BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF047J13

Length=675
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_010270927.1|  PREDICTED: uncharacterized protein LOC104607107    207   2e-58   
emb|CDP01464.1|  unnamed protein product                                201   2e-56   Coffea canephora [robusta coffee]
ref|XP_002279803.1|  PREDICTED: uncharacterized protein LOC100264112    200   5e-56   Vitis vinifera
ref|XP_011079490.1|  PREDICTED: uncharacterized protein LOC105162997    198   2e-55   Sesamum indicum [beniseed]
ref|XP_007051241.1|  TolB protein-related isoform 2                     193   8e-55   
emb|CAN71280.1|  hypothetical protein VITISV_027089                     196   8e-55   Vitis vinifera
ref|XP_007051240.1|  TolB protein-related isoform 1                     193   2e-53   
ref|XP_006492392.1|  PREDICTED: uncharacterized protein LOC102621537    190   2e-52   
ref|XP_010921344.1|  PREDICTED: uncharacterized protein LOC105044938    189   4e-52   Elaeis guineensis
gb|KJB09508.1|  hypothetical protein B456_001G146700                    189   6e-52   Gossypium raimondii
ref|XP_009617529.1|  PREDICTED: uncharacterized protein LOC104109859    188   1e-51   Nicotiana tomentosiformis
ref|XP_004240561.1|  PREDICTED: uncharacterized protein LOC101263710    188   1e-51   Solanum lycopersicum
gb|KDO86848.1|  hypothetical protein CISIN_1g039497mg                   187   1e-51   Citrus sinensis [apfelsine]
ref|XP_006444588.1|  hypothetical protein CICLE_v10019102mg             188   1e-51   
ref|XP_008781198.1|  PREDICTED: uncharacterized protein LOC103701039    187   2e-51   Phoenix dactylifera
ref|XP_006355827.1|  PREDICTED: uncharacterized protein LOC102591696    187   2e-51   Solanum tuberosum [potatoes]
ref|XP_006840288.1|  hypothetical protein AMTR_s00045p00058890          186   5e-51   Amborella trichopoda
ref|XP_009773068.1|  PREDICTED: uncharacterized protein LOC104223342    186   6e-51   Nicotiana sylvestris
gb|EYU46868.1|  hypothetical protein MIMGU_mgv1a002606mg                185   8e-51   Erythranthe guttata [common monkey flower]
ref|XP_011467073.1|  PREDICTED: uncharacterized protein LOC105352244    185   1e-50   Fragaria vesca subsp. vesca
ref|XP_008461387.1|  PREDICTED: uncharacterized protein LOC103499982    184   3e-50   Cucumis melo [Oriental melon]
gb|KCW45418.1|  hypothetical protein EUGRSUZ_L00886                     184   3e-50   Eucalyptus grandis [rose gum]
ref|XP_006366666.1|  PREDICTED: uncharacterized protein LOC102589112    179   9e-49   Solanum tuberosum [potatoes]
ref|XP_006840287.1|  hypothetical protein AMTR_s00045p00058330          179   1e-48   
ref|XP_010522850.1|  PREDICTED: uncharacterized protein LOC104801322    178   3e-48   Tarenaya hassleriana [spider flower]
ref|XP_010069735.1|  PREDICTED: uncharacterized protein LOC104456605    178   4e-48   Eucalyptus grandis [rose gum]
gb|KCW45417.1|  hypothetical protein EUGRSUZ_L00885                     176   6e-48   Eucalyptus grandis [rose gum]
ref|XP_004135965.1|  PREDICTED: uncharacterized protein LOC101214858    177   9e-48   Cucumis sativus [cucumbers]
gb|KCW58166.1|  hypothetical protein EUGRSUZ_H00884                     176   1e-47   Eucalyptus grandis [rose gum]
ref|XP_002515212.1|  conserved hypothetical protein                     176   2e-47   Ricinus communis
ref|XP_009382467.1|  PREDICTED: uncharacterized protein LOC103970421    175   4e-47   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDP28318.1|  hypothetical protein JCGZ_14089                         174   8e-47   Jatropha curcas
ref|XP_004240512.1|  PREDICTED: uncharacterized protein LOC101247825    174   9e-47   Solanum lycopersicum
ref|XP_008227800.1|  PREDICTED: uncharacterized protein LOC103327273    173   2e-46   Prunus mume [ume]
ref|XP_010091406.1|  hypothetical protein L484_013861                   171   1e-45   
ref|XP_003637684.1|  Protein tolB                                       171   2e-45   
gb|EPS68684.1|  hypothetical protein M569_06083                         169   3e-45   Genlisea aurea
gb|AAM13860.1|  unknown protein                                         169   5e-45   Arabidopsis thaliana [mouse-ear cress]
ref|NP_192096.1|  tolB-related protein                                  169   6e-45   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006396381.1|  hypothetical protein EUTSA_v10029172mg             166   1e-44   
ref|XP_010428858.1|  PREDICTED: uncharacterized protein LOC104713446    166   4e-44   Camelina sativa [gold-of-pleasure]
ref|XP_002461097.1|  hypothetical protein SORBIDRAFT_02g040640          166   6e-44   Sorghum bicolor [broomcorn]
ref|XP_006396377.1|  hypothetical protein EUTSA_v10029281mg             165   1e-43   
ref|XP_002872871.1|  hypothetical protein ARALYDRAFT_490390             165   1e-43   
gb|EAZ40813.1|  hypothetical protein OsJ_25290                          164   2e-43   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004498256.1|  PREDICTED: uncharacterized protein LOC101515113    164   2e-43   Cicer arietinum [garbanzo]
ref|XP_009367159.1|  PREDICTED: uncharacterized protein LOC103956844    165   2e-43   Pyrus x bretschneideri [bai li]
gb|AJD80981.1|  ABA-activated 1 protein                                 164   3e-43   Lupinus luteus
ref|NP_001060406.1|  Os07g0638100                                       164   3e-43   
gb|EAZ04851.1|  hypothetical protein OsI_27029                          164   3e-43   Oryza sativa Indica Group [Indian rice]
ref|XP_010679438.1|  PREDICTED: uncharacterized protein LOC104894805    162   1e-42   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003637686.1|  Protein tolB                                       161   2e-42   
ref|XP_007221548.1|  hypothetical protein PRUPE_ppa002534mg             161   3e-42   
emb|CDX74396.1|  BnaA03g26510D                                          161   3e-42   
ref|XP_009134471.1|  PREDICTED: uncharacterized protein LOC103858800    160   4e-42   Brassica rapa
ref|XP_003529216.2|  PREDICTED: uncharacterized protein LOC100814036    161   4e-42   Glycine max [soybeans]
ref|XP_010422681.1|  PREDICTED: uncharacterized protein LOC104707922    160   7e-42   Camelina sativa [gold-of-pleasure]
ref|XP_006289995.1|  hypothetical protein CARUB_v10003625mg             160   8e-42   Capsella rubella
dbj|BAJ94262.1|  predicted protein                                      159   1e-41   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ89339.1|  predicted protein                                      159   1e-41   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KFK30736.1|  hypothetical protein AALP_AA6G020600                    159   1e-41   Arabis alpina [alpine rockcress]
gb|KCW58168.1|  hypothetical protein EUGRSUZ_H008851                    152   3e-41   Eucalyptus grandis [rose gum]
ref|XP_006658881.1|  PREDICTED: uncharacterized protein LOC102705738    157   4e-41   Oryza brachyantha
ref|XP_007153254.1|  hypothetical protein PHAVU_003G019700g             158   4e-41   Phaseolus vulgaris [French bean]
ref|XP_008343202.1|  PREDICTED: uncharacterized protein LOC103405949    154   7e-40   
ref|XP_008653395.1|  PREDICTED: uncharacterized protein LOC103633477    154   8e-40   Zea mays [maize]
ref|XP_004958463.1|  PREDICTED: uncharacterized protein LOC101757241    152   8e-39   Setaria italica
ref|XP_003562594.1|  PREDICTED: uncharacterized protein LOC100822199    150   3e-38   Brachypodium distachyon [annual false brome]
dbj|BAJ88545.1|  predicted protein                                      128   3e-30   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004981111.1|  PREDICTED: uncharacterized protein LOC101776730    121   7e-28   Setaria italica
ref|NP_001051846.1|  Os03g0840200                                       120   2e-27   
ref|XP_002890451.1|  hypothetical protein ARALYDRAFT_472405             120   2e-27   Arabidopsis lyrata subsp. lyrata
ref|XP_010510815.1|  PREDICTED: uncharacterized protein LOC104787018    120   3e-27   Camelina sativa [gold-of-pleasure]
gb|EAY92514.1|  hypothetical protein OsI_14253                          119   4e-27   Oryza sativa Indica Group [Indian rice]
ref|XP_010466457.1|  PREDICTED: uncharacterized protein LOC104746...    119   5e-27   
ref|NP_564146.1|  uncharacterized protein                               119   6e-27   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010466456.1|  PREDICTED: uncharacterized protein LOC104746...    119   6e-27   Camelina sativa [gold-of-pleasure]
gb|EAZ29242.1|  hypothetical protein OsJ_13305                          118   9e-27   Oryza sativa Japonica Group [Japonica rice]
gb|KJB29176.1|  hypothetical protein B456_005G088400                    118   1e-26   Gossypium raimondii
ref|XP_009411896.1|  PREDICTED: uncharacterized protein LOC103993528    117   3e-26   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003562684.2|  PREDICTED: uncharacterized protein LOC100824160    117   3e-26   
ref|XP_010488216.1|  PREDICTED: uncharacterized protein LOC104766097    116   4e-26   Camelina sativa [gold-of-pleasure]
ref|XP_010477408.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    116   6e-26   
ref|XP_010911317.1|  PREDICTED: uncharacterized protein LOC105037336    115   8e-26   Elaeis guineensis
ref|XP_007137456.1|  hypothetical protein PHAVU_009G128300g             115   9e-26   Phaseolus vulgaris [French bean]
ref|XP_010270269.1|  PREDICTED: uncharacterized protein LOC104606655    115   1e-25   Nelumbo nucifera [Indian lotus]
ref|XP_005646452.1|  tricorn protease N-terminal domain-containin...    114   2e-25   Coccomyxa subellipsoidea C-169
gb|KCW71232.1|  hypothetical protein EUGRSUZ_F04330                     114   3e-25   Eucalyptus grandis [rose gum]
ref|XP_010063935.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    114   4e-25   Eucalyptus grandis [rose gum]
emb|CDY04661.1|  BnaC05g16990D                                          112   2e-24   
ref|XP_004502520.1|  PREDICTED: uncharacterized protein LOC101497096    112   2e-24   Cicer arietinum [garbanzo]
ref|XP_007019162.1|  DPP6 N-terminal domain-like protein                111   3e-24   
gb|KHN46997.1|  Replication factor C subunit 4                          108   5e-24   Glycine soja [wild soybean]
ref|XP_009149685.1|  PREDICTED: uncharacterized protein LOC103873008    109   1e-23   Brassica rapa
ref|XP_008466749.1|  PREDICTED: uncharacterized protein LOC103504088    109   1e-23   Cucumis melo [Oriental melon]
ref|XP_006416278.1|  hypothetical protein EUTSA_v10006965mg             108   2e-23   Eutrema salsugineum [saltwater cress]
gb|KFK44273.1|  hypothetical protein AALP_AA1G236600                    108   2e-23   Arabis alpina [alpine rockcress]
ref|XP_011069633.1|  PREDICTED: uncharacterized protein LOC105155456    107   7e-23   Sesamum indicum [beniseed]
emb|CDP10970.1|  unnamed protein product                                107   8e-23   Coffea canephora [robusta coffee]
ref|XP_008644344.1|  PREDICTED: uncharacterized protein LOC103625729    106   1e-22   Zea mays [maize]
ref|XP_003630471.1|  Protein tolB                                       106   1e-22   
emb|CDY08187.1|  BnaA06g15390D                                          106   1e-22   Brassica napus [oilseed rape]
gb|EYU32510.1|  hypothetical protein MIMGU_mgv1a026619mg                106   2e-22   Erythranthe guttata [common monkey flower]
ref|XP_006386357.1|  hypothetical protein POPTR_0002s08010g             106   2e-22   Populus trichocarpa [western balsam poplar]
ref|XP_011027472.1|  PREDICTED: uncharacterized protein LOC105127760    106   2e-22   Populus euphratica
ref|XP_011027475.1|  PREDICTED: uncharacterized protein LOC105127763    105   2e-22   Populus euphratica
ref|XP_003527947.1|  PREDICTED: uncharacterized protein LOC100791865    105   3e-22   Glycine max [soybeans]
ref|XP_002993781.1|  hypothetical protein SELMODRAFT_187603             104   8e-22   
ref|XP_002466125.1|  hypothetical protein SORBIDRAFT_01g001880          103   9e-22   Sorghum bicolor [broomcorn]
gb|KFK44274.1|  hypothetical protein AALP_AA1G237000                    103   1e-21   Arabis alpina [alpine rockcress]
gb|KDP32822.1|  hypothetical protein JCGZ_12114                         103   1e-21   Jatropha curcas
ref|XP_002985152.1|  hypothetical protein SELMODRAFT_121622             103   1e-21   
ref|XP_006416277.1|  hypothetical protein EUTSA_v10009943mg             103   2e-21   Eutrema salsugineum [saltwater cress]
ref|XP_004160721.1|  PREDICTED: protein TolB-like                       102   2e-21   
ref|XP_004149439.1|  PREDICTED: protein TolB-like                       102   3e-21   Cucumis sativus [cucumbers]
gb|KDO80522.1|  hypothetical protein CISIN_1g004971mg                   102   3e-21   Citrus sinensis [apfelsine]
ref|NP_564147.1|  DPP6 N-terminal domain-like protein                   101   6e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004249849.1|  PREDICTED: uncharacterized protein LOC101257324    101   8e-21   Solanum lycopersicum
emb|CAN73514.1|  hypothetical protein VITISV_037210                     101   9e-21   Vitis vinifera
ref|XP_002285876.2|  PREDICTED: uncharacterized protein LOC100267814    100   1e-20   Vitis vinifera
ref|XP_002520326.1|  conserved hypothetical protein                     100   1e-20   Ricinus communis
ref|XP_009149686.1|  PREDICTED: uncharacterized protein LOC103873010    100   1e-20   Brassica rapa
emb|CDY04662.1|  BnaC05g17000D                                          100   2e-20   
ref|XP_006472827.1|  PREDICTED: uncharacterized protein LOC102617553    100   2e-20   Citrus sinensis [apfelsine]
ref|XP_010539663.1|  PREDICTED: uncharacterized protein LOC104813673  99.4    3e-20   Tarenaya hassleriana [spider flower]
ref|XP_006304666.1|  hypothetical protein CARUB_v10011878mg           99.4    4e-20   Capsella rubella
ref|XP_009593179.1|  PREDICTED: uncharacterized protein LOC104089880  99.4    4e-20   Nicotiana tomentosiformis
ref|XP_010672499.1|  PREDICTED: uncharacterized protein LOC104889058  99.0    5e-20   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002890452.1|  hypothetical protein ARALYDRAFT_472406           98.6    6e-20   
ref|XP_006351203.1|  PREDICTED: uncharacterized protein LOC102604753  98.6    6e-20   Solanum tuberosum [potatoes]
ref|XP_002515210.1|  conserved hypothetical protein                   98.2    7e-20   
ref|XP_006434259.1|  hypothetical protein CICLE_v10000425mg           98.2    1e-19   Citrus clementina [clementine]
emb|CDP10971.1|  unnamed protein product                              98.2    1e-19   Coffea canephora [robusta coffee]
ref|XP_002993240.1|  hypothetical protein SELMODRAFT_136782           98.2    1e-19   Selaginella moellendorffii
emb|CDX84088.1|  BnaC08g07650D                                        97.8    1e-19   
ref|XP_010477409.1|  PREDICTED: uncharacterized protein LOC104756505  97.8    1e-19   Camelina sativa [gold-of-pleasure]
ref|XP_009796392.1|  PREDICTED: uncharacterized protein LOC104242978  97.8    1e-19   Nicotiana sylvestris
ref|XP_010095431.1|  hypothetical protein L484_013388                 97.8    1e-19   
ref|XP_010498624.1|  PREDICTED: uncharacterized protein LOC104776288  97.1    3e-19   Camelina sativa [gold-of-pleasure]
ref|XP_010521281.1|  PREDICTED: uncharacterized protein LOC104800...  95.5    7e-19   Tarenaya hassleriana [spider flower]
ref|XP_010521282.1|  PREDICTED: uncharacterized protein LOC104800...  95.5    8e-19   Tarenaya hassleriana [spider flower]
emb|CDY08186.1|  BnaA06g15400D                                        94.7    1e-18   Brassica napus [oilseed rape]
ref|XP_008338671.1|  PREDICTED: uncharacterized protein LOC103401727  94.0    2e-18   
gb|ABR17080.1|  unknown                                               91.3    2e-17   Picea sitchensis
ref|XP_009343980.1|  PREDICTED: uncharacterized protein LOC103935890  90.9    2e-17   Pyrus x bretschneideri [bai li]
ref|XP_008219596.1|  PREDICTED: uncharacterized protein LOC103319783  88.2    2e-16   Prunus mume [ume]
ref|XP_004290903.2|  PREDICTED: uncharacterized protein LOC101292474  87.0    5e-16   Fragaria vesca subsp. vesca
ref|XP_001780675.1|  predicted protein                                86.7    7e-16   
ref|XP_002448903.1|  hypothetical protein SORBIDRAFT_05g001167        71.6    1e-12   
ref|XP_010675830.1|  PREDICTED: uncharacterized protein LOC104891773  70.5    1e-10   Beta vulgaris subsp. vulgaris [field beet]
gb|EAY93383.1|  hypothetical protein OsI_15178                        68.6    5e-10   Oryza sativa Indica Group [Indian rice]
ref|XP_010675837.1|  PREDICTED: uncharacterized protein LOC104891780  67.0    2e-09   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010675836.1|  PREDICTED: uncharacterized protein LOC104891779  66.6    2e-09   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011003182.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  65.1    3e-09   Populus euphratica
ref|XP_003570812.2|  PREDICTED: uncharacterized protein LOC100837266  66.6    3e-09   
ref|XP_010102639.1|  hypothetical protein L484_010931                 65.1    7e-09   Morus notabilis
ref|XP_002524154.1|  conserved hypothetical protein                   65.1    8e-09   Ricinus communis
gb|EMT29283.1|  hypothetical protein F775_17496                       65.1    8e-09   
ref|XP_010675829.1|  PREDICTED: uncharacterized protein LOC104891772  64.3    1e-08   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002467956.1|  hypothetical protein SORBIDRAFT_01g037140        63.5    2e-08   
ref|NP_001049934.1|  Os03g0314500                                     62.0    8e-08   
gb|EAY89757.1|  hypothetical protein OsI_11300                        62.0    9e-08   Oryza sativa Indica Group [Indian rice]
ref|XP_002519802.1|  conserved hypothetical protein                   61.2    1e-07   Ricinus communis
ref|XP_007223068.1|  hypothetical protein PRUPE_ppa003730mg           60.8    2e-07   
ref|XP_010235117.1|  PREDICTED: uncharacterized protein LOC100846313  60.5    3e-07   
ref|XP_002520327.1|  conserved hypothetical protein                   60.1    3e-07   
gb|EMT08438.1|  hypothetical protein F775_30261                       60.1    3e-07   
ref|XP_003574472.1|  PREDICTED: uncharacterized protein LOC100838501  60.1    3e-07   Brachypodium distachyon [annual false brome]
ref|XP_010087211.1|  hypothetical protein L484_006140                 60.1    3e-07   Morus notabilis
ref|XP_008662981.1|  PREDICTED: uncharacterized protein LOC103641407  60.1    3e-07   Zea mays [maize]
ref|XP_002446045.1|  hypothetical protein SORBIDRAFT_06g000930        59.7    4e-07   Sorghum bicolor [broomcorn]
ref|XP_002524160.1|  conserved hypothetical protein                   59.7    4e-07   Ricinus communis
ref|NP_001050324.1|  Os03g0403400                                     58.2    1e-06   
gb|EAY90391.1|  hypothetical protein OsI_11968                        58.2    1e-06   Oryza sativa Indica Group [Indian rice]
gb|EAZ27259.1|  hypothetical protein OsJ_11196                        58.2    1e-06   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002519807.1|  conserved hypothetical protein                   58.2    1e-06   
ref|XP_010097483.1|  hypothetical protein L484_024689                 57.8    2e-06   Morus notabilis
ref|XP_010097467.1|  hypothetical protein L484_024672                 57.8    2e-06   
ref|XP_010102640.1|  hypothetical protein L484_010932                 57.4    2e-06   Morus notabilis
ref|XP_010091028.1|  hypothetical protein L484_002197                 55.1    3e-06   
ref|XP_010097765.1|  hypothetical protein L484_023906                 56.6    5e-06   Morus notabilis
gb|EMS66234.1|  hypothetical protein TRIUR3_20351                     56.6    5e-06   Triticum urartu
dbj|BAJ88525.1|  predicted protein                                    55.1    1e-05   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAK07068.1|  predicted protein                                    53.9    4e-05   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ92843.1|  predicted protein                                    53.5    5e-05   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CBI18981.3|  unnamed protein product                              52.4    1e-04   Vitis vinifera
ref|NP_001066679.1|  Os12g0431300                                     52.0    2e-04   
gb|EMT19136.1|  hypothetical protein F775_12749                       50.1    8e-04   
ref|XP_002437598.1|  hypothetical protein SORBIDRAFT_10g030220        50.1    8e-04   Sorghum bicolor [broomcorn]



>ref|XP_010270927.1| PREDICTED: uncharacterized protein LOC104607107, partial [Nelumbo 
nucifera]
Length=715

 Score =   207 bits (526),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 103/168 (61%), Positives = 130/168 (77%), Gaps = 4/168 (2%)
 Frame = +1

Query  172  MDPHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEGDT  351
            M+P GTI+F++VGR +YGFDIFSV LPS          EHRLTDG+S+NFNG F+DE +T
Sbjct  62   MNPKGTIIFTSVGRPYYGFDIFSVSLPSIIAA-TTSWKEHRLTDGISVNFNGQFVDEDET  120

Query  352  FVFVSERSGSPRIYLQENRSASAGKPQQLLSPSGTLFHDRPVVRDGRLLYISAHEPPKEV  531
             V+VSER+G  R+YL +   A++ KP+QL S + +LFHDRP+V+DGRL ++SAHEP  + 
Sbjct  121  LVYVSERTGYARVYLNQ---ANSPKPKQLPSVADSLFHDRPIVKDGRLYFVSAHEPADKH  177

Query  532  FKSWSALYSTHLGLKEITRLTPYGAVDFSPSVSQSGEFIAVASYGSRP  675
             KSWSALYST L   +I RLTPY AVD+SPS+SQSG+FIAVASYG RP
Sbjct  178  LKSWSALYSTLLDHGKIERLTPYKAVDYSPSISQSGKFIAVASYGFRP  225



>emb|CDP01464.1| unnamed protein product [Coffea canephora]
Length=719

 Score =   201 bits (512),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 114/195 (58%), Positives = 137/195 (70%), Gaps = 16/195 (8%)
 Frame = +1

Query  91   YVISHRFFPLCTQILSSLRIPKPPIMIMDPHGTIVFSTVGRSHYGFDIFSVQLPSSFEQD  270
            + I+   FPL     S L   KP    MDP GTIVFSTVG + YGFDIFSV+LP+     
Sbjct  45   FTIATTTFPLH----SPLVYLKPSNFSMDPSGTIVFSTVGVTQYGFDIFSVKLPN-----  95

Query  271  RRPASEHRLTDGVSINFNGHFLDEGD-TFVFVSERSGSPRIYLQENRSASAGKPQQLLSP  447
                ++ RLTDGVSINFNG FLDE + + VFVSERSGSPRIYL +       +P+ L SP
Sbjct  96   ---LTQRRLTDGVSINFNGQFLDENEESLVFVSERSGSPRIYLSK---PELSEPELLPSP  149

Query  448  SGTLFHDRPVVRDGRLLYISAHEPPKEVFKSWSALYSTHLGLKEITRLTPYGAVDFSPSV  627
              +LFHDRPV+++ R  +ISAHE P ++FKSWSALYST L  K++ RLTP G  D+SPSV
Sbjct  150  PESLFHDRPVIKNQRAYFISAHEEPDKLFKSWSALYSTRLDDKKVRRLTPPGVADYSPSV  209

Query  628  SQSGEFIAVASYGSR  672
            SQSG+FIAVASYGSR
Sbjct  210  SQSGKFIAVASYGSR  224



>ref|XP_002279803.1| PREDICTED: uncharacterized protein LOC100264112 [Vitis vinifera]
Length=677

 Score =   200 bits (508),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 104/177 (59%), Positives = 129/177 (73%), Gaps = 10/177 (6%)
 Frame = +1

Query  145  RIPKPPIMIMDPHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFN  324
            R P P    M+P GTI F+TVGR HYGFD+FS+ L  +        SE RLT G SINFN
Sbjct  23   RTPPP----MEPTGTIAFTTVGRPHYGFDLFSLNLDPNLINH---TSERRLTGGTSINFN  75

Query  325  GHFLDEGDTFVFVSERSGSPRIYLQENRSASAGKPQQLLSPSGTLFHDRPVVRDGRLLYI  504
            GHFLDE  T V+VSERSGSPRIY          KP+QLLS  G+L+HDRP+V++GRL ++
Sbjct  76   GHFLDENQTLVYVSERSGSPRIY---QIRPGVTKPEQLLSVPGSLYHDRPIVKNGRLYFV  132

Query  505  SAHEPPKEVFKSWSALYSTHLGLKEITRLTPYGAVDFSPSVSQSGEFIAVASYGSRP  675
            SAHE P++ F SWSA+YST L  K + +LTP+G VD+SP++S+SG+FIAVASYGSRP
Sbjct  133  SAHERPEKPFISWSAVYSTGLDDKAVVQLTPHGVVDYSPAISRSGKFIAVASYGSRP  189



>ref|XP_011079490.1| PREDICTED: uncharacterized protein LOC105162997 [Sesamum indicum]
Length=659

 Score =   198 bits (503),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 99/168 (59%), Positives = 127/168 (76%), Gaps = 4/168 (2%)
 Frame = +1

Query  172  MDPHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRP-ASEHRLTDGVSINFNGHFLDEGD  348
            M+P GTIVF++VGR +YGFD+FS+QLPS+ +      +SEH LTDG+SINFNG F+DEG 
Sbjct  1    MEPTGTIVFTSVGRPYYGFDLFSLQLPSNLDASLLDFSSEHPLTDGISINFNGQFVDEGK  60

Query  349  TFVFVSERSGSPRIYLQENRSASAGKPQQLLSPSGTLFHDRPVVRDGRLLYISAHEPPKE  528
            T V++SER+GS RI+L    S     PQ L SP  +LFHDRP++++ RL +ISAHEPP++
Sbjct  61   TLVYISERTGSARIFLN---SPGNANPQLLHSPPESLFHDRPLIKNHRLYFISAHEPPEK  117

Query  529  VFKSWSALYSTHLGLKEITRLTPYGAVDFSPSVSQSGEFIAVASYGSR  672
              +SWSALYST L  K   RLTPYG+VD+SP++S SG  IAVASYG R
Sbjct  118  PLRSWSALYSTRLHEKTAVRLTPYGSVDYSPAISHSGNLIAVASYGPR  165



>ref|XP_007051241.1| TolB protein-related isoform 2, partial [Theobroma cacao]
 gb|EOX95398.1| TolB protein-related isoform 2, partial [Theobroma cacao]
Length=481

 Score =   193 bits (491),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 97/169 (57%), Positives = 126/169 (75%), Gaps = 6/169 (4%)
 Frame = +1

Query  172  MDPHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEGDT  351
            M+P GT+VF++VGR  YGFDIF+V L  +   +  P  EHRLTD +SINFN  F++E  +
Sbjct  51   MNPKGTVVFTSVGRPQYGFDIFTVNLNQTPITNSTP--EHRLTDCISINFNAQFINEDQS  108

Query  352  FVFVSERSGSPRIYLQENRSASAGKPQQLLSPSGTLFHDRPVVRDGRLLYISAHEPPKEV  531
             VF+SERSGSPRIYL         KP+QL S   +LFHDRP++++ RL +ISAHE P + 
Sbjct  109  IVFISERSGSPRIYLTH---PDLPKPEQLTSAPSSLFHDRPIIQNHRLYFISAHEQPDQP  165

Query  532  FKSWSALYSTHL-GLKEITRLTPYGAVDFSPSVSQSGEFIAVASYGSRP  675
            FKSWSALYST L G ++ TRL+PYG  D+SP++S+SG+F+AVASYGSRP
Sbjct  166  FKSWSALYSTELRGKRDTTRLSPYGVADYSPAISKSGKFVAVASYGSRP  214



>emb|CAN71280.1| hypothetical protein VITISV_027089 [Vitis vinifera]
Length=677

 Score =   196 bits (499),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 103/177 (58%), Positives = 127/177 (72%), Gaps = 10/177 (6%)
 Frame = +1

Query  145  RIPKPPIMIMDPHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFN  324
            R P P    M+P GTI F+TVGR HYGFD+FS+ L  +        SE RLT G SINFN
Sbjct  23   RTPPP----MEPTGTIAFTTVGRPHYGFDLFSLNLDPNLINH---TSERRLTGGTSINFN  75

Query  325  GHFLDEGDTFVFVSERSGSPRIYLQENRSASAGKPQQLLSPSGTLFHDRPVVRDGRLLYI  504
            GHFLDE  T V+VSE SGSPRIY          KP+QLLS  G+L+HDRP+V++GRL ++
Sbjct  76   GHFLDENQTLVYVSEXSGSPRIY---QIRPGVTKPEQLLSVPGSLYHDRPIVKNGRLYFV  132

Query  505  SAHEPPKEVFKSWSALYSTHLGLKEITRLTPYGAVDFSPSVSQSGEFIAVASYGSRP  675
            SAHE P++ F SWSA+YST L  K +  LTP+G VD+SP++S+SG+FIAVASYGSRP
Sbjct  133  SAHERPEKPFISWSAVYSTGLDDKAVVXLTPHGVVDYSPAISRSGKFIAVASYGSRP  189



>ref|XP_007051240.1| TolB protein-related isoform 1 [Theobroma cacao]
 gb|EOX95397.1| TolB protein-related isoform 1 [Theobroma cacao]
Length=704

 Score =   193 bits (490),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 97/169 (57%), Positives = 126/169 (75%), Gaps = 6/169 (4%)
 Frame = +1

Query  172  MDPHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEGDT  351
            M+P GT+VF++VGR  YGFDIF+V L  +   +  P  EHRLTD +SINFN  F++E  +
Sbjct  51   MNPKGTVVFTSVGRPQYGFDIFTVNLNQTPITNSTP--EHRLTDCISINFNAQFINEDQS  108

Query  352  FVFVSERSGSPRIYLQENRSASAGKPQQLLSPSGTLFHDRPVVRDGRLLYISAHEPPKEV  531
             VF+SERSGSPRIYL         KP+QL S   +LFHDRP++++ RL +ISAHE P + 
Sbjct  109  IVFISERSGSPRIYLTH---PDLPKPEQLTSAPSSLFHDRPIIQNHRLYFISAHEQPDQP  165

Query  532  FKSWSALYSTHL-GLKEITRLTPYGAVDFSPSVSQSGEFIAVASYGSRP  675
            FKSWSALYST L G ++ TRL+PYG  D+SP++S+SG+F+AVASYGSRP
Sbjct  166  FKSWSALYSTELRGKRDTTRLSPYGVADYSPAISKSGKFVAVASYGSRP  214



>ref|XP_006492392.1| PREDICTED: uncharacterized protein LOC102621537 [Citrus sinensis]
Length=700

 Score =   190 bits (482),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 103/171 (60%), Positives = 124/171 (73%), Gaps = 7/171 (4%)
 Frame = +1

Query  166  MIMDPHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEG  345
            M M+P GTIVF+TVGR +YGFD+FS++ P     +     EHRLTDG SINFN  F+D  
Sbjct  47   MYMEPKGTIVFTTVGRPYYGFDVFSIKSPFV---NAPKFHEHRLTDGTSINFNAQFVDGQ  103

Query  346  D-TFVFVSERSGSPRIYLQENRSASAGKPQQLLSPSGTLFHDRPVVRDGRLLYISAHEPP  522
            D T  F+SERSGSPRIY  + R  S+ K + L S   +LFHDRPV R+ +L +ISAHE P
Sbjct  104  DQTIAFISERSGSPRIY--QTRPGSS-KTELLPSIPCSLFHDRPVARNNKLFFISAHEQP  160

Query  523  KEVFKSWSALYSTHLGLKEITRLTPYGAVDFSPSVSQSGEFIAVASYGSRP  675
             ++FKSWSALYST L   + TRLTPYG VD+SPSVS SG+FIAVASY SRP
Sbjct  161  DQIFKSWSALYSTDLKASKFTRLTPYGVVDYSPSVSYSGKFIAVASYESRP  211



>ref|XP_010921344.1| PREDICTED: uncharacterized protein LOC105044938 [Elaeis guineensis]
Length=656

 Score =   189 bits (480),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 94/167 (56%), Positives = 121/167 (72%), Gaps = 3/167 (2%)
 Frame = +1

Query  172  MDPHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEGDT  351
            M+P GTIVFSTVG  +YGFD+FS  LP++ +      +E R TDGVS+NFN  F+DEG T
Sbjct  1    MEPQGTIVFSTVGLLYYGFDVFSTPLPANLDAAVNKVTERRHTDGVSVNFNAQFVDEGPT  60

Query  352  FVFVSERSGSPRIYLQENRSASAGKPQQLLSPSGTLFHDRPVVRDGRLLYISAHEPPKEV  531
              FVSER+GSPR+Y+ ++      KP+ L +   +L HDRP V++G + ++SAHEPP E 
Sbjct  61   VAFVSERTGSPRLYVAQSPDH---KPKPLPNIPESLHHDRPTVKNGLVYFVSAHEPPSEP  117

Query  532  FKSWSALYSTHLGLKEITRLTPYGAVDFSPSVSQSGEFIAVASYGSR  672
            FKSWSA+Y+  L   E  RLTP G VDFSP+VS+SGEF+AVASYGSR
Sbjct  118  FKSWSAVYAARLDTNETVRLTPPGVVDFSPAVSRSGEFVAVASYGSR  164



>gb|KJB09508.1| hypothetical protein B456_001G146700 [Gossypium raimondii]
Length=710

 Score =   189 bits (479),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 96/173 (55%), Positives = 126/173 (73%), Gaps = 14/173 (8%)
 Frame = +1

Query  172  MDPHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRP----ASEHRLTDGVSINFNGHFLD  339
            MDP G +VF++VGRS YGFDIF+V L      ++ P     SEHRLTDG+SIN+N  F++
Sbjct  57   MDPKGIVVFTSVGRSQYGFDIFTVNL------NQTPITGSTSEHRLTDGISINYNAQFVN  110

Query  340  EGDTFVFVSERSGSPRIYLQENRSASAGKPQQLLSPSGTLFHDRPVVRDGRLLYISAHEP  519
            E  + VF+SERSG PRIYL         KP+QL S   +LFHDRP+++   L +ISAHE 
Sbjct  111  EDQSIVFISERSGCPRIYLTRR---GLSKPEQLPSVPDSLFHDRPIIKSHHLYFISAHEQ  167

Query  520  PKEVFKSWSALYSTHL-GLKEITRLTPYGAVDFSPSVSQSGEFIAVASYGSRP  675
            P++ F+SWSALYST L G ++I RL+PYG VD+SP++S+SG F+A+ASYGSRP
Sbjct  168  PEKPFQSWSALYSTELHGKRKIIRLSPYGVVDYSPAISKSGTFVAIASYGSRP  220



>ref|XP_009617529.1| PREDICTED: uncharacterized protein LOC104109859 [Nicotiana tomentosiformis]
Length=700

 Score =   188 bits (477),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 115/224 (51%), Positives = 144/224 (64%), Gaps = 28/224 (13%)
 Frame = +1

Query  28   TFDVSLYRRL*NSRADDDVMPYVISHRFFPLCTQILSSLRIPKPPIMIMD---PHGTIVF  198
            TF +   RRL        V+   + +  FP   QI+++         IMD   PHG+I+F
Sbjct  6    TFHLPKLRRL------SQVLQLQLYNYHFPAAEQIINN---------IMDSQSPHGSIIF  50

Query  199  STVGRSHYGFDIFSVQLPSSFEQD--RRPASEHRLTDGVSINFNGHFLDEGDTFVFVSER  372
            STVGR++YGFDIFS++ P SF         +E RLTDG S+NFNG F+DE  T VFVSER
Sbjct  51   STVGRTNYGFDIFSLKSPFSFFNSPLHTFPTEQRLTDGTSVNFNGQFVDEDQTLVFVSER  110

Query  373  SGSPRIYLQENRSASAGKPQQLLSPSG---TLFHDRPVVRDGRLLYISAHEPPKEVFKSW  543
            SGSPRIYLQ  R +  G+ +QL  P G   + F DRP++R+  L YISAH+ PK++F SW
Sbjct  111  SGSPRIYLQ--RPSHLGEIEQL--PDGSPDSPFLDRPLLRNKCLYYISAHQSPKQIFTSW  166

Query  544  SALYSTHLG-LKEITRLTPYGAVDFSPSVSQSGEFIAVASYGSR  672
            SALYST L   K   RLTPYG VD+SP++SQSG  IAVASYG R
Sbjct  167  SALYSTTLDHEKTAVRLTPYGCVDYSPAISQSGHLIAVASYGDR  210



>ref|XP_004240561.1| PREDICTED: uncharacterized protein LOC101263710 [Solanum lycopersicum]
Length=697

 Score =   188 bits (477),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 102/173 (59%), Positives = 127/173 (73%), Gaps = 10/173 (6%)
 Frame = +1

Query  169  IMD----PHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFL  336
            IMD    PHG+I+FSTVGR++YGFDIFS++ P SF        EHRLTDG SIN+NG F+
Sbjct  40   IMDSQSSPHGSIIFSTVGRTNYGFDIFSIKSPFSFLNS---PVEHRLTDGTSINYNGQFV  96

Query  337  DEGDTFVFVSERSGSPRIYLQENRSASAGKPQQLLSPSGTLFHDRPVVRDGRLLYISAHE  516
            DE  T VFVSERSG+PRIYL+    +S  + +QL +P  +LF DRP +R+ +L YISAH+
Sbjct  97   DEDQTLVFVSERSGAPRIYLRH--PSSQVQMEQLPTPIDSLFLDRPFLRNKQLYYISAHQ  154

Query  517  PPKEVFKSWSALYSTHL-GLKEITRLTPYGAVDFSPSVSQSGEFIAVASYGSR  672
             PK+VF S SALYST++     I RLTPYG VD+SP++SQSG  IAVASYG R
Sbjct  155  QPKQVFTSSSALYSTNIEDNSNIIRLTPYGCVDYSPAISQSGHLIAVASYGDR  207



>gb|KDO86848.1| hypothetical protein CISIN_1g039497mg [Citrus sinensis]
Length=642

 Score =   187 bits (476),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 102/169 (60%), Positives = 123/169 (73%), Gaps = 7/169 (4%)
 Frame = +1

Query  172  MDPHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEGD-  348
            M+P GTIVF+TVGR +YGFD+FS++ P     +     EHRLTDG SINFN  F+D  D 
Sbjct  1    MEPKGTIVFTTVGRPYYGFDVFSIKSPFV---NAPKFHEHRLTDGTSINFNAQFVDGQDQ  57

Query  349  TFVFVSERSGSPRIYLQENRSASAGKPQQLLSPSGTLFHDRPVVRDGRLLYISAHEPPKE  528
            T  F+SERSGSPRIY  + R  S+ K + L S   +LFHDRPV R+ +L +ISAHE P +
Sbjct  58   TIAFISERSGSPRIY--QTRPGSS-KTELLPSIPCSLFHDRPVARNNKLFFISAHEQPDQ  114

Query  529  VFKSWSALYSTHLGLKEITRLTPYGAVDFSPSVSQSGEFIAVASYGSRP  675
            +FKSWSALYST L   + TRLTPYG VD+SPSVS SG+FIAVASY SRP
Sbjct  115  IFKSWSALYSTDLKASKFTRLTPYGVVDYSPSVSYSGKFIAVASYESRP  163



>ref|XP_006444588.1| hypothetical protein CICLE_v10019102mg [Citrus clementina]
 gb|ESR57828.1| hypothetical protein CICLE_v10019102mg [Citrus clementina]
Length=700

 Score =   188 bits (477),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 102/171 (60%), Positives = 123/171 (72%), Gaps = 7/171 (4%)
 Frame = +1

Query  166  MIMDPHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEG  345
            M M+P GTIVF+TVGR +YGFD+FS++ P     +     EHRLTDG SINFN  F+D  
Sbjct  47   MYMEPKGTIVFTTVGRPYYGFDVFSIKSPFV---NAPKFHEHRLTDGTSINFNAQFVDGQ  103

Query  346  D-TFVFVSERSGSPRIYLQENRSASAGKPQQLLSPSGTLFHDRPVVRDGRLLYISAHEPP  522
            D T  F+SERSGSPRIY  + R  S+ K + L S   +LFHDRPV R+ +L +ISAHE P
Sbjct  104  DQTIAFISERSGSPRIY--QTRPGSS-KTELLPSIPCSLFHDRPVARNDKLFFISAHEQP  160

Query  523  KEVFKSWSALYSTHLGLKEITRLTPYGAVDFSPSVSQSGEFIAVASYGSRP  675
             ++FKSWSALYST L   + TRLTPYG VD+SPSVS SG+FI VASY SRP
Sbjct  161  DQIFKSWSALYSTDLKASKFTRLTPYGVVDYSPSVSYSGKFITVASYESRP  211



>ref|XP_008781198.1| PREDICTED: uncharacterized protein LOC103701039 [Phoenix dactylifera]
Length=656

 Score =   187 bits (475),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 95/168 (57%), Positives = 118/168 (70%), Gaps = 3/168 (2%)
 Frame = +1

Query  172  MDPHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEGDT  351
            M+P GTIVFSTVG  +YGFD+FS  LP+  +       E R TDG S+NFN  F+DEG T
Sbjct  1    MEPQGTIVFSTVGLLYYGFDVFSTPLPADLDAAVNKLRERRHTDGTSVNFNAQFVDEGQT  60

Query  352  FVFVSERSGSPRIYLQENRSASAGKPQQLLSPSGTLFHDRPVVRDGRLLYISAHEPPKEV  531
              FVSER+GS ++YL E+      KP+ L +   +L  DRP V++G + ++SAHEPP E 
Sbjct  61   VAFVSERTGSSQLYLAESPDH---KPKPLPTTLESLHQDRPTVKNGLVYFVSAHEPPSEP  117

Query  532  FKSWSALYSTHLGLKEITRLTPYGAVDFSPSVSQSGEFIAVASYGSRP  675
            FKSWSA+YST L   E  RLTP G VDFSP+VS+SGEF+AVASYGSRP
Sbjct  118  FKSWSAVYSTRLDTNETVRLTPPGVVDFSPAVSRSGEFVAVASYGSRP  165



>ref|XP_006355827.1| PREDICTED: uncharacterized protein LOC102591696 [Solanum tuberosum]
Length=698

 Score =   187 bits (475),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 103/173 (60%), Positives = 128/173 (74%), Gaps = 10/173 (6%)
 Frame = +1

Query  169  IMD----PHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFL  336
            IMD    PHG+I+FSTVGR++YGFDIFS++ P SF        EHRLTDG SIN+NG F+
Sbjct  40   IMDSQSSPHGSIIFSTVGRTNYGFDIFSIKSPFSFLNS---PVEHRLTDGTSINYNGQFV  96

Query  337  DEGDTFVFVSERSGSPRIYLQENRSASAGKPQQLLSPSGTLFHDRPVVRDGRLLYISAHE  516
            DE  T VFVSERSG+PRIYL+  R +S  + +QL +   +LF DRP +R+ RL YISAH+
Sbjct  97   DEDQTLVFVSERSGAPRIYLR--RPSSQVQIEQLPTSIDSLFLDRPFLRNRRLYYISAHQ  154

Query  517  PPKEVFKSWSALYSTHL-GLKEITRLTPYGAVDFSPSVSQSGEFIAVASYGSR  672
             PK+VF S SALYST++    +ITRLTPYG  D+SP++SQSG  IAVASYG R
Sbjct  155  QPKQVFTSSSALYSTNIEDGSKITRLTPYGFADYSPAISQSGHLIAVASYGDR  207



>ref|XP_006840288.1| hypothetical protein AMTR_s00045p00058890 [Amborella trichopoda]
 gb|ERN01963.1| hypothetical protein AMTR_s00045p00058890 [Amborella trichopoda]
Length=652

 Score =   186 bits (471),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 91/168 (54%), Positives = 124/168 (74%), Gaps = 4/168 (2%)
 Frame = +1

Query  172  MDPHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEGD-  348
            M   GTI+FSTVGR+ YGFDIF+V + +         +E RLTDG S+NFNG F D+ D 
Sbjct  1    MMGKGTIIFSTVGRASYGFDIFAVTVHNLLNGAAANWTERRLTDGKSVNFNGQFTDDEDG  60

Query  349  TFVFVSERSGSPRIYLQENRSASAGKPQQLLSPSGTLFHDRPVVRDGRLLYISAHEPPKE  528
            T VF+SER+G+ +IYLQ  +  +   P+QLL  SG+LFHDRP  R+GR+ ++SAHEP ++
Sbjct  61   TVVFISERNGASKIYLQLPKCET---PKQLLGASGSLFHDRPTFRNGRVFFVSAHEPAEK  117

Query  529  VFKSWSALYSTHLGLKEITRLTPYGAVDFSPSVSQSGEFIAVASYGSR  672
            +  SW+A+YST +  +E TRL P+G VD+SPS+SQSG++IAVASYGS+
Sbjct  118  LLNSWAAIYSTCMESQETTRLNPHGTVDYSPSISQSGKWIAVASYGSK  165



>ref|XP_009773068.1| PREDICTED: uncharacterized protein LOC104223342 [Nicotiana sylvestris]
Length=663

 Score =   186 bits (471),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 102/172 (59%), Positives = 125/172 (73%), Gaps = 13/172 (8%)
 Frame = +1

Query  181  HGTIVFSTVGRSHYGFDIFSVQLPSSFEQDR----RPASEHRLTDGVSINFNGHFLDEGD  348
            HG+I+FSTVGR++YGFDIF ++ P SF   +    +  +EHRLTDG S+NFNG F+DE  
Sbjct  7    HGSIIFSTVGRTNYGFDIFCLKSPFSFLDSQLHSTQYPTEHRLTDGSSVNFNGQFVDEDQ  66

Query  349  TFVFVSERSGSPRIYLQENRSASAGKPQQLLSPSG---TLFHDRPVVRDGRLLYISAHEP  519
            T VFVSERSGSPRIYLQ     S  K +QL  P G   +LF DRP++ + RL YISAH+P
Sbjct  67   TLVFVSERSGSPRIYLQR---PSQLKIEQL--PDGSPDSLFLDRPLLGNKRLYYISAHQP  121

Query  520  PKEVFKSWSALYSTHL-GLKEITRLTPYGAVDFSPSVSQSGEFIAVASYGSR  672
            P+++F SWSALYST L   K   RLTPYG VD+SP++SQSG  IAVASYG R
Sbjct  122  PEQIFTSWSALYSTTLDDEKTAVRLTPYGCVDYSPAISQSGHLIAVASYGDR  173



>gb|EYU46868.1| hypothetical protein MIMGU_mgv1a002606mg [Erythranthe guttata]
Length=654

 Score =   185 bits (470),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 97/170 (57%), Positives = 125/170 (74%), Gaps = 7/170 (4%)
 Frame = +1

Query  172  MDPHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEGDT  351
            M+P GTIVF++VGR  YGFD++SV LPS+        +E RLTD  S+NFNG F+D+  T
Sbjct  1    MEPTGTIVFTSVGRPDYGFDVYSVHLPSN-SLSHWNFTEQRLTDCASVNFNGQFVDDDST  59

Query  352  FVFVSERSGSPRIYLQENRSASAGKPQQLLSPSGTLFHDRPVVRDGRLLYISAHEPPKEV  531
             VF+SER+GS RI+L  NR  +A  P+QL SP  +LFHDRP +++GRL +ISAH+ P + 
Sbjct  60   LVFISERTGSARIFL--NRPGNAA-PEQLHSPPESLFHDRPFIKNGRLYFISAHQQPDKP  116

Query  532  FKSWSALYSTHLGL---KEITRLTPYGAVDFSPSVSQSGEFIAVASYGSR  672
            FKSW+ALYST   L   K + RLTPYG+VD+SP++SQSG  IAVASYG R
Sbjct  117  FKSWTALYSTGGLLDVNKAVVRLTPYGSVDYSPAISQSGNLIAVASYGPR  166



>ref|XP_011467073.1| PREDICTED: uncharacterized protein LOC105352244 [Fragaria vesca 
subsp. vesca]
Length=685

 Score =   185 bits (469),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 100/181 (55%), Positives = 125/181 (69%), Gaps = 10/181 (6%)
 Frame = +1

Query  133  LSSLRIPKPPIMIMDPHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVS  312
            L+  R    P M   P GT+VFST+GR  YGFD+FS++L SS         EHRLTDG S
Sbjct  27   LTLTRSHSNPKMEQQPKGTLVFSTIGRPQYGFDLFSLRLHSS-------NLEHRLTDGRS  79

Query  313  INFNGHFLDEGDTFVFVSERSGSPRIYLQENRSASAGKPQQLLSPSGTLFHDRPVVRDGR  492
            INFN  F D   + VF+SER+GSP I+L    + +   PQ L S  G+LFHDRPV+++ +
Sbjct  80   INFNAQFADSHQSIVFISERTGSPAIFLTRPGNPT---PQLLHSVPGSLFHDRPVIKNRK  136

Query  493  LLYISAHEPPKEVFKSWSALYSTHLGLKEITRLTPYGAVDFSPSVSQSGEFIAVASYGSR  672
            L +ISAH+ P  +FKSWSALYST L   + TRLTP G+VD+SP+VS SGEF+AVASYGSR
Sbjct  137  LYFISAHQHPDRLFKSWSALYSTDLDENKTTRLTPLGSVDYSPAVSLSGEFVAVASYGSR  196

Query  673  P  675
            P
Sbjct  197  P  197



>ref|XP_008461387.1| PREDICTED: uncharacterized protein LOC103499982 [Cucumis melo]
Length=647

 Score =   184 bits (466),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 97/167 (58%), Positives = 123/167 (74%), Gaps = 11/167 (7%)
 Frame = +1

Query  175  DPHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEGDTF  354
            +P G ++F+T+G + YGFDIFSV L S       P  E RLTDG+S+NFN  FL+   + 
Sbjct  3    NPTGAVLFTTIGLNQYGFDIFSVALNS-------PTVERRLTDGISVNFNAQFLNNQLSV  55

Query  355  VFVSERSGSPRIYLQENRSASAGKPQQLLSPSGTLFHDRPVVRDGRLLYISAHEPPKEVF  534
            VF+SERSGS RIYL ++ ++S   P+ L S  G+ FHDRP+VR+GRLL+ISAHE P + F
Sbjct  56   VFISERSGSSRIYLSDSPNSS---PKLLASAPGSCFHDRPIVRNGRLLFISAHENPHKPF  112

Query  535  KSWSALYSTHL-GLKEITRLTPYGAVDFSPSVSQSGEFIAVASYGSR  672
             SW+ALYST L G   ITRLTP G+VDFSP+VS SG+F+AVASYGSR
Sbjct  113  TSWAALYSTPLDGDDSITRLTPLGSVDFSPAVSGSGKFVAVASYGSR  159



>gb|KCW45418.1| hypothetical protein EUGRSUZ_L00886 [Eucalyptus grandis]
Length=648

 Score =   184 bits (466),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 98/175 (56%), Positives = 123/175 (70%), Gaps = 19/175 (11%)
 Frame = +1

Query  175  DPHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEG---  345
            +P GT++F+TVGR +YGFD+FS+ L S     RR   E RLTDGVSINFN  F   G   
Sbjct  3    EPTGTVLFTTVGRPYYGFDVFSLDLAS-----RR---ERRLTDGVSINFNAQFASAGDDE  54

Query  346  -----DTFVFVSERSGSPRIYLQENRSASAGKPQQLLSPSGTLFHDRPVVRDGRLLYISA  510
                 +  VFVSER+G PR+YL     +   +P+ LLS  G+LFHDRP++R+G L +ISA
Sbjct  55   DDDDPEAVVFVSERTGCPRVYLAR---SGFSQPEPLLSAPGSLFHDRPILRNGLLYFISA  111

Query  511  HEPPKEVFKSWSALYSTHLGLKEITRLTPYGAVDFSPSVSQSGEFIAVASYGSRP  675
            HE P + F  WSALYS  L  +EI RLTPYG+VD+SP+VSQSG+F+AVASYGSRP
Sbjct  112  HEAPDKPFAGWSALYSADLEGREIARLTPYGSVDYSPAVSQSGKFVAVASYGSRP  166



>ref|XP_006366666.1| PREDICTED: uncharacterized protein LOC102589112 [Solanum tuberosum]
Length=658

 Score =   179 bits (455),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 94/166 (57%), Positives = 124/166 (75%), Gaps = 7/166 (4%)
 Frame = +1

Query  178  PHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEGDTFV  357
            P+G+I+FSTVGR++YGFDIFS++ P SF     P +EHRLTDG S+NFNG F+DE  T V
Sbjct  6    PNGSIIFSTVGRTNYGFDIFSLKSPLSFLN--SPITEHRLTDGASVNFNGQFIDEDQTLV  63

Query  358  FVSERSGSPRIYLQENRSASAGKPQQLLSPSGTLFHDRPVVRDGRLLYISAHEPPKEVFK  537
            FVSERSG+PRIYL+++ S     P  +     +LF D P++R+ RL YISAH+  ++ F 
Sbjct  64   FVSERSGAPRIYLRQHPSGIELIPTSI----NSLFLDCPILRNNRLYYISAHQHSEKKFT  119

Query  538  SWSALYSTHL-GLKEITRLTPYGAVDFSPSVSQSGEFIAVASYGSR  672
            S SALY T++ G  E+TRLTP G+VD+SPS+S+SG  IAVASYG+R
Sbjct  120  SSSALYCTNIEGDNEVTRLTPEGSVDYSPSISKSGHMIAVASYGNR  165



>ref|XP_006840287.1| hypothetical protein AMTR_s00045p00058330 [Amborella trichopoda]
 gb|ERN01962.1| hypothetical protein AMTR_s00045p00058330 [Amborella trichopoda]
Length=642

 Score =   179 bits (454),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 90/162 (56%), Positives = 119/162 (73%), Gaps = 4/162 (2%)
 Frame = +1

Query  187  TIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEGDTFVFVS  366
            TIVFSTVGR  YGFDIFSV +P + + D R  +E RLTDG S+N+NGHF +E  T VFVS
Sbjct  6    TIVFSTVGRPSYGFDIFSVTVPKNLD-DMRDWTERRLTDGKSVNYNGHFTEEDGTVVFVS  64

Query  367  ERSGSPRIYLQENRSASAGKPQQLLSPSGTLFHDRPVVRDGRLLYISAHEPPKEVFKSWS  546
            ERSG  ++Y+Q     +  KP +L S   +LFHD P + +GRL ++SA+EP  +  KSW+
Sbjct  65   ERSGCSKLYIQ---LPNTNKPLELPSVPDSLFHDHPTINNGRLFFVSANEPADKPLKSWA  121

Query  547  ALYSTHLGLKEITRLTPYGAVDFSPSVSQSGEFIAVASYGSR  672
            A+YST L  ++ TRLTP G VD+SP+VS+SG++IAVASYGS+
Sbjct  122  AMYSTCLDSQKTTRLTPVGTVDYSPAVSESGKWIAVASYGSK  163



>ref|XP_010522850.1| PREDICTED: uncharacterized protein LOC104801322 [Tarenaya hassleriana]
Length=649

 Score =   178 bits (451),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 96/167 (57%), Positives = 121/167 (72%), Gaps = 13/167 (8%)
 Frame = +1

Query  178  PHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLD-EGDTF  354
            P GTI+F+TVGR++YGFD+FS  +PS        A+E RLTDGVS+NFNGHF D +G + 
Sbjct  4    PRGTIIFTTVGRTYYGFDLFSFHIPS--------ATERRLTDGVSVNFNGHFSDGDGHSV  55

Query  355  VFVSERSGSPRIYLQENRSASAGKPQQLLSPSGTLFHDRPVVRDGRLLYISAHEPPKEVF  534
            VFVSER+ S R+Y     + +   P+QL     +LFHDRPVVRD RL ++SAHE P   F
Sbjct  56   VFVSERTASARVYRTRPDNPT---PEQLPGAPDSLFHDRPVVRDNRLYFVSAHEQPDCHF  112

Query  535  KSWSALYSTHLGL-KEITRLTPYGAVDFSPSVSQSGEFIAVASYGSR  672
            KSWSALY+  LG  ++ TRLTP  A D+SP+VS+SGEF+AVASYGSR
Sbjct  113  KSWSALYAAELGSDRKPTRLTPPSAADYSPAVSRSGEFVAVASYGSR  159



>ref|XP_010069735.1| PREDICTED: uncharacterized protein LOC104456605 [Eucalyptus grandis]
Length=702

 Score =   178 bits (451),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 103/221 (47%), Positives = 141/221 (64%), Gaps = 34/221 (15%)
 Frame = +1

Query  82   VMPYVISHRFF----PLCTQILSSLRIP-----KPPI------MIMDPHGTIVFSTVGRS  216
            ++  + S RFF    P  T I +++R        P +      ++ +P GT++F+TVGR 
Sbjct  1    MINLIRSRRFFTSLHPATTTIFTAVRFSISRSLAPSVTRFLHHLMDEPTGTVLFTTVGRP  60

Query  217  HYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFL--------DEGDTFVFVSER  372
            ++GFD+FS+ L S          E RLTDG+SINFN  F         D+ +  VFVS+R
Sbjct  61   YFGFDVFSLDLAS--------GRERRLTDGLSINFNAQFASAGGEDGEDDPEAVVFVSDR  112

Query  373  SGSPRIYLQENRSASAGKPQQLLSPSGTLFHDRPVVRDGRLLYISAHEPPKEVFKSWSAL  552
            +G PR+YL   RS S+ +P+ L S  G+LFHDRPV+R+GRL +ISAHE P + F SWSAL
Sbjct  113  TGCPRVYLA--RSGSS-QPEPLPSAPGSLFHDRPVLRNGRLYFISAHEDPSKPFASWSAL  169

Query  553  YSTHLGLKEITRLTPYGAVDFSPSVSQSGEFIAVASYGSRP  675
            YS  L   +  RLTPYG+ D+SP+VS+SG+F+AVASYGSRP
Sbjct  170  YSADLEGTQFARLTPYGSADYSPAVSRSGKFVAVASYGSRP  210



>gb|KCW45417.1| hypothetical protein EUGRSUZ_L00885 [Eucalyptus grandis]
Length=531

 Score =   176 bits (446),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 97/176 (55%), Positives = 122/176 (69%), Gaps = 20/176 (11%)
 Frame = +1

Query  175  DPHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFL------  336
            +P GT++F+T+G  +YGFD+FS+ L S          E RLTDG+SINFN  F       
Sbjct  3    EPKGTVLFTTIGCPYYGFDVFSLDLTSH--------REPRLTDGLSINFNAQFASVSASD  54

Query  337  ---DEGDTFVFVSERSGSPRIYLQENRSASAGKPQQLLSPSGTLFHDRPVVRDGRLLYIS  507
               DE +  VFVSE +G PR+YL   RS S+ +PQ LLS  G+LFHDRPV+R+ RL +IS
Sbjct  55   EDDDEPEAVVFVSEWTGCPRVYL--TRSGSS-QPQPLLSAPGSLFHDRPVLRNRRLYFIS  111

Query  508  AHEPPKEVFKSWSALYSTHLGLKEITRLTPYGAVDFSPSVSQSGEFIAVASYGSRP  675
            AHE P + F  WSALYS  L  +EI RLTPYG+VD+SP+VS+SG+F AVASYGSRP
Sbjct  112  AHEEPDKPFAGWSALYSPDLEGREIARLTPYGSVDYSPAVSRSGKFTAVASYGSRP  167



>ref|XP_004135965.1| PREDICTED: uncharacterized protein LOC101214858 [Cucumis sativus]
 ref|XP_004158170.1| PREDICTED: uncharacterized protein LOC101226808 [Cucumis sativus]
 gb|KGN45063.1| hypothetical protein Csa_7G419590 [Cucumis sativus]
Length=642

 Score =   177 bits (448),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 94/167 (56%), Positives = 122/167 (73%), Gaps = 11/167 (7%)
 Frame = +1

Query  175  DPHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEGDTF  354
            +P G ++F+TVG + YGFDIFSV L S          E +LTDG+S+NFN  FL+   + 
Sbjct  3    NPTGAVLFTTVGLNQYGFDIFSVPLNSL-------TVERQLTDGISVNFNAQFLNNQLSV  55

Query  355  VFVSERSGSPRIYLQENRSASAGKPQQLLSPSGTLFHDRPVVRDGRLLYISAHEPPKEVF  534
            VF+SERSGS RIYL ++ ++S   P+ L S  G+ FHDRP+V +GRLL+ISAHE P + F
Sbjct  56   VFISERSGSSRIYLSDSPNSS---PKLLASAPGSCFHDRPIVTNGRLLFISAHENPHKPF  112

Query  535  KSWSALYSTHL-GLKEITRLTPYGAVDFSPSVSQSGEFIAVASYGSR  672
             SW+ALYST L G   +TRLTP G+VDFSP+VS+SG+F+AVASYGSR
Sbjct  113  TSWAALYSTPLDGHDSVTRLTPLGSVDFSPAVSESGKFVAVASYGSR  159



>gb|KCW58166.1| hypothetical protein EUGRSUZ_H00884 [Eucalyptus grandis]
Length=658

 Score =   176 bits (446),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 94/175 (54%), Positives = 123/175 (70%), Gaps = 19/175 (11%)
 Frame = +1

Query  175  DPHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFL------  336
            +P GT++F+TVGR ++GFD+FS+ L S          E RLTDG+SINFN  F       
Sbjct  3    EPTGTVLFTTVGRPYFGFDVFSLDLAS--------GRERRLTDGLSINFNAQFASAGGED  54

Query  337  --DEGDTFVFVSERSGSPRIYLQENRSASAGKPQQLLSPSGTLFHDRPVVRDGRLLYISA  510
              D+ +  VFVS+R+G PR+YL   RS S+ +P+ L S  G+LFHDRPV+R+GRL +ISA
Sbjct  55   GEDDPEAVVFVSDRTGCPRVYLA--RSGSS-QPEPLPSAPGSLFHDRPVLRNGRLYFISA  111

Query  511  HEPPKEVFKSWSALYSTHLGLKEITRLTPYGAVDFSPSVSQSGEFIAVASYGSRP  675
            HE P + F SWSALYS  L   +  RLTPYG+ D+SP+VS+SG+F+AVASYGSRP
Sbjct  112  HEDPSKPFASWSALYSADLEGTQFARLTPYGSADYSPAVSRSGKFVAVASYGSRP  166



>ref|XP_002515212.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF47196.1| conserved hypothetical protein [Ricinus communis]
Length=666

 Score =   176 bits (446),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 93/177 (53%), Positives = 122/177 (69%), Gaps = 13/177 (7%)
 Frame = +1

Query  175  DPHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPAS-EHRLTDGVSINFNGHFLDE---  342
            +P GT+VF+TVGR  YGFD+FS++LPS         S EH LTDG SIN+N  F+ +   
Sbjct  3    NPKGTVVFTTVGRPSYGFDVFSIKLPSDLNSFHFSNSDEHCLTDGTSINYNAQFVTQQHH  62

Query  343  -GDTFVFVSERSGSPRIYLQENRSASAGKPQQLLSPSGTLFHDRPVVRDGRLLYISAHEP  519
               + V++SERSG P +YL +    +  KP+QL S   +LFHDRP++++ RL +ISAHE 
Sbjct  63   QNQSIVYISERSGFPAMYLSK---PNLSKPEQLPSAPESLFHDRPIIKNDRLYFISAHEK  119

Query  520  PKEVFKSWSALYSTHLGL-----KEITRLTPYGAVDFSPSVSQSGEFIAVASYGSRP  675
            P ++F+SWSALYST L         +TRLTP+G VDFSP++S SG FIAVASYGSRP
Sbjct  120  PDQLFRSWSALYSTDLSHSRREGDNVTRLTPFGVVDFSPAISLSGNFIAVASYGSRP  176



>ref|XP_009382467.1| PREDICTED: uncharacterized protein LOC103970421 [Musa acuminata 
subsp. malaccensis]
Length=656

 Score =   175 bits (443),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 89/168 (53%), Positives = 113/168 (67%), Gaps = 3/168 (2%)
 Frame = +1

Query  172  MDPHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEGDT  351
            M+P GTIVF+TVG  HYGFD+FSV +    +      +E R TDG S+NFN  F+DEGD+
Sbjct  1    MEPQGTIVFTTVGLPHYGFDVFSVPVSPDLDDPAAQLTERRHTDGTSVNFNAQFVDEGDS  60

Query  352  FVFVSERSGSPRIYLQENRSASAGKPQQLLSPSGTLFHDRPVVRDGRLLYISAHEPPKEV  531
              FVSER+GS R++   +R  +   P  L + S +LFHDRP VR+GR+ ++SAHE P E 
Sbjct  61   IAFVSERTGSARLFRSSSRDPA---PVPLPAFSDSLFHDRPTVRNGRVFFVSAHERPAEP  117

Query  532  FKSWSALYSTHLGLKEITRLTPYGAVDFSPSVSQSGEFIAVASYGSRP  675
            F+SW A+YS  L   E  RLTP G  D SP+VS SGE +AVASYGS P
Sbjct  118  FRSWCAVYSARLDSGETARLTPPGFADMSPAVSCSGELVAVASYGSAP  165



>gb|KDP28318.1| hypothetical protein JCGZ_14089 [Jatropha curcas]
Length=703

 Score =   174 bits (441),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 89/172 (52%), Positives = 126/172 (73%), Gaps = 7/172 (4%)
 Frame = +1

Query  172  MDPHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPAS-EHRLTDGVSINFNGHFLDE-G  345
            M+P GTIVF+TVGR +YGFD+F V+LPS+ +  +   S E+RLTDGVSINFN  F++E  
Sbjct  47   MNPTGTIVFTTVGRPNYGFDVFFVRLPSNLKDFKFSNSDENRLTDGVSINFNAQFINEHN  106

Query  346  DTFVFVSERSGSPRIYLQENRSASAGKPQQLLSPSGTLFHDRPVVRDGRLLYISAHEPPK  525
             + V+VSER+G  RIYL +   +   + ++L     +LFHDRP++++ RL ++SAHE P 
Sbjct  107  QSIVYVSERTGCSRIYLSK---SGVSETERLPFVPESLFHDRPIIKNNRLYFVSAHERPD  163

Query  526  EVFKSWSALYSTHLG--LKEITRLTPYGAVDFSPSVSQSGEFIAVASYGSRP  675
            + F+SW ALY+T L    + ITRLTP G +D+SP++S SG++IA+ASYGSRP
Sbjct  164  QPFRSWCALYATDLNDQKRNITRLTPPGVIDYSPAISHSGKYIAIASYGSRP  215



>ref|XP_004240512.1| PREDICTED: uncharacterized protein LOC101247825 [Solanum lycopersicum]
Length=660

 Score =   174 bits (441),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 93/167 (56%), Positives = 118/167 (71%), Gaps = 8/167 (5%)
 Frame = +1

Query  178  PHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEGDTFV  357
            P+G+I+FSTVGR++YGFDIFS++ P SF     P +EH LTDG S+NFNG F+DE  T V
Sbjct  6    PNGSIIFSTVGRTNYGFDIFSLKSPLSFLNS--PITEHCLTDGASVNFNGQFIDEDQTLV  63

Query  358  FVSERSGSPRIYLQENRSASAGKPQQLLSPSGTLFHDRPVVRDGRLLYISAHEPPKEVFK  537
            FVSERSG+PRI+L    S     P  +     TLF DRP++R+ RL YISAH+  +++F 
Sbjct  64   FVSERSGAPRIHLSRRHSGIELIPISI----NTLFLDRPILRNNRLYYISAHQHSEKIFT  119

Query  538  SWSALYSTHL--GLKEITRLTPYGAVDFSPSVSQSGEFIAVASYGSR  672
            S SALY T    G  E+ RLTP G VD+SPS+S+SG  IAVASYG+R
Sbjct  120  SSSALYCTSTVEGDNEVKRLTPQGYVDYSPSISKSGHMIAVASYGNR  166



>ref|XP_008227800.1| PREDICTED: uncharacterized protein LOC103327273 [Prunus mume]
Length=712

 Score =   173 bits (439),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 96/182 (53%), Positives = 122/182 (67%), Gaps = 16/182 (9%)
 Frame = +1

Query  160  PIMIMDPHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFL-  336
            PI + DP GT+VFSTVGR HYGFD+FS+ L S+F      ASEHRL+DG+S+NFN  F  
Sbjct  49   PITMNDPKGTVVFSTVGRPHYGFDLFSLPLHSAFNN---LASEHRLSDGISVNFNAQFAN  105

Query  337  DEGDTFVFVSERSGSPRIYLQENRSASAGKPQQLLSPSGTLFHDRPVVRDGRLLYISAHE  516
            D+  + VF+SER+G P IYL          P+ L S  G+LFHDRP++++  L +ISAH+
Sbjct  106  DDPHSVVFISERTGLPAIYLTR---PGLPTPKLLHSEPGSLFHDRPILKNDILYFISAHQ  162

Query  517  PPKEVFKSWSALYSTHLGL---------KEITRLTPYGAVDFSPSVSQSGEFIAVASYGS  669
             P   FKSWSALYST              + TRLTP  +VD+SP++S SG+FIAVASYGS
Sbjct  163  HPNRPFKSWSALYSTTTTFLLDEDQNQNTKTTRLTPSDSVDYSPAISLSGQFIAVASYGS  222

Query  670  RP  675
            RP
Sbjct  223  RP  224



>ref|XP_010091406.1| hypothetical protein L484_013861 [Morus notabilis]
 gb|EXB44443.1| hypothetical protein L484_013861 [Morus notabilis]
Length=662

 Score =   171 bits (432),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 97/175 (55%), Positives = 119/175 (68%), Gaps = 18/175 (10%)
 Frame = +1

Query  172  MDPHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEGDT  351
            MDP GTIVF+TVGR  YGFD+FS+ L  S         E RL+D +SINFNG F D  D 
Sbjct  1    MDPKGTIVFTTVGRPSYGFDLFSLPLDHS-------GPERRLSDALSINFNGQFSDSDDV  53

Query  352  FVFVSERSGSPRIYLQENRSASAGKPQQLLSPSGTLFHDRPVVRDGRLLYISAHEPPKEV  531
             VFVSER+GSPR+YL         +P+ L     +LFHDRPV+++G+L +ISAH+ P + 
Sbjct  54   -VFVSERTGSPRVYLTR---PGLPRPKSLPFVPESLFHDRPVLKNGKLYFISAHQRPDQP  109

Query  532  FKSWSALYSTHLGLKE-------ITRLTPYGAVDFSPSVSQSGEFIAVASYGSRP  675
            FKSWSALYST L   +       ITRLTP G+ D+SP+VS SGEF+AVASYGSRP
Sbjct  110  FKSWSALYSTSLIKGDYNPDEIVITRLTPQGSADYSPAVSLSGEFVAVASYGSRP  164



>ref|XP_003637684.1| Protein tolB [Medicago truncatula]
 gb|KEH40612.1| translocation protein TolB [Medicago truncatula]
Length=657

 Score =   171 bits (432),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 90/169 (53%), Positives = 113/169 (67%), Gaps = 14/169 (8%)
 Frame = +1

Query  178  PHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEGD-TF  354
            P GTIVFST+GR+ YGFD+F   L +    D      H LTDG+SINFN  F D+   T 
Sbjct  4    PIGTIVFSTIGRAQYGFDVFYTNLKNHSNHD------HCLTDGISINFNAQFTDDDQKTI  57

Query  355  VFVSERSGSPRIYLQENRSASAGKPQQLLSPSGTLFHDRPVVRDGRLLYISAHEPPKEVF  534
            VFVSER+GSPR YL    S    +P+ L SP   +F DRP +R+G+L ++S HE P E+F
Sbjct  58   VFVSERTGSPRFYL----SKLGNEPELLPSPLNAVFLDRPTIRNGKLYFVSTHEQPNELF  113

Query  535  KSWSALYSTHL---GLKEITRLTPYGAVDFSPSVSQSGEFIAVASYGSR  672
            KSW+A+YST +   G    TRLTPYG VD+SP+VS +G  IAVASYG+R
Sbjct  114  KSWTAVYSTAINSAGTSTFTRLTPYGVVDYSPAVSLTGSLIAVASYGTR  162



>gb|EPS68684.1| hypothetical protein M569_06083, partial [Genlisea aurea]
Length=638

 Score =   169 bits (429),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 89/166 (54%), Positives = 119/166 (72%), Gaps = 12/166 (7%)
 Frame = +1

Query  184  GTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDE-GDTFVF  360
            GT++FSTV R  YGFD+FSV L  +        SE  LTDGVS+NFN  F D+ G + VF
Sbjct  2    GTVIFSTVDRQFYGFDVFSVGLTPN-------TSEQLLTDGVSVNFNAQFADDVGKSIVF  54

Query  361  VSERSGSPRIYLQENRSASAGKPQQLLSPSGTLFHDRPVVRDGRLLYISAHEPPKEVFKS  540
            +SER+G+PRI+L  +  +    PQ+L S  G+LFHDRP+V +GRL +ISAHE P + F+S
Sbjct  55   ISERTGAPRIFLLRDGDS---PPQELGSVRGSLFHDRPIVNNGRLYFISAHELPGKPFRS  111

Query  541  WSALYSTHLGL-KEITRLTPYGAVDFSPSVSQSGEFIAVASYGSRP  675
            W+ALYS  + + +E  RL+P G  D+SP++S+SGEFIAVASYG+RP
Sbjct  112  WTALYSVAIDVEEEAVRLSPPGCADYSPAISKSGEFIAVASYGNRP  157



>gb|AAM13860.1| unknown protein [Arabidopsis thaliana]
Length=657

 Score =   169 bits (428),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 90/169 (53%), Positives = 121/169 (72%), Gaps = 15/169 (9%)
 Frame = +1

Query  178  PHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFL-DEGDTF  354
            P GTI+F+TVGR+HYGFD+FS+ + +S E+        RLTDGVS+NFN  F+ D+ D  
Sbjct  9    PKGTIIFTTVGRTHYGFDVFSLNIATSVER--------RLTDGVSVNFNAQFVNDKSDDV  60

Query  355  VFVSERSGSPRIYLQENRSASAGKPQQLLSPSGTLFHDRPVV-RDGRLLYISAHEPPKEV  531
            VFVSER+GS RIY  + RS  + KP+Q+     + FHDRP++ ++ RL +ISAHE P   
Sbjct  61   VFVSERNGSARIY--KTRSGIS-KPEQIPGAPESYFHDRPIITQNNRLYFISAHEQPDRY  117

Query  532  FKSWSALYSTHL--GLKEITRLTPYGAVDFSPSVSQSGEFIAVASYGSR  672
            FK+WSALY+  L    +E+TR+TP    DFSP+VSQSG+F+AVASYG+R
Sbjct  118  FKNWSALYTVELNSAKREVTRVTPPDTTDFSPAVSQSGDFLAVASYGTR  166



>ref|NP_192096.1| tolB-related protein [Arabidopsis thaliana]
 gb|AAD22649.1|AC007138_13 predicted protein of unknown function [Arabidopsis thaliana]
 emb|CAB80680.1| predicted protein of unknown function [Arabidopsis thaliana]
 gb|AAP04154.1| unknown protein [Arabidopsis thaliana]
 dbj|BAE99158.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE82088.1| tolB-related protein [Arabidopsis thaliana]
Length=652

 Score =   169 bits (427),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 90/169 (53%), Positives = 121/169 (72%), Gaps = 15/169 (9%)
 Frame = +1

Query  178  PHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFL-DEGDTF  354
            P GTI+F+TVGR+HYGFD+FS+ + +S E+        RLTDGVS+NFN  F+ D+ D  
Sbjct  4    PKGTIIFTTVGRTHYGFDVFSLNIATSVER--------RLTDGVSVNFNAQFVNDKSDDV  55

Query  355  VFVSERSGSPRIYLQENRSASAGKPQQLLSPSGTLFHDRPVV-RDGRLLYISAHEPPKEV  531
            VFVSER+GS RIY  + RS  + KP+Q+     + FHDRP++ ++ RL +ISAHE P   
Sbjct  56   VFVSERNGSARIY--KTRSGIS-KPEQIPGAPESYFHDRPIITQNNRLYFISAHEQPDRY  112

Query  532  FKSWSALYSTHL--GLKEITRLTPYGAVDFSPSVSQSGEFIAVASYGSR  672
            FK+WSALY+  L    +E+TR+TP    DFSP+VSQSG+F+AVASYG+R
Sbjct  113  FKNWSALYTVELNSAKREVTRVTPPDTADFSPAVSQSGDFLAVASYGTR  161



>ref|XP_006396381.1| hypothetical protein EUTSA_v10029172mg, partial [Eutrema salsugineum]
 gb|ESQ37834.1| hypothetical protein EUTSA_v10029172mg, partial [Eutrema salsugineum]
Length=430

 Score =   166 bits (419),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 89/168 (53%), Positives = 112/168 (67%), Gaps = 14/168 (8%)
 Frame = +1

Query  178  PHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEGDTFV  357
            P GTI+F+TVGR+HYGFD+FS+ + S        A E RLTDGVS+NFN  F ++    V
Sbjct  4    PSGTIIFTTVGRTHYGFDVFSLHINS--------AVERRLTDGVSVNFNAQFANDNGDVV  55

Query  358  FVSERSGSPRIYLQENRSASAGKPQQLLSPSGTLFHDRPVV-RDGRLLYISAHEPPKEVF  534
            FVSER+GS RI+          KP+QL     + FHDRPV+ ++ RL +ISAHE P   F
Sbjct  56   FVSERAGSARIFRTR---PGDSKPEQLPGAPQSFFHDRPVITQNNRLYFISAHEQPDRHF  112

Query  535  KSWSALYSTHLG--LKEITRLTPYGAVDFSPSVSQSGEFIAVASYGSR  672
            K+WSALYS  L    +E+TR+TP    DFSP+VSQSGE + VASYGSR
Sbjct  113  KNWSALYSVKLDGEEREVTRVTPLDTADFSPAVSQSGELLTVASYGSR  160



>ref|XP_010428858.1| PREDICTED: uncharacterized protein LOC104713446 [Camelina sativa]
Length=651

 Score =   166 bits (421),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 92/168 (55%), Positives = 117/168 (70%), Gaps = 15/168 (9%)
 Frame = +1

Query  178  PHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEGDTFV  357
            P GTI+F+TVGR+HYGFD+FS+ + +S E+        RLTDGVS+NFN  F   GD  V
Sbjct  4    PKGTIIFTTVGRTHYGFDVFSLHIATSVER--------RLTDGVSVNFNAQFT-SGDDVV  54

Query  358  FVSERSGSPRIYLQENRSASAGKPQQLLSPSGTLFHDRPVV-RDGRLLYISAHEPPKEVF  534
            FVSER+GS RI+    R  ++ +P+QL    G+ FHDRP+V +  RL +ISAHE P   F
Sbjct  55   FVSERNGSARIF--RTRPGNS-EPEQLPGAPGSYFHDRPIVTQSNRLYFISAHEQPDRHF  111

Query  535  KSWSALYSTHLGLK--EITRLTPYGAVDFSPSVSQSGEFIAVASYGSR  672
            K+WSALY+  L  K  E+TR+TP    DFSP+VSQSGE +AVASYGSR
Sbjct  112  KNWSALYTVELNDKKREVTRITPPDVADFSPAVSQSGELLAVASYGSR  159



>ref|XP_002461097.1| hypothetical protein SORBIDRAFT_02g040640 [Sorghum bicolor]
 gb|EER97618.1| hypothetical protein SORBIDRAFT_02g040640 [Sorghum bicolor]
Length=669

 Score =   166 bits (420),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 84/177 (47%), Positives = 117/177 (66%), Gaps = 9/177 (5%)
 Frame = +1

Query  172  MDPHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPA------SEHRLTDGVSINFNGHF  333
            M+P GTIVF++VG +++GFD+FSV +P+    +           E R TDGVS+NFN  F
Sbjct  1    MEPTGTIVFASVGVTNFGFDVFSVAVPTPASAEAEAGVSAQELDERRHTDGVSVNFNAQF  60

Query  334  LDE-GDTFVFVSERSGSPRIYLQENRSASAGKPQQLLSPSGTLFHDRPVVRDGRLLYISA  510
             D+ GD   FVSER+G+  ++L     + + +P+ L +  G+LFHDRP VR GR+ ++SA
Sbjct  61   ADDAGDAVAFVSERTGAASLFLSRPPGSESDRPEPLPAAEGSLFHDRPTVRGGRVYFVSA  120

Query  511  HEPPKEVFKSWSALYSTHLGLK--EITRLTPYGAVDFSPSVSQSGEFIAVASYGSRP  675
            HE P   F+SW+A+Y+  +G +  E  RLTP G VD SP+VS SG+ IAVASYG RP
Sbjct  121  HEKPDRTFQSWAAVYAARVGERKAEPERLTPRGVVDMSPAVSASGDLIAVASYGDRP  177



>ref|XP_006396377.1| hypothetical protein EUTSA_v10029281mg [Eutrema salsugineum]
 gb|ESQ37830.1| hypothetical protein EUTSA_v10029281mg [Eutrema salsugineum]
Length=601

 Score =   165 bits (418),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 90/168 (54%), Positives = 114/168 (68%), Gaps = 14/168 (8%)
 Frame = +1

Query  178  PHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEGDTFV  357
            P GTI+F+TVGR+HYGFD+FS+ + S        A E RLTDGVS+NFN  F ++    V
Sbjct  4    PSGTIIFTTVGRTHYGFDVFSLHINS--------AVERRLTDGVSVNFNAQFANDNGDVV  55

Query  358  FVSERSGSPRIYLQENRSASAGKPQQLLSPSGTLFHDRPVV-RDGRLLYISAHEPPKEVF  534
            FVSER+GS RI+    R   + KP+QL     + FHDRPV+ ++ RL +ISAHE P   F
Sbjct  56   FVSERAGSARIF--RTRPGDS-KPEQLPGAPQSFFHDRPVITQNNRLYFISAHEQPDRHF  112

Query  535  KSWSALYSTHLG--LKEITRLTPYGAVDFSPSVSQSGEFIAVASYGSR  672
            K+WSALYS  L    +E+TR+TP    DFSP+VSQSGE + VASYGSR
Sbjct  113  KNWSALYSVKLDGEEREVTRVTPLDTADFSPAVSQSGELLTVASYGSR  160



>ref|XP_002872871.1| hypothetical protein ARALYDRAFT_490390 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49130.1| hypothetical protein ARALYDRAFT_490390 [Arabidopsis lyrata subsp. 
lyrata]
Length=652

 Score =   165 bits (418),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 89/169 (53%), Positives = 115/169 (68%), Gaps = 15/169 (9%)
 Frame = +1

Query  178  PHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFL-DEGDTF  354
            P GTI+F+TVGR+HYGFD+FS+ + +        A E RLTDGVS+NFN  F+ D+ D  
Sbjct  4    PKGTIIFTTVGRTHYGFDVFSLHIAT--------AVERRLTDGVSVNFNAQFVNDKSDDV  55

Query  355  VFVSERSGSPRIYLQENRSASAGKPQQLLSPSGTLFHDRPVV-RDGRLLYISAHEPPKEV  531
            VFVSER+GS RIY          +P+QL     + FHDRP++ +  RL +ISAHE P   
Sbjct  56   VFVSERNGSARIYKTR---PGISEPEQLPGAPESYFHDRPIITQSNRLYFISAHEQPDRH  112

Query  532  FKSWSALYSTHLG--LKEITRLTPYGAVDFSPSVSQSGEFIAVASYGSR  672
            FK+WSALY+  L    +E+TR+TP    DFSP+VSQSG+F+AVASYGSR
Sbjct  113  FKNWSALYTVELNGEEREVTRVTPLDTADFSPAVSQSGDFLAVASYGSR  161



>gb|EAZ40813.1| hypothetical protein OsJ_25290 [Oryza sativa Japonica Group]
Length=594

 Score =   164 bits (416),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 85/170 (50%), Positives = 116/170 (68%), Gaps = 8/170 (5%)
 Frame = +1

Query  172  MDPHGTIVFSTVGRSHYGFDIFSVQLP-SSFEQDRRPASEHRLTDGVSINFNGHFLDEG-  345
            M+P GTIVF+TVG +++GFD+FS  +P    E+D    +E R TDGVS+NFN  F+D+G 
Sbjct  1    MEPTGTIVFATVGVTNFGFDVFSAAVPLPPMEED----AERRHTDGVSVNFNAQFVDDGG  56

Query  346  DTFVFVSERSGSPRIYLQENRSASAGKPQQLLSPSGTLFHDRPVVRDGRLLYISAHEPPK  525
            +   FVSER G+  ++    R     + + L +  G+LFHDRP VR GRL ++SAHE P 
Sbjct  57   EEVAFVSERGGAAGLF--RCRPGPEQRAEPLPTVEGSLFHDRPTVRGGRLYFVSAHEQPP  114

Query  526  EVFKSWSALYSTHLGLKEITRLTPYGAVDFSPSVSQSGEFIAVASYGSRP  675
              F+SW+A+Y+T +G KE  R++P G VD SP+VS SGE +AVASYG RP
Sbjct  115  APFRSWAAVYATEIGSKETVRVSPPGVVDMSPAVSDSGELVAVASYGDRP  164



>ref|XP_004498256.1| PREDICTED: uncharacterized protein LOC101515113 [Cicer arietinum]
Length=652

 Score =   164 bits (416),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 89/176 (51%), Positives = 123/176 (70%), Gaps = 14/176 (8%)
 Frame = +1

Query  166  MIMDPHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRP---ASEHRLTDGVSINFNGHFL  336
            M  +  GTIVF+TVGR+ YGFD+FSV L     Q+  P   + EH LTDG S+NFN  F 
Sbjct  1    MANELTGTIVFNTVGRAQYGFDVFSVNL-----QNDTPFQISHEHCLTDGTSVNFNAQFT  55

Query  337  D--EGDTFVFVSERSGSPRIYLQENRSASAGKPQQLLSPSGTLFHDRPVVRDGRLLYISA  510
            +  +  + VF+SER+GSPRIY+ +    +  +P   +S S  LFHDRP++++ +L ++SA
Sbjct  56   ESKQNQSIVFISERTGSPRIYITQPEKENPVEPLAFVSES--LFHDRPIIKNEKLYFVSA  113

Query  511  HEPPKEVFKSWSALYSTHL-GLKEITRLTPYGAVDFSPSVSQSGEFIAVASYGSRP  675
            H+P   +FKSW A+YST + G   ITR+TP+G VD+SP+VS +G+FIAVASYGSRP
Sbjct  114  HDP-NVLFKSWCAVYSTSVNGDGNITRITPHGIVDYSPAVSLTGKFIAVASYGSRP  168



>ref|XP_009367159.1| PREDICTED: uncharacterized protein LOC103956844 [Pyrus x bretschneideri]
Length=715

 Score =   165 bits (417),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 94/178 (53%), Positives = 118/178 (66%), Gaps = 13/178 (7%)
 Frame = +1

Query  160  PIMIMDPHGTIVFSTVGRSHYGFDIFSVQL---PSSFEQDRRPASEHRLTDGVSINFNGH  330
            P M  DP GT+VFSTVGR +YGFDIF++ +   PSS         E RL+DG SINFN  
Sbjct  53   PTMNTDPKGTVVFSTVGRPNYGFDIFALPILLHPSS----TNIGPERRLSDGRSINFNAQ  108

Query  331  FLD---EGDTFVFVSERSGSPRIYLQENRSASAGKPQQLLSPSGTLFHDRPVVRDGRLLY  501
            F D   E  + VF+SER+G P IYL          PQ L S  G+LFHDRP++++  L +
Sbjct  109  FADNNHEPHSLVFISERTGFPAIYLTR---PGLPHPQVLHSEPGSLFHDRPIIKNHTLYF  165

Query  502  ISAHEPPKEVFKSWSALYSTHLGLKEITRLTPYGAVDFSPSVSQSGEFIAVASYGSRP  675
            +SAH+ P   FKSWSALYS+ L  K  TRLTP  +VD+SP++S SG+F+AVASYGSRP
Sbjct  166  VSAHQDPGRYFKSWSALYSSTLHDKITTRLTPSDSVDYSPALSLSGKFVAVASYGSRP  223



>gb|AJD80981.1| ABA-activated 1 protein [Lupinus luteus]
Length=647

 Score =   164 bits (415),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 88/172 (51%), Positives = 116/172 (67%), Gaps = 11/172 (6%)
 Frame = +1

Query  169  IMDPHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLD---  339
            ++ P GTIVF+TVGR  YGFD+FSV L     Q     ++HRLTDGVSINFN  F+D   
Sbjct  1    MLPPAGTIVFNTVGRPQYGFDVFSVDL---HHQPPHAVTDHRLTDGVSINFNAQFIDNDE  57

Query  340  EGDTFVFVSERSGSPRIYLQENRSASAGKPQQLLSPSGTLFHDRPVVRDGRLLYISAHEP  519
            E ++ VF+SER+GSPR YL    +    KPQ L     +LFHDR  +++G++ ++S H+ 
Sbjct  58   EQNSIVFISERTGSPRCYL----TRPGNKPQPLPFVPNSLFHDRATIKNGKMYFVSTHDE  113

Query  520  PKEVFKSWSALYSTHL-GLKEITRLTPYGAVDFSPSVSQSGEFIAVASYGSR  672
               VFKSWSA+YST + G   + RLTP   VD+SP+VS +G+FIAV SYGSR
Sbjct  114  NDTVFKSWSAVYSTDIDGDGTVIRLTPKDVVDYSPAVSLTGKFIAVTSYGSR  165



>ref|NP_001060406.1| Os07g0638100 [Oryza sativa Japonica Group]
 dbj|BAC45195.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF22320.1| Os07g0638100 [Oryza sativa Japonica Group]
Length=659

 Score =   164 bits (415),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 85/170 (50%), Positives = 116/170 (68%), Gaps = 8/170 (5%)
 Frame = +1

Query  172  MDPHGTIVFSTVGRSHYGFDIFSVQLP-SSFEQDRRPASEHRLTDGVSINFNGHFLDEG-  345
            M+P GTIVF+TVG +++GFD+FS  +P    E+D    +E R TDGVS+NFN  F+D+G 
Sbjct  1    MEPTGTIVFATVGVTNFGFDVFSAAVPLPPMEED----AERRHTDGVSVNFNAQFVDDGG  56

Query  346  DTFVFVSERSGSPRIYLQENRSASAGKPQQLLSPSGTLFHDRPVVRDGRLLYISAHEPPK  525
            +   FVSER G+  ++    R     + + L +  G+LFHDRP VR GRL ++SAHE P 
Sbjct  57   EEVAFVSERGGAAGLF--RCRPGPEQRAEPLPTVEGSLFHDRPTVRGGRLYFVSAHEQPP  114

Query  526  EVFKSWSALYSTHLGLKEITRLTPYGAVDFSPSVSQSGEFIAVASYGSRP  675
              F+SW+A+Y+T +G KE  R++P G VD SP+VS SGE +AVASYG RP
Sbjct  115  APFRSWAAVYATEIGSKETVRVSPPGVVDMSPAVSDSGELVAVASYGDRP  164



>gb|EAZ04851.1| hypothetical protein OsI_27029 [Oryza sativa Indica Group]
Length=659

 Score =   164 bits (415),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 85/170 (50%), Positives = 116/170 (68%), Gaps = 8/170 (5%)
 Frame = +1

Query  172  MDPHGTIVFSTVGRSHYGFDIFSVQLP-SSFEQDRRPASEHRLTDGVSINFNGHFLDEG-  345
            M+P GTIVF+TVG +++GFD+FS  +P    E+D    +E R TDGVS+NFN  F+D+G 
Sbjct  1    MEPTGTIVFATVGVTNFGFDVFSAAVPLPPMEED----AERRHTDGVSVNFNAQFVDDGG  56

Query  346  DTFVFVSERSGSPRIYLQENRSASAGKPQQLLSPSGTLFHDRPVVRDGRLLYISAHEPPK  525
            +   FVSER G+  ++    R     + + L +  G+LFHDRP VR GRL ++SAHE P 
Sbjct  57   EEVAFVSERGGAAGLF--RCRPGPEQRAEPLPTVEGSLFHDRPTVRGGRLYFVSAHEQPP  114

Query  526  EVFKSWSALYSTHLGLKEITRLTPYGAVDFSPSVSQSGEFIAVASYGSRP  675
              F+SW+A+Y+T +G KE  R++P G VD SP+VS SGE +AVASYG RP
Sbjct  115  APFRSWAAVYATEIGSKETVRVSPPGVVDMSPAVSDSGELVAVASYGDRP  164



>ref|XP_010679438.1| PREDICTED: uncharacterized protein LOC104894805 [Beta vulgaris 
subsp. vulgaris]
Length=668

 Score =   162 bits (410),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 88/163 (54%), Positives = 114/163 (70%), Gaps = 11/163 (7%)
 Frame = +1

Query  184  GTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEGDTFVFV  363
            G+IVFSTVGR+ YGFDIF V L     QD   A+EH LTDG+SINFNG F+D+ +T VF+
Sbjct  17   GSIVFSTVGRTEYGFDIFCVSL-----QDT--ATEHCLTDGISINFNGQFVDDNNTLVFI  69

Query  364  SERSGSPRIYLQENRSASAGKPQQLLSPSGTLFHDRPVVRDGRLLYISAHEPPKEVFKSW  543
            SER+G P++YL   R  S+  P++L S   +LFHDRP++    L ++SAHEP   ++KS 
Sbjct  70   SERNGVPQVYLT--RPNSSDSPEKLPSAPRSLFHDRPILYGDCLYFVSAHEPTDSLYKSC  127

Query  544  SALYSTHLGLKEITRLTPYGAVDFSPSVSQSGEFIAVASYGSR  672
            SA+YS    +   TRLTP G  DFSP++S +G FIAVASYGS 
Sbjct  128  SAVYSIQSNIP--TRLTPPGTADFSPALSPNGNFIAVASYGSN  168



>ref|XP_003637686.1| Protein tolB [Medicago truncatula]
 gb|KEH40586.1| translocation protein TolB [Medicago truncatula]
 gb|KEH40614.1| translocation protein TolB [Medicago truncatula]
Length=650

 Score =   161 bits (408),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 85/168 (51%), Positives = 116/168 (69%), Gaps = 14/168 (8%)
 Frame = +1

Query  178  PHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEGDTFV  357
            P GTIVF+TVGR+ YGFD+F   L ++        ++HRLTDG+S+NFN  F ++  T V
Sbjct  4    PSGTIVFNTVGRTQYGFDVFYTHLNNNH-------NDHRLTDGISVNFNAQFTNDHQTIV  56

Query  358  FVSERSGSPRIYLQENRSASAGKPQQLLS--PSGTLFHDRPVVRDGRLLYISAHEPPKEV  531
            FVSER+GSPR YL    + S  KP+ LL   P+ TLF D P++++ ++ + S H+ P  +
Sbjct  57   FVSERTGSPRFYL----TRSENKPELLLPSLPNNTLFQDCPIIKNSKIYFSSTHDQPNAL  112

Query  532  FKSWSALYSTHL-GLKEITRLTPYGAVDFSPSVSQSGEFIAVASYGSR  672
            FKS SA+YST + G   +TRLTP+G VD+SP+VS +G  IAVASYGSR
Sbjct  113  FKSASAVYSTAVDGTGTLTRLTPHGVVDYSPAVSLTGNLIAVASYGSR  160



>ref|XP_007221548.1| hypothetical protein PRUPE_ppa002534mg [Prunus persica]
 gb|EMJ22747.1| hypothetical protein PRUPE_ppa002534mg [Prunus persica]
Length=661

 Score =   161 bits (407),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 94/176 (53%), Positives = 118/176 (67%), Gaps = 16/176 (9%)
 Frame = +1

Query  178  PHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFL-DEGDTF  354
            P GT+VFSTVGR HYGFD+FS  LP  F  +   A EHRL+DG+S+NFN  F  D+  + 
Sbjct  4    PKGTVVFSTVGRPHYGFDLFS--LPLHFSSNNL-ALEHRLSDGISVNFNAQFANDDPHSV  60

Query  355  VFVSERSGSPRIYLQENRSASAGKPQQLLSPSGTLFHDRPVVRDGRLLYISAHEPPKEVF  534
            VF+SER+G P IYL          P+ L S  G+LFHDRP++++  L +ISAH+ P   F
Sbjct  61   VFISERTGLPAIYLTR---PGLPTPKLLHSEPGSLFHDRPILKNDILYFISAHQHPNRPF  117

Query  535  KSWSALYSTHLGLK---------EITRLTPYGAVDFSPSVSQSGEFIAVASYGSRP  675
            KSWSALYST   L          + TRLTP  +VD+SP++SQSG+FIAVASYGSRP
Sbjct  118  KSWSALYSTTTTLLLDEDQNQNPKTTRLTPSDSVDYSPAISQSGQFIAVASYGSRP  173



>emb|CDX74396.1| BnaA03g26510D [Brassica napus]
Length=650

 Score =   161 bits (407),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 90/172 (52%), Positives = 120/172 (70%), Gaps = 16/172 (9%)
 Frame = +1

Query  172  MD-PHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDE-G  345
            MD P GTI+F+TVGR+HYGFD+FS+ + SS E+        RLTDGVS+NFN  F D+ G
Sbjct  1    MDTPSGTIIFTTVGRTHYGFDVFSLHIASSVER--------RLTDGVSVNFNAQFADDNG  52

Query  346  DTFVFVSERSGSPRIYLQENRSASAGKPQQLLSPSGTLFHDRPVV-RDGRLLYISAHEPP  522
            +  VFVSER+GS RI+    R  ++ KP+QL     + FHDRP++ +D  L +ISAHE P
Sbjct  53   NDIVFVSERAGSARIF--RTRPGNS-KPEQLPGAPESFFHDRPIITQDNTLYFISAHEQP  109

Query  523  KEVFKSWSALYSTHLGLKE--ITRLTPYGAVDFSPSVSQSGEFIAVASYGSR  672
               FK+W+ALYS +   KE  +TR+TP    DFSP++S+SG++ AVASYGSR
Sbjct  110  DRHFKNWTALYSVNPNSKEKAVTRVTPPDTADFSPTISKSGKYFAVASYGSR  161



>ref|XP_009134471.1| PREDICTED: uncharacterized protein LOC103858800 [Brassica rapa]
Length=650

 Score =   160 bits (406),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 90/172 (52%), Positives = 120/172 (70%), Gaps = 16/172 (9%)
 Frame = +1

Query  172  MD-PHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDE-G  345
            MD P GTI+F+TVGR+HYGFD+FS+ + SS E+        RLTDGVS+NFN  F D+ G
Sbjct  1    MDTPSGTIIFTTVGRTHYGFDVFSLHIASSVER--------RLTDGVSVNFNAQFADDNG  52

Query  346  DTFVFVSERSGSPRIYLQENRSASAGKPQQLLSPSGTLFHDRPVV-RDGRLLYISAHEPP  522
            +  VFVSER+GS RI+    R  ++ KP+QL     + FHDRP++ +D  L +ISAHE P
Sbjct  53   NDIVFVSERAGSARIF--RTRPGNS-KPEQLPGAPESFFHDRPIITQDNTLYFISAHEQP  109

Query  523  KEVFKSWSALYSTHLG--LKEITRLTPYGAVDFSPSVSQSGEFIAVASYGSR  672
               FK+W+ALYS +     KE+TR+TP    DFSP++S+SG++ AVASYGSR
Sbjct  110  DRHFKNWTALYSVNPNSQEKEVTRVTPPDTADFSPAISKSGKYFAVASYGSR  161



>ref|XP_003529216.2| PREDICTED: uncharacterized protein LOC100814036 [Glycine max]
Length=704

 Score =   161 bits (407),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 86/170 (51%), Positives = 114/170 (67%), Gaps = 7/170 (4%)
 Frame = +1

Query  169  IMDPHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEGD  348
            ++ P GTIVF+TVGR  YGFD+FSV L    +      ++HRLTDGVSINFN  F++  +
Sbjct  49   MLPPAGTIVFNTVGRVQYGFDVFSVDLNHQ-QPPPHATADHRLTDGVSINFNAQFINPQN  107

Query  349  TFVFVSERSGSPRIYLQENRSASAGKPQQLLSPSGTLFHDRPVVRDGRLLYISAHEPPKE  528
              VFVSER+GSPR Y+ +  +    KPQ L      LFHDRP+V++G+L ++S HE    
Sbjct  108  DVVFVSERTGSPRFYITKPDT----KPQPLPFLPNALFHDRPIVKNGKLYFVSTHEENDA  163

Query  529  VFKSWSALYSTHL--GLKEITRLTPYGAVDFSPSVSQSGEFIAVASYGSR  672
            VF SWSA+YST +      + RLTP G VD+SP+VS +G+F+ VASY SR
Sbjct  164  VFTSWSAVYSTAIDDSTATVKRLTPRGEVDYSPAVSLTGKFLGVASYRSR  213



>ref|XP_010422681.1| PREDICTED: uncharacterized protein LOC104707922 [Camelina sativa]
Length=651

 Score =   160 bits (405),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 89/168 (53%), Positives = 114/168 (68%), Gaps = 15/168 (9%)
 Frame = +1

Query  178  PHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEGDTFV  357
            P GTI+F+TVGR+HYGFD+FS+ + +S E+        RLTDGVS+NFN  F   GD  V
Sbjct  4    PKGTIIFTTVGRTHYGFDVFSLHIATSLER--------RLTDGVSVNFNAQFT-SGDNVV  54

Query  358  FVSERSGSPRIYLQENRSASAGKPQQLLSPSGTLFHDRPVVRDGRLLY-ISAHEPPKEVF  534
            FVSER+GS  I+    R  ++ +P+QL     + FHDRP+V    +LY ISAHE P   F
Sbjct  55   FVSERNGSATIF--RTRPGNS-EPEQLPGAPDSYFHDRPIVTQSNILYFISAHEQPDRHF  111

Query  535  KSWSALYSTHLG--LKEITRLTPYGAVDFSPSVSQSGEFIAVASYGSR  672
            K+WSALY+  L    +E+TR+TP    DFSP+VSQSGE +AVASYGSR
Sbjct  112  KNWSALYAVELNGEKREVTRVTPPDVADFSPAVSQSGELLAVASYGSR  159



>ref|XP_006289995.1| hypothetical protein CARUB_v10003625mg [Capsella rubella]
 gb|EOA22893.1| hypothetical protein CARUB_v10003625mg [Capsella rubella]
Length=650

 Score =   160 bits (404),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 86/169 (51%), Positives = 114/169 (67%), Gaps = 17/169 (10%)
 Frame = +1

Query  178  PHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEGDTFV  357
            P GTI+++TVGR+HYGFD+FS+ + +S E+        RLTDGVS+NFN  F   GD  V
Sbjct  4    PKGTIIYTTVGRTHYGFDVFSLHIATSVER--------RLTDGVSVNFNAQFT--GDDVV  53

Query  358  FVSERSGSPRIYLQENRSASAGKPQQLLSPSGTLFHDRPVV--RDGRLLYISAHEPPKEV  531
            FVSER+GS R+Y          +P+QL     + FHDRP++  +  +L +ISAHE P   
Sbjct  54   FVSERTGSARVYRTR---PGKPEPEQLPGAPDSYFHDRPIIVSQSNKLYFISAHEQPDRH  110

Query  532  FKSWSALYSTHLG--LKEITRLTPYGAVDFSPSVSQSGEFIAVASYGSR  672
            FK+WSALY+  L    +E+TR+TP    DFSP+VSQSG+F+AVASYGSR
Sbjct  111  FKNWSALYAVELNGDKREVTRVTPPDVADFSPAVSQSGDFLAVASYGSR  159



>dbj|BAJ94262.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=654

 Score =   159 bits (403),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 84/169 (50%), Positives = 112/169 (66%), Gaps = 5/169 (3%)
 Frame = +1

Query  175  DPHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPA-SEHRLTDGVSINFNGHFLDE-GD  348
            +P GT+VF++VG + +GFD+FSV +P + E       +E R TDGVS+NFN  F D+ G+
Sbjct  6    EPTGTVVFASVGVTSFGFDVFSVAVPQTPESVSAAGLAERRHTDGVSVNFNAQFADDVGE  65

Query  349  TFVFVSERSGSPRIYLQENRSASAGKPQQLLSPSGTLFHDRPVVRDGRLLYISAHEPPKE  528
               FVSER+GS  ++L    S  A     L    G+LFHDRP VR GRL ++S+HE P  
Sbjct  66   EVAFVSERTGSAGLFLCRPESERA---VPLPVVEGSLFHDRPAVRGGRLYFVSSHEKPAA  122

Query  529  VFKSWSALYSTHLGLKEITRLTPYGAVDFSPSVSQSGEFIAVASYGSRP  675
             F+SW+A+Y+T LG +E  R+TP G  D SP+VS SGE +AVASYG RP
Sbjct  123  WFRSWAAVYATELGSEETVRVTPQGVADMSPAVSTSGELLAVASYGERP  171



>dbj|BAJ89339.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=654

 Score =   159 bits (403),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 84/169 (50%), Positives = 112/169 (66%), Gaps = 5/169 (3%)
 Frame = +1

Query  175  DPHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPA-SEHRLTDGVSINFNGHFLDE-GD  348
            +P GT+VF++VG + +GFD+FSV +P + E       +E R TDGVS+NFN  F D+ G+
Sbjct  6    EPTGTVVFASVGVTSFGFDVFSVAVPQTPESVSAAGLAERRHTDGVSVNFNAQFADDVGE  65

Query  349  TFVFVSERSGSPRIYLQENRSASAGKPQQLLSPSGTLFHDRPVVRDGRLLYISAHEPPKE  528
               FVSER+GS  ++L    S  A     L    G+LFHDRP VR GRL ++S+HE P  
Sbjct  66   EVAFVSERTGSAGLFLCRPESERA---VPLPVVEGSLFHDRPAVRGGRLYFVSSHEKPAA  122

Query  529  VFKSWSALYSTHLGLKEITRLTPYGAVDFSPSVSQSGEFIAVASYGSRP  675
             F+SW+A+Y+T LG +E  R+TP G  D SP+VS SGE +AVASYG RP
Sbjct  123  WFRSWAAVYATELGSEETVRVTPQGVADMSPAVSTSGELLAVASYGERP  171



>gb|KFK30736.1| hypothetical protein AALP_AA6G020600 [Arabis alpina]
Length=648

 Score =   159 bits (403),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 84/168 (50%), Positives = 112/168 (67%), Gaps = 13/168 (8%)
 Frame = +1

Query  178  PHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEGDTFV  357
            P GTI+F+T+GR+HYGFD+FS+ + +S E+        RLTDGVS+NFN  F ++ +  V
Sbjct  4    PRGTIIFTTIGRTHYGFDVFSLNIATSVER--------RLTDGVSVNFNAQFTND-NNIV  54

Query  358  FVSERSGSPRIYLQENRSASAGKPQQLLSPSGTLFHDRPVVRDGRLLY-ISAHEPPKEVF  534
            FVSER+GS R+Y +        KP+QL     + FHDRP++     LY ISAHE P   F
Sbjct  55   FVSERAGSARLY-KTRPGTENSKPEQLPGAPDSFFHDRPILTHNNTLYFISAHEQPDRHF  113

Query  535  KSWSALYSTHLG--LKEITRLTPYGAVDFSPSVSQSGEFIAVASYGSR  672
            K+W+ALY+  L    +EITR+TP    DFSP+VS+SGE  A+ASYGSR
Sbjct  114  KNWTALYAVKLNDDEREITRVTPLNTADFSPAVSKSGELFAIASYGSR  161



>gb|KCW58168.1| hypothetical protein EUGRSUZ_H008851, partial [Eucalyptus grandis]
Length=251

 Score =   152 bits (384),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 87/175 (50%), Positives = 114/175 (65%), Gaps = 33/175 (19%)
 Frame = +1

Query  175  DPHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEG---  345
            +P GT++F+TVGR +YGFD+FS+ L S     RR   E RLTDG+SINFN  F   G   
Sbjct  3    EPTGTVLFTTVGRPYYGFDVFSLDLAS-----RR---ERRLTDGLSINFNAQFASAGDDE  54

Query  346  -----DTFVFVSERSGSPRIYLQENRSASAGKPQQLLSPSGTLFHDRPVVRDGRLLYISA  510
                 +  VFVSER+G PR+YL  +      +P+ L S  G+LFHDRP++R+G L +ISA
Sbjct  55   DDDDPEAVVFVSERTGCPRVYLARS---GFSQPEPLPSAPGSLFHDRPILRNGLLYFISA  111

Query  511  HEPPKEVFKSWSALYSTHLGLKEITRLTPYGAVDFSPSVSQSGEFIAVASYGSRP  675
            HE                +G +EI RLTPYG+VD+SP+VSQ+G+F+AVASYGSRP
Sbjct  112  HE-------------RRQVG-REIARLTPYGSVDYSPAVSQTGKFVAVASYGSRP  152



>ref|XP_006658881.1| PREDICTED: uncharacterized protein LOC102705738, partial [Oryza 
brachyantha]
Length=502

 Score =   157 bits (397),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 83/169 (49%), Positives = 111/169 (66%), Gaps = 4/169 (2%)
 Frame = +1

Query  172  MDPHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEG-D  348
            M+P GTIVF+TVG + +GFD+FS  +P    Q   P +E R TDGVS+NFN  F+D+  +
Sbjct  1    MEPTGTIVFATVGVTSFGFDVFSSPVPPPPLQSTAPGAERRHTDGVSVNFNAQFVDDAAE  60

Query  349  TFVFVSERSGSPRIYLQENRSASAGKPQQLLSPSGTLFHDRPVVRDGRLLYISAHEPPKE  528
               FVSER G+  +++       A   + L +  G+LFHDRP VR GR+ ++SAHE P  
Sbjct  61   EVAFVSERGGAAGLFVCRPGDERA---EPLPAVEGSLFHDRPTVRGGRMYFVSAHERPPV  117

Query  529  VFKSWSALYSTHLGLKEITRLTPYGAVDFSPSVSQSGEFIAVASYGSRP  675
             F+SW+A+Y T L  KE  R++P G VD SP+VS SGE +AVASYG RP
Sbjct  118  PFRSWAAVYVTDLARKETARVSPPGVVDMSPAVSASGELVAVASYGHRP  166



>ref|XP_007153254.1| hypothetical protein PHAVU_003G019700g [Phaseolus vulgaris]
 gb|ESW25248.1| hypothetical protein PHAVU_003G019700g [Phaseolus vulgaris]
Length=687

 Score =   158 bits (399),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 87/175 (50%), Positives = 116/175 (66%), Gaps = 15/175 (9%)
 Frame = +1

Query  169  IMDPHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRP---ASEHRLTDGVSINFNGHFLD  339
            ++ P GT+VF+TVGR  YGFD+FSV L     + R P   +++HRLTDG+SINFN  F+ 
Sbjct  32   MLPPPGTVVFNTVGRPQYGFDVFSVDL----HRHRPPPHASTDHRLTDGLSINFNAQFIS  87

Query  340  EGDTFVFVSERSGSPRIYLQENRSASAGKPQQLLSPSGTLFHDRPVVRDGRLLYISAHEP  519
              +  VFVSER+GSPR Y+    +    KPQ L      LF DRP++R+G L ++S H  
Sbjct  88   HQNDVVFVSERTGSPRFYI----TRPDNKPQPLSFLPNALFLDRPIIRNGNLYFVSTHHQ  143

Query  520  PKEVFKSWSALYSTHL----GLKEITRLTPYGAVDFSPSVSQSGEFIAVASYGSR  672
            P EVF SWSA+YS+ +        +TRLTP G VD+SP+VS +G+F+AVASY SR
Sbjct  144  PDEVFTSWSAVYSSAVEEGATAATVTRLTPPGEVDYSPAVSLTGKFLAVASYRSR  198



>ref|XP_008343202.1| PREDICTED: uncharacterized protein LOC103405949 [Malus domestica]
Length=661

 Score =   154 bits (390),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 90/171 (53%), Positives = 112/171 (65%), Gaps = 10/171 (6%)
 Frame = +1

Query  178  PHGTIVFSTVGRSHYGFDIFSVQLPSSFE-QDRRPASEHRLTDGVSINFNGHFLD---EG  345
            P GT+VFSTVGR HYGFDIF+  LP+           E RL+DG SINFN  F D   E 
Sbjct  4    PKGTVVFSTVGRPHYGFDIFA--LPTLLHPSSTNIGPERRLSDGRSINFNAQFADNSHEP  61

Query  346  DTFVFVSERSGSPRIYLQENRSASAGKPQQLLSPSGTLFHDRPVVRDGRLLYISAHEPPK  525
             + VF+SER+G P IYL          PQ   S  G+LFHDRP+ ++  L ++SAH+ P 
Sbjct  62   HSLVFISERTGFPAIYLTR---PGLPHPQLXHSEPGSLFHDRPIJKNHTLYFVSAHQDPS  118

Query  526  EVFKSWSALYSTHLGLKEI-TRLTPYGAVDFSPSVSQSGEFIAVASYGSRP  675
              FKSWSALYS+ L   +I TRLTP  +VD+SP++S SG+F+AVASYGSRP
Sbjct  119  RYFKSWSALYSSTLLHDKITTRLTPSDSVDYSPALSLSGKFVAVASYGSRP  169



>ref|XP_008653395.1| PREDICTED: uncharacterized protein LOC103633477 [Zea mays]
 tpg|DAA63832.1| TPA: putative WD40-like beta propeller repeat family protein 
[Zea mays]
Length=667

 Score =   154 bits (390),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 82/180 (46%), Positives = 115/180 (64%), Gaps = 16/180 (9%)
 Frame = +1

Query  172  MDPHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASE----HRLTDGVSINFNGHFLD  339
            M+P GTIVF++VG +++GFD+FS  +P+    +   ++E     R TDG+S+NFN  F D
Sbjct  1    MEPAGTIVFASVGVTNFGFDVFSATVPAPTSAEAGVSAEDLDERRHTDGISVNFNAQFAD  60

Query  340  E-GDTFVFVSERSGSPRIYLQENRSASAGKPQQLLSPSGTLFHDRPVVRDGRLLYISAHE  516
            + GD   FVSER+G+  ++L    S    +P  L +  G+LFHDRP VR GR+ ++SAHE
Sbjct  61   DAGDAVAFVSERTGAASLFL----SRPGSEPDPLPAAEGSLFHDRPTVRGGRVYFVSAHE  116

Query  517  PPKEVFKSWSALYSTHLGLK-------EITRLTPYGAVDFSPSVSQSGEFIAVASYGSRP  675
             P   F+SW+A+Y+  LG         +  RLTP G VD SP+VS SG+ +AVASYG RP
Sbjct  117  KPDRPFRSWAAVYAAELGAGRERNPEPQPQRLTPRGVVDMSPAVSASGDLLAVASYGDRP  176



>ref|XP_004958463.1| PREDICTED: uncharacterized protein LOC101757241 [Setaria italica]
Length=666

 Score =   152 bits (383),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 82/174 (47%), Positives = 110/174 (63%), Gaps = 9/174 (5%)
 Frame = +1

Query  172  MDPHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPAS---EHRLTDGVSINFNGHFLDE  342
            M+P GTIVF++ G S +GFD+FSV +P +   D   A    E R TDGVS+NFN  F D+
Sbjct  1    MEPTGTIVFASFGVSRFGFDVFSVAVPPAAPDDVPDAKMLDERRHTDGVSVNFNAQFADD  60

Query  343  G-DTFVFVSERSGSPRIYLQENRSASAGKPQQLLSPSGTLFHDRPVVRDGRLLYISAHEP  519
              D   FVSER+G+  ++L    S    +P+ L +  G+LFHDRP VR GR+ ++SAHE 
Sbjct  61   ASDAVAFVSERTGAASLFLSRPGSE---RPEPLPAAEGSLFHDRPTVRGGRVYFVSAHEK  117

Query  520  PKEVFKSWSALY--STHLGLKEITRLTPYGAVDFSPSVSQSGEFIAVASYGSRP  675
            P   F+SW+A++          + R+TP G VD SP+VS SGE +AVASYG RP
Sbjct  118  PDRPFRSWAAVHAAGLGGEGGAVERVTPRGVVDMSPAVSASGELVAVASYGDRP  171



>ref|XP_003562594.1| PREDICTED: uncharacterized protein LOC100822199 [Brachypodium 
distachyon]
Length=674

 Score =   150 bits (378),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 84/172 (49%), Positives = 109/172 (63%), Gaps = 10/172 (6%)
 Frame = +1

Query  178  PHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRL-TDGVSINFNGHFLD----E  342
            P GTI F++VG + +GFD+FSV +P S E         R  TDGVS+NFN  F D    E
Sbjct  9    PTGTIAFASVGVTSFGFDVFSVAVPQSPETTTAEELAERCHTDGVSVNFNAQFTDDEAGE  68

Query  343  GDTFVFVSERSGSPRIYLQENRSASAGKPQQLLSPSGTLFHDRPVVRDGRLLYISAHE-P  519
             +   FVSER+GS  ++L        G+   L +   +LFHDRP +R GRL ++SAHE P
Sbjct  69   EEEVAFVSERTGSAALFL----CRPGGRATPLPAVEESLFHDRPTLRRGRLYFVSAHEKP  124

Query  520  PKEVFKSWSALYSTHLGLKEITRLTPYGAVDFSPSVSQSGEFIAVASYGSRP  675
            P   F+SW+ALY+T L  +E +R+TP G VD SP+VS SGE +AVASYG RP
Sbjct  125  PGAPFRSWAALYATDLESQETSRVTPEGVVDMSPAVSPSGELVAVASYGDRP  176



>dbj|BAJ88545.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=706

 Score =   128 bits (322),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 77/179 (43%), Positives = 103/179 (58%), Gaps = 18/179 (10%)
 Frame = +1

Query  184  GTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEGDTFVFV  363
            GTIVF+T+GRS Y FD++++ L  S      PA+E RLTDG S+N+NG+F    D  +FV
Sbjct  31   GTIVFTTLGRSRYAFDVYALPLAPSLSIPASPAAELRLTDGASVNYNGNFAPSSDALLFV  90

Query  364  SERSGSPRIYLQENRSASAGKPQQLLSPSG----------------TLFHDRPVV-RDG-  489
            SER+GS  IYL     +S+ + + L    G                    DRP + RDG 
Sbjct  91   SERNGSLNIYLSPAPPSSSSRREALQLEDGDSSPAAPPMPLLPWDPVALRDRPALTRDGS  150

Query  490  RLLYISAHEPPKEVFKSWSALYSTHLGLKEITRLTPYGAVDFSPSVSQSGEFIAVASYG  666
            RL+Y+S   P     +SW+A+Y+THL     TRLTP G  DFSP+VS SG++ A AS G
Sbjct  151  RLVYVSTAVPAAAPRRSWAAVYATHLPSGRATRLTPPGVADFSPAVSPSGDWAAAASPG  209



>ref|XP_004981111.1| PREDICTED: uncharacterized protein LOC101776730 [Setaria italica]
Length=691

 Score =   121 bits (304),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 77/178 (43%), Positives = 101/178 (57%), Gaps = 17/178 (10%)
 Frame = +1

Query  184  GTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEGDTFVFV  363
            GTIVF+T+GRS Y FDIF++ L         PA+E RLTDG S+N+NG+F    D+ +FV
Sbjct  30   GTIVFTTLGRSRYAFDIFALPLTPLSSSSSSPAAEVRLTDGASVNYNGNFAPSSDSLLFV  89

Query  364  SERSGSPRIY---------------LQENRSASAGKPQQLLSPSGTLFHDRP-VVRDG-R  492
            SER+G+  +Y                 E   A+A  P  LL        DRP +  DG  
Sbjct  90   SERNGTLNLYAFPVPSASGSGARREALEVPEAAAALPSPLLPWDPIALKDRPSLTPDGAH  149

Query  493  LLYISAHEPPKEVFKSWSALYSTHLGLKEITRLTPYGAVDFSPSVSQSGEFIAVASYG  666
            L+Y+S  EP +   +SW+A+Y+THL      RLTP G  DFSP+VS SGE+ A AS G
Sbjct  150  LVYVSTAEPAEAPRRSWAAVYNTHLPSGATRRLTPRGVADFSPAVSPSGEWTAAASPG  207



>ref|NP_001051846.1| Os03g0840200 [Oryza sativa Japonica Group]
 gb|AAT77013.1| putative F8K7.10 protein [Oryza sativa Japonica Group]
 gb|ABF99802.1| WD40-like Beta Propeller Repeat family protein, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF13760.1| Os03g0840200 [Oryza sativa Japonica Group]
 dbj|BAG90604.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG94589.1| unnamed protein product [Oryza sativa Japonica Group]
Length=688

 Score =   120 bits (301),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 81/178 (46%), Positives = 105/178 (59%), Gaps = 17/178 (10%)
 Frame = +1

Query  184  GTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEGDTFVFV  363
            GTIVF+T+GRS Y FDIFS+ L  S   +   A+E RLTDGVS+N+NG+F    D+ +FV
Sbjct  28   GTIVFTTLGRSRYEFDIFSLPLAPS-PHNPAAAAELRLTDGVSVNYNGNFAPASDSILFV  86

Query  364  SERSGSPRIYLQ----------ENRSASAGKPQQLLSP----SGTLFHDRP-VVRDG-RL  495
            SER+GS  +YL           E+ S+S+      +SP          DRP +  DG RL
Sbjct  87   SERNGSLNLYLSPVPSSRREALESASSSSSSAAATISPLLPWEPIALKDRPSLTPDGSRL  146

Query  496  LYISAHEPPKEVFKSWSALYSTHLGLKEITRLTPYGAVDFSPSVSQSGEFIAVASYGS  669
            +Y+S   P  E   SW+A+YST L      RLTP G  DFSP+VS SGE+ A AS G+
Sbjct  147  VYVSTAVPAAEPRSSWAAVYSTELSTGRTRRLTPLGVADFSPAVSPSGEWTAAASPGA  204



>ref|XP_002890451.1| hypothetical protein ARALYDRAFT_472405 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66710.1| hypothetical protein ARALYDRAFT_472405 [Arabidopsis lyrata subsp. 
lyrata]
Length=703

 Score =   120 bits (301),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 75/189 (40%), Positives = 106/189 (56%), Gaps = 31/189 (16%)
 Frame = +1

Query  187  TIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEGDTFV---  357
            TI+F+T+GR  + FDIF+  LP+S  +   PA EHRLTD  S+NFNGHF       +   
Sbjct  33   TILFTTIGRPTFEFDIFT--LPTS-HRPPSPADEHRLTDAKSVNFNGHFASPSPALISLL  89

Query  358  --------------FVSERSGSPRIY---LQENRSAS-------AGKPQQLLSPSGTLFH  465
                          +V+ER G+P +Y   + +++S S       +G+ QQ      ++  
Sbjct  90   PNKSQIQPQDLHLIYVTERDGTPSLYYDVVHDDKSGSRVQVPLFSGEEQQSGMNVNSM-K  148

Query  466  DRPVVRDGRLLYISAHEPPKEVFKSWSALYSTHLGLKEITRLTPYGAVDFSPSVSQSGEF  645
            D PV+    L+Y+S HE P +   SW+A+YST L  K   RLTP G  DFSP+VS SG++
Sbjct  149  DTPVLTSDYLVYVSTHENPGKPMASWAAVYSTELQTKSTRRLTPPGIADFSPAVSPSGKW  208

Query  646  IAVASYGSR  672
             AVASYG +
Sbjct  209  TAVASYGEK  217



>ref|XP_010510815.1| PREDICTED: uncharacterized protein LOC104787018 [Camelina sativa]
Length=700

 Score =   120 bits (300),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 74/187 (40%), Positives = 104/187 (56%), Gaps = 28/187 (15%)
 Frame = +1

Query  187  TIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEGDTFV---  357
            TI+F+T+GR  + FDIF+  LP++ ++   PA EHRLTDG SINFNGHF       +   
Sbjct  31   TILFTTIGRPTFEFDIFT--LPTN-KRPPSPADEHRLTDGTSINFNGHFASPSPALISLL  87

Query  358  -----------------FVSERSGSPRIYLQENRSASAGKPQQLLS--PSG---TLFHDR  471
                             +V+ER G+P +      ++ +    QL S   SG       D+
Sbjct  88   PNNSRIQLQDSSLVHLIYVTERDGTPSLNYDVVSNSGSRVRAQLFSGDKSGMAVNWMQDK  147

Query  472  PVVRDGRLLYISAHEPPKEVFKSWSALYSTHLGLKEITRLTPYGAVDFSPSVSQSGEFIA  651
            PV+ +  L+Y+S HE P +   SW+A+YST L  K   RLTP G  DFSP+VS SG++ A
Sbjct  148  PVLTNEYLVYVSTHEDPGKPMASWAAVYSTELRSKSTRRLTPPGIADFSPAVSPSGKWTA  207

Query  652  VASYGSR  672
            VAS+G +
Sbjct  208  VASFGEK  214



>gb|EAY92514.1| hypothetical protein OsI_14253 [Oryza sativa Indica Group]
Length=682

 Score =   119 bits (298),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 82/175 (47%), Positives = 102/175 (58%), Gaps = 16/175 (9%)
 Frame = +1

Query  184  GTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEH-RLTDGVSINFNGHFLDEGDTFVF  360
            GTIVF+T+GRS Y FDIFS+ L  S      PA+E  RLTDGVS+N+NG+F    D+ +F
Sbjct  28   GTIVFTTLGRSRYEFDIFSLPLAPS---PHNPAAEELRLTDGVSVNYNGNFAPASDSILF  84

Query  361  VSERSGSPRIYLQENRSA----------SAGKPQQLLSPSGTLFHDRP-VVRDG-RLLYI  504
            VSER+GS  +YL    S+          SA     LL        DRP +  DG RL+Y+
Sbjct  85   VSERNGSLNLYLSPVPSSRREALESASSSAATLSPLLPWEPIALKDRPSLTPDGSRLVYV  144

Query  505  SAHEPPKEVFKSWSALYSTHLGLKEITRLTPYGAVDFSPSVSQSGEFIAVASYGS  669
            S   P  E   SW+A+YST L      RLTP G  DFSP+VS SGE+ A AS G+
Sbjct  145  STAVPAAEPRSSWAAVYSTELSTGRTRRLTPLGVADFSPAVSPSGEWTAAASPGA  199



>ref|XP_010466457.1| PREDICTED: uncharacterized protein LOC104746633 isoform X2 [Camelina 
sativa]
Length=701

 Score =   119 bits (298),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 75/190 (39%), Positives = 103/190 (54%), Gaps = 34/190 (18%)
 Frame = +1

Query  187  TIVFSTVGRSHYGFDIFSV---QLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEGDTFV  357
            TI+F+T+GR  + FDIF++   +LP S      PA EHRLTDG SINFNGHF       +
Sbjct  32   TILFTTIGRPTFEFDIFTLPTNKLPPS------PADEHRLTDGTSINFNGHFASPSPALI  85

Query  358  --------------------FVSERSGSPRIYLQENRSASAGKPQQLLS--PSGTL---F  462
                                +V+ER G+P +      ++ +    QL S   SG      
Sbjct  86   SLLPNNSRIQLQDSSLVHLIYVTERDGTPSLNYDVVSNSGSRVRGQLFSGDKSGMAVNSM  145

Query  463  HDRPVVRDGRLLYISAHEPPKEVFKSWSALYSTHLGLKEITRLTPYGAVDFSPSVSQSGE  642
             D+PV+ +  L+Y+S HE P +   SW+A+YST L  K   RLTP G  DFSP+VS SG+
Sbjct  146  QDKPVLTNEYLVYVSTHEDPGKPMASWAAVYSTELRSKSTRRLTPPGIADFSPAVSPSGK  205

Query  643  FIAVASYGSR  672
            + AVAS+G +
Sbjct  206  WTAVASFGEK  215



>ref|NP_564146.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAD41420.1|AC007727_9 F8K7.9 [Arabidopsis thaliana]
 gb|AAK59584.1| unknown protein [Arabidopsis thaliana]
 gb|AAN41381.1| unknown protein [Arabidopsis thaliana]
 gb|AEE30137.1| uncharacterized protein AT1G21670 [Arabidopsis thaliana]
Length=703

 Score =   119 bits (297),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 74/188 (39%), Positives = 103/188 (55%), Gaps = 29/188 (15%)
 Frame = +1

Query  187  TIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEGDTFV---  357
            TI+F+T+GR  + FDIF+  LP+S  +   PA EHRLTDG SINFNG+F       +   
Sbjct  33   TILFTTIGRPTFEFDIFT--LPTS-HRPPSPADEHRLTDGKSINFNGYFASPSTALISLL  89

Query  358  --------------FVSERSGSPRIYLQENRSASAGKPQQLLSPSG---------TLFHD  468
                          +V+ER+G+P +      S + G   Q+   SG             D
Sbjct  90   PKRTQIQPQDVHLIYVTERAGTPSLNYDVVHSDNVGSRIQVPLFSGEEQQSGMNVNSMKD  149

Query  469  RPVVRDGRLLYISAHEPPKEVFKSWSALYSTHLGLKEITRLTPYGAVDFSPSVSQSGEFI  648
             PV+ +G L+++S HE P +   SW+A+YST L  K   RLTP G  DFSP+VS SG++ 
Sbjct  150  TPVLTNGYLVHVSTHENPGKPMASWAAVYSTELRTKSTRRLTPLGIADFSPAVSPSGKWT  209

Query  649  AVASYGSR  672
            AVAS+G +
Sbjct  210  AVASFGEK  217



>ref|XP_010466456.1| PREDICTED: uncharacterized protein LOC104746633 isoform X1 [Camelina 
sativa]
Length=701

 Score =   119 bits (297),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 75/190 (39%), Positives = 103/190 (54%), Gaps = 34/190 (18%)
 Frame = +1

Query  187  TIVFSTVGRSHYGFDIFSV---QLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEGDTFV  357
            TI+F+T+GR  + FDIF++   +LP S      PA EHRLTDG SINFNGHF       +
Sbjct  32   TILFTTIGRPTFEFDIFTLPTNKLPPS------PADEHRLTDGTSINFNGHFASPSPALI  85

Query  358  --------------------FVSERSGSPRIYLQENRSASAGKPQQLLS--PSGTL---F  462
                                +V+ER G+P +      ++ +    QL S   SG      
Sbjct  86   SLLPNNSRIQLQDSSLVHLIYVTERDGTPSLNYDVVSNSGSRVRGQLFSGDKSGMAVNSM  145

Query  463  HDRPVVRDGRLLYISAHEPPKEVFKSWSALYSTHLGLKEITRLTPYGAVDFSPSVSQSGE  642
             D+PV+ +  L+Y+S HE P +   SW+A+YST L  K   RLTP G  DFSP+VS SG+
Sbjct  146  QDKPVLTNEYLVYVSTHEDPGKPMASWAAVYSTELRSKSTRRLTPPGIADFSPAVSPSGK  205

Query  643  FIAVASYGSR  672
            + AVAS+G +
Sbjct  206  WTAVASFGEK  215



>gb|EAZ29242.1| hypothetical protein OsJ_13305 [Oryza sativa Japonica Group]
Length=688

 Score =   118 bits (296),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 80/177 (45%), Positives = 104/177 (59%), Gaps = 17/177 (10%)
 Frame = +1

Query  187  TIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEGDTFVFVS  366
            TIVF+T+GRS Y FDIFS+ L  S   +   A+E RLTDGVS+N+NG+F    D+ +FVS
Sbjct  29   TIVFTTLGRSRYEFDIFSLPLAPS-PHNPAAAAELRLTDGVSVNYNGNFAPASDSILFVS  87

Query  367  ERSGSPRIYLQ----------ENRSASAGKPQQLLSP----SGTLFHDRP-VVRDG-RLL  498
            ER+GS  +YL           E+ S+S+      +SP          DRP +  DG RL+
Sbjct  88   ERNGSLNLYLSPVPSSRREALESASSSSSSAAATISPLLPWEPIALKDRPSLTPDGSRLV  147

Query  499  YISAHEPPKEVFKSWSALYSTHLGLKEITRLTPYGAVDFSPSVSQSGEFIAVASYGS  669
            Y+S   P  E   SW+A+YST L      RLTP G  DFSP+VS SGE+ A AS G+
Sbjct  148  YVSTAVPAAEPRSSWAAVYSTELSTGRTRRLTPLGVADFSPAVSPSGEWTAAASPGA  204



>gb|KJB29176.1| hypothetical protein B456_005G088400 [Gossypium raimondii]
Length=713

 Score =   118 bits (295),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 82/202 (41%), Positives = 107/202 (53%), Gaps = 45/202 (22%)
 Frame = +1

Query  184  GTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEGDT----  351
            GTIVF+T+GRS+Y +DI++  LP+S      P++E R+TDG S+NFNGHF     +    
Sbjct  32   GTIVFTTLGRSNYAWDIYT--LPTS--DPPSPSNELRVTDGESVNFNGHFPSTSPSSVLS  87

Query  352  --------------------FVFVSERSGSPRIYLQ--------ENRSASAGK-PQQLLS  444
                                 V+V+ER+G P IY            RS SA + P +L +
Sbjct  88   LLHNRSLIRTPGPQAPPPLQLVYVTERNGMPNIYYDALYYGAPGSTRSRSALEVPVRLQA  147

Query  445  PSGTL--------FHDRPVVRDGRLLYISAHEPPKEVFKSWSALYSTHLGLKEITRLTPY  600
            P   L          DRP +    L+Y+S HE P E   SW+A+YSTHLG     RLTP 
Sbjct  148  PLLGLEESKNRVSMKDRPSLSGENLIYVSTHEDPGEPRTSWAAVYSTHLGTGLTRRLTPS  207

Query  601  GAVDFSPSVSQSGEFIAVASYG  666
            G  DFSP+VS SG + AVASYG
Sbjct  208  GIADFSPAVSPSGVWTAVASYG  229



>ref|XP_009411896.1| PREDICTED: uncharacterized protein LOC103993528 [Musa acuminata 
subsp. malaccensis]
Length=714

 Score =   117 bits (292),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 82/204 (40%), Positives = 110/204 (54%), Gaps = 43/204 (21%)
 Frame = +1

Query  184  GTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPAS-----EHRLTDGVSINFNGHF-----  333
            GTI+F+T+GRS Y FDIFS+ + SS  + RRP +     EHRLTDGVS+NFNG+F     
Sbjct  28   GTIIFTTLGRSRYNFDIFSLPIASSSSR-RRPIAVDRHGEHRLTDGVSVNFNGYFPSLAS  86

Query  334  -----------LDEGDTFVFVSERSGSPRIYLQENRSASA-----------GKPQQLLSP  447
                           D+ ++VSER+GS  IYL    ++S+            + Q  L P
Sbjct  87   SSFLSSLLPSSSSSVDSLLYVSERNGSSAIYLDLFLASSSPSTRRDALELQTRLQFPLVP  146

Query  448  S----------GTLFHDRPVVRDGRLLYISAHEPPKEVFKSWSALYSTHLGLKEITRLTP  597
            +               DRP +    L+Y+S H+P     +SW+A+YSTHL      RLTP
Sbjct  147  APDDAAAESDPNVSMKDRPSLSGDLLVYVSTHQPNPSPRQSWAAVYSTHLPTGRTRRLTP  206

Query  598  YGAVDFSPSVSQSGEFIAVASYGS  669
             G  DFSP+VS SG + AVASYG+
Sbjct  207  SGIADFSPAVSPSGAWTAVASYGA  230



>ref|XP_003562684.2| PREDICTED: uncharacterized protein LOC100824160 [Brachypodium 
distachyon]
Length=745

 Score =   117 bits (292),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 78/183 (43%), Positives = 100/183 (55%), Gaps = 23/183 (13%)
 Frame = +1

Query  187  TIVFSTVGRSHYGFDIFSVQLPSSFE-----QDRRPASEHRLTDGVSINFNGHFLDE--G  345
            TIVF+T+GRS Y FDIF+V L           D+  A+E RLTDG S+N+NG+F      
Sbjct  77   TIVFTTLGRSRYAFDIFAVPLNRGDHLALSPSDKSAAAEVRLTDGASVNYNGNFAASPSS  136

Query  346  DTFVFVSERSGSPRIYL--------------QENRSASAGKPQQLLSPSGTLFHDRP-VV  480
            D  +FVSER+GS  +YL              +E    S+ +   LL        DRP + 
Sbjct  137  DALLFVSERNGSLNLYLSPIPSSPTSRREALEEKEEDSSAQISPLLPWDPVALKDRPSLT  196

Query  481  RDG-RLLYISAHEPPKEVFKSWSALYSTHLGLKEITRLTPYGAVDFSPSVSQSGEFIAVA  657
             DG RL+Y+S   P     +SW+A+YST L      RLTP G  DFSP+VS SGE+ AVA
Sbjct  197  PDGTRLVYVSTAVPAGSPRRSWAAVYSTELHSGRTRRLTPEGVADFSPAVSPSGEWTAVA  256

Query  658  SYG  666
            S G
Sbjct  257  SPG  259



>ref|XP_010488216.1| PREDICTED: uncharacterized protein LOC104766097 [Camelina sativa]
Length=701

 Score =   116 bits (291),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 74/191 (39%), Positives = 101/191 (53%), Gaps = 36/191 (19%)
 Frame = +1

Query  187  TIVFSTVGRSHYGFDIFSV---QLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEGDTFV  357
            TI+F+T+GR  + FDIF++   +LP S      PA EHRLTDG SINFNGHF       +
Sbjct  32   TILFTTIGRPTFEFDIFTLPTNKLPPS------PADEHRLTDGTSINFNGHFASPSPALI  85

Query  358  --------------------FVSERSGSPRIYLQENRSASAGKPQQLLSPSG------TL  459
                                +V+ER G+P +      S S  + +  L P G        
Sbjct  86   SLLPNNSRIQLQDSSLVHLIYVTERDGTPSLNYNV-VSNSGSRVRAQLFPGGESGMAVNS  144

Query  460  FHDRPVVRDGRLLYISAHEPPKEVFKSWSALYSTHLGLKEITRLTPYGAVDFSPSVSQSG  639
              D+PV+ +  L+Y+S H  P +   SW+A+YST L  K   RLTP G  DFSP+VS SG
Sbjct  145  MKDKPVLTNEYLVYVSTHVDPGKPMASWAAVYSTELRSKSTRRLTPPGIADFSPAVSPSG  204

Query  640  EFIAVASYGSR  672
            ++ AVAS+G +
Sbjct  205  KWTAVASFGEK  215



>ref|XP_010477408.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC104756504 
[Camelina sativa]
Length=723

 Score =   116 bits (290),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 81/217 (37%), Positives = 114/217 (53%), Gaps = 35/217 (16%)
 Frame = +1

Query  109  FFPLCTQILSSLRIPKPPIMIMDPHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASE  288
            FF +    LSS    KP         TI+FST GR  + FDIF+  LP++ ++   PA E
Sbjct  10   FFLISLFCLSSASSNKP---TTSNGSTILFSTTGRPTFEFDIFT--LPTN-KRPPSPADE  63

Query  289  HRLTDGVSINFNGHF----------------LDEGDT----FVFVSERSGSPRIYLQENR  408
            HRLTDG S+NFNGHF                +   D+     ++V+ER G+P +      
Sbjct  64   HRLTDGNSVNFNGHFASPSPALISLLPNSSRIQPHDSSLVHLIYVTERDGTPSLNYDVVH  123

Query  409  SASAGKPQQLLSPSGTLFH---------DRPVVRDGRLLYISAHEPPKEVFKSWSALYST  561
            + ++G    +   SG   H         D PV+ +  L+Y+S HE P++   SW+A+YST
Sbjct  124  NDNSGSRVHVPLFSGDEQHSGMAVNSMKDTPVLTNKHLVYVSTHENPRKPLASWAAVYST  183

Query  562  HLGLKEITRLTPYGAVDFSPSVSQSGEFIAVASYGSR  672
             L  K   RLTP G  DFSP+VS SG++ AVAS+G +
Sbjct  184  KLQSKSTRRLTPPGIADFSPAVSPSGKWTAVASFGEK  220



>ref|XP_010911317.1| PREDICTED: uncharacterized protein LOC105037336 [Elaeis guineensis]
Length=698

 Score =   115 bits (289),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 79/193 (41%), Positives = 104/193 (54%), Gaps = 33/193 (17%)
 Frame = +1

Query  187  TIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPA--------SEHRLTDGVSINFNGHFLDE  342
            TI+F+T+GRS YGFDIFSV  P +F               +E +LTDGVS+N+NG F   
Sbjct  27   TILFTTLGRSRYGFDIFSV--PFTFSSSSSCLHSISIEHHNELQLTDGVSVNYNGFFPSN  84

Query  343  GDTFVFVSERSGSPRIYLQEN--------RSASAGKPQQLLSP------SGTLFH-----  465
              + +++SER+G   +YL           R  +   P +L SP      S + F      
Sbjct  85   SSSLLYISERNGYCNVYLDHLSLPQSSPLRREALQLPSRLQSPLLPTPSSSSAFRSPPPI  144

Query  466  ---DRPVVRDG-RLLYISAHEPPKEVFKSWSALYSTHLGLKEITRLTPYGAVDFSPSVSQ  633
               DRP +  G RL+Y+S HEP     +SW A+YSTHL      RLTP G  DFSP+VS 
Sbjct  145  SMKDRPSLISGDRLIYVSTHEPSGSPRQSWVAVYSTHLPTGRTRRLTPSGVADFSPAVSP  204

Query  634  SGEFIAVASYGSR  672
            SG + AVAS G+R
Sbjct  205  SGRWTAVASSGAR  217



>ref|XP_007137456.1| hypothetical protein PHAVU_009G128300g [Phaseolus vulgaris]
 gb|ESW09450.1| hypothetical protein PHAVU_009G128300g [Phaseolus vulgaris]
Length=683

 Score =   115 bits (288),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 77/190 (41%), Positives = 101/190 (53%), Gaps = 31/190 (16%)
 Frame = +1

Query  184  GTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEGDT----  351
             TI+F+T+GR+ Y FDI+ + +    +Q   P  E +LTDG S+NFNGHF+         
Sbjct  28   ATIIFTTLGRAFYAFDIYYLPI---HQQPVNPDQELQLTDGHSVNFNGHFISNASAIQLP  84

Query  352  -------FVFVSERSGSPRIYLQE---------NRSASAGKPQQLLSP------SGTLFH  465
                    V+V+ER+GSP IY              S +A + Q  L P      S     
Sbjct  85   THSPPLQLVYVTERNGSPTIYYDAVYTSTTRSTKESVTAERIQIPLLPNKPTDTSQLSIK  144

Query  466  DRP-VVRDGR-LLYISAHEPPKEVFKSWSALYSTHLGLKEITRLTPYGAVDFSPSVSQSG  639
            D+P V  DG  L+Y+S HE P     SW+A+YSTHL      RLTPY   DFSP++S SG
Sbjct  145  DKPSVTPDGEFLIYVSTHEDPGVPRASWAAVYSTHLQSGLTQRLTPYAVADFSPALSPSG  204

Query  640  EFIAVASYGS  669
             + AVASYGS
Sbjct  205  IWTAVASYGS  214



>ref|XP_010270269.1| PREDICTED: uncharacterized protein LOC104606655 [Nelumbo nucifera]
Length=728

 Score =   115 bits (288),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 78/197 (40%), Positives = 105/197 (53%), Gaps = 38/197 (19%)
 Frame = +1

Query  187  TIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEGDT-----  351
            +IVF+T+GRS Y FDIF+  LP+S      P  E ++TDG S+NFNGHF     +     
Sbjct  30   SIVFTTLGRSRYAFDIFT--LPTS-SHTPSPVDELQITDGESVNFNGHFPSPSSSSILSN  86

Query  352  ----------------FVFVSERSGSPRIYLQEN------RSASAGKPQQ----LLSP--  447
                             V+V+ER GS  IYL         R ++   P +    LL+P  
Sbjct  87   LLSNRTLTLDPHPLQFIVYVTERHGSSNIYLDAYYHHSPIRRSALETPCRIQVPLLNPEQ  146

Query  448  --SGTLFHDRPVVRDGRLLYISAHEPPKEVFKSWSALYSTHLGLKEITRLTPYGAVDFSP  621
               G    DRP +    L+Y+S HE  K   +SW+A+YSTH+G  E  RLTPYG  DFSP
Sbjct  147  SNGGISLKDRPSLSGYYLIYVSTHEDSKVPRRSWAAVYSTHVGTGETRRLTPYGVADFSP  206

Query  622  SVSQSGEFIAVASYGSR  672
            ++S SG ++AVAS G +
Sbjct  207  AISPSGIWMAVASSGEK  223



>ref|XP_005646452.1| tricorn protease N-terminal domain-containing protein [Coccomyxa 
subellipsoidea C-169]
 gb|EIE21908.1| tricorn protease N-terminal domain-containing protein [Coccomyxa 
subellipsoidea C-169]
Length=732

 Score =   114 bits (286),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 64/182 (35%), Positives = 107/182 (59%), Gaps = 7/182 (4%)
 Frame = +1

Query  130  ILSSLRIPKPPIMIMDPHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGV  309
            I S+  +     +      T+V++TVGR+ Y FDI++  + +  + +   A+E +LTDGV
Sbjct  57   IFSAESLKDTTTLDQQARTTVVYATVGRAQYAFDIYTKLMGNERDPELANAAETQLTDGV  116

Query  310  SINFNGHFLDEGDTFVFVSERSGSPRIYLQENRSASAGKPQQL--LSPSGTLFHDRPVVR  483
            S+N+NG F  +G+  +FVSER G+  +Y       + G    L  L+ S TL  DRP+  
Sbjct  117  SVNYNGAFAGDGEALLFVSERDGNMELYKGHAEGVTGGHRPSLKRLTYSPTL-QDRPIYS  175

Query  484  -DGRLLYISAHEPPKEVFKSWSALYSTHLGLK--EITRLTPYGAVDFSPSVSQSGEFIAV  654
             DGR++++S H+P K+  + W+A+YS   G+K   + RLTP    D+SP++S   +++A 
Sbjct  176  PDGRIIFVSTHQPAKKPRQGWTAIYSVS-GVKGHTVRRLTPENETDYSPAISADEQWLAA  234

Query  655  AS  660
            A+
Sbjct  235  AT  236



>gb|KCW71232.1| hypothetical protein EUGRSUZ_F04330 [Eucalyptus grandis]
Length=640

 Score =   114 bits (284),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 76/198 (38%), Positives = 102/198 (52%), Gaps = 40/198 (20%)
 Frame = +1

Query  190  IVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEGDT------  351
            I+F+T+GRS Y FDIF+  LP+  ++  +PA E +LTDG S+NFNGHF            
Sbjct  49   IIFATLGRSDYAFDIFA--LPTRPDRSPKPADEVKLTDGNSVNFNGHFPSLSPAASSSLL  106

Query  352  ------------FVFVSERSGSPRIYLQ--------------ENRSASAGKPQQLLSP--  447
                         ++V+ER+GS  IY                  RSA    P ++  P  
Sbjct  107  ALSPDQTPPSLHVIYVTERNGSSSIYYDAVYDGDGGGAEGSPRRRSALEAAPPRVQVPLV  166

Query  448  -SGTL---FHDRPVVRDGRLLYISAHEPPKEVFKSWSALYSTHLGLKEITRLTPYGAVDF  615
             SGT      DRP +    L+Y+S HE       SW+A+YST +      RLTPYGA D+
Sbjct  167  GSGTSVISMKDRPSLSGENLIYVSTHEDTGVPRTSWAAVYSTDVRTGSTRRLTPYGAADY  226

Query  616  SPSVSQSGEFIAVASYGS  669
            SP+VS SG + AVASYG+
Sbjct  227  SPAVSPSGAWTAVASYGA  244



>ref|XP_010063935.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC104450916 
[Eucalyptus grandis]
Length=729

 Score =   114 bits (284),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 76/198 (38%), Positives = 102/198 (52%), Gaps = 40/198 (20%)
 Frame = +1

Query  190  IVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEGDT------  351
            I+F+T+GRS Y FDIF+  LP+  ++  +PA E +LTDG S+NFNGHF            
Sbjct  49   IIFATLGRSDYAFDIFA--LPTRPDRSPKPADEVKLTDGNSVNFNGHFPSLSPAASSSLL  106

Query  352  ------------FVFVSERSGSPRIYLQ--------------ENRSASAGKPQQLLSP--  447
                         ++V+ER+GS  IY                  RSA    P ++  P  
Sbjct  107  ALSPDQTPPSLHVIYVTERNGSSSIYYDAVYDGDGGGAEGSPRRRSALEAAPPRVQVPLV  166

Query  448  -SGTL---FHDRPVVRDGRLLYISAHEPPKEVFKSWSALYSTHLGLKEITRLTPYGAVDF  615
             SGT      DRP +    L+Y+S HE       SW+A+YST +      RLTPYGA D+
Sbjct  167  GSGTSVISMKDRPSLSGENLIYVSTHEDTGVPRTSWAAVYSTDVRTGSTRRLTPYGAADY  226

Query  616  SPSVSQSGEFIAVASYGS  669
            SP+VS SG + AVASYG+
Sbjct  227  SPAVSPSGAWTAVASYGA  244



>emb|CDY04661.1| BnaC05g16990D [Brassica napus]
Length=697

 Score =   112 bits (279),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 75/192 (39%), Positives = 99/192 (52%), Gaps = 36/192 (19%)
 Frame = +1

Query  187  TIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPAS---EHRLTDGVSINFNGHFLDEGDTFV  357
            TI+F+T+G S + FDIF++         RRP S   EHRLTDG SINFNGH        +
Sbjct  32   TILFTTMGSSTFEFDIFTLH------TSRRPPSPSDEHRLTDGKSINFNGHLASPSPALI  85

Query  358  --------------------FVSERSGSPRIYLQENRSASAGKPQQ--LLSP-----SGT  456
                                +V+ER G+P ++     S + G   Q  LLS      S  
Sbjct  86   SLLPNTSGVQPQDKTLLHLIYVTERDGAPTLHYDVVHSDNKGTNVQVPLLSEQQSGMSVN  145

Query  457  LFHDRPVVRDGRLLYISAHEPPKEVFKSWSALYSTHLGLKEITRLTPYGAVDFSPSVSQS  636
               D PV+ +  L+Y+S HE   +   SW+A+YST L  K   RLTP G  DFSP+VS S
Sbjct  146  SMKDTPVLTNEHLVYVSTHENSGKPMASWAAVYSTELITKATQRLTPPGIADFSPAVSPS  205

Query  637  GEFIAVASYGSR  672
            G++ AVASYG +
Sbjct  206  GKWTAVASYGEK  217



>ref|XP_004502520.1| PREDICTED: uncharacterized protein LOC101497096 [Cicer arietinum]
Length=683

 Score =   112 bits (279),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 76/191 (40%), Positives = 99/191 (52%), Gaps = 34/191 (18%)
 Frame = +1

Query  190  IVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDE---GD----  348
            I+F+T+GR++Y FDI+S  LP        P  E ++TDG S+NFNGHFL      D    
Sbjct  28   IIFTTLGRAYYAFDIYS--LPIHLNHSTNPHQELQITDGNSVNFNGHFLSNQFPADHNPP  85

Query  349  --TFVFVSERSGSPRIYLQE--------------------NRSASAGKPQQLLSPSGTL-  459
                V+V+ER+G P IY                       +R      P  L     ++ 
Sbjct  86   PLQLVYVTERNGFPSIYYDAVYTTTTSTSRRSALESVTVTDRIQLPLLPNHLKDSQLSVS  145

Query  460  FHDRP-VVRDGR-LLYISAHEPPKEVFKSWSALYSTHLGLKEITRLTPYGAVDFSPSVSQ  633
              D+P V  DG  L+Y+S HE P+    SW+A+YSTHL      RLTPYG  DFSPS+S 
Sbjct  146  IKDKPSVTSDGEFLIYVSTHENPEVPRVSWTAVYSTHLKSGLTRRLTPYGVADFSPSLSP  205

Query  634  SGEFIAVASYG  666
            SG + AVASYG
Sbjct  206  SGTWTAVASYG  216



>ref|XP_007019162.1| DPP6 N-terminal domain-like protein [Theobroma cacao]
 gb|EOY16387.1| DPP6 N-terminal domain-like protein [Theobroma cacao]
Length=710

 Score =   111 bits (277),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 78/204 (38%), Positives = 107/204 (52%), Gaps = 45/204 (22%)
 Frame = +1

Query  184  GTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEGDT----  351
            G+IVF+T+GRS Y +DIF+  LP+    +  P++E ++TDG S+NFNGHF     +    
Sbjct  31   GSIVFTTLGRSDYAWDIFT--LPTLDPPN--PSNELQITDGESVNFNGHFPSASSSSILS  86

Query  352  --------------------FVFVSERSGSPRIYL--------QENRSASAGK-PQQLLS  444
                                 ++V+ER G   IY         +  RS SA + P ++ +
Sbjct  87   LLHNRSLLHPPGPQAPSPLQLIYVTERKGMSNIYYDALYHGAPRSTRSRSALEIPVRVQA  146

Query  445  PSGTL--------FHDRPVVRDGRLLYISAHEPPKEVFKSWSALYSTHLGLKEITRLTPY  600
            P   L          DRP +    L+Y+S HE P E   SW+A+YST LG     RLTPY
Sbjct  147  PLLGLEESKNRISMKDRPSLSGENLIYVSTHEDPGEPRTSWAAVYSTQLGTGVTRRLTPY  206

Query  601  GAVDFSPSVSQSGEFIAVASYGSR  672
            G  DFSP+VS SG + AVASYGS+
Sbjct  207  GIADFSPAVSPSGVWTAVASYGSK  230



>gb|KHN46997.1| Replication factor C subunit 4 [Glycine soja]
Length=422

 Score =   108 bits (270),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 78/181 (43%), Positives = 103/181 (57%), Gaps = 20/181 (11%)
 Frame = +1

Query  184  GTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPAS--EHRLTDGVSINFNGHFLDEGDT--  351
             TI+F+T+GR+ Y FDI+S+ +P   +Q +  +   E  LTDG S+NFNGHFL       
Sbjct  49   ATIIFTTLGRASYAFDIYSLPVPVQQQQQQPLSPSQELLLTDGHSVNFNGHFLSNSSAIQ  108

Query  352  ---------FVFVSERSGSPRIYLQENRSASAGKPQ---QLLSP--SGTLFHDRPVVR-D  486
                      V+V+ER+G P I+     S+S    +    LLS   S     D+P V  D
Sbjct  109  LPKHSPPLQLVYVTERNGYPTIFYDAIYSSSMVSNRIQIPLLSNHLSDASIKDKPSVTPD  168

Query  487  GR-LLYISAHEPPKEVFKSWSALYSTHLGLKEITRLTPYGAVDFSPSVSQSGEFIAVASY  663
            G+ LLY+S+HE P     SW+A+YST L      RLTPYG  DFSPS+S SG + AVASY
Sbjct  169  GQYLLYVSSHENPGVPRASWTAVYSTQLESGLTQRLTPYGVADFSPSLSPSGLWTAVASY  228

Query  664  G  666
            G
Sbjct  229  G  229



>ref|XP_009149685.1| PREDICTED: uncharacterized protein LOC103873008 [Brassica rapa]
Length=704

 Score =   109 bits (273),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 76/193 (39%), Positives = 100/193 (52%), Gaps = 37/193 (19%)
 Frame = +1

Query  187  TIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPAS---EHRLTDGVSINFNGHFLDEGDTFV  357
            TI+F+T+G S + FDIF+  LP+S    RRP S   EHRLTDG SINFNGH        +
Sbjct  35   TILFTTMGSSTFEFDIFT--LPTS----RRPPSPSDEHRLTDGKSINFNGHLASPSPALI  88

Query  358  --------------------FVSERSGSPRIYLQ----ENRSASAGKP---QQLLSPSGT  456
                                +V+ER G+P ++      +N+      P   +Q    S  
Sbjct  89   SLLPNTSGIQPQDKSLLHLIYVTERDGAPTLHYDVVHGDNKGTRVQVPLLSEQQSGMSVN  148

Query  457  LFHDRPVVRDGRLLYISAHEPPKEVFKSWSALYSTHLGLKEIT-RLTPYGAVDFSPSVSQ  633
               D PVV +  L+Y+S HE   +   SW+A+YST L  K    RLTP G  DFSP+VS 
Sbjct  149  SMKDTPVVTNEHLVYVSTHENSGKPMASWAAVYSTELRTKATQQRLTPPGIADFSPAVSP  208

Query  634  SGEFIAVASYGSR  672
            SG + AVASYG +
Sbjct  209  SGNWTAVASYGEK  221



>ref|XP_008466749.1| PREDICTED: uncharacterized protein LOC103504088 [Cucumis melo]
Length=703

 Score =   109 bits (272),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 74/199 (37%), Positives = 103/199 (52%), Gaps = 39/199 (20%)
 Frame = +1

Query  187  TIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHF-----------  333
            +IVF+T+GRS Y FDI++  LP+    +   A E  +TDG S+NFNG+F           
Sbjct  28   SIVFTTLGRSFYAFDIYT--LPADANNNPSSADEILITDGQSVNFNGYFPSSSSFSSLIS  85

Query  334  --LDEGDTF------VFVSERSGSPRIY---------LQENRSASAGKPQQLLSP-----  447
               ++  +F      V+V+ER+G  RI+         +   R +    P +L  P     
Sbjct  86   LLTNQSHSFTPDLELVYVTERNGISRIFYDAVFGGTGVSARRRSELEIPHRLQIPLLDEE  145

Query  448  ----SGTLFHDRPVVRDGRLLYISAHEPPKEVFKSWSALYSTHLGLKEITRLTPYGAVDF  615
                    F DRP +    L+Y+S HE P+E   SW+A+YS +L      RLTPYG  DF
Sbjct  146  QKNEVRVSFKDRPSLSGDYLVYVSTHEDPREFRTSWAAVYSRNLKSGVTRRLTPYGIADF  205

Query  616  SPSVSQSGEFIAVASYGSR  672
            SPSVS SG + AVASYG +
Sbjct  206  SPSVSPSGIWTAVASYGEK  224



>ref|XP_006416278.1| hypothetical protein EUTSA_v10006965mg [Eutrema salsugineum]
 gb|ESQ34631.1| hypothetical protein EUTSA_v10006965mg [Eutrema salsugineum]
Length=698

 Score =   108 bits (271),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 68/189 (36%), Positives = 104/189 (55%), Gaps = 30/189 (16%)
 Frame = +1

Query  187  TIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEGDTFV---  357
            TI+F+T+GR  + FD+F+  LP+S  +   P+ EHR+T G SI+FNGHF       +   
Sbjct  33   TILFTTLGRPTFEFDLFT--LPTS-HRPPSPSDEHRITAGKSIHFNGHFASPSPALISLI  89

Query  358  -----------------FVSERSGSPRI---YLQENRSASAGK----PQQLLSPSGTLFH  465
                             +V+ER G+P +    +Q + S ++ +    P+     +     
Sbjct  90   PKNSGIHSQDPSLLHLIYVTERYGAPTLSYDVVQADYSKTSAQVPLLPELQSGMTVNSMK  149

Query  466  DRPVVRDGRLLYISAHEPPKEVFKSWSALYSTHLGLKEITRLTPYGAVDFSPSVSQSGEF  645
            D PV+ +  L+Y+S HE P +   SW+A+YST L  +   RLTPYG  DFSP+VS SG++
Sbjct  150  DTPVLTNEHLVYVSTHEEPGKPKASWAAVYSTELRTRSTRRLTPYGIADFSPAVSPSGKW  209

Query  646  IAVASYGSR  672
             AVAS+G +
Sbjct  210  TAVASFGEK  218



>gb|KFK44273.1| hypothetical protein AALP_AA1G236600 [Arabis alpina]
Length=690

 Score =   108 bits (271),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 69/188 (37%), Positives = 97/188 (52%), Gaps = 28/188 (15%)
 Frame = +1

Query  187  TIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEGDTFV---  357
            +I F+T+GR  + FDIF+  LP++      P++EHRLTDG SINFNGHF       +   
Sbjct  27   SIFFTTLGRPTFEFDIFT--LPTTNHPPPSPSNEHRLTDGKSINFNGHFASPSPALISLL  84

Query  358  -------------FVSERSGSPRIYLQENRSASAGKPQQL-------LSPSGTLFH---D  468
                         +V+ER G+  +        + G   Q+          SG   +   D
Sbjct  85   PNKSQDKSLLHLIYVTERDGTMSLRYDVVHRDNTGTTTQVPLFSDEKKKQSGMTVNSMKD  144

Query  469  RPVVRDGRLLYISAHEPPKEVFKSWSALYSTHLGLKEITRLTPYGAVDFSPSVSQSGEFI  648
             P + +  L+++S HE P +   SW+A+YST L  K   RLTP G  DFSP+VS SG+  
Sbjct  145  TPFLTNEYLVHVSTHENPNKPMASWAAVYSTELRTKSTRRLTPTGIADFSPAVSPSGKLT  204

Query  649  AVASYGSR  672
            AVAS+G R
Sbjct  205  AVASFGER  212



>ref|XP_011069633.1| PREDICTED: uncharacterized protein LOC105155456 [Sesamum indicum]
Length=688

 Score =   107 bits (266),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 75/208 (36%), Positives = 106/208 (51%), Gaps = 43/208 (21%)
 Frame = +1

Query  157  PPIMIMDPHGT-IVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHF  333
            P ++ +   GT I F+T+GRS Y FDIF+  LP++      P+ E RLTDG S+NFNG+F
Sbjct  12   PLLLAVGGGGTSIAFATLGRSSYAFDIFA--LPTA-----SPSKEIRLTDGNSVNFNGYF  64

Query  334  ---------------LDEGDTFVFVSERSGSPRIYLQE---------------NRSASAG  423
                            D+    V+++ER+GS +IYL                   SA + 
Sbjct  65   PSSSSLSMLPHLSKNTDQATHIVYITERNGSSKIYLDALYDTPPIRSGSRSLVEGSAEST  124

Query  424  KPQQLL-----SPSGTLFHDRPVVRDGRLLYISAHEPPKEVFKSWSALYSTHLGLKEITR  588
            + Q LL     +       D+P +    L+Y+S HE P     SW+A++ST L      R
Sbjct  125  RLQVLLLGDEQTGGRVSMKDKPSLVGQSLIYVSTHENPGVPRASWAAVFSTQLTTGATRR  184

Query  589  LTPYGAVDFSPSVSQSGEFIAVASYGSR  672
            LTP G  DFSP+VS SG + AVAS+G +
Sbjct  185  LTPKGVADFSPAVSPSGVWTAVASFGEK  212



>emb|CDP10970.1| unnamed protein product [Coffea canephora]
Length=715

 Score =   107 bits (266),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 75/211 (36%), Positives = 104/211 (49%), Gaps = 56/211 (27%)
 Frame = +1

Query  187  TIVFSTVGRSHYGFDIFSVQL---PSSFEQDRRPASEHRLTDGVSINFNGHFLDEGDT--  351
            +IVF+T+GRS Y FDI+S+ L   P+S       ++E RLTDGVS+NFNG+F        
Sbjct  38   SIVFATLGRSSYHFDIYSLPLWVAPAS-------SNELRLTDGVSVNFNGYFPSPSSVSM  90

Query  352  ------------------FVFVSERSGSPRIYLQE----------NRSASAGKPQQLLSP  447
                              FV+V+ER+G+  ++L            +R+     P +    
Sbjct  91   LFRAPDWTPADVSPPPLHFVYVTERNGNSHVFLDSLYYRGREHTGSRAILEEDPSEPTRS  150

Query  448  SGTLFH----------------DRPVVRDGRLLYISAHEPPKEVFKSWSALYSTHLGLKE  579
              T F                 D+P +    L+Y+S HE P     SW+A+YSTHL  + 
Sbjct  151  ELTRFQFPLVGLEESDGRVSMKDKPTLVGEYLIYVSTHENPGVPRTSWTAVYSTHLKTRS  210

Query  580  ITRLTPYGAVDFSPSVSQSGEFIAVASYGSR  672
              RLTPYG  DFSP+VS SG + AVASYG +
Sbjct  211  TRRLTPYGVADFSPAVSPSGVWTAVASYGEK  241



>ref|XP_008644344.1| PREDICTED: uncharacterized protein LOC103625729 [Zea mays]
 gb|AFW67030.1| putative WD40-like beta propeller repeat family protein [Zea 
mays]
Length=689

 Score =   106 bits (265),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 75/184 (41%), Positives = 99/184 (54%), Gaps = 26/184 (14%)
 Frame = +1

Query  184  GTIVFSTVGRSHYGFDIFSVQL-PSSFEQDRRPASEHRLTDGVSINFNGHFLDEGD---T  351
            GTIVF+T+GRS Y FD+F++ + P S       ++E RLTDG S+N+NG+F        +
Sbjct  26   GTIVFTTLGRSRYAFDVFALTIAPLSAA-----SAELRLTDGASVNYNGNFAPSSSGPPS  80

Query  352  FVFVSERSGSPRIYLQ--------------ENRSASAGKPQQLLSPSGTLFHDRP-VVRD  486
             +FVSER+GS  +YL               E     +  P  LL        DRP +  D
Sbjct  81   LLFVSERNGSLNLYLTPVPTSASARRRDALEEEEEDSAPPTPLLPWDPIALKDRPSLTPD  140

Query  487  G-RLLYISAHEPPKEVFKSWSALYSTHLGLKEITR-LTPYGAVDFSPSVSQSGEFIAVAS  660
            G  L+Y+S  EP     +SW+A+YST L     TR LTP G  DFSP+VS SG + A AS
Sbjct  141  GAHLVYVSTAEPAGAPRRSWAAVYSTSLAPGRATRRLTPRGVADFSPAVSPSGVWTAAAS  200

Query  661  YGSR  672
             G R
Sbjct  201  PGPR  204



>ref|XP_003630471.1| Protein tolB [Medicago truncatula]
 gb|KEH35326.1| DPP6 amino-terminal domain protein [Medicago truncatula]
Length=684

 Score =   106 bits (264),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 71/185 (38%), Positives = 97/185 (52%), Gaps = 30/185 (16%)
 Frame = +1

Query  187  TIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEGDT-----  351
            +I+F+T+GR  Y FDI+S+ +   +        E +LTDG S+NFNG FL    +     
Sbjct  33   SIIFTTLGRPDYAFDIYSLPIHHHYHH-----QELQLTDGHSVNFNGQFLPNLTSIKLLT  87

Query  352  --------FVFVSERSGSPRIYLQ---------ENRSASAGKPQQLLSPSGTL-FHDRPV  477
                     V+V+ER+G P IY            +R      P  L      L   D+P 
Sbjct  88   HQDPPPLQLVYVTERTGFPTIYYDAVYTTTTKINDRIQLPLLPNHLTQTQSQLSIKDKPS  147

Query  478  VR-DGR-LLYISAHEPPKEVFKSWSALYSTHLGLKEITRLTPYGAVDFSPSVSQSGEFIA  651
            +  DG+ L+Y+S HE P     SW+A+YSTHL      RLTPYG  DFSP+VS +G++ A
Sbjct  148  LSSDGQYLIYVSTHEDPGVQRVSWTAVYSTHLKSGNTRRLTPYGVADFSPAVSPTGKWTA  207

Query  652  VASYG  666
            VASYG
Sbjct  208  VASYG  212



>emb|CDY08187.1| BnaA06g15390D [Brassica napus]
Length=704

 Score =   106 bits (264),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 75/193 (39%), Positives = 99/193 (51%), Gaps = 37/193 (19%)
 Frame = +1

Query  187  TIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPAS---EHRLTDGVSINFNGHFLDEGDTFV  357
            TI+F+T+G S + FDIF+  LP+S    RRP S   EHRLTD  SINFNGH        +
Sbjct  35   TILFTTMGSSTFEFDIFT--LPTS----RRPPSPSDEHRLTDRKSINFNGHLASPSPALI  88

Query  358  --------------------FVSERSGSPRIYLQ----ENRSASAGKP---QQLLSPSGT  456
                                +V+ER G+P ++      +N+      P   +Q    S  
Sbjct  89   SLLPNTSGIQPQDKSLLHLIYVTERDGAPTLHYDVVHGDNKGTRVQVPLLSEQQSGMSVN  148

Query  457  LFHDRPVVRDGRLLYISAHEPPKEVFKSWSALYSTHLGLKEIT-RLTPYGAVDFSPSVSQ  633
               D PVV +  L+Y+S HE   +   SW+A+YST L  K    RLTP G  DFSP+VS 
Sbjct  149  SMKDTPVVTNEHLVYVSTHENSGKPMASWAAVYSTELRTKATQQRLTPPGIADFSPAVSP  208

Query  634  SGEFIAVASYGSR  672
            SG + AVASYG +
Sbjct  209  SGNWTAVASYGEK  221



>gb|EYU32510.1| hypothetical protein MIMGU_mgv1a026619mg [Erythranthe guttata]
Length=716

 Score =   106 bits (264),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 74/197 (38%), Positives = 100/197 (51%), Gaps = 39/197 (20%)
 Frame = +1

Query  190  IVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFL-----------  336
            I F+T+GRS YGFDI++  LP++      P  E RLTDG S+N+NG+F            
Sbjct  43   IAFATLGRSSYGFDIYA--LPTTTTTIASP-EEIRLTDGNSVNYNGYFPSSSSLSVFPLL  99

Query  337  ----DEGDTFVFVSERSGSPRIYLQEN------RSASAGKPQQLLSPSGTL---------  459
                D    F++V+ER+GS +IYL         ++ S    +   S S  L         
Sbjct  100  PDQPDPTTHFIYVTERNGSSQIYLDALYGTLPLKTGSRSMLESFPSKSNQLQIRLVGGEQ  159

Query  460  ------FHDRPVVRDGRLLYISAHEPPKEVFKSWSALYSTHLGLKEITRLTPYGAVDFSP  621
                    DRP +    L+Y+S HE P E   SW+A++ST L      RLTP G  DFSP
Sbjct  160  ENGRVSMKDRPSLVGRSLIYVSTHEDPGEPRASWAAVFSTELATGLTRRLTPSGVADFSP  219

Query  622  SVSQSGEFIAVASYGSR  672
            +VS SG + AVASYG +
Sbjct  220  AVSPSGIWTAVASYGEK  236



>ref|XP_006386357.1| hypothetical protein POPTR_0002s08010g [Populus trichocarpa]
 gb|ERP64154.1| hypothetical protein POPTR_0002s08010g [Populus trichocarpa]
Length=712

 Score =   106 bits (264),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 76/203 (37%), Positives = 103/203 (51%), Gaps = 42/203 (21%)
 Frame = +1

Query  178  PHGT-IVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEGD--  348
            P GT I+F+T+GR  Y FDIF+  LP+     +   +E R+TDG S+NFNGHF       
Sbjct  27   PSGTSIIFATLGRLDYDFDIFT--LPTGDPPTK--TNELRITDGESVNFNGHFPSPSSSL  82

Query  349  ---------------------TFVFVSERSGSPRIYL--------QENRSASAGK-PQQL  438
                                   ++V+ER GS  I+         +  RS SA + P+++
Sbjct  83   LSLLTNKTLINPPGQQNPSPLNLIYVTERGGSSNIFYDAVYVDIPRSARSRSALEIPKRV  142

Query  439  LSP-----SGTLFHDRPVVRDGRLLYISAHEPPKEVFKSWSALYSTHLGLKEITRLTPYG  603
              P      G    D+P V    L+Y+S HE P E   SW+A+Y+T L      RLTP+G
Sbjct  143  QVPLLDGKGGISMKDKPTVSGDYLVYVSTHENPGEPRTSWAAVYATELTTGLTRRLTPHG  202

Query  604  AVDFSPSVSQSGEFIAVASYGSR  672
              DFSP+VS SG + AVASYG R
Sbjct  203  IADFSPAVSPSGVYTAVASYGER  225



>ref|XP_011027472.1| PREDICTED: uncharacterized protein LOC105127760 [Populus euphratica]
Length=712

 Score =   106 bits (264),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 76/203 (37%), Positives = 103/203 (51%), Gaps = 42/203 (21%)
 Frame = +1

Query  178  PHGT-IVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEGDTF  354
            P GT I+F+T+GR  Y FDIF+  LP+     +   +E R+TDG S+NFNGHF     + 
Sbjct  27   PSGTSIIFATLGRLDYDFDIFT--LPTGEPPTK--TNELRITDGESVNFNGHFPSPSPSL  82

Query  355  -----------------------VFVSERSGSPRI-----YLQENRSASAGK----PQQL  438
                                   ++V+ER GS  I     Y+   RSA +      P+++
Sbjct  83   LSRLTNKTLINPPGQQNPSPLNLIYVTERGGSSNIFYDAVYVDPPRSARSRSALEIPKRV  142

Query  439  LSP-----SGTLFHDRPVVRDGRLLYISAHEPPKEVFKSWSALYSTHLGLKEITRLTPYG  603
              P      G    D+P V    L+Y+S HE P E   SW+A+Y+T L      RLTP+G
Sbjct  143  QVPLLNGKGGISMKDKPTVSGDYLVYVSTHENPGEPRTSWAAVYATELTTGVTRRLTPHG  202

Query  604  AVDFSPSVSQSGEFIAVASYGSR  672
              DFSP+VS SG + AVASYG R
Sbjct  203  IADFSPAVSPSGVYTAVASYGER  225



>ref|XP_011027475.1| PREDICTED: uncharacterized protein LOC105127763 [Populus euphratica]
Length=712

 Score =   105 bits (263),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 75/203 (37%), Positives = 102/203 (50%), Gaps = 42/203 (21%)
 Frame = +1

Query  178  PHGT-IVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEGD--  348
            P GT I+F+T+GR  Y FDIF+  LP+     +   +E R+TDG S+NFNGHF       
Sbjct  27   PRGTSIIFATLGRLDYDFDIFT--LPTGEPPTK--TNELRITDGESVNFNGHFPSPSPSL  82

Query  349  ---------------------TFVFVSERSGSPRI-----YLQENRSASAGK----PQQL  438
                                   ++V+ER GS  I     Y+   RSA +      P+++
Sbjct  83   LSLLTNKTLINPPGQQNPSPLNLIYVTERGGSSNIFYDAVYVDPPRSARSRSALEIPKRV  142

Query  439  LSP-----SGTLFHDRPVVRDGRLLYISAHEPPKEVFKSWSALYSTHLGLKEITRLTPYG  603
              P      G    D+P V    L+Y+S HE P E   SW+A+Y+T L      RLTP+G
Sbjct  143  QVPLLNGKGGISMKDKPTVSGDYLVYVSTHENPGEPRTSWAAVYATELTTGLTRRLTPHG  202

Query  604  AVDFSPSVSQSGEFIAVASYGSR  672
              DFSP+VS SG + AVASYG +
Sbjct  203  IADFSPAVSPSGVYTAVASYGEK  225



>ref|XP_003527947.1| PREDICTED: uncharacterized protein LOC100791865 [Glycine max]
Length=723

 Score =   105 bits (262),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 77/181 (43%), Positives = 103/181 (57%), Gaps = 20/181 (11%)
 Frame = +1

Query  184  GTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPAS--EHRLTDGVSINFNGHFLDEGDT--  351
             +I+F+T+GR+ Y FDI+S+ +P   +Q +  +   E  LTDG S+NFNGHFL       
Sbjct  65   ASIIFTTLGRASYAFDIYSLPVPVQQQQQQPLSPSQELLLTDGHSVNFNGHFLSNSSAIQ  124

Query  352  ---------FVFVSERSGSPRIYLQENRSASAGKPQ---QLLSP--SGTLFHDRP-VVRD  486
                      V+V+ER+G P I+     S+S    +    LLS   S     D+P V  D
Sbjct  125  LPKHSPPLQLVYVTERNGYPTIFYDAIYSSSMVSNRIQIPLLSNHLSDASIKDKPSVTPD  184

Query  487  GR-LLYISAHEPPKEVFKSWSALYSTHLGLKEITRLTPYGAVDFSPSVSQSGEFIAVASY  663
            G+ LLY+S+HE P     SW+A+YST L      RLTPYG  DFSPS+S SG + AVASY
Sbjct  185  GQYLLYVSSHENPGVPRASWTAVYSTQLESGLTQRLTPYGVADFSPSLSPSGLWTAVASY  244

Query  664  G  666
            G
Sbjct  245  G  245



>ref|XP_002993781.1| hypothetical protein SELMODRAFT_187603 [Selaginella moellendorffii]
 gb|EFJ05147.1| hypothetical protein SELMODRAFT_187603 [Selaginella moellendorffii]
Length=722

 Score =   104 bits (259),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 74/227 (33%), Positives = 106/227 (47%), Gaps = 63/227 (28%)
 Frame = +1

Query  181  HGTIVFSTVGRSHYGFDIFSVQL-PSSFEQDR-RPASEHRLTDGVSINFNGHFLD-----  339
             GT+ F++VGR+HY FD+F +   P   E     P  E R TDGVS+N+NG  +D     
Sbjct  27   EGTVAFASVGRAHYAFDVFLLDFRPWELENASLGPHLEFRATDGVSVNYNGALVDDSQRR  86

Query  340  ------------EGD----TFVFVSERSGSPRIYL------QENRSA------------S  417
                        +GD      ++VSER G+  +        Q +R              S
Sbjct  87   VIFEALDFRGEQQGDGSQGILIYVSERDGAAEVRFNLFYQGQRDRGERSLGNIESGSQES  146

Query  418  AGKPQQLLSPSG----------------------TLFHDRPVVRDGRLLYISAHEPPKEV  531
             G  +  L   G                      T  +DRP V DGR++++S  +P ++ 
Sbjct  147  HGNRRDALEIHGDRGNSQNFIDLGKLWSSSEVEPTALYDRPSVADGRVIFVSTRKPREQS  206

Query  532  FKSWSALYSTHLGLKEITRLTPYGAVDFSPSVSQSGEFIAVASYGSR  672
             +SW+A+YS  +  K+ITRLTP G  D+SPSVS SG+F+ VAS   R
Sbjct  207  RQSWAAVYSMDIVTKKITRLTPEGVTDYSPSVSPSGKFVMVASDDGR  253



>ref|XP_002466125.1| hypothetical protein SORBIDRAFT_01g001880 [Sorghum bicolor]
 gb|EER93123.1| hypothetical protein SORBIDRAFT_01g001880 [Sorghum bicolor]
Length=690

 Score =   103 bits (258),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 78/184 (42%), Positives = 104/184 (57%), Gaps = 23/184 (13%)
 Frame = +1

Query  184  GTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEGDT----  351
            GTIVF+T+GRS Y FDIF++ L          ++E RLTDGVS+N+NG+F     +    
Sbjct  24   GTIVFTTLGRSRYAFDIFALPLSPLSSAAA--SAELRLTDGVSVNYNGNFAPSSSSSEPP  81

Query  352  -FVFVSERSGSPRIYLQE-NRSASAGKPQQLL-----SPSGT--------LFHDRP-VVR  483
              +FVSER+GS  +Y      SASA + ++ L     SP+ T           DRP +  
Sbjct  82   SLLFVSERNGSLNLYRTPVPLSASAARRREALEEEDDSPTLTPLLPWDPIALKDRPSLTP  141

Query  484  DG-RLLYISAHEPPKEVFKSWSALYSTHLGLKEITRLTPYGAVDFSPSVSQSGEFIAVAS  660
            DG  L+Y+S  EP     +SW+A+YST L      RLTP G  DFSP+VS SG++ A AS
Sbjct  142  DGAHLVYVSTAEPAGSPRRSWAAVYSTSLASGATRRLTPRGVADFSPAVSPSGDWTAAAS  201

Query  661  YGSR  672
             G R
Sbjct  202  PGPR  205



>gb|KFK44274.1| hypothetical protein AALP_AA1G237000 [Arabis alpina]
Length=703

 Score =   103 bits (258),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 77/207 (37%), Positives = 103/207 (50%), Gaps = 51/207 (25%)
 Frame = +1

Query  187  TIVFSTVGRSHYGFDIFSVQL--PSSFEQDRRPASEHRLTDGVSINFNGHF---------  333
            TI+F+T+GRSHY FDIFS+    P S       + E +LTDG S+NFNG+F         
Sbjct  33   TIIFTTLGRSHYEFDIFSLSTTHPPSI------SVELQLTDGESVNFNGYFPSPSPALIS  86

Query  334  ---------LDEGDTF--VFVSERSGSPRIYL-------------QENRSASAGKPQQLL  441
                     L++      ++V+ER+G+  IY               + RS     P ++ 
Sbjct  87   LLPDETLIQLEDSSPLHLIYVTERNGTSSIYYDLVSSSNYSDTTSNQRRSVLEAAPSRVQ  146

Query  442  SP-------SGTL---FHDRPVVRDGRLLYISAHEPPKEVFKSWSALYSTHLGLKEITRL  591
             P       SGT+   F D+P +    L+Y+S HE   E   SW+A+YST L      RL
Sbjct  147  IPLLSSSHRSGTIVNSFKDKPSLIGEFLVYVSTHENSGEPRTSWTAVYSTELRTGLTRRL  206

Query  592  TPYGAVDFSPSVSQSGEFIAVASYGSR  672
            TP G  DFSP+VS SG   AVASYG R
Sbjct  207  TPSGIADFSPAVSPSGNLTAVASYGER  233



>gb|KDP32822.1| hypothetical protein JCGZ_12114 [Jatropha curcas]
Length=699

 Score =   103 bits (258),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 77/198 (39%), Positives = 102/198 (52%), Gaps = 41/198 (21%)
 Frame = +1

Query  187  TIVFSTVG-RSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFL---------  336
            +I+F+T+G RS Y FDIF+  LP+       PA+E ++TDG S+NFNGHF          
Sbjct  29   SIIFATLGSRSDYAFDIFT--LPTQGPPPT-PANELQITDGRSLNFNGHFPSPSSSLLSL  85

Query  337  ------------DEGDTFVFVSERSGSPRIYL--------QENRSASAGK---PQQLLSP  447
                         E  + V+V+ER GS  IY         +  R  SA +   P ++  P
Sbjct  86   LSNQTLTSATQNSEPVSLVYVTERGGSSNIYYDTVYFSIPRSTRLRSALEIEIPVRVQVP  145

Query  448  -----SGTLFHDRPVVRDGRLLYISAHEPPKEVFKSWSALYSTHLGLKEITRLTPYGAVD  612
                  G    D+P V    L+Y+S HE  K+   SW+A+YST L      RLTPYG  D
Sbjct  146  LLKGIDGISMKDKPTVSGDYLIYVSTHEDSKKPRTSWAAVYSTELKTGLTRRLTPYGIAD  205

Query  613  FSPSVSQSGEFIAVASYG  666
            FSP+VS SG + AVASYG
Sbjct  206  FSPAVSPSGLYTAVASYG  223



>ref|XP_002985152.1| hypothetical protein SELMODRAFT_121622 [Selaginella moellendorffii]
 gb|EFJ13646.1| hypothetical protein SELMODRAFT_121622 [Selaginella moellendorffii]
Length=669

 Score =   103 bits (257),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 66/186 (35%), Positives = 102/186 (55%), Gaps = 24/186 (13%)
 Frame = +1

Query  166  MIMDPHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEG  345
            M  D  GT+VF++VGRSHY FD F++ + +          E  LTDGVS+NFN  F+++ 
Sbjct  1    MANDGGGTVVFASVGRSHYAFDAFALDIAT--------LKEEVLTDGVSVNFNAQFVEDD  52

Query  346  ---DTFVFVSERSGSPRIYLQE---------NRSASAGKPQQLLSPSGTLFHDRPVVRDG  489
                  +FVSER+G+  I+L+          +  +S  K   L +  G L+ DRP V  G
Sbjct  53   PKPSAVIFVSERTGASNIFLRRQSLTSKSDRDDHSSTLKLGSLDAGDGFLYCDRPCVAGG  112

Query  490  -RLLYISAHEPP---KEVFKSWSALYSTHLGLKEITRLTPYGAVDFSPSVSQSGEFIAVA  657
             R+++ S    P   + + +  +A++S  L +    RLTP G  D+SP++S S ++IAVA
Sbjct  113  GRIIFASTKSSPEISQNLRQPSTAIFSACLRIGLTRRLTPEGVADYSPALSPSKKWIAVA  172

Query  658  SYGSRP  675
            S   +P
Sbjct  173  SNAGKP  178



>ref|XP_006416277.1| hypothetical protein EUTSA_v10009943mg [Eutrema salsugineum]
 gb|ESQ34630.1| hypothetical protein EUTSA_v10009943mg [Eutrema salsugineum]
Length=713

 Score =   103 bits (256),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 79/215 (37%), Positives = 107/215 (50%), Gaps = 54/215 (25%)
 Frame = +1

Query  172  MDPHG--TIVFSTVGRSHYGFDIFSVQL--PSSFEQDRRPASEHRLTDGVSINFNGHFL-  336
             +P+G  TIVF+T+GRSHY FDIF++    P S  +      E ++TDG S+NFNG+F  
Sbjct  24   QNPNGGDTIVFTTLGRSHYEFDIFALSTTHPPSISR------ELQITDGESVNFNGYFPS  77

Query  337  ----------DEGDT---------FVFVSERSGSPRIY------------LQENRSASAG  423
                      DE  T          ++V+ER+G+  IY             +  R +   
Sbjct  78   PSPTLISLLPDETLTQLEDSSPLHLIYVTERNGTSSIYYDLVYGGGGDSDFKRKRRSVLE  137

Query  424  KPQQLLSP---------SGTL---FHDRPVVRDGRLLYISAHEPPKEVFKSWSALYSTHL  567
             P ++  P         SGT    F D+P +    L+Y+S HE   E   SW+A+YST L
Sbjct  138  SPSRIQVPLLSIANHHRSGTKVNSFKDKPSLSGEFLVYVSTHENSGEPRTSWTAVYSTEL  197

Query  568  GLKEITRLTPYGAVDFSPSVSQSGEFIAVASYGSR  672
                  RLTP G  DFSP+VS SG + AVASYG R
Sbjct  198  RTGLTRRLTPSGIADFSPAVSPSGNWTAVASYGER  232



>ref|XP_004160721.1| PREDICTED: protein TolB-like [Cucumis sativus]
Length=703

 Score =   102 bits (255),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 71/199 (36%), Positives = 102/199 (51%), Gaps = 39/199 (20%)
 Frame = +1

Query  187  TIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHF-----------  333
            +IVF+T+GRS Y FDI++  LP+   ++     E  +TDG  +NFNG+F           
Sbjct  28   SIVFTTLGRSFYAFDIYT--LPADANKNPSLPDEILITDGQYVNFNGYFPSSTSSSSLIS  85

Query  334  --LDEGDTF------VFVSERSGSPRIY---------LQENRSASAGKPQQLLSP-----  447
               ++  +F      V+V+ER+G   I+         +   R +    P +L  P     
Sbjct  86   LLTNQSHSFTPDFELVYVTERNGISTIFYDAVFGGIGVSARRRSELEIPHRLQIPLLDEE  145

Query  448  ----SGTLFHDRPVVRDGRLLYISAHEPPKEVFKSWSALYSTHLGLKEITRLTPYGAVDF  615
                +   F DRP +    L+Y+S HE P+E   SW+A+YS +L      RLTPYG  DF
Sbjct  146  QKNEAKVSFKDRPSLSGDYLVYVSTHEDPRESRTSWAAVYSRNLKSGLTRRLTPYGIADF  205

Query  616  SPSVSQSGEFIAVASYGSR  672
            SPSVS SG + AVASYG +
Sbjct  206  SPSVSPSGIWTAVASYGEK  224



>ref|XP_004149439.1| PREDICTED: protein TolB-like [Cucumis sativus]
 gb|KGN47697.1| hypothetical protein Csa_6G382360 [Cucumis sativus]
Length=703

 Score =   102 bits (254),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 71/199 (36%), Positives = 102/199 (51%), Gaps = 39/199 (20%)
 Frame = +1

Query  187  TIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHF-----------  333
            +IVF+T+GRS Y FDI++  LP+   ++     E  +TDG  +NFNG+F           
Sbjct  28   SIVFTTLGRSFYAFDIYT--LPADANKNPSLPDEILITDGQYVNFNGYFPSSTSSSSLIS  85

Query  334  --LDEGDTF------VFVSERSGSPRIY---------LQENRSASAGKPQQLLSP-----  447
               ++  +F      V+V+ER+G   I+         +   R +    P +L  P     
Sbjct  86   LLTNQSHSFTPDFELVYVTERNGISTIFYDAVFGGIGVSARRRSELEIPHRLQIPLLDEE  145

Query  448  ----SGTLFHDRPVVRDGRLLYISAHEPPKEVFKSWSALYSTHLGLKEITRLTPYGAVDF  615
                +   F DRP +    L+Y+S HE P+E   SW+A+YS +L      RLTPYG  DF
Sbjct  146  QKNEARVSFKDRPSLSGDYLVYVSTHEDPRESRTSWAAVYSRNLKSGLTRRLTPYGIADF  205

Query  616  SPSVSQSGEFIAVASYGSR  672
            SPSVS SG + AVASYG +
Sbjct  206  SPSVSPSGIWTAVASYGEK  224



>gb|KDO80522.1| hypothetical protein CISIN_1g004971mg [Citrus sinensis]
Length=721

 Score =   102 bits (254),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 70/213 (33%), Positives = 107/213 (50%), Gaps = 56/213 (26%)
 Frame = +1

Query  187  TIVFSTVGRSHYGFDIFSVQLPSSFEQDR-RPASEHRLTDGVSINFNGHFLDEGDTF---  354
            +I+F+T+GRS Y FDI+++ +      DR   A+E ++TDG S+NFNGHF      F   
Sbjct  31   SIIFTTLGRSDYAFDIYTLPI-----SDRPTTANEIKITDGESVNFNGHFPSPSSPFLSF  85

Query  355  ------------------------VFVSERSGSPRIY-----------------LQENRS  411
                                    ++V+ER+G+  IY                 L+++ +
Sbjct  86   LLRNQTLIQSPGPQDSRDPPPLQLIYVTERNGTSNIYYDAVYYDTRRNTRSRTALEQHGA  145

Query  412  ASAGKPQ----QLLSPSGTL--FHDRPVVRDGRLLYISAHEPPKEVFKSWSALYSTHLGL  573
              + + Q     L   +G +    D+P++    L+Y+S HE P     SW+A+YST L  
Sbjct  146  EVSTRVQVPLLDLNEVNGGVISMKDKPILSGEYLIYVSTHENPGTPRTSWAAVYSTELKT  205

Query  574  KEITRLTPYGAVDFSPSVSQSGEFIAVASYGSR  672
                RLTPYG  DFSP+VS SG++ AVASYG++
Sbjct  206  GLTRRLTPYGVADFSPAVSPSGKYTAVASYGNK  238



>ref|NP_564147.1| DPP6 N-terminal domain-like protein [Arabidopsis thaliana]
 gb|AAD41421.1|AC007727_10 ESTs gb|N96028, gb|F14286, gb|T20680, gb|F14443, gb|AA657300 
and gb|N65244 come from this gene [Arabidopsis thaliana]
 gb|AAK76710.1| unknown protein [Arabidopsis thaliana]
 gb|AAN13226.1| unknown protein [Arabidopsis thaliana]
 gb|AEE30138.1| DPP6 N-terminal domain-like protein [Arabidopsis thaliana]
Length=706

 Score =   101 bits (252),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 72/203 (35%), Positives = 101/203 (50%), Gaps = 45/203 (22%)
 Frame = +1

Query  187  TIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHF-----------  333
            TI+F+T+GRSHY FDIF++    S  Q    + E R+TDG S+NFNG+F           
Sbjct  33   TIIFTTLGRSHYEFDIFAL----STTQPPSVSGELRITDGESVNFNGYFPSPSPALLSLL  88

Query  334  -----LDEGDT----FVFVSERSGSPRIY----------LQENRSASAGKPQQLLSP---  447
                 +   D+     ++V+ER+G+  +Y           +  R +    P ++  P   
Sbjct  89   PDETLIQMEDSSPLHLIYVTERNGTSSLYYDLVYGGNSDFKTKRRSVLEAPSRVQVPLLS  148

Query  448  -----SGTL---FHDRPVVRDGRLLYISAHEPPKEVFKSWSALYSTHLGLKEITRLTPYG  603
                 SG     F D+P +    ++Y+S HE   E   SW+A+YST L      RLTP G
Sbjct  149  RFDHLSGMTVNSFKDKPSLSGEFIVYVSTHESSGEPRASWTAVYSTELKTGLTRRLTPSG  208

Query  604  AVDFSPSVSQSGEFIAVASYGSR  672
              DFSP+VS SG   AVASYG R
Sbjct  209  VADFSPAVSPSGNLTAVASYGER  231



>ref|XP_004249849.1| PREDICTED: uncharacterized protein LOC101257324 [Solanum lycopersicum]
Length=675

 Score =   101 bits (251),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 69/184 (38%), Positives = 96/184 (52%), Gaps = 31/184 (17%)
 Frame = +1

Query  187  TIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHF-----------  333
            +I+F+T+GRS Y FDIF+  LP++      P +E +LTDG S+NFNGHF           
Sbjct  23   SIIFTTLGRSSYAFDIFA--LPTT-----HPQTEFQLTDGNSVNFNGHFPATLPPSLLSR  75

Query  334  ------LDEGDTFVFVSERSGSPRIYLQENRSASAGKPQQ--LLSP-----SGTLFHDRP  474
                  ++ G   ++V+ER+G+  ++           P Q  L  P           D+P
Sbjct  76   LPDDDSVNSGFHLIYVTERNGTHHVFYDAVFHDILEFPSQTRLQVPLVGFEQSVSMKDKP  135

Query  475  VVRDGRLLYISAHEPPKEVFKSWSALYSTHLGLKEITRLTPYGAVDFSPSVSQSGEFIAV  654
             +    L+Y+S HE       SW+A+YSTHL      RLTP G  DFSP+VS SG + AV
Sbjct  136  SLSGEFLIYVSTHEDSGVPRTSWAAVYSTHLVSGFTQRLTPKGVADFSPAVSPSGVWTAV  195

Query  655  ASYG  666
            ASYG
Sbjct  196  ASYG  199



>emb|CAN73514.1| hypothetical protein VITISV_037210 [Vitis vinifera]
Length=715

 Score =   101 bits (251),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 76/199 (38%), Positives = 98/199 (49%), Gaps = 49/199 (25%)
 Frame = +1

Query  205  VGRSHYGFDIFSVQL--PSSFEQDRRPASEHRLTDGVSINFNGHFL--------------  336
            +GRS Y FD+FS+    PS+       A E R+TDG S+NFNGHF               
Sbjct  47   LGRSDYAFDVFSLPTLGPSTI------ADELRITDGQSVNFNGHFPSSPIISLLANQTLL  100

Query  337  --------DEGDTFVFVSERSGSPRIYLQ----------ENRSA--SAGKPQQLLSPSGT  456
                    DE    ++V+ER+GS  IYL             RSA  +A + +  L  + T
Sbjct  101  ESSSVKRPDESLQTIYVTERNGSSNIYLDIIYYDTPTNSRRRSALETAVRVEVPLLGTNT  160

Query  457  L-------FHDRPVVRDGRLLYISAHEPPKEVFKSWSALYSTHLGLKEITRLTPYGAVDF  615
                      DRP +    L+Y+S HE      KSW+A+YSTHL      RLTPYG  D+
Sbjct  161  EQSDGRISMKDRPSLVGEXLVYVSTHEDSGVPRKSWAAVYSTHLPTGSTRRLTPYGVADY  220

Query  616  SPSVSQSGEFIAVASYGSR  672
            SP+VS SG + AVASYG R
Sbjct  221  SPAVSPSGVWTAVASYGER  239



>ref|XP_002285876.2| PREDICTED: uncharacterized protein LOC100267814 [Vitis vinifera]
Length=715

 Score =   100 bits (250),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 76/199 (38%), Positives = 98/199 (49%), Gaps = 49/199 (25%)
 Frame = +1

Query  205  VGRSHYGFDIFSVQL--PSSFEQDRRPASEHRLTDGVSINFNGHFL--------------  336
            +GRS Y FD+FS+    PS+       A E R+TDG S+NFNGHF               
Sbjct  47   LGRSDYAFDVFSLPTLGPSTI------ADELRITDGQSVNFNGHFPSSPIISLLANQTLV  100

Query  337  --------DEGDTFVFVSERSGSPRIYLQ----------ENRSA--SAGKPQQLLSPSGT  456
                    DE    ++V+ER+GS  IYL             RSA  +A + +  L  + T
Sbjct  101  ESSSVKRPDESLQTIYVTERNGSSNIYLDIIYYDTPTNSRRRSALETAVRVEVPLLGTNT  160

Query  457  L-------FHDRPVVRDGRLLYISAHEPPKEVFKSWSALYSTHLGLKEITRLTPYGAVDF  615
                      DRP +    L+Y+S HE      KSW+A+YSTHL      RLTPYG  D+
Sbjct  161  EQSDGRISMKDRPSLVGEDLVYVSTHEDSGVPRKSWAAVYSTHLPTGSTRRLTPYGVADY  220

Query  616  SPSVSQSGEFIAVASYGSR  672
            SP+VS SG + AVASYG R
Sbjct  221  SPAVSPSGVWTAVASYGER  239



>ref|XP_002520326.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF42112.1| conserved hypothetical protein [Ricinus communis]
Length=708

 Score =   100 bits (249),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 72/198 (36%), Positives = 101/198 (51%), Gaps = 42/198 (21%)
 Frame = +1

Query  187  TIVFSTVG-RSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHF----------  333
            +I+F+T+G RS   FDIF+  LP++   D   ++E ++TDG S++FNGHF          
Sbjct  32   SIIFATLGSRSSNAFDIFA--LPTTTPPDS--SNEIQITDGKSLSFNGHFPSPTSLVSLF  87

Query  334  ------------LDEGDTFVFVSERSGSPRIYLQ----------ENRSASAGKPQQLL--  441
                             T ++V+ER GS  IYL            +RSA    P+  +  
Sbjct  88   PNQTLIHSSAHQNSASITVIYVTERGGSSTIYLDVLSYDTARSARSRSALETPPRVQIPL  147

Query  442  ---SPSGTLFHDRPVVRDGRLLYISAHEPPKEVFKSWSALYSTHLGLKEITRLTPYGAVD  612
               +  G  F D+P +    L+Y+S HE   +   SW+A+YST L      RLTPYG  D
Sbjct  148  LKGNNVGVSFKDKPTINGNYLVYLSTHEDAGKPRASWAAVYSTELNTGLTRRLTPYGVAD  207

Query  613  FSPSVSQSGEFIAVASYG  666
            FSP+VS SG + AVASYG
Sbjct  208  FSPAVSPSGVYTAVASYG  225



>ref|XP_009149686.1| PREDICTED: uncharacterized protein LOC103873010 [Brassica rapa]
Length=705

 Score =   100 bits (249),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 73/206 (35%), Positives = 100/206 (49%), Gaps = 51/206 (25%)
 Frame = +1

Query  187  TIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPAS---EHRLTDGVSINFNGHF--------  333
            TIVF+T+GRS Y FD+F++          RP S   E R+TDG S+NFNG+F        
Sbjct  33   TIVFTTLGRSRYEFDVFALST-------TRPPSISGEIRITDGESVNFNGYFPSPSPALI  85

Query  334  --------LDEGDT----FVFVSERSGSPRIY---LQENRSASAGKPQQLLSPSGTL---  459
                    +  GD+     ++V+ER+G+  IY   L      S  K + +L  +  +   
Sbjct  86   SLLPDATLIQPGDSSPLHLIYVTERNGTSSIYYDLLHGGDPDSKSKRRSMLEATSRVQIP  145

Query  460  ---------------FHDRPVVRDGRLLYISAHEPPKEVFKSWSALYSTHLGLKEITRLT  594
                           F D+P +    L+Y+S HE   E   SW+A+YST L      RLT
Sbjct  146  LLSNADHRSGNTVNSFKDKPSLSGEFLVYVSTHENSGEPRTSWTAVYSTELRTGLTRRLT  205

Query  595  PYGAVDFSPSVSQSGEFIAVASYGSR  672
            P G  DFSP++S SG   AVASYG R
Sbjct  206  PSGIADFSPALSPSGNLTAVASYGER  231



>emb|CDY04662.1| BnaC05g17000D [Brassica napus]
Length=706

 Score =   100 bits (249),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 75/211 (36%), Positives = 103/211 (49%), Gaps = 51/211 (24%)
 Frame = +1

Query  175  DPHG--TIVFSTVGRSHYGFDIFSVQL--PSSFEQDRRPASEHRLTDGVSINFNGHF---  333
            +P+G  TIVF+T+GRS Y FDIF++    P S       + E R+TDG S+NFNG+F   
Sbjct  27   NPNGGDTIVFTTLGRSRYEFDIFALSTTHPPSI------SGEIRITDGESVNFNGYFPSP  80

Query  334  -------------LDEGDT----FVFVSERSGSPRIY---LQENRSASAGKPQQLLSPSG  453
                         +  GD+     ++V+ER+G+  IY   L      S  K + +L    
Sbjct  81   SPALISLLPDATLIQPGDSSPLHLIYVTERNGTSSIYYDLLHGGDPDSKSKRRSMLEAQS  140

Query  454  TL------------------FHDRPVVRDGRLLYISAHEPPKEVFKSWSALYSTHLGLKE  579
             +                  F D+P +    L+Y+S HE   E   SW+A+YST L    
Sbjct  141  RVQIQLLTNADNRSGNTVNSFKDKPSLSGEFLVYVSTHENSGEPRTSWTAVYSTELRTGL  200

Query  580  ITRLTPYGAVDFSPSVSQSGEFIAVASYGSR  672
              RLTP G  DFSP++S SG   AVASYG R
Sbjct  201  TRRLTPSGIADFSPALSPSGNLTAVASYGER  231



>ref|XP_006472827.1| PREDICTED: uncharacterized protein LOC102617553 [Citrus sinensis]
Length=721

 Score =   100 bits (248),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 74/213 (35%), Positives = 109/213 (51%), Gaps = 56/213 (26%)
 Frame = +1

Query  187  TIVFSTVGRSHYGFDIFSVQLPSSFEQDR-RPASEHRLTDGVSINFNGHFL---------  336
            +I+F+T+GRS Y FDI++  LP S   DR   A+E ++TDG S+NFNGHF          
Sbjct  31   SIIFTTLGRSDYAFDIYT--LPIS---DRPTTANEIKITDGESVNFNGHFPSPSSSFLSF  85

Query  337  --------------DEGD----TFVFVSERSGSPRIY-----------------LQENRS  411
                          D  D      ++V+ER+G+  IY                 L+++ +
Sbjct  86   LLRNQTLIQSPGPQDSRDPPPLQLIYVTERNGTSNIYYDAVYYDTRRNTRSRTALEQHGA  145

Query  412  ASAGKPQ----QLLSPSGTL--FHDRPVVRDGRLLYISAHEPPKEVFKSWSALYSTHLGL  573
              + + Q     L   +G +    D+P++    L+Y+S HE P     SW+A+YST L  
Sbjct  146  EVSTRVQVPLLDLNEVNGGVISMKDKPILSGEYLIYVSTHENPGTPRTSWAAVYSTELKT  205

Query  574  KEITRLTPYGAVDFSPSVSQSGEFIAVASYGSR  672
                RLTPYG  DFSP+VS SG++ AVASYG++
Sbjct  206  GLTRRLTPYGVADFSPAVSPSGKYTAVASYGNK  238



>ref|XP_010539663.1| PREDICTED: uncharacterized protein LOC104813673 [Tarenaya hassleriana]
Length=672

 Score = 99.4 bits (246),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 66/192 (34%), Positives = 98/192 (51%), Gaps = 32/192 (17%)
 Frame = +1

Query  187  TIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHF-----------  333
            +IVF+T+GR  Y FDIF+  LP+        + E R+TDGV +NFNGHF           
Sbjct  12   SIVFTTLGRPSYEFDIFT--LPTRHRSPPSDSGELRITDGVPVNFNGHFAYPSAALISLL  69

Query  334  -----LDEGDT----FVFVSERSGSPRIY---LQENRSASAGKPQQLLSPSGTL------  459
                 +   D      ++++ER+G+  +Y   +  +   ++     ++S +  L      
Sbjct  70   PNNSGIQPHDQSYMHLIYITERNGTSSVYYDAVSGDHQVTSRLQVPVISGANRLSGMAVN  129

Query  460  -FHDRPVVRDGRLLYISAHEPPKEVFKSWSALYSTHLGLKEITRLTPYGAVDFSPSVSQS  636
               D+P +    L+Y+S HE   +   SW+A+YST L      RLTP G  DFSP+VS S
Sbjct  130  SMKDKPSLAGDYLVYVSTHEVQSKPMTSWAAVYSTELRTGSTRRLTPPGIADFSPAVSPS  189

Query  637  GEFIAVASYGSR  672
            G + AVASYG R
Sbjct  190  GNWTAVASYGER  201



>ref|XP_006304666.1| hypothetical protein CARUB_v10011878mg [Capsella rubella]
 gb|EOA37564.1| hypothetical protein CARUB_v10011878mg [Capsella rubella]
Length=708

 Score = 99.4 bits (246),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 74/203 (36%), Positives = 101/203 (50%), Gaps = 45/203 (22%)
 Frame = +1

Query  187  TIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHF----------L  336
            TI+F+T+GRS Y FDIF++    S  Q    + E R+TDG S+NFNG+F          L
Sbjct  35   TIIFTTLGRSRYEFDIFTL----STAQPPSVSGELRITDGASVNFNGYFPSPSPALISLL  90

Query  337  DEGDTF----------VFVSERSGSPRIY---LQENRSASAGKPQQLLS-----------  444
             +   F          ++V+ER+G+  +Y   +    S S  K + +L            
Sbjct  91   PDETLFQLEDSSPLHLIYVTERNGTSSVYYDLIYGVDSDSINKRRSMLEAPSRVQVPLLS  150

Query  445  ----PSGTL---FHDRPVVRDGRLLYISAHEPPKEVFKSWSALYSTHLGLKEITRLTPYG  603
                PSG     F D+P +    L+Y+S HE   +   SW+A+YST L      RLTP  
Sbjct  151  GFDQPSGMTVNSFKDKPSLSGDFLVYVSTHENSGKPRTSWTAVYSTELRTGLTRRLTPRD  210

Query  604  AVDFSPSVSQSGEFIAVASYGSR  672
              DFSP+VS SG F AVASYG R
Sbjct  211  IADFSPAVSPSGNFTAVASYGER  233



>ref|XP_009593179.1| PREDICTED: uncharacterized protein LOC104089880 [Nicotiana tomentosiformis]
Length=706

 Score = 99.4 bits (246),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 69/199 (35%), Positives = 100/199 (50%), Gaps = 36/199 (18%)
 Frame = +1

Query  172  MDPHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHF------  333
            ++ H +I+F+T+GRS Y FDIF++    S  Q +    E +LTDG S+NFNG+F      
Sbjct  34   LNAHTSIIFTTLGRSSYAFDIFALPTTHSPIQSK----ELQLTDGNSVNFNGYFPATLPP  89

Query  334  -----------LDEGDTF--VFVSERSGSPRIY-------------LQENRSASAGKPQQ  435
                        +E   F  ++V+ER+G+  I+             L+        + Q 
Sbjct  90   SLVSCLPNHSLNNETPPFHLIYVTERNGTHHIFYDVVFHGTPRRAILEFPTRTEWTRVQV  149

Query  436  LLSPSGTLFHDRPVVRDGRLLYISAHEPPKEVFKSWSALYSTHLGLKEITRLTPYGAVDF  615
             L  +     D+P +    L+Y+S HE P     SW+A+YST L      RLTP G  DF
Sbjct  150  PLVGAHVSLKDKPSLVGESLIYVSTHEDPGVPRTSWAAVYSTQLNSGSTRRLTPKGVADF  209

Query  616  SPSVSQSGEFIAVASYGSR  672
            SP+VS SG + AVASYG +
Sbjct  210  SPAVSPSGVWTAVASYGKK  228



>ref|XP_010672499.1| PREDICTED: uncharacterized protein LOC104889058 [Beta vulgaris 
subsp. vulgaris]
Length=700

 Score = 99.0 bits (245),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 69/199 (35%), Positives = 101/199 (51%), Gaps = 42/199 (21%)
 Frame = +1

Query  190  IVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEH----RLTDGVSINFNGHF--------  333
            IVF+T+GRS Y FDI++  LP    +     S H    ++TDG+S+NFNGHF        
Sbjct  34   IVFTTLGRSRYNFDIYT--LPIFTTKSSASISNHHQELKVTDGISVNFNGHFPINSTSIF  91

Query  334  --LDEGDT---------FVFVSERSGSPRIYLQ---ENRSASAGKPQQLLSPSGTL----  459
              L++ ++          ++V+ER+GS  IY     ++ S +  +    L   G +    
Sbjct  92   SLLNQPNSPPSPTTNIQLIYVTERNGSFNIYFDSVYDSLSRAGSRSALELRVPGRVQVPL  151

Query  460  ----------FHDRPVVRDGRLLYISAHEPPKEVFKSWSALYSTHLGLKEITRLTPYGAV  609
                        DRP +    ++Y+S H+       SW+A+YSTH+      RLTP+G  
Sbjct  152  LGVNENERVSMKDRPSLVGEHVVYVSTHQNSGVARTSWAAVYSTHILTGSTRRLTPFGVA  211

Query  610  DFSPSVSQSGEFIAVASYG  666
            DFSP+VS SG F AVASYG
Sbjct  212  DFSPAVSPSGVFTAVASYG  230



>ref|XP_002890452.1| hypothetical protein ARALYDRAFT_472406 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66711.1| hypothetical protein ARALYDRAFT_472406 [Arabidopsis lyrata subsp. 
lyrata]
Length=706

 Score = 98.6 bits (244),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 72/203 (35%), Positives = 100/203 (49%), Gaps = 45/203 (22%)
 Frame = +1

Query  187  TIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHF-----------  333
            TI+F+T+GRS Y FDIF++    S       ++E R+TDG S+NFNG+F           
Sbjct  33   TIIFTTLGRSRYEFDIFTL----STTHPPSDSNELRITDGESVNFNGYFPSPTPALISLL  88

Query  334  -----LDEGDT----FVFVSERSGSPRIYL----------QENRSASAGKPQQLLSP---  447
                 +   D+     ++V+ER+G+  IY           +  R +    P ++  P   
Sbjct  89   PDETLIQMEDSSPLHLIYVTERNGTSSIYYDLIYGGDSDSKMKRRSVLEAPSRVQVPLLS  148

Query  448  -----SGTL---FHDRPVVRDGRLLYISAHEPPKEVFKSWSALYSTHLGLKEITRLTPYG  603
                 SG     F D+P +    L+Y+S HE   E   SW+A+YST L      RLTP G
Sbjct  149  GFDHQSGMTVNSFKDKPSLSGEFLVYVSTHENSGEPRTSWTAVYSTELKTGLTRRLTPSG  208

Query  604  AVDFSPSVSQSGEFIAVASYGSR  672
              DFSP+VS SG   AVASYG R
Sbjct  209  VADFSPAVSPSGNLTAVASYGER  231



>ref|XP_006351203.1| PREDICTED: uncharacterized protein LOC102604753 [Solanum tuberosum]
Length=696

 Score = 98.6 bits (244),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 72/201 (36%), Positives = 103/201 (51%), Gaps = 46/201 (23%)
 Frame = +1

Query  187  TIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHF-----------  333
            +I+F+T+GRS Y FDIF+  LP++      P +E +LTDG S+NFNG+F           
Sbjct  24   SIIFTTLGRSTYAFDIFA--LPTT-----HPQTEFQLTDGNSVNFNGNFPASLPPSLLSR  76

Query  334  LDEGDT---------FVFVSERSGSPRIY-------LQENRSASAGKPQQL---------  438
            L + D+          ++V+ER+G+  ++       + E R+     PQ           
Sbjct  77   LPDDDSVNSGKLPFHLIYVTERNGTHHVFYDAVFHGVGERRAILEFPPQTESTRVQVPLV  136

Query  439  -LSPSG--TLFHDRPVVRDGRLLYISAHEPPKEVFKSWSALYSTHLGLKEITRLTPYGAV  609
                SG      D+P +    L+Y+S HE       SW+A+YSTHLG     RLTP G  
Sbjct  137  GFEQSGGRVSMKDKPSLTGEFLIYVSTHEDSGVPRTSWAAVYSTHLGSGLTRRLTPKGVA  196

Query  610  DFSPSVSQSGEFIAVASYGSR  672
            DFSP+VS SG + AVASYG +
Sbjct  197  DFSPAVSPSGVWTAVASYGEK  217



>ref|XP_002515210.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF47194.1| conserved hypothetical protein [Ricinus communis]
Length=618

 Score = 98.2 bits (243),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 43/75 (57%), Positives = 61/75 (81%), Gaps = 2/75 (3%)
 Frame = +1

Query  454  TLFHDRPVVRDGRLLYISAHEPPKEVFKSWSALYSTHLGLK--EITRLTPYGAVDFSPSV  627
            +LFHDRP+++D RL +ISAH+ P +++KSW+ALY+  L  +   +TRLTPYG +D+SP+V
Sbjct  34   SLFHDRPIIKDNRLYFISAHQEPDKLYKSWNALYAIDLNQEGNSVTRLTPYGVIDYSPAV  93

Query  628  SQSGEFIAVASYGSR  672
            S SG++IAV SYGSR
Sbjct  94   SLSGKYIAVGSYGSR  108



>ref|XP_006434259.1| hypothetical protein CICLE_v10000425mg [Citrus clementina]
 gb|ESR47499.1| hypothetical protein CICLE_v10000425mg [Citrus clementina]
Length=721

 Score = 98.2 bits (243),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 74/213 (35%), Positives = 108/213 (51%), Gaps = 56/213 (26%)
 Frame = +1

Query  187  TIVFSTVGRSHYGFDIFSVQLPSSFEQDR-RPASEHRLTDGVSINFNGHFL---------  336
            +I+F+T+GRS Y FDI++  LP S   DR   A+E ++TDG S+NFNGHF          
Sbjct  31   SIIFTTLGRSDYAFDIYT--LPIS---DRPTTANEIKITDGESVNFNGHFPSPSSSFLSF  85

Query  337  --------------DEGD----TFVFVSERSGSPRIY-----------------LQENRS  411
                          D  D      ++V+ER+G+  IY                 L+++ +
Sbjct  86   LLRNQTLIQSPGPQDSRDPPPLQLIYVTERNGTSNIYYDAVYYDTRRNTRSRTALEQHGA  145

Query  412  ASAGKPQ----QLLSPSGTL--FHDRPVVRDGRLLYISAHEPPKEVFKSWSALYSTHLGL  573
              + + Q     L   +G +    D+P +    L+Y+S HE P     SW+A+YST L  
Sbjct  146  EVSTRVQVPLLDLNEVNGGVISMKDKPSLSGEYLIYVSTHENPGTPRTSWAAVYSTELKT  205

Query  574  KEITRLTPYGAVDFSPSVSQSGEFIAVASYGSR  672
                RLTPYG  DFSP+VS SG++ AVASYG++
Sbjct  206  GLTRRLTPYGVADFSPAVSPSGKYTAVASYGNK  238



>emb|CDP10971.1| unnamed protein product [Coffea canephora]
Length=731

 Score = 98.2 bits (243),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 73/213 (34%), Positives = 100/213 (47%), Gaps = 57/213 (27%)
 Frame = +1

Query  187  TIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPAS--EHRLTDGVSINFNGHFLDEGDT---  351
            +IVF+T+GR+ Y FDI+S+ L  +      PAS  E +LTDGVS+NFNG+F         
Sbjct  38   SIVFTTLGRASYCFDIYSLPLWVA------PASSNELQLTDGVSVNFNGYFPSPSSVSVL  91

Query  352  --------------------FVFVSERSGSPRIYLQE----------NRSASAGKPQQLL  441
                                 V+V+ER+GS  ++L            +R+     P +  
Sbjct  92   FGAPDRTPADVSPPPPPPLHLVYVTERNGSSHVFLDSLYYRGREHAGSRAILEEDPSEST  151

Query  442  SPSGTLFH----------------DRPVVRDGRLLYISAHEPPKEVFKSWSALYSTHLGL  573
                T F                 D+P +    L+Y+S HE       SW+A+YSTHL  
Sbjct  152  RSELTRFQFPLVGLEQSDGRVSMKDKPTLVGEYLIYVSTHENTGVPRTSWAAVYSTHLKT  211

Query  574  KEITRLTPYGAVDFSPSVSQSGEFIAVASYGSR  672
                RLTPYG  DFSP+VS SG + AVASYG +
Sbjct  212  GSTRRLTPYGVADFSPAVSPSGVWTAVASYGEK  244



>ref|XP_002993240.1| hypothetical protein SELMODRAFT_136782 [Selaginella moellendorffii]
 gb|EFJ05661.1| hypothetical protein SELMODRAFT_136782 [Selaginella moellendorffii]
Length=717

 Score = 98.2 bits (243),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 72/227 (32%), Positives = 104/227 (46%), Gaps = 63/227 (28%)
 Frame = +1

Query  181  HGTIVFSTVGRSHYGFDIFSVQL-PSSFEQ-DRRPASEHRLTDGVSINFNGHFLD-----  339
             GT+ F++VGR+ Y FD+F +   P   E     P  E R TDGVS+N+NG  +D     
Sbjct  27   EGTVAFASVGRARYAFDVFLLDFRPWELENASLGPHLEFRATDGVSVNYNGALVDDSQRR  86

Query  340  ------------EGDT----FVFVSERSGSPRIYL------QENRSA------------S  417
                        +GD      ++VSER G+  +        Q +R              S
Sbjct  87   VIFEALDFRGEQQGDASQGILIYVSERDGAAEVRFNLFYQGQRDRGERSLGNIESGSQES  146

Query  418  AGKPQQLLSPSG----------------------TLFHDRPVVRDGRLLYISAHEPPKEV  531
             G  +  L   G                      T  +DRP V DGR++++S  +  ++ 
Sbjct  147  HGNRRDALEIHGDRGNSQNFIDLGKLWSSSEVEPTALYDRPSVADGRVIFVSTRKRREQS  206

Query  532  FKSWSALYSTHLGLKEITRLTPYGAVDFSPSVSQSGEFIAVASYGSR  672
             +SW+A+YS  +  K+ITRLTP G  D+SPSVS SG+F+ VAS   R
Sbjct  207  RQSWAAVYSMDIVTKKITRLTPEGVTDYSPSVSPSGKFVMVASDDGR  253



>emb|CDX84088.1| BnaC08g07650D [Brassica napus]
Length=668

 Score = 97.8 bits (242),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 69/179 (39%), Positives = 92/179 (51%), Gaps = 34/179 (19%)
 Frame = +1

Query  187  TIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPAS---EHRLTDGVSINFNGHF------LD  339
            TIVF+T+GRS Y FD+F++          RP S   E R+TDG S+NFNG+F      L 
Sbjct  33   TIVFTTLGRSRYEFDVFALST-------TRPPSISGEIRITDGESVNFNGYFPIYYDLLH  85

Query  340  EGD--------TFVFVSERSGSPRIYLQENRSASAGKPQQLLSPSGTLFHDRPVVRDGRL  495
             GD        + +  + R   P +   E+RS +              F D+P +    L
Sbjct  86   GGDPDSKSKRRSMLEATSRVQIPLLSNAEHRSGNTVNS----------FKDKPSLSGEFL  135

Query  496  LYISAHEPPKEVFKSWSALYSTHLGLKEITRLTPYGAVDFSPSVSQSGEFIAVASYGSR  672
            +Y+S HE   E   SW+A+YST L      RLTP G  DFSP++S SG + AVASYG R
Sbjct  136  VYVSTHENSGEPRTSWTAVYSTELRTGLTRRLTPSGIADFSPALSPSGNWTAVASYGER  194



>ref|XP_010477409.1| PREDICTED: uncharacterized protein LOC104756505 [Camelina sativa]
Length=711

 Score = 97.8 bits (242),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 74/206 (36%), Positives = 100/206 (49%), Gaps = 48/206 (23%)
 Frame = +1

Query  187  TIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFL----------  336
            TI+F+T+GRS Y FDIF++    S  Q    + E R+TDG S+NFNG+F           
Sbjct  35   TIIFTTLGRSRYEFDIFAL----STAQPPSVSGEFRITDGESVNFNGYFPSPSPALISLL  90

Query  337  -DEGDT---------FVFVSERSGSPRIYL-------------QENRSA--SAGKPQQLL  441
             DE             ++V+ER+G+  +Y              +  RS   +A + Q  L
Sbjct  91   PDETQIQLEDSSPLHLIYVTERNGTSSLYYDLIYEGSVESDSKRRRRSVLEAASRVQVPL  150

Query  442  SPSG---------TLFHDRPVVRDGRLLYISAHEPPKEVFKSWSALYSTHLGLKEITRLT  594
              SG           F D+P +    L+Y+S HE   E   SW+A+YST L      RLT
Sbjct  151  LLSGFDQRSGMTVNSFKDKPSLSGEFLVYVSTHENSGEPRTSWTAIYSTELRTGLTRRLT  210

Query  595  PYGAVDFSPSVSQSGEFIAVASYGSR  672
            P G  DFSP+V+ SG   AVASYG R
Sbjct  211  PSGVADFSPAVTPSGNLTAVASYGER  236



>ref|XP_009796392.1| PREDICTED: uncharacterized protein LOC104242978 [Nicotiana sylvestris]
Length=706

 Score = 97.8 bits (242),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 69/199 (35%), Positives = 104/199 (52%), Gaps = 37/199 (19%)
 Frame = +1

Query  172  MDPHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFL-----  336
            ++ + +I+F+T+GRS Y FDIF++ + S  E     ++E +LTDG S+NFNG+FL     
Sbjct  31   LNANTSIIFTTLGRSSYAFDIFALPIYSPTE-----SNELQLTDGNSVNFNGYFLATLPP  85

Query  337  ------------DEGDTF--VFVSERSGSPRIYLQE-----NRSA--------SAGKPQQ  435
                        +E   F  ++V+ER+G+  I+        +R A         + + Q 
Sbjct  86   SLVSRLPDHSLNNETPPFHLIYVTERNGTHHIFYDAVFHGTSRRAILDFPARTESTRVQV  145

Query  436  LLSPSGTLFHDRPVVRDGRLLYISAHEPPKEVFKSWSALYSTHLGLKEITRLTPYGAVDF  615
             L  +     D+P +    L+Y+S HE       SW+A+YST L      RLTP G  DF
Sbjct  146  PLVGAHVSLKDKPSLVGESLIYVSTHEDSGVPRTSWAAVYSTQLSSGSTRRLTPKGVADF  205

Query  616  SPSVSQSGEFIAVASYGSR  672
            SP+VS SG + AVASYG +
Sbjct  206  SPAVSPSGVWTAVASYGKK  224



>ref|XP_010095431.1| hypothetical protein L484_013388 [Morus notabilis]
 gb|EXB60123.1| hypothetical protein L484_013388 [Morus notabilis]
Length=732

 Score = 97.8 bits (242),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 76/208 (37%), Positives = 98/208 (47%), Gaps = 52/208 (25%)
 Frame = +1

Query  187  TIVFSTVGRSHYGFDIFSVQLPSSFEQDRRP--ASEHRLTDGVSINFNGHFLDEGDT---  351
            +IVF+T+GR  Y FDIF+  LP+    DR P  ++E ++TDG S+NFNGHF     T   
Sbjct  32   SIVFTTLGRLDYAFDIFT--LPT----DRPPTISNEIQITDGESVNFNGHFPSPSSTSSL  85

Query  352  ----------------------FVFVSERSGSPRIYLQ-----ENRSASAGKPQQLLSPS  450
                                   ++V+ER G   +Y          S S G+   L  P 
Sbjct  86   LSLLPNQTLIQTLLPTDPPPLQLIYVTERDGVSSLYYDVVFPDSPTSRSIGRRSALEFPD  145

Query  451  GTLF--------------HDRPVVRDGRLLYISAHEPPKEVFKSWSALYSTHLGLKEITR  588
               F               DRP +    L+YIS HE   +   SW+A+YST L      R
Sbjct  146  RVQFPLLGEDLIQNKISMKDRPNLAGDYLVYISTHENTGKPRTSWAAVYSTELKSGTTRR  205

Query  589  LTPYGAVDFSPSVSQSGEFIAVASYGSR  672
            LTPYG  DFSPSVS SG   AVASYG++
Sbjct  206  LTPYGVADFSPSVSPSGILTAVASYGAK  233



>ref|XP_010498624.1| PREDICTED: uncharacterized protein LOC104776288 [Camelina sativa]
Length=710

 Score = 97.1 bits (240),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 72/204 (35%), Positives = 99/204 (49%), Gaps = 46/204 (23%)
 Frame = +1

Query  187  TIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFL----------  336
            TI+F+T+GRS Y FDIF++    S  +    + E R+TDG S+NFNG+F           
Sbjct  36   TIIFTTLGRSRYEFDIFAL----STAKPPSVSDELRITDGESVNFNGYFPSPSPALISLL  91

Query  337  -DEGDT---------FVFVSERSGSPRIYL-----------QENRSASAGKPQQLLSP--  447
             DE             ++V+ER+G+  +Y            +  R +    P ++  P  
Sbjct  92   PDETQIQLEDSSPLHLIYVTERNGTSSLYYDLIYGGVDSDSKRRRRSVLEAPSRVQVPLL  151

Query  448  ------SGTL---FHDRPVVRDGRLLYISAHEPPKEVFKSWSALYSTHLGLKEITRLTPY  600
                  SG     F D+P +    L+Y+S HE   E   SW+A+YST L      RLTP 
Sbjct  152  SGFDQRSGMTVNSFKDKPSLSGEFLVYVSTHENSGEPRTSWTAVYSTELRTGLTRRLTPS  211

Query  601  GAVDFSPSVSQSGEFIAVASYGSR  672
            G  DFSP+VS SG   AVASYG R
Sbjct  212  GVADFSPAVSPSGNLTAVASYGER  235



>ref|XP_010521281.1| PREDICTED: uncharacterized protein LOC104800217 isoform X1 [Tarenaya 
hassleriana]
Length=724

 Score = 95.5 bits (236),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 71/207 (34%), Positives = 101/207 (49%), Gaps = 50/207 (24%)
 Frame = +1

Query  184  GTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPAS---EHRLTDGVSINFNGHF-------  333
             +++F+T+ RSHY FDIF+  LP+     RRP S   E R+TDG S+NFNG+F       
Sbjct  43   ASLIFATLDRSHYEFDIFT--LPTR----RRPPSASMEIRITDGESVNFNGYFPSPSPAL  96

Query  334  --------LDEGDT------FVFVSERSGSPRIYLQENRSASAGK--PQQLLSPSGTL--  459
                    L + +T       ++++ER+G+  IY        +G    + LL  S  +  
Sbjct  97   LSLLPDETLIQQETVTPPLHLIYITERNGTSSIYYDVVYGQDSGSMTKRSLLESSARVQV  156

Query  460  ----------------FHDRPVVRDGRLLYISAHEPPKEVFKSWSALYSTHLGLKEITRL  591
                              D+P +    L+Y+S HE P     SW+A+YST +      RL
Sbjct  157  PLLSGADGRSGMTVNSMRDKPSLIGDYLVYVSTHEDPGVPRASWAAVYSTQVQTGLTRRL  216

Query  592  TPYGAVDFSPSVSQSGEFIAVASYGSR  672
            TP G  DFSP+VS SG + AVASY  R
Sbjct  217  TPRGIADFSPAVSPSGNWTAVASYAER  243



>ref|XP_010521282.1| PREDICTED: uncharacterized protein LOC104800217 isoform X2 [Tarenaya 
hassleriana]
Length=725

 Score = 95.5 bits (236),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 71/207 (34%), Positives = 101/207 (49%), Gaps = 50/207 (24%)
 Frame = +1

Query  184  GTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPAS---EHRLTDGVSINFNGHF-------  333
             +++F+T+ RSHY FDIF+  LP+     RRP S   E R+TDG S+NFNG+F       
Sbjct  43   ASLIFATLDRSHYEFDIFT--LPTR----RRPPSASMEIRITDGESVNFNGYFPSPSPAL  96

Query  334  --------LDEGDT------FVFVSERSGSPRIYLQENRSASAGK--PQQLLSPSGTL--  459
                    L + +T       ++++ER+G+  IY        +G    + LL  S  +  
Sbjct  97   LSLLPDETLIQQETVTPPLHLIYITERNGTSSIYYDVVYGQDSGSMTKRSLLESSARVQV  156

Query  460  ----------------FHDRPVVRDGRLLYISAHEPPKEVFKSWSALYSTHLGLKEITRL  591
                              D+P +    L+Y+S HE P     SW+A+YST +      RL
Sbjct  157  PLLSGADGRSGMTVNSMRDKPSLIGDYLVYVSTHEDPGVPRASWAAVYSTQVQTGLTRRL  216

Query  592  TPYGAVDFSPSVSQSGEFIAVASYGSR  672
            TP G  DFSP+VS SG + AVASY  R
Sbjct  217  TPRGIADFSPAVSPSGNWTAVASYAER  243



>emb|CDY08186.1| BnaA06g15400D [Brassica napus]
Length=667

 Score = 94.7 bits (234),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 66/178 (37%), Positives = 90/178 (51%), Gaps = 33/178 (19%)
 Frame = +1

Query  187  TIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPAS---EHRLTDGVSINFNGHF--------  333
            TIVF+T+GRS Y FD+F++          RP S   E R+TDG S+NFNG+F        
Sbjct  33   TIVFTTLGRSRYEFDVFALST-------TRPPSISGEIRITDGESVNFNGYFPFLSSPSH  85

Query  334  -----LDEGDTFVFVSERSGSPRIYLQENRSASAGKPQQLLSPSGTLFHDRPVVRDGRLL  498
                   +  + +  + R   P +   E+RS +              F D+P +    L+
Sbjct  86   LRHREKRKRRSMLEATSRVQIPLLSNAEHRSGNTVNS----------FKDKPSLSGEFLV  135

Query  499  YISAHEPPKEVFKSWSALYSTHLGLKEITRLTPYGAVDFSPSVSQSGEFIAVASYGSR  672
            Y+S HE   E   SW+A+YST L      RLTP G  DFSP++S SG + AVASYG R
Sbjct  136  YVSTHENSGEPRTSWTAVYSTELRTGLTRRLTPSGIADFSPALSPSGNWTAVASYGER  193



>ref|XP_008338671.1| PREDICTED: uncharacterized protein LOC103401727 [Malus domestica]
Length=689

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 72/194 (37%), Positives = 99/194 (51%), Gaps = 39/194 (20%)
 Frame = +1

Query  187  TIVFSTVGRSHYGFDIFSVQL---PSSFEQDRRPASEHRLTDGVSINFNGHFLDEGDT--  351
            +IVF+T+GR  Y FDIF++ +   PSS        +E ++TDG S+NFNGHF ++     
Sbjct  28   SIVFTTLGRLDYNFDIFTLPIRGPPSS-------TTETQITDGKSVNFNGHFPNKTRIQS  80

Query  352  ---------FVFVSERSGSPRIYLQ----ENRSASAGKPQQL------LSPSGTL-----  459
                      ++V+ER+G   I+       + +AS+G+   L        P  +L     
Sbjct  81   PTRSDPYLQLIYVTERNGFSNIFYDAVYLNSXTASSGRRSTLEVSXRVQVPLLSLEQGQN  140

Query  460  ---FHDRPVVRDGRLLYISAHEPPKEVFKSWSALYSTHLGLKEITRLTPYGAVDFSPSVS  630
                 DRP +    L+Y+S HE       S  A+YSTHL      RLTP G  DFSPSVS
Sbjct  141  RLSMKDRPTLTGDYLVYVSTHEDSGVPRTSSVAVYSTHLDSSVTRRLTPRGDADFSPSVS  200

Query  631  QSGEFIAVASYGSR  672
             SG + AVASYG R
Sbjct  201  PSGIWTAVASYGPR  214



>gb|ABR17080.1| unknown [Picea sitchensis]
Length=714

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 69/214 (32%), Positives = 95/214 (44%), Gaps = 53/214 (25%)
 Frame = +1

Query  181  HGTIVFSTVGRSHYGFDIFSVQL-PSSFEQDRRPASEHRLTDGVSINFNGHFLDE-----  342
             GT+ F++VGR+HY FDI+++ L P  F  +     E  +TDG S+N NG +L       
Sbjct  37   QGTLAFASVGRAHYAFDIYTLPLQPLRFSTN---LEETLVTDGESVNHNGQYLQGPGIQT  93

Query  343  --------------GDTFVFVSERSGSPRIYL---------------QEN--RSASAGKP  429
                           +   FVSER G P +YL               +EN  R A     
Sbjct  94   LMHRLNINTTSTPVENVMAFVSERDGFPELYLNIYLKDNLPLLAEKAEENSRREALEDGK  153

Query  430  QQLLSPSGTLFH-------------DRPVVRDGRLLYISAHEPPKEVFKSWSALYSTHLG  570
            + L    G +F              DRP +    ++Y+S     K   KSW+A+YST + 
Sbjct  154  RCLTINFGGVFEEKGKKDMPDLSMKDRPSMAGNSMVYVSTRGQTKASRKSWAAVYSTSIK  213

Query  571  LKEITRLTPYGAVDFSPSVSQSGEFIAVASYGSR  672
                 RLTP G  D SP+VS SGE++  AS G R
Sbjct  214  TGRTRRLTPDGIADLSPAVSPSGEWVMAASAGER  247



>ref|XP_009343980.1| PREDICTED: uncharacterized protein LOC103935890 [Pyrus x bretschneideri]
Length=689

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 68/194 (35%), Positives = 98/194 (51%), Gaps = 39/194 (20%)
 Frame = +1

Query  187  TIVFSTVGRSHYGFDIFSVQL---PSSFEQDRRPASEHRLTDGVSINFNGHFLDEGDT--  351
            +IVF+T+GR  Y FDIF++ +   PSS        +E ++TDG S+NFNG+F ++     
Sbjct  28   SIVFTTLGRLDYNFDIFTLPIRGPPSS-------TTETQITDGKSVNFNGNFPNKTRIQS  80

Query  352  ---------FVFVSERSGSPRIYLQ----ENRSASAGKPQQL--------------LSPS  450
                      ++V+ER+G   I+       + +AS+G+   L                 +
Sbjct  81   PTRSDPYLQLIYVTERNGFSNIFYDAVYLNSPTASSGRRSTLEVSDRVQIPLLSLEQGQN  140

Query  451  GTLFHDRPVVRDGRLLYISAHEPPKEVFKSWSALYSTHLGLKEITRLTPYGAVDFSPSVS  630
                 DRP +    L+Y+S HE       S +A+YSTHL      RLTP G  DFSP+VS
Sbjct  141  RLSMKDRPTLTGDYLVYVSTHEDSGVPRTSSAAVYSTHLDSGVTRRLTPRGVADFSPAVS  200

Query  631  QSGEFIAVASYGSR  672
             SG + AVASYG R
Sbjct  201  PSGIWTAVASYGPR  214



>ref|XP_008219596.1| PREDICTED: uncharacterized protein LOC103319783 [Prunus mume]
Length=697

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 65/191 (34%), Positives = 94/191 (49%), Gaps = 32/191 (17%)
 Frame = +1

Query  187  TIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFL----------  336
            +IVF+T+GR  Y FDIF++ +          A+E R+TD  S+NFNG+F           
Sbjct  28   SIVFTTLGRLDYYFDIFTLPIQGGLPS---AATETRITDAKSVNFNGYFPNLTRIPSHTR  84

Query  337  -DEGDTFVFVSERSGSPRIYLQE----------NRSASAGKPQQLLSPSGTL--------  459
             D     ++V+ER+G   IY              R ++     ++  P  +L        
Sbjct  85   PDPSLHLIYVTERNGFFNIYYDGVYLTSPTTIGGRRSALEVSDRIQVPLLSLEQGQNRFS  144

Query  460  FHDRPVVRDGRLLYISAHEPPKEVFKSWSALYSTHLGLKEITRLTPYGAVDFSPSVSQSG  639
              DRP +    L+Y+S HE       S +A+YSTH+      RLTP+G  DFSP+VS SG
Sbjct  145  MKDRPSLTGDYLVYVSTHEDSGVPRTSSAAVYSTHINSGVTQRLTPHGIADFSPAVSPSG  204

Query  640  EFIAVASYGSR  672
             + AVASYG +
Sbjct  205  VWTAVASYGPK  215



>ref|XP_004290903.2| PREDICTED: uncharacterized protein LOC101292474 [Fragaria vesca 
subsp. vesca]
Length=716

 Score = 87.0 bits (214),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 67/200 (34%), Positives = 95/200 (48%), Gaps = 35/200 (18%)
 Frame = +1

Query  166  MIMDPHG--TIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFL-  336
            +  + HG  +IVF+T GR  Y FDIF++ +         P +E R+TDG S+NFNGHF  
Sbjct  42   ITAEDHGPSSIVFTTNGRLDYYFDIFTLPV----AHPTHPIAETRITDGQSVNFNGHFPS  97

Query  337  ----------------DEGDTFVFVSERSGSPRIYLQE-------NRSASAGKPQQ----  435
                            D     ++V+ER+G   I+          +R  SA +       
Sbjct  98   STFFPNQTRLRSPNRPDPSLQIIYVTERNGFSNIFYDAVYFDDSPSRKRSALEVVDRVQL  157

Query  436  -LLSPSGTLFHDRPVVRDGRLLYISAHEPPKEVFKSWSALYSTHLGLKEITRLTPYGAVD  612
             LL        D+P +    L+Y+S HE       S +A+Y+T L      RLTP+G  D
Sbjct  158  PLLGSDRVSMKDKPSLTGEYLVYVSTHEDSGVPRTSSAAVYATELSSGLTRRLTPHGVAD  217

Query  613  FSPSVSQSGEFIAVASYGSR  672
            FSP+VS SG + A ASYG +
Sbjct  218  FSPAVSPSGVWTAAASYGEK  237



>ref|XP_001780675.1| predicted protein [Physcomitrella patens]
 gb|EDQ54561.1| predicted protein [Physcomitrella patens]
Length=710

 Score = 86.7 bits (213),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 61/190 (32%), Positives = 91/190 (48%), Gaps = 24/190 (13%)
 Frame = +1

Query  175  DPHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPA-----SEHRLTDGVSINFNGHFL-  336
            D  GTI FST+GR  + FD+++V                   E R+T G S+N+N   L 
Sbjct  25   DAGGTIGFSTLGRLSFAFDVYTVVFSQMGVLRGGGGGVGDFQETRVTLGESVNYNAQLLE  84

Query  337  ----DEGDTFVFVSERSGSPRIYLQ---ENRSASAGKP-----------QQLLSPSGTLF  462
                D  +  ++VSE  GSP++YL      R A    P            +L +PS    
Sbjct  85   GSGSDVPELLLYVSEVEGSPQLYLDVPLTGRFAIDRLPTRSSRRIELLADRLNAPSKAFL  144

Query  463  HDRPVVRDGRLLYISAHEPPKEVFKSWSALYSTHLGLKEITRLTPYGAVDFSPSVSQSGE  642
            +DRP +     +++S  E   +  + W+A+YS +     + RLTP G  D+SP+VS SGE
Sbjct  145  NDRPSMIGDVFIFVSTEEDVGKPVQGWNAVYSLNFITSVVKRLTPPGITDYSPAVSPSGE  204

Query  643  FIAVASYGSR  672
            ++AV S   R
Sbjct  205  WVAVGSNEGR  214



>ref|XP_002448903.1| hypothetical protein SORBIDRAFT_05g001167 [Sorghum bicolor]
 gb|EES07891.1| hypothetical protein SORBIDRAFT_05g001167 [Sorghum bicolor]
Length=98

 Score = 71.6 bits (174),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 54/84 (64%), Gaps = 9/84 (11%)
 Frame = +1

Query  172  MDPHGTIVFSTVGRSHYGFDIFSVQL--PSSFEQDRRPA------SEHRLTDGVSINFNG  327
            M+P GTIVF++VG +++GFD+FS+ +  P+S E             E   T+GVS+NFN 
Sbjct  1    MEPTGTIVFASVGVTNFGFDVFSIVVLTPASAEAKAEAGVSAQELDEQHHTNGVSVNFNA  60

Query  328  HFLDE-GDTFVFVSERSGSPRIYL  396
             F D+ GD  VFVSER+G+  ++L
Sbjct  61   QFADDAGDAVVFVSERTGAASLFL  84



>ref|XP_010675830.1| PREDICTED: uncharacterized protein LOC104891773 [Beta vulgaris 
subsp. vulgaris]
Length=886

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 59/200 (30%), Positives = 84/200 (42%), Gaps = 35/200 (18%)
 Frame = +1

Query  154  KPPIMIMDPHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHF  333
            K P +I +  G+I F    R     DI+S + P +  QD     E  +TDG S N+NG  
Sbjct  174  KIPKVIKEKKGSIAFFATYRPPVALDIYSTKYPLTSNQD-----EILMTDGHSYNYNGQV  228

Query  334  L---------------DEGDT----------FVFVSERSGSPR-----IYLQENRSASAG  423
            +               D G             +FVSERS +       +  Q+       
Sbjct  229  IPPLALKIMLQRPLLRDHGTERDVNLGRLSGMIFVSERSHNLETLHIALLFQDQPPKVFN  288

Query  424  KPQQLLSPSGTLFHDRPVVRDGRLLYISAHEPPKEVFKSWSALYSTHLGLKEITRLTPYG  603
              +   +  G    D   +    L+Y+S  EP  E  + W+A+Y T+L   +  RLT  G
Sbjct  289  FAEVYDTFKGVRMEDSGCIAGDYLIYVSTMEPSPEPHQPWTAVYKTNLKTGKTERLTLQG  348

Query  604  AVDFSPSVSQSGEFIAVASY  663
              D SPSVS  G+ IAVAS+
Sbjct  349  QADLSPSVSPDGKRIAVASF  368



>gb|EAY93383.1| hypothetical protein OsI_15178 [Oryza sativa Indica Group]
Length=470

 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 59/169 (35%), Positives = 84/169 (50%), Gaps = 20/169 (12%)
 Frame = +1

Query  184  GTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHF--LDEGDTFV  357
            GTIVF+T+GRS Y F IFS+ L  S      PA+E  LTDGVS+N+NG+F      D+ +
Sbjct  24   GTIVFTTLGRSRYEFSIFSLPLSPS---PHNPATELYLTDGVSVNYNGNFAPTSHSDSIL  80

Query  358  FVSERSGSPRIYL-------QENRSASAGKPQQLLSPSGTLFHDRPVVRDGRLLYISAHE  516
            FVS+R+GS  +YL        E   A+A  P    +PS      R   R        +  
Sbjct  81   FVSKRNGSLNLYLSPVPSSRHEALEAAALSPLLPGNPS----RSRTGYRSHPTAPTLSTS  136

Query  517  PPKEVFKSWSALYSTHLGLKEITRLTPYGAVDFSPSVSQSGE-FIAVAS  660
            PP    ++ +A     +    + R+TP G   F+P+ S      +AVA+
Sbjct  137  PPPSPLRNRAA---AGVEAASVERITPRGFHAFTPAASPGAPGLVAVAT  182



>ref|XP_010675837.1| PREDICTED: uncharacterized protein LOC104891780 [Beta vulgaris 
subsp. vulgaris]
Length=722

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 59/202 (29%), Positives = 85/202 (42%), Gaps = 41/202 (20%)
 Frame = +1

Query  169  IMDPHGTIVFSTVGRSHYGFDIFSVQL-PSSFEQDRRPASEHRLTDGVSINFNGHFL---  336
            + D  G++ F T  R    FDI+S  + P+S E       E  +TD +S N NGHF+   
Sbjct  1    MADNRGSLSFFTTYRPTVKFDIYSCPISPTSIED------EICMTDELSYNSNGHFIAPE  54

Query  337  ----------------------DEGDTFVFVSERSGSPRIYLQENRSASAGKPQQLLSPS  450
                                        +FVSER G+    L  +       P   + P 
Sbjct  55   ALKKILKHPKIASEVDDDDVDSGRLTGLIFVSER-GNGLETLHLSLRLDDEPPVYEVFPI  113

Query  451  GTLFH--------DRPVVRDGRLLYISAHEPPKEVFKSWSALYSTHLGLKEITRLTPYGA  606
              L+H        D   +    L+Y++  +P  E  + W+ +Y THL   E TRLTP G 
Sbjct  114  SHLYHTFNGVRMEDSGCIAGDYLIYVTTKDPASERRQPWTTVYKTHLITGETTRLTPEGL  173

Query  607  VDFSPSVSQSGEFIAVASYGSR  672
             D SP+VS  G  IA+AS+  +
Sbjct  174  ADLSPAVSPCGTKIAMASFEGK  195



>ref|XP_010675836.1| PREDICTED: uncharacterized protein LOC104891779 [Beta vulgaris 
subsp. vulgaris]
Length=723

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 59/199 (30%), Positives = 83/199 (42%), Gaps = 42/199 (21%)
 Frame = +1

Query  184  GTIVFSTVGRSHYGFDIFSVQL-PSSFEQDRRPASEHRLTDGVSINFNGHFL--------  336
            G++ F T  R     DI+S  + P+S +       E  +TD +S N NGHF+        
Sbjct  6    GSLSFFTTYRPTVKLDIYSCPISPTSIDD------EICMTDELSYNSNGHFIEPEALKII  59

Query  337  -----------DEGDT-------FVFVSERSGSPRIYLQENRSASAGKPQQLLSP-----  447
                       DE D         +FVSER       L  +       P   + P     
Sbjct  60   LQHPKIASESVDEEDVDSGHLTGLIFVSERENGLET-LHLSLRLDDEPPVFEVFPISHVY  118

Query  448  ---SGTLFHDRPVVRDGRLLYISAHEPPKEVFKSWSALYSTHLGLKEITRLTPYGAVDFS  618
                G    D   +    L+Y++  +P  E  + W+A+Y THL   E TRLTP G  D S
Sbjct  119  DTFDGVRMEDSGCIAGDYLIYVTTKDPALERRQPWTAVYKTHLITGETTRLTPEGEADLS  178

Query  619  PSVSQSGEFIAVASYGSRP  675
            P+VS  G  IA+AS+  +P
Sbjct  179  PAVSPCGTKIAMASFEGKP  197



>ref|XP_011003182.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC105109992 
[Populus euphratica]
Length=270

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 42/65 (65%), Gaps = 5/65 (8%)
 Frame = +1

Query  493  LLYISAHEPPKEVFKSWSALYST-----HLGLKEITRLTPYGAVDFSPSVSQSGEFIAVA  657
              +ISAHE P + FKSWS LY T     H    +  RLTP+GAV +SP++S S  FIAVA
Sbjct  14   FYFISAHEKPDQPFKSWSTLYXTIVDHIHYRTSKFIRLTPHGAVYYSPAISLSANFIAVA  73

Query  658  SYGSR  672
            S GSR
Sbjct  74   SDGSR  78



>ref|XP_003570812.2| PREDICTED: uncharacterized protein LOC100837266 [Brachypodium 
distachyon]
Length=852

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 65/213 (31%), Positives = 91/213 (43%), Gaps = 54/213 (25%)
 Frame = +1

Query  175  DPHGTIVFSTVGRSHYGFDIFSVQL-PSSFEQDRRPASEHRLTDGVSINFNGHFL-----  336
            +P G IVFS    +   FDIFS  L PSS         E  LTDGVS N+NG  +     
Sbjct  127  EPGGRIVFSRTNGTLVSFDIFSSPLSPSS-------TYELPLTDGVSYNYNGQAIPPAAL  179

Query  337  --------------------DEGDT--FVFVSER-SGSPRIYLQENRSASAGKPQQLLSP  447
                                D G+    +FVSER +G   +Y+  + +A +   + +   
Sbjct  180  KTLLKNPKLADKADANDADIDAGNVSGLIFVSERDNGLETLYIALHFNAGSNILKVIALA  239

Query  448  --------SGTLFHDRPVVRDGR----------LLYISAHEPPKEVFKSWSALYSTHLGL  573
                    SG    D   +  G           L+Y+S  E  +E    W+ +Y T+L  
Sbjct  240  DIFGAADFSGVRLEDSGCIGGGYSVGCRTVDHCLIYVSTKEAAQERRSPWTVVYKTNLTT  299

Query  574  KEITRLTPYGAVDFSPSVSQSGEFIAVASYGSR  672
             +  RLTP G  D SP+VS SG  +AVAS+ S+
Sbjct  300  GKTERLTPQGVFDLSPAVSPSGMMVAVASFESK  332



>ref|XP_010102639.1| hypothetical protein L484_010931 [Morus notabilis]
 gb|EXB93789.1| hypothetical protein L484_010931 [Morus notabilis]
Length=714

 Score = 65.1 bits (157),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 56/200 (28%), Positives = 85/200 (43%), Gaps = 40/200 (20%)
 Frame = +1

Query  166  MIMDPHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFL---  336
            M     G+I F    R     DIFS  +P + ++D     E  +TDGVS N+N   +   
Sbjct  1    MADQKRGSIAFFATYRPPVPLDIFSCPIPPTSKKD-----ELHMTDGVSYNYNAQVIPPA  55

Query  337  -----------------DEGDT-----FVFVSERSGSPRIYLQENRSASAGKPQQLLSPS  450
                             D+ D+      +FVSER     +++    +       ++ S +
Sbjct  56   ALKTILKRPKVASEANEDDVDSGRLSGMIFVSERGNLETLHIALRFNDETAPKVKVFSLA  115

Query  451  ---------GTLFHDRPVVRDGRLLYISAHEPPKEVFKSWSALYSTHLGLKEITRLTPYG  603
                     G    D   +    L+YI+  +P  +  + W+A+Y T+L   E  RLTP  
Sbjct  116  DVFGAATFNGVRMEDSGCIAGDHLVYITTKDP-ADRHQPWTAVYKTNLVTGETDRLTPSE  174

Query  604  AVDFSPSVSQSGEFIAVASY  663
              D SPSVS SG+ IAVAS+
Sbjct  175  HSDLSPSVSPSGKKIAVASF  194



>ref|XP_002524154.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF38217.1| conserved hypothetical protein [Ricinus communis]
Length=724

 Score = 65.1 bits (157),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 59/210 (28%), Positives = 87/210 (41%), Gaps = 47/210 (22%)
 Frame = +1

Query  169  IMDPHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFN--------  324
            + +  G+I F    R     DIFS  +P +  QD     E  +TDG+S N+N        
Sbjct  1    MAEKRGSIAFFATYRPPVPLDIFSCSVPPTSRQD-----ELHMTDGLSYNYNCQLIPPEA  55

Query  325  ---------------GHFLDEG--DTFVFVSERSGSPR---IYLQENRSASAGKPQQLLS  444
                           G  +D G     +FVSER  +     I L+ N +  + K      
Sbjct  56   LKTIIKRPKLASEAKGSDVDSGRLSGLIFVSERDNNLETLHIALRFNDNPPSVKVFSFAD  115

Query  445  PSGTL----FHDRPVVR----------DGRLLYISAHEPPKEVFKSWSALYSTHLGLKEI  582
              GT       D   +           D  L+Y++  +P K+  + W+ +Y T+L   + 
Sbjct  116  VYGTFDGVRMEDSGCIAGGYKVGSRTADCSLIYVTTKDPSKDRRQPWTVVYKTNLKTGKT  175

Query  583  TRLTPYGAVDFSPSVSQSGEFIAVASYGSR  672
             RLTP G  D SPSVS SG  +AVAS+  +
Sbjct  176  DRLTPSGVNDLSPSVSPSGRKVAVASFQGK  205



>gb|EMT29283.1| hypothetical protein F775_17496 [Aegilops tauschii]
Length=869

 Score = 65.1 bits (157),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 59/208 (28%), Positives = 88/208 (42%), Gaps = 50/208 (24%)
 Frame = +1

Query  184  GTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFL---------  336
            G IVFST  R    FDIF+     S   +     E  LTDGVS N+NG  +         
Sbjct  34   GRIVFSTAYRPPVPFDIFACPFSPSCTNE-----ELHLTDGVSYNYNGCSIPPAALKTLL  88

Query  337  -------DEGDT-----------FVFVSERSGS---------------PRIYLQENRSAS  417
                   ++G T            +FVSER+                  +++   +   +
Sbjct  89   KNPKLAEEDGTTDADVDAGHVSGLIFVSERNDGLEILHIALHFNVDSRVKVFALADIFGA  148

Query  418  AGKPQQLLSPSGTL---FHDRPVVRDGRLLYISAHEPPKEVFKSWSALYSTHLGLKEITR  588
            A      L  SG +   ++    +    L+Y S  EP ++    W+ +Y T+L   +  R
Sbjct  149  ANFIGPRLEDSGCIGGGYNVGSRMVGHSLIYTSTKEPVQQCRSPWTVVYKTNLSTGKTER  208

Query  589  LTPYGAVDFSPSVSQSGEFIAVASYGSR  672
            LTP G  D SP+VS SG+ +AVAS+ S+
Sbjct  209  LTPQGVFDLSPAVSPSGKMVAVASFQSK  236



>ref|XP_010675829.1| PREDICTED: uncharacterized protein LOC104891772 [Beta vulgaris 
subsp. vulgaris]
Length=731

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 53/193 (27%), Positives = 80/193 (41%), Gaps = 35/193 (18%)
 Frame = +1

Query  175  DPHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFL------  336
            +  G+I F    R     DI+S       +Q +    E  +TDG++ N+NG  +      
Sbjct  7    NKRGSIAFFATYRPPVALDIYSAP-----DQPKSRHDEVLMTDGMAYNYNGQVIPPLALK  61

Query  337  --------------DEGDT-----FVFVSERSGSPR-----IYLQENRSASAGKPQQLLS  444
                          D+ D+      +FVSER+ S       +  Q+         +   +
Sbjct  62   TMLKRPLMASHGTEDDVDSGRLSGLIFVSERTNSLETLHIALLFQDQPPKVFNFAEVYDT  121

Query  445  PSGTLFHDRPVVRDGRLLYISAHEPPKEVFKSWSALYSTHLGLKEITRLTPYGAVDFSPS  624
              G    D   +    L+Y+S  EP  E  + W+A+Y T+L      RLT  G  D SPS
Sbjct  122  FKGVRMEDSGCIAGNYLIYVSTMEPASEPHQPWTAVYKTNLTTAITERLTLKGQADLSPS  181

Query  625  VSQSGEFIAVASY  663
            VS  G+ IAVAS+
Sbjct  182  VSPDGKRIAVASF  194



>ref|XP_002467956.1| hypothetical protein SORBIDRAFT_01g037140 [Sorghum bicolor]
 gb|EER94954.1| hypothetical protein SORBIDRAFT_01g037140 [Sorghum bicolor]
Length=724

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 64/208 (31%), Positives = 84/208 (40%), Gaps = 51/208 (25%)
 Frame = +1

Query  184  GTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFL---------  336
            G+I F T  R     DIF   +P S +QD     E  LTDG+S N+N   +         
Sbjct  6    GSIAFFTSYRPPVALDIFCCPVPPSSKQD-----ELHLTDGLSYNYNCRPIPPAALKTII  60

Query  337  ------------DEGDT-----FVFVSERSGSPRIYLQENRSASAGKPQQLLSP------  447
                        D+ D+      VFVSER  S    L       A    ++ S       
Sbjct  61   KRLRLAPEAVIDDDVDSGHLTGLVFVSEREHSLET-LHVALRFVANNEVKIFSLADIYGS  119

Query  448  ---SGTLFHDRPVV----------RDGRLLYISAHEPPKEVFKSWSALYSTHLGLKEITR  588
               SG    D   +           D  L+Y+S  EP +E    W+ +Y T+L   E   
Sbjct  120  DLFSGARLEDNGCIAGGYEVDGSTNDHYLVYVSTKEPVQERRSPWNVVYKTNLRTSETEH  179

Query  589  LTPYGAVDFSPSVSQSGEFIAVASYGSR  672
            LTP G  D SPSVS SG+ IAVAS+  +
Sbjct  180  LTPPGTFDLSPSVSPSGKKIAVASFQGK  207



>ref|NP_001049934.1| Os03g0314500 [Oryza sativa Japonica Group]
 gb|ABF95608.1| WD40-like Beta Propeller Repeat family protein, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF11848.1| Os03g0314500 [Oryza sativa Japonica Group]
 gb|EAZ26709.1| hypothetical protein OsJ_10615 [Oryza sativa Japonica Group]
Length=730

 Score = 62.0 bits (149),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 65/205 (32%), Positives = 78/205 (38%), Gaps = 50/205 (24%)
 Frame = +1

Query  184  GTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLD--------  339
            G+I F    R     DIF    P S      P  E  LTDG S N+N   +         
Sbjct  6    GSIAFFASYRPPVALDIFCCPAPPS-----SPKDELHLTDGDSYNYNCQPIPPAALKTVV  60

Query  340  -----------EGDT-------FVFVSERSGSPRIYLQENRSASAGKPQQLLSP------  447
                       EGD         VFVSER  +        R    G+ Q           
Sbjct  61   ERLGVSRGDAVEGDIDSGRITGLVFVSEREHNLETLHIALRFNDDGEVQVFSLADAYGGD  120

Query  448  ---SGTLFHDRPVVR-----DGR-----LLYISAHEPPKEVFKSWSALYSTHLGLKEITR  588
               SG    D   +      DGR     L+Y+S  EP +E    W+  Y T+L   E  R
Sbjct  121  GLFSGARMEDSGCIAGGYEVDGRTVDHYLVYVSTKEPVRERRSPWNVAYKTNLRTGETER  180

Query  589  LTPYGAVDFSPSVSQSGEFIAVASY  663
            LTP G  D SPSVS SG+ +AVASY
Sbjct  181  LTPPGTFDISPSVSPSGKKVAVASY  205



>gb|EAY89757.1| hypothetical protein OsI_11300 [Oryza sativa Indica Group]
Length=737

 Score = 62.0 bits (149),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 65/211 (31%), Positives = 81/211 (38%), Gaps = 50/211 (24%)
 Frame = +1

Query  166  MIMDPHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLD--  339
            ++ +  G+I F    R     DIF    P S      P  E  LTDG S N+N   +   
Sbjct  7    IMGESRGSIAFFASYRPPVALDIFCCPAPPS-----SPKDELHLTDGDSYNYNCQPIPPA  61

Query  340  -----------------EGDT-------FVFVSERSGSPRIYLQENRSASAGKPQQLLSP  447
                             EGD         VFVSER  +        R    G+ Q     
Sbjct  62   ALKTVVERLGVSRGDAIEGDIDSGRITGLVFVSEREHNLETLHIALRFNDDGEVQVFSLA  121

Query  448  ---------SGTLFHDRPVVR-----DGR-----LLYISAHEPPKEVFKSWSALYSTHLG  570
                     SG    D   +      DGR     L+Y+S  EP +E    W+  Y T+L 
Sbjct  122  DAYGGDGLFSGARMEDSGCIAGGYEVDGRTVDHYLVYVSTKEPVRERRSPWNVAYKTNLR  181

Query  571  LKEITRLTPYGAVDFSPSVSQSGEFIAVASY  663
              E  RLTP G  D SPSVS SG+ +AVASY
Sbjct  182  TGETERLTPPGTFDISPSVSPSGKKVAVASY  212



>ref|XP_002519802.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF42598.1| conserved hypothetical protein [Ricinus communis]
Length=724

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 57/210 (27%), Positives = 85/210 (40%), Gaps = 47/210 (22%)
 Frame = +1

Query  169  IMDPHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFL----  336
            + +  G+I F    R     DIFS  +P    QD     E  +TDG+S N+N   +    
Sbjct  1    MAEKRGSIAFFATYRPPVPLDIFSCSVPPRSRQD-----ELHMTDGLSYNYNCQIIPPEA  55

Query  337  --------------DEGDT-------FVFVSERSG---SPRIYLQENRSASAGKPQQLLS  444
                           E D         +FVSER     + +I L+ N +  + K      
Sbjct  56   LKTIIKRPILASEAKEADVDSGRLTGLIFVSERDNNLETLQIALRFNDNRPSVKVFSFAD  115

Query  445  PSGTL----FHDRPVVRDG----------RLLYISAHEPPKEVFKSWSALYSTHLGLKEI  582
              GT       D   +  G           L++++  +P K+  + W+ +Y T+L     
Sbjct  116  VYGTFDVVRMEDSGCIAGGYKIGNRIVDYSLIHVTTKDPSKDRRQPWTVVYKTNLRTGRT  175

Query  583  TRLTPYGAVDFSPSVSQSGEFIAVASYGSR  672
             RLTP G  D SPSVS SG  +AVAS+  +
Sbjct  176  ERLTPPGVNDLSPSVSPSGRKVAVASFQGK  205



>ref|XP_007223068.1| hypothetical protein PRUPE_ppa003730mg [Prunus persica]
 gb|EMJ24267.1| hypothetical protein PRUPE_ppa003730mg [Prunus persica]
Length=553

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 33/69 (48%), Positives = 43/69 (62%), Gaps = 0/69 (0%)
 Frame = +1

Query  466  DRPVVRDGRLLYISAHEPPKEVFKSWSALYSTHLGLKEITRLTPYGAVDFSPSVSQSGEF  645
            DRP +    L+Y+S HE       S +A+YSTH+      RLTP+G  DFSP+VS SG +
Sbjct  3    DRPSLTGEYLVYVSTHEDSGVPRTSSAAVYSTHINSGVTQRLTPHGIADFSPAVSPSGVW  62

Query  646  IAVASYGSR  672
             AVASYG +
Sbjct  63   TAVASYGPK  71



>ref|XP_010235117.1| PREDICTED: uncharacterized protein LOC100846313 [Brachypodium 
distachyon]
Length=751

 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 67/211 (32%), Positives = 89/211 (42%), Gaps = 50/211 (24%)
 Frame = +1

Query  166  MIMDPHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFL---  336
            M  +  G I F    R     DIFS  +P S  +D     E  LTDGVS N++   +   
Sbjct  1    MAGESRGNIAFFATYRPPVPLDIFSSPVPPSSSRD-----EVHLTDGVSYNYDCRPIPAS  55

Query  337  -------------DEGDT-----------FVFVSERSG---SPRIYL---QENRSASAGK  426
                         D G T            VFVSER G   + RI L   ++N++     
Sbjct  56   ALKALLRRPKLAADGGATEADVDAGRVSGLVFVSERDGGLETLRIALRFDKDNKTKVFSL  115

Query  427  PQQLLSP--SGTLFHDRPVVRDG----------RLLYISAHEPPKEVFKSWSALYSTHLG  570
                 S   SGT   D      G           L+Y+S  EP K+    W+ +Y T+L 
Sbjct  116  ADVFGSGDFSGTRLEDSGCFGGGYKVGSRTVDHSLIYVSTKEPVKDRRSPWTVVYKTNLR  175

Query  571  LKEITRLTPYGAVDFSPSVSQSGEFIAVASY  663
              +  RLTP GA D SP+VS SG+ +AVAS+
Sbjct  176  TGKTERLTPKGAYDLSPAVSPSGKKVAVASF  206



>ref|XP_002520327.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF42113.1| conserved hypothetical protein [Ricinus communis]
Length=540

 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 33/72 (46%), Positives = 43/72 (60%), Gaps = 3/72 (4%)
 Frame = +1

Query  466  DRPVVRDGRLLYISAHEP---PKEVFKSWSALYSTHLGLKEITRLTPYGAVDFSPSVSQS  636
            D P+     L+ +    P   P++   SW+A+YST L      RLTPYG  DFSP+VS S
Sbjct  2    DHPIFTSTNLIMMPREAPDRDPQKPRASWAAVYSTGLKSGFTRRLTPYGVADFSPAVSPS  61

Query  637  GEFIAVASYGSR  672
            G + AVASYG+R
Sbjct  62   GVYTAVASYGAR  73



>gb|EMT08438.1| hypothetical protein F775_30261 [Aegilops tauschii]
Length=806

 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 71/242 (29%), Positives = 93/242 (38%), Gaps = 53/242 (22%)
 Frame = +1

Query  91   YVISHRFFPLCTQILSSLR----IPKPPIMIMDPHGTIVFSTVGRSHYGFDIFSVQLPSS  258
            Y   H F P  T     LR    I    + + +  G+I F    R     DIF    P+S
Sbjct  37   YNTLHYFLPYSTVPYRWLRLILLITTSILKMGESRGSIAFFACYRPPVPLDIFCCPAPAS  96

Query  259  FEQDRRPASEHRLTDGVSINFNGH------------------------FLDEG--DTFVF  360
                   A E  LTDGVS N+N                           +D G     VF
Sbjct  97   SR-----AEERHLTDGVSYNYNCQPIPSAALKTIVKHLDLAPEDVEEAAIDSGRLTGLVF  151

Query  361  VSERS---GSPRIYLQ-----ENRSASAGKPQQLLSPSGTLFHDRPVVRDGR--------  492
            VSER     +  I L+     E R  + G        SG    D   +  G         
Sbjct  152  VSERQHHLETLHIGLRFDDGDEVRVFTLGDIYGGDFFSGARLEDSGCIAGGYEVDGHTAD  211

Query  493  --LLYISAHEPPKEVFKSWSALYSTHLGLKEITRLTPYGAVDFSPSVSQSGEFIAVASYG  666
              L+++S  EP +E    W+ +Y T+L   E  RLTP G  D SPSVS SG+ +AVAS+ 
Sbjct  212  HYLVFVSTKEPVQERRSPWNVVYKTNLRTGETERLTPPGTSDLSPSVSPSGKRVAVASFQ  271

Query  667  SR  672
             +
Sbjct  272  GK  273



>ref|XP_003574472.1| PREDICTED: uncharacterized protein LOC100838501 [Brachypodium 
distachyon]
Length=752

 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 67/211 (32%), Positives = 89/211 (42%), Gaps = 50/211 (24%)
 Frame = +1

Query  166  MIMDPHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFL---  336
            M  +  G I F    R     DIFS  +P S  +D     E  LTDGVS N++   +   
Sbjct  1    MAGESRGNIAFFATYRPPVPLDIFSSPVPPSSSRD-----EVHLTDGVSYNYDCRPIPAS  55

Query  337  -------------DEGDT-----------FVFVSERSG---SPRIYL---QENRSASAGK  426
                         D G T            VFVSER G   + RI L   ++N++     
Sbjct  56   ALKALLRRPKLAADGGATEADVDAGRVSGLVFVSERDGGLETLRIALRFDKDNKTKVFSL  115

Query  427  PQQLLSP--SGTLFHDRPVVRDG----------RLLYISAHEPPKEVFKSWSALYSTHLG  570
                 S   SGT   D      G           L+Y+S  EP K+    W+ +Y T+L 
Sbjct  116  ADVFGSGDFSGTRLEDSGCFGGGYKVGSRTVDHSLIYVSTKEPVKDRRSPWTVVYKTNLR  175

Query  571  LKEITRLTPYGAVDFSPSVSQSGEFIAVASY  663
              +  RLTP GA D SP+VS SG+ +AVAS+
Sbjct  176  TGKTERLTPKGAYDLSPAVSPSGKKVAVASF  206



>ref|XP_010087211.1| hypothetical protein L484_006140 [Morus notabilis]
 gb|EXB28518.1| hypothetical protein L484_006140 [Morus notabilis]
Length=726

 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 58/201 (29%), Positives = 80/201 (40%), Gaps = 38/201 (19%)
 Frame = +1

Query  169  IMDPHGTIVFSTVGRSHYGFDIFSV--QLPSSFEQDRRPASEHRLTDGVSINFNGHFL--  336
            + +  G+I F    R     DIFS   +LP +    +    E  +TDG S N+N   +  
Sbjct  1    MAEKRGSIAFFATYRPPVALDIFSCPQELPQTTSNHQ--GHEVHMTDGKSYNYNAKVIPP  58

Query  337  -----------------------DEG--DTFVFVSERSG--SPRIYLQENRSA-----SA  420
                                   D G     +FVSER    +  I L+ N        S 
Sbjct  59   AALKTILKRPELASQRIYKAADVDSGHLSGLIFVSERDNLETLHIALRFNDDTVPKVFSL  118

Query  421  GKPQQLLSPSGTLFHDRPVVRDGRLLYISAHEPPKEVFKSWSALYSTHLGLKEITRLTPY  600
                   S +G    D        L+Y+S  EP     + W+A+Y T+L   +  RLTP 
Sbjct  119  ADVFGTRSFNGVRMEDSGCFAGDYLIYVSTKEPAVRRRQPWTAVYRTNLKTGKTDRLTPL  178

Query  601  GAVDFSPSVSQSGEFIAVASY  663
            G  D SPSVS  G+ IAVAS+
Sbjct  179  GEADLSPSVSPCGKKIAVASF  199



>ref|XP_008662981.1| PREDICTED: uncharacterized protein LOC103641407 [Zea mays]
 gb|AFW57694.1| putative WD40-like beta propeller repeat family protein [Zea 
mays]
Length=730

 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 63/207 (30%), Positives = 86/207 (42%), Gaps = 52/207 (25%)
 Frame = +1

Query  184  GTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFL---------  336
            G+I F    R     DIFSV +P S  +D     E  LTDGVS N+N   +         
Sbjct  6    GSIAFFATYRPPVPLDIFSVPIPPSSIRD-----EVHLTDGVSYNYNCRPIPKDALKSLL  60

Query  337  -------DEGDT-----------FVFVSERSG---SPRIYLQ-ENRSASAGKPQQLLSP-  447
                   D G T            +FVSER     + R+ L  ++    A K   L    
Sbjct  61   KRPKLAADGGATDADVDSGRVSGLLFVSERDDGLETLRVALHFKDSGEQACKVFSLADVF  120

Query  448  -----SGTLFHDRPVVRDG----------RLLYISAHEPPKEVFKSWSALYSTHLGLKEI  582
                 SG    D   V  G           L+Y+S  EP +E    W+ +Y T+L   + 
Sbjct  121  GAADFSGVRLEDSGCVGGGYKVGSRTVDHSLIYVSTKEPVQERRSPWTVVYKTNLRTGKT  180

Query  583  TRLTPYGAVDFSPSVSQSGEFIAVASY  663
             RLTP G  D SP+VS SG+ +A+A++
Sbjct  181  ERLTPKGQFDLSPAVSPSGKKVAMATF  207



>ref|XP_002446045.1| hypothetical protein SORBIDRAFT_06g000930 [Sorghum bicolor]
 gb|EES10373.1| hypothetical protein SORBIDRAFT_06g000930 [Sorghum bicolor]
Length=730

 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 62/210 (30%), Positives = 82/210 (39%), Gaps = 57/210 (27%)
 Frame = +1

Query  184  GTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGH-----------  330
            G+I F    R     DIFSV  P S  +D     E  LTDGVS N+N             
Sbjct  6    GSIAFFATYRPPMPLDIFSVPNPPSSIRD-----EVHLTDGVSYNYNCRPIPKDALKSLL  60

Query  331  ----FLDEGDT------------FVFVSERSGSPRIYLQENRSASAGKPQQL--------  438
                 + EG               +FVSER G         R   +G  Q          
Sbjct  61   KRPKLVAEGGATDADVDSGRVSGLLFVSERDGGLETLRVALRFDDSGGKQTCKVFSLADV  120

Query  439  ----------LSPSGTL-----FHDRPVVRDGRLLYISAHEPPKEVFKSWSALYSTHLGL  573
                      L  SG +        R V  D  L+Y+S  EP +E    W+ +Y T+L  
Sbjct  121  FGAADFTGARLEDSGCIGGGYKMGSRSV--DHSLIYVSTKEPVEERRSPWTVVYKTNLRT  178

Query  574  KEITRLTPYGAVDFSPSVSQSGEFIAVASY  663
             +  RLTP G  D SP+VS SG+ +A+A++
Sbjct  179  GKTERLTPKGQFDLSPAVSPSGKKVAMATF  208



>ref|XP_002524160.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF38223.1| conserved hypothetical protein [Ricinus communis]
Length=724

 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 58/210 (28%), Positives = 84/210 (40%), Gaps = 47/210 (22%)
 Frame = +1

Query  169  IMDPHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFL----  336
            + +  G+I F    R     DIFS  +P +  QD     E  +TDG+S N+N   +    
Sbjct  1    MAEKRGSIAFFATYRPPVPLDIFSCPVPPTSRQD-----ELHMTDGLSYNYNCQVIPPEA  55

Query  337  --------------DEGDT-------FVFVSERSGSPR---IYLQENRSASAGKPQQLLS  444
                           E D         +F+SER  S     I L+ N S  + K      
Sbjct  56   LKVIIKRPKLASEAKESDVDSGRLSGLIFISERDNSLETLHIALRFNDSPPSVKVFSFAD  115

Query  445  PSGTL----FHDRPVVRDG----------RLLYISAHEPPKEVFKSWSALYSTHLGLKEI  582
              GT       D   +  G           L+Y++  +P  +  + W+ +Y T+L   + 
Sbjct  116  VYGTYNGVRMEDGGCIAGGYKVGNRTVDYSLIYVTTKDPSTDRRQPWTVVYKTNLKTGKT  175

Query  583  TRLTPYGAVDFSPSVSQSGEFIAVASYGSR  672
             RLTP G  D SPSVS S   IAVAS+  +
Sbjct  176  DRLTPSGVNDLSPSVSPSRRKIAVASFQGK  205



>ref|NP_001050324.1| Os03g0403400 [Oryza sativa Japonica Group]
 gb|AAP03369.1| hypothetical protein [Oryza sativa Japonica Group]
 gb|ABF96486.1| WD40-like Beta Propeller Repeat family protein, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF12238.1| Os03g0403400 [Oryza sativa Japonica Group]
Length=744

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 42/75 (56%), Gaps = 0/75 (0%)
 Frame = +1

Query  451  GTLFHDRPVVRDGRLLYISAHEPPKEVFKSWSALYSTHLGLKEITRLTPYGAVDFSPSVS  630
            G  + +R    D  L+Y+S  EP       W+ +Y T+L   E  RLTP G  D SP+VS
Sbjct  137  GGGYRERGRAVDHTLVYVSTREPVAARRSPWTVVYGTNLRTGETARLTPRGTFDLSPAVS  196

Query  631  QSGEFIAVASYGSRP  675
             SG+ +AVAS+  +P
Sbjct  197  PSGKRVAVASWQGKP  211



>gb|EAY90391.1| hypothetical protein OsI_11968 [Oryza sativa Indica Group]
Length=744

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 42/75 (56%), Gaps = 0/75 (0%)
 Frame = +1

Query  451  GTLFHDRPVVRDGRLLYISAHEPPKEVFKSWSALYSTHLGLKEITRLTPYGAVDFSPSVS  630
            G  + +R    D  L+Y+S  EP       W+ +Y T+L   E  RLTP G  D SP+VS
Sbjct  137  GGGYRERGRAVDHTLVYVSTREPVAARRSPWTVVYGTNLRTGETARLTPRGTFDLSPAVS  196

Query  631  QSGEFIAVASYGSRP  675
             SG+ +AVAS+  +P
Sbjct  197  PSGKRVAVASWQGKP  211



>gb|EAZ27259.1| hypothetical protein OsJ_11196 [Oryza sativa Japonica Group]
Length=744

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 42/75 (56%), Gaps = 0/75 (0%)
 Frame = +1

Query  451  GTLFHDRPVVRDGRLLYISAHEPPKEVFKSWSALYSTHLGLKEITRLTPYGAVDFSPSVS  630
            G  + +R    D  L+Y+S  EP       W+ +Y T+L   E  RLTP G  D SP+VS
Sbjct  137  GGGYRERGRAVDHTLVYVSTREPVAARRSPWTVVYGTNLRTGETARLTPRGTFDLSPAVS  196

Query  631  QSGEFIAVASYGSRP  675
             SG+ +AVAS+  +P
Sbjct  197  PSGKRVAVASWQGKP  211



>ref|XP_002519807.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF42603.1| conserved hypothetical protein [Ricinus communis]
Length=711

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 58/209 (28%), Positives = 81/209 (39%), Gaps = 48/209 (23%)
 Frame = +1

Query  169  IMDPHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFL----  336
            + +  G I F    R     DIFS  +P   +QD     E  +TDG+  N+N   +    
Sbjct  1    MAEKRGCIAFFASYRPPVPLDIFSCPVPPRTKQD-----EVHMTDGLFYNYNCQSIPPEA  55

Query  337  --------------DEGDT-------FVFVSERSGSPRIYLQENRSASAGKPQQLLSPSG  453
                           E D         +FVSER  +        RS    K        G
Sbjct  56   LKTIIKHPKLVPEAKESDVDSGRLSGMIFVSERKNNLETLHIGLRSRDKVKVFSFADVYG  115

Query  454  TL----------------FHDRPVVRDGRLLYISAHEPPKEVFKSWSALYSTHLGLKEIT  585
            T                   DR V  D  L+Y++  +P ++  + W+ +Y T+L   +  
Sbjct  116  TFNGVRMEDSGCIAGGYKVGDRIV--DHSLVYVTTKDPSEDRRQPWTVVYKTNLRTGKTE  173

Query  586  RLTPYGAVDFSPSVSQSGEFIAVASYGSR  672
            RLTP G  D SPSVS SG  +AVAS+  R
Sbjct  174  RLTPSGVNDLSPSVSPSGRKVAVASFQGR  202



>ref|XP_010097483.1| hypothetical protein L484_024689 [Morus notabilis]
 gb|EXB68674.1| hypothetical protein L484_024689 [Morus notabilis]
Length=740

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 41/74 (55%), Gaps = 0/74 (0%)
 Frame = +1

Query  451  GTLFHDRPVVRDGRLLYISAHEPPKEVFKSWSALYSTHLGLKEITRLTPYGAVDFSPSVS  630
            G    D   V    L+Y++  +P  +  + W+A+Y T+L   E  RLTP G  D SPSVS
Sbjct  136  GVRMEDSGCVAGDYLIYVTTKDPAPKRRQPWTAVYKTNLNTGETERLTPPGEADLSPSVS  195

Query  631  QSGEFIAVASYGSR  672
             SG  IAVAS+  +
Sbjct  196  PSGRKIAVASFEGK  209



>ref|XP_010097467.1| hypothetical protein L484_024672 [Morus notabilis]
 gb|EXB68658.1| hypothetical protein L484_024672 [Morus notabilis]
Length=743

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 41/74 (55%), Gaps = 0/74 (0%)
 Frame = +1

Query  451  GTLFHDRPVVRDGRLLYISAHEPPKEVFKSWSALYSTHLGLKEITRLTPYGAVDFSPSVS  630
            G    D   V    L+Y++  +P  +  + W+A+Y T+L   E  RLTP G  D SPSVS
Sbjct  137  GVRMEDSGCVAGDYLIYVTTKDPAPKRRQPWTAVYKTNLNTGETERLTPPGEADLSPSVS  196

Query  631  QSGEFIAVASYGSR  672
             SG  IAVAS+  +
Sbjct  197  PSGRKIAVASFEGK  210



>ref|XP_010102640.1| hypothetical protein L484_010932 [Morus notabilis]
 gb|EXB93790.1| hypothetical protein L484_010932 [Morus notabilis]
Length=717

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 57/201 (28%), Positives = 82/201 (41%), Gaps = 41/201 (20%)
 Frame = +1

Query  166  MIMDPHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFL---  336
            M     G+I F    R     DIFS  L  +  +D     E  +TDGVS N+N   +   
Sbjct  1    MANQKRGSIAFFATYRPPVPLDIFSCPLLPTSNKD-----ELLMTDGVSYNYNAQVIPPE  55

Query  337  --------------------DEGDT--FVFVSERSGSPRIYL----QENRSASAGKPQQL  438
                                D G     +FVSER     +++     +N +A   K   L
Sbjct  56   ALKTILQRPKLASEANAADVDAGRVSGTIFVSERGNLETLHIALRFNDNTTAPRVKVFSL  115

Query  439  LSPSGT------LFHDRPVVRDGRLLYISAHEPPKEVFKSWSALYSTHLGLKEITRLTPY  600
                GT         D   +    L+Y++  +P  E  + W+A+Y T+L   +  RLTP 
Sbjct  116  ADVFGTSSFIGVRMEDSGCIAGDYLVYVTTKDP-AERRQPWTAVYKTNLKTGKTERLTPP  174

Query  601  GAVDFSPSVSQSGEFIAVASY  663
               D +PSVS  G+ IAVAS+
Sbjct  175  EHADLNPSVSPCGKKIAVASF  195



>ref|XP_010091028.1| hypothetical protein L484_002197 [Morus notabilis]
 gb|EXB41946.1| hypothetical protein L484_002197 [Morus notabilis]
Length=163

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 31/52 (60%), Positives = 35/52 (67%), Gaps = 7/52 (13%)
 Frame = +1

Query  541  WSALYSTHLGLKE-------ITRLTPYGAVDFSPSVSQSGEFIAVASYGSRP  675
            WSALYST L   +       ITRLTP G+ D+S  VS SGEF+AVASYGS P
Sbjct  43   WSALYSTSLINGDYNPHEIVITRLTPQGSTDYSHVVSLSGEFVAVASYGSHP  94



>ref|XP_010097765.1| hypothetical protein L484_023906 [Morus notabilis]
 gb|EXB70720.1| hypothetical protein L484_023906 [Morus notabilis]
Length=744

 Score = 56.6 bits (135),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 42/119 (35%), Positives = 59/119 (50%), Gaps = 13/119 (11%)
 Frame = +1

Query  352  FVFVSERSGSPR-----IYLQENRSASAGKPQQLLSP-------SGTLFHDRPVVRDGRL  495
            FVFVSER GSP+     I L+ N   +       L+        SG    D        L
Sbjct  87   FVFVSER-GSPQLETLHIALRINDETTPEVTVFSLADIFGTKDFSGVRLEDSGCFAGDYL  145

Query  496  LYISAHEPPKEVFKSWSALYSTHLGLKEITRLTPYGAVDFSPSVSQSGEFIAVASYGSR  672
            +Y+S  EP ++  + W+ +Y T+L   +  RLTP    D SP+VS SG+ IAVAS+  +
Sbjct  146  IYVSTKEPARKRRQPWTVVYKTNLKTGKTERLTPSMQADLSPAVSPSGKKIAVASFQGK  204



>gb|EMS66234.1| hypothetical protein TRIUR3_20351 [Triticum urartu]
Length=775

 Score = 56.6 bits (135),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 66/220 (30%), Positives = 90/220 (41%), Gaps = 64/220 (29%)
 Frame = +1

Query  184  GTIVFSTVGRSHYGFDIFSVQL---PSSFEQDRRPASEHRLTDGVSINFNGHFL------  336
            G+I F    R      IFS  +   PSS+E       E  LTD  S N NGH +      
Sbjct  6    GSISFFGTYRPPVPLGIFSCPIDPPPSSYED------ELLLTDDESYNQNGHAIPAAALR  59

Query  337  ---------------DEGDTF-----------VFVSERS-GSPRIYLQENRSASAGKPQQ  435
                           D G T            VFVSER  G   ++L   R A+ G+  +
Sbjct  60   EILAFMGKKNPKMASDCGATLEDVDKGHVTGLVFVSERDRGLETLHLALRRPAT-GQVVK  118

Query  436  LLSPSGTLF--------HDRPVVRDG------------RLLYISAHEPPKEVFKSWSALY  555
            +LS  G ++         D   +  G             L+Y+S  EP K     W+ +Y
Sbjct  119  VLSLLGDIYGVGGGVRMEDSGCIAGGFTVNGGRCAVGHSLVYVSTKEPAKTRRTPWTVVY  178

Query  556  STHLGLKEITRLTPYGAVDFSPSVSQSGEFIAVASY-GSR  672
             T L   +  RLTP G  D SP+VS SG+ +AVA++ G+R
Sbjct  179  RTDLADGKTERLTPLGQYDLSPAVSPSGKMVAVANFHGNR  218



>dbj|BAJ88525.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=555

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 61/216 (28%), Positives = 85/216 (39%), Gaps = 61/216 (28%)
 Frame = +1

Query  181  HGTIVFSTVGRSHYGFDIFSVQL---PSSFEQDRRPASEHRLTDGVSINFNGHFL-----  336
             G+I F    R     DI+S      PSS E       E  LTDGVS N NG  +     
Sbjct  8    RGSIAFFGTYRPPVPLDIYSCPANPPPSSRED------ELHLTDGVSYNQNGRAIPAPAL  61

Query  337  ----------------------DEGDT-----FVFVSER-SGSPRIYLQENRSASAGKPQ  432
                                  D+ +       VFVSER +G   +++   R    G   
Sbjct  62   KDLLAFLGKKNPGLATECGATPDDAEKGRVAGLVFVSERDNGLETLHVALVRPNGEGGAV  121

Query  433  QLLSPS---------GTLFHDRPVVRDG----------RLLYISAHEPPKEVFKSWSALY  555
            ++LS           G+   D   +  G           L+Y+S  EP       W+ +Y
Sbjct  122  KVLSLGDVYGADTFGGSRLEDSGCIAGGFKVGARAVGHLLVYVSTKEPVTRRRTPWTVVY  181

Query  556  STHLGLKEITRLTPYGAVDFSPSVSQSGEFIAVASY  663
             T+LG  +  RLTP G  D SP+VS SG+ +AVA++
Sbjct  182  RTNLGDGKTERLTPPGQYDVSPAVSPSGKMVAVANF  217



>dbj|BAK07068.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=733

 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 61/212 (29%), Positives = 80/212 (38%), Gaps = 58/212 (27%)
 Frame = +1

Query  184  GTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGH-----FLDEGD  348
            G+I F T  R     DIFS     S      P  E  LTDGVS N NG       L E  
Sbjct  6    GSIAFFTTYRPAVPLDIFSCPATPS------PDDELSLTDGVSYNQNGRPIPAAALKELL  59

Query  349  TFV---------------------------FVSERSG---SPRIYLQENRSASAGKPQQL  438
            TF+                           FVSER     +  + L+   S + G    +
Sbjct  60   TFLGKKNPGLAAECGATPDDAGKGRVAGLLFVSERDNGLETLHVALRCTASGAGGVKAAV  119

Query  439  L-----------SPSGTLFHDRPVVRDG------RLLYISAHEPPKEVFKSWSALYSTHL  567
                        +  G    D   V  G       L+Y+S  EP K+    W+ +Y T L
Sbjct  120  KVLRLADVYGADAFGGVRMEDSGCVAGGFDGVGHSLVYVSTKEPAKKRRAPWTVVYKTSL  179

Query  568  GLKEITRLTPYGAVDFSPSVSQSGEFIAVASY  663
               +  RLTP    D SP+VS SG+ +AVA++
Sbjct  180  ADGKTERLTPPDQYDLSPAVSPSGKMVAVANF  211



>dbj|BAJ92843.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=754

 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 61/214 (29%), Positives = 84/214 (39%), Gaps = 60/214 (28%)
 Frame = +1

Query  184  GTIVFSTVGRSHYGFDIFSVQL---PSSFEQDRRPASEHRLTDGVSINFNGHFL------  336
            G+I F    R     DI+S      PSS E +R       LTDGVS N NG  +      
Sbjct  9    GSIAFFGTYRPPVPLDIYSCPADPPPSSREDERH------LTDGVSYNQNGRAIPAAALK  62

Query  337  ---------------------DEGDT-----FVFVSER-SGSPRIYLQENRSASAGKPQQ  435
                                 D+ +       VFVSER  G   +++   R    G  + 
Sbjct  63   ELLTFLGKKNPALAAECGATPDDAEKGRVAGLVFVSERDKGLETLHVALVRPNGEGAVKV  122

Query  436  LL--------SPSGTLFHDRPVVRDG----------RLLYISAHEPPKEVFKSWSALYST  561
            L         +  GT   D   V  G           L+Y+S  EP  +    W+ +Y T
Sbjct  123  LSLGDVYGADTFGGTRLEDSGCVAGGFKVGARAVSHSLVYVSTKEPVTKRRTPWTVVYRT  182

Query  562  HLGLKEITRLTPYGAVDFSPSVSQSGEFIAVASY  663
            +L   +  RLTP G  D SP+VS SG+ +AVA++
Sbjct  183  NLADGKTERLTPPGQYDVSPAVSPSGKMVAVANF  216



>emb|CBI18981.3| unnamed protein product [Vitis vinifera]
Length=541

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 59/180 (33%), Positives = 81/180 (45%), Gaps = 50/180 (28%)
 Frame = +1

Query  205  VGRSHYGFDIFSVQL--PSSFEQDRRPASEHRLTDGVSINFNGHFLDEGDTFVFVSE--R  372
            +GRS Y FD+FS+    PS+       A E R+TDG S+NFNGHF       +  ++  R
Sbjct  47   LGRSDYAFDVFSLPTLGPSTI------ADELRITDGQSVNFNGHFPSSPIISLLANQTLR  100

Query  373  SGSPRIYLQ----------ENRSA--SAGKPQQLLSPSGTL-------FHDRPVVRDGRL  495
            +GS  IYL             RSA  +A + +  L  + T          DRP +    L
Sbjct  101  NGSSNIYLDIIYYDTPTNSRRRSALETAVRVEVPLLGTNTEQSDGRISMKDRPSLVGEDL  160

Query  496  LYISAHE----PPKEVFKSWSALYSTHLGLKEITRLTPYGAVDFSPSVSQSGE-FIAVAS  660
            +Y+S HE    P K V                I R+TP G   F+P+ S   + FIAVA+
Sbjct  161  VYVSTHEDSGVPRKMV----------------IERVTPPGLHAFTPATSPGNKNFIAVAT  204



>ref|NP_001066679.1| Os12g0431300 [Oryza sativa Japonica Group]
 gb|ABA97669.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF29698.1| Os12g0431300 [Oryza sativa Japonica Group]
 gb|EAY82937.1| hypothetical protein OsI_38155 [Oryza sativa Indica Group]
 gb|EAZ20324.1| hypothetical protein OsJ_35933 [Oryza sativa Japonica Group]
Length=777

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 39/123 (32%), Positives = 52/123 (42%), Gaps = 19/123 (15%)
 Frame = +1

Query  352  FVFVSERSGSPRIYLQENRSASAGKPQQLLSPS---------GTLFHDRPVVRDG-----  489
             VFVSER           R  + GK  ++LS           G    D   V  G     
Sbjct  91   LVFVSERDRGLETLHVALRFVAGGKQVKVLSLGNIYGADTFGGVRMEDSGCVAGGFKVGR  150

Query  490  -----RLLYISAHEPPKEVFKSWSALYSTHLGLKEITRLTPYGAVDFSPSVSQSGEFIAV  654
                  L+Y+S   P K     W+ +Y T L   +  RLTP G  D SP+VS SG+ +AV
Sbjct  151  TTVGHSLVYVSTKAPVKARRTPWTVVYRTDLADGKTERLTPLGQYDLSPAVSPSGKMVAV  210

Query  655  ASY  663
            A++
Sbjct  211  ANF  213



>gb|EMT19136.1| hypothetical protein F775_12749 [Aegilops tauschii]
Length=669

 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 40/123 (33%), Positives = 56/123 (46%), Gaps = 20/123 (16%)
 Frame = +1

Query  352  FVFVSERS-GSPRIYLQENRSASAGKPQQL--------LSPSGTLFHDRPVVRDG-----  489
             VFVSER  G   ++L   RS + G+ + L        L   G    D   +  G     
Sbjct  91   MVFVSERDRGLETLHLALRRS-TGGEVKVLSLLGDIYGLDDLGVRMEDSGCIAGGYMVDG  149

Query  490  -----RLLYISAHEPPKEVFKSWSALYSTHLGLKEITRLTPYGAVDFSPSVSQSGEFIAV  654
                  L+Y+S  E  K     W+ +Y T L   +  RLTP G  D SP+VS SG+ +AV
Sbjct  150  VTVGHSLVYVSTKEEVKARRTPWTVVYRTDLADGKTERLTPQGQYDLSPAVSPSGKMVAV  209

Query  655  ASY  663
            A++
Sbjct  210  ANF  212



>ref|XP_002437598.1| hypothetical protein SORBIDRAFT_10g030220 [Sorghum bicolor]
 gb|EER88965.1| hypothetical protein SORBIDRAFT_10g030220 [Sorghum bicolor]
Length=769

 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 37/60 (62%), Gaps = 0/60 (0%)
 Frame = +1

Query  484  DGRLLYISAHEPPKEVFKSWSALYSTHLGLKEITRLTPYGAVDFSPSVSQSGEFIAVASY  663
            D  ++Y+S  +P ++    W+ +Y T+L   E  RLTP G  D SP+VS SG+ +AVA +
Sbjct  143  DPCIVYVSTKKPVEKRRTPWTVVYRTNLRTGETVRLTPDGEYDLSPAVSPSGKRVAVAKF  202



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1091035074420