BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF047G24

Length=654
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

dbj|BAO57279.1|  alpha-expansin                                         383   1e-131   Ipomoea nil [qian niu]
gb|AEQ55271.1|  expansin                                                335   9e-113   Breonia chinensis
ref|XP_006341021.1|  PREDICTED: expansin-A3                             335   2e-112   Solanum tuberosum [potatoes]
ref|NP_001234081.1|  expansin A4 precursor                              335   2e-112   Solanum lycopersicum
gb|KDP35637.1|  hypothetical protein JCGZ_09075                         332   1e-111   Jatropha curcas
gb|KJB76740.1|  hypothetical protein B456_012G104400                    332   2e-111   Gossypium raimondii
ref|XP_009788740.1|  PREDICTED: expansin-A3-like                        332   2e-111   Nicotiana sylvestris
ref|XP_009607348.1|  PREDICTED: expansin-A3-like                        332   5e-111   Nicotiana tomentosiformis
ref|XP_007027012.1|  Expansin A4, ALPHA 1.6,EXPA4                       330   7e-111   
ref|XP_004249634.1|  PREDICTED: expansin-A3                             330   1e-110   
ref|XP_009787901.1|  PREDICTED: expansin-A3-like                        331   1e-110   Nicotiana sylvestris
gb|KHG12430.1|  Expansin-A4 -like protein                               330   1e-110   Gossypium arboreum [tree cotton]
emb|CDP06606.1|  unnamed protein product                                330   1e-110   Coffea canephora [robusta coffee]
ref|XP_007016396.1|  Expansin A4, ALPHA 1.6,EXPA4                       329   2e-110   Theobroma cacao [chocolate]
ref|XP_003537990.1|  PREDICTED: expansin-A4-like                        329   3e-110   
ref|XP_004505858.1|  PREDICTED: expansin-A6-like                        329   3e-110   Cicer arietinum [garbanzo]
gb|KHG15821.1|  Expansin-A4 -like protein                               328   4e-110   Gossypium arboreum [tree cotton]
gb|KHG30766.1|  Expansin-A4 -like protein                               328   6e-110   Gossypium arboreum [tree cotton]
ref|XP_006349505.1|  PREDICTED: expansin-A3-like                        328   7e-110   Solanum tuberosum [potatoes]
gb|EYU41729.1|  hypothetical protein MIMGU_mgv1a012073mg                328   7e-110   Erythranthe guttata [common monkey flower]
gb|KJB36710.1|  hypothetical protein B456_006G172400                    328   7e-110   Gossypium raimondii
gb|KJB16930.1|  hypothetical protein B456_002G257400                    328   7e-110   Gossypium raimondii
gb|AFB77223.1|  expansin 1                                              328   8e-110   Betula platyphylla [Asian white birch]
gb|KHN21950.1|  Expansin-A4                                             329   1e-109   Glycine soja [wild soybean]
ref|XP_008387765.1|  PREDICTED: expansin-A4-like                        327   2e-109   
ref|XP_009587747.1|  PREDICTED: expansin-A3-like                        326   3e-109   Nicotiana tomentosiformis
ref|XP_003519349.1|  PREDICTED: expansin-A4-like                        326   3e-109   Glycine max [soybeans]
gb|KJB46592.1|  hypothetical protein B456_007G376300                    326   5e-109   Gossypium raimondii
ref|XP_003544219.1|  PREDICTED: expansin-A6-like                        325   7e-109   Glycine max [soybeans]
ref|XP_010256907.1|  PREDICTED: expansin-A4                             325   9e-109   Nelumbo nucifera [Indian lotus]
ref|XP_007140533.1|  hypothetical protein PHAVU_008G120700g             325   1e-108   Phaseolus vulgaris [French bean]
ref|XP_004300427.1|  PREDICTED: expansin-A6                             325   1e-108   Fragaria vesca subsp. vesca
gb|AEE69071.1|  expansin-4                                              324   2e-108   Petunia hybrid cultivar [hybrid petunia]
ref|XP_003552173.1|  PREDICTED: expansin-A4                             324   2e-108   Glycine max [soybeans]
ref|XP_007132063.1|  hypothetical protein PHAVU_011G063800g             324   2e-108   Phaseolus vulgaris [French bean]
gb|KDP20458.1|  hypothetical protein JCGZ_05303                         324   2e-108   Jatropha curcas
gb|ACJ48968.2|  expansin                                                324   2e-108   Breonia chinensis
ref|XP_009772489.1|  PREDICTED: expansin-A3-like                        324   2e-108   Nicotiana sylvestris
ref|XP_011094866.1|  PREDICTED: expansin-A6                             324   2e-108   Sesamum indicum [beniseed]
gb|AAR82849.1|  expansin-1                                              323   3e-108   Petunia x hybrida [garden petunia]
ref|XP_007009225.1|  Expansin A4, ALPHA 1.6,EXPA4                       323   4e-108   
ref|XP_003538409.1|  PREDICTED: expansin-A6                             323   4e-108   Glycine max [soybeans]
emb|CBI16120.3|  unnamed protein product                                324   5e-108   Vitis vinifera
ref|XP_008233635.1|  PREDICTED: expansin-A4-like                        323   5e-108   Prunus mume [ume]
ref|XP_009761115.1|  PREDICTED: expansin-A6-like                        323   5e-108   Nicotiana sylvestris
ref|XP_003552923.2|  PREDICTED: expansin-A3-like                        323   6e-108   Glycine max [soybeans]
gb|AEQ55274.1|  expansin                                                323   7e-108   Breonia chinensis
ref|XP_007218834.1|  hypothetical protein PRUPE_ppa010198mg             323   8e-108   Prunus persica
ref|XP_002283530.1|  PREDICTED: expansin-A4                             323   8e-108   Vitis vinifera
gb|AAF32410.1|AF230277_1  alpha-expansin 2                              323   8e-108   Triphysaria versicolor
ref|XP_008464122.1|  PREDICTED: expansin-A4                             322   9e-108   Cucumis melo [Oriental melon]
gb|AEQ55290.1|  expansin                                                322   1e-107   Breonia chinensis
ref|XP_004492358.1|  PREDICTED: expansin-A6-like                        322   1e-107   Cicer arietinum [garbanzo]
gb|AAM47000.1|AF512542_1  alpha-expansin precursor                      322   1e-107   Gossypium hirsutum [American cotton]
dbj|BAC67193.1|  expansin                                               322   1e-107   Pyrus communis
gb|KHN17924.1|  Expansin-A3                                             324   1e-107   Glycine soja [wild soybean]
ref|XP_007205748.1|  hypothetical protein PRUPE_ppa010226mg             322   1e-107   Prunus persica
gb|AEQ55275.1|  expansin                                                322   1e-107   Breonia chinensis
ref|NP_001242978.1|  expansin-A4-like precursor                         322   2e-107   Glycine max [soybeans]
ref|XP_011019858.1|  PREDICTED: expansin-A6                             322   2e-107   Populus euphratica
gb|ACK36943.1|  expansin                                                322   2e-107   Annona cherimola [cherimoya]
ref|XP_003616412.1|  Expansin                                           322   2e-107   Medicago truncatula
ref|XP_002309061.1|  expansin family protein                            321   3e-107   Populus trichocarpa [western balsam poplar]
ref|XP_010106493.1|  hypothetical protein L484_025251                   321   4e-107   Morus notabilis
gb|KEH39447.1|  expansin A10                                            321   5e-107   Medicago truncatula
ref|XP_002298353.1|  alpha-expansin 1 family protein                    321   5e-107   Populus trichocarpa [western balsam poplar]
ref|XP_009364387.1|  PREDICTED: expansin-A4                             320   6e-107   Pyrus x bretschneideri [bai li]
ref|XP_002283358.1|  PREDICTED: expansin-A4                             320   6e-107   Vitis vinifera
ref|XP_009610453.1|  PREDICTED: expansin-A3-like                        320   7e-107   Nicotiana tomentosiformis
ref|XP_004142066.1|  PREDICTED: expansin-A4-like                        320   7e-107   
ref|XP_011035307.1|  PREDICTED: expansin-A6                             320   8e-107   Populus euphratica
ref|XP_009757427.1|  PREDICTED: expansin-A4-like                        320   8e-107   Nicotiana sylvestris
ref|XP_002315218.1|  alpha-expansin 9 precursor family protein          320   9e-107   
gb|AEN70914.1|  expansin                                                320   9e-107   Gossypium trilobum
ref|XP_003552064.1|  PREDICTED: expansin-A4                             320   9e-107   Glycine max [soybeans]
ref|NP_001284471.1|  expansin-A4 precursor                              320   9e-107   Cucumis melo [Oriental melon]
gb|AAL31480.1|AF319475_1  alpha-expansin 9 precursor                    319   1e-106   Cucumis sativus [cucumbers]
ref|XP_009341751.1|  PREDICTED: expansin-A4-like                        320   1e-106   Pyrus x bretschneideri [bai li]
ref|XP_011027216.1|  PREDICTED: expansin-A4                             320   1e-106   Populus euphratica
ref|XP_002533097.1|  Alpha-expansin 4 precursor, putative               320   1e-106   Ricinus communis
emb|CDP09064.1|  unnamed protein product                                320   1e-106   Coffea canephora [robusta coffee]
ref|XP_004143121.1|  PREDICTED: expansin-A4-like                        319   1e-106   Cucumis sativus [cucumbers]
emb|CAH18933.1|  expansin                                               319   1e-106   Pyrus communis
gb|AIE54285.1|  expansin                                                319   2e-106   Nicotiana tabacum [American tobacco]
gb|AFZ78606.1|  expansin protein                                        319   2e-106   Populus tomentosa [Chinese white poplar]
gb|AAM22625.1|AF428178_1  expansin 11 precursor                         319   2e-106   Rumex palustris
gb|ADC35365.1|  alpha-expansin 2                                        319   2e-106   Coffea arabica [arabica coffee]
gb|KCW65541.1|  hypothetical protein EUGRSUZ_G02938                     319   2e-106   Eucalyptus grandis [rose gum]
gb|AEN70891.1|  expansin                                                319   2e-106   Gossypium thurberi
gb|KEH22886.1|  expansin-A1-like protein                                319   2e-106   Medicago truncatula
ref|XP_004147685.1|  PREDICTED: expansin-A4-like                        319   2e-106   Cucumis sativus [cucumbers]
gb|AEN70901.1|  expansin                                                319   3e-106   Gossypium barbadense var. brasiliense
gb|ADY68814.1|  expansin                                                318   3e-106   Gossypium barbadense [Egyptian cotton]
gb|AAR09168.1|  alpha-expansin 1                                        319   3e-106   Populus tremula x Populus tremuloides
ref|XP_004249536.1|  PREDICTED: expansin-A6-like                        318   3e-106   Solanum lycopersicum
ref|XP_009768238.1|  PREDICTED: expansin-A6-like                        318   3e-106   Nicotiana sylvestris
gb|ACN94264.1|  expansin                                                318   3e-106   Rehmannia glutinosa [Chinese foxglove]
gb|AFK40565.1|  unknown                                                 317   4e-106   Medicago truncatula
gb|KDP44940.1|  hypothetical protein JCGZ_01440                         318   4e-106   Jatropha curcas
gb|AAR82850.1|  expansin-2                                              318   4e-106   Petunia x hybrida [garden petunia]
gb|AEN70907.1|  expansin                                                318   4e-106   Gossypium armourianum
ref|XP_008802710.1|  PREDICTED: expansin-A4                             318   4e-106   Phoenix dactylifera
ref|XP_008357089.1|  PREDICTED: expansin-A6                             318   5e-106   
gb|ADY68815.1|  expansin                                                318   5e-106   Gossypium barbadense [Egyptian cotton]
ref|XP_004486999.1|  PREDICTED: expansin-A6-like                        318   5e-106   Cicer arietinum [garbanzo]
ref|XP_008461679.1|  PREDICTED: expansin-A4                             318   6e-106   Cucumis melo [Oriental melon]
ref|XP_006339024.1|  PREDICTED: expansin-A3-like                        318   6e-106   Solanum tuberosum [potatoes]
gb|AEN70893.1|  expansin                                                318   6e-106   Gossypium schwendimanii
gb|KJB73995.1|  hypothetical protein B456_011G266000                    318   7e-106   Gossypium raimondii
ref|XP_011089478.1|  PREDICTED: expansin-A6                             317   9e-106   Sesamum indicum [beniseed]
gb|ADY68817.1|  expansin                                                317   1e-105   Gossypium raimondii
emb|CAA59470.1|  orf                                                    317   1e-105   Pisum sativum [garden pea]
ref|XP_010067412.1|  PREDICTED: expansin-A4                             319   1e-105   Eucalyptus grandis [rose gum]
ref|XP_008223717.1|  PREDICTED: expansin-A4                             317   1e-105   Prunus mume [ume]
ref|XP_007205740.1|  hypothetical protein PRUPE_ppa010180mg             317   1e-105   Prunus persica
ref|XP_009597793.1|  PREDICTED: expansin-A6-like                        317   1e-105   Nicotiana tomentosiformis
gb|KJB55836.1|  hypothetical protein B456_009G098800                    317   1e-105   Gossypium raimondii
ref|XP_010685747.1|  PREDICTED: expansin-A4                             317   1e-105   Beta vulgaris subsp. vulgaris [field beet]
gb|AAM22626.1|AF428179_1  expansin 12 precursor                         317   1e-105   Rumex palustris
ref|XP_007141864.1|  hypothetical protein PHAVU_008G232200g             317   1e-105   Phaseolus vulgaris [French bean]
gb|AAT11859.2|  expansin 1                                              317   1e-105   Mangifera indica
gb|AAM22624.1|AF428177_1  expansin 10 precursor                         317   1e-105   Rumex palustris
ref|NP_001234881.1|  expansin9 precursor                                317   1e-105   Solanum lycopersicum
emb|CDY31742.1|  BnaA04g16780D                                          317   1e-105   Brassica napus [oilseed rape]
ref|NP_001288899.1|  expansin-A6 precursor                              317   1e-105   Brassica rapa
gb|AHL25255.1|  expansin                                                317   2e-105   Boehmeria nivea [Chinese silk-plant]
gb|ACO07292.1|  expansin 10                                             317   2e-105   Cucumis sativus [cucumbers]
ref|XP_009613959.1|  PREDICTED: expansin-A6-like                        317   2e-105   Nicotiana tomentosiformis
gb|ADY68818.1|  expansin                                                317   2e-105   Gossypium hirsutum [American cotton]
ref|XP_009589397.1|  PREDICTED: expansin-A4-like                        317   2e-105   Nicotiana tomentosiformis
ref|XP_007133996.1|  hypothetical protein PHAVU_010G010200g             316   2e-105   Phaseolus vulgaris [French bean]
ref|NP_001233958.1|  expansin precursor                                 317   2e-105   Solanum lycopersicum
ref|XP_009353647.1|  PREDICTED: expansin-A6-like                        317   2e-105   Pyrus x bretschneideri [bai li]
ref|XP_009349313.1|  PREDICTED: expansin-A6-like                        316   2e-105   Pyrus x bretschneideri [bai li]
ref|XP_006409928.1|  hypothetical protein EUTSA_v10017116mg             316   3e-105   Eutrema salsugineum [saltwater cress]
ref|XP_010521846.1|  PREDICTED: expansin-A6                             316   3e-105   Tarenaya hassleriana [spider flower]
gb|AEN70900.1|  expansin                                                316   3e-105   Gossypium tomentosum
emb|CDX77222.1|  BnaC04g40170D                                          316   4e-105   
gb|AEN70895.1|  expansin                                                316   4e-105   Gossypium mustelinum
ref|XP_003547326.1|  PREDICTED: expansin-A4-like                        315   4e-105   Glycine max [soybeans]
gb|KHG20113.1|  Expansin-A4 -like protein                               315   5e-105   Gossypium arboreum [tree cotton]
ref|XP_008457477.1|  PREDICTED: expansin-A4-like                        315   5e-105   Cucumis melo [Oriental melon]
gb|AEU08407.1|  expansin 2                                              315   5e-105   Prunus salicina [Japanese plum]
ref|XP_003543517.1|  PREDICTED: expansin-A4                             315   5e-105   Glycine max [soybeans]
dbj|BAH36862.1|  alpha expansin                                         315   6e-105   Rosa hybrid cultivar
gb|ABO30976.2|  alpha expansin protein 1                                315   6e-105   Calotropis procera
gb|EYU18981.1|  hypothetical protein MIMGU_mgv1a012125mg                315   7e-105   Erythranthe guttata [common monkey flower]
ref|XP_010690765.1|  PREDICTED: expansin-A4                             315   8e-105   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007150329.1|  hypothetical protein PHAVU_005G144500g             315   9e-105   Phaseolus vulgaris [French bean]
gb|AFK44569.1|  unknown                                                 315   9e-105   Medicago truncatula
gb|KEH30169.1|  expansin A10                                            315   9e-105   Medicago truncatula
ref|XP_010528418.1|  PREDICTED: expansin-A3                             315   9e-105   Tarenaya hassleriana [spider flower]
ref|XP_006435550.1|  hypothetical protein CICLE_v10032484mg             315   1e-104   Citrus clementina [clementine]
gb|KJB78839.1|  hypothetical protein B456_013G022200                    315   1e-104   Gossypium raimondii
ref|XP_010920576.1|  PREDICTED: expansin-A4-like                        315   1e-104   Elaeis guineensis
ref|XP_008384848.1|  PREDICTED: expansin-A4                             314   1e-104   Malus domestica [apple tree]
ref|XP_004154408.1|  PREDICTED: expansin-A4-like                        314   1e-104   
gb|AAL31477.1|AF319472_1  alpha-expansin 6 precursor                    314   1e-104   Cucumis sativus [cucumbers]
gb|KHG29956.1|  Expansin-A4 -like protein                               314   1e-104   Gossypium arboreum [tree cotton]
ref|XP_008240857.1|  PREDICTED: expansin-A6-like                        314   2e-104   Prunus mume [ume]
ref|XP_010033123.1|  PREDICTED: expansin-A4                             314   2e-104   Eucalyptus grandis [rose gum]
ref|NP_001234761.1|  expansin18 precursor                               314   2e-104   
ref|XP_010043542.1|  PREDICTED: expansin-A4-like                        313   3e-104   Eucalyptus grandis [rose gum]
ref|XP_010414459.1|  PREDICTED: expansin-A6-like                        313   3e-104   Camelina sativa [gold-of-pleasure]
emb|CAN73252.1|  hypothetical protein VITISV_027049                     313   3e-104   Vitis vinifera
emb|CDP00110.1|  unnamed protein product                                313   3e-104   Coffea canephora [robusta coffee]
ref|XP_009343581.1|  PREDICTED: expansin-A4-like                        313   4e-104   Pyrus x bretschneideri [bai li]
ref|XP_006350774.1|  PREDICTED: expansin-A6                             313   4e-104   Solanum tuberosum [potatoes]
gb|ABO32367.1|  expansin                                                313   4e-104   Litchi
ref|XP_006429095.1|  hypothetical protein CICLE_v10012518mg             313   5e-104   Citrus clementina [clementine]
ref|XP_011042710.1|  PREDICTED: expansin-A4-like                        313   5e-104   Populus euphratica
dbj|BAN09210.1|  alpha expansin                                         313   5e-104   Eustoma exaltatum subsp. russellianum [bluebells]
gb|AFK34565.1|  unknown                                                 310   5e-104   Medicago truncatula
ref|XP_010264435.1|  PREDICTED: expansin-A4                             313   6e-104   Nelumbo nucifera [Indian lotus]
gb|AAK48848.1|AF350939_1  expansin                                      313   7e-104   Prunus cerasus [pie cherry]
gb|KJB08889.1|  hypothetical protein B456_001G111100                    313   7e-104   Gossypium raimondii
gb|KHN30166.1|  Expansin-A4                                             313   9e-104   Glycine soja [wild soybean]
ref|XP_002313434.1|  alpha-expansin 1 family protein                    312   9e-104   Populus trichocarpa [western balsam poplar]
ref|XP_006488339.1|  PREDICTED: expansin-A4-like                        312   1e-103   Citrus sinensis [apfelsine]
ref|XP_006424843.1|  hypothetical protein CICLE_v10029094mg             312   1e-103   Citrus clementina [clementine]
ref|XP_006410954.1|  hypothetical protein EUTSA_v10017095mg             312   1e-103   Eutrema salsugineum [saltwater cress]
ref|XP_006480833.1|  PREDICTED: expansin-A4-like                        312   1e-103   Citrus sinensis [apfelsine]
ref|XP_010517036.1|  PREDICTED: expansin-A3                             312   1e-103   Camelina sativa [gold-of-pleasure]
emb|CAA04385.1|  Expansin                                               312   1e-103   Brassica napus [oilseed rape]
ref|XP_008343537.1|  PREDICTED: expansin-A4-like                        312   1e-103   Malus domestica [apple tree]
ref|XP_002881024.1|  ATEXPA6                                            311   1e-103   Arabidopsis lyrata subsp. lyrata
ref|XP_009409516.1|  PREDICTED: expansin-A6-like                        312   1e-103   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHG24991.1|  Expansin-A4 -like protein                               311   2e-103   Gossypium arboreum [tree cotton]
ref|XP_010922313.1|  PREDICTED: LOW QUALITY PROTEIN: expansin-A4-...    311   2e-103   
ref|NP_180461.1|  expansin A6                                           311   2e-103   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008777004.1|  PREDICTED: expansin-A4-like                        311   2e-103   Phoenix dactylifera
ref|XP_010510558.1|  PREDICTED: expansin-A6                             311   2e-103   Camelina sativa [gold-of-pleasure]
ref|XP_010505357.1|  PREDICTED: expansin-A3-like                        311   2e-103   Camelina sativa [gold-of-pleasure]
ref|XP_007163413.1|  hypothetical protein PHAVU_001G232600g             311   2e-103   Phaseolus vulgaris [French bean]
ref|XP_004490888.1|  PREDICTED: expansin-A4-like                        311   2e-103   Cicer arietinum [garbanzo]
ref|XP_009357738.1|  PREDICTED: expansin-A4-like                        311   3e-103   Pyrus x bretschneideri [bai li]
ref|XP_011077647.1|  PREDICTED: expansin-A6-like                        311   3e-103   
ref|NP_181300.1|  expansin-A3                                           311   4e-103   Arabidopsis thaliana [mouse-ear cress]
gb|KFK32246.1|  hypothetical protein AALP_AA6G217100                    311   4e-103   Arabis alpina [alpine rockcress]
ref|XP_008784594.1|  PREDICTED: expansin-A4-like                        311   4e-103   Phoenix dactylifera
ref|XP_010111142.1|  hypothetical protein L484_010756                   310   4e-103   Morus notabilis
ref|XP_004302749.1|  PREDICTED: expansin-A6                             310   5e-103   Fragaria vesca subsp. vesca
ref|XP_002266625.1|  PREDICTED: expansin-A6                             310   5e-103   Vitis vinifera
ref|XP_006288496.1|  hypothetical protein CARUB_v10001761mg             310   5e-103   Capsella rubella
ref|XP_011077214.1|  PREDICTED: expansin-A6-like                        310   6e-103   Sesamum indicum [beniseed]
gb|AAP48989.1|  expansin                                                310   7e-103   Sambucus nigra
ref|XP_009380637.1|  PREDICTED: expansin-A4                             310   7e-103   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY47883.1|  BnaA07g14280D                                          310   8e-103   Brassica napus [oilseed rape]
ref|XP_010557251.1|  PREDICTED: expansin-A6-like                        310   1e-102   Tarenaya hassleriana [spider flower]
gb|EPS67093.1|  hypothetical protein M569_07682                         310   1e-102   Genlisea aurea
gb|KFK36651.1|  alpha-expansin 4                                        310   1e-102   Arabis alpina [alpine rockcress]
ref|XP_006366490.1|  PREDICTED: expansin-A6                             309   1e-102   Solanum tuberosum [potatoes]
ref|XP_006846223.1|  hypothetical protein AMTR_s00012p00230920          309   1e-102   Amborella trichopoda
ref|NP_001236550.1|  expansin precursor                                 309   1e-102   
dbj|BAC67194.1|  expansin                                               309   1e-102   Pyrus communis
ref|XP_002881524.1|  ATEXPA3                                            309   2e-102   Arabidopsis lyrata subsp. lyrata
gb|AAM62987.1|  expansin AtEx6                                          308   3e-102   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001150534.1|  alpha-expansin 6 precursor                         308   3e-102   
gb|KJB46593.1|  hypothetical protein B456_007G376300                    310   3e-102   Gossypium raimondii
ref|XP_008371813.1|  PREDICTED: expansin-A4-like                        308   4e-102   Malus domestica [apple tree]
ref|XP_010534508.1|  PREDICTED: expansin-A4                             308   4e-102   Tarenaya hassleriana [spider flower]
ref|XP_011031225.1|  PREDICTED: expansin-A4-like                        308   5e-102   Populus euphratica
ref|XP_009124371.1|  PREDICTED: LOW QUALITY PROTEIN: expansin-A6        308   6e-102   Brassica rapa
ref|NP_001288852.1|  expansin-A3 precursor                              307   9e-102   Brassica rapa
ref|XP_006294844.1|  hypothetical protein CARUB_v10023895mg             307   1e-101   Capsella rubella
emb|CDX74942.1|  BnaA05g06880D                                          307   1e-101   
ref|XP_002312101.1|  alpha-expansin 9 precursor family protein          306   2e-101   Populus trichocarpa [western balsam poplar]
ref|XP_006411198.1|  hypothetical protein EUTSA_v10017119mg             306   2e-101   Eutrema salsugineum [saltwater cress]
ref|XP_004145295.1|  PREDICTED: expansin-A4-like                        306   2e-101   
ref|XP_008799850.1|  PREDICTED: expansin-A6-like                        306   3e-101   Phoenix dactylifera
ref|XP_006294816.1|  hypothetical protein CARUB_v10023867mg             306   3e-101   Capsella rubella
ref|XP_010931278.1|  PREDICTED: LOW QUALITY PROTEIN: expansin-A7        306   4e-101   Elaeis guineensis
emb|CDY07642.1|  BnaA03g18690D                                          306   4e-101   Brassica napus [oilseed rape]
gb|ABK93541.1|  unknown                                                 305   4e-101   Populus trichocarpa [western balsam poplar]
ref|XP_010111457.1|  hypothetical protein L484_021280                   305   5e-101   Morus notabilis
gb|KHN33378.1|  Expansin-A4                                             305   5e-101   Glycine soja [wild soybean]
ref|XP_010937609.1|  PREDICTED: expansin-A4                             305   5e-101   Elaeis guineensis
gb|ACF87150.1|  unknown                                                 305   6e-101   Zea mays [maize]
gb|AAV85475.1|  expansin                                                305   6e-101   Populus tomentosa [Chinese white poplar]
ref|XP_010423881.1|  PREDICTED: expansin-A9-like                        305   7e-101   Camelina sativa [gold-of-pleasure]
ref|XP_002463623.1|  hypothetical protein SORBIDRAFT_01g003120          305   7e-101   Sorghum bicolor [broomcorn]
ref|XP_010452058.1|  PREDICTED: expansin-A9-like                        305   7e-101   Camelina sativa [gold-of-pleasure]
gb|ACA05164.1|  expansin 1                                              305   8e-101   Dimocarpus longan [longan]
ref|XP_010532011.1|  PREDICTED: expansin-A4-like                        305   1e-100   Tarenaya hassleriana [spider flower]
gb|EYU26594.1|  hypothetical protein MIMGU_mgv1a012061mg                305   1e-100   Erythranthe guttata [common monkey flower]
ref|XP_010558331.1|  PREDICTED: expansin-A9                             305   1e-100   Tarenaya hassleriana [spider flower]
ref|XP_004981242.1|  PREDICTED: expansin-A7-like                        303   3e-100   Setaria italica
ref|XP_009409019.1|  PREDICTED: expansin-A4-like                        303   4e-100   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY07024.1|  BnaA04g22910D                                          303   4e-100   
dbj|BAE06067.1|  expansin                                               303   4e-100   Sagittaria pygmaea
ref|NP_001288961.1|  expansin-A4 precursor                              303   6e-100   Brassica rapa
ref|XP_010490643.1|  PREDICTED: expansin-A9                             303   6e-100   Camelina sativa [gold-of-pleasure]
gb|ACT67493.1|  expansin A1                                             302   9e-100   Raphanus sativus
ref|XP_009388613.1|  PREDICTED: expansin-A7                             302   1e-99    Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY69611.1|  BnaCnng64440D                                          302   1e-99    Brassica napus [oilseed rape]
ref|XP_009130690.1|  PREDICTED: expansin-A9-like                        301   1e-99    Brassica rapa
emb|CDX80810.1|  BnaC03g00640D                                          301   2e-99    
ref|NP_181500.1|  expansin A4                                           301   2e-99    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009141827.1|  PREDICTED: expansin-A4-like                        301   3e-99    Brassica rapa
ref|XP_003597354.1|  Cell wall protein Exp5                             298   3e-99    
ref|XP_006294843.1|  hypothetical protein CARUB_v10023894mg             301   3e-99    Capsella rubella
gb|EPS64820.1|  hypothetical protein M569_09956                         300   4e-99    Genlisea aurea
ref|XP_002870966.1|  ATEXPA9                                            300   5e-99    Arabidopsis lyrata subsp. lyrata
ref|XP_002881669.1|  ATEXPA4                                            300   5e-99    
emb|CDY24952.1|  BnaC03g22200D                                          300   7e-99    Brassica napus [oilseed rape]
ref|NP_195846.1|  expansin A9                                           300   7e-99    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002878036.1|  ATEXPA16                                           300   8e-99    Arabidopsis lyrata subsp. lyrata
ref|NP_001051731.1|  Os03g0822000                                       300   8e-99    
ref|XP_009419260.1|  PREDICTED: expansin-A7-like                        299   1e-98    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006650810.1|  PREDICTED: expansin-A7-like                        300   1e-98    Oryza brachyantha
ref|XP_010554612.1|  PREDICTED: expansin-A4                             299   1e-98    Tarenaya hassleriana [spider flower]
ref|XP_009122794.1|  PREDICTED: expansin-A9                             299   1e-98    Brassica rapa
emb|CDY20467.1|  BnaC04g05770D                                          299   1e-98    Brassica napus [oilseed rape]
gb|AAQ08016.1|  expansin                                                299   2e-98    Melilotus albus
ref|XP_009143296.1|  PREDICTED: expansin-A4-like                        299   2e-98    Brassica rapa
ref|XP_009381075.1|  PREDICTED: expansin-A7-like                        299   2e-98    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010505648.1|  PREDICTED: expansin-A4                             298   3e-98    Camelina sativa [gold-of-pleasure]
gb|KJB08890.1|  hypothetical protein B456_001G111100                    299   3e-98    Gossypium raimondii
ref|NP_001288942.1|  expansin-A16 precursor                             298   4e-98    Brassica rapa
emb|CDY10456.1|  BnaCnng03570D                                          298   4e-98    
ref|XP_006398690.1|  hypothetical protein EUTSA_v10014430mg             298   4e-98    
ref|XP_010517323.1|  PREDICTED: expansin-A4-like                        298   5e-98    
gb|ABK24904.1|  unknown                                                 298   5e-98    
gb|ABN09939.1|  expansin A4                                             298   5e-98    
ref|XP_010508990.1|  PREDICTED: expansin-A4-like                        297   6e-98    
ref|XP_009398502.1|  PREDICTED: expansin-A7-like                        297   8e-98    
gb|AAM62937.1|  Alpha-expansin 4 precursor (At-EXP4) (AtEx4) (Ath...    296   1e-97    
ref|XP_010427324.1|  PREDICTED: expansin-A16-like                       296   3e-97    
ref|XP_010516124.1|  PREDICTED: expansin-A16                            296   3e-97    
gb|ABM54492.1|  expansin 2                                              296   3e-97    
emb|CDY40233.1|  BnaA09g35150D                                          296   3e-97    
ref|XP_006291698.1|  hypothetical protein CARUB_v10017862mg             296   3e-97    
ref|XP_003563572.1|  PREDICTED: expansin-A7                             296   4e-97    
emb|CDY04847.1|  BnaAnng00290D                                          295   4e-97    
emb|CDY48101.1|  BnaC02g03580D                                          295   5e-97    
ref|NP_001288956.1|  expansin-A9-like precursor                         295   6e-97    
gb|ABN09942.1|  expansin A5                                             294   8e-97    
gb|KFK34799.1|  hypothetical protein AALP_AA5G194700                    295   9e-97    
ref|NP_191109.1|  expansin A16                                          294   2e-96    
ref|XP_010504408.1|  PREDICTED: expansin-A16-like                       294   2e-96    
ref|XP_008458865.1|  PREDICTED: expansin-A4                             293   4e-96    
gb|AAS48878.1|  expansin EXPA9                                          292   7e-96    
gb|ABN09940.1|  expansin A5                                             292   8e-96    
gb|ACG46282.1|  alpha-expansin 6 precursor                              292   8e-96    
gb|KHN07218.1|  Expansin-A4                                             291   9e-96    
ref|XP_009139160.1|  PREDICTED: expansin-A16-like                       291   2e-95    
ref|XP_006403453.1|  hypothetical protein EUTSA_v10010989mg             291   2e-95    
emb|CDX76090.1|  BnaA04g03540D                                          291   2e-95    
gb|KFK36856.1|  hypothetical protein AALP_AA4G180600                    290   6e-95    
gb|KFK24708.1|  hypothetical protein AALP_AA8G014300                    290   8e-95    
emb|CDY41218.1|  BnaC08g26400D                                          289   2e-94    
emb|CDY02943.1|  BnaC04g25430D                                          288   4e-94    
ref|XP_004171211.1|  PREDICTED: expansin-A16-like                       287   6e-94    
ref|XP_010677870.1|  PREDICTED: expansin-A4-like                        287   1e-93    
gb|AAL01624.1|  expansin                                                283   1e-93    
gb|ACF84785.1|  unknown                                                 286   3e-93    
gb|KFK34800.1|  hypothetical protein AALP_AA5G194900                    283   1e-92    
gb|ABK93258.1|  unknown                                                 277   5e-91    
gb|AAL87024.1|  cell wall protein Exp5                                  276   9e-91    
gb|AAL87021.1|  cell wall protein EXP2 precursor                        278   1e-90    
gb|EPS68567.1|  hypothetical protein M569_06200                         276   1e-89    
gb|AAN60246.1|  unknown                                                 274   1e-89    
ref|NP_001267685.1|  expansin-A16-like                                  276   1e-89    
ref|XP_004307494.1|  PREDICTED: expansin-A4-like                        273   1e-88    
gb|AFK33369.1|  unknown                                                 270   3e-88    
emb|CAB65694.1|  Expansin 18                                            268   1e-87    
gb|EYU19913.1|  hypothetical protein MIMGU_mgv1a012177mg                269   8e-87    
gb|ABM66430.1|  expansin 3                                              269   8e-87    
ref|XP_010931357.1|  PREDICTED: expansin-A4-like                        268   2e-86    
dbj|BAD00017.1|  expansin                                               266   3e-86    
gb|AAM22631.1|AF428184_1  expansin 17 precursor                         263   7e-86    
ref|XP_010921302.1|  PREDICTED: expansin-A10-like                       266   9e-86    
gb|ADD14631.1|  expansin precursor                                      264   2e-85    
ref|XP_008354429.1|  PREDICTED: expansin-A4-like                        266   2e-85    
ref|XP_006435913.1|  hypothetical protein CICLE_v10032524mg             265   2e-85    
gb|AFK34543.1|  unknown                                                 265   3e-85    
gb|AAL87023.1|  cell wall protein Exp4 precursor                        265   3e-85    
ref|NP_001275780.1|  expansin 2 precursor                               265   4e-85    
ref|NP_001289251.1|  expansin-A4-like precursor                         265   5e-85    
gb|AGU13763.1|  expansin                                                265   5e-85    
gb|AEQ55268.1|  expansin                                                264   6e-85    
ref|XP_003607738.1|  Expansin                                           265   7e-85    
gb|ACU17612.1|  unknown                                                 261   7e-85    
gb|ABO32366.1|  expansin                                                263   1e-84    
ref|XP_010103644.1|  hypothetical protein L484_011237                   263   1e-84    
ref|XP_010257816.1|  PREDICTED: expansin-A1                             263   1e-84    
ref|XP_002523388.1|  Alpha-expansin 1 precursor, putative               263   1e-84    
ref|NP_001117573.1|  expansin A1                                        264   1e-84    
ref|NP_849869.1|  expansin A1                                           264   1e-84    
gb|AJR32958.1|  expansin                                                263   1e-84    
gb|ADN03964.1|  EXP1                                                    263   1e-84    
ref|XP_009410516.1|  PREDICTED: expansin-A4-like                        263   2e-84    
ref|NP_001185357.1|  expansin A1                                        263   2e-84    
gb|AAM46682.1|AF442773_1  expansin 1                                    259   2e-84    
ref|XP_003529476.1|  PREDICTED: expansin-A15-like                       263   2e-84    
emb|CDY24897.1|  BnaC03g22750D                                          263   2e-84    
ref|XP_010938009.1|  PREDICTED: expansin-A2-like                        263   2e-84    
gb|AEQ55270.1|  expansin                                                263   2e-84    
ref|XP_002887242.1|  ATEXPA1                                            263   2e-84    
ref|NP_177112.1|  expansin A1                                           263   2e-84    
gb|AEL88239.1|  expansin                                                261   2e-84    
ref|XP_009384771.1|  PREDICTED: expansin-A2                             263   3e-84    
ref|XP_008792215.1|  PREDICTED: expansin-A8-like                        263   3e-84    
gb|ADD14630.1|  expansin precursor                                      261   3e-84    
gb|KHN32128.1|  Expansin-A4                                             261   4e-84    
gb|AAD13634.1|  expansin                                                258   5e-84    
ref|XP_004970396.1|  PREDICTED: expansin-A2-like                        261   6e-84    
gb|KCW65774.1|  hypothetical protein EUGRSUZ_G03134                     261   6e-84    
ref|XP_003613849.1|  Expansin                                           261   7e-84    
ref|XP_010670609.1|  PREDICTED: expansin-A4                             261   7e-84    
ref|XP_010258310.1|  PREDICTED: expansin-A1 isoform X1                  261   8e-84    
ref|XP_003568245.1|  PREDICTED: expansin-A4                             261   8e-84    
ref|XP_008782645.1|  PREDICTED: expansin-A2-like                        261   9e-84    
ref|XP_010921134.1|  PREDICTED: expansin-A2-like isoform X1             261   9e-84    
ref|XP_010922733.1|  PREDICTED: expansin-A2-like                        261   1e-83    
ref|NP_001281040.1|  expansin-A4-like precursor                         261   1e-83    
ref|XP_011089527.1|  PREDICTED: expansin-A4-like                        261   1e-83    
dbj|BAJ10397.1|  alpha-expansin                                         261   1e-83    
gb|KDO49685.1|  hypothetical protein CISIN_1g025193mg                   261   1e-83    
gb|AHL25252.1|  expansin                                                261   1e-83    
ref|XP_010470942.1|  PREDICTED: expansin-A1-like                        261   1e-83    
ref|XP_010258311.1|  PREDICTED: expansin-A1 isoform X2                  261   1e-83    
gb|ACM90161.1|  expansin 3                                              260   2e-83    
ref|XP_006654542.1|  PREDICTED: expansin-A4-like                        260   2e-83    
ref|XP_006429564.1|  hypothetical protein CICLE_v10013804mg             260   2e-83    
ref|XP_009374380.1|  PREDICTED: expansin-A4-like                        260   2e-83    
ref|XP_010108480.1|  hypothetical protein L484_010673                   260   2e-83    
ref|XP_007158645.1|  hypothetical protein PHAVU_002G170300g             262   2e-83    
ref|XP_002520863.1|  Alpha-expansin 8 precursor, putative               260   2e-83    
gb|AEQ55284.1|  expansin                                                260   3e-83    
ref|XP_010415602.1|  PREDICTED: expansin-A1-like                        259   3e-83    
gb|AEV43315.1|  expansin A5                                             258   3e-83    
gb|AEQ55269.1|  expansin                                                259   4e-83    
emb|CDP13911.1|  unnamed protein product                                259   4e-83    
ref|XP_007205739.1|  hypothetical protein PRUPE_ppa010180mg             257   4e-83    
gb|ACA05166.1|  expansin 3                                              259   4e-83    
gb|KFK42332.1|  hypothetical protein AALP_AA2G242600                    259   5e-83    
gb|KEH35550.1|  expansin A10                                            259   5e-83    
gb|AAB81662.1|  expansin                                                259   6e-83    
emb|CDP04049.1|  unnamed protein product                                259   6e-83    
gb|ADC35366.1|  alpha-expansin 3                                        259   6e-83    
gb|AEQ55272.1|  expansin                                                259   6e-83    
ref|XP_011076589.1|  PREDICTED: expansin-A4-like                        259   6e-83    
gb|ADD14636.1|  expansin precursor                                      257   7e-83    
ref|XP_008242138.1|  PREDICTED: expansin-A8-like                        259   7e-83    
ref|XP_007205762.1|  hypothetical protein PRUPE_ppa010314mg             259   7e-83    
dbj|BAJ10398.1|  alpha-expansin                                         259   7e-83    
gb|ACK43222.1|  expansin 2                                              259   8e-83    
ref|XP_002323665.1|  expansin S1 precursor family protein               259   8e-83    
gb|KEH35551.1|  expansin A10                                            259   8e-83    
gb|AAB38070.1|  expansin At-EXPA1                                       258   8e-83    
gb|AAC33529.1|  expansin                                                259   9e-83    
ref|XP_003544930.1|  PREDICTED: expansin-A8                             259   9e-83    
gb|AAG13982.1|AF297521_1  expansin 1                                    258   9e-83    
ref|NP_001055842.1|  Os05g0477600                                       258   9e-83    
gb|KJB20063.1|  hypothetical protein B456_003G131000                    256   1e-82    
ref|XP_004155305.1|  PREDICTED: LOW QUALITY PROTEIN: expansin-A1-...    258   1e-82    
ref|XP_006291657.1|  hypothetical protein CARUB_v10017813mg             259   1e-82    
ref|NP_001240136.1|  expansin-A1-like precursor                         258   1e-82    
ref|XP_010917068.1|  PREDICTED: expansin-A10-like                       258   1e-82    
gb|AAR10411.2|  EXP1                                                    257   1e-82    
ref|XP_006302737.1|  hypothetical protein CARUB_v10020849mg             258   1e-82    
ref|XP_004135171.1|  PREDICTED: expansin-A1-like                        258   1e-82    
gb|AFK24457.1|  expansin 4                                              258   1e-82    
ref|XP_008446373.1|  PREDICTED: expansin-A1                             258   1e-82    
ref|NP_001267550.1|  expansin-A8-like precursor                         258   2e-82    
gb|ADD14635.1|  expansin precursor                                      256   2e-82    
ref|XP_009399910.1|  PREDICTED: expansin-A2-like                        258   2e-82    
emb|CBI15823.3|  unnamed protein product                                257   2e-82    
gb|AAL87022.1|  cell wall protein EXP3 precursor                        258   2e-82    
gb|ABR17119.1|  unknown                                                 258   2e-82    
gb|AFK24458.1|  expansin 5                                              258   2e-82    
ref|XP_010511994.1|  PREDICTED: expansin-A1                             257   2e-82    
ref|XP_010257730.1|  PREDICTED: expansin-A15-like                       257   2e-82    
ref|XP_002456550.1|  hypothetical protein SORBIDRAFT_03g038290          258   2e-82    
gb|AAR82851.1|  expansin-3                                              257   2e-82    
gb|EYU20096.1|  hypothetical protein MIMGU_mgv1a012489mg                257   3e-82    
ref|XP_007209512.1|  hypothetical protein PRUPE_ppa010443mg             257   3e-82    
ref|XP_003518007.1|  PREDICTED: expansin-A1-like                        257   3e-82    
ref|XP_006829796.1|  hypothetical protein AMTR_s00119p00058870          257   3e-82    
gb|KDP30638.1|  hypothetical protein JCGZ_16203                         257   3e-82    
ref|XP_002514740.1|  Alpha-expansin 15 precursor, putative              257   3e-82    
ref|XP_008808309.1|  PREDICTED: expansin-A2-like                        257   3e-82    
ref|XP_010044491.1|  PREDICTED: expansin-A1-like                        257   3e-82    
ref|XP_002276565.3|  PREDICTED: expansin-A4                             257   3e-82    
emb|CDP00351.1|  unnamed protein product                                259   3e-82    
ref|XP_007142047.1|  hypothetical protein PHAVU_008G248000g             257   3e-82    
ref|XP_004307732.1|  PREDICTED: expansin-A10                            257   3e-82    
gb|AAM08930.1|  expansin 1                                              257   3e-82    
ref|XP_003523276.1|  PREDICTED: expansin-A8-like                        257   4e-82    
ref|XP_009622932.1|  PREDICTED: expansin-A8-like                        257   4e-82    
ref|XP_011019014.1|  PREDICTED: expansin-A8-like                        257   4e-82    
ref|XP_010252076.1|  PREDICTED: expansin-A8-like                        257   4e-82    
gb|KDP20276.1|  hypothetical protein JCGZ_06862                         256   4e-82    
ref|XP_009404081.1|  PREDICTED: expansin-A15                            256   5e-82    
ref|XP_008239926.1|  PREDICTED: expansin-A1-like                        256   5e-82    
dbj|BAJ99188.1|  predicted protein                                      256   5e-82    
gb|AAK72877.1|  expansin 6                                              253   7e-82    
gb|AFK38068.1|  unknown                                                 256   7e-82    
ref|XP_009399909.1|  PREDICTED: expansin-A2-like                        258   7e-82    
gb|AFZ78603.1|  expansin protein                                        256   7e-82    
ref|NP_001105040.1|  alpha expansin1 precursor                          256   7e-82    
ref|XP_010525408.1|  PREDICTED: expansin-A8                             256   8e-82    
gb|ABF48653.1|  expansin precursor                                      256   8e-82    
gb|AAW88314.1|  expansin EXPA10                                         256   8e-82    
gb|AEC03978.1|  expansin                                                256   8e-82    
gb|AEQ28765.1|  expansin 3                                              256   8e-82    
gb|AAW88315.1|  expansin EXPA11                                         256   8e-82    
ref|XP_011013147.1|  PREDICTED: expansin-A1                             256   9e-82    
gb|ACA05165.1|  expansin 2                                              256   9e-82    
ref|XP_008456949.1|  PREDICTED: expansin-A8-like                        256   9e-82    
gb|KJB80218.1|  hypothetical protein B456_013G086900                    256   1e-81    
ref|XP_002325925.2|  alpha-expansin 8 precursor family protein          256   1e-81    
gb|AAG13983.1|AF297522_1  expansin 2                                    256   1e-81    
gb|ADC35364.1|  alpha-expansin 1                                        256   1e-81    
ref|XP_006391003.1|  hypothetical protein EUTSA_v10019043mg             256   1e-81    
gb|KDP21654.1|  hypothetical protein JCGZ_03325                         256   1e-81    
ref|XP_007037392.1|  Expansin A1, ALPHA 1.2,EXPA1                       257   1e-81    
ref|XP_004294733.1|  PREDICTED: expansin-A4-like                        256   1e-81    
gb|AGF90536.1|  expansin 2                                              255   1e-81    
ref|XP_002309181.2|  hypothetical protein POPTR_0006s10850g             256   1e-81    
gb|ABB59694.1|  alpha-expansin 2                                        255   1e-81    
emb|CDP12277.1|  unnamed protein product                                255   1e-81    
ref|XP_010502317.1|  PREDICTED: expansin-A15                            256   1e-81    
ref|XP_008648280.1|  PREDICTED: alpha-expansin 5 isoform X1             255   1e-81    
ref|XP_011011315.1|  PREDICTED: expansin-A8-like                        256   1e-81    
ref|XP_010910535.1|  PREDICTED: expansin-A1-like                        255   1e-81    
ref|XP_010452431.1|  PREDICTED: expansin-A2                             256   2e-81    
gb|KDP22771.1|  hypothetical protein JCGZ_00358                         255   2e-81    
gb|AAD47901.1|AF085330_1  expansin                                      255   2e-81    
gb|KHF98169.1|  Expansin-A4 -like protein                               254   2e-81    
ref|NP_001044656.1|  Os01g0823100                                       255   2e-81    
ref|XP_010108685.1|  hypothetical protein L484_015671                   255   2e-81    
ref|XP_010423483.1|  PREDICTED: expansin-A2-like                        255   2e-81    
gb|AAL40354.1|AF448467_1  alpha-expansin                                255   2e-81    
ref|NP_001266033.1|  expansin-A15-like precursor                        255   2e-81    
ref|NP_001288866.1|  expansin-A1 precursor                              255   2e-81    
gb|AHL25254.1|  expansin                                                255   2e-81    
gb|AEE69072.1|  expansin-5                                              255   2e-81    
emb|CDY40938.1|  BnaC06g30760D                                          255   2e-81    



>dbj|BAO57279.1| alpha-expansin [Ipomoea nil]
Length=257

 Score =   383 bits (983),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 187/187 (100%), Positives = 187/187 (100%), Gaps = 0/187 (0%)
 Frame = +1

Query  94   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  273
            MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS
Sbjct  1    MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  60

Query  274  QGYGVNNAALSTALFNNGLSCGACFEIKCSNDRSCSPGNPSIFVTATNFCPPNFALPNDN  453
            QGYGVNNAALSTALFNNGLSCGACFEIKCSNDRSCSPGNPSIFVTATNFCPPNFALPNDN
Sbjct  61   QGYGVNNAALSTALFNNGLSCGACFEIKCSNDRSCSPGNPSIFVTATNFCPPNFALPNDN  120

Query  454  GGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVT  633
            GGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVT
Sbjct  121  GGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVT  180

Query  634  NVAGAGD  654
            NVAGAGD
Sbjct  181  NVAGAGD  187



>gb|AEQ55271.1| expansin [Breonia chinensis]
 gb|AEQ55286.1| expansin [Breonia chinensis]
Length=258

 Score =   335 bits (859),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 161/188 (86%), Positives = 175/188 (93%), Gaps = 1/188 (1%)
 Frame = +1

Query  94   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  273
            MA V +LCIA LLC LT V+ARIPGVYSGG WQ+AHATFYGG+DASGTMGGACGYGNLYS
Sbjct  1    MAQVGLLCIATLLCFLTVVNARIPGVYSGGPWQSAHATFYGGSDASGTMGGACGYGNLYS  60

Query  274  QGYGVNNAALSTALFNNGLSCGACFEIKCSN-DRSCSPGNPSIFVTATNFCPPNFALPND  450
            QGYGVN  ALSTALFNNGLSCGACFE+KC+N  + C PGNPSIF+TATNFCPPNFALPND
Sbjct  61   QGYGVNTGALSTALFNNGLSCGACFELKCANAPKWCLPGNPSIFITATNFCPPNFALPND  120

Query  451  NGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLV  630
            NGGWCNPPRPHFDLAMPMFLKIA YRAGIVPVN+RR+PCRK+GGIRFTVNGFRYFNL+L+
Sbjct  121  NGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVNYRRVPCRKRGGIRFTVNGFRYFNLILI  180

Query  631  TNVAGAGD  654
            TNVAGAG+
Sbjct  181  TNVAGAGN  188



>ref|XP_006341021.1| PREDICTED: expansin-A3 [Solanum tuberosum]
Length=263

 Score =   335 bits (858),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 162/191 (85%), Positives = 175/191 (92%), Gaps = 3/191 (2%)
 Frame = +1

Query  91   KMAAVRVLCIA--LLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGN  264
            KMAA  +L I   +LLC LTAV+ARIPGVY+GG WQ+AHATFYGG+DASGTMGGACGYGN
Sbjct  3    KMAATMMLYITTTILLCFLTAVNARIPGVYTGGPWQSAHATFYGGSDASGTMGGACGYGN  62

Query  265  LYSQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFAL  441
            LYSQGYGVNNAALST LFNNGLSCGACFE+KC ND + C PGNPSIFVTATNFCPPNFAL
Sbjct  63   LYSQGYGVNNAALSTVLFNNGLSCGACFELKCDNDGKWCLPGNPSIFVTATNFCPPNFAL  122

Query  442  PNDNGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNL  621
            PND+GGWCNPPRPHFDLAMPMFLKI  YRAGIVPV +RR+PCRKQGGIRFT+NGFRYFNL
Sbjct  123  PNDDGGWCNPPRPHFDLAMPMFLKIGLYRAGIVPVTYRRVPCRKQGGIRFTINGFRYFNL  182

Query  622  VLVTNVAGAGD  654
            +LVTNVAGAGD
Sbjct  183  LLVTNVAGAGD  193



>ref|NP_001234081.1| expansin A4 precursor [Solanum lycopersicum]
 gb|AAD13632.1| expansin precursor [Solanum lycopersicum]
Length=263

 Score =   335 bits (858),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 163/191 (85%), Positives = 175/191 (92%), Gaps = 3/191 (2%)
 Frame = +1

Query  91   KMAAVRVL--CIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGN  264
            KMAA  +L   I +LLC LTAV+ARIPGVY+GG WQTAHATFYGG+DASGTMGGACGYGN
Sbjct  3    KMAANMMLYITITVLLCFLTAVNARIPGVYTGGPWQTAHATFYGGSDASGTMGGACGYGN  62

Query  265  LYSQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFAL  441
            LYSQGYGVNNAALST LFNNGLSCGACFE+KC ND + C PGNPSIFVTATNFCPPNFAL
Sbjct  63   LYSQGYGVNNAALSTVLFNNGLSCGACFELKCDNDGKWCLPGNPSIFVTATNFCPPNFAL  122

Query  442  PNDNGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNL  621
            PND+GGWCNPPRPHFDLAMPMFLKI  YRAGIVPV +RR+PCRKQGGIRFT+NGFRYFNL
Sbjct  123  PNDDGGWCNPPRPHFDLAMPMFLKIGLYRAGIVPVTYRRVPCRKQGGIRFTINGFRYFNL  182

Query  622  VLVTNVAGAGD  654
            +LVTNVAGAGD
Sbjct  183  LLVTNVAGAGD  193



>gb|KDP35637.1| hypothetical protein JCGZ_09075 [Jatropha curcas]
Length=258

 Score =   332 bits (851),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 158/188 (84%), Positives = 174/188 (93%), Gaps = 1/188 (1%)
 Frame = +1

Query  94   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  273
            MA + VLCI  L      V+ARIPGVY+GG+W++AHATFYGG+DASGTMGGACGYGNLYS
Sbjct  1    MANLDVLCIISLFSLFWVVNARIPGVYTGGSWESAHATFYGGSDASGTMGGACGYGNLYS  60

Query  274  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPND  450
            QGYGVN AALSTALFNNGLSCGACFEIKC++D + C+PG+PSIF+TATNFCPPNFALP+D
Sbjct  61   QGYGVNTAALSTALFNNGLSCGACFEIKCADDPKWCNPGSPSIFITATNFCPPNFALPSD  120

Query  451  NGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLV  630
            NGGWCNPPRPHFDLAMPMFLKIA YRAGIVPVNFRRIPCRKQGGIRFT+NGFRYFNLVLV
Sbjct  121  NGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVNFRRIPCRKQGGIRFTINGFRYFNLVLV  180

Query  631  TNVAGAGD  654
            +NVAGAGD
Sbjct  181  SNVAGAGD  188



>gb|KJB76740.1| hypothetical protein B456_012G104400 [Gossypium raimondii]
Length=264

 Score =   332 bits (850),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 155/187 (83%), Positives = 175/187 (94%), Gaps = 1/187 (1%)
 Frame = +1

Query  97   AAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQ  276
            +++ +LC A L+C    V+ARIPGVY+GG+W++AHATFYGG+DASGTMGGACGYGNLYSQ
Sbjct  8    SSLTLLCFASLMCLFGMVNARIPGVYTGGSWESAHATFYGGSDASGTMGGACGYGNLYSQ  67

Query  277  GYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDN  453
            GYGVN AALSTALFNNGLSCGACFEIKC++D R C PGNPSIF+TATNFCPPN+ALP+DN
Sbjct  68   GYGVNTAALSTALFNNGLSCGACFEIKCTDDPRWCHPGNPSIFITATNFCPPNYALPSDN  127

Query  454  GGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVT  633
            GGWCNPPRPHFDLAMPMFLK+A YRAGIVPV+FRR+PCRKQGGIRFT+NGFRYFNLVLVT
Sbjct  128  GGWCNPPRPHFDLAMPMFLKMAEYRAGIVPVSFRRVPCRKQGGIRFTINGFRYFNLVLVT  187

Query  634  NVAGAGD  654
            NVAGAGD
Sbjct  188  NVAGAGD  194



>ref|XP_009788740.1| PREDICTED: expansin-A3-like [Nicotiana sylvestris]
Length=259

 Score =   332 bits (850),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 160/189 (85%), Positives = 173/189 (92%), Gaps = 2/189 (1%)
 Frame = +1

Query  94   MAAVRVLCIA-LLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLY  270
            MA  ++LCIA  LLC LTAV+A+IPGVY+GG WQ AHATFYGG+DASGTMGGACGYGNLY
Sbjct  1    MAVTKILCIAATLLCFLTAVNAKIPGVYTGGPWQGAHATFYGGSDASGTMGGACGYGNLY  60

Query  271  SQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPN  447
            SQGYGVNNAALST LFNNGLSCGACFEIKC +D + C PGNPSIFVTATNFCPPNFALPN
Sbjct  61   SQGYGVNNAALSTVLFNNGLSCGACFEIKCVDDGKWCLPGNPSIFVTATNFCPPNFALPN  120

Query  448  DNGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVL  627
            D+GGWCNPPRPHFDLAMPMFLKI  YRAGIVPV +RR+PCRK GGIRFT+NGFRYFNL+L
Sbjct  121  DDGGWCNPPRPHFDLAMPMFLKIGQYRAGIVPVTYRRVPCRKAGGIRFTINGFRYFNLLL  180

Query  628  VTNVAGAGD  654
            VTNVAGAGD
Sbjct  181  VTNVAGAGD  189



>ref|XP_009607348.1| PREDICTED: expansin-A3-like [Nicotiana tomentosiformis]
Length=293

 Score =   332 bits (851),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 156/182 (86%), Positives = 169/182 (93%), Gaps = 0/182 (0%)
 Frame = +1

Query  109  VLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGV  288
             L IA +LC LTAV+A+I G Y+GG W TAHATFYGG+DASGTMGGACGYGNLYSQGYGV
Sbjct  7    TLYIASVLCFLTAVNAKISGNYAGGPWTTAHATFYGGSDASGTMGGACGYGNLYSQGYGV  66

Query  289  NNAALSTALFNNGLSCGACFEIKCSNDRSCSPGNPSIFVTATNFCPPNFALPNDNGGWCN  468
            NNAALST LFNNGLSCGACFE+KC++ + C+PGNPSI VTATNFCPPNFALPNDNGGWCN
Sbjct  67   NNAALSTVLFNNGLSCGACFELKCTDQKWCTPGNPSILVTATNFCPPNFALPNDNGGWCN  126

Query  469  PPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGA  648
            PPRPHFDLAMPMFLKIA YRAGIVPVN+RR+PCRKQGGIRFT+NGFRYFNLVLVTNVAGA
Sbjct  127  PPRPHFDLAMPMFLKIAEYRAGIVPVNYRRVPCRKQGGIRFTINGFRYFNLVLVTNVAGA  186

Query  649  GD  654
            GD
Sbjct  187  GD  188



>ref|XP_007027012.1| Expansin A4, ALPHA 1.6,EXPA4 [Theobroma cacao]
 gb|EOY07514.1| Expansin A4, ALPHA 1.6,EXPA4 [Theobroma cacao]
Length=263

 Score =   330 bits (847),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 157/187 (84%), Positives = 173/187 (93%), Gaps = 1/187 (1%)
 Frame = +1

Query  97   AAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQ  276
            +++ VLC A LL     V+ARIPGVY+GG+W++AHATFYGG+DASGTMGGACGYGNLYSQ
Sbjct  7    SSLTVLCFASLLSFSVVVNARIPGVYTGGSWESAHATFYGGSDASGTMGGACGYGNLYSQ  66

Query  277  GYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDN  453
            GYGVN AALSTALFNNGLSCGACFEIKC+ND R C PG+PSIFVTATNFCPPN+ALP+DN
Sbjct  67   GYGVNTAALSTALFNNGLSCGACFEIKCANDPRWCHPGSPSIFVTATNFCPPNYALPSDN  126

Query  454  GGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVT  633
            GGWCNPPR HFDLAMPMFLKIA YRAGIVPV+FRR+PCRKQGGIRFT+NGFRYFNLVLVT
Sbjct  127  GGWCNPPRSHFDLAMPMFLKIAEYRAGIVPVSFRRVPCRKQGGIRFTINGFRYFNLVLVT  186

Query  634  NVAGAGD  654
            NVAGAGD
Sbjct  187  NVAGAGD  193



>ref|XP_004249634.1| PREDICTED: expansin-A3 [Solanum lycopersicum]
Length=259

 Score =   330 bits (846),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 159/189 (84%), Positives = 171/189 (90%), Gaps = 2/189 (1%)
 Frame = +1

Query  94   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  273
            MA    LCIA LLC LT V+A+I GVY+GG W +AHATFYGGADASGTMGGACGYGNLYS
Sbjct  1    MAVNWALCIATLLCFLTVVNAKIAGVYTGGPWTSAHATFYGGADASGTMGGACGYGNLYS  60

Query  274  QGYGVNNAALSTALFNNGLSCGACFEIKCSNDRS--CSPGNPSIFVTATNFCPPNFALPN  447
            QGYGVNNAALSTALFNNGLSCGACFEIKC++ +   C+PGNPSI VT TNFCPPN+ALPN
Sbjct  61   QGYGVNNAALSTALFNNGLSCGACFEIKCTDSKKEYCNPGNPSILVTGTNFCPPNYALPN  120

Query  448  DNGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVL  627
            DNGGWCNPPRPHFDLAMPMFLKIA YRAGIV VN+RR+PCRKQGGIRFTVNGF+YFNLVL
Sbjct  121  DNGGWCNPPRPHFDLAMPMFLKIAVYRAGIVAVNYRRVPCRKQGGIRFTVNGFQYFNLVL  180

Query  628  VTNVAGAGD  654
            VTNVAGAGD
Sbjct  181  VTNVAGAGD  189



>ref|XP_009787901.1| PREDICTED: expansin-A3-like [Nicotiana sylvestris]
Length=293

 Score =   331 bits (849),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 155/182 (85%), Positives = 169/182 (93%), Gaps = 0/182 (0%)
 Frame = +1

Query  109  VLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGV  288
             LCIA +LC LT+V+A+I G Y+GG W TAHATFYGG+DASGTMGGACGYGNLYSQGYGV
Sbjct  7    TLCIASVLCFLTSVNAKISGNYAGGPWTTAHATFYGGSDASGTMGGACGYGNLYSQGYGV  66

Query  289  NNAALSTALFNNGLSCGACFEIKCSNDRSCSPGNPSIFVTATNFCPPNFALPNDNGGWCN  468
            NNAALST LFNNGLSCGACFE+KC++ + C+PGNPSI VTATNFCPPN+ALPNDNGGWCN
Sbjct  67   NNAALSTVLFNNGLSCGACFELKCTDQKWCTPGNPSILVTATNFCPPNYALPNDNGGWCN  126

Query  469  PPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGA  648
            PPRPHFDLAMPMFLKIA YRAGIVPVN+RR+PCRKQGGIRFTVNGF YFNLVLVTNVAGA
Sbjct  127  PPRPHFDLAMPMFLKIAEYRAGIVPVNYRRVPCRKQGGIRFTVNGFNYFNLVLVTNVAGA  186

Query  649  GD  654
            GD
Sbjct  187  GD  188



>gb|KHG12430.1| Expansin-A4 -like protein [Gossypium arboreum]
Length=264

 Score =   330 bits (846),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 154/187 (82%), Positives = 175/187 (94%), Gaps = 1/187 (1%)
 Frame = +1

Query  97   AAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQ  276
            +++ +LC A L+C    V+ARIPGVY+GG+W++AHATFYGG+DASGTMGGACGYGNLYSQ
Sbjct  8    SSLTLLCFASLMCLFGMVNARIPGVYTGGSWESAHATFYGGSDASGTMGGACGYGNLYSQ  67

Query  277  GYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDN  453
            GYGVN AALSTA+FNNGLSCGACFEIKC++D R C PGNPSIF+TATNFCPPN+ALP+DN
Sbjct  68   GYGVNTAALSTAIFNNGLSCGACFEIKCTDDPRWCHPGNPSIFITATNFCPPNYALPSDN  127

Query  454  GGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVT  633
            GGWCNPPRPHFDLAMPMFLKIA YRAGIVPV+FRR+PCRKQGGIRFT+NGFRYFNLVLVT
Sbjct  128  GGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSFRRVPCRKQGGIRFTINGFRYFNLVLVT  187

Query  634  NVAGAGD  654
            NVAGAG+
Sbjct  188  NVAGAGN  194



>emb|CDP06606.1| unnamed protein product [Coffea canephora]
Length=260

 Score =   330 bits (845),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 158/188 (84%), Positives = 175/188 (93%), Gaps = 1/188 (1%)
 Frame = +1

Query  94   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  273
            MA +  LCIA LLC LT V+AR+PG YSGG WQ+AHATFYGG+DASGTMGGACGYGNLYS
Sbjct  1    MAQMCPLCIAALLCFLTVVNARLPGAYSGGPWQSAHATFYGGSDASGTMGGACGYGNLYS  60

Query  274  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPND  450
            QGYGVN AALSTALFN+GLSCGACFE+KC++D + C PG+PSIF+TATNFCPPNFALPND
Sbjct  61   QGYGVNTAALSTALFNDGLSCGACFELKCADDPKWCLPGSPSIFITATNFCPPNFALPND  120

Query  451  NGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLV  630
            NGGWCNPPRPHFDLAMPMFLKIA YRAGIVPVNFRR+PCRK+GGIRFTV+GFRYFNLVL+
Sbjct  121  NGGWCNPPRPHFDLAMPMFLKIAQYRAGIVPVNFRRVPCRKRGGIRFTVDGFRYFNLVLI  180

Query  631  TNVAGAGD  654
            TNVAGAG+
Sbjct  181  TNVAGAGN  188



>ref|XP_007016396.1| Expansin A4, ALPHA 1.6,EXPA4 [Theobroma cacao]
 gb|EOY34015.1| Expansin A4, ALPHA 1.6,EXPA4 [Theobroma cacao]
Length=258

 Score =   329 bits (844),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 154/188 (82%), Positives = 171/188 (91%), Gaps = 1/188 (1%)
 Frame = +1

Query  94   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  273
            MA V V+C+ L + S+    A+IPGVYSGGAWQ AHATFYGG+DASGTMGGACGYGNLYS
Sbjct  1    MAVVSVVCVLLFISSMWMAEAKIPGVYSGGAWQNAHATFYGGSDASGTMGGACGYGNLYS  60

Query  274  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPND  450
            QGYGVN AALSTALFNNGLSCGACFEIKC+ND + C  G PSIF+TATNFCPPN+ALPND
Sbjct  61   QGYGVNTAALSTALFNNGLSCGACFEIKCANDPKWCHSGGPSIFITATNFCPPNYALPND  120

Query  451  NGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLV  630
            NGGWCNPPRPHFDLAMPMFLKIA YRAGIVPV++RR+PCRK+GGIRFT+NGFRYFNLVL+
Sbjct  121  NGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKRGGIRFTINGFRYFNLVLI  180

Query  631  TNVAGAGD  654
            +NVAGAGD
Sbjct  181  SNVAGAGD  188



>ref|XP_003537990.1| PREDICTED: expansin-A4-like [Glycine max]
Length=259

 Score =   329 bits (843),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 157/183 (86%), Positives = 169/183 (92%), Gaps = 1/183 (1%)
 Frame = +1

Query  109  VLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGV  288
            VLCIA ++    AV ARIPG+YSGGAWQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGV
Sbjct  7    VLCIAFIITLTWAVEARIPGIYSGGAWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGV  66

Query  289  NNAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALPNDNGGWC  465
            N AALSTALFN+GLSCGACFEIKC+NDR  C  G+PSIF+TATNFCPPNFALPNDNGGWC
Sbjct  67   NTAALSTALFNSGLSCGACFEIKCANDRQWCHSGSPSIFITATNFCPPNFALPNDNGGWC  126

Query  466  NPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAG  645
            NPPRPHFDLAMPMFLKIA YRAGIVPV +RR+PCRK GGIRFTVNGFRYFNLVLV+NVAG
Sbjct  127  NPPRPHFDLAMPMFLKIAEYRAGIVPVAYRRVPCRKHGGIRFTVNGFRYFNLVLVSNVAG  186

Query  646  AGD  654
            AGD
Sbjct  187  AGD  189



>ref|XP_004505858.1| PREDICTED: expansin-A6-like [Cicer arietinum]
Length=257

 Score =   329 bits (843),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 156/184 (85%), Positives = 169/184 (92%), Gaps = 1/184 (1%)
 Frame = +1

Query  106  RVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYG  285
            ++L IA ++ S+  V ARIPG+YSGG WQTAHATFYGG+DASGTMGGACGYGNLYSQGYG
Sbjct  4    KILYIAFIISSMWIVEARIPGLYSGGQWQTAHATFYGGSDASGTMGGACGYGNLYSQGYG  63

Query  286  VNNAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALPNDNGGW  462
            VN AALSTALFNNGLSCGACFEIKC+NDR  C  G+PSIF+TATNFCPPNFALPNDNGGW
Sbjct  64   VNTAALSTALFNNGLSCGACFEIKCANDREWCHSGSPSIFITATNFCPPNFALPNDNGGW  123

Query  463  CNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVA  642
            CNPPRPHFDLAMPMFLKIA YRAGIVPV FRR+PCRK GGIRFTVNGFRYFNLVL++NVA
Sbjct  124  CNPPRPHFDLAMPMFLKIAEYRAGIVPVAFRRVPCRKHGGIRFTVNGFRYFNLVLISNVA  183

Query  643  GAGD  654
            GAGD
Sbjct  184  GAGD  187



>gb|KHG15821.1| Expansin-A4 -like protein [Gossypium arboreum]
Length=264

 Score =   328 bits (842),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 156/186 (84%), Positives = 172/186 (92%), Gaps = 1/186 (1%)
 Frame = +1

Query  100  AVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQG  279
            ++ VLC A LL  L  V+ARIPGV++GGAW++AHATFYGG+DASGTMGGACGYGNLYSQG
Sbjct  9    SLSVLCFASLLSFLAVVNARIPGVFTGGAWESAHATFYGGSDASGTMGGACGYGNLYSQG  68

Query  280  YGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNG  456
            YGVN AALSTALFNNGLSCGACFEIKC+ND R C  G+PSI +TATNFCPPN+ALPNDNG
Sbjct  69   YGVNTAALSTALFNNGLSCGACFEIKCANDPRWCHSGSPSIIITATNFCPPNYALPNDNG  128

Query  457  GWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTN  636
            GWCNPPRPHFDLAMPMFLKIA YRAGIVPV++RR+PCRKQGGIRFT+NGFRYFNLVLVTN
Sbjct  129  GWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKQGGIRFTINGFRYFNLVLVTN  188

Query  637  VAGAGD  654
            VAGAGD
Sbjct  189  VAGAGD  194



>gb|KHG30766.1| Expansin-A4 -like protein [Gossypium arboreum]
Length=262

 Score =   328 bits (841),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 157/186 (84%), Positives = 173/186 (93%), Gaps = 1/186 (1%)
 Frame = +1

Query  100  AVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQG  279
            ++ +LC   LL   T+V+ARIPGV+S G+W+TAHATFYGG+DASGTMGGACGYGNLYSQG
Sbjct  7    SLTLLCFTSLLPFFTSVNARIPGVFSTGSWETAHATFYGGSDASGTMGGACGYGNLYSQG  66

Query  280  YGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNG  456
            YGVN AALSTALFNNGLSCGACFEIKC++D R C PG+PSIFVTATNFCPPNFALP+DNG
Sbjct  67   YGVNTAALSTALFNNGLSCGACFEIKCASDPRWCHPGSPSIFVTATNFCPPNFALPSDNG  126

Query  457  GWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTN  636
            GWCNPPRPHFDLAMPMFLKIA YRAGIVPV+FRR+PCRKQGGIRFTVNGFRYFNLVL+TN
Sbjct  127  GWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSFRRVPCRKQGGIRFTVNGFRYFNLVLITN  186

Query  637  VAGAGD  654
            VAGAGD
Sbjct  187  VAGAGD  192



>ref|XP_006349505.1| PREDICTED: expansin-A3-like [Solanum tuberosum]
Length=259

 Score =   328 bits (840),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 157/189 (83%), Positives = 172/189 (91%), Gaps = 2/189 (1%)
 Frame = +1

Query  94   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  273
            MA    LCIA LLC LT V+A+I GVY+GG+W +AHATFYGGADASGTMGGACGYGNLYS
Sbjct  1    MAVNWALCIASLLCFLTVVNAKIVGVYTGGSWTSAHATFYGGADASGTMGGACGYGNLYS  60

Query  274  QGYGVNNAALSTALFNNGLSCGACFEIKCSNDRS--CSPGNPSIFVTATNFCPPNFALPN  447
            QGYGVNNAALSTALFN+GLSCG+CFEIKC++ +   C+PGNPSI VT TNFCPPN+ALPN
Sbjct  61   QGYGVNNAALSTALFNSGLSCGSCFEIKCTDSKKEYCNPGNPSILVTGTNFCPPNYALPN  120

Query  448  DNGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVL  627
            DNGGWCNPPRPHFDLAMPMFLKIA YRAGIV VN+RR+PCRKQGGIRFTVNGF+YFNLVL
Sbjct  121  DNGGWCNPPRPHFDLAMPMFLKIAVYRAGIVAVNYRRVPCRKQGGIRFTVNGFQYFNLVL  180

Query  628  VTNVAGAGD  654
            VTNVAGAGD
Sbjct  181  VTNVAGAGD  189



>gb|EYU41729.1| hypothetical protein MIMGU_mgv1a012073mg [Erythranthe guttata]
Length=262

 Score =   328 bits (841),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 157/185 (85%), Positives = 169/185 (91%), Gaps = 3/185 (2%)
 Frame = +1

Query  109  VLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGV  288
            +LC A +LC LT+  ARIPGVY+GG W+TAHATFYGG+DASGTMGGACGYGNLYSQGYGV
Sbjct  8    LLCFATVLCFLTSAQARIPGVYAGGPWETAHATFYGGSDASGTMGGACGYGNLYSQGYGV  67

Query  289  NNAALSTALFNNGLSCGACFEIKC---SNDRSCSPGNPSIFVTATNFCPPNFALPNDNGG  459
            N AALSTALFNNGLSCGACFEIKC    + + C+PG+PSI VTATNFCPPNFALPNDNGG
Sbjct  68   NTAALSTALFNNGLSCGACFEIKCDAAQDSKWCNPGSPSILVTATNFCPPNFALPNDNGG  127

Query  460  WCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNV  639
            WCNPPR HFDLAMPMFLKIA YRAGIVPVNFRRIPCRKQGG+RFT+NGFRYFNLVLVTNV
Sbjct  128  WCNPPRTHFDLAMPMFLKIAQYRAGIVPVNFRRIPCRKQGGMRFTINGFRYFNLVLVTNV  187

Query  640  AGAGD  654
            AGAGD
Sbjct  188  AGAGD  192



>gb|KJB36710.1| hypothetical protein B456_006G172400 [Gossypium raimondii]
Length=264

 Score =   328 bits (841),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 156/186 (84%), Positives = 171/186 (92%), Gaps = 1/186 (1%)
 Frame = +1

Query  100  AVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQG  279
            ++ VLC A LL  L  V+ARIPGVY+GGAW++AHATFYGG+DASGTMGGACGYGNLYSQG
Sbjct  9    SLSVLCFASLLSFLAVVNARIPGVYTGGAWESAHATFYGGSDASGTMGGACGYGNLYSQG  68

Query  280  YGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNG  456
            YGVN AALSTALFNNGLSCG CFEIKC+ND R C  G+PSI +TATNFCPPN+ALPNDNG
Sbjct  69   YGVNTAALSTALFNNGLSCGGCFEIKCANDPRWCHSGSPSIIITATNFCPPNYALPNDNG  128

Query  457  GWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTN  636
            GWCNPPRPHFDLAMPMFLKIA YRAGIVPV++RR+PCRKQGGIRFT+NGFRYFNLVLVTN
Sbjct  129  GWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKQGGIRFTINGFRYFNLVLVTN  188

Query  637  VAGAGD  654
            VAGAGD
Sbjct  189  VAGAGD  194



>gb|KJB16930.1| hypothetical protein B456_002G257400 [Gossypium raimondii]
Length=264

 Score =   328 bits (841),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 155/187 (83%), Positives = 172/187 (92%), Gaps = 1/187 (1%)
 Frame = +1

Query  97   AAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQ  276
            ++  +L +A L      V+ARIPGVY+GG+W+TAHATFYGG+DASGTMGGACGYGNLYSQ
Sbjct  8    SSFTMLHLASLFSIFVLVNARIPGVYTGGSWETAHATFYGGSDASGTMGGACGYGNLYSQ  67

Query  277  GYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDN  453
            GYGVN AALSTALFNNGLSCGACFEIKC+ND R C PG+PSIF+TATNFCPPNFALP+DN
Sbjct  68   GYGVNTAALSTALFNNGLSCGACFEIKCANDPRWCHPGSPSIFITATNFCPPNFALPSDN  127

Query  454  GGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVT  633
            GGWCNPPRPHFDLAMPMFLKIA YRAGIVPV+FRR+PCRKQGGIRFT+NGFRYFNLVL+T
Sbjct  128  GGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSFRRVPCRKQGGIRFTINGFRYFNLVLIT  187

Query  634  NVAGAGD  654
            NVAGAGD
Sbjct  188  NVAGAGD  194



>gb|AFB77223.1| expansin 1 [Betula platyphylla]
Length=258

 Score =   328 bits (840),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 156/188 (83%), Positives = 172/188 (91%), Gaps = 1/188 (1%)
 Frame = +1

Query  94   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  273
            MAA+ V CI  L+  LT V A+IPGVYSGGAWQ+AHATFYGG DASGTMGGACGYGNLYS
Sbjct  1    MAALCVACIVSLMALLTLVDAKIPGVYSGGAWQSAHATFYGGNDASGTMGGACGYGNLYS  60

Query  274  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPND  450
            QGYGVN AALSTALFNNGLSCGACFEIKC+N+ + C  G+PSI +TATNFCPPN+ALP+D
Sbjct  61   QGYGVNTAALSTALFNNGLSCGACFEIKCANEPQWCHSGSPSILITATNFCPPNYALPSD  120

Query  451  NGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLV  630
            NGGWCNPPRPHFDLAMPMFLKIA YRAGIVPV++RR+PCRKQGGIRFT+NGFRYFNLVL+
Sbjct  121  NGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKQGGIRFTINGFRYFNLVLI  180

Query  631  TNVAGAGD  654
            TNVAGAGD
Sbjct  181  TNVAGAGD  188



>gb|KHN21950.1| Expansin-A4 [Glycine soja]
Length=299

 Score =   329 bits (843),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 157/183 (86%), Positives = 169/183 (92%), Gaps = 1/183 (1%)
 Frame = +1

Query  109  VLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGV  288
            VLCIA ++    AV ARIPG+YSGGAWQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGV
Sbjct  7    VLCIAFIITLTWAVEARIPGIYSGGAWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGV  66

Query  289  NNAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALPNDNGGWC  465
            N AALSTALFN+GLSCGACFEIKC+NDR  C  G+PSIF+TATNFCPPNFALPNDNGGWC
Sbjct  67   NTAALSTALFNSGLSCGACFEIKCANDRQWCHSGSPSIFITATNFCPPNFALPNDNGGWC  126

Query  466  NPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAG  645
            NPPRPHFDLAMPMFLKIA YRAGIVPV +RR+PCRK GGIRFTVNGFRYFNLVLV+NVAG
Sbjct  127  NPPRPHFDLAMPMFLKIAEYRAGIVPVAYRRVPCRKHGGIRFTVNGFRYFNLVLVSNVAG  186

Query  646  AGD  654
            AGD
Sbjct  187  AGD  189



>ref|XP_008387765.1| PREDICTED: expansin-A4-like [Malus domestica]
Length=258

 Score =   327 bits (838),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 156/188 (83%), Positives = 171/188 (91%), Gaps = 1/188 (1%)
 Frame = +1

Query  94   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  273
            MA +R+LCIA LL    A  ARIPGVY+GGAW+ AHATFYGG+DASGTMGGACGYGNLYS
Sbjct  1    MAFLRMLCIASLLSLFMAABARIPGVYTGGAWEGAHATFYGGSDASGTMGGACGYGNLYS  60

Query  274  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPND  450
            QGYGVN AALSTALFNNGLSCGACFEIKC +D R C PGNPSIFVTATNFCPPNFA P+D
Sbjct  61   QGYGVNTAALSTALFNNGLSCGACFEIKCGDDPRWCHPGNPSIFVTATNFCPPNFAQPSD  120

Query  451  NGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLV  630
            +GGWCNPPR HFDLAMPMFLKIA Y+AGIVPV++RR+PCRKQGG+RFT+NGFRYFNLVL+
Sbjct  121  DGGWCNPPRTHFDLAMPMFLKIAEYKAGIVPVSYRRVPCRKQGGVRFTINGFRYFNLVLI  180

Query  631  TNVAGAGD  654
            TNVAGAGD
Sbjct  181  TNVAGAGD  188



>ref|XP_009587747.1| PREDICTED: expansin-A3-like [Nicotiana tomentosiformis]
Length=259

 Score =   326 bits (836),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 157/189 (83%), Positives = 171/189 (90%), Gaps = 2/189 (1%)
 Frame = +1

Query  94   MAAVRVLCIAL-LLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLY  270
            M   ++LCI   LLC LTAV+A+IPGVY+GG WQ AHATFYGG+DASGTMGGACGYGNLY
Sbjct  1    MVVTKILCITTTLLCFLTAVNAKIPGVYTGGPWQGAHATFYGGSDASGTMGGACGYGNLY  60

Query  271  SQGYGVNNAALSTALFNNGLSCGACFEIKC-SNDRSCSPGNPSIFVTATNFCPPNFALPN  447
            SQGYGVNNAALST LFNNGLSCGACFEIKC  +D+ C PGNPSIFVTATNFCPPNFALPN
Sbjct  61   SQGYGVNNAALSTVLFNNGLSCGACFEIKCVDDDKWCLPGNPSIFVTATNFCPPNFALPN  120

Query  448  DNGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVL  627
            D+GGWCNPPRPHFDLAMPMFLKI  YRAGIVPV++RR+ CRK GGIRFT+NGFRYFNL+L
Sbjct  121  DDGGWCNPPRPHFDLAMPMFLKIGLYRAGIVPVSYRRVACRKAGGIRFTINGFRYFNLLL  180

Query  628  VTNVAGAGD  654
            VTNVAGAGD
Sbjct  181  VTNVAGAGD  189



>ref|XP_003519349.1| PREDICTED: expansin-A4-like [Glycine max]
Length=257

 Score =   326 bits (836),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 153/183 (84%), Positives = 168/183 (92%), Gaps = 1/183 (1%)
 Frame = +1

Query  109  VLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGV  288
            +  + L+   LT+  ARIPG YSGGAW+TAHATFYGG+DASGTMGGACGYGNLYSQGYGV
Sbjct  5    IAIVTLIAVVLTSTEARIPGAYSGGAWETAHATFYGGSDASGTMGGACGYGNLYSQGYGV  64

Query  289  NNAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALPNDNGGWC  465
            N AALSTALFNNGLSCGACFEIKC+ND S C  G+PSIFVTATNFCPPN+ALPNDNGGWC
Sbjct  65   NTAALSTALFNNGLSCGACFEIKCANDPSWCHAGSPSIFVTATNFCPPNYALPNDNGGWC  124

Query  466  NPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAG  645
            NPPRPHFDLAMPMFLKIA YRAGIVPV++RR+PCRKQGG+RFT+NGFRYFNLVL+TNVAG
Sbjct  125  NPPRPHFDLAMPMFLKIAQYRAGIVPVSYRRVPCRKQGGMRFTINGFRYFNLVLITNVAG  184

Query  646  AGD  654
            AGD
Sbjct  185  AGD  187



>gb|KJB46592.1| hypothetical protein B456_007G376300 [Gossypium raimondii]
Length=262

 Score =   326 bits (835),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 156/186 (84%), Positives = 172/186 (92%), Gaps = 1/186 (1%)
 Frame = +1

Query  100  AVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQG  279
            ++ +LC   LL   T+V+A+IPGVYS G+W+TAHATFYGG+DASGTMGGACGYGNLYSQG
Sbjct  7    SLALLCFTSLLPFFTSVNAKIPGVYSTGSWETAHATFYGGSDASGTMGGACGYGNLYSQG  66

Query  280  YGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNG  456
            YGVN AALSTALFNNGLSCGACFEIKC++D R C PG+PSIFVTATNFCPPNFALP+DNG
Sbjct  67   YGVNTAALSTALFNNGLSCGACFEIKCASDPRWCHPGSPSIFVTATNFCPPNFALPSDNG  126

Query  457  GWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTN  636
            GWCNPPRPHFDLAMPMFLKIA YRAGIVPV+FRR+PCRK GGIRFTVNGFRYFNLVL+TN
Sbjct  127  GWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSFRRVPCRKHGGIRFTVNGFRYFNLVLITN  186

Query  637  VAGAGD  654
            VAGAGD
Sbjct  187  VAGAGD  192



>ref|XP_003544219.1| PREDICTED: expansin-A6-like [Glycine max]
Length=260

 Score =   325 bits (834),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 153/180 (85%), Positives = 167/180 (93%), Gaps = 1/180 (1%)
 Frame = +1

Query  118  IALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNA  297
            I  L+  L +  AR+PGVYSGGAW+TAHATFYGG+DASGTMGGACGYGNLYSQGYGVN A
Sbjct  11   IVTLITLLASTEARVPGVYSGGAWETAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTA  70

Query  298  ALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALPNDNGGWCNPP  474
            ALSTALFNNGLSCGACFEIKC+ND S C  G+PSIFVTATNFCPPN+ALPNDNGGWCNPP
Sbjct  71   ALSTALFNNGLSCGACFEIKCANDPSWCHAGSPSIFVTATNFCPPNYALPNDNGGWCNPP  130

Query  475  RPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGD  654
            RPHFDLAMPMFLKIA YRAGIVPV++RR+PCRKQGG+RFT+NGFRYFNLVL+TNVAGAGD
Sbjct  131  RPHFDLAMPMFLKIAQYRAGIVPVSYRRVPCRKQGGMRFTINGFRYFNLVLITNVAGAGD  190



>ref|XP_010256907.1| PREDICTED: expansin-A4 [Nelumbo nucifera]
Length=260

 Score =   325 bits (833),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 155/187 (83%), Positives = 169/187 (90%), Gaps = 1/187 (1%)
 Frame = +1

Query  97   AAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQ  276
            A V V+   LL+  LT V ARIPGVY+GG WQ+AHATFYGG+DASGTMGGACGYGNLYSQ
Sbjct  4    ATVNVVSAVLLISFLTLVDARIPGVYTGGPWQSAHATFYGGSDASGTMGGACGYGNLYSQ  63

Query  277  GYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDN  453
            GYGVN AALSTALFN GLSCGACFEIKC+ND + C  G+PSIF+TATNFCPPN+ALPNDN
Sbjct  64   GYGVNTAALSTALFNAGLSCGACFEIKCANDPQWCHSGSPSIFITATNFCPPNYALPNDN  123

Query  454  GGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVT  633
            GGWCNPPRPHFDLAMPMFLKIA YRAGIVPV +RR+PCRKQGGIRFT+NGFRYFNLVL+T
Sbjct  124  GGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVAYRRVPCRKQGGIRFTINGFRYFNLVLIT  183

Query  634  NVAGAGD  654
            NVAGAGD
Sbjct  184  NVAGAGD  190



>ref|XP_007140533.1| hypothetical protein PHAVU_008G120700g [Phaseolus vulgaris]
 gb|ESW12527.1| hypothetical protein PHAVU_008G120700g [Phaseolus vulgaris]
Length=258

 Score =   325 bits (832),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 156/188 (83%), Positives = 167/188 (89%), Gaps = 1/188 (1%)
 Frame = +1

Query  94   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  273
            MAA+  L IA L     +  ARIPGVY+GG+WQ+AHATFYGG+DASGTMGGACGYGNLYS
Sbjct  1    MAAIVFLYIASLASLFVSTSARIPGVYTGGSWQSAHATFYGGSDASGTMGGACGYGNLYS  60

Query  274  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPND  450
            QGYGVN AALSTALFNNGLSCGACFEIKC  D R C+PGNPSI +TATNFCPPNFALPND
Sbjct  61   QGYGVNTAALSTALFNNGLSCGACFEIKCDQDPRWCNPGNPSILITATNFCPPNFALPND  120

Query  451  NGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLV  630
            NGGWCNPPRPHFDLAMPMFLKIA YRAGIVPV FRR+ CRK GGIRFT+NGFRYFNLVL+
Sbjct  121  NGGWCNPPRPHFDLAMPMFLKIAQYRAGIVPVAFRRVACRKTGGIRFTINGFRYFNLVLI  180

Query  631  TNVAGAGD  654
            TNVAGAGD
Sbjct  181  TNVAGAGD  188



>ref|XP_004300427.1| PREDICTED: expansin-A6 [Fragaria vesca subsp. vesca]
Length=259

 Score =   325 bits (832),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 157/189 (83%), Positives = 173/189 (92%), Gaps = 2/189 (1%)
 Frame = +1

Query  94   MAAVRVLCIALLLCSLTAV-HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLY  270
            MA   + CIA LL SLT++  ARIPGVYSGGAWQ AHATFYGG+DASGTMGGACGYGNLY
Sbjct  1    MAMASLACIAALLISLTSITEARIPGVYSGGAWQGAHATFYGGSDASGTMGGACGYGNLY  60

Query  271  SQGYGVNNAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALPN  447
            SQGYGV+ AALSTALFNNGLSCGACFEIKC+ND + C  G+PSIF+TATNFCPPNFA P+
Sbjct  61   SQGYGVSTAALSTALFNNGLSCGACFEIKCANDPNWCHSGSPSIFITATNFCPPNFAQPS  120

Query  448  DNGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVL  627
            DNGGWCNPPRPHFDLAMPMFLKIA YRAGIVPV++RR+PCRK+GGIRFT+NGFRYFNLVL
Sbjct  121  DNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKRGGIRFTINGFRYFNLVL  180

Query  628  VTNVAGAGD  654
            V+NVAGAGD
Sbjct  181  VSNVAGAGD  189



>gb|AEE69071.1| expansin-4 [Petunia hybrid cultivar]
Length=248

 Score =   324 bits (830),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 154/175 (88%), Positives = 166/175 (95%), Gaps = 1/175 (1%)
 Frame = +1

Query  133  CSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTA  312
            C LTAV+A+IPGVY GG WQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGVNNAALST 
Sbjct  4    CFLTAVYAKIPGVYIGGPWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNNAALSTV  63

Query  313  LFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFD  489
            LFN+GLSCGACFE+KC+ND   C PGNPSIFVTATNFCPPN+ALPND+GGWCNPPRPHFD
Sbjct  64   LFNSGLSCGACFELKCTNDEPWCLPGNPSIFVTATNFCPPNYALPNDDGGWCNPPRPHFD  123

Query  490  LAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGD  654
            LAMPMFLKIA YRAGIVPVN+RR+PCRKQGGIRFT+NGFRYFNLVLVTNVAGAGD
Sbjct  124  LAMPMFLKIAQYRAGIVPVNYRRVPCRKQGGIRFTINGFRYFNLVLVTNVAGAGD  178



>ref|XP_003552173.1| PREDICTED: expansin-A4 [Glycine max]
Length=258

 Score =   324 bits (831),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 156/188 (83%), Positives = 167/188 (89%), Gaps = 1/188 (1%)
 Frame = +1

Query  94   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  273
            MAA+  L IA L     A  ARIPGVY+GG WQ+AHATFYGG+DASGTMGGACGYGNLYS
Sbjct  1    MAAIVFLHIASLASLFVATSARIPGVYTGGPWQSAHATFYGGSDASGTMGGACGYGNLYS  60

Query  274  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPND  450
            QGYGVN AALSTALFNNGLSCGACFEIKC  D R C+PG+PSI +TATNFCPPNFALPND
Sbjct  61   QGYGVNTAALSTALFNNGLSCGACFEIKCDQDPRWCNPGSPSILITATNFCPPNFALPND  120

Query  451  NGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLV  630
            NGGWCNPPRPHFDLAMPMFLKIA YRAGIVPV +RR+PCRK GGIRFT+NGFRYFNLVL+
Sbjct  121  NGGWCNPPRPHFDLAMPMFLKIAQYRAGIVPVAYRRVPCRKTGGIRFTINGFRYFNLVLI  180

Query  631  TNVAGAGD  654
            TNVAGAGD
Sbjct  181  TNVAGAGD  188



>ref|XP_007132063.1| hypothetical protein PHAVU_011G063800g [Phaseolus vulgaris]
 gb|ESW04057.1| hypothetical protein PHAVU_011G063800g [Phaseolus vulgaris]
Length=259

 Score =   324 bits (831),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 155/182 (85%), Positives = 167/182 (92%), Gaps = 1/182 (1%)
 Frame = +1

Query  112  LCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVN  291
            LCIA ++     V ARIPG+YSGGAW++AHATFYGG+DASGTMGGACGYGNLYSQGYGVN
Sbjct  8    LCIAFVISLTWMVEARIPGIYSGGAWESAHATFYGGSDASGTMGGACGYGNLYSQGYGVN  67

Query  292  NAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALPNDNGGWCN  468
             AALSTALFNNGLSCGACFEIKC+NDR  C  G+PSIF+TATNFCPPN+ALPNDNGGWCN
Sbjct  68   TAALSTALFNNGLSCGACFEIKCANDRQWCHSGSPSIFITATNFCPPNYALPNDNGGWCN  127

Query  469  PPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGA  648
            PPRPHFDLAMPMFLKIA YRAGIVPV FRR+PCRK GGIRFTVNGFRYFNLVLV+NVAGA
Sbjct  128  PPRPHFDLAMPMFLKIAEYRAGIVPVAFRRVPCRKHGGIRFTVNGFRYFNLVLVSNVAGA  187

Query  649  GD  654
            GD
Sbjct  188  GD  189



>gb|KDP20458.1| hypothetical protein JCGZ_05303 [Jatropha curcas]
Length=260

 Score =   324 bits (831),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 156/190 (82%), Positives = 172/190 (91%), Gaps = 3/190 (2%)
 Frame = +1

Query  94   MAAVRVLCIALLLCSLTAV--HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNL  267
            MA VR+L +A ++ SL  V   ARIPG Y GGAWQTAHATFYGG+DASGTMGGACGYGNL
Sbjct  1    MAMVRMLSVASVVMSLMWVVAEARIPGNYMGGAWQTAHATFYGGSDASGTMGGACGYGNL  60

Query  268  YSQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALP  444
            YSQGYGVN AALSTALFNNGLSCGACFEIKC+ND + C  G+PSIF+TATNFCPPN+ALP
Sbjct  61   YSQGYGVNTAALSTALFNNGLSCGACFEIKCANDPQWCHSGSPSIFITATNFCPPNYALP  120

Query  445  NDNGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLV  624
            NDNGGWCNPPRPHFDLAMPMFLKIA YRAGIVPV++RR+PCRK GGIRFT+NGFRYFNLV
Sbjct  121  NDNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKSGGIRFTINGFRYFNLV  180

Query  625  LVTNVAGAGD  654
            L++NVAGAGD
Sbjct  181  LISNVAGAGD  190



>gb|ACJ48968.2| expansin [Breonia chinensis]
 gb|ACT10284.2| expansin [Breonia chinensis]
Length=258

 Score =   324 bits (831),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 154/188 (82%), Positives = 170/188 (90%), Gaps = 1/188 (1%)
 Frame = +1

Query  94   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  273
            MAA+ +  I  L   LT   ARIPGVYSGG+WQ AHATFYGG+DASGTMGGACGYGNLYS
Sbjct  1    MAAMCLTSIVALSLLLTLAEARIPGVYSGGSWQNAHATFYGGSDASGTMGGACGYGNLYS  60

Query  274  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPND  450
            QGYGVN AALSTALFNNGLSCGACFE+KC++D + C PG+PSIF+TATNFCPPN+ALPND
Sbjct  61   QGYGVNTAALSTALFNNGLSCGACFELKCADDPQWCHPGSPSIFITATNFCPPNYALPND  120

Query  451  NGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLV  630
            NGGWCNPPRPHFDLAMPMFLKIA YRAGIVPV++RR+PCRKQGGIRF +NGFRYFNLVL+
Sbjct  121  NGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKQGGIRFQINGFRYFNLVLI  180

Query  631  TNVAGAGD  654
            TNVAGAGD
Sbjct  181  TNVAGAGD  188



>ref|XP_009772489.1| PREDICTED: expansin-A3-like [Nicotiana sylvestris]
Length=257

 Score =   324 bits (830),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 150/187 (80%), Positives = 168/187 (90%), Gaps = 0/187 (0%)
 Frame = +1

Query  94   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  273
            MA +  LCIA LL  LTA +A++PGVY+GG WQ+AHATFYGG DASGTMGGACGYGNLYS
Sbjct  1    MAIIWTLCIASLLSLLTAANAKVPGVYTGGPWQSAHATFYGGEDASGTMGGACGYGNLYS  60

Query  274  QGYGVNNAALSTALFNNGLSCGACFEIKCSNDRSCSPGNPSIFVTATNFCPPNFALPNDN  453
             GYGVNNAALSTALFNNGLSCGACFEI+C++ + C+PGNPSIFVT TNFCPPN+ALPNDN
Sbjct  61   AGYGVNNAALSTALFNNGLSCGACFEIRCTDPKWCTPGNPSIFVTGTNFCPPNYALPNDN  120

Query  454  GGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVT  633
            GGWCNPPRPHFDLA PMFLK A YRAGIVPV +RR+PC+K GGIRFT+NGF YFN+V+VT
Sbjct  121  GGWCNPPRPHFDLAEPMFLKFAQYRAGIVPVTYRRVPCKKSGGIRFTINGFNYFNMVIVT  180

Query  634  NVAGAGD  654
            NVAGAGD
Sbjct  181  NVAGAGD  187



>ref|XP_011094866.1| PREDICTED: expansin-A6 [Sesamum indicum]
Length=262

 Score =   324 bits (830),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 158/191 (83%), Positives = 172/191 (90%), Gaps = 4/191 (2%)
 Frame = +1

Query  94   MAAVRVL-CIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLY  270
            +AA+++L CI+ +LC LT   ARIPGVYSGG WQ+AHATFYGG+DASGTMGGACGYGNLY
Sbjct  2    LAAMKLLLCISSILCFLTCSDARIPGVYSGGPWQSAHATFYGGSDASGTMGGACGYGNLY  61

Query  271  SQGYGVNNAALSTALFNNGLSCGACFEIKC---SNDRSCSPGNPSIFVTATNFCPPNFAL  441
            SQGYGVN AALSTALFNNGLSCGACFEIKC    + + C+PG+PSI VTATNFCPPN+AL
Sbjct  62   SQGYGVNTAALSTALFNNGLSCGACFEIKCDAAQDPKWCNPGSPSILVTATNFCPPNYAL  121

Query  442  PNDNGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNL  621
            PNDNGGWCNPPR HFDLAMPMFLKIA Y AGIVPVNFRRIPCRKQGGIRFT+NGFRYFNL
Sbjct  122  PNDNGGWCNPPREHFDLAMPMFLKIAQYSAGIVPVNFRRIPCRKQGGIRFTINGFRYFNL  181

Query  622  VLVTNVAGAGD  654
            VLVTNV GAGD
Sbjct  182  VLVTNVGGAGD  192



>gb|AAR82849.1| expansin-1 [Petunia x hybrida]
Length=260

 Score =   323 bits (829),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 156/184 (85%), Positives = 168/184 (91%), Gaps = 2/184 (1%)
 Frame = +1

Query  109  VLCI-ALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYG  285
            V C+ +L+L  L  V ARIPGVYSGGAWQ+AHATFYGG+DASGTMGGACGYGNLYSQGYG
Sbjct  7    VACVTSLVLLMLLTVEARIPGVYSGGAWQSAHATFYGGSDASGTMGGACGYGNLYSQGYG  66

Query  286  VNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGW  462
            VNN ALSTALFNNGLSCGACFEIKC  D + C  G+PSIF+TATNFCPPN+ALPNDNGGW
Sbjct  67   VNNGALSTALFNNGLSCGACFEIKCDKDPQWCHSGSPSIFITATNFCPPNYALPNDNGGW  126

Query  463  CNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVA  642
            CNPPRPHFDLAMPMFLKIA YRAGIVPV +RR+PCRKQGGIRFT+NGFRYFNLVLVTNVA
Sbjct  127  CNPPRPHFDLAMPMFLKIAEYRAGIVPVVYRRVPCRKQGGIRFTINGFRYFNLVLVTNVA  186

Query  643  GAGD  654
            GAGD
Sbjct  187  GAGD  190



>ref|XP_007009225.1| Expansin A4, ALPHA 1.6,EXPA4 [Theobroma cacao]
 gb|EOY18035.1| Expansin A4, ALPHA 1.6,EXPA4 [Theobroma cacao]
Length=259

 Score =   323 bits (829),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 154/183 (84%), Positives = 167/183 (91%), Gaps = 1/183 (1%)
 Frame = +1

Query  109  VLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGV  288
            V C+  L   L AV ARIPGVYSG  WQTAHATFYGG+DASGTMGGACGYGNLYSQGYGV
Sbjct  7    VACLVALNLILVAVEARIPGVYSGAEWQTAHATFYGGSDASGTMGGACGYGNLYSQGYGV  66

Query  289  NNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWC  465
            N AALSTALFNNGLSCGACFEIKC+N+ + C  G+PSIFVTATNFCPPN+ALP+DNGGWC
Sbjct  67   NTAALSTALFNNGLSCGACFEIKCANEPQWCHAGSPSIFVTATNFCPPNYALPSDNGGWC  126

Query  466  NPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAG  645
            NPPRPHFDLAMPMFLKIA YRAGIVPV++RR+PCRKQGGIRFT+NGFRYFNLVL+TNVAG
Sbjct  127  NPPRPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKQGGIRFTINGFRYFNLVLITNVAG  186

Query  646  AGD  654
            AGD
Sbjct  187  AGD  189



>ref|XP_003538409.1| PREDICTED: expansin-A6 [Glycine max]
Length=258

 Score =   323 bits (828),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 151/188 (80%), Positives = 170/188 (90%), Gaps = 1/188 (1%)
 Frame = +1

Query  94   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  273
            MA + ++ I  LL  +    A+IPGVYSGG WQ+AHATFYGG+DASGTMGGACGYGNLYS
Sbjct  1    MAMLNIIAIVSLLLLMIPSQAKIPGVYSGGPWQSAHATFYGGSDASGTMGGACGYGNLYS  60

Query  274  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPND  450
            QGYGVN AALSTALFNNG SCGACFEIKC++D + C PGNPSIFVTATNFCPPN+ALP+D
Sbjct  61   QGYGVNTAALSTALFNNGFSCGACFEIKCTDDPKWCHPGNPSIFVTATNFCPPNYALPSD  120

Query  451  NGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLV  630
            NGGWCNPPRPHFDLAMPMFLKIA YRAGIVPV++RR+PCRK+GG+RFT+NGFRYFNLVL+
Sbjct  121  NGGWCNPPRPHFDLAMPMFLKIAQYRAGIVPVSYRRVPCRKEGGMRFTINGFRYFNLVLI  180

Query  631  TNVAGAGD  654
            TNVAGAGD
Sbjct  181  TNVAGAGD  188



>emb|CBI16120.3| unnamed protein product [Vitis vinifera]
Length=277

 Score =   324 bits (830),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 153/188 (81%), Positives = 169/188 (90%), Gaps = 1/188 (1%)
 Frame = +1

Query  94   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  273
            MA   V+C A L+   + V A+IPG YSGGAWQ+AHATFYGG+DASGTMGGACGYGNLYS
Sbjct  1    MAVGVVVCFASLISLFSLVQAKIPGAYSGGAWQSAHATFYGGSDASGTMGGACGYGNLYS  60

Query  274  QGYGVNNAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALPND  450
            QGYGVN AALSTALFNNGLSCGACFE+KC+ND + C  G+PSI +TATNFCPPN+ALP+D
Sbjct  61   QGYGVNTAALSTALFNNGLSCGACFELKCANDPTWCHSGSPSILITATNFCPPNYALPSD  120

Query  451  NGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLV  630
            NGGWCNPPRPHFDLAMPMFLKIA YRAGIVPV FRR+PCRKQGGIRFT+NGFRYFNLVL+
Sbjct  121  NGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVAFRRVPCRKQGGIRFTINGFRYFNLVLI  180

Query  631  TNVAGAGD  654
            TNVAGAGD
Sbjct  181  TNVAGAGD  188



>ref|XP_008233635.1| PREDICTED: expansin-A4-like [Prunus mume]
Length=259

 Score =   323 bits (828),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 156/189 (83%), Positives = 172/189 (91%), Gaps = 2/189 (1%)
 Frame = +1

Query  94   MAAVRVLCI-ALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLY  270
            MA + +LCI +L+  + T V ARIPGVYSGGAWQ AHATFYGG+DASGTMGGACGYGNLY
Sbjct  1    MATMTLLCIVSLIALASTIVEARIPGVYSGGAWQGAHATFYGGSDASGTMGGACGYGNLY  60

Query  271  SQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPN  447
            SQGYGVN AALSTALFNNGLSCGACFEIKC+N  + C  G+PSIFVTATNFCPPN+ALPN
Sbjct  61   SQGYGVNTAALSTALFNNGLSCGACFEIKCANQPQWCHSGSPSIFVTATNFCPPNYALPN  120

Query  448  DNGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVL  627
            DNGGWCNPPRPHFDLAMPMFLKIA YRAGIVPV++RR+PCRK GGIRFT+NGF+YFNLVL
Sbjct  121  DNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKPGGIRFTINGFKYFNLVL  180

Query  628  VTNVAGAGD  654
            +TNVAGAGD
Sbjct  181  ITNVAGAGD  189



>ref|XP_009761115.1| PREDICTED: expansin-A6-like [Nicotiana sylvestris]
Length=260

 Score =   323 bits (828),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 157/190 (83%), Positives = 168/190 (88%), Gaps = 3/190 (2%)
 Frame = +1

Query  94   MAAVRVLCIALLLCSL--TAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNL  267
            M  +   CI  L+ SL    V ARIPGVYSGG+WQTAHATFYGG+DASGTMGGACGYGNL
Sbjct  1    MEMLNFFCIFSLIISLFLLTVEARIPGVYSGGSWQTAHATFYGGSDASGTMGGACGYGNL  60

Query  268  YSQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALP  444
            YSQGYGVNNAALSTALFNNGLSCGACFEIKC N  + C  G+PSI +TATNFCPPN+ALP
Sbjct  61   YSQGYGVNNAALSTALFNNGLSCGACFEIKCDNQPQWCHAGSPSILITATNFCPPNYALP  120

Query  445  NDNGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLV  624
            NDNGGWCNPPRPHFDLAMPMFLKIA YRAGIVPV +RR+PCRKQGGIRFT+NGFRYFNLV
Sbjct  121  NDNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVVYRRVPCRKQGGIRFTINGFRYFNLV  180

Query  625  LVTNVAGAGD  654
            LVTNVAGAGD
Sbjct  181  LVTNVAGAGD  190



>ref|XP_003552923.2| PREDICTED: expansin-A3-like [Glycine max]
Length=262

 Score =   323 bits (828),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 153/188 (81%), Positives = 170/188 (90%), Gaps = 3/188 (2%)
 Frame = +1

Query  94   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  273
            MA + ++ I  LL  LT  HA+IPGVYSGG WQ+AHATFYGG+DASGTMGGACGYGNLYS
Sbjct  7    MAMLNIISILSLL--LTQSHAKIPGVYSGGPWQSAHATFYGGSDASGTMGGACGYGNLYS  64

Query  274  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPND  450
            QGYGVN AALSTALFNNG SCGACFEIKC++D + C+PGNPSI VTATNFCPPN+ALP D
Sbjct  65   QGYGVNTAALSTALFNNGFSCGACFEIKCTDDPKWCNPGNPSILVTATNFCPPNYALPTD  124

Query  451  NGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLV  630
            NGGWCNPPRPHFDLAMPMFLKIA YRAGIVPV++RR+ CRKQGG+RFT+NGFRYFNLVL+
Sbjct  125  NGGWCNPPRPHFDLAMPMFLKIAQYRAGIVPVSYRRVACRKQGGMRFTINGFRYFNLVLI  184

Query  631  TNVAGAGD  654
            TNVAGAGD
Sbjct  185  TNVAGAGD  192



>gb|AEQ55274.1| expansin [Breonia chinensis]
 gb|AEQ55289.1| expansin [Breonia chinensis]
Length=256

 Score =   323 bits (827),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 155/188 (82%), Positives = 171/188 (91%), Gaps = 3/188 (2%)
 Frame = +1

Query  94   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  273
            MA V + CIA +L  +    ARIPGVY+GG+WQ+AHATFYGG+DASGTMGGACGYGNLYS
Sbjct  1    MAIVVLTCIASVLALV--AEARIPGVYTGGSWQSAHATFYGGSDASGTMGGACGYGNLYS  58

Query  274  QGYGVNNAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALPND  450
            QGYGVN  ALSTALFN+GLSCGACFE+KC+ND   C PG+PSIF+TATNFCPPN+ALPND
Sbjct  59   QGYGVNTGALSTALFNSGLSCGACFELKCANDPGWCHPGSPSIFITATNFCPPNYALPND  118

Query  451  NGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLV  630
            NGGWCNPPRPHFDLAMPMFLKIA YRAGIVPVN+RR+PCRKQGGIRFT+NGFRYFNLVLV
Sbjct  119  NGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVNYRRVPCRKQGGIRFTINGFRYFNLVLV  178

Query  631  TNVAGAGD  654
            TNVAGAGD
Sbjct  179  TNVAGAGD  186



>ref|XP_007218834.1| hypothetical protein PRUPE_ppa010198mg [Prunus persica]
 gb|EMJ20033.1| hypothetical protein PRUPE_ppa010198mg [Prunus persica]
Length=259

 Score =   323 bits (827),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 156/189 (83%), Positives = 171/189 (90%), Gaps = 2/189 (1%)
 Frame = +1

Query  94   MAAVRVLCI-ALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLY  270
            MA + +LCI +L+  + T V ARIPGVYSG AWQ AHATFYGG+DASGTMGGACGYGNLY
Sbjct  1    MATMALLCIVSLIALASTIVEARIPGVYSGEAWQGAHATFYGGSDASGTMGGACGYGNLY  60

Query  271  SQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPN  447
            SQGYGVN AALSTALFNNGLSCGACFEIKC+N  + C  G+PSIFVTATNFCPPN+ALPN
Sbjct  61   SQGYGVNTAALSTALFNNGLSCGACFEIKCANQPQWCHSGSPSIFVTATNFCPPNYALPN  120

Query  448  DNGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVL  627
            DNGGWCNPPR HFDLAMPMFLKIA YRAGIVPV++RR+PCRKQGGIRFTVNGF+YFNLVL
Sbjct  121  DNGGWCNPPRSHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKQGGIRFTVNGFKYFNLVL  180

Query  628  VTNVAGAGD  654
            +TNVAGAGD
Sbjct  181  ITNVAGAGD  189



>ref|XP_002283530.1| PREDICTED: expansin-A4 [Vitis vinifera]
Length=258

 Score =   323 bits (827),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 153/188 (81%), Positives = 169/188 (90%), Gaps = 1/188 (1%)
 Frame = +1

Query  94   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  273
            MA   V+C A L+   + V A+IPG YSGGAWQ+AHATFYGG+DASGTMGGACGYGNLYS
Sbjct  1    MAVGVVVCFASLISLFSLVQAKIPGAYSGGAWQSAHATFYGGSDASGTMGGACGYGNLYS  60

Query  274  QGYGVNNAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALPND  450
            QGYGVN AALSTALFNNGLSCGACFE+KC+ND + C  G+PSI +TATNFCPPN+ALP+D
Sbjct  61   QGYGVNTAALSTALFNNGLSCGACFELKCANDPTWCHSGSPSILITATNFCPPNYALPSD  120

Query  451  NGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLV  630
            NGGWCNPPRPHFDLAMPMFLKIA YRAGIVPV FRR+PCRKQGGIRFT+NGFRYFNLVL+
Sbjct  121  NGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVAFRRVPCRKQGGIRFTINGFRYFNLVLI  180

Query  631  TNVAGAGD  654
            TNVAGAGD
Sbjct  181  TNVAGAGD  188



>gb|AAF32410.1|AF230277_1 alpha-expansin 2 [Triphysaria versicolor]
Length=262

 Score =   323 bits (827),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 154/185 (83%), Positives = 166/185 (90%), Gaps = 3/185 (2%)
 Frame = +1

Query  109  VLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGV  288
            +LCIA  +C LT+  ARIPG+YSGG WQ AHATFYGG+DASGTMGGACGYGNLYSQGYGV
Sbjct  8    LLCIATFICFLTSAQARIPGIYSGGPWQGAHATFYGGSDASGTMGGACGYGNLYSQGYGV  67

Query  289  NNAALSTALFNNGLSCGACFEIKC---SNDRSCSPGNPSIFVTATNFCPPNFALPNDNGG  459
            N AALSTALFNNGLSCGACFEI+C    + + C+PG PSI VTATNFCPPNFA P+DNGG
Sbjct  68   NTAALSTALFNNGLSCGACFEIRCDMAQDGKWCNPGTPSILVTATNFCPPNFAQPSDNGG  127

Query  460  WCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNV  639
            WCNPPR HFDLAMPMFLKIA YRAGIVPVN+RRIPCRKQGGIRFT+NGFRYFNLVLVTNV
Sbjct  128  WCNPPRTHFDLAMPMFLKIAQYRAGIVPVNYRRIPCRKQGGIRFTINGFRYFNLVLVTNV  187

Query  640  AGAGD  654
            AGAGD
Sbjct  188  AGAGD  192



>ref|XP_008464122.1| PREDICTED: expansin-A4 [Cucumis melo]
Length=258

 Score =   322 bits (826),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 156/188 (83%), Positives = 167/188 (89%), Gaps = 1/188 (1%)
 Frame = +1

Query  94   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  273
            MA    LCIALLL     + ARIPGVYSGG WQ+AHATFYGGADASGTMGGACGYGNLYS
Sbjct  1    MATPISLCIALLLSFSLLIDARIPGVYSGGPWQSAHATFYGGADASGTMGGACGYGNLYS  60

Query  274  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPND  450
            QGYGVN AALSTALFN G SCGACFEIKC+ND R C  G+PSI +TATNFCPPN+ALPND
Sbjct  61   QGYGVNTAALSTALFNKGQSCGACFEIKCANDPRWCHSGSPSILITATNFCPPNYALPND  120

Query  451  NGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLV  630
            NGGWCNPPR HFDLAMPMFLKIA YRAGIVPV++RR+PCRKQGGIRFT+NGFRYFNLVL+
Sbjct  121  NGGWCNPPRSHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKQGGIRFTINGFRYFNLVLI  180

Query  631  TNVAGAGD  654
            TNVAGAGD
Sbjct  181  TNVAGAGD  188



>gb|AEQ55290.1| expansin [Breonia chinensis]
Length=259

 Score =   322 bits (826),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 158/190 (83%), Positives = 172/190 (91%), Gaps = 4/190 (2%)
 Frame = +1

Query  94   MAAVRVLCIA--LLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNL  267
            MA V ++CIA  L L  L A  ARIPGVY+GGAWQ+AHATFYGG+DASGTMGGACGYGNL
Sbjct  1    MAVVGLVCIASVLALAGLVA-EARIPGVYTGGAWQSAHATFYGGSDASGTMGGACGYGNL  59

Query  268  YSQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALP  444
            YSQGYGVN AALSTALFN+GL CGACFEIKC+N+ + C PG+PSIFVTATNFCPPN+ALP
Sbjct  60   YSQGYGVNTAALSTALFNSGLRCGACFEIKCANEPQWCHPGSPSIFVTATNFCPPNYALP  119

Query  445  NDNGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLV  624
            NDNGGWCNPPRPHFDLAMPMFLKIA YRAGIVPV +RR+PCRKQGG RFT+NGFRYFNLV
Sbjct  120  NDNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVTYRRVPCRKQGGTRFTINGFRYFNLV  179

Query  625  LVTNVAGAGD  654
            LVTNVAGAGD
Sbjct  180  LVTNVAGAGD  189



>ref|XP_004492358.1| PREDICTED: expansin-A6-like [Cicer arietinum]
Length=258

 Score =   322 bits (825),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 155/188 (82%), Positives = 166/188 (88%), Gaps = 1/188 (1%)
 Frame = +1

Query  94   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  273
            MAA  +L IA L     A  ARIPG YSGG WQTAHATFYGG+DASGTMGGACGYGNLYS
Sbjct  1    MAATVLLSIASLASLFVATTARIPGFYSGGPWQTAHATFYGGSDASGTMGGACGYGNLYS  60

Query  274  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPND  450
            QGYGVN AALSTALFNNGLSCG+CFEIKC  D R C+PGNPSI +TATNFCPPNFA P+D
Sbjct  61   QGYGVNTAALSTALFNNGLSCGSCFEIKCDQDPRWCNPGNPSILITATNFCPPNFAQPSD  120

Query  451  NGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLV  630
            NGGWCNPPRPHFDLAMPMFLKIA YRAGIVPV +RR+PCRK+GGIRFT+NGFRYFNLVL+
Sbjct  121  NGGWCNPPRPHFDLAMPMFLKIAQYRAGIVPVAYRRVPCRKKGGIRFTINGFRYFNLVLI  180

Query  631  TNVAGAGD  654
            TNVAGAGD
Sbjct  181  TNVAGAGD  188



>gb|AAM47000.1|AF512542_1 alpha-expansin precursor [Gossypium hirsutum]
Length=264

 Score =   322 bits (826),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 154/186 (83%), Positives = 170/186 (91%), Gaps = 1/186 (1%)
 Frame = +1

Query  100  AVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQG  279
            ++ VLC A LL     V+ARIPGV++GGAW++AHATFYGG+DASGTMGGACGYGNLYSQG
Sbjct  9    SLSVLCFASLLSFFGWVNARIPGVFTGGAWESAHATFYGGSDASGTMGGACGYGNLYSQG  68

Query  280  YGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNG  456
            YGVN AALS ALFNNGLSCGACFEIKC+ND R C  G+PSI +TATNFCPPN+ALPNDNG
Sbjct  69   YGVNTAALSPALFNNGLSCGACFEIKCANDPRWCHSGSPSIIITATNFCPPNYALPNDNG  128

Query  457  GWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTN  636
            GWCNPPRPHFDLAMPMFLKIA YRAGIVPV++RR+PCRKQGGIRFT+NGFRYFNLVLVTN
Sbjct  129  GWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKQGGIRFTINGFRYFNLVLVTN  188

Query  637  VAGAGD  654
            VAGAGD
Sbjct  189  VAGAGD  194



>dbj|BAC67193.1| expansin [Pyrus communis]
Length=258

 Score =   322 bits (825),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 153/188 (81%), Positives = 170/188 (90%), Gaps = 1/188 (1%)
 Frame = +1

Query  94   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  273
            MA++RVL IA +L    A +ARIPGVY+GG+W+ AHATFYGG DASGTMGGACGYGNLYS
Sbjct  1    MASLRVLYIAFMLSLFMAANARIPGVYTGGSWEGAHATFYGGNDASGTMGGACGYGNLYS  60

Query  274  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPND  450
            QGYGVN AALSTALFNNGLSCGACFEIKC +D R C PGNPSI VTATNFCPPNFA P+D
Sbjct  61   QGYGVNTAALSTALFNNGLSCGACFEIKCGDDPRWCHPGNPSILVTATNFCPPNFAQPSD  120

Query  451  NGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLV  630
            +GGWCNPPR HFDLAMPMFLKIA Y+AGIVPV++RR+PCRKQGG+RFT+NGFRYFNLVL+
Sbjct  121  DGGWCNPPRTHFDLAMPMFLKIAEYKAGIVPVSYRRVPCRKQGGVRFTINGFRYFNLVLI  180

Query  631  TNVAGAGD  654
            TNVAGAGD
Sbjct  181  TNVAGAGD  188



>gb|KHN17924.1| Expansin-A3 [Glycine soja]
Length=307

 Score =   324 bits (830),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 151/188 (80%), Positives = 170/188 (90%), Gaps = 1/188 (1%)
 Frame = +1

Query  94   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  273
            MA + ++ I  LL  +    A+IPGVYSGG WQ+AHATFYGG+DASGTMGGACGYGNLYS
Sbjct  1    MAMLNIIAIVSLLLLIIPSQAKIPGVYSGGPWQSAHATFYGGSDASGTMGGACGYGNLYS  60

Query  274  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPND  450
            QGYGVN AALSTALFNNG SCGACFEIKC++D + C PGNPSIFVTATNFCPPN+ALP+D
Sbjct  61   QGYGVNTAALSTALFNNGFSCGACFEIKCTDDPKWCHPGNPSIFVTATNFCPPNYALPSD  120

Query  451  NGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLV  630
            NGGWCNPPRPHFDLAMPMFLKIA YRAGIVPV++RR+PCRK+GG+RFT+NGFRYFNLVL+
Sbjct  121  NGGWCNPPRPHFDLAMPMFLKIAQYRAGIVPVSYRRVPCRKEGGMRFTINGFRYFNLVLI  180

Query  631  TNVAGAGD  654
            TNVAGAGD
Sbjct  181  TNVAGAGD  188



>ref|XP_007205748.1| hypothetical protein PRUPE_ppa010226mg [Prunus persica]
 gb|EMJ06947.1| hypothetical protein PRUPE_ppa010226mg [Prunus persica]
Length=258

 Score =   322 bits (825),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 152/188 (81%), Positives = 171/188 (91%), Gaps = 1/188 (1%)
 Frame = +1

Query  94   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  273
            MA V +LCIA LL    A +ARIPGVY+GG W+ AHATFYGG+DASGTMGGACGYGNLYS
Sbjct  1    MAFVHMLCIASLLSLFMAANARIPGVYTGGPWEGAHATFYGGSDASGTMGGACGYGNLYS  60

Query  274  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPND  450
            +GYGVN AALSTALFNNGLSCGACFEIKC +D + C PGNPSIF+TATNFCPPN+ALPND
Sbjct  61   EGYGVNTAALSTALFNNGLSCGACFEIKCGDDPKWCHPGNPSIFITATNFCPPNYALPND  120

Query  451  NGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLV  630
            +GGWCNPPR HFDLAMPMFL+IA Y+AGIVPV+FRR+PCRK+GG+RFT+NGFRYFNLVL+
Sbjct  121  DGGWCNPPRTHFDLAMPMFLQIAEYKAGIVPVSFRRVPCRKEGGVRFTINGFRYFNLVLI  180

Query  631  TNVAGAGD  654
            TNVAGAGD
Sbjct  181  TNVAGAGD  188



>gb|AEQ55275.1| expansin [Breonia chinensis]
Length=259

 Score =   322 bits (825),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 158/190 (83%), Positives = 172/190 (91%), Gaps = 4/190 (2%)
 Frame = +1

Query  94   MAAVRVLCIA--LLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNL  267
            MA V ++CIA  L L  L A  ARIPGVY+GGAWQ+AHATFYGG+DASGTMGGACGYGNL
Sbjct  1    MAIVGLVCIASVLALAGLVA-EARIPGVYTGGAWQSAHATFYGGSDASGTMGGACGYGNL  59

Query  268  YSQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALP  444
            YSQGYGVN AALSTALFN+GL CGACFEIKC+N+ + C PG+PSIFVTATNFCPPN+ALP
Sbjct  60   YSQGYGVNTAALSTALFNSGLRCGACFEIKCANEPQWCHPGSPSIFVTATNFCPPNYALP  119

Query  445  NDNGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLV  624
            NDNGGWCNPPRPHFDLAMPMFLKIA YRAGIVPV +RR+PCRKQGG RFT+NGFRYFNLV
Sbjct  120  NDNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVTYRRVPCRKQGGTRFTINGFRYFNLV  179

Query  625  LVTNVAGAGD  654
            LVTNVAGAGD
Sbjct  180  LVTNVAGAGD  189



>ref|NP_001242978.1| expansin-A4-like precursor [Glycine max]
 gb|AEV43316.1| expansin A5a [Glycine max]
Length=259

 Score =   322 bits (825),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 153/183 (84%), Positives = 166/183 (91%), Gaps = 1/183 (1%)
 Frame = +1

Query  109  VLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGV  288
            VLCI  ++     V ARIPGVYS GAWQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGV
Sbjct  7    VLCIFFIISLTCMVQARIPGVYSAGAWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGV  66

Query  289  NNAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALPNDNGGWC  465
            N AALSTALFN+GLSCGACFEIKC+NDR  C  G+PSIF+TATNFCPPNFALPNDNGGWC
Sbjct  67   NTAALSTALFNSGLSCGACFEIKCANDRQWCHSGSPSIFITATNFCPPNFALPNDNGGWC  126

Query  466  NPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAG  645
            NPPRPHFDLAMPMFLKIA YRAGIVPV +RR+PCRK GGIRFT+NGFRYFNLVL++NVAG
Sbjct  127  NPPRPHFDLAMPMFLKIAEYRAGIVPVAYRRVPCRKHGGIRFTINGFRYFNLVLISNVAG  186

Query  646  AGD  654
            AGD
Sbjct  187  AGD  189



>ref|XP_011019858.1| PREDICTED: expansin-A6 [Populus euphratica]
Length=260

 Score =   322 bits (824),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 153/183 (84%), Positives = 166/183 (91%), Gaps = 1/183 (1%)
 Frame = +1

Query  109  VLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGV  288
            +LCI  L+      HARIPGV++GG W++AHATFYGG+DASGTMGGACGYGNLYSQGYGV
Sbjct  8    LLCIVFLISVFVLAHARIPGVFTGGPWESAHATFYGGSDASGTMGGACGYGNLYSQGYGV  67

Query  289  NNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWC  465
            N AALSTALFNNGLSCGACFEIKC++D R C+PGNPSIFVTATNFCPPNFA  +DNGGWC
Sbjct  68   NTAALSTALFNNGLSCGACFEIKCADDPRWCNPGNPSIFVTATNFCPPNFAQASDNGGWC  127

Query  466  NPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAG  645
            NPPRPHFDLAMPMFLKIA YRAGIVPV  RR+PCRKQGGIRFT+NGFRYFNLVLVTNVAG
Sbjct  128  NPPRPHFDLAMPMFLKIAQYRAGIVPVAHRRVPCRKQGGIRFTINGFRYFNLVLVTNVAG  187

Query  646  AGD  654
            AGD
Sbjct  188  AGD  190



>gb|ACK36943.1| expansin [Annona cherimola]
Length=259

 Score =   322 bits (824),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 151/185 (82%), Positives = 169/185 (91%), Gaps = 2/185 (1%)
 Frame = +1

Query  103  VRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGY  282
            +R    +L+LC L+ V ARIPGVY+GGAWQ+AHATFYGG+DASGTMGGACGYGNLYSQGY
Sbjct  6    IRTFVASLILC-LSLVEARIPGVYTGGAWQSAHATFYGGSDASGTMGGACGYGNLYSQGY  64

Query  283  GVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGG  459
            GVN A LSTA FNNGLSCGACFEIKC++D + C  G+PSI +TATNFCPPN+ALP+DNGG
Sbjct  65   GVNTAVLSTAFFNNGLSCGACFEIKCADDPKWCHSGSPSILITATNFCPPNYALPSDNGG  124

Query  460  WCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNV  639
            WCNPPRPHFDLAMPMFLKIA YRAGIVPV+FRR+PCRKQGGIRFT+NGFRYFNLVL+TNV
Sbjct  125  WCNPPRPHFDLAMPMFLKIAEYRAGIVPVSFRRVPCRKQGGIRFTINGFRYFNLVLITNV  184

Query  640  AGAGD  654
            AGAGD
Sbjct  185  AGAGD  189



>ref|XP_003616412.1| Expansin [Medicago truncatula]
 gb|AES99370.1| expansin A10 [Medicago truncatula]
Length=259

 Score =   322 bits (824),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 153/189 (81%), Positives = 169/189 (89%), Gaps = 2/189 (1%)
 Frame = +1

Query  94   MAAVRVLCI-ALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLY  270
            M  + +  I + L   LT+  AR+PGVYSGGAWQTAHATFYGG+DASGTMGGACGYGNLY
Sbjct  1    MTKLNITTIFSFLALLLTSTEARLPGVYSGGAWQTAHATFYGGSDASGTMGGACGYGNLY  60

Query  271  SQGYGVNNAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALPN  447
            SQGYGVN AALSTALFNNGLSCG+CFE+KCSND S C PG+PSI VTATNFCPPNFA  +
Sbjct  61   SQGYGVNTAALSTALFNNGLSCGSCFELKCSNDPSWCHPGSPSILVTATNFCPPNFAQAS  120

Query  448  DNGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVL  627
            DNGGWCNPPRPHFDLAMPMFLKIA YRAGIVPV++RR+PCRKQGGIR+T+NGFRYFNLVL
Sbjct  121  DNGGWCNPPRPHFDLAMPMFLKIAQYRAGIVPVSYRRVPCRKQGGIRYTINGFRYFNLVL  180

Query  628  VTNVAGAGD  654
            +TNVAGAGD
Sbjct  181  ITNVAGAGD  189



>ref|XP_002309061.1| expansin family protein [Populus trichocarpa]
 gb|ABK94860.1| unknown [Populus trichocarpa]
 gb|EEE92584.1| expansin family protein [Populus trichocarpa]
Length=260

 Score =   321 bits (823),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 153/183 (84%), Positives = 165/183 (90%), Gaps = 1/183 (1%)
 Frame = +1

Query  109  VLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGV  288
            +LCI  L       HARIPGV++GG W++AHATFYGG+DASGTMGGACGYGNLYSQGYGV
Sbjct  8    LLCIVFLTSVFVLAHARIPGVFTGGPWESAHATFYGGSDASGTMGGACGYGNLYSQGYGV  67

Query  289  NNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWC  465
            N AALSTALFNNGLSCGACFEIKC++D R C+PGNPSI VTATNFCPPNFA P+DNGGWC
Sbjct  68   NTAALSTALFNNGLSCGACFEIKCADDPRWCNPGNPSILVTATNFCPPNFAQPSDNGGWC  127

Query  466  NPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAG  645
            NPPRPHFDLAMPMFLKIA YRAGIVPV  RR+PCRKQGGIRFT+NGFRYFNLVLVTNVAG
Sbjct  128  NPPRPHFDLAMPMFLKIAQYRAGIVPVAHRRVPCRKQGGIRFTINGFRYFNLVLVTNVAG  187

Query  646  AGD  654
            AGD
Sbjct  188  AGD  190



>ref|XP_010106493.1| hypothetical protein L484_025251 [Morus notabilis]
 gb|EXC10669.1| hypothetical protein L484_025251 [Morus notabilis]
Length=258

 Score =   321 bits (822),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 151/188 (80%), Positives = 169/188 (90%), Gaps = 1/188 (1%)
 Frame = +1

Query  94   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  273
            MA + V  IA LL  +    ARIPGVY+GG+W+TAHATFYGG+DASGTMGGACGYGNLYS
Sbjct  1    MAGLTVTWIASLLSLMWMAEARIPGVYTGGSWETAHATFYGGSDASGTMGGACGYGNLYS  60

Query  274  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPND  450
            QGYGV+ AALSTALFNNGLSCGACFEIKC+ND + C  G+PSI +TATNFCPPN+ALPND
Sbjct  61   QGYGVSTAALSTALFNNGLSCGACFEIKCANDPKWCHSGSPSILITATNFCPPNYALPND  120

Query  451  NGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLV  630
            NGGWCNPPRPHFDLAMPMFLKIA YRAGIVPV +RR+PCRK+GGIRFT+NGFRYFNLVL+
Sbjct  121  NGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVAYRRVPCRKRGGIRFTINGFRYFNLVLI  180

Query  631  TNVAGAGD  654
            +NVAGAGD
Sbjct  181  SNVAGAGD  188



>gb|KEH39447.1| expansin A10 [Medicago truncatula]
Length=260

 Score =   321 bits (822),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 153/190 (81%), Positives = 171/190 (90%), Gaps = 3/190 (2%)
 Frame = +1

Query  94   MAAVRVLCIALLLCSLTA--VHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNL  267
            M  V ++ +  L+ SLT   V ARIPGVY+GGAWQTAHATFYGG+DASGTMGGACGYGNL
Sbjct  1    MGMVSMVYVVTLIMSLTMWMVDARIPGVYNGGAWQTAHATFYGGSDASGTMGGACGYGNL  60

Query  268  YSQGYGVNNAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALP  444
            YSQGYGVN AALSTALFNNGLSCG+CFE+KC+ND+  C  G+PSIF+TATNFCPPNFA P
Sbjct  61   YSQGYGVNTAALSTALFNNGLSCGSCFELKCANDKQWCHSGSPSIFITATNFCPPNFAQP  120

Query  445  NDNGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLV  624
            +DNGGWCNPPRPHFDLAMPMFLKIA YRAGIVPV FRR+PCRK+GGIRFT+NGFRYFNLV
Sbjct  121  SDNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVAFRRVPCRKRGGIRFTINGFRYFNLV  180

Query  625  LVTNVAGAGD  654
            L++NVAGAGD
Sbjct  181  LISNVAGAGD  190



>ref|XP_002298353.1| alpha-expansin 1 family protein [Populus trichocarpa]
 gb|ABK92494.1| unknown [Populus trichocarpa]
 gb|EEE83158.1| alpha-expansin 1 family protein [Populus trichocarpa]
Length=262

 Score =   321 bits (822),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 152/192 (79%), Positives = 172/192 (90%), Gaps = 5/192 (3%)
 Frame = +1

Query  94   MAAVRVLCIA----LLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYG  261
            MA   ++CIA    +++ SL    ARIPGVYSGGAWQ AHATFYGGADASGTMGGACGYG
Sbjct  1    MAMSSLICIATSLLIIMSSLWMAEARIPGVYSGGAWQNAHATFYGGADASGTMGGACGYG  60

Query  262  NLYSQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFA  438
            NLYSQGYGV+ AALSTALFNNGL+CG+CFEIKC++D R C  G+PSIF+TATNFCPPN+A
Sbjct  61   NLYSQGYGVSTAALSTALFNNGLTCGSCFEIKCASDPRWCHSGSPSIFITATNFCPPNYA  120

Query  439  LPNDNGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFN  618
            LP+DNGGWCNPPRPHFDLAMPMFLKIA YRAGIVPV +RR+PCRK+GGIRFT+NGFRYFN
Sbjct  121  LPSDNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVAYRRVPCRKRGGIRFTINGFRYFN  180

Query  619  LVLVTNVAGAGD  654
            LVL++NVAGAGD
Sbjct  181  LVLISNVAGAGD  192



>ref|XP_009364387.1| PREDICTED: expansin-A4 [Pyrus x bretschneideri]
Length=260

 Score =   320 bits (821),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 158/190 (83%), Positives = 169/190 (89%), Gaps = 3/190 (2%)
 Frame = +1

Query  94   MAAVRV-LCIALLLCSLTAV-HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNL  267
            M  V V  CIA LL SL  V  ARIPGVY+GGAWQ AHATFYGG+DASGTMGGACGYGNL
Sbjct  1    MGVVSVSTCIATLLISLMWVAEARIPGVYTGGAWQGAHATFYGGSDASGTMGGACGYGNL  60

Query  268  YSQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALP  444
            YSQGYGVN  ALSTALFNNGLSCGACFEIKCSND R C  G+PSIF+TATNFCPPNFA P
Sbjct  61   YSQGYGVNTGALSTALFNNGLSCGACFEIKCSNDPRWCHSGSPSIFITATNFCPPNFAQP  120

Query  445  NDNGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLV  624
            +DNGGWCNPPRPHFDLAMPMFLKIA YRAGIVPV +RR+PCRK+GGIRFT+NGFRYFNLV
Sbjct  121  SDNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVAYRRVPCRKRGGIRFTINGFRYFNLV  180

Query  625  LVTNVAGAGD  654
            L++NVAGAGD
Sbjct  181  LISNVAGAGD  190



>ref|XP_002283358.1| PREDICTED: expansin-A4 [Vitis vinifera]
 emb|CBI31662.3| unnamed protein product [Vitis vinifera]
Length=258

 Score =   320 bits (821),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 151/188 (80%), Positives = 166/188 (88%), Gaps = 1/188 (1%)
 Frame = +1

Query  94   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  273
            M  V V+C   +   L    ARIPGVY+GG WQ+AHATFYGG+DASGTMGGACGYGNLYS
Sbjct  1    MGLVAVVCFVAMASVLKLGEARIPGVYTGGGWQSAHATFYGGSDASGTMGGACGYGNLYS  60

Query  274  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPND  450
            QGYGVN AALSTALFNNGLSCGACFE+KC+ND   C  G+PSI +TATNFCPPN+ALP+D
Sbjct  61   QGYGVNTAALSTALFNNGLSCGACFELKCANDPEWCHSGSPSILITATNFCPPNYALPSD  120

Query  451  NGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLV  630
            NGGWCNPPRPHFDLAMPMFLKIA YRAGIVPV+FRR+PCRKQGGIRFT+NGFRYFNLVL+
Sbjct  121  NGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSFRRVPCRKQGGIRFTINGFRYFNLVLI  180

Query  631  TNVAGAGD  654
            TNVAGAGD
Sbjct  181  TNVAGAGD  188



>ref|XP_009610453.1| PREDICTED: expansin-A3-like [Nicotiana tomentosiformis]
Length=257

 Score =   320 bits (820),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 148/187 (79%), Positives = 167/187 (89%), Gaps = 0/187 (0%)
 Frame = +1

Query  94   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  273
            MA +  LCIA LL  LT  +A++PGVY+ G W++AHATFYGGADASGTMGGACGYGNLYS
Sbjct  1    MAIIWTLCIASLLSFLTGANAKVPGVYTSGPWESAHATFYGGADASGTMGGACGYGNLYS  60

Query  274  QGYGVNNAALSTALFNNGLSCGACFEIKCSNDRSCSPGNPSIFVTATNFCPPNFALPNDN  453
             GYGVNNAALSTALFNNGLSCGACFEI+C++ + C+PGNPSIFVT TNFCPPN+ALPNDN
Sbjct  61   AGYGVNNAALSTALFNNGLSCGACFEIRCTDPKWCTPGNPSIFVTGTNFCPPNYALPNDN  120

Query  454  GGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVT  633
            GGWCNPPRPHFDLA PMFLK A YRAGIVPV +RR+PC+K GGIRFT+NGF YFN+V+VT
Sbjct  121  GGWCNPPRPHFDLAEPMFLKFAQYRAGIVPVTYRRVPCKKSGGIRFTINGFNYFNMVIVT  180

Query  634  NVAGAGD  654
            NVAGAGD
Sbjct  181  NVAGAGD  187



>ref|XP_004142066.1| PREDICTED: expansin-A4-like [Cucumis sativus]
 gb|KGN54256.1| hypothetical protein Csa_4G296100 [Cucumis sativus]
Length=259

 Score =   320 bits (821),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 152/169 (90%), Positives = 161/169 (95%), Gaps = 1/169 (1%)
 Frame = +1

Query  151  HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGL  330
            HARIPGVYSGG WQ AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFNNGL
Sbjct  21   HARIPGVYSGGPWQDAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGL  80

Query  331  SCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMF  507
            SCGACFEIKC+ND R C PG+PSIF+TATNFCPPNFALPNDNGGWCNPPR HFDLAMPMF
Sbjct  81   SCGACFEIKCANDPRWCHPGSPSIFITATNFCPPNFALPNDNGGWCNPPRTHFDLAMPMF  140

Query  508  LKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGD  654
            LKIA YRAGIVPV++RR+PCRKQGGIRFT+NGFRYFNLVL+TNVAGAGD
Sbjct  141  LKIAEYRAGIVPVSYRRVPCRKQGGIRFTINGFRYFNLVLITNVAGAGD  189



>ref|XP_011035307.1| PREDICTED: expansin-A6 [Populus euphratica]
Length=262

 Score =   320 bits (820),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 153/192 (80%), Positives = 172/192 (90%), Gaps = 5/192 (3%)
 Frame = +1

Query  94   MAAVRVLCIA----LLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYG  261
            MA   ++CIA    +++ SL    ARIPGVYSGGAWQ AHATFYGGADASGTMGGACGYG
Sbjct  1    MAMSSLICIATSLLIIMSSLWMGEARIPGVYSGGAWQNAHATFYGGADASGTMGGACGYG  60

Query  262  NLYSQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFA  438
            NLYSQGYGV+ AALSTALFNNGLSCG+CFEIKC++D R C  G+PSIF+TATNFCPPN+A
Sbjct  61   NLYSQGYGVSTAALSTALFNNGLSCGSCFEIKCASDPRWCHSGSPSIFITATNFCPPNYA  120

Query  439  LPNDNGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFN  618
            LP+DNGGWCNPPRPHFDLAMPMFLKIA YRAGIVPV +RR+PCRK+GGIRFT+NGFRYFN
Sbjct  121  LPSDNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVAYRRVPCRKRGGIRFTINGFRYFN  180

Query  619  LVLVTNVAGAGD  654
            LVL++NVAGAGD
Sbjct  181  LVLISNVAGAGD  192



>ref|XP_009757427.1| PREDICTED: expansin-A4-like [Nicotiana sylvestris]
Length=261

 Score =   320 bits (820),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 154/192 (80%), Positives = 168/192 (88%), Gaps = 5/192 (3%)
 Frame = +1

Query  88   GKMAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNL  267
            G M  +  +   + L SL  V ARIPGVYSGG+WQTAHATFYGG+DASGTMGGACGYGNL
Sbjct  2    GSMGVITSIVGLIFLVSL--VEARIPGVYSGGSWQTAHATFYGGSDASGTMGGACGYGNL  59

Query  268  YSQGYGVNNAALSTALFNNGLSCGACFEIKCSND---RSCSPGNPSIFVTATNFCPPNFA  438
            YSQGYGVN AALSTALFNNGLSCGACFEIKC+ND   + C PG+PSI +TATNFCPPN+A
Sbjct  60   YSQGYGVNTAALSTALFNNGLSCGACFEIKCTNDPNWKWCLPGSPSILITATNFCPPNYA  119

Query  439  LPNDNGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFN  618
             PNDNGGWCNPPR HFDLAMPMFLKIA YRAGIVPV +RRIPCRK+GGIRFT+NGFRYFN
Sbjct  120  KPNDNGGWCNPPRSHFDLAMPMFLKIAEYRAGIVPVTYRRIPCRKRGGIRFTINGFRYFN  179

Query  619  LVLVTNVAGAGD  654
            LVL+TNVAGAGD
Sbjct  180  LVLITNVAGAGD  191



>ref|XP_002315218.1| alpha-expansin 9 precursor family protein [Populus trichocarpa]
 gb|EEF01389.1| alpha-expansin 9 precursor family protein [Populus trichocarpa]
Length=258

 Score =   320 bits (820),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 151/188 (80%), Positives = 169/188 (90%), Gaps = 1/188 (1%)
 Frame = +1

Query  94   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  273
            MA    +C+A L+  LT V ARIPGVY+GGAWQ+AHATFYGG+DASGTMGGACGYGNLYS
Sbjct  1    MAIRATICVASLVLFLTLVEARIPGVYTGGAWQSAHATFYGGSDASGTMGGACGYGNLYS  60

Query  274  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPND  450
            QGYGVN AALSTALFNNGLSCGACFEIKC ND + C  G+PSI +TATNFCPPN+ALP+D
Sbjct  61   QGYGVNTAALSTALFNNGLSCGACFEIKCGNDPQWCHSGSPSILITATNFCPPNYALPSD  120

Query  451  NGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLV  630
            NGGWCNPPRPHFDLAMP+FLKIA YRAGIVPV++RR+PCRK+GGIRF +NG RYFNLVL+
Sbjct  121  NGGWCNPPRPHFDLAMPVFLKIAEYRAGIVPVSYRRVPCRKRGGIRFQINGHRYFNLVLI  180

Query  631  TNVAGAGD  654
            TNVAGAGD
Sbjct  181  TNVAGAGD  188



>gb|AEN70914.1| expansin [Gossypium trilobum]
Length=259

 Score =   320 bits (820),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 152/189 (80%), Positives = 171/189 (90%), Gaps = 2/189 (1%)
 Frame = +1

Query  94   MAAVRVLCIALLLCSLTAV-HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLY  270
            MA V V+ + + + S+  +  ARIPGVYSGGAWQ AHATFYGGADASGTMGGACGYGNLY
Sbjct  1    MAMVNVISVLIFISSMWMMGEARIPGVYSGGAWQNAHATFYGGADASGTMGGACGYGNLY  60

Query  271  SQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPN  447
            SQGYGV+ AALSTALFNNGLSCGACFEIKC++D + C  G+PSIF+TATNFCPPNFALPN
Sbjct  61   SQGYGVSTAALSTALFNNGLSCGACFEIKCASDPKWCHSGSPSIFITATNFCPPNFALPN  120

Query  448  DNGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVL  627
            DNGGWCNPPR HFDLAMPMFLKIA YRAGIVPV++RR+PCRK+GGIRFT+NGFRYFNLVL
Sbjct  121  DNGGWCNPPRTHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKRGGIRFTINGFRYFNLVL  180

Query  628  VTNVAGAGD  654
            ++NVAGAGD
Sbjct  181  ISNVAGAGD  189



>ref|XP_003552064.1| PREDICTED: expansin-A4 [Glycine max]
Length=258

 Score =   320 bits (819),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 154/188 (82%), Positives = 168/188 (89%), Gaps = 1/188 (1%)
 Frame = +1

Query  94   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  273
            MA +  LCIA L+    A  ARIPGV++GGAWQ AHATFYGG DASGTMGGACGYGNLYS
Sbjct  1    MAGMVPLCIASLVTLFVATSARIPGVFNGGAWQGAHATFYGGNDASGTMGGACGYGNLYS  60

Query  274  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPND  450
            QGYGVN AALSTALFNNGLSCGACFEIKC  D R C+PG+PSI +TATNFCPPNFALP+D
Sbjct  61   QGYGVNTAALSTALFNNGLSCGACFEIKCDQDPRWCNPGSPSIVITATNFCPPNFALPSD  120

Query  451  NGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLV  630
            NGGWCNPPRPHFDLAMPMFLKIA Y+AGIVPV++RR+PCRK GGIRFT+NGFRYFNLVL+
Sbjct  121  NGGWCNPPRPHFDLAMPMFLKIAQYKAGIVPVSYRRVPCRKVGGIRFTINGFRYFNLVLI  180

Query  631  TNVAGAGD  654
            TNVAGAGD
Sbjct  181  TNVAGAGD  188



>ref|NP_001284471.1| expansin-A4 precursor [Cucumis melo]
 gb|ABI94060.1| ripening-related expansin [Cucumis melo]
Length=259

 Score =   320 bits (820),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 152/169 (90%), Positives = 161/169 (95%), Gaps = 1/169 (1%)
 Frame = +1

Query  151  HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGL  330
            HARIPGVYSGG WQ AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFNNGL
Sbjct  21   HARIPGVYSGGPWQDAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGL  80

Query  331  SCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMF  507
            SCGACFEIKC+ND R C PG+PSIF+TATNFCPPNFALPNDNGGWCNPPR HFDLAMPMF
Sbjct  81   SCGACFEIKCANDPRWCHPGSPSIFITATNFCPPNFALPNDNGGWCNPPRTHFDLAMPMF  140

Query  508  LKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGD  654
            LKIA YRAGIVPV++RR+PCRKQGGIRFT+NGFRYFNLVL+TNVAGAGD
Sbjct  141  LKIAEYRAGIVPVSYRRVPCRKQGGIRFTINGFRYFNLVLITNVAGAGD  189



>gb|AAL31480.1|AF319475_1 alpha-expansin 9 precursor [Cucumis sativus]
Length=245

 Score =   319 bits (818),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 148/170 (87%), Positives = 163/170 (96%), Gaps = 1/170 (1%)
 Frame = +1

Query  148  VHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNG  327
            VHARIPGVYSGG WQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFNNG
Sbjct  20   VHARIPGVYSGGQWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNG  79

Query  328  LSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPM  504
            LSCGACFE+KC+ND + C  G+PSIF+TATNFCPPN+ALP+DNGGWCNPPRPHFDLAMPM
Sbjct  80   LSCGACFELKCANDPQWCHSGSPSIFITATNFCPPNYALPSDNGGWCNPPRPHFDLAMPM  139

Query  505  FLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGD  654
            FLKIA YRAGIVPV++RR+PCRKQGGIRFT+NGFRYFNL+L+TNVAGAGD
Sbjct  140  FLKIAEYRAGIVPVSYRRVPCRKQGGIRFTINGFRYFNLILITNVAGAGD  189



>ref|XP_009341751.1| PREDICTED: expansin-A4-like [Pyrus x bretschneideri]
Length=258

 Score =   320 bits (819),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 152/188 (81%), Positives = 169/188 (90%), Gaps = 1/188 (1%)
 Frame = +1

Query  94   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  273
            MA++RVL IA +L    A +ARIPGVY+GG W+ AHATFYGG DASGTMGGACGYGNLYS
Sbjct  1    MASLRVLYIAFMLSLFMAANARIPGVYTGGPWEGAHATFYGGNDASGTMGGACGYGNLYS  60

Query  274  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPND  450
            QGYGVN AALSTALFNNGLSCGACFE+KC +D R C PGNPSI VTATNFCPPNFA P+D
Sbjct  61   QGYGVNTAALSTALFNNGLSCGACFELKCGDDPRWCHPGNPSILVTATNFCPPNFAQPSD  120

Query  451  NGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLV  630
            +GGWCNPPR HFDLAMPMFLKIA Y+AGIVPV++RR+PCRKQGG+RFT+NGFRYFNLVL+
Sbjct  121  DGGWCNPPRTHFDLAMPMFLKIAEYKAGIVPVSYRRVPCRKQGGVRFTINGFRYFNLVLI  180

Query  631  TNVAGAGD  654
            TNVAGAGD
Sbjct  181  TNVAGAGD  188



>ref|XP_011027216.1| PREDICTED: expansin-A4 [Populus euphratica]
Length=258

 Score =   320 bits (819),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 151/188 (80%), Positives = 168/188 (89%), Gaps = 1/188 (1%)
 Frame = +1

Query  94   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  273
            MA     C+A L+  LT V ARIPGVY+GGAWQ+AHATFYGG+DASGTMGGACGYGNLYS
Sbjct  1    MAIRATTCVASLVLFLTLVEARIPGVYTGGAWQSAHATFYGGSDASGTMGGACGYGNLYS  60

Query  274  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPND  450
            QGYGVN AALSTALFN+GLSCGACFEIKC ND + C  G+PSI +TATNFCPPN+ALP+D
Sbjct  61   QGYGVNTAALSTALFNSGLSCGACFEIKCGNDPQWCHSGSPSILITATNFCPPNYALPSD  120

Query  451  NGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLV  630
            NGGWCNPPRPHFDLAMPMFLKIA YRAGIVPV++RR+PCRK+GGIRF +NG RYFNLVL+
Sbjct  121  NGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKRGGIRFQINGHRYFNLVLI  180

Query  631  TNVAGAGD  654
            TNVAGAGD
Sbjct  181  TNVAGAGD  188



>ref|XP_002533097.1| Alpha-expansin 4 precursor, putative [Ricinus communis]
 gb|EEF29289.1| Alpha-expansin 4 precursor, putative [Ricinus communis]
Length=259

 Score =   320 bits (819),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 152/189 (80%), Positives = 171/189 (90%), Gaps = 2/189 (1%)
 Frame = +1

Query  91   KMAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLY  270
            KM +V +  + LL+  + A  ARIPGVY+GG+WQ+AHATFYGG+DASGTMGGACGYGNLY
Sbjct  2    KMGSV-ISGVILLVMLMGASEARIPGVYTGGSWQSAHATFYGGSDASGTMGGACGYGNLY  60

Query  271  SQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPN  447
            SQGYGVN AALSTALFNNGLSCGACFEIKC+ND + C  G+PSI +TATNFCPPNFALPN
Sbjct  61   SQGYGVNTAALSTALFNNGLSCGACFEIKCANDPKWCHSGSPSILITATNFCPPNFALPN  120

Query  448  DNGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVL  627
            DNGGWCNPPRPHFDLAMPMFLKIA YRAGIVPV +RR+PCRK+GGIRFT+NGFRYFNLVL
Sbjct  121  DNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVAYRRVPCRKRGGIRFTINGFRYFNLVL  180

Query  628  VTNVAGAGD  654
            ++NVAGAGD
Sbjct  181  ISNVAGAGD  189



>emb|CDP09064.1| unnamed protein product [Coffea canephora]
Length=260

 Score =   320 bits (819),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 155/190 (82%), Positives = 171/190 (90%), Gaps = 3/190 (2%)
 Frame = +1

Query  94   MAAVRVLCIA--LLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNL  267
            MA V ++CIA  L L  +    ARIPGVY+GG WQ+AHATFYGG+DASGTMGGACGYGNL
Sbjct  1    MAVVGLVCIASVLALAFMLGAEARIPGVYTGGDWQSAHATFYGGSDASGTMGGACGYGNL  60

Query  268  YSQGYGVNNAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALP  444
            YSQGYGVN AALSTALF++GLSCGACFEIKC++D   C PG+PSIFVTATNFCPPN+ALP
Sbjct  61   YSQGYGVNTAALSTALFSSGLSCGACFEIKCASDPGWCHPGSPSIFVTATNFCPPNYALP  120

Query  445  NDNGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLV  624
            NDNGGWCNPPRPHFDLAMPMFLKIA YRAGIVPV +RR+PCRKQGGIRFT+NGFRYFNLV
Sbjct  121  NDNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVTYRRVPCRKQGGIRFTINGFRYFNLV  180

Query  625  LVTNVAGAGD  654
            LVTNVAGAG+
Sbjct  181  LVTNVAGAGN  190



>ref|XP_004143121.1| PREDICTED: expansin-A4-like [Cucumis sativus]
 ref|XP_004166197.1| PREDICTED: expansin-A4-like [Cucumis sativus]
 gb|KGN47143.1| hypothetical protein Csa_6G190340 [Cucumis sativus]
Length=258

 Score =   319 bits (818),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 154/188 (82%), Positives = 166/188 (88%), Gaps = 1/188 (1%)
 Frame = +1

Query  94   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  273
            MA    LCI LLL     + ARIPGVYSGG WQ+AHATFYGG+DASGTMGGACGYGNLYS
Sbjct  1    MATPFSLCIPLLLSFSLLIEARIPGVYSGGPWQSAHATFYGGSDASGTMGGACGYGNLYS  60

Query  274  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPND  450
            QGYGVN AALSTALFN G SCGACFEIKC+ND R C  G+PSI +TATNFCPPN+ALPND
Sbjct  61   QGYGVNTAALSTALFNKGQSCGACFEIKCANDPRWCHSGSPSILITATNFCPPNYALPND  120

Query  451  NGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLV  630
            NGGWCNPPR HFDLAMPMFLKIA YRAGIVPV++RR+PCRKQGGIRFT+NGFRYFNLVL+
Sbjct  121  NGGWCNPPRSHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKQGGIRFTINGFRYFNLVLI  180

Query  631  TNVAGAGD  654
            TNVAGAGD
Sbjct  181  TNVAGAGD  188



>emb|CAH18933.1| expansin [Pyrus communis]
Length=258

 Score =   319 bits (818),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 152/188 (81%), Positives = 168/188 (89%), Gaps = 1/188 (1%)
 Frame = +1

Query  94   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  273
            MA++RVL IA +L      +ARIPGVY+GG W+ AHATFYGG DASGTMGGACGYGNLYS
Sbjct  1    MASLRVLYIAFMLSLFMEANARIPGVYTGGPWEGAHATFYGGNDASGTMGGACGYGNLYS  60

Query  274  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPND  450
            QGYGVN AALSTALFNNGLSCGACFEIKC +D R C PGNPSI VTATNFCPPNFA P+D
Sbjct  61   QGYGVNTAALSTALFNNGLSCGACFEIKCGDDPRWCHPGNPSILVTATNFCPPNFAQPSD  120

Query  451  NGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLV  630
            +GGWCNPPR HFDLAMPMFLKIA Y+AGIVPV++RR+PCRKQGG+RFT+NGFRYFNLVL+
Sbjct  121  DGGWCNPPRTHFDLAMPMFLKIAEYKAGIVPVSYRRVPCRKQGGVRFTINGFRYFNLVLI  180

Query  631  TNVAGAGD  654
            TNVAGAGD
Sbjct  181  TNVAGAGD  188



>gb|AIE54285.1| expansin [Nicotiana tabacum]
Length=257

 Score =   319 bits (818),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 147/187 (79%), Positives = 167/187 (89%), Gaps = 0/187 (0%)
 Frame = +1

Query  94   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  273
            MA +  LCIA LL  LT  +A++PGVY+ G W++AHATFYGGADASGTMGGACGYGNLYS
Sbjct  1    MAIIWTLCIASLLSFLTGANAKVPGVYTSGPWESAHATFYGGADASGTMGGACGYGNLYS  60

Query  274  QGYGVNNAALSTALFNNGLSCGACFEIKCSNDRSCSPGNPSIFVTATNFCPPNFALPNDN  453
             GYGVNNAALSTALFNNGLSCGACFEI+C++ + C+PGNPSIFVT TNFCPPN+ALPNDN
Sbjct  61   AGYGVNNAALSTALFNNGLSCGACFEIRCTDPKWCTPGNPSIFVTGTNFCPPNYALPNDN  120

Query  454  GGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVT  633
            GGWCNPPRPHFDLA PMFLK A YRAGIVPV +RR+PC+K GGI+FT+NGF YFN+V+VT
Sbjct  121  GGWCNPPRPHFDLAEPMFLKFAQYRAGIVPVTYRRVPCKKSGGIKFTINGFNYFNMVIVT  180

Query  634  NVAGAGD  654
            NVAGAGD
Sbjct  181  NVAGAGD  187



>gb|AFZ78606.1| expansin protein [Populus tomentosa]
Length=262

 Score =   319 bits (818),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 152/192 (79%), Positives = 172/192 (90%), Gaps = 5/192 (3%)
 Frame = +1

Query  94   MAAVRVLCIA----LLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYG  261
            MA   ++CIA    +++ SL    ARIPGVYSGGAW+ AHATFYGGADASGTMGGACGYG
Sbjct  1    MAMRSLICIATSLLIIVSSLWMAEARIPGVYSGGAWENAHATFYGGADASGTMGGACGYG  60

Query  262  NLYSQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFA  438
            NLYSQGYGV+ AALSTALFNNGLSCG+CFEIKC++D R C  G+PSIF+TATNFCPPN+A
Sbjct  61   NLYSQGYGVSTAALSTALFNNGLSCGSCFEIKCASDPRWCHSGSPSIFITATNFCPPNYA  120

Query  439  LPNDNGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFN  618
            LP+DNGGWCNPPRPHFDLAMPMFLKIA YRAGIVPV +RR+PCRK+GGIRFT+NGFRYFN
Sbjct  121  LPSDNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVAYRRVPCRKRGGIRFTINGFRYFN  180

Query  619  LVLVTNVAGAGD  654
            LVL++NVAGAGD
Sbjct  181  LVLISNVAGAGD  192



>gb|AAM22625.1|AF428178_1 expansin 11 precursor [Rumex palustris]
Length=258

 Score =   319 bits (817),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 153/188 (81%), Positives = 168/188 (89%), Gaps = 1/188 (1%)
 Frame = +1

Query  94   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  273
            MAA+  L   + + S  +  ARIPGVYSGG W+TAHATFYGG+DASGTMGGACG+GNLYS
Sbjct  1    MAALSALLCIVSVLSFYSADARIPGVYSGGGWETAHATFYGGSDASGTMGGACGFGNLYS  60

Query  274  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPND  450
            QGYGVN AALSTALFNNGLSCGACFEIKC++D R C PG+PSI +TATNFCPPNFA P+D
Sbjct  61   QGYGVNTAALSTALFNNGLSCGACFEIKCADDPRWCHPGSPSILITATNFCPPNFAEPSD  120

Query  451  NGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLV  630
            NGGWCNPPRPHFDLAMPMFLKIA YRAGIVPV FRR+PCRK+GGIRFTVNGFRYFNLVL+
Sbjct  121  NGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVAFRRVPCRKRGGIRFTVNGFRYFNLVLI  180

Query  631  TNVAGAGD  654
            TNVAGAGD
Sbjct  181  TNVAGAGD  188



>gb|ADC35365.1| alpha-expansin 2 [Coffea arabica]
Length=258

 Score =   319 bits (817),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 148/188 (79%), Positives = 169/188 (90%), Gaps = 1/188 (1%)
 Frame = +1

Query  94   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  273
            MAA+ + CI  L   LT   ARIPGVY+G +W++AHATFYGG+DASGTMGGACGYGNLYS
Sbjct  1    MAAMGLTCIVALSLLLTLTEARIPGVYTGDSWESAHATFYGGSDASGTMGGACGYGNLYS  60

Query  274  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPND  450
            QGYGVN AALSTALFNNG SCG+CFE+KC++D + C PG+PSI +TATNFCPPN+ALPND
Sbjct  61   QGYGVNTAALSTALFNNGFSCGSCFELKCADDPQWCHPGSPSILITATNFCPPNYALPND  120

Query  451  NGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLV  630
            NGGWCNPPRPHFDLAMPMFL+IA YRAGIVPV++RR+PCRKQGGIRF +NGFRYFNLVL+
Sbjct  121  NGGWCNPPRPHFDLAMPMFLRIAEYRAGIVPVSYRRVPCRKQGGIRFQINGFRYFNLVLI  180

Query  631  TNVAGAGD  654
            TNVAGAGD
Sbjct  181  TNVAGAGD  188



>gb|KCW65541.1| hypothetical protein EUGRSUZ_G02938 [Eucalyptus grandis]
Length=259

 Score =   319 bits (817),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 154/189 (81%), Positives = 170/189 (90%), Gaps = 2/189 (1%)
 Frame = +1

Query  94   MAAV-RVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLY  270
            MA+V RV+ +  L+   T   ARIPGVY+GG WQ+AHATFYGG+DASGTMGGACGYGNLY
Sbjct  1    MASVSRVVGLVSLILFSTLAEARIPGVYTGGPWQSAHATFYGGSDASGTMGGACGYGNLY  60

Query  271  SQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPN  447
            SQGYGVN AALSTALFNNG SCGACFEIKC+N+ + C  G+PSI VTATNFCPPN+ALPN
Sbjct  61   SQGYGVNTAALSTALFNNGFSCGACFEIKCANEPQWCHSGSPSILVTATNFCPPNYALPN  120

Query  448  DNGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVL  627
            DNGGWCNPPRPHFDLAMPMFLKIA YRAGIVPV++RR+PCRKQGGIRFT+NGFRYFNLVL
Sbjct  121  DNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKQGGIRFTINGFRYFNLVL  180

Query  628  VTNVAGAGD  654
            VTNVAGAGD
Sbjct  181  VTNVAGAGD  189



>gb|AEN70891.1| expansin [Gossypium thurberi]
Length=259

 Score =   319 bits (817),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 151/189 (80%), Positives = 171/189 (90%), Gaps = 2/189 (1%)
 Frame = +1

Query  94   MAAVRVLCIALLLCSLTAV-HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLY  270
            MA V V+ + + + S+  +  ARIPGVYSGGAWQ AHATFYGGADASGTMGGACGYGNLY
Sbjct  1    MAMVNVISVLIFISSMWMMGEARIPGVYSGGAWQNAHATFYGGADASGTMGGACGYGNLY  60

Query  271  SQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPN  447
            SQGYGV+ AALSTALFNNGLSCGACFEIKC++D + C  G+PSIF+TATNFCPPN+ALPN
Sbjct  61   SQGYGVSTAALSTALFNNGLSCGACFEIKCASDPKWCHSGSPSIFITATNFCPPNYALPN  120

Query  448  DNGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVL  627
            DNGGWCNPPR HFDLAMPMFLKIA YRAGIVPV++RR+PCRK+GGIRFT+NGFRYFNLVL
Sbjct  121  DNGGWCNPPRTHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKRGGIRFTINGFRYFNLVL  180

Query  628  VTNVAGAGD  654
            ++NVAGAGD
Sbjct  181  ISNVAGAGD  189



>gb|KEH22886.1| expansin-A1-like protein [Medicago truncatula]
Length=258

 Score =   319 bits (817),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 154/188 (82%), Positives = 165/188 (88%), Gaps = 1/188 (1%)
 Frame = +1

Query  94   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  273
            MA + +L IA L     A  ARIPGVYSGG W +AHATFYGG+DASGTMGGACGYGNLYS
Sbjct  1    MAGILLLTIASLASLFAATTARIPGVYSGGPWTSAHATFYGGSDASGTMGGACGYGNLYS  60

Query  274  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPND  450
            QGYGVN AALSTALFNNGLSCGACFE+KC  D R C+PGNPSI +TATNFCPPNFA P+D
Sbjct  61   QGYGVNTAALSTALFNNGLSCGACFELKCDQDPRWCNPGNPSILITATNFCPPNFAQPSD  120

Query  451  NGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLV  630
            NGGWCNPPRPHFDLAMPMFLKIA YRAGIVPV +RR+PCRK GGIRFT+NGFRYFNLVLV
Sbjct  121  NGGWCNPPRPHFDLAMPMFLKIAQYRAGIVPVAYRRVPCRKAGGIRFTINGFRYFNLVLV  180

Query  631  TNVAGAGD  654
            TNVAGAGD
Sbjct  181  TNVAGAGD  188



>ref|XP_004147685.1| PREDICTED: expansin-A4-like [Cucumis sativus]
 ref|XP_004161909.1| PREDICTED: expansin-A4-like [Cucumis sativus]
 gb|KGN50556.1| hypothetical protein Csa_5G182120 [Cucumis sativus]
Length=259

 Score =   319 bits (817),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 148/170 (87%), Positives = 163/170 (96%), Gaps = 1/170 (1%)
 Frame = +1

Query  148  VHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNG  327
            VHARIPGVYSGG WQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFNNG
Sbjct  20   VHARIPGVYSGGQWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNG  79

Query  328  LSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPM  504
            LSCGACFE+KC+ND + C  G+PSIF+TATNFCPPN+ALP+DNGGWCNPPRPHFDLAMPM
Sbjct  80   LSCGACFELKCANDPQWCHSGSPSIFITATNFCPPNYALPSDNGGWCNPPRPHFDLAMPM  139

Query  505  FLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGD  654
            FLKIA YRAGIVPV++RR+PCRKQGGIRFT+NGFRYFNL+L+TNVAGAGD
Sbjct  140  FLKIAEYRAGIVPVSYRRVPCRKQGGIRFTINGFRYFNLILITNVAGAGD  189



>gb|AEN70901.1| expansin [Gossypium barbadense var. brasiliense]
Length=259

 Score =   319 bits (817),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 151/189 (80%), Positives = 171/189 (90%), Gaps = 2/189 (1%)
 Frame = +1

Query  94   MAAVRVLCIALLLCSLTAV-HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLY  270
            MA V V+ + + + S+  +  ARIPGVYSGGAWQ AHATFYGGADASGTMGGACGYGNLY
Sbjct  1    MAMVNVISVLIFISSMWMMGEARIPGVYSGGAWQNAHATFYGGADASGTMGGACGYGNLY  60

Query  271  SQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPN  447
            SQGYGV+ AALSTALFNNGLSCGACFEIKC++D + C  G+PSIF+TATNFCPPN+ALPN
Sbjct  61   SQGYGVSTAALSTALFNNGLSCGACFEIKCASDPKWCHSGSPSIFITATNFCPPNYALPN  120

Query  448  DNGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVL  627
            DNGGWCNPPR HFDLAMPMFLKIA YRAGIVPV++RR+PCRK+GGIRFT+NGFRYFNLVL
Sbjct  121  DNGGWCNPPRTHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKRGGIRFTINGFRYFNLVL  180

Query  628  VTNVAGAGD  654
            ++NVAGAGD
Sbjct  181  ISNVAGAGD  189



>gb|ADY68814.1| expansin [Gossypium barbadense]
 gb|ADY68816.1| expansin [Gossypium herbaceum subsp. africanum]
 gb|AEN70897.1| expansin [Gossypium darwinii]
 gb|AEN70899.1| expansin [Gossypium tomentosum]
 gb|AEN70903.1| expansin [Gossypium barbadense var. peruvianum]
 gb|AEN70905.1| expansin [Gossypium hirsutum subsp. latifolium]
 gb|AEN70909.1| expansin [Gossypium davidsonii]
 gb|AEN70910.1| expansin [Gossypium klotzschianum]
 gb|KJB20062.1| hypothetical protein B456_003G131000 [Gossypium raimondii]
Length=259

 Score =   318 bits (816),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 151/189 (80%), Positives = 171/189 (90%), Gaps = 2/189 (1%)
 Frame = +1

Query  94   MAAVRVLCIALLLCSLTAV-HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLY  270
            MA V V+ + + + S+  +  ARIPGVYSGGAWQ AHATFYGGADASGTMGGACGYGNLY
Sbjct  1    MAMVNVISVLIFISSMWMMGEARIPGVYSGGAWQNAHATFYGGADASGTMGGACGYGNLY  60

Query  271  SQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPN  447
            SQGYGV+ AALSTALFNNGLSCGACFEIKC++D + C  G+PSIF+TATNFCPPN+ALPN
Sbjct  61   SQGYGVSTAALSTALFNNGLSCGACFEIKCASDPKWCHSGSPSIFITATNFCPPNYALPN  120

Query  448  DNGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVL  627
            DNGGWCNPPR HFDLAMPMFLKIA YRAGIVPV++RR+PCRK+GGIRFT+NGFRYFNLVL
Sbjct  121  DNGGWCNPPRTHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKRGGIRFTINGFRYFNLVL  180

Query  628  VTNVAGAGD  654
            ++NVAGAGD
Sbjct  181  ISNVAGAGD  189



>gb|AAR09168.1| alpha-expansin 1 [Populus tremula x Populus tremuloides]
Length=262

 Score =   319 bits (817),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 151/192 (79%), Positives = 172/192 (90%), Gaps = 5/192 (3%)
 Frame = +1

Query  94   MAAVRVLCIA----LLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYG  261
            MA   ++CIA    +++ SL    ARIPGVYSGGAW+ AHATFYGG+DASGTMGGACGYG
Sbjct  1    MAMSSLICIATSLLIIVSSLWMAEARIPGVYSGGAWENAHATFYGGSDASGTMGGACGYG  60

Query  262  NLYSQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFA  438
            NLYSQGYGV+ AALSTALFNNGLSCG+CFEIKC++D R C  G+PSIF+TATNFCPPN+A
Sbjct  61   NLYSQGYGVSTAALSTALFNNGLSCGSCFEIKCASDPRWCHSGSPSIFITATNFCPPNYA  120

Query  439  LPNDNGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFN  618
            LP+DNGGWCNPPRPHFDLAMPMFLKIA YRAGIVPV +RR+PCRK+GGIRFT+NGFRYFN
Sbjct  121  LPSDNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVAYRRVPCRKRGGIRFTINGFRYFN  180

Query  619  LVLVTNVAGAGD  654
            LVL++NVAGAGD
Sbjct  181  LVLISNVAGAGD  192



>ref|XP_004249536.1| PREDICTED: expansin-A6-like [Solanum lycopersicum]
Length=257

 Score =   318 bits (816),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 144/187 (77%), Positives = 168/187 (90%), Gaps = 0/187 (0%)
 Frame = +1

Query  94   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  273
            MA   + CIA LL  LT V +++ GVY+ G WQ+AHATFYGG+DASGTMGGACGYGNLYS
Sbjct  1    MAITWMFCIASLLSFLTIVESKVRGVYTAGPWQSAHATFYGGSDASGTMGGACGYGNLYS  60

Query  274  QGYGVNNAALSTALFNNGLSCGACFEIKCSNDRSCSPGNPSIFVTATNFCPPNFALPNDN  453
             GYGVNNAALST LFN+GLSCGACFEIKC++++ C+PGNPSIFVT TNFCPPN+ALPNDN
Sbjct  61   TGYGVNNAALSTVLFNSGLSCGACFEIKCTDEKWCNPGNPSIFVTGTNFCPPNYALPNDN  120

Query  454  GGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVT  633
            GGWCNPPRPHFDL+MP+FL+IA YRAGIVPV +RR+PC+KQGGIRFT+NGF YFN+++VT
Sbjct  121  GGWCNPPRPHFDLSMPVFLQIAQYRAGIVPVTYRRVPCKKQGGIRFTINGFNYFNMIIVT  180

Query  634  NVAGAGD  654
            NVAGAGD
Sbjct  181  NVAGAGD  187



>ref|XP_009768238.1| PREDICTED: expansin-A6-like [Nicotiana sylvestris]
Length=257

 Score =   318 bits (816),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 152/176 (86%), Positives = 162/176 (92%), Gaps = 1/176 (1%)
 Frame = +1

Query  130  LCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALST  309
            L  + AV  RIPGVYSGGAWQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGVNN ALST
Sbjct  12   LILVAAVEGRIPGVYSGGAWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNNGALST  71

Query  310  ALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHF  486
            ALFNNGLSCGACFEIKC  D +SC  G+PSIF+TATNFCPPNFALPNDNGGWCNPPRPHF
Sbjct  72   ALFNNGLSCGACFEIKCDKDPQSCHSGSPSIFITATNFCPPNFALPNDNGGWCNPPRPHF  131

Query  487  DLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGD  654
            DLAMPMFLKIA YRAGIVPV +RR+PCRK+GGIRFT+NGFRYFNLVLV NVAGAGD
Sbjct  132  DLAMPMFLKIAEYRAGIVPVVYRRVPCRKKGGIRFTINGFRYFNLVLVANVAGAGD  187



>gb|ACN94264.1| expansin [Rehmannia glutinosa]
 gb|ACN94265.1| expansin [Rehmannia glutinosa]
Length=260

 Score =   318 bits (816),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 158/190 (83%), Positives = 169/190 (89%), Gaps = 3/190 (2%)
 Frame = +1

Query  94   MAAVRVL-CIALLLCSLTA-VHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNL  267
            MA + V+ CIA L+  L   + ARIPG Y GGAWQ AHATFYGG+DASGTMGGACGYGNL
Sbjct  1    MALLAVIACIASLISVLPPPIEARIPGNYGGGAWQGAHATFYGGSDASGTMGGACGYGNL  60

Query  268  YSQGYGVNNAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALP  444
            YSQGYGVN AALSTALFNNG SCGACFEIKC+ND+  C  G+PSIFVTATNFCPPN+ALP
Sbjct  61   YSQGYGVNTAALSTALFNNGFSCGACFEIKCANDKQWCHAGSPSIFVTATNFCPPNYALP  120

Query  445  NDNGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLV  624
            NDNGGWCNPPR HFDLAMPMFLKIA YRAGIVPVNFRR+PCRKQGGIRFT+NGFRYFNLV
Sbjct  121  NDNGGWCNPPRTHFDLAMPMFLKIAEYRAGIVPVNFRRVPCRKQGGIRFTINGFRYFNLV  180

Query  625  LVTNVAGAGD  654
            LVTNVAGAGD
Sbjct  181  LVTNVAGAGD  190



>gb|AFK40565.1| unknown [Medicago truncatula]
Length=231

 Score =   317 bits (813),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 152/190 (80%), Positives = 170/190 (89%), Gaps = 3/190 (2%)
 Frame = +1

Query  94   MAAVRVLCIALLLCSLTA--VHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNL  267
            M  V ++ +  L+ SLT   V ARIPGVY+GGAWQTAHATFYGG+DASGTMGGACGYGNL
Sbjct  1    MGMVSMVYVVTLIMSLTMWMVDARIPGVYNGGAWQTAHATFYGGSDASGTMGGACGYGNL  60

Query  268  YSQGYGVNNAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALP  444
            YSQGYGVN AALSTALFNNGLSCG+CFE+KC+ND+  C  G+PSIF+TATNFCPPNFA P
Sbjct  61   YSQGYGVNTAALSTALFNNGLSCGSCFELKCANDKQWCHSGSPSIFITATNFCPPNFAQP  120

Query  445  NDNGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLV  624
            +DNGGWCNPPRPHFDLAMP FLKIA YRAGIVPV FRR+PCRK+GGIRFT+NGFRYFNLV
Sbjct  121  SDNGGWCNPPRPHFDLAMPTFLKIAEYRAGIVPVAFRRVPCRKRGGIRFTINGFRYFNLV  180

Query  625  LVTNVAGAGD  654
            L++NVAGAGD
Sbjct  181  LISNVAGAGD  190



>gb|KDP44940.1| hypothetical protein JCGZ_01440 [Jatropha curcas]
Length=258

 Score =   318 bits (815),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 151/188 (80%), Positives = 168/188 (89%), Gaps = 1/188 (1%)
 Frame = +1

Query  94   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  273
            M     + I  LL  L    ARIPGVYSGG+W++AHATFYGG+DASGTMGGACGYGNLYS
Sbjct  1    MGLKGTISIFCLLLVLKLADARIPGVYSGGSWESAHATFYGGSDASGTMGGACGYGNLYS  60

Query  274  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPND  450
            QGYGVN AALSTALFNNGLSCGACFEIKC+N+ + C  G+PSIF+TATNFCPPN+ALP+D
Sbjct  61   QGYGVNTAALSTALFNNGLSCGACFEIKCANEPQWCHSGSPSIFITATNFCPPNYALPSD  120

Query  451  NGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLV  630
            NGGWCNPPRPHFDLAMPMFLKIA YRAGIVPV++RR+PCRKQGGIRFT+NGFRYFNLVL+
Sbjct  121  NGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKQGGIRFTINGFRYFNLVLI  180

Query  631  TNVAGAGD  654
            TNVAGAGD
Sbjct  181  TNVAGAGD  188



>gb|AAR82850.1| expansin-2 [Petunia x hybrida]
Length=262

 Score =   318 bits (816),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 154/192 (80%), Positives = 170/192 (89%), Gaps = 5/192 (3%)
 Frame = +1

Query  94   MAAVRVLC--IALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNL  267
            MA++ V+   I  LL  ++ V ARIPGVYSGG+WQTAHATFYGG+DASGTMGGACGYGNL
Sbjct  1    MASMGVMATYILALLFLISLVEARIPGVYSGGSWQTAHATFYGGSDASGTMGGACGYGNL  60

Query  268  YSQGYGVNNAALSTALFNNGLSCGACFEIKCSND---RSCSPGNPSIFVTATNFCPPNFA  438
            YSQGYGVN AALSTALFNNGLSCGACFE+KC+ND   + C PGNPSI +TATNFCPPN+A
Sbjct  61   YSQGYGVNTAALSTALFNNGLSCGACFELKCTNDPHWKWCLPGNPSILITATNFCPPNYA  120

Query  439  LPNDNGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFN  618
             PNDNGGWCNPPR HFDLAMPMFLKIA YRAGIVPV +RR+PCRKQGGIRFT+NGFRYFN
Sbjct  121  KPNDNGGWCNPPRSHFDLAMPMFLKIAEYRAGIVPVTYRRVPCRKQGGIRFTMNGFRYFN  180

Query  619  LVLVTNVAGAGD  654
            LVL+ NVAGAGD
Sbjct  181  LVLIPNVAGAGD  192



>gb|AEN70907.1| expansin [Gossypium armourianum]
Length=259

 Score =   318 bits (815),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 151/189 (80%), Positives = 170/189 (90%), Gaps = 2/189 (1%)
 Frame = +1

Query  94   MAAVRVLCIALLLCSLTAV-HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLY  270
            MA V V+ + + + S+  +  ARIPGVYSGGAWQ AHATFYGGADASGTMGGACGYGNLY
Sbjct  1    MAMVNVISVLIFISSMWMMGEARIPGVYSGGAWQNAHATFYGGADASGTMGGACGYGNLY  60

Query  271  SQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPN  447
            SQGYGV+ AALSTALFNNGLSCGACFEIKC +D + C  G+PSIF+TATNFCPPN+ALPN
Sbjct  61   SQGYGVSTAALSTALFNNGLSCGACFEIKCGSDPKWCHSGSPSIFITATNFCPPNYALPN  120

Query  448  DNGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVL  627
            DNGGWCNPPR HFDLAMPMFLKIA YRAGIVPV++RR+PCRK+GGIRFT+NGFRYFNLVL
Sbjct  121  DNGGWCNPPRTHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKRGGIRFTINGFRYFNLVL  180

Query  628  VTNVAGAGD  654
            ++NVAGAGD
Sbjct  181  ISNVAGAGD  189



>ref|XP_008802710.1| PREDICTED: expansin-A4 [Phoenix dactylifera]
Length=258

 Score =   318 bits (815),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 149/188 (79%), Positives = 172/188 (91%), Gaps = 1/188 (1%)
 Frame = +1

Query  94   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  273
            MA +R++ +A LL  L    ARIPGVYSGGAWQ+AHATFYGG+DASGTMGGACGYGNLYS
Sbjct  1    MAILRLVALASLLAFLVPAAARIPGVYSGGAWQSAHATFYGGSDASGTMGGACGYGNLYS  60

Query  274  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPND  450
            QGYGV+ AALSTALFN+GLSCGACFEIKC+++ + C  G+PSIF+TATNFCPPN+ALP+D
Sbjct  61   QGYGVDTAALSTALFNDGLSCGACFEIKCADEPQWCHSGSPSIFITATNFCPPNYALPSD  120

Query  451  NGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLV  630
            +GGWCNPPRPHFDLAMPMFLKIA YRAGIVPV++RR+PCRK GGIRFT+NGF+YFNLVL+
Sbjct  121  DGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKSGGIRFTINGFKYFNLVLI  180

Query  631  TNVAGAGD  654
            TNVAGAGD
Sbjct  181  TNVAGAGD  188



>ref|XP_008357089.1| PREDICTED: expansin-A6 [Malus domestica]
Length=260

 Score =   318 bits (815),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 157/190 (83%), Positives = 168/190 (88%), Gaps = 3/190 (2%)
 Frame = +1

Query  94   MAAVRV-LCIALLLCSLTAV-HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNL  267
            M  V V  CIA LL SL  V  ARIPGVY+GGAWQ AHATFYGG+DASGTM GACGYGNL
Sbjct  1    MGVVSVSTCIATLLISLMWVAEARIPGVYTGGAWQGAHATFYGGSDASGTMXGACGYGNL  60

Query  268  YSQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALP  444
            YSQGYGVN  ALSTALFNNGLSCGACFEIKCSND R C  G+PSIF+TATNFCPPNFA P
Sbjct  61   YSQGYGVNTGALSTALFNNGLSCGACFEIKCSNDPRWCHSGSPSIFITATNFCPPNFAQP  120

Query  445  NDNGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLV  624
            +DNGGWCNPPRPHFDLAMPMFLKIA YRAGIVPV +RR+PCRK+GGIRFT+NGFRYFNLV
Sbjct  121  SDNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVAYRRVPCRKRGGIRFTINGFRYFNLV  180

Query  625  LVTNVAGAGD  654
            L++NVAGAGD
Sbjct  181  LISNVAGAGD  190



>gb|ADY68815.1| expansin [Gossypium barbadense]
 gb|ADY68819.1| expansin [Gossypium hirsutum]
 gb|AEN70892.1| expansin [Gossypium laxum]
 gb|AEN70894.1| expansin [Gossypium turneri]
 gb|AEN70896.1| expansin [Gossypium mustelinum]
 gb|AEN70898.1| expansin [Gossypium darwinii]
 gb|AEN70902.1| expansin [Gossypium barbadense var. brasiliense]
 gb|AEN70904.1| expansin [Gossypium barbadense var. peruvianum]
 gb|AEN70906.1| expansin [Gossypium hirsutum subsp. latifolium]
 gb|AEN70908.1| expansin [Gossypium harknessii]
 gb|AEN70911.1| expansin [Gossypium aridum]
 gb|AEN70912.1| expansin [Gossypium gossypioides]
 gb|AEN70913.1| expansin [Gossypium lobatum]
Length=259

 Score =   318 bits (815),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 151/189 (80%), Positives = 170/189 (90%), Gaps = 2/189 (1%)
 Frame = +1

Query  94   MAAVRVLCIALLLCSLTAV-HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLY  270
            MA V V+ + + + S+  +  ARIPGVYSGGAWQ AHATFYGGADASGTMGGACGYGNLY
Sbjct  1    MAMVNVISVLIFISSMWMMGEARIPGVYSGGAWQNAHATFYGGADASGTMGGACGYGNLY  60

Query  271  SQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPN  447
            SQGYGV+ AALSTALFNNGLSCGACFEIKC +D + C  G+PSIF+TATNFCPPN+ALPN
Sbjct  61   SQGYGVSTAALSTALFNNGLSCGACFEIKCGSDPKWCHSGSPSIFITATNFCPPNYALPN  120

Query  448  DNGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVL  627
            DNGGWCNPPR HFDLAMPMFLKIA YRAGIVPV++RR+PCRK+GGIRFT+NGFRYFNLVL
Sbjct  121  DNGGWCNPPRTHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKRGGIRFTINGFRYFNLVL  180

Query  628  VTNVAGAGD  654
            ++NVAGAGD
Sbjct  181  ISNVAGAGD  189



>ref|XP_004486999.1| PREDICTED: expansin-A6-like [Cicer arietinum]
Length=257

 Score =   318 bits (815),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 152/186 (82%), Positives = 169/186 (91%), Gaps = 2/186 (1%)
 Frame = +1

Query  103  VRVLCIALLLCSLTAV-HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQG  279
            + ++ I  L+ SLT +  +RIPG Y+GGAW+TAHATFYGG+DASGTMGGACGYGNLYSQG
Sbjct  2    MTIVYIVSLIMSLTWLAESRIPGNYNGGAWETAHATFYGGSDASGTMGGACGYGNLYSQG  61

Query  280  YGVNNAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALPNDNG  456
            YGVN AALSTALFN GLSCGACFEIKC+ND+  C  G+PSIF+TATNFCPPN+ALPNDNG
Sbjct  62   YGVNTAALSTALFNKGLSCGACFEIKCANDKEWCHSGSPSIFITATNFCPPNYALPNDNG  121

Query  457  GWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTN  636
            GWCNPPRPHFDLAMPMFLKIA YRAGIVPV FRR+PCRKQGGIRFTVNGFRYFNLVL++N
Sbjct  122  GWCNPPRPHFDLAMPMFLKIAEYRAGIVPVAFRRVPCRKQGGIRFTVNGFRYFNLVLISN  181

Query  637  VAGAGD  654
            VAGAGD
Sbjct  182  VAGAGD  187



>ref|XP_008461679.1| PREDICTED: expansin-A4 [Cucumis melo]
Length=260

 Score =   318 bits (815),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 147/171 (86%), Positives = 163/171 (95%), Gaps = 1/171 (1%)
 Frame = +1

Query  145  AVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNN  324
             VHARIPGVYSGG WQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFNN
Sbjct  20   TVHARIPGVYSGGQWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNN  79

Query  325  GLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMP  501
            GLSCGACFE+KC+ND + C  G+PSIF+TATNFCPPN+ALP+DNGGWCNPPRPHFDLAMP
Sbjct  80   GLSCGACFELKCANDPQWCHSGSPSIFITATNFCPPNYALPSDNGGWCNPPRPHFDLAMP  139

Query  502  MFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGD  654
            MFLKIA YRAGIVPV++RR+PCRK+GGIRFT+NGFRYFNL+L+TNVAGAGD
Sbjct  140  MFLKIAEYRAGIVPVSYRRVPCRKKGGIRFTINGFRYFNLILITNVAGAGD  190



>ref|XP_006339024.1| PREDICTED: expansin-A3-like [Solanum tuberosum]
Length=257

 Score =   318 bits (814),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 144/187 (77%), Positives = 168/187 (90%), Gaps = 0/187 (0%)
 Frame = +1

Query  94   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  273
            MA   +LCIA LL  LT V +++ GVY+ G WQ+AHATFYGG+DASGTMGGACGYGNLYS
Sbjct  1    MAITWMLCIASLLSFLTTVDSKVRGVYTAGPWQSAHATFYGGSDASGTMGGACGYGNLYS  60

Query  274  QGYGVNNAALSTALFNNGLSCGACFEIKCSNDRSCSPGNPSIFVTATNFCPPNFALPNDN  453
             GYGVNNAALST LFN+GLSCGACFEIKC++++ C+PGNPSIFVT TNFCPPN+ALPNDN
Sbjct  61   TGYGVNNAALSTVLFNSGLSCGACFEIKCTDEKWCNPGNPSIFVTGTNFCPPNYALPNDN  120

Query  454  GGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVT  633
            GGWCNPPRPHFDL+MP+FL+IA YRAGIVPV +RR+PC+KQ GIRFT+NGF YFN+++VT
Sbjct  121  GGWCNPPRPHFDLSMPVFLQIAQYRAGIVPVTYRRVPCKKQEGIRFTINGFNYFNMIIVT  180

Query  634  NVAGAGD  654
            NVAGAGD
Sbjct  181  NVAGAGD  187



>gb|AEN70893.1| expansin [Gossypium schwendimanii]
Length=259

 Score =   318 bits (814),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 151/189 (80%), Positives = 170/189 (90%), Gaps = 2/189 (1%)
 Frame = +1

Query  94   MAAVRVLCIALLLCSLTAV-HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLY  270
            MA V V+ + + + S+  +  ARIPGVYSGGAWQ AHATFYGGADASGTMGGACGYGNLY
Sbjct  1    MAMVNVISVLIFISSIWMMGEARIPGVYSGGAWQNAHATFYGGADASGTMGGACGYGNLY  60

Query  271  SQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPN  447
            SQGYGV+ AALSTALFNNGLSCGACFEIKC +D + C  G+PSIF+TATNFCPPN+ALPN
Sbjct  61   SQGYGVSTAALSTALFNNGLSCGACFEIKCGSDPKWCHSGSPSIFITATNFCPPNYALPN  120

Query  448  DNGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVL  627
            DNGGWCNPPR HFDLAMPMFLKIA YRAGIVPV++RR+PCRK+GGIRFT+NGFRYFNLVL
Sbjct  121  DNGGWCNPPRTHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKRGGIRFTINGFRYFNLVL  180

Query  628  VTNVAGAGD  654
            ++NVAGAGD
Sbjct  181  ISNVAGAGD  189



>gb|KJB73995.1| hypothetical protein B456_011G266000 [Gossypium raimondii]
Length=258

 Score =   318 bits (814),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 152/188 (81%), Positives = 167/188 (89%), Gaps = 1/188 (1%)
 Frame = +1

Query  94   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  273
            MA      +  L+   TAV ARIPGVYSGGAWQ+AHATFYGG DASGTMGGACG+GNLYS
Sbjct  1    MAIKGFTYLVYLIIISTAVEARIPGVYSGGAWQSAHATFYGGNDASGTMGGACGFGNLYS  60

Query  274  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPND  450
            QGYGVN AALSTALFNNG SCGACFEIKC+ND + C  G+PSIF+TATNFCPPN+ALPND
Sbjct  61   QGYGVNTAALSTALFNNGFSCGACFEIKCANDPQWCHSGSPSIFITATNFCPPNYALPND  120

Query  451  NGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLV  630
            NGGWCNPPR HFDLAMPMFLKIA YRAGIVPV++RR+PCRK+GGIRFT+NGFRYFNLVL+
Sbjct  121  NGGWCNPPRSHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKRGGIRFTINGFRYFNLVLI  180

Query  631  TNVAGAGD  654
            TNVAGAGD
Sbjct  181  TNVAGAGD  188



>ref|XP_011089478.1| PREDICTED: expansin-A6 [Sesamum indicum]
Length=260

 Score =   317 bits (813),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 151/184 (82%), Positives = 166/184 (90%), Gaps = 2/184 (1%)
 Frame = +1

Query  109  VLCIALLLCSLTA-VHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYG  285
            ++CIA L+  L     ARIPGVY+GG WQTAHATFYGG+DASGTMGGACGYGNLYSQGYG
Sbjct  7    IVCIASLISVLQPPAEARIPGVYTGGGWQTAHATFYGGSDASGTMGGACGYGNLYSQGYG  66

Query  286  VNNAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALPNDNGGW  462
            VN AALSTALFNNG SCGACFEIKC+ ++  C  G+PSIFVTATNFCPPN+ALPNDNGGW
Sbjct  67   VNTAALSTALFNNGFSCGACFEIKCAMEKQWCHAGSPSIFVTATNFCPPNYALPNDNGGW  126

Query  463  CNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVA  642
            CNPPRPHFDLAMPMFLKIA YRAGIVPV +RR+PCRK+GGIRFT+NGFRYFNLVL+TNVA
Sbjct  127  CNPPRPHFDLAMPMFLKIAEYRAGIVPVTYRRVPCRKKGGIRFTINGFRYFNLVLITNVA  186

Query  643  GAGD  654
            GAGD
Sbjct  187  GAGD  190



>gb|ADY68817.1| expansin [Gossypium raimondii]
Length=259

 Score =   317 bits (813),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 150/189 (79%), Positives = 171/189 (90%), Gaps = 2/189 (1%)
 Frame = +1

Query  94   MAAVRVLCIALLLCSLTAV-HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLY  270
            MA V V+ + + + S+  +  ARIPGVYSGGAWQ AHATFYGGADASGTMGGACGYGNLY
Sbjct  1    MAMVNVISVLIFISSMWMMGEARIPGVYSGGAWQNAHATFYGGADASGTMGGACGYGNLY  60

Query  271  SQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPN  447
            SQGYGV+ AALSTALFNNGLSCGACFEIKC++D + C  G+PSIF+TATNFCPPN+ALPN
Sbjct  61   SQGYGVSTAALSTALFNNGLSCGACFEIKCASDPKWCHSGSPSIFITATNFCPPNYALPN  120

Query  448  DNGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVL  627
            DNGGWCNPPR HFDLAMPMFLKIA YRAGIVPV++RR+PCRK+GGIRFT+NGFRYF+LVL
Sbjct  121  DNGGWCNPPRTHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKRGGIRFTINGFRYFDLVL  180

Query  628  VTNVAGAGD  654
            ++NVAGAGD
Sbjct  181  ISNVAGAGD  189



>emb|CAA59470.1| orf [Pisum sativum]
Length=258

 Score =   317 bits (813),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 152/188 (81%), Positives = 165/188 (88%), Gaps = 1/188 (1%)
 Frame = +1

Query  94   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  273
            MAA+ +L IA L        ARIPGVY+GG W +AHATFYGG+DASGTMGGACGYGNLYS
Sbjct  1    MAAILLLTIASLTSLFAPTTARIPGVYTGGPWTSAHATFYGGSDASGTMGGACGYGNLYS  60

Query  274  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPND  450
            QGYGVN AALSTALFNNGLSCGACFE+KC  D R C+PGNPSI +TATNFCPPNFA P+D
Sbjct  61   QGYGVNTAALSTALFNNGLSCGACFELKCDQDPRWCNPGNPSILITATNFCPPNFAEPSD  120

Query  451  NGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLV  630
            NGGWCNPPRPHFDLAMPMFLKIA YRAGIVPV +RR+PCRK GGIRFT+NGFRYFNLVL+
Sbjct  121  NGGWCNPPRPHFDLAMPMFLKIAQYRAGIVPVAYRRVPCRKAGGIRFTINGFRYFNLVLI  180

Query  631  TNVAGAGD  654
            TNVAGAGD
Sbjct  181  TNVAGAGD  188



>ref|XP_010067412.1| PREDICTED: expansin-A4 [Eucalyptus grandis]
Length=307

 Score =   319 bits (817),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 154/189 (81%), Positives = 170/189 (90%), Gaps = 2/189 (1%)
 Frame = +1

Query  94   MAAV-RVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLY  270
            MA+V RV+ +  L+   T   ARIPGVY+GG WQ+AHATFYGG+DASGTMGGACGYGNLY
Sbjct  49   MASVSRVVGLVSLILFSTLAEARIPGVYTGGPWQSAHATFYGGSDASGTMGGACGYGNLY  108

Query  271  SQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPN  447
            SQGYGVN AALSTALFNNG SCGACFEIKC+N+ + C  G+PSI VTATNFCPPN+ALPN
Sbjct  109  SQGYGVNTAALSTALFNNGFSCGACFEIKCANEPQWCHSGSPSILVTATNFCPPNYALPN  168

Query  448  DNGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVL  627
            DNGGWCNPPRPHFDLAMPMFLKIA YRAGIVPV++RR+PCRKQGGIRFT+NGFRYFNLVL
Sbjct  169  DNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKQGGIRFTINGFRYFNLVL  228

Query  628  VTNVAGAGD  654
            VTNVAGAGD
Sbjct  229  VTNVAGAGD  237



>ref|XP_008223717.1| PREDICTED: expansin-A4 [Prunus mume]
Length=260

 Score =   317 bits (813),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 153/182 (84%), Positives = 168/182 (92%), Gaps = 2/182 (1%)
 Frame = +1

Query  115  CIALLLCSLTAV-HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVN  291
            C+A LL SL  V  ARIPGVYSGGAW+ AHATFYGG+DASGTMGGACGYGNLYSQGYGV+
Sbjct  9    CLASLLISLMWVAEARIPGVYSGGAWEAAHATFYGGSDASGTMGGACGYGNLYSQGYGVS  68

Query  292  NAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALPNDNGGWCN  468
             AALSTALFNNGLSCGACFEIKC+ND + C  G+PSIF+TATNFCPPNFA P+DNGGWCN
Sbjct  69   TAALSTALFNNGLSCGACFEIKCANDPNWCHSGSPSIFITATNFCPPNFAQPSDNGGWCN  128

Query  469  PPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGA  648
            PPRPHFDLAMPMFLKIA YRAGIVPV++RR+PCRK+GGIRFT+NGFRYFNLVLV+NVAGA
Sbjct  129  PPRPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKRGGIRFTINGFRYFNLVLVSNVAGA  188

Query  649  GD  654
            GD
Sbjct  189  GD  190



>ref|XP_007205740.1| hypothetical protein PRUPE_ppa010180mg [Prunus persica]
 dbj|BAC66787.1| expansin [Prunus persica]
 gb|EMJ06939.1| hypothetical protein PRUPE_ppa010180mg [Prunus persica]
Length=260

 Score =   317 bits (813),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 153/182 (84%), Positives = 167/182 (92%), Gaps = 2/182 (1%)
 Frame = +1

Query  115  CIALLLCSLTAV-HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVN  291
            C+A LL SL  V  ARIPGVYSGGAW+ AHATFYGG+DASGTMGGACGYGNLYSQGYGV+
Sbjct  9    CLASLLISLMWVAEARIPGVYSGGAWEAAHATFYGGSDASGTMGGACGYGNLYSQGYGVS  68

Query  292  NAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCN  468
             AALSTALFNNGLSCGACFEIKC+ND   C  G+PSIF+TATNFCPPNFA P+DNGGWCN
Sbjct  69   TAALSTALFNNGLSCGACFEIKCANDPNWCHSGSPSIFITATNFCPPNFAQPSDNGGWCN  128

Query  469  PPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGA  648
            PPRPHFDLAMPMFLKIA YRAGIVPV++RR+PCRK+GGIRFT+NGFRYFNLVLV+NVAGA
Sbjct  129  PPRPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKRGGIRFTINGFRYFNLVLVSNVAGA  188

Query  649  GD  654
            GD
Sbjct  189  GD  190



>ref|XP_009597793.1| PREDICTED: expansin-A6-like [Nicotiana tomentosiformis]
Length=260

 Score =   317 bits (813),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 152/183 (83%), Positives = 166/183 (91%), Gaps = 2/183 (1%)
 Frame = +1

Query  109  VLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGV  288
            + C+  L+  + AV +RIPGVYSGGAWQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGV
Sbjct  9    IACVFSLML-VVAVESRIPGVYSGGAWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGV  67

Query  289  NNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWC  465
            NN ALSTALFNNGLSCGACFEIKC  D + C  G+PSIF+TATNFCPPNFALPNDNGGWC
Sbjct  68   NNGALSTALFNNGLSCGACFEIKCDKDPQWCHSGSPSIFITATNFCPPNFALPNDNGGWC  127

Query  466  NPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAG  645
            NPPR HFDLAMPMFLKIA YRAGIVPV +RR+PCRK+GGIRFT+NGFRYFNLVLVTNVAG
Sbjct  128  NPPRSHFDLAMPMFLKIAEYRAGIVPVVYRRVPCRKKGGIRFTINGFRYFNLVLVTNVAG  187

Query  646  AGD  654
            AGD
Sbjct  188  AGD  190



>gb|KJB55836.1| hypothetical protein B456_009G098800 [Gossypium raimondii]
Length=259

 Score =   317 bits (812),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 151/189 (80%), Positives = 169/189 (89%), Gaps = 2/189 (1%)
 Frame = +1

Query  94   MAAVRVLCIAL-LLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLY  270
            M     +CI + L+ S+    ARIPGVYSGGAWQ AHATFYGG+DASGTMGGACGYGNLY
Sbjct  1    MGIAGAVCIIVGLISSMWMAEARIPGVYSGGAWQNAHATFYGGSDASGTMGGACGYGNLY  60

Query  271  SQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPN  447
            SQGYGVN AALSTALFNNGLSCGACFEIKC++D + C  G+PSIF+TATNFCPPN+ALPN
Sbjct  61   SQGYGVNTAALSTALFNNGLSCGACFEIKCASDPKWCHSGSPSIFITATNFCPPNYALPN  120

Query  448  DNGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVL  627
            DNGGWCNPPR HFDLAMPMFLKIA YRAGIVPV++RR+PCRK+GGIRFT+NGFRYFNLVL
Sbjct  121  DNGGWCNPPRSHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKRGGIRFTINGFRYFNLVL  180

Query  628  VTNVAGAGD  654
            ++NVAGAGD
Sbjct  181  ISNVAGAGD  189



>ref|XP_010685747.1| PREDICTED: expansin-A4 [Beta vulgaris subsp. vulgaris]
Length=261

 Score =   317 bits (813),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 150/190 (79%), Positives = 168/190 (88%), Gaps = 1/190 (1%)
 Frame = +1

Query  88   GKMAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNL  267
            G  +   ++ +  L  + T V ARIPG Y GG+WQ+AHATFYGG+DASGTMGGACGYGNL
Sbjct  2    GMFSIFNIVSLMTLWVTSTLVDARIPGNYQGGSWQSAHATFYGGSDASGTMGGACGYGNL  61

Query  268  YSQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALP  444
            YSQGYGVN AALSTALFN+GLSCGACFE+KC+ND R C PG+PSI +TATNFCPPNFALP
Sbjct  62   YSQGYGVNTAALSTALFNSGLSCGACFELKCANDPRWCHPGSPSILITATNFCPPNFALP  121

Query  445  NDNGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLV  624
            NDNGGWCNPPRPHFDLAMPMFLK+A YRAGIVPV FRR+PCRK+GGIRFT+NGFRYFNLV
Sbjct  122  NDNGGWCNPPRPHFDLAMPMFLKLAQYRAGIVPVAFRRVPCRKRGGIRFTMNGFRYFNLV  181

Query  625  LVTNVAGAGD  654
            LV+NVAGAGD
Sbjct  182  LVSNVAGAGD  191



>gb|AAM22626.1|AF428179_1 expansin 12 precursor [Rumex palustris]
Length=258

 Score =   317 bits (812),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 152/188 (81%), Positives = 167/188 (89%), Gaps = 1/188 (1%)
 Frame = +1

Query  94   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  273
            MAA+  L   + + S  +  ARIPGVYSGG W+TAHATFYGG+DASGTMGGACG+GNLYS
Sbjct  1    MAALSALLCIVSVLSFYSADARIPGVYSGGGWETAHATFYGGSDASGTMGGACGFGNLYS  60

Query  274  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPND  450
            QGYGVN AALSTALFNNGLSCGACFEIKC++D R C PG+PSI +TATNFCPPNFA P+D
Sbjct  61   QGYGVNTAALSTALFNNGLSCGACFEIKCADDPRWCHPGSPSILITATNFCPPNFAEPSD  120

Query  451  NGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLV  630
            NGGWCNPPRPHFDLAMPMFLK A YRAGIVPV FRR+PCRK+GGIRFTVNGFRYFNLVL+
Sbjct  121  NGGWCNPPRPHFDLAMPMFLKFAEYRAGIVPVAFRRVPCRKRGGIRFTVNGFRYFNLVLI  180

Query  631  TNVAGAGD  654
            TNVAGAGD
Sbjct  181  TNVAGAGD  188



>ref|XP_007141864.1| hypothetical protein PHAVU_008G232200g [Phaseolus vulgaris]
 gb|ESW13858.1| hypothetical protein PHAVU_008G232200g [Phaseolus vulgaris]
Length=260

 Score =   317 bits (812),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 148/180 (82%), Positives = 166/180 (92%), Gaps = 1/180 (1%)
 Frame = +1

Query  118  IALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNA  297
            ++L+   L +  ARIPGVY GGAW+TAHATFYGG+DASGTMGGACGYGNLYSQGYGVN A
Sbjct  11   VSLVTVLLASAEARIPGVYGGGAWETAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTA  70

Query  298  ALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALPNDNGGWCNPP  474
            ALSTALFN+GLSCGACFEIKC++D S C  G+PSI VTATNFCPPN+ALP+DNGGWCNPP
Sbjct  71   ALSTALFNSGLSCGACFEIKCADDPSWCHAGSPSILVTATNFCPPNYALPSDNGGWCNPP  130

Query  475  RPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGD  654
            RPHFDLAMPMFLKIA YRAGIVPV++RR+PCRKQGG+RFT+NGFRYFNLVL+TNVAGAGD
Sbjct  131  RPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKQGGMRFTINGFRYFNLVLITNVAGAGD  190



>gb|AAT11859.2| expansin 1 [Mangifera indica]
Length=260

 Score =   317 bits (812),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 147/188 (78%), Positives = 169/188 (90%), Gaps = 1/188 (1%)
 Frame = +1

Query  94   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  273
            M  + + CI  L C +  V ARIPGVY+GGAWQ+AHATFYGG+DASGTMGGACGYGNLYS
Sbjct  3    MVGLSMACILSLRCLMWMVEARIPGVYTGGAWQSAHATFYGGSDASGTMGGACGYGNLYS  62

Query  274  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPND  450
            QGYGVN AALSTALFNNG SCGACFEIKC++D + C  G+PSIF+TATNFCPPN+ALP+D
Sbjct  63   QGYGVNTAALSTALFNNGFSCGACFEIKCASDPKWCHSGSPSIFITATNFCPPNYALPSD  122

Query  451  NGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLV  630
            NGGWCNPPRPHFDLAMPMFLKIA YRAGIVPV++RR+PCR++GGIRFT+NGFRYFNLVL+
Sbjct  123  NGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRERGGIRFTINGFRYFNLVLI  182

Query  631  TNVAGAGD  654
             +VAG+GD
Sbjct  183  ADVAGSGD  190



>gb|AAM22624.1|AF428177_1 expansin 10 precursor [Rumex palustris]
Length=258

 Score =   317 bits (812),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 152/188 (81%), Positives = 167/188 (89%), Gaps = 1/188 (1%)
 Frame = +1

Query  94   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  273
            MAA+  L   + + S  +  ARIPGVYSGG W+TAHATFYGG+DASGTMGGACG+GNLYS
Sbjct  1    MAALSALLCIVSVLSFYSADARIPGVYSGGGWETAHATFYGGSDASGTMGGACGFGNLYS  60

Query  274  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPND  450
            QGYGVN AALSTALFNNG+SCGACFEIKC++D R C PGNPSI +TATNFCPPNFA P+D
Sbjct  61   QGYGVNTAALSTALFNNGMSCGACFEIKCADDPRWCHPGNPSILITATNFCPPNFAEPSD  120

Query  451  NGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLV  630
            NGGWCNPP PHFDLAMPMFLKIA YRAGIVPV FRR+PCRK+GGIRFTVNGFRYFNLVL+
Sbjct  121  NGGWCNPPLPHFDLAMPMFLKIAEYRAGIVPVAFRRVPCRKRGGIRFTVNGFRYFNLVLI  180

Query  631  TNVAGAGD  654
            TNVAGAGD
Sbjct  181  TNVAGAGD  188



>ref|NP_001234881.1| expansin9 precursor [Solanum lycopersicum]
 emb|CAB46492.1| expansin9 [Solanum lycopersicum]
Length=257

 Score =   317 bits (812),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 149/180 (83%), Positives = 162/180 (90%), Gaps = 1/180 (1%)
 Frame = +1

Query  118  IALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNA  297
            + ++L  L  V  RIPGVYSGG+WQ AHATFYGG+DASGTMGGACGYGNLYSQGYGVNNA
Sbjct  8    LIIILVILVGVEGRIPGVYSGGSWQNAHATFYGGSDASGTMGGACGYGNLYSQGYGVNNA  67

Query  298  ALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPP  474
            ALSTALFNNGLSCGACFEIKC N  + C PG+PSI +TATNFCPPN+ALPNDNGGWCNPP
Sbjct  68   ALSTALFNNGLSCGACFEIKCDNQPQWCHPGSPSILITATNFCPPNYALPNDNGGWCNPP  127

Query  475  RPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGD  654
            R HFDLAMPMFLKIA YRAGIVPV +RR+PCRKQGGIRFT+NGF YFNL+LVTNVAGAGD
Sbjct  128  RTHFDLAMPMFLKIAEYRAGIVPVVYRRVPCRKQGGIRFTINGFSYFNLILVTNVAGAGD  187



>emb|CDY31742.1| BnaA04g16780D [Brassica napus]
Length=260

 Score =   317 bits (812),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 150/184 (82%), Positives = 167/184 (91%), Gaps = 2/184 (1%)
 Frame = +1

Query  109  VLCIALLLCSLTAV-HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYG  285
            VLC+  +L   T +  ARIPGVYSGG W+TAHATFYGG+DASGTMGGACGYGNLYSQGYG
Sbjct  7    VLCVLTILADFTTISEARIPGVYSGGGWETAHATFYGGSDASGTMGGACGYGNLYSQGYG  66

Query  286  VNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGW  462
            VN AALSTALFNNG SCGACFE+KC++D + C  G+PSIFVTATNFCPPNFA P+DNGGW
Sbjct  67   VNTAALSTALFNNGFSCGACFELKCASDPKWCHSGSPSIFVTATNFCPPNFAQPSDNGGW  126

Query  463  CNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVA  642
            CNPPRPHFDLAMPMFLKIA YRAGIVPV+FRR+PCRK+GG+RFT+NGFRYFNLVLVTNVA
Sbjct  127  CNPPRPHFDLAMPMFLKIAEYRAGIVPVSFRRVPCRKRGGMRFTINGFRYFNLVLVTNVA  186

Query  643  GAGD  654
            GAG+
Sbjct  187  GAGN  190



>ref|NP_001288899.1| expansin-A6 precursor [Brassica rapa]
 gb|AGM16348.1| alpha-expansin protein 6 [Brassica rapa]
Length=260

 Score =   317 bits (812),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 150/184 (82%), Positives = 167/184 (91%), Gaps = 2/184 (1%)
 Frame = +1

Query  109  VLCIALLLCSLTAV-HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYG  285
            VLC+  +L   T +  ARIPGVYSGG W+TAHATFYGG+DASGTMGGACGYGNLYSQGYG
Sbjct  7    VLCVLTILADFTTISEARIPGVYSGGGWETAHATFYGGSDASGTMGGACGYGNLYSQGYG  66

Query  286  VNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGW  462
            VN AALSTALFNNG SCGACFE+KC++D + C  G+PSIFVTATNFCPPNFA P+DNGGW
Sbjct  67   VNTAALSTALFNNGFSCGACFELKCASDPKWCHSGSPSIFVTATNFCPPNFAQPSDNGGW  126

Query  463  CNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVA  642
            CNPPRPHFDLAMPMFLKIA YRAGIVPV+FRR+PCRK+GG+RFT+NGFRYFNLVLVTNVA
Sbjct  127  CNPPRPHFDLAMPMFLKIAEYRAGIVPVSFRRVPCRKRGGMRFTINGFRYFNLVLVTNVA  186

Query  643  GAGD  654
            GAG+
Sbjct  187  GAGN  190



>gb|AHL25255.1| expansin [Boehmeria nivea]
Length=260

 Score =   317 bits (811),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 148/187 (79%), Positives = 170/187 (91%), Gaps = 3/187 (2%)
 Frame = +1

Query  97   AAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQ  276
            AA ++ C+  L+    A  ARIPGVYSGG+WQTAHATFYGG+DASGTMGGACGYGNLYSQ
Sbjct  6    AAWKIACLVSLMT--LATEARIPGVYSGGSWQTAHATFYGGSDASGTMGGACGYGNLYSQ  63

Query  277  GYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDN  453
            GYGVN AALSTALFN+GLSCGACFE+KC+ND +SC  G+PSI VTATNFCPPN+ALPND+
Sbjct  64   GYGVNTAALSTALFNSGLSCGACFELKCANDPKSCHSGSPSIIVTATNFCPPNYALPNDH  123

Query  454  GGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVT  633
            GGWCNPPRPHFDLAMPMFLKIA YRAGIVPV+FRR+PCRK+GG+RFT+NG RYFNL+L++
Sbjct  124  GGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSFRRVPCRKRGGVRFTINGHRYFNLILIS  183

Query  634  NVAGAGD  654
            NVAG+GD
Sbjct  184  NVAGSGD  190



>gb|ACO07292.1| expansin 10 [Cucumis sativus]
Length=259

 Score =   317 bits (811),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 150/169 (89%), Positives = 159/169 (94%), Gaps = 1/169 (1%)
 Frame = +1

Query  151  HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGL  330
            HARIPGVYSGG WQ AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFNNGL
Sbjct  21   HARIPGVYSGGPWQDAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGL  80

Query  331  SCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMF  507
            SCGACFEIKC+ND R C PG+PSIF+TATNFCPPNFALPNDNGGWC PPR HFD AMPMF
Sbjct  81   SCGACFEIKCANDPRWCHPGSPSIFITATNFCPPNFALPNDNGGWCTPPRTHFDFAMPMF  140

Query  508  LKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGD  654
            LKIA YRAGIVPV++RR+PCRKQGGIRFT+NGFRYFNLVL+TNVAGAGD
Sbjct  141  LKIAEYRAGIVPVSYRRVPCRKQGGIRFTINGFRYFNLVLITNVAGAGD  189



>ref|XP_009613959.1| PREDICTED: expansin-A6-like [Nicotiana tomentosiformis]
Length=260

 Score =   317 bits (811),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 150/170 (88%), Positives = 160/170 (94%), Gaps = 1/170 (1%)
 Frame = +1

Query  148  VHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNG  327
            V ARIPGVY+GG+WQTAHATFYGG+DASGTMGGACGYGNLYSQGYGVNNAALSTALFNNG
Sbjct  21   VEARIPGVYTGGSWQTAHATFYGGSDASGTMGGACGYGNLYSQGYGVNNAALSTALFNNG  80

Query  328  LSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPM  504
            LSCGACFEIKC N  + C  G+PSI +TATNFCPPN+ALPNDNGGWCNPPRPHFDLAMPM
Sbjct  81   LSCGACFEIKCDNQPQWCHAGSPSILITATNFCPPNYALPNDNGGWCNPPRPHFDLAMPM  140

Query  505  FLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGD  654
            FLKIA YRAGIVPV +RR+PCRKQGGIRFT+NGFRYFNLVLVTNVAGAGD
Sbjct  141  FLKIAEYRAGIVPVVYRRVPCRKQGGIRFTINGFRYFNLVLVTNVAGAGD  190



>gb|ADY68818.1| expansin [Gossypium hirsutum]
Length=259

 Score =   317 bits (811),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 150/189 (79%), Positives = 170/189 (90%), Gaps = 2/189 (1%)
 Frame = +1

Query  94   MAAVRVLCIALLLCSLTAV-HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLY  270
            MA V V+ + + + S+  +  ARIPGVYSGGAWQ AHATFYGGADASGTMGGACGYGNLY
Sbjct  1    MAMVNVISVLIFISSMWMMGEARIPGVYSGGAWQNAHATFYGGADASGTMGGACGYGNLY  60

Query  271  SQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPN  447
             QGYGV+ AALSTALFNNGLSCGACFEIKC++D + C  G+PSIF+TATNFCPPN+ALPN
Sbjct  61   GQGYGVSTAALSTALFNNGLSCGACFEIKCASDPKWCHSGSPSIFITATNFCPPNYALPN  120

Query  448  DNGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVL  627
            DNGGWCNPPR HFDLAMPMFLKIA YRAGIVPV++RR+PCRK+GGIRFT+NGFRYFNLVL
Sbjct  121  DNGGWCNPPRTHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKRGGIRFTINGFRYFNLVL  180

Query  628  VTNVAGAGD  654
            ++NVAGAGD
Sbjct  181  ISNVAGAGD  189



>ref|XP_009589397.1| PREDICTED: expansin-A4-like [Nicotiana tomentosiformis]
Length=261

 Score =   317 bits (811),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 153/191 (80%), Positives = 170/191 (89%), Gaps = 4/191 (2%)
 Frame = +1

Query  94   MAAVRVLC-IALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLY  270
            MA++ V+  I  L+  ++ V ARIPGVYSGG+WQTAHATFYGG+DASGTMGGACGYGNLY
Sbjct  1    MASMGVITSIIGLIFLVSLVEARIPGVYSGGSWQTAHATFYGGSDASGTMGGACGYGNLY  60

Query  271  SQGYGVNNAALSTALFNNGLSCGACFEIKCSND---RSCSPGNPSIFVTATNFCPPNFAL  441
            SQGYGVN AALSTALFNNGLSCGACFEIKC+ND   + C PG+PSI +TATNFCPPN+A 
Sbjct  61   SQGYGVNTAALSTALFNNGLSCGACFEIKCTNDPNWKWCLPGSPSILITATNFCPPNYAK  120

Query  442  PNDNGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNL  621
            PNDNGGWCNPPR HFDLAMPMFL IA YRAGIVPV +RRIPCRK+GGIRFT+NGFRYFNL
Sbjct  121  PNDNGGWCNPPRSHFDLAMPMFLNIAQYRAGIVPVTYRRIPCRKRGGIRFTINGFRYFNL  180

Query  622  VLVTNVAGAGD  654
            VL+TNVAGAGD
Sbjct  181  VLITNVAGAGD  191



>ref|XP_007133996.1| hypothetical protein PHAVU_010G010200g [Phaseolus vulgaris]
 gb|ESW05990.1| hypothetical protein PHAVU_010G010200g [Phaseolus vulgaris]
Length=258

 Score =   316 bits (810),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 151/188 (80%), Positives = 165/188 (88%), Gaps = 1/188 (1%)
 Frame = +1

Query  94   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  273
            MA +  LCIA  +    A +ARIPGVY+GGAWQ AHATFYGG+DASGTMGGACGYGNLYS
Sbjct  1    MAEMLSLCIASFVTLFVATNARIPGVYTGGAWQGAHATFYGGSDASGTMGGACGYGNLYS  60

Query  274  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPND  450
            QGYGVN AALSTALFNNGLSCGACFEIKC  D R C+PG PSI +TATNFCPPN ALP+D
Sbjct  61   QGYGVNTAALSTALFNNGLSCGACFEIKCDQDPRWCNPGRPSIIITATNFCPPNLALPSD  120

Query  451  NGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLV  630
            NGGWCNPPRPHFDLAMPMFLKIA YRAGIVPV++RR+ CRK GGIRF +NGFRYFNLVL+
Sbjct  121  NGGWCNPPRPHFDLAMPMFLKIAQYRAGIVPVSYRRVACRKAGGIRFMINGFRYFNLVLI  180

Query  631  TNVAGAGD  654
            +NVAGAGD
Sbjct  181  SNVAGAGD  188



>ref|NP_001233958.1| expansin precursor [Solanum lycopersicum]
 gb|AAC63088.1| expansin [Solanum lycopersicum]
 gb|AAQ12264.1| expansin 1 protein [Solanum lycopersicum]
Length=261

 Score =   317 bits (811),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 149/187 (80%), Positives = 165/187 (88%), Gaps = 3/187 (2%)
 Frame = +1

Query  103  VRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGY  282
            + +L +  +      V  RIPGVYSGG+W+TAHATFYGG+DASGTMGGACGYGNLYSQGY
Sbjct  5    IFILVLLFVDSCFNIVEGRIPGVYSGGSWETAHATFYGGSDASGTMGGACGYGNLYSQGY  64

Query  283  GVNNAALSTALFNNGLSCGACFEIKCSND---RSCSPGNPSIFVTATNFCPPNFALPNDN  453
            GVN AALSTALFNNGLSCGACFE+KC+N    + C PGNPSI +TATNFCPPN+ALPNDN
Sbjct  65   GVNTAALSTALFNNGLSCGACFELKCTNTPNWKWCLPGNPSILITATNFCPPNYALPNDN  124

Query  454  GGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVT  633
            GGWCNPPRPHFDLAMPMFLK+A YRAGIVPV +RRIPCRKQGGIRFT+NGFRYFNLVL+T
Sbjct  125  GGWCNPPRPHFDLAMPMFLKLAQYRAGIVPVTYRRIPCRKQGGIRFTINGFRYFNLVLIT  184

Query  634  NVAGAGD  654
            NVAGAGD
Sbjct  185  NVAGAGD  191



>ref|XP_009353647.1| PREDICTED: expansin-A6-like [Pyrus x bretschneideri]
 ref|XP_009349875.1| PREDICTED: expansin-A6-like [Pyrus x bretschneideri]
Length=260

 Score =   317 bits (811),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 155/190 (82%), Positives = 170/190 (89%), Gaps = 3/190 (2%)
 Frame = +1

Query  94   MAAVRV-LCIALLLCSLTAV-HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNL  267
            M  V V  CIA L+ SL  V  ARIPGVY+GGAWQ AHATFYGG+DASGTMGGACGYGNL
Sbjct  1    MGVVSVSTCIASLIISLMWVAEARIPGVYTGGAWQGAHATFYGGSDASGTMGGACGYGNL  60

Query  268  YSQGYGVNNAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALP  444
            YSQGYGVN AALSTALFNNGLSCGACFE+KC++D S C  G PSIF+TATNFCPPNFA P
Sbjct  61   YSQGYGVNTAALSTALFNNGLSCGACFELKCADDPSWCHAGGPSIFITATNFCPPNFAQP  120

Query  445  NDNGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLV  624
            +DNGGWCNPPRPHFDLAMPMFLKIA YRAGIVPV++RR+PCRK+GGIRFT+NGFRYFNLV
Sbjct  121  SDNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKRGGIRFTINGFRYFNLV  180

Query  625  LVTNVAGAGD  654
            L++NVAGAGD
Sbjct  181  LISNVAGAGD  190



>ref|XP_009349313.1| PREDICTED: expansin-A6-like [Pyrus x bretschneideri]
Length=260

 Score =   316 bits (810),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 155/190 (82%), Positives = 170/190 (89%), Gaps = 3/190 (2%)
 Frame = +1

Query  94   MAAVRV-LCIALLLCSLTAV-HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNL  267
            M  V V  CIA L+ SL  V  ARIPGVY+GGAWQ AHATFYGG+DASGTMGGACGYGNL
Sbjct  1    MGVVSVSTCIASLIISLMWVAEARIPGVYTGGAWQGAHATFYGGSDASGTMGGACGYGNL  60

Query  268  YSQGYGVNNAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALP  444
            YSQGYGVN AALSTALFNNGLSCGACFE+KC++D S C  G PSIF+TATNFCPPNFA P
Sbjct  61   YSQGYGVNTAALSTALFNNGLSCGACFELKCADDPSWCHAGGPSIFITATNFCPPNFAQP  120

Query  445  NDNGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLV  624
            +DNGGWCNPPRPHFDLAMPMFLKIA YRAGIVPV++RR+PCRK+GGIRFT+NGFRYFNLV
Sbjct  121  SDNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKRGGIRFTINGFRYFNLV  180

Query  625  LVTNVAGAGD  654
            L++NVAGAGD
Sbjct  181  LISNVAGAGD  190



>ref|XP_006409928.1| hypothetical protein EUTSA_v10017116mg [Eutrema salsugineum]
 gb|ESQ51381.1| hypothetical protein EUTSA_v10017116mg [Eutrema salsugineum]
Length=260

 Score =   316 bits (810),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 149/184 (81%), Positives = 170/184 (92%), Gaps = 2/184 (1%)
 Frame = +1

Query  109  VLCIALLLCSLTAVH-ARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYG  285
            VLC+  +L  LTA++ ARIPGVY+GG W++AHATFYGG+DASGTMGGACGYGNLYSQGYG
Sbjct  7    VLCVLTILADLTAIYEARIPGVYNGGGWESAHATFYGGSDASGTMGGACGYGNLYSQGYG  66

Query  286  VNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGW  462
            VN AALSTALFNNG SCGACFE+KC++D + C  G+PSIF+TATNFCPPNFA P+DNGGW
Sbjct  67   VNTAALSTALFNNGFSCGACFELKCASDPKWCHSGSPSIFITATNFCPPNFAQPSDNGGW  126

Query  463  CNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVA  642
            CNPPRPHFDLAMPMFLKIA YRAGIVPV+FRR+PCRK+GG+RFT+NGFRYFNLVLVTNVA
Sbjct  127  CNPPRPHFDLAMPMFLKIAEYRAGIVPVSFRRVPCRKRGGMRFTINGFRYFNLVLVTNVA  186

Query  643  GAGD  654
            GAG+
Sbjct  187  GAGN  190



>ref|XP_010521846.1| PREDICTED: expansin-A6 [Tarenaya hassleriana]
Length=259

 Score =   316 bits (810),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 151/189 (80%), Positives = 169/189 (89%), Gaps = 2/189 (1%)
 Frame = +1

Query  94   MAAVRVLCIALLLCSLTAV-HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLY  270
            MA + ++ +  +L SLT +  ARIPGVY GGAWQ AHATFYGG+DASGTMGGACGYGNLY
Sbjct  1    MAMISLVFVLTILVSLTLMSEARIPGVYGGGAWQNAHATFYGGSDASGTMGGACGYGNLY  60

Query  271  SQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPN  447
            SQGYGVN AALSTALFNNG  CGACFEIKC++D + C  G+PSIF+TATNFCPPN+ALP+
Sbjct  61   SQGYGVNTAALSTALFNNGFRCGACFEIKCASDPKWCHSGSPSIFITATNFCPPNYALPS  120

Query  448  DNGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVL  627
            DNGGWCNPPRPHFDLAMPMFLKIA YRAGIVPV +RR+PCRK+GGIRFT+NGFRYFNLVL
Sbjct  121  DNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVAYRRVPCRKRGGIRFTINGFRYFNLVL  180

Query  628  VTNVAGAGD  654
            VTNVAGAGD
Sbjct  181  VTNVAGAGD  189



>gb|AEN70900.1| expansin [Gossypium tomentosum]
Length=259

 Score =   316 bits (810),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 150/189 (79%), Positives = 169/189 (89%), Gaps = 2/189 (1%)
 Frame = +1

Query  94   MAAVRVLCIALLLCSLTAV-HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLY  270
            MA V V+ + + + S+  +  ARIPGVYSGGAWQ AHAT YGGADASGTMGGACGYGNLY
Sbjct  1    MAMVNVISVLIFISSMWMMGEARIPGVYSGGAWQNAHATLYGGADASGTMGGACGYGNLY  60

Query  271  SQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPN  447
            SQGYGV+ AALSTALFNNGLSCGACFEIKC +D + C  G+PSIF+TATNFCPPN+ALPN
Sbjct  61   SQGYGVSTAALSTALFNNGLSCGACFEIKCGSDPKWCHSGSPSIFITATNFCPPNYALPN  120

Query  448  DNGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVL  627
            DNGGWCNPPR HFDLAMPMFLKIA YRAGIVPV++RR+PCRK+GGIRFT+NGFRYFNLVL
Sbjct  121  DNGGWCNPPRTHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKRGGIRFTINGFRYFNLVL  180

Query  628  VTNVAGAGD  654
            ++NVAGAGD
Sbjct  181  ISNVAGAGD  189



>emb|CDX77222.1| BnaC04g40170D [Brassica napus]
Length=260

 Score =   316 bits (809),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 150/184 (82%), Positives = 167/184 (91%), Gaps = 2/184 (1%)
 Frame = +1

Query  109  VLCIALLLCSLTAV-HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYG  285
            VLC+  +L   T +  ARIPGVYSGG W+TAHATFYGG+DASGTMGGACGYGNLYSQGYG
Sbjct  7    VLCLLTILADFTTISEARIPGVYSGGGWETAHATFYGGSDASGTMGGACGYGNLYSQGYG  66

Query  286  VNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGW  462
            VN AALSTALFNNG SCGACFE+KC++D + C  G+PSIFVTATNFCPPNFA P+DNGGW
Sbjct  67   VNTAALSTALFNNGFSCGACFELKCASDPKWCHSGSPSIFVTATNFCPPNFAQPSDNGGW  126

Query  463  CNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVA  642
            CNPPRPHFDLAMPMFLKIA YRAGIVPV+FRR+PCRK+GG+RFT+NGFRYFNLVLVTNVA
Sbjct  127  CNPPRPHFDLAMPMFLKIAEYRAGIVPVSFRRVPCRKRGGMRFTINGFRYFNLVLVTNVA  186

Query  643  GAGD  654
            GAG+
Sbjct  187  GAGN  190



>gb|AEN70895.1| expansin [Gossypium mustelinum]
Length=259

 Score =   316 bits (809),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 150/189 (79%), Positives = 170/189 (90%), Gaps = 2/189 (1%)
 Frame = +1

Query  94   MAAVRVLCIALLLCSLTAV-HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLY  270
            MA V V+ + + + S+  +  ARIPGVYSGGAWQ AHATFYGGADASGTMGGACGYGNLY
Sbjct  1    MAMVNVISVLIFISSMWMMGEARIPGVYSGGAWQNAHATFYGGADASGTMGGACGYGNLY  60

Query  271  SQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPN  447
            SQGYGV+ AALSTALFNNGLSCGACFEIKC++D + C  G+PSIF+TATNFCPPN+ALPN
Sbjct  61   SQGYGVSTAALSTALFNNGLSCGACFEIKCASDPKWCHSGSPSIFITATNFCPPNYALPN  120

Query  448  DNGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVL  627
            DNGGWCNPPR  FDLAMPMFLKIA YRAGIVPV++RR+PCRK+GGIRFT+NGFRYFNLVL
Sbjct  121  DNGGWCNPPRTRFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKRGGIRFTINGFRYFNLVL  180

Query  628  VTNVAGAGD  654
            ++NVAGAGD
Sbjct  181  ISNVAGAGD  189



>ref|XP_003547326.1| PREDICTED: expansin-A4-like [Glycine max]
Length=256

 Score =   315 bits (808),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 150/183 (82%), Positives = 166/183 (91%), Gaps = 4/183 (2%)
 Frame = +1

Query  109  VLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGV  288
            VLC   L+  +  V ARIPGVY+GGAWQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGV
Sbjct  7    VLC---LMSLMWMVEARIPGVYTGGAWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGV  63

Query  289  NNAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALPNDNGGWC  465
            N AALSTALFN+GLSCGACFEIKC+ND+  C  G+PSIF+TATNFCPPN+ALPNDNGGWC
Sbjct  64   NTAALSTALFNSGLSCGACFEIKCANDKQWCHSGSPSIFITATNFCPPNYALPNDNGGWC  123

Query  466  NPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAG  645
            NPPRPHFDLAMPMFLKIA YRAGIVPV +RR+ CRK GGIRFT+NGFRYFNLVL++NVAG
Sbjct  124  NPPRPHFDLAMPMFLKIAEYRAGIVPVAYRRVACRKHGGIRFTINGFRYFNLVLISNVAG  183

Query  646  AGD  654
            AGD
Sbjct  184  AGD  186



>gb|KHG20113.1| Expansin-A4 -like protein [Gossypium arboreum]
Length=259

 Score =   315 bits (808),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 150/189 (79%), Positives = 168/189 (89%), Gaps = 2/189 (1%)
 Frame = +1

Query  94   MAAVRVLCIAL-LLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLY  270
            M     +CI +  + S+    ARIPGVYSGGAWQ AHATFYGG+DASGTMGGACGYGNLY
Sbjct  1    MGIAGAVCIIVGFISSMWMAEARIPGVYSGGAWQNAHATFYGGSDASGTMGGACGYGNLY  60

Query  271  SQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPN  447
            SQGYGVN AALSTALFNNGLSCGACFEIKC++D + C  G+PSIF+TATNFCPPN+ALPN
Sbjct  61   SQGYGVNTAALSTALFNNGLSCGACFEIKCASDPKWCHSGSPSIFITATNFCPPNYALPN  120

Query  448  DNGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVL  627
            DNGGWCNPPR HFDLAMPMFLKIA YRAGIVPV++RR+PCRK+GGIRFT+NGFRYFNLVL
Sbjct  121  DNGGWCNPPRSHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKRGGIRFTINGFRYFNLVL  180

Query  628  VTNVAGAGD  654
            ++NVAGAGD
Sbjct  181  ISNVAGAGD  189



>ref|XP_008457477.1| PREDICTED: expansin-A4-like [Cucumis melo]
Length=259

 Score =   315 bits (808),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 150/183 (82%), Positives = 166/183 (91%), Gaps = 1/183 (1%)
 Frame = +1

Query  109  VLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGV  288
            +LCIA L+ ++    ARIPGVYSGG W++AHATFYGG+DASGTMGGACGYGNLYSQGYGV
Sbjct  7    LLCIASLISTMWPATARIPGVYSGGPWESAHATFYGGSDASGTMGGACGYGNLYSQGYGV  66

Query  289  NNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWC  465
            N AALSTALFNNGLSCGACFEIKC+ND R C  G+PSI +TATNFCPPNFALP+DNGGWC
Sbjct  67   NTAALSTALFNNGLSCGACFEIKCANDPRWCHSGSPSIVITATNFCPPNFALPSDNGGWC  126

Query  466  NPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAG  645
            NPPRPHFDLAMPMFLKIA YRAGIVPV +RR+ CRK GGIRFT++GFRYFNLVL+TNVAG
Sbjct  127  NPPRPHFDLAMPMFLKIAEYRAGIVPVAYRRVACRKPGGIRFTIHGFRYFNLVLITNVAG  186

Query  646  AGD  654
            AGD
Sbjct  187  AGD  189



>gb|AEU08407.1| expansin 2 [Prunus salicina]
Length=260

 Score =   315 bits (808),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 152/182 (84%), Positives = 167/182 (92%), Gaps = 2/182 (1%)
 Frame = +1

Query  115  CIALLLCSLTAV-HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVN  291
            C+A LL SL  V  ARIPGVYSGGAW+ AHATFYGG+DASGTMGGACGYGNLYSQGYGV+
Sbjct  9    CLASLLISLMWVAEARIPGVYSGGAWEAAHATFYGGSDASGTMGGACGYGNLYSQGYGVS  68

Query  292  NAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCN  468
             AALSTALFNNGLSCGACFEIKC+ND   C  G+PSIF+TATNFCPPNFA P+D+GGWCN
Sbjct  69   TAALSTALFNNGLSCGACFEIKCANDPNWCHSGSPSIFITATNFCPPNFAQPSDDGGWCN  128

Query  469  PPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGA  648
            PPRPHFDLAMPMFLKIA YRAGIVPV++RR+PCRK+GGIRFT+NGFRYFNLVLV+NVAGA
Sbjct  129  PPRPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKRGGIRFTINGFRYFNLVLVSNVAGA  188

Query  649  GD  654
            GD
Sbjct  189  GD  190



>ref|XP_003543517.1| PREDICTED: expansin-A4 [Glycine max]
Length=257

 Score =   315 bits (808),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 151/181 (83%), Positives = 165/181 (91%), Gaps = 4/181 (2%)
 Frame = +1

Query  124  LLLCSLT---AVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNN  294
            +LLC ++    V ARIPGVYSGGAWQ AHATFYGG+DASGTMGGACGYGNLYSQGYGVN 
Sbjct  7    VLLCLMSLMWMVDARIPGVYSGGAWQNAHATFYGGSDASGTMGGACGYGNLYSQGYGVNT  66

Query  295  AALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALPNDNGGWCNP  471
            AALSTALFN+GLSCGACFEIKC+ND+  C  G+PSIF+TATNFCPPN+ALPNDNGGWCNP
Sbjct  67   AALSTALFNSGLSCGACFEIKCANDKQWCHSGSPSIFITATNFCPPNYALPNDNGGWCNP  126

Query  472  PRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAG  651
            PRPHFDLAMPMFLKIA YRAGIVPV FRR+ CRK GGIRFT+NGFRYFNLVL++NVAGAG
Sbjct  127  PRPHFDLAMPMFLKIAEYRAGIVPVAFRRVACRKHGGIRFTINGFRYFNLVLISNVAGAG  186

Query  652  D  654
            D
Sbjct  187  D  187



>dbj|BAH36862.1| alpha expansin [Rosa hybrid cultivar]
Length=258

 Score =   315 bits (808),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 150/188 (80%), Positives = 168/188 (89%), Gaps = 1/188 (1%)
 Frame = +1

Query  94   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  273
            MA++ +LCIA L   L   +ARIPG Y+GG WQ AHATFYGG+DASGTMGGACGYGNLYS
Sbjct  1    MASLHLLCIASLASLLILANARIPGPYTGGPWQDAHATFYGGSDASGTMGGACGYGNLYS  60

Query  274  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPND  450
            QGYGVN AALSTALFNNGLSCGACFEI+C +D R C+PG PSIFVTATNFCPPNFA P+D
Sbjct  61   QGYGVNTAALSTALFNNGLSCGACFEIRCGDDPRWCTPGKPSIFVTATNFCPPNFAQPSD  120

Query  451  NGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLV  630
            NGGWCNPPR HFDLAMPMFLKIA Y+AGIVPV++RR+PCRK+GGIRFT+NG +YFNLVL+
Sbjct  121  NGGWCNPPRTHFDLAMPMFLKIAEYKAGIVPVSYRRVPCRKRGGIRFTINGHKYFNLVLI  180

Query  631  TNVAGAGD  654
            TNVAGAGD
Sbjct  181  TNVAGAGD  188



>gb|ABO30976.2| alpha expansin protein 1 [Calotropis procera]
Length=260

 Score =   315 bits (808),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 154/190 (81%), Positives = 169/190 (89%), Gaps = 3/190 (2%)
 Frame = +1

Query  94   MAAVRVLCIALLLCSLTA-VHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLY  270
            MA V + CI  +L  L   + ARIPGVYSGG WQ AHATFYGG+DASGTMGGACGYGNLY
Sbjct  1    MAMVNLACIVSILSLLVVGIQARIPGVYSGGTWQRAHATFYGGSDASGTMGGACGYGNLY  60

Query  271  S-QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALP  444
            S   YGVN AALSTALFNNGLSCGACFEIKC+N+ + C PG+PSIF+TATNFCPPNFALP
Sbjct  61   SPNEYGVNTAALSTALFNNGLSCGACFEIKCANEPQWCHPGSPSIFITATNFCPPNFALP  120

Query  445  NDNGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLV  624
            NDNGGWCNPPRPHFDLAMPMFL+IA YRAGIVPV+FRR+PCRKQGGIRFT+NGFRYFNLV
Sbjct  121  NDNGGWCNPPRPHFDLAMPMFLRIAEYRAGIVPVSFRRVPCRKQGGIRFTINGFRYFNLV  180

Query  625  LVTNVAGAGD  654
            L++NVAGAGD
Sbjct  181  LISNVAGAGD  190



>gb|EYU18981.1| hypothetical protein MIMGU_mgv1a012125mg [Erythranthe guttata]
Length=260

 Score =   315 bits (807),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 155/190 (82%), Positives = 168/190 (88%), Gaps = 3/190 (2%)
 Frame = +1

Query  94   MAAVRVL-CIALLLCSLTA-VHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNL  267
            MA + V+ CIA ++  L   + ARIPGVYSGG WQ AHATFYGG+DASGTMGGACGYGNL
Sbjct  1    MALLAVIACIATIVSVLPPPIEARIPGVYSGGGWQGAHATFYGGSDASGTMGGACGYGNL  60

Query  268  YSQGYGVNNAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALP  444
            YSQGYGVN AALSTALFNNG SCGACFEIKC+N++  C  G+PSI VTATNFCPPN+ALP
Sbjct  61   YSQGYGVNTAALSTALFNNGFSCGACFEIKCANEKQWCHAGSPSILVTATNFCPPNYALP  120

Query  445  NDNGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLV  624
            NDNGGWCNPPR HFDLAMPMFLKIA YRAGIVPVNFRR+ CRKQGGIRFT+NGFRYFNLV
Sbjct  121  NDNGGWCNPPRTHFDLAMPMFLKIAEYRAGIVPVNFRRVACRKQGGIRFTINGFRYFNLV  180

Query  625  LVTNVAGAGD  654
            LVTNVAGAGD
Sbjct  181  LVTNVAGAGD  190



>ref|XP_010690765.1| PREDICTED: expansin-A4 [Beta vulgaris subsp. vulgaris]
Length=258

 Score =   315 bits (807),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 152/189 (80%), Positives = 172/189 (91%), Gaps = 3/189 (2%)
 Frame = +1

Query  94   MAAVRVLCIALLLCSL-TAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLY  270
            MA++ +L I L L SL + +HAR PGVYS G WQ+AHATFYGG+DASGTMGGACGYGNLY
Sbjct  1    MASI-ILPITLSLFSLFSLIHARYPGVYSRGGWQSAHATFYGGSDASGTMGGACGYGNLY  59

Query  271  SQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPN  447
            SQGYGVN AALSTALFN+G SCGACFE+KC++D R C PG+PSIF+TATNFCPPN+ALP+
Sbjct  60   SQGYGVNTAALSTALFNSGQSCGACFELKCADDPRWCHPGSPSIFITATNFCPPNYALPS  119

Query  448  DNGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVL  627
            DNGGWCNPPRPHFDLAMPMFLKIA YRAGIVPV FRR+PCRK+GGIRFT+NGFRYFNLVL
Sbjct  120  DNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVAFRRVPCRKKGGIRFTINGFRYFNLVL  179

Query  628  VTNVAGAGD  654
            ++NVAGAGD
Sbjct  180  ISNVAGAGD  188



>ref|XP_007150329.1| hypothetical protein PHAVU_005G144500g [Phaseolus vulgaris]
 gb|ESW22323.1| hypothetical protein PHAVU_005G144500g [Phaseolus vulgaris]
Length=256

 Score =   315 bits (806),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 152/184 (83%), Positives = 166/184 (90%), Gaps = 2/184 (1%)
 Frame = +1

Query  109  VLCIALLLCSLT-AVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYG  285
            VL IAL   S+   V ARIPGVY+GGAWQ+AHATFYGG+DASGTMGGACGYGNLYSQGYG
Sbjct  3    VLGIALCFASIMWMVDARIPGVYTGGAWQSAHATFYGGSDASGTMGGACGYGNLYSQGYG  62

Query  286  VNNAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALPNDNGGW  462
            VN AALSTALFNNGLSCGACFEIKC+ND+  C  G+PSIF+TATNFCPPN+ALPNDNGGW
Sbjct  63   VNTAALSTALFNNGLSCGACFEIKCANDKEWCHSGSPSIFITATNFCPPNYALPNDNGGW  122

Query  463  CNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVA  642
            CNPPRPHFDLAMPMFLKIA YRAGIVPV +RR+ C K GGIRFT+NGFRYFNLVL++NVA
Sbjct  123  CNPPRPHFDLAMPMFLKIAEYRAGIVPVAYRRVACMKHGGIRFTINGFRYFNLVLISNVA  182

Query  643  GAGD  654
            GAGD
Sbjct  183  GAGD  186



>gb|AFK44569.1| unknown [Medicago truncatula]
Length=258

 Score =   315 bits (807),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 150/188 (80%), Positives = 166/188 (88%), Gaps = 1/188 (1%)
 Frame = +1

Query  94   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  273
            M A  +    +++ S+  V ARIPGVYSGG WQ AHATFYGG+DASGTMGGACGYGNLYS
Sbjct  1    MVAKMLYIAFIIITSMYIVQARIPGVYSGGQWQDAHATFYGGSDASGTMGGACGYGNLYS  60

Query  274  QGYGVNNAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALPND  450
            QGYGVN AALSTALFNNGLSCGACFEIKC+ND+  C  G+PSIF+TATNFCPPNFA  +D
Sbjct  61   QGYGVNTAALSTALFNNGLSCGACFEIKCANDKEWCRSGSPSIFITATNFCPPNFAQASD  120

Query  451  NGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLV  630
            NGGWCNPPRPHFDLAMPMFLKIA YRAGIVPV +RR+PCRK+GGIRFTVNGFRYFNLVL+
Sbjct  121  NGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVAYRRVPCRKRGGIRFTVNGFRYFNLVLI  180

Query  631  TNVAGAGD  654
            +NVAGAGD
Sbjct  181  SNVAGAGD  188



>gb|KEH30169.1| expansin A10 [Medicago truncatula]
Length=258

 Score =   315 bits (806),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 150/188 (80%), Positives = 166/188 (88%), Gaps = 1/188 (1%)
 Frame = +1

Query  94   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  273
            M A  +    +++ S+  V ARIPGVYSGG WQ AHATFYGG+DASGTMGGACGYGNLYS
Sbjct  1    MVAKMLYIAFIIITSMYIVQARIPGVYSGGQWQDAHATFYGGSDASGTMGGACGYGNLYS  60

Query  274  QGYGVNNAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALPND  450
            QGYGVN AALSTALFNNGLSCGACFEIKC+ND+  C  G+PSIF+TATNFCPPNFA  +D
Sbjct  61   QGYGVNTAALSTALFNNGLSCGACFEIKCANDKEWCHSGSPSIFITATNFCPPNFAQASD  120

Query  451  NGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLV  630
            NGGWCNPPRPHFDLAMPMFLKIA YRAGIVPV +RR+PCRK+GGIRFTVNGFRYFNLVL+
Sbjct  121  NGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVAYRRVPCRKRGGIRFTVNGFRYFNLVLI  180

Query  631  TNVAGAGD  654
            +NVAGAGD
Sbjct  181  SNVAGAGD  188



>ref|XP_010528418.1| PREDICTED: expansin-A3 [Tarenaya hassleriana]
Length=264

 Score =   315 bits (807),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 151/183 (83%), Positives = 166/183 (91%), Gaps = 2/183 (1%)
 Frame = +1

Query  112  LCIALLLCSLTA-VHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGV  288
            L +A+    L A   ARIPGVY+GG WQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGV
Sbjct  12   LSLAITASFLVASATARIPGVYTGGPWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGV  71

Query  289  NNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWC  465
            N AALSTALFNNGLSCGACFEIKC+ D + C+PGNPSIFVTATNFCPPNFA P+D+GGWC
Sbjct  72   NTAALSTALFNNGLSCGACFEIKCTEDPKWCNPGNPSIFVTATNFCPPNFAQPSDDGGWC  131

Query  466  NPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAG  645
            NPPR HFDLAMPMFLKIA YRAGIVPV+FRR+PCRK+GGIRFT+NGFRYFNLVL+TNVAG
Sbjct  132  NPPRQHFDLAMPMFLKIAQYRAGIVPVSFRRVPCRKKGGIRFTINGFRYFNLVLITNVAG  191

Query  646  AGD  654
            AGD
Sbjct  192  AGD  194



>ref|XP_006435550.1| hypothetical protein CICLE_v10032484mg [Citrus clementina]
 ref|XP_006486470.1| PREDICTED: expansin-A4-like [Citrus sinensis]
 gb|ESR48790.1| hypothetical protein CICLE_v10032484mg [Citrus clementina]
 gb|KDO69285.1| hypothetical protein CISIN_1g024916mg [Citrus sinensis]
Length=260

 Score =   315 bits (806),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 152/187 (81%), Positives = 168/187 (90%), Gaps = 2/187 (1%)
 Frame = +1

Query  100  AVRVLCIALLLC-SLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQ  276
            AV ++CI   +  S  +V ARIPGVY G AWQ+AHATFYGG DASGTMGGACGYGNLYSQ
Sbjct  4    AVGIICIVTFVTFSSLSVDARIPGVYGGEAWQSAHATFYGGNDASGTMGGACGYGNLYSQ  63

Query  277  GYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDN  453
            GYGVN AALSTALFNNGLSCGACFEIKC+ND + C  G+PSIFVTATNFCPPNFA P+DN
Sbjct  64   GYGVNTAALSTALFNNGLSCGACFEIKCANDPQWCHAGSPSIFVTATNFCPPNFAQPSDN  123

Query  454  GGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVT  633
            GGWCNPPRPHFDLAMPMFLK+A YRAGIVPV++RR+PCRK+GGIRFT+NGFRYFNLVL+T
Sbjct  124  GGWCNPPRPHFDLAMPMFLKMAEYRAGIVPVSYRRVPCRKRGGIRFTINGFRYFNLVLIT  183

Query  634  NVAGAGD  654
            NVAGAGD
Sbjct  184  NVAGAGD  190



>gb|KJB78839.1| hypothetical protein B456_013G022200 [Gossypium raimondii]
Length=258

 Score =   315 bits (806),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 150/188 (80%), Positives = 165/188 (88%), Gaps = 1/188 (1%)
 Frame = +1

Query  94   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  273
            MA     C+  LL  +  V ARIPGVYS GAWQ+AHATFYGG+DASGTMGGACGYGNLYS
Sbjct  1    MANWVDTCLVSLLFIIVTVEARIPGVYSDGAWQSAHATFYGGSDASGTMGGACGYGNLYS  60

Query  274  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPND  450
            QGYGVN AALSTALFNNG SCGACFEIKC N  + C  G+PSIF+TATNFCPPN+ALPND
Sbjct  61   QGYGVNTAALSTALFNNGFSCGACFEIKCVNQPQWCHSGSPSIFITATNFCPPNYALPND  120

Query  451  NGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLV  630
            NGGWCNPPR HFDLAMPMFLKIA YRAGIVPV++RR+PCRK+GGIRFT+NGFRYFNLVL+
Sbjct  121  NGGWCNPPRSHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKRGGIRFTINGFRYFNLVLI  180

Query  631  TNVAGAGD  654
            TNVAG+GD
Sbjct  181  TNVAGSGD  188



>ref|XP_010920576.1| PREDICTED: expansin-A4-like [Elaeis guineensis]
Length=260

 Score =   315 bits (806),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 148/177 (84%), Positives = 162/177 (92%), Gaps = 1/177 (1%)
 Frame = +1

Query  127  LLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALS  306
            LL  LT   ARIPGVY+GG WQTAHATFYGG+DASGTMGGACGYGNLYSQGYGV  AALS
Sbjct  14   LLAFLTLADARIPGVYAGGQWQTAHATFYGGSDASGTMGGACGYGNLYSQGYGVETAALS  73

Query  307  TALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPH  483
            TALFN GLSCGACFEIKC++D R C PG+PSIF+TATNFCPPN+ALP+DNGGWCNPPRPH
Sbjct  74   TALFNEGLSCGACFEIKCADDPRWCHPGSPSIFITATNFCPPNYALPSDNGGWCNPPRPH  133

Query  484  FDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGD  654
            FDLAMPMFLKIA YRAGIVPV++RR+PCRK GGIRFT+NGF+YFNLVL+TNVA AGD
Sbjct  134  FDLAMPMFLKIAQYRAGIVPVSYRRVPCRKSGGIRFTINGFQYFNLVLITNVASAGD  190



>ref|XP_008384848.1| PREDICTED: expansin-A4 [Malus domestica]
Length=260

 Score =   314 bits (805),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 151/181 (83%), Positives = 166/181 (92%), Gaps = 2/181 (1%)
 Frame = +1

Query  118  IALLLCSLTAV-HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNN  294
            IA L+ SL  V  ARIPGVY+GGAWQ AHATFYGG+DASGTMGGACGYGNLYSQGYGVN 
Sbjct  10   IASLIISLMWVAEARIPGVYTGGAWQGAHATFYGGSDASGTMGGACGYGNLYSQGYGVNT  69

Query  295  AALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALPNDNGGWCNP  471
            AALSTALFNNGLSCGACFE+KC+ D S C  G+PSIF+TATNFCPPNFA P+DNGGWCNP
Sbjct  70   AALSTALFNNGLSCGACFELKCAEDPSWCHAGSPSIFITATNFCPPNFAQPSDNGGWCNP  129

Query  472  PRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAG  651
            PRPHFDLAMPMFLKIA YRAGIVPV++RR+PCRK+GGIRFT+NGFRYFNLVL++NVAGAG
Sbjct  130  PRPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKRGGIRFTINGFRYFNLVLISNVAGAG  189

Query  652  D  654
            D
Sbjct  190  D  190



>ref|XP_004154408.1| PREDICTED: expansin-A4-like [Cucumis sativus]
 ref|XP_004173564.1| PREDICTED: expansin-A4-like [Cucumis sativus]
 gb|KGN65728.1| hypothetical protein Csa_1G522540 [Cucumis sativus]
Length=259

 Score =   314 bits (805),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 150/183 (82%), Positives = 166/183 (91%), Gaps = 1/183 (1%)
 Frame = +1

Query  109  VLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGV  288
            +LCIA L+ ++    ARIPG+YSGG W++AHATFYGG+DASGTMGGACGYGNLYSQGYGV
Sbjct  7    LLCIASLISTMWPAAARIPGIYSGGPWESAHATFYGGSDASGTMGGACGYGNLYSQGYGV  66

Query  289  NNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWC  465
            N AALSTALFNNGLSCGACFEIKC+ND R C  G+PSI +TATNFCPPNFALP+DNGGWC
Sbjct  67   NTAALSTALFNNGLSCGACFEIKCANDPRWCHSGSPSIVITATNFCPPNFALPSDNGGWC  126

Query  466  NPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAG  645
            NPPRPHFDLAMPMFLKIA YRAGIVPV +RR+ CRK GGIRFT++GFRYFNLVLVTNVAG
Sbjct  127  NPPRPHFDLAMPMFLKIAEYRAGIVPVAYRRVGCRKPGGIRFTIHGFRYFNLVLVTNVAG  186

Query  646  AGD  654
            AGD
Sbjct  187  AGD  189



>gb|AAL31477.1|AF319472_1 alpha-expansin 6 precursor [Cucumis sativus]
Length=259

 Score =   314 bits (805),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 150/183 (82%), Positives = 166/183 (91%), Gaps = 1/183 (1%)
 Frame = +1

Query  109  VLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGV  288
            +LCIA L+ ++    ARIPG+YSGG W++AHATFYGG+DASGTMGGACGYGNLYSQGYGV
Sbjct  7    LLCIASLISTMWPAAARIPGIYSGGPWESAHATFYGGSDASGTMGGACGYGNLYSQGYGV  66

Query  289  NNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWC  465
            N AALSTALFNNGLSCGACFEIKC+ND R C  G+PSI +TATNFCPPNFALP+DNGGWC
Sbjct  67   NTAALSTALFNNGLSCGACFEIKCANDPRWCHSGSPSIVITATNFCPPNFALPSDNGGWC  126

Query  466  NPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAG  645
            NPPRPHFDLAMPMFLKIA YRAGIVPV +RR+ CRK GGIRFT++GFRYFNLVLVTNVAG
Sbjct  127  NPPRPHFDLAMPMFLKIAEYRAGIVPVAYRRVGCRKPGGIRFTIHGFRYFNLVLVTNVAG  186

Query  646  AGD  654
            AGD
Sbjct  187  AGD  189



>gb|KHG29956.1| Expansin-A4 -like protein [Gossypium arboreum]
Length=258

 Score =   314 bits (805),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 150/188 (80%), Positives = 165/188 (88%), Gaps = 1/188 (1%)
 Frame = +1

Query  94   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  273
            MA      +  L+   TAV ARIPG YSGG WQ+AHATFYGG DASGTMGGACGYGNLYS
Sbjct  1    MAIKGFTYLVYLIIISTAVEARIPGFYSGGEWQSAHATFYGGNDASGTMGGACGYGNLYS  60

Query  274  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPND  450
            QGYGV+ AALSTALFNNG SCGACFEIKC+ND + C  G+PSIF+TATNFCPPN+ALPND
Sbjct  61   QGYGVSTAALSTALFNNGFSCGACFEIKCANDPQWCHSGSPSIFITATNFCPPNYALPND  120

Query  451  NGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLV  630
            NGGWCNPPR HFDLAMPMFLKIA YRAGIVPV++RR+PCRK+GGIRFT+NGFRYFNLVL+
Sbjct  121  NGGWCNPPRSHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKRGGIRFTINGFRYFNLVLI  180

Query  631  TNVAGAGD  654
            TNVAGAGD
Sbjct  181  TNVAGAGD  188



>ref|XP_008240857.1| PREDICTED: expansin-A6-like [Prunus mume]
Length=258

 Score =   314 bits (804),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 149/188 (79%), Positives = 168/188 (89%), Gaps = 1/188 (1%)
 Frame = +1

Query  94   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  273
            MA V +LCIA LL    A +ARI G  +GG W+ AHATFYGG+DASGTMGGACGYGNLYS
Sbjct  1    MAFVHMLCIASLLSLFMAANARIRGFDTGGPWEGAHATFYGGSDASGTMGGACGYGNLYS  60

Query  274  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPND  450
            +GYGVN AALSTALFNNGLSCGACFEIKC +D + C PGNPSIF+TATNFCPPN+ALPND
Sbjct  61   EGYGVNTAALSTALFNNGLSCGACFEIKCGDDPKWCHPGNPSIFITATNFCPPNYALPND  120

Query  451  NGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLV  630
            +GGWCNPPR HFDLAMPMFL+IA Y+AGIVPV+FRR+PCRK+GG+RFT+NGFRYFNLVL+
Sbjct  121  DGGWCNPPRTHFDLAMPMFLQIAEYKAGIVPVSFRRVPCRKEGGVRFTINGFRYFNLVLI  180

Query  631  TNVAGAGD  654
            TNVAGAGD
Sbjct  181  TNVAGAGD  188



>ref|XP_010033123.1| PREDICTED: expansin-A4 [Eucalyptus grandis]
 gb|KCW52678.1| hypothetical protein EUGRSUZ_J02048 [Eucalyptus grandis]
Length=263

 Score =   314 bits (804),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 151/193 (78%), Positives = 168/193 (87%), Gaps = 6/193 (3%)
 Frame = +1

Query  94   MAAVRVLCIALL-----LCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGY  258
            MAA RV+ +AL      L +     ARIPG+Y+GG WQ+AHATFYGGADASGTMGGACGY
Sbjct  1    MAAARVMALALAFLGVALSATRMAEARIPGIYTGGPWQSAHATFYGGADASGTMGGACGY  60

Query  259  GNLYSQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  435
            GNLYSQGYGVN AALSTALFNNG SCGACFEIKC+ND + C  G+ SIFVTATNFCPPN+
Sbjct  61   GNLYSQGYGVNTAALSTALFNNGFSCGACFEIKCANDPQWCHSGSSSIFVTATNFCPPNY  120

Query  436  ALPNDNGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYF  615
            A P+DNGGWCNPPRPHFDLAMPMFLKIA YRAGIVPV +RR+PCRK+GGIRFT+NGFRYF
Sbjct  121  AQPSDNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVAYRRVPCRKRGGIRFTINGFRYF  180

Query  616  NLVLVTNVAGAGD  654
            NLVL++NVAGAGD
Sbjct  181  NLVLISNVAGAGD  193



>ref|NP_001234761.1| expansin18 precursor [Solanum lycopersicum]
 emb|CAA06271.2| expansin18 [Solanum lycopersicum]
Length=260

 Score =   314 bits (804),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 155/184 (84%), Positives = 166/184 (90%), Gaps = 4/184 (2%)
 Frame = +1

Query  112  LCIALL--LCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYG  285
             C+A L  L  LTA  ARIPGV++ GAWQ+AHATFYGG+DASGTMGGACGYGNLYSQGYG
Sbjct  8    FCVASLFSLILLTA-EARIPGVFTAGAWQSAHATFYGGSDASGTMGGACGYGNLYSQGYG  66

Query  286  VNNAALSTALFNNGLSCGACFEIKCSN-DRSCSPGNPSIFVTATNFCPPNFALPNDNGGW  462
            VNN ALSTALFNNGLSCGACFEIKC N  + C PG+PSIF+TATNFCPPNFALPNDNGGW
Sbjct  67   VNNGALSTALFNNGLSCGACFEIKCDNYPQWCHPGSPSIFITATNFCPPNFALPNDNGGW  126

Query  463  CNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVA  642
            CNPPRPHFDLAMPMFL IA YRAGIVPV +RR+PCRKQGGIRFT+NGFRYFNLVLVTNVA
Sbjct  127  CNPPRPHFDLAMPMFLHIAEYRAGIVPVVYRRVPCRKQGGIRFTINGFRYFNLVLVTNVA  186

Query  643  GAGD  654
            GAGD
Sbjct  187  GAGD  190



>ref|XP_010043542.1| PREDICTED: expansin-A4-like [Eucalyptus grandis]
 ref|XP_010043543.1| PREDICTED: expansin-A4-like [Eucalyptus grandis]
 gb|KCW85556.1| hypothetical protein EUGRSUZ_B02355 [Eucalyptus grandis]
Length=260

 Score =   313 bits (803),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 152/184 (83%), Positives = 167/184 (91%), Gaps = 2/184 (1%)
 Frame = +1

Query  109  VLCIALLLCSLTAV-HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYG  285
            V   +L+  SL  +  ARIPGVYSGG WQTAHATFYGG+DASGTMGGACGYGNLYSQGYG
Sbjct  7    VFAASLISFSLMWLADARIPGVYSGGPWQTAHATFYGGSDASGTMGGACGYGNLYSQGYG  66

Query  286  VNNAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALPNDNGGW  462
            VN AALSTALFNNGLSCGACFEIKC+ND + C  G+PSIFVTATNFCPPNFA P+DNGGW
Sbjct  67   VNTAALSTALFNNGLSCGACFEIKCANDPTWCHSGSPSIFVTATNFCPPNFAQPSDNGGW  126

Query  463  CNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVA  642
            CNPPRPHFDLAMPMFLKIA YRAGIVPV+FRR+PCRK+GG+RFT+NGFRYFNLVL++NVA
Sbjct  127  CNPPRPHFDLAMPMFLKIAEYRAGIVPVSFRRVPCRKRGGMRFTINGFRYFNLVLISNVA  186

Query  643  GAGD  654
            GAGD
Sbjct  187  GAGD  190



>ref|XP_010414459.1| PREDICTED: expansin-A6-like [Camelina sativa]
Length=257

 Score =   313 bits (803),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 149/182 (82%), Positives = 165/182 (91%), Gaps = 1/182 (1%)
 Frame = +1

Query  112  LCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVN  291
            L + +L   L  + ARIPGVY+GG W+TAHATFYGG+DASGTMGGACGYGNLYSQGYGVN
Sbjct  6    LVLFVLTILLATIEARIPGVYNGGGWETAHATFYGGSDASGTMGGACGYGNLYSQGYGVN  65

Query  292  NAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCN  468
             AALSTALFNNG SCGACFE+KC++D R C  G+PSIFVTATNFCPPNFA P+DNGGWCN
Sbjct  66   TAALSTALFNNGFSCGACFELKCASDPRWCHSGSPSIFVTATNFCPPNFAQPSDNGGWCN  125

Query  469  PPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGA  648
            PPRPHFDLAMPMFLKIA YRAGIVPV+FRR+PCRK+GGIRFT+NGFRYFNLVLVTNVAGA
Sbjct  126  PPRPHFDLAMPMFLKIAEYRAGIVPVSFRRVPCRKRGGIRFTINGFRYFNLVLVTNVAGA  185

Query  649  GD  654
            G+
Sbjct  186  GN  187



>emb|CAN73252.1| hypothetical protein VITISV_027049 [Vitis vinifera]
Length=247

 Score =   313 bits (802),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 146/169 (86%), Positives = 159/169 (94%), Gaps = 1/169 (1%)
 Frame = +1

Query  151  HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGL  330
             ARIPGVY+GG WQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFNNGL
Sbjct  9    EARIPGVYTGGGWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGL  68

Query  331  SCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMF  507
            SCGACFE+KC+ND   C  G+PSI +TATNFCPPN+ALP+DNGGWCNPPRPHFDLAMPMF
Sbjct  69   SCGACFELKCANDPEWCHSGSPSILITATNFCPPNYALPSDNGGWCNPPRPHFDLAMPMF  128

Query  508  LKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGD  654
            LKIA YRAGIVPV+FRR+PCRKQGGIRFT+NGFRYFNLVL+TNVAGAGD
Sbjct  129  LKIAEYRAGIVPVSFRRVPCRKQGGIRFTINGFRYFNLVLITNVAGAGD  177



>emb|CDP00110.1| unnamed protein product [Coffea canephora]
Length=255

 Score =   313 bits (802),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 145/183 (79%), Positives = 165/183 (90%), Gaps = 1/183 (1%)
 Frame = +1

Query  109  VLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGV  288
            + CI  L   LT   ARIPGVY+G +W++AHATFYGG+DASGTMGGACGYGNLYSQGYGV
Sbjct  3    LTCIIALSLLLTPTEARIPGVYTGDSWESAHATFYGGSDASGTMGGACGYGNLYSQGYGV  62

Query  289  NNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWC  465
            N AALSTALFNNG SCG+CFE+KC++D + C PG+PSI +TATNFCPPN+ALPNDNGGWC
Sbjct  63   NTAALSTALFNNGFSCGSCFELKCADDPQWCHPGSPSILITATNFCPPNYALPNDNGGWC  122

Query  466  NPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAG  645
            NPPRPHFDLAMPMFL+IA YRAGIVPV++RR+PCRKQGGIRF +NGFRYFNLVL+TNVAG
Sbjct  123  NPPRPHFDLAMPMFLRIAEYRAGIVPVSYRRVPCRKQGGIRFQINGFRYFNLVLITNVAG  182

Query  646  AGD  654
            AGD
Sbjct  183  AGD  185



>ref|XP_009343581.1| PREDICTED: expansin-A4-like [Pyrus x bretschneideri]
Length=261

 Score =   313 bits (803),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 155/191 (81%), Positives = 169/191 (88%), Gaps = 4/191 (2%)
 Frame = +1

Query  94   MAAVR-VLCIALL--LCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGN  264
            MAA+  +LCIA L  L S   V ARIPGVY+GGAWQ AHATFYGG+DASGTMGGACGYGN
Sbjct  1    MAAMAPLLCIASLMALASTIVVEARIPGVYTGGAWQGAHATFYGGSDASGTMGGACGYGN  60

Query  265  LYSQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFAL  441
            LYSQGYGVN AALSTALFNNGLSCGACFEIKC+N  + C  G+PSIFVTATNFCPPNFA 
Sbjct  61   LYSQGYGVNTAALSTALFNNGLSCGACFEIKCANQPQWCKSGSPSIFVTATNFCPPNFAQ  120

Query  442  PNDNGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNL  621
            P+DNGGWCNPPR HFDLAMPMFLKIA YRAGIVPV++RR+PCRKQGGIRFT+NG +YFNL
Sbjct  121  PSDNGGWCNPPRTHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKQGGIRFTINGHKYFNL  180

Query  622  VLVTNVAGAGD  654
            VL+ NVAGAGD
Sbjct  181  VLIHNVAGAGD  191



>ref|XP_006350774.1| PREDICTED: expansin-A6 [Solanum tuberosum]
Length=260

 Score =   313 bits (802),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 154/190 (81%), Positives = 166/190 (87%), Gaps = 3/190 (2%)
 Frame = +1

Query  94   MAAVRVLCIALLLCSLTAV--HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNL  267
            M  + V C    L SL  +   ARIPGV++ GAWQ+AHATFYGG+DASGTMGGACGYGNL
Sbjct  1    MGFLNVACCVASLFSLILLTAEARIPGVFTAGAWQSAHATFYGGSDASGTMGGACGYGNL  60

Query  268  YSQGYGVNNAALSTALFNNGLSCGACFEIKCSN-DRSCSPGNPSIFVTATNFCPPNFALP  444
            YSQGYGVNN ALSTALFNNGLSCGACFEIKC N  + C PG+PSIF+TATNFCPPNFALP
Sbjct  61   YSQGYGVNNGALSTALFNNGLSCGACFEIKCDNYPQWCHPGSPSIFITATNFCPPNFALP  120

Query  445  NDNGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLV  624
            NDNGGWCNPPRPHFDLAMPMFL IA YRAGIVPV +RR+PCRKQGGIRFT+NGFRYFNLV
Sbjct  121  NDNGGWCNPPRPHFDLAMPMFLHIAEYRAGIVPVVYRRVPCRKQGGIRFTINGFRYFNLV  180

Query  625  LVTNVAGAGD  654
            LVTNVAGAGD
Sbjct  181  LVTNVAGAGD  190



>gb|ABO32367.1| expansin [Litchi chinensis]
Length=256

 Score =   313 bits (802),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 155/188 (82%), Positives = 168/188 (89%), Gaps = 3/188 (2%)
 Frame = +1

Query  94   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  273
            MA   VLC  L L  LTA +A+IPGVY+GG W++AHATFYGG+DASGTMGGACGYGNLYS
Sbjct  1    MAVFNVLCF-LSLLFLTA-NAKIPGVYTGGPWESAHATFYGGSDASGTMGGACGYGNLYS  58

Query  274  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPND  450
            QGYGVN AALSTALFNNGLSCGACFE+KC  D R C PGNPSI VTATNFCPPNFA P+D
Sbjct  59   QGYGVNTAALSTALFNNGLSCGACFELKCVADPRWCLPGNPSILVTATNFCPPNFAQPSD  118

Query  451  NGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLV  630
            +GGWCNPPR HFDLAMPMFLKIA YRAGIVPV++RR+PCRKQGGIRFT+NGFRYFNLVLV
Sbjct  119  DGGWCNPPRTHFDLAMPMFLKIAQYRAGIVPVSYRRVPCRKQGGIRFTINGFRYFNLVLV  178

Query  631  TNVAGAGD  654
            TNVAGAGD
Sbjct  179  TNVAGAGD  186



>ref|XP_006429095.1| hypothetical protein CICLE_v10012518mg [Citrus clementina]
 gb|ESR42335.1| hypothetical protein CICLE_v10012518mg [Citrus clementina]
Length=259

 Score =   313 bits (802),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 151/189 (80%), Positives = 170/189 (90%), Gaps = 2/189 (1%)
 Frame = +1

Query  94   MAAVRVLCIALLLCSLTAV-HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLY  270
            MA  R+LC   L  SL A  +A+IPGV++GG WQ+AHATFYGG+DASGTMGGACGYGNLY
Sbjct  1    MALFRMLCFFSLALSLFATANAKIPGVFAGGPWQSAHATFYGGSDASGTMGGACGYGNLY  60

Query  271  SQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPN  447
            SQGYGVN AALSTALFNNGLSCGACFE+KC  D + C+PGNP+I +TATNFCPPNFA P+
Sbjct  61   SQGYGVNTAALSTALFNNGLSCGACFELKCGGDPQWCNPGNPAILITATNFCPPNFAQPS  120

Query  448  DNGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVL  627
            DNGGWCNPPRPHFDLAMPMFLK+A YRAGIVPV++RR+PCRK+GGIRFT+NGFRYFNLVL
Sbjct  121  DNGGWCNPPRPHFDLAMPMFLKLAQYRAGIVPVSYRRVPCRKRGGIRFTINGFRYFNLVL  180

Query  628  VTNVAGAGD  654
            VTNVAGAGD
Sbjct  181  VTNVAGAGD  189



>ref|XP_011042710.1| PREDICTED: expansin-A4-like [Populus euphratica]
Length=262

 Score =   313 bits (802),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 149/192 (78%), Positives = 168/192 (88%), Gaps = 5/192 (3%)
 Frame = +1

Query  94   MAAVRVLCIALLLCSLTAV----HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYG  261
            MA  R+LC    L  + ++     ARIPGVYSGGAW+TAHATFYGGADASGTMGGACGYG
Sbjct  1    MATSRLLCFTTTLLIMMSLMWKGEARIPGVYSGGAWETAHATFYGGADASGTMGGACGYG  60

Query  262  NLYSQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFA  438
            NLYSQGYGV+ AALSTALFNNGLSCGACFEIKC++D + C  G+PSI +TATNFCPPN+A
Sbjct  61   NLYSQGYGVSTAALSTALFNNGLSCGACFEIKCADDPQWCHSGSPSILITATNFCPPNYA  120

Query  439  LPNDNGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFN  618
            LP+DNGGWC PPRPHFDLAMPMFLKIA Y AGIVPV +RR+PCRK+GGIRFT+NGFRYFN
Sbjct  121  LPSDNGGWCTPPRPHFDLAMPMFLKIAEYHAGIVPVAYRRVPCRKRGGIRFTINGFRYFN  180

Query  619  LVLVTNVAGAGD  654
            LVL++NVAGAGD
Sbjct  181  LVLISNVAGAGD  192



>dbj|BAN09210.1| alpha expansin [Eustoma exaltatum subsp. russellianum]
Length=262

 Score =   313 bits (802),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 147/171 (86%), Positives = 159/171 (93%), Gaps = 3/171 (2%)
 Frame = +1

Query  151  HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGL  330
             ARIPGVYSGGAW++AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFNNGL
Sbjct  22   EARIPGVYSGGAWESAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGL  81

Query  331  SCGACFEIKCSND---RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMP  501
            SCGACFEIKC ND   R C PG+PSIF+TATNFCPPN+ALPNDNGGWCNPPRPHFDLAMP
Sbjct  82   SCGACFEIKCINDPNWRWCHPGSPSIFITATNFCPPNYALPNDNGGWCNPPRPHFDLAMP  141

Query  502  MFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGD  654
            MFL +A YRAGIVPV +RR+PCRK GG+RFT+NGFRYFNLVL+TNVAGAGD
Sbjct  142  MFLNLAQYRAGIVPVTYRRVPCRKHGGVRFTINGFRYFNLVLITNVAGAGD  192



>gb|AFK34565.1| unknown [Medicago truncatula]
Length=191

 Score =   310 bits (795),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 150/189 (79%), Positives = 168/189 (89%), Gaps = 3/189 (2%)
 Frame = +1

Query  94   MAAVRVLCIALLLCSLTA--VHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNL  267
            M  V ++ +  L+ SLT   V ARIPGVY+GGAWQTAHATFYGG+DASGTMGGACGYGNL
Sbjct  1    MGMVSMVYVVTLIMSLTMWMVDARIPGVYNGGAWQTAHATFYGGSDASGTMGGACGYGNL  60

Query  268  YSQGYGVNNAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALP  444
            YSQGYGVN AALSTALFNNGLSCG+CFE+KC+ND+  C  G+PSIF+TATNFCPPNFA P
Sbjct  61   YSQGYGVNTAALSTALFNNGLSCGSCFELKCANDKQWCHSGSPSIFITATNFCPPNFAQP  120

Query  445  NDNGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLV  624
            +DNGGWCNPPRPHFDLAMPMFLKIA YRAGIVPV FRR+PCRK+GGIRFT+NGFRYFNLV
Sbjct  121  SDNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVAFRRVPCRKRGGIRFTINGFRYFNLV  180

Query  625  LVTNVAGAG  651
            L++NVA  G
Sbjct  181  LISNVAVQG  189



>ref|XP_010264435.1| PREDICTED: expansin-A4 [Nelumbo nucifera]
Length=260

 Score =   313 bits (801),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 150/170 (88%), Positives = 158/170 (93%), Gaps = 1/170 (1%)
 Frame = +1

Query  148  VHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNG  327
            V ARIPGVYSGG WQ AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFNNG
Sbjct  21   VDARIPGVYSGGPWQNAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNG  80

Query  328  LSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPM  504
            LSCGACFEIKC+ND + C PG PSI +TATNFCPPNFALP+DNGGWCNPPRPHFDLAMPM
Sbjct  81   LSCGACFEIKCANDPQWCHPGGPSILITATNFCPPNFALPSDNGGWCNPPRPHFDLAMPM  140

Query  505  FLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGD  654
            FLKIA YRAGIVPV +RR+PCRK GGIRFT+NGFRYFNLVLVTNVAGAGD
Sbjct  141  FLKIAEYRAGIVPVAYRRVPCRKHGGIRFTINGFRYFNLVLVTNVAGAGD  190



>gb|AAK48848.1|AF350939_1 expansin [Prunus cerasus]
Length=260

 Score =   313 bits (801),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 150/182 (82%), Positives = 166/182 (91%), Gaps = 2/182 (1%)
 Frame = +1

Query  115  CIALLLCSLTAV-HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVN  291
            C+A LL S+  V  ARIPGVY+G AW+ AHATFYGG+DASGTMGGACGYGNLYSQGYGV+
Sbjct  9    CLASLLISVMWVAEARIPGVYTGDAWEAAHATFYGGSDASGTMGGACGYGNLYSQGYGVS  68

Query  292  NAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCN  468
             AALSTALFNNGLSCGACFEIKC+ND   C  G+PSIF+TATNFCPPNFA P+DNGGWCN
Sbjct  69   TAALSTALFNNGLSCGACFEIKCANDPNWCHSGSPSIFITATNFCPPNFAQPSDNGGWCN  128

Query  469  PPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGA  648
            PPRPHFDLAMPMFLKIA YRAGIVPV++RR+PCRK+GGIRFT+NGFRYFNLVLV+NVAGA
Sbjct  129  PPRPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKRGGIRFTINGFRYFNLVLVSNVAGA  188

Query  649  GD  654
            GD
Sbjct  189  GD  190



>gb|KJB08889.1| hypothetical protein B456_001G111100 [Gossypium raimondii]
Length=260

 Score =   313 bits (801),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 149/184 (81%), Positives = 167/184 (91%), Gaps = 2/184 (1%)
 Frame = +1

Query  109  VLCIALLLCSLTAV-HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYG  285
            V CI L L S   +  ARIPGVYSGGAWQ AHATFYGG+DASGTMGGACGYGNLYSQGYG
Sbjct  7    VACILLFLSSTMWMGEARIPGVYSGGAWQNAHATFYGGSDASGTMGGACGYGNLYSQGYG  66

Query  286  VNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGW  462
            VN AALSTALFNNG SCGACFEIKC++D + C  G+PSIF+TATNFCPPN+ALP+DNGGW
Sbjct  67   VNTAALSTALFNNGFSCGACFEIKCASDPQWCHSGSPSIFITATNFCPPNYALPSDNGGW  126

Query  463  CNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVA  642
            CNPPRPHFDLAMPMFLKIA YRAGIVPV++RR+PCRK+GGIRFT+NGFRYFNLVL++NVA
Sbjct  127  CNPPRPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKRGGIRFTINGFRYFNLVLISNVA  186

Query  643  GAGD  654
            G+G+
Sbjct  187  GSGN  190



>gb|KHN30166.1| Expansin-A4 [Glycine soja]
Length=292

 Score =   313 bits (803),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 150/181 (83%), Positives = 164/181 (91%), Gaps = 4/181 (2%)
 Frame = +1

Query  124  LLLCSLT---AVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNN  294
            +LLC ++    V ARIPGVYSGGAWQ AHATFYGG+DASGTMGGACGYGNLYSQGYGVN 
Sbjct  7    VLLCLMSLMWMVDARIPGVYSGGAWQNAHATFYGGSDASGTMGGACGYGNLYSQGYGVNT  66

Query  295  AALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALPNDNGGWCNP  471
            AALSTALFN+GLSCGACFEIKC+ND+  C  G+PSIF+TATNFCP N+ALPNDNGGWCNP
Sbjct  67   AALSTALFNSGLSCGACFEIKCANDKQWCHSGSPSIFITATNFCPSNYALPNDNGGWCNP  126

Query  472  PRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAG  651
            PRPHFDLAMPMFLKIA YRAGIVPV FRR+ CRK GGIRFT+NGFRYFNLVL++NVAGAG
Sbjct  127  PRPHFDLAMPMFLKIAEYRAGIVPVAFRRVACRKHGGIRFTINGFRYFNLVLISNVAGAG  186

Query  652  D  654
            D
Sbjct  187  D  187



>ref|XP_002313434.1| alpha-expansin 1 family protein [Populus trichocarpa]
 gb|EEE87389.1| alpha-expansin 1 family protein [Populus trichocarpa]
Length=262

 Score =   312 bits (800),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 149/192 (78%), Positives = 169/192 (88%), Gaps = 5/192 (3%)
 Frame = +1

Query  94   MAAVRVLC----IALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYG  261
            MA   +LC    + +++  +    ARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYG
Sbjct  1    MAMGSLLCFTTSLLIMMSLMWKGEARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYG  60

Query  262  NLYSQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFA  438
            NLYSQGYGV+ AALSTALFNNGLSCGACFEIKC++D + C  G+PSI +TATNFCPPN+A
Sbjct  61   NLYSQGYGVSTAALSTALFNNGLSCGACFEIKCADDPQWCHSGSPSILITATNFCPPNYA  120

Query  439  LPNDNGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFN  618
            LP+DNGGWCNPPRPHFDLAMPMFLKIA Y AGIVPV +RR+PCRK+GGIRFT+NGFRYFN
Sbjct  121  LPSDNGGWCNPPRPHFDLAMPMFLKIAEYHAGIVPVAYRRVPCRKRGGIRFTINGFRYFN  180

Query  619  LVLVTNVAGAGD  654
            LVL++NVAGAGD
Sbjct  181  LVLISNVAGAGD  192



>ref|XP_006488339.1| PREDICTED: expansin-A4-like [Citrus sinensis]
 gb|KDO72838.1| hypothetical protein CISIN_1g046524mg [Citrus sinensis]
Length=259

 Score =   312 bits (800),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 151/189 (80%), Positives = 168/189 (89%), Gaps = 2/189 (1%)
 Frame = +1

Query  94   MAAVRVLCIAL-LLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLY  270
            MA V    + L L+C +    AR+PG YSGG WQ+AHATFYGG+DASGTMGGACGYGNLY
Sbjct  1    MAVVNWAGVILSLVCLMWVADARLPGDYSGGPWQSAHATFYGGSDASGTMGGACGYGNLY  60

Query  271  SQGYGVNNAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALPN  447
            SQGYGVN AALSTALFNNGLSCGACFEIKC+N+ + C  G+PSI VTATNFCPPN+ALP+
Sbjct  61   SQGYGVNTAALSTALFNNGLSCGACFEIKCANEPAWCHSGSPSILVTATNFCPPNYALPS  120

Query  448  DNGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVL  627
            DNGGWCNPPRPHFDLAMPMFLKIA YRAGIVPV++RR+PCRK+GGIRFT+NGFRYFNLVL
Sbjct  121  DNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKKGGIRFTINGFRYFNLVL  180

Query  628  VTNVAGAGD  654
            VTNVAGAGD
Sbjct  181  VTNVAGAGD  189



>ref|XP_006424843.1| hypothetical protein CICLE_v10029094mg [Citrus clementina]
 gb|ESR38083.1| hypothetical protein CICLE_v10029094mg [Citrus clementina]
Length=259

 Score =   312 bits (799),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 151/189 (80%), Positives = 168/189 (89%), Gaps = 2/189 (1%)
 Frame = +1

Query  94   MAAVRVLCIAL-LLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLY  270
            MA V    + L L+C +    AR+PG YSGG WQ+AHATFYGG+DASGTMGGACGYGNLY
Sbjct  1    MAVVNWAGVILSLVCLMWVADARLPGDYSGGPWQSAHATFYGGSDASGTMGGACGYGNLY  60

Query  271  SQGYGVNNAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALPN  447
            SQGYGVN AALSTALFNNGLSCGACFEIKC+N+ + C  G+PSI VTATNFCPPN+ALP+
Sbjct  61   SQGYGVNTAALSTALFNNGLSCGACFEIKCANEPAWCHSGSPSILVTATNFCPPNYALPS  120

Query  448  DNGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVL  627
            DNGGWCNPPRPHFDLAMPMFLKIA YRAGIVPV++RR+PCRK+GGIRFT+NGFRYFNLVL
Sbjct  121  DNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKKGGIRFTINGFRYFNLVL  180

Query  628  VTNVAGAGD  654
            VTNVAGAGD
Sbjct  181  VTNVAGAGD  189



>ref|XP_006410954.1| hypothetical protein EUTSA_v10017095mg [Eutrema salsugineum]
 dbj|BAJ34443.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ52407.1| hypothetical protein EUTSA_v10017095mg [Eutrema salsugineum]
Length=263

 Score =   312 bits (800),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 150/186 (81%), Positives = 166/186 (89%), Gaps = 2/186 (1%)
 Frame = +1

Query  103  VRVLCIALLLC-SLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQG  279
            +R L +A+ +   L A +A+IPGVY+GG WQ AHATFYGG+DASGTMGGACGYGNLYSQG
Sbjct  8    IRFLWLAVTISFLLAATNAKIPGVYTGGPWQNAHATFYGGSDASGTMGGACGYGNLYSQG  67

Query  280  YGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNG  456
            YGVN AALSTALFNNG SCGACFEIKC++D R C PGNPSIFVTATNFCPPNFA P+D+G
Sbjct  68   YGVNTAALSTALFNNGFSCGACFEIKCTDDPRWCVPGNPSIFVTATNFCPPNFAQPSDDG  127

Query  457  GWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTN  636
            GWCNPPR HFDLAMPMFLKI  YRAGIVPV++RR+PCRK GGIRFTVNGFRYFNLVL+TN
Sbjct  128  GWCNPPREHFDLAMPMFLKIGLYRAGIVPVSYRRVPCRKLGGIRFTVNGFRYFNLVLITN  187

Query  637  VAGAGD  654
            VAGAGD
Sbjct  188  VAGAGD  193



>ref|XP_006480833.1| PREDICTED: expansin-A4-like [Citrus sinensis]
 gb|KDO51152.1| hypothetical protein CISIN_1g025025mg [Citrus sinensis]
Length=259

 Score =   312 bits (799),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 150/189 (79%), Positives = 170/189 (90%), Gaps = 2/189 (1%)
 Frame = +1

Query  94   MAAVRVLCIALLLCSLTAV-HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLY  270
            MA  R+LC   +  SL A  +A+IPGV++GG WQ+AHATFYGG+DASGTMGGACGYGNLY
Sbjct  1    MALFRMLCFFSVALSLFATANAKIPGVFAGGPWQSAHATFYGGSDASGTMGGACGYGNLY  60

Query  271  SQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPN  447
            SQGYGVN AALSTALFNNGLSCGACFE+KC  D + C+PGNP+I +TATNFCPPNFA P+
Sbjct  61   SQGYGVNTAALSTALFNNGLSCGACFELKCGGDPQWCNPGNPAILITATNFCPPNFAQPS  120

Query  448  DNGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVL  627
            DNGGWCNPPRPHFDLAMPMFLK+A YRAGIVPV++RR+PCRK+GGIRFT+NGFRYFNLVL
Sbjct  121  DNGGWCNPPRPHFDLAMPMFLKLAQYRAGIVPVSYRRVPCRKRGGIRFTINGFRYFNLVL  180

Query  628  VTNVAGAGD  654
            VTNVAGAGD
Sbjct  181  VTNVAGAGD  189



>ref|XP_010517036.1| PREDICTED: expansin-A3 [Camelina sativa]
Length=262

 Score =   312 bits (799),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 153/191 (80%), Positives = 167/191 (87%), Gaps = 4/191 (2%)
 Frame = +1

Query  94   MAAVRVLCIALLLCS---LTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGN  264
            MA    +C+ L + +   LTA +A+IPGVYSGG WQ AHATFYGG+DASGTMGGACGYGN
Sbjct  2    MATAFGICLWLAVTASFLLTATNAKIPGVYSGGPWQNAHATFYGGSDASGTMGGACGYGN  61

Query  265  LYSQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFAL  441
            LYSQGYGVN AALSTALFNNG SCGACFEIKC++D R C PGNPSI VTATNFCPPNFA 
Sbjct  62   LYSQGYGVNTAALSTALFNNGFSCGACFEIKCTDDPRWCVPGNPSILVTATNFCPPNFAQ  121

Query  442  PNDNGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNL  621
            P+D+GGWCNPPR HFDLAMPMFLKI  YRAGIVPV++RR+PCRK GGIRFTVNGFRYFNL
Sbjct  122  PSDDGGWCNPPREHFDLAMPMFLKIGLYRAGIVPVSYRRVPCRKIGGIRFTVNGFRYFNL  181

Query  622  VLVTNVAGAGD  654
            VLVTNVAGAGD
Sbjct  182  VLVTNVAGAGD  192



>emb|CAA04385.1| Expansin [Brassica napus]
Length=260

 Score =   312 bits (799),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 147/184 (80%), Positives = 166/184 (90%), Gaps = 2/184 (1%)
 Frame = +1

Query  109  VLCIALLLCSLTAV-HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYG  285
            VLC+  +L   T +  ARIPGVYSGG W+TAHATFYGG+DASGTMG ACGYGNLY++GYG
Sbjct  7    VLCLLTILADFTTISEARIPGVYSGGGWETAHATFYGGSDASGTMGSACGYGNLYTKGYG  66

Query  286  VNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGW  462
            VN AALSTALFNNG SCGACFE+KC++D + C  G+PSIFVTATNFCPPNFA P+DNGGW
Sbjct  67   VNTAALSTALFNNGFSCGACFELKCASDPKWCHSGSPSIFVTATNFCPPNFAQPSDNGGW  126

Query  463  CNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVA  642
            CNPPRPHFDLAMPMFLKIA YRAGIVPV+FRR+PCRK+GG+RFT+NGFRYFNLVLVTNVA
Sbjct  127  CNPPRPHFDLAMPMFLKIAEYRAGIVPVSFRRVPCRKRGGMRFTINGFRYFNLVLVTNVA  186

Query  643  GAGD  654
            GAG+
Sbjct  187  GAGN  190



>ref|XP_008343537.1| PREDICTED: expansin-A4-like [Malus domestica]
Length=261

 Score =   312 bits (799),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 153/191 (80%), Positives = 169/191 (88%), Gaps = 4/191 (2%)
 Frame = +1

Query  94   MAAVR-VLCIALL--LCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGN  264
            MAA+  +LCIA L  L S   V ARIPGVY+GGAWQ AHATFYGG+DASGTMGGACGYGN
Sbjct  1    MAAMAPLLCIASLMALASTIVVEARIPGVYTGGAWQDAHATFYGGSDASGTMGGACGYGN  60

Query  265  LYSQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFAL  441
            LYSQGYGVN AALSTALFNNGLSCGACFE+KC+N  + C  G+PSIFVTATNFCPPNFA 
Sbjct  61   LYSQGYGVNTAALSTALFNNGLSCGACFELKCANQPQWCKSGSPSIFVTATNFCPPNFAQ  120

Query  442  PNDNGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNL  621
            P+D+GGWCNPPR HFDLAMPMFLKIA YRAGIVPV++RR+PCRKQGGIRFT+NG +YFNL
Sbjct  121  PSDDGGWCNPPRTHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKQGGIRFTINGHKYFNL  180

Query  622  VLVTNVAGAGD  654
            VL+ NVAGAGD
Sbjct  181  VLIHNVAGAGD  191



>ref|XP_002881024.1| ATEXPA6 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH57283.1| ATEXPA6 [Arabidopsis lyrata subsp. lyrata]
Length=257

 Score =   311 bits (798),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 147/182 (81%), Positives = 164/182 (90%), Gaps = 1/182 (1%)
 Frame = +1

Query  112  LCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVN  291
            L +++L   L    ARIPGVY+GG W+TAHATFYGG+DASGTMGGACGYGNLYSQGYGVN
Sbjct  6    LVLSVLTTILALSEARIPGVYNGGGWETAHATFYGGSDASGTMGGACGYGNLYSQGYGVN  65

Query  292  NAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCN  468
             AALSTALFNNG SCGACFE+KC++D R C  G+PSIF+TATNFCPPNFA P+DNGGWCN
Sbjct  66   TAALSTALFNNGFSCGACFELKCASDPRWCHSGSPSIFITATNFCPPNFAQPSDNGGWCN  125

Query  469  PPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGA  648
            PPRPHFDLAMPMFLKIA YRAGIVPV+FRR+PCRK+GGIRFT+NGFRYFNLVLVTNVAG 
Sbjct  126  PPRPHFDLAMPMFLKIAEYRAGIVPVSFRRVPCRKRGGIRFTINGFRYFNLVLVTNVAGV  185

Query  649  GD  654
            G+
Sbjct  186  GN  187



>ref|XP_009409516.1| PREDICTED: expansin-A6-like [Musa acuminata subsp. malaccensis]
Length=261

 Score =   312 bits (799),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 148/186 (80%), Positives = 164/186 (88%), Gaps = 1/186 (1%)
 Frame = +1

Query  100  AVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQG  279
            A+ V    +L  S     ARIPGVY+GG WQTAHATFYGG+DASGTMGGACGYGNLYSQG
Sbjct  6    ALAVTVALVLASSALLADARIPGVYTGGPWQTAHATFYGGSDASGTMGGACGYGNLYSQG  65

Query  280  YGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNG  456
            YGV  AALSTAL+N+GL CGACFEIKC++D R C  GNPSIF+TATNFCPPN+ALP+DNG
Sbjct  66   YGVETAALSTALYNDGLRCGACFEIKCADDPRWCKGGNPSIFITATNFCPPNYALPSDNG  125

Query  457  GWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTN  636
            GWCNPPRPHFDLAMPMFLKIA YRAGIVPV+FRR+PCRK GGIRFT+NGF+YFNLVL+TN
Sbjct  126  GWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSFRRVPCRKSGGIRFTINGFQYFNLVLITN  185

Query  637  VAGAGD  654
            VAGAGD
Sbjct  186  VAGAGD  191



>gb|KHG24991.1| Expansin-A4 -like protein [Gossypium arboreum]
Length=260

 Score =   311 bits (798),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 149/187 (80%), Positives = 168/187 (90%), Gaps = 2/187 (1%)
 Frame = +1

Query  100  AVRVLCIALLLCSLTAV-HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQ  276
            A  V CI L + S   +  ARIPGVYSGGAWQ AHATFYGG+DASGTMGGACGYGNLYSQ
Sbjct  4    ASAVACIFLFISSTMWMGEARIPGVYSGGAWQNAHATFYGGSDASGTMGGACGYGNLYSQ  63

Query  277  GYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDN  453
            GYGVN AALSTALFNNG SCGACFEIKC++D + C  G+PSIF+TATNFCPPN+ALP+DN
Sbjct  64   GYGVNTAALSTALFNNGFSCGACFEIKCASDPQWCHSGSPSIFITATNFCPPNYALPSDN  123

Query  454  GGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVT  633
            GGWCNPPRPHFDLAMPMFLKIA YRAGIVPV++RR+PCRK+GGIRFT+NGFRYFNLVL++
Sbjct  124  GGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKRGGIRFTINGFRYFNLVLIS  183

Query  634  NVAGAGD  654
            NVAG+G+
Sbjct  184  NVAGSGN  190



>ref|XP_010922313.1| PREDICTED: LOW QUALITY PROTEIN: expansin-A4-like [Elaeis guineensis]
Length=258

 Score =   311 bits (797),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 146/188 (78%), Positives = 168/188 (89%), Gaps = 1/188 (1%)
 Frame = +1

Query  94   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  273
            MA +R++ +A LL  L    ARIPGVYS G WQ+AHATFYGG+DASGTMGGACGYGNLYS
Sbjct  1    MAILRLVALASLLAFLVPAAARIPGVYSSGPWQSAHATFYGGSDASGTMGGACGYGNLYS  60

Query  274  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPND  450
            QGYGV  AALSTALFN+G+SCGACFEIKC++D + C  G+PSIF+TATNFCPPN+ALP+D
Sbjct  61   QGYGVETAALSTALFNDGMSCGACFEIKCADDPQWCHSGSPSIFITATNFCPPNYALPSD  120

Query  451  NGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLV  630
            +GGWCNPP PHFDLAMPMFLKIA YRAGIVPV++RR+PCRK GGIRFT+NGF+YFNLVL+
Sbjct  121  DGGWCNPPXPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKSGGIRFTINGFQYFNLVLI  180

Query  631  TNVAGAGD  654
            TNVAGAGD
Sbjct  181  TNVAGAGD  188



>ref|NP_180461.1| expansin A6 [Arabidopsis thaliana]
 sp|Q38865.2|EXPA6_ARATH RecName: Full=Expansin-A6; Short=AtEXPA6; AltName: Full=Alpha-expansin-6; 
Short=At-EXP6; Short=AtEx6; AltName: Full=Ath-ExpAlpha-1.8; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAC33223.1| expansin AtEx6 [Arabidopsis thaliana]
 gb|AAL25606.1| At2g28950/F8N16.24 [Arabidopsis thaliana]
 gb|AAB38072.2| expansin At-EXPA6 [Arabidopsis thaliana]
 gb|AAL62401.1| expansin AtEx6 [Arabidopsis thaliana]
 gb|AAM15074.1| expansin AtEx6 [Arabidopsis thaliana]
 gb|AAO30068.1| expansin AtEx6 [Arabidopsis thaliana]
 gb|AEC08194.1| expansin A6 [Arabidopsis thaliana]
Length=257

 Score =   311 bits (797),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 147/182 (81%), Positives = 165/182 (91%), Gaps = 1/182 (1%)
 Frame = +1

Query  112  LCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVN  291
            L +++L   L    ARIPGVY+GG W+TAHATFYGG+DASGTMGGACGYGNLYSQGYGVN
Sbjct  6    LVLSVLTTILALSEARIPGVYNGGGWETAHATFYGGSDASGTMGGACGYGNLYSQGYGVN  65

Query  292  NAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCN  468
             AALSTALFNNG SCGACFE+KC++D + C  G+PSIF+TATNFCPPNFA P+DNGGWCN
Sbjct  66   TAALSTALFNNGFSCGACFELKCASDPKWCHSGSPSIFITATNFCPPNFAQPSDNGGWCN  125

Query  469  PPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGA  648
            PPRPHFDLAMPMFLKIA YRAGIVPV+FRR+PCRK+GGIRFT+NGFRYFNLVLVTNVAGA
Sbjct  126  PPRPHFDLAMPMFLKIAEYRAGIVPVSFRRVPCRKRGGIRFTINGFRYFNLVLVTNVAGA  185

Query  649  GD  654
            G+
Sbjct  186  GN  187



>ref|XP_008777004.1| PREDICTED: expansin-A4-like [Phoenix dactylifera]
Length=258

 Score =   311 bits (797),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 148/188 (79%), Positives = 169/188 (90%), Gaps = 1/188 (1%)
 Frame = +1

Query  94   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  273
            MA +R++ +A +L  L+   ARI GVY+GGAWQ+AHATFYGG+DASGTMGGACGYGNLYS
Sbjct  1    MAILRLVALASVLAFLSPAAARILGVYTGGAWQSAHATFYGGSDASGTMGGACGYGNLYS  60

Query  274  QGYGVNNAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALPND  450
            QGYGV  AALSTALFN G SCGACFEIKC++D S C  G+PSIF+TATNFCPPN+ALP+D
Sbjct  61   QGYGVETAALSTALFNEGQSCGACFEIKCADDPSWCHRGSPSIFITATNFCPPNYALPSD  120

Query  451  NGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLV  630
            NGGWCNPPRPHFDLAMPMFLKIA YRAGIVPV++RR+PCRK GGIRFT+NGF+YFNLVL+
Sbjct  121  NGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKPGGIRFTINGFQYFNLVLI  180

Query  631  TNVAGAGD  654
            TNVAGAGD
Sbjct  181  TNVAGAGD  188



>ref|XP_010510558.1| PREDICTED: expansin-A6 [Camelina sativa]
 ref|XP_010470018.1| PREDICTED: expansin-A6 [Camelina sativa]
Length=256

 Score =   311 bits (797),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 148/180 (82%), Positives = 163/180 (91%), Gaps = 1/180 (1%)
 Frame = +1

Query  118  IALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNA  297
            +  +L  L    ARIPGVY+GG W+TAHATFYGG+DASGTMGGACGYGNLYSQGYGVN A
Sbjct  7    VLFVLTILATSEARIPGVYNGGGWETAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTA  66

Query  298  ALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPP  474
            ALSTALFNNG SCGACFE+KC++D R C  G+PSIFVTATNFCPPNFA P+DNGGWCNPP
Sbjct  67   ALSTALFNNGFSCGACFELKCASDPRWCHSGSPSIFVTATNFCPPNFAQPSDNGGWCNPP  126

Query  475  RPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGD  654
            RPHFDLAMPMFLKIA YRAGIVPV+FRR+PCRK+GGIRFT+NGFRYFNLVLVTNVAGAG+
Sbjct  127  RPHFDLAMPMFLKIAEYRAGIVPVSFRRVPCRKRGGIRFTINGFRYFNLVLVTNVAGAGN  186



>ref|XP_010505357.1| PREDICTED: expansin-A3-like [Camelina sativa]
Length=262

 Score =   311 bits (797),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 151/185 (82%), Positives = 165/185 (89%), Gaps = 4/185 (2%)
 Frame = +1

Query  112  LCIALLLCS---LTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGY  282
            +C+ L + +   LTA +A+IPGVYSGG WQ AHATFYGG+DASGTMGGACGYGNLYSQGY
Sbjct  8    ICLWLAVTASFLLTATNAKIPGVYSGGPWQNAHATFYGGSDASGTMGGACGYGNLYSQGY  67

Query  283  GVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGG  459
            GVN AALSTALFNNG SCGACFEIKC++D R C PGNPSI VTATNFCPPNFA P+D+GG
Sbjct  68   GVNTAALSTALFNNGFSCGACFEIKCTDDPRWCVPGNPSILVTATNFCPPNFAQPSDDGG  127

Query  460  WCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNV  639
            WCNPPR HFDLAMPMFLKI  YRAGIVPV++RR+PCRK GGIRFTVNGFRYFNLVLVTNV
Sbjct  128  WCNPPREHFDLAMPMFLKIGLYRAGIVPVSYRRVPCRKIGGIRFTVNGFRYFNLVLVTNV  187

Query  640  AGAGD  654
            AGAGD
Sbjct  188  AGAGD  192



>ref|XP_007163413.1| hypothetical protein PHAVU_001G232600g [Phaseolus vulgaris]
 gb|ESW35407.1| hypothetical protein PHAVU_001G232600g [Phaseolus vulgaris]
Length=258

 Score =   311 bits (797),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 147/188 (78%), Positives = 166/188 (88%), Gaps = 1/188 (1%)
 Frame = +1

Query  94   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  273
            M  + +  I  LL  LT   A+IPG +SGG WQTAHATFYGG+DASGTMGGACGYGNLYS
Sbjct  1    MPMLNIFAIVSLLPFLTPSQAKIPGAFSGGPWQTAHATFYGGSDASGTMGGACGYGNLYS  60

Query  274  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPND  450
            QGYGVN AALSTALFNNG SCGACF+IKC++D + C PGNPSIFVTATNFCPPN+ALP+D
Sbjct  61   QGYGVNTAALSTALFNNGFSCGACFQIKCTHDPKWCLPGNPSIFVTATNFCPPNYALPSD  120

Query  451  NGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLV  630
            NGGWCNPPRPHFDLAMPMFLKIA YRAGIVPV++RR+ CRK+GG+RFT+NGFRYFNL+L+
Sbjct  121  NGGWCNPPRPHFDLAMPMFLKIAQYRAGIVPVSYRRVGCRKEGGMRFTMNGFRYFNLILI  180

Query  631  TNVAGAGD  654
            TNV GAGD
Sbjct  181  TNVGGAGD  188



>ref|XP_004490888.1| PREDICTED: expansin-A4-like [Cicer arietinum]
Length=260

 Score =   311 bits (797),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 147/169 (87%), Positives = 159/169 (94%), Gaps = 1/169 (1%)
 Frame = +1

Query  151  HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGL  330
             ARIPGVY+GGAWQTAHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFN GL
Sbjct  22   EARIPGVYTGGAWQTAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNEGL  81

Query  331  SCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMF  507
            SCGACFEIKCS+D + C  G+PSI VTATNFCPPN+A P+DNGGWCNPPRPHFDLAMPMF
Sbjct  82   SCGACFEIKCSDDPNWCHAGSPSILVTATNFCPPNYAQPSDNGGWCNPPRPHFDLAMPMF  141

Query  508  LKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGD  654
            LKIA YRAGIVPV++RR+PCRKQGGIRFT+NGFRYFNLVL+TNVAGAGD
Sbjct  142  LKIAQYRAGIVPVSYRRVPCRKQGGIRFTINGFRYFNLVLITNVAGAGD  190



>ref|XP_009357738.1| PREDICTED: expansin-A4-like [Pyrus x bretschneideri]
 ref|XP_009357739.1| PREDICTED: expansin-A4-like [Pyrus x bretschneideri]
Length=261

 Score =   311 bits (797),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 153/191 (80%), Positives = 168/191 (88%), Gaps = 4/191 (2%)
 Frame = +1

Query  94   MAAVR-VLCIALL--LCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGN  264
            MAA+  +LCI  L  L S   V ARIPGVY+GGAWQ AHATFYGG+DASGTMGGACGYGN
Sbjct  1    MAAMAPLLCIVSLMALASTIVVDARIPGVYTGGAWQDAHATFYGGSDASGTMGGACGYGN  60

Query  265  LYSQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFAL  441
            LYSQGYGVN AALSTALFNNGLSCGACFE+KC+N  + C  G+PSIFVTATNFCPPNFA 
Sbjct  61   LYSQGYGVNTAALSTALFNNGLSCGACFELKCANQPQWCKSGSPSIFVTATNFCPPNFAQ  120

Query  442  PNDNGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNL  621
            P+DNGGWCNPPR HFDLAMPMFLKIA YRAGIVPV++RR+PCRKQGGIRFT+NG +YFNL
Sbjct  121  PSDNGGWCNPPRTHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKQGGIRFTINGHKYFNL  180

Query  622  VLVTNVAGAGD  654
            VL+ NVAGAGD
Sbjct  181  VLIHNVAGAGD  191



>ref|XP_011077647.1| PREDICTED: expansin-A6-like [Sesamum indicum]
Length=266

 Score =   311 bits (797),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 151/194 (78%), Positives = 170/194 (88%), Gaps = 10/194 (5%)
 Frame = +1

Query  85   SGKMAAVR-VLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYG  261
            S  +AA++ +LCIA +LC +T+ +ARIPGVY+GG W+ A +      DASGTMGGACGYG
Sbjct  9    SKMVAAMKLILCIATVLCFITSAYARIPGVYTGGPWEAARS------DASGTMGGACGYG  62

Query  262  NLYSQGYGVNNAALSTALFNNGLSCGACFEIKC---SNDRSCSPGNPSIFVTATNFCPPN  432
            NLYSQGYGVN AALSTALFNNGLSCGACFEIKC    + + C+PGNPSI +TATNFCPPN
Sbjct  63   NLYSQGYGVNTAALSTALFNNGLSCGACFEIKCDAAQDAKWCNPGNPSILITATNFCPPN  122

Query  433  FALPNDNGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRY  612
            +ALPNDNGGWCNPPRPHFDLAMPMFLKIA YRAGIVPVN+RR+PCRKQGGIRFT+NGFRY
Sbjct  123  YALPNDNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVNYRRVPCRKQGGIRFTINGFRY  182

Query  613  FNLVLVTNVAGAGD  654
            FNLVLVTNVAGAGD
Sbjct  183  FNLVLVTNVAGAGD  196



>ref|NP_181300.1| expansin-A3 [Arabidopsis thaliana]
 ref|XP_004253297.1| PREDICTED: expansin-A3 [Solanum lycopersicum]
 sp|O80932.1|EXPA3_ARATH RecName: Full=Expansin-A3; Short=AtEXPA3; AltName: Full=Alpha-expansin-3; 
Short=At-EXP3; Short=AtEx3; AltName: Full=Ath-ExpAlpha-1.9; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAC23634.1| putative expansin [Arabidopsis thaliana]
 gb|AAL91271.1| At2g37640/F13M22.14 [Arabidopsis thaliana]
 gb|AAM67431.1| At2g37640/F13M22.14 [Arabidopsis thaliana]
 gb|AEC09429.1| expansin-A3 [Arabidopsis thaliana]
Length=262

 Score =   311 bits (796),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 149/173 (86%), Positives = 159/173 (92%), Gaps = 1/173 (1%)
 Frame = +1

Query  139  LTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALF  318
            LTA +A+IPGVYSGG WQ AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALF
Sbjct  20   LTATNAKIPGVYSGGPWQNAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALF  79

Query  319  NNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLA  495
            NNG SCGACFEIKC++D R C PGNPSI VTATNFCPPNFA P+D+GGWCNPPR HFDLA
Sbjct  80   NNGFSCGACFEIKCTDDPRWCVPGNPSILVTATNFCPPNFAQPSDDGGWCNPPREHFDLA  139

Query  496  MPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGD  654
            MPMFLKI  YRAGIVPV++RR+PCRK GGIRFTVNGFRYFNLVLVTNVAGAGD
Sbjct  140  MPMFLKIGLYRAGIVPVSYRRVPCRKIGGIRFTVNGFRYFNLVLVTNVAGAGD  192



>gb|KFK32246.1| hypothetical protein AALP_AA6G217100 [Arabis alpina]
Length=257

 Score =   311 bits (796),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 148/183 (81%), Positives = 166/183 (91%), Gaps = 3/183 (2%)
 Frame = +1

Query  109  VLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGV  288
            VL +  +L  LT   ARIPGVY+GG W+TAHATFYGG+DASGTMGGACGYGNLYSQGYGV
Sbjct  7    VLLVLTILADLT--EARIPGVYNGGGWETAHATFYGGSDASGTMGGACGYGNLYSQGYGV  64

Query  289  NNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWC  465
            N AALSTALFNNG SCGACFE+KC++D + C  G+PSIF+TATNFCPPNFA P+DNGGWC
Sbjct  65   NTAALSTALFNNGYSCGACFELKCASDPKWCHSGSPSIFITATNFCPPNFAQPSDNGGWC  124

Query  466  NPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAG  645
            NPPRPHFDLAMPMFLKIA YRAGIVPV+FRR+PCRK+GG+RFT+NGFRYFNLVLVTNVAG
Sbjct  125  NPPRPHFDLAMPMFLKIAEYRAGIVPVSFRRVPCRKRGGMRFTINGFRYFNLVLVTNVAG  184

Query  646  AGD  654
            AG+
Sbjct  185  AGN  187



>ref|XP_008784594.1| PREDICTED: expansin-A4-like [Phoenix dactylifera]
Length=260

 Score =   311 bits (796),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 147/177 (83%), Positives = 160/177 (90%), Gaps = 1/177 (1%)
 Frame = +1

Query  127  LLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALS  306
            LL  LT   ARIPGVY+GG WQTAHATFYGG+DASGTMGGACGYGNLYSQGYGV  AALS
Sbjct  14   LLAFLTLADARIPGVYAGGPWQTAHATFYGGSDASGTMGGACGYGNLYSQGYGVETAALS  73

Query  307  TALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPH  483
            TALFN+GLSCGACFEIKC  + R C PG+PSI +TATNFCPPN+ALP+DNGGWCNPPRPH
Sbjct  74   TALFNDGLSCGACFEIKCGEEPRWCHPGSPSILITATNFCPPNYALPSDNGGWCNPPRPH  133

Query  484  FDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGD  654
            FDLAMPMFLKIA YRAGIVPV++RR+PCRK GGIRFT+NGF YFNLVL+TNVAGAGD
Sbjct  134  FDLAMPMFLKIAQYRAGIVPVSYRRVPCRKAGGIRFTINGFEYFNLVLITNVAGAGD  190



>ref|XP_010111142.1| hypothetical protein L484_010756 [Morus notabilis]
 gb|EXC30507.1| hypothetical protein L484_010756 [Morus notabilis]
Length=258

 Score =   310 bits (795),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 147/188 (78%), Positives = 165/188 (88%), Gaps = 1/188 (1%)
 Frame = +1

Query  94   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  273
            MA +  + +  L+     V A+IPG Y GG+WQ+AHATFYGG+DASGTMGGACGYGNLYS
Sbjct  1    MAPLSFIILLSLIACAAFVDAKIPGNYGGGSWQSAHATFYGGSDASGTMGGACGYGNLYS  60

Query  274  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPND  450
            QGYGVN AALSTALFNNGLSCGACFEIKC+ND + C  G+PSI VTATNFCPPN+ALPND
Sbjct  61   QGYGVNTAALSTALFNNGLSCGACFEIKCANDPQWCHSGSPSILVTATNFCPPNYALPND  120

Query  451  NGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLV  630
            NGGWCNPPR HFDLAMPMFLKIA YRAGIVPV +RR+PCRKQGG+RFT+NGF+YFNLVL+
Sbjct  121  NGGWCNPPRSHFDLAMPMFLKIAEYRAGIVPVTYRRVPCRKQGGVRFTINGFKYFNLVLI  180

Query  631  TNVAGAGD  654
            TNVAGAGD
Sbjct  181  TNVAGAGD  188



>ref|XP_004302749.1| PREDICTED: expansin-A6 [Fragaria vesca subsp. vesca]
Length=260

 Score =   310 bits (795),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 149/185 (81%), Positives = 164/185 (89%), Gaps = 1/185 (1%)
 Frame = +1

Query  103  VRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGY  282
            +R+LCIA L   L   +ARIPG Y+GG WQ AHATFYGG+DASGTMGGACGYGNLYSQGY
Sbjct  6    LRLLCIASLASLLMVANARIPGPYTGGPWQEAHATFYGGSDASGTMGGACGYGNLYSQGY  65

Query  283  GVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGG  459
            GVN AALSTALFNNGLSCGACFEIKC +D R C+ G PSIFVTATNFCPPNFA P+DNGG
Sbjct  66   GVNTAALSTALFNNGLSCGACFEIKCGDDPRWCTAGKPSIFVTATNFCPPNFAQPSDNGG  125

Query  460  WCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNV  639
            WCNPPR HFDLAMPMFLKIA Y+AGIVPV++RR+PC K+GGIRFT+NG +YFNLVLVTNV
Sbjct  126  WCNPPRTHFDLAMPMFLKIAEYKAGIVPVSYRRVPCVKKGGIRFTINGHKYFNLVLVTNV  185

Query  640  AGAGD  654
            AGAGD
Sbjct  186  AGAGD  190



>ref|XP_002266625.1| PREDICTED: expansin-A6 [Vitis vinifera]
 emb|CAN65872.1| hypothetical protein VITISV_000251 [Vitis vinifera]
 emb|CBI30547.3| unnamed protein product [Vitis vinifera]
Length=258

 Score =   310 bits (795),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 148/170 (87%), Positives = 159/170 (94%), Gaps = 1/170 (1%)
 Frame = +1

Query  148  VHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNG  327
            VHARIPGVY+ G W++AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFN+G
Sbjct  19   VHARIPGVYTSGPWESAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNSG  78

Query  328  LSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPM  504
            LSCGACFEIKC+ND + C  G+PSIFVTATNFCPPN+ALP+DNGGWCNPPRPHFDLAMPM
Sbjct  79   LSCGACFEIKCANDPKWCHSGSPSIFVTATNFCPPNYALPSDNGGWCNPPRPHFDLAMPM  138

Query  505  FLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGD  654
            FLKIA YRAGIVPV FRR+ CRK GGIRFTVNGFRYFNLVLVTNVAGAGD
Sbjct  139  FLKIAEYRAGIVPVAFRRVSCRKSGGIRFTVNGFRYFNLVLVTNVAGAGD  188



>ref|XP_006288496.1| hypothetical protein CARUB_v10001761mg [Capsella rubella]
 gb|EOA21394.1| hypothetical protein CARUB_v10001761mg [Capsella rubella]
Length=258

 Score =   310 bits (795),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 148/188 (79%), Positives = 165/188 (88%), Gaps = 1/188 (1%)
 Frame = +1

Query  94   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  273
            MAA  +  +A++L +   VHARIPGVY+GG W  AHATFYGGADASGTMGGACGYGNLYS
Sbjct  1    MAAKVITLMAVMLATAFTVHARIPGVYTGGPWVNAHATFYGGADASGTMGGACGYGNLYS  60

Query  274  QGYGVNNAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALPND  450
            QGYGVN AALSTALFNNGLSCG+CFE+KC ND   C PGNPSI +TATNFCPPNFA  +D
Sbjct  61   QGYGVNTAALSTALFNNGLSCGSCFELKCINDPGWCLPGNPSILITATNFCPPNFAQASD  120

Query  451  NGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLV  630
            NGGWCNPPR HFDLAMPMFL IA Y+AGIVPV++RRIPCRK+GGIRFT+NGF++FNLVLV
Sbjct  121  NGGWCNPPREHFDLAMPMFLSIAKYKAGIVPVSYRRIPCRKKGGIRFTINGFKFFNLVLV  180

Query  631  TNVAGAGD  654
            TNVAGAGD
Sbjct  181  TNVAGAGD  188



>ref|XP_011077214.1| PREDICTED: expansin-A6-like [Sesamum indicum]
Length=259

 Score =   310 bits (795),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 152/189 (80%), Positives = 169/189 (89%), Gaps = 2/189 (1%)
 Frame = +1

Query  94   MAAVRVLCIALLLCSLTA-VHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLY  270
            MA +   CIA LL  L + V  RIPGVY+GGAWQTAHATFYGG+DASGTMGGACGYGNLY
Sbjct  1    MATMGFSCIAALLLLLLSYVECRIPGVYTGGAWQTAHATFYGGSDASGTMGGACGYGNLY  60

Query  271  SQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPN  447
            SQGYGVN AALSTALFNNG SCGACFEIKC ++ + C PG+PSIF+TATNFCPPN+ALPN
Sbjct  61   SQGYGVNTAALSTALFNNGFSCGACFEIKCRDEPQWCHPGSPSIFITATNFCPPNYALPN  120

Query  448  DNGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVL  627
            DNGGWCNPPR HFDLAMPMFLKIA YRAGIVPV++RR+PC K+GGIRFT+NGFRYFNLVL
Sbjct  121  DNGGWCNPPRTHFDLAMPMFLKIAEYRAGIVPVSYRRVPCHKKGGIRFTINGFRYFNLVL  180

Query  628  VTNVAGAGD  654
            ++NVAGAGD
Sbjct  181  ISNVAGAGD  189



>gb|AAP48989.1| expansin [Sambucus nigra]
Length=256

 Score =   310 bits (794),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 149/186 (80%), Positives = 165/186 (89%), Gaps = 2/186 (1%)
 Frame = +1

Query  103  VRVLCIALLLCSL-TAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQG  279
            + + CIA L+ SL + V ARIPG Y GGAW++AHATFYGG+DASGTMGGACGYGNLYSQG
Sbjct  1    MSLACIASLVISLFSVVEARIPGNYGGGAWESAHATFYGGSDASGTMGGACGYGNLYSQG  60

Query  280  YGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNG  456
            YGVN AALSTALFN G SCGACFEIKC+ND   C  G+PSI VTATNFCPPN+ALPNDNG
Sbjct  61   YGVNTAALSTALFNKGESCGACFEIKCANDPNWCHSGSPSIMVTATNFCPPNYALPNDNG  120

Query  457  GWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTN  636
            GWCNPPR HFDLAMPMFLKIA YRAGIVPV +RR+PCRKQGG+RFT+NGFRYFNLVL++N
Sbjct  121  GWCNPPRTHFDLAMPMFLKIAEYRAGIVPVAYRRVPCRKQGGVRFTINGFRYFNLVLISN  180

Query  637  VAGAGD  654
            VAGAGD
Sbjct  181  VAGAGD  186



>ref|XP_009380637.1| PREDICTED: expansin-A4 [Musa acuminata subsp. malaccensis]
Length=262

 Score =   310 bits (794),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 146/187 (78%), Positives = 165/187 (88%), Gaps = 1/187 (1%)
 Frame = +1

Query  97   AAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQ  276
            +AV      +L  S     ARIPGVY+GG WQ+AHATFYGG+DASGTMGGACGYGNLYSQ
Sbjct  6    SAVAATVALVLASSALLADARIPGVYTGGQWQSAHATFYGGSDASGTMGGACGYGNLYSQ  65

Query  277  GYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDN  453
            GYGV  AALSTALFN+GLSCGACFEIKC++D R C  G+PSIF+TATNFCPPN+ALP+D+
Sbjct  66   GYGVETAALSTALFNDGLSCGACFEIKCADDPRWCKGGSPSIFITATNFCPPNYALPSDD  125

Query  454  GGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVT  633
            GGWCNPPRPHFDLAMPMFLKIA YRAGIVPV++RR+PCRK GGIRFT+NGF+YFNLVL+T
Sbjct  126  GGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKSGGIRFTINGFQYFNLVLIT  185

Query  634  NVAGAGD  654
            NVAGAGD
Sbjct  186  NVAGAGD  192



>emb|CDY47883.1| BnaA07g14280D [Brassica napus]
Length=260

 Score =   310 bits (794),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 148/184 (80%), Positives = 164/184 (89%), Gaps = 2/184 (1%)
 Frame = +1

Query  109  VLCIALLLCSLTAV-HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYG  285
            VLCI  +L   T +   RIPGVY+GG W+TAHATFYGG+DASGTMGGACGYGNLYSQGYG
Sbjct  7    VLCILTILADFTTITEGRIPGVYNGGGWETAHATFYGGSDASGTMGGACGYGNLYSQGYG  66

Query  286  VNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGW  462
            VN AALSTALFNNG SCGACFE+KC++D + C  G+PSIFVTATNFCPPNFA P+DNGGW
Sbjct  67   VNTAALSTALFNNGYSCGACFELKCASDPKWCHSGSPSIFVTATNFCPPNFAQPSDNGGW  126

Query  463  CNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVA  642
            CNPPRPHFDLAMPMFLKIA YRAGIVPV+FRR+PCRK GG+RFT+NGFRYFNLVLVTNVA
Sbjct  127  CNPPRPHFDLAMPMFLKIAEYRAGIVPVSFRRVPCRKIGGMRFTINGFRYFNLVLVTNVA  186

Query  643  GAGD  654
            G G+
Sbjct  187  GVGN  190



>ref|XP_010557251.1| PREDICTED: expansin-A6-like [Tarenaya hassleriana]
Length=259

 Score =   310 bits (793),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 149/185 (81%), Positives = 166/185 (90%), Gaps = 3/185 (2%)
 Frame = +1

Query  103  VRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGY  282
            V VL + + L S++   ARIPGVY GGAWQ AHATFYGG+DASGTMGGACGYGNLYSQGY
Sbjct  7    VFVLTVLVGLTSMS--EARIPGVYRGGAWQNAHATFYGGSDASGTMGGACGYGNLYSQGY  64

Query  283  GVNNAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALPNDNGG  459
            GV+ AALSTALFNNG  CGACFEIKC+ND + C  G+PSIF+TATNFCPPNFALP+DNGG
Sbjct  65   GVSTAALSTALFNNGYRCGACFEIKCANDPTWCHSGSPSIFITATNFCPPNFALPSDNGG  124

Query  460  WCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNV  639
            WCNPPRPHFDLAMPMFL+IA YRAGIVPV +RR+PCRK+GGIRFT+NGFRYFNLVL+TNV
Sbjct  125  WCNPPRPHFDLAMPMFLRIAEYRAGIVPVAYRRVPCRKRGGIRFTINGFRYFNLVLITNV  184

Query  640  AGAGD  654
            AGAGD
Sbjct  185  AGAGD  189



>gb|EPS67093.1| hypothetical protein M569_07682, partial [Genlisea aurea]
Length=261

 Score =   310 bits (793),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 149/184 (81%), Positives = 161/184 (88%), Gaps = 3/184 (2%)
 Frame = +1

Query  112  LCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVN  291
            L ++  L  + + HARIPGVY+G  W++AHATFYGGADASGTMGGACGYGNLYSQGYGVN
Sbjct  8    LFVSAALSFIASSHARIPGVYAGTGWESAHATFYGGADASGTMGGACGYGNLYSQGYGVN  67

Query  292  NAALSTALFNNGLSCGACFEIKC---SNDRSCSPGNPSIFVTATNFCPPNFALPNDNGGW  462
             AALSTALFN GLSCGACFEI+C    + R CSPG PSI VTATNFCPPN+ALP+D GGW
Sbjct  68   TAALSTALFNTGLSCGACFEIRCDESQDGRWCSPGRPSISVTATNFCPPNYALPSDKGGW  127

Query  463  CNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVA  642
            CNPPRPHFDLAMPMFLKIA YRAGIV VNFRRIPCRK GGIRFTVNGFRYFNLVL+TNVA
Sbjct  128  CNPPRPHFDLAMPMFLKIAEYRAGIVAVNFRRIPCRKAGGIRFTVNGFRYFNLVLITNVA  187

Query  643  GAGD  654
            GAGD
Sbjct  188  GAGD  191



>gb|KFK36651.1| alpha-expansin 4 [Arabis alpina]
Length=261

 Score =   310 bits (793),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 148/173 (86%), Positives = 160/173 (92%), Gaps = 1/173 (1%)
 Frame = +1

Query  139  LTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALF  318
            LTA +A+IPGVY+GG WQ AHATFYGGADASGTMGGACGYGNLYSQGYGVN AALSTALF
Sbjct  19   LTASNAKIPGVYTGGPWQNAHATFYGGADASGTMGGACGYGNLYSQGYGVNTAALSTALF  78

Query  319  NNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLA  495
            NNGLSCGACFE+KC++D R C PGNPSI VTATNFCPPNFA P+D+GGWCNPPR HFDLA
Sbjct  79   NNGLSCGACFEMKCTDDPRWCVPGNPSILVTATNFCPPNFAQPSDDGGWCNPPREHFDLA  138

Query  496  MPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGD  654
            MPMFLKI  YRAGIVPV++RR+PCRK GGIRFTVNGF+YFNLVLVTNVAGAGD
Sbjct  139  MPMFLKIGIYRAGIVPVSYRRVPCRKLGGIRFTVNGFKYFNLVLVTNVAGAGD  191



>ref|XP_006366490.1| PREDICTED: expansin-A6 [Solanum tuberosum]
Length=257

 Score =   309 bits (792),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 149/182 (82%), Positives = 162/182 (89%), Gaps = 1/182 (1%)
 Frame = +1

Query  112  LCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVN  291
             C+ ++L  +  V  RIPGVYSGG+WQ AHATFYGG+DASGTMGGACGYGNLYSQGYGVN
Sbjct  6    FCLIIILVIIVGVEGRIPGVYSGGSWQNAHATFYGGSDASGTMGGACGYGNLYSQGYGVN  65

Query  292  NAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCN  468
            NAALSTALFNNGLSCGACFEIKC N  + C PG+PSI +TATNFCPPN+ALPNDNGGWCN
Sbjct  66   NAALSTALFNNGLSCGACFEIKCDNQPQWCHPGSPSILITATNFCPPNYALPNDNGGWCN  125

Query  469  PPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGA  648
            PPR HFDLAMPMFLKIA YRAGIVPV +RR+ CRKQGGIRFT+NGF YFNLVLVTNVAGA
Sbjct  126  PPRTHFDLAMPMFLKIAEYRAGIVPVVYRRVSCRKQGGIRFTINGFSYFNLVLVTNVAGA  185

Query  649  GD  654
            GD
Sbjct  186  GD  187



>ref|XP_006846223.1| hypothetical protein AMTR_s00012p00230920 [Amborella trichopoda]
 gb|ERN07898.1| hypothetical protein AMTR_s00012p00230920 [Amborella trichopoda]
Length=258

 Score =   309 bits (792),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 146/188 (78%), Positives = 166/188 (88%), Gaps = 1/188 (1%)
 Frame = +1

Query  94   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  273
            M+   VL +ALL   +    ARIPGVYSG  W++AHATFYGG+DASGTMGGACGYGNLYS
Sbjct  1    MSPKWVLALALLASIMVPAFARIPGVYSGSDWESAHATFYGGSDASGTMGGACGYGNLYS  60

Query  274  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPND  450
            QGYGV  AALSTALFN+GLSCGACFEIKC++D + C  G+PSIF+TATNFCPPN+ALP+D
Sbjct  61   QGYGVETAALSTALFNSGLSCGACFEIKCASDPKWCHSGSPSIFITATNFCPPNYALPSD  120

Query  451  NGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLV  630
            NGGWCNPPRPHFDLAMPMFLKIA YRAGIVPV++RR+ CRK GGIRFT+NGFRYFNLVL+
Sbjct  121  NGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSYRRVSCRKPGGIRFTINGFRYFNLVLI  180

Query  631  TNVAGAGD  654
            +NVAGAGD
Sbjct  181  SNVAGAGD  188



>ref|NP_001236550.1| expansin precursor [Glycine max]
 gb|AAO15999.1|AF516880_1 expansin [Glycine max]
Length=258

 Score =   309 bits (792),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 149/188 (79%), Positives = 162/188 (86%), Gaps = 1/188 (1%)
 Frame = +1

Query  94   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  273
            MAA+  + IA L+    A  ARIPGVY+GG WQ+AHATFYG +DASGTMGG CGYGNLYS
Sbjct  1    MAAIVFIHIASLVSLFVATSARIPGVYTGGPWQSAHATFYGASDASGTMGGRCGYGNLYS  60

Query  274  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPND  450
            QGYGVN AALSTALFNNGLSCGACFEIKC  D R C+PGNPSI +TATNFCPPNFALPND
Sbjct  61   QGYGVNTAALSTALFNNGLSCGACFEIKCDQDPRWCNPGNPSILITATNFCPPNFALPND  120

Query  451  NGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLV  630
            NGGWCNPPRPHFDLAMPMFLKIA YRAGIVPV +RR+PCRK GGI F +NGF  FNLVL+
Sbjct  121  NGGWCNPPRPHFDLAMPMFLKIAQYRAGIVPVAYRRVPCRKVGGINFQINGFVTFNLVLI  180

Query  631  TNVAGAGD  654
            TNVAGAG+
Sbjct  181  TNVAGAGE  188



>dbj|BAC67194.1| expansin [Pyrus communis]
Length=261

 Score =   309 bits (792),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 152/191 (80%), Positives = 167/191 (87%), Gaps = 4/191 (2%)
 Frame = +1

Query  94   MAAVR-VLCIALL--LCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGN  264
            MAA+  +LCI  L  L S   V ARIPGVY+G AWQ AHATFYGG+DASGTMGGACGYGN
Sbjct  1    MAAMAPLLCIVSLMALASTIVVDARIPGVYTGAAWQDAHATFYGGSDASGTMGGACGYGN  60

Query  265  LYSQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFAL  441
            LYSQGYGVN AALSTALFNNGLSCGACFE+KC+N  + C  G+PSIFVTATNFCPPNFA 
Sbjct  61   LYSQGYGVNTAALSTALFNNGLSCGACFELKCANQPQWCKSGSPSIFVTATNFCPPNFAQ  120

Query  442  PNDNGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNL  621
            P+DNGGWCNPPR HFDLAMPMFLKIA YRAGIVPV++RR+PCRKQGGIRFT+NG +YFNL
Sbjct  121  PSDNGGWCNPPRTHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKQGGIRFTINGHKYFNL  180

Query  622  VLVTNVAGAGD  654
            VL+ NVAGAGD
Sbjct  181  VLIHNVAGAGD  191



>ref|XP_002881524.1| ATEXPA3 [Arabidopsis lyrata subsp. lyrata]
 ref|XP_002881525.1| ATEXPA3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH57783.1| ATEXPA3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH57784.1| ATEXPA3 [Arabidopsis lyrata subsp. lyrata]
Length=262

 Score =   309 bits (791),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 148/173 (86%), Positives = 158/173 (91%), Gaps = 1/173 (1%)
 Frame = +1

Query  139  LTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALF  318
             TA +A+IPGVYSGG WQ AHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALF
Sbjct  20   FTASNAKIPGVYSGGPWQNAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALF  79

Query  319  NNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLA  495
            NNG SCGACFEIKC++D R C PGNPSI VTATNFCPPNFA P+D+GGWCNPPR HFDLA
Sbjct  80   NNGFSCGACFEIKCTDDPRWCVPGNPSILVTATNFCPPNFAQPSDDGGWCNPPREHFDLA  139

Query  496  MPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGD  654
            MPMFLKI  YRAGIVPV++RR+PCRK GGIRFTVNGFRYFNLVLVTNVAGAGD
Sbjct  140  MPMFLKIGLYRAGIVPVSYRRVPCRKIGGIRFTVNGFRYFNLVLVTNVAGAGD  192



>gb|AAM62987.1| expansin AtEx6 [Arabidopsis thaliana]
Length=257

 Score =   308 bits (790),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 146/182 (80%), Positives = 164/182 (90%), Gaps = 1/182 (1%)
 Frame = +1

Query  112  LCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVN  291
            L +++L   L    ARIPGVY+GG W+TAHATFYGG+DASGTMGGACGYGNLYSQGYGVN
Sbjct  6    LVLSVLTTILALSEARIPGVYNGGGWETAHATFYGGSDASGTMGGACGYGNLYSQGYGVN  65

Query  292  NAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCN  468
             AALSTALFNNG SCGACFE+KC++D + C  G+PSIF+TATNFCPPNFA P+DNGGWCN
Sbjct  66   TAALSTALFNNGFSCGACFELKCASDPKWCHSGSPSIFITATNFCPPNFAQPSDNGGWCN  125

Query  469  PPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGA  648
             PRPHFDLAMPMFLKIA YRAGIVPV+FRR+PCRK+GGIRFT+NGFRYFNLVLVTNVAGA
Sbjct  126  XPRPHFDLAMPMFLKIAEYRAGIVPVSFRRVPCRKRGGIRFTINGFRYFNLVLVTNVAGA  185

Query  649  GD  654
            G+
Sbjct  186  GN  187



>ref|NP_001150534.1| alpha-expansin 6 precursor [Zea mays]
 gb|ACG39445.1| alpha-expansin 6 precursor [Zea mays]
Length=263

 Score =   308 bits (790),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 149/186 (80%), Positives = 162/186 (87%), Gaps = 8/186 (4%)
 Frame = +1

Query  121  ALLLCSLTAVH-----ARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYG  285
            ALLL   TA+      ARIPGVY GG WQ+AHATFYGG+DASGTMGGACGYGNLYSQGYG
Sbjct  7    ALLLVVATAMMFSPAAARIPGVYGGGGWQSAHATFYGGSDASGTMGGACGYGNLYSQGYG  66

Query  286  VNNAALSTALFNNGLSCGACFEIKCSND---RSCSPGNPSIFVTATNFCPPNFALPNDNG  456
            VNNAALSTALFN GLSCGACFEIKC +    R C PG+PSI VTATNFCPPN+ALP+D+G
Sbjct  67   VNNAALSTALFNQGLSCGACFEIKCEDQPGWRWCRPGSPSILVTATNFCPPNYALPSDDG  126

Query  457  GWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTN  636
            GWCNPPRPHFDLAMPMFL IA YRAGIVPV +RR+PCRK GG+RFT+NGFRYFNLVL+TN
Sbjct  127  GWCNPPRPHFDLAMPMFLHIAEYRAGIVPVTYRRVPCRKSGGVRFTINGFRYFNLVLITN  186

Query  637  VAGAGD  654
            VAGAGD
Sbjct  187  VAGAGD  192



>gb|KJB46593.1| hypothetical protein B456_007G376300 [Gossypium raimondii]
Length=293

 Score =   310 bits (793),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 156/217 (72%), Positives = 172/217 (79%), Gaps = 32/217 (15%)
 Frame = +1

Query  100  AVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMG------------  243
            ++ +LC   LL   T+V+A+IPGVYS G+W+TAHATFYGG+DASGTMG            
Sbjct  7    SLALLCFTSLLPFFTSVNAKIPGVYSTGSWETAHATFYGGSDASGTMGISQITLPSPPSK  66

Query  244  -------------------GACGYGNLYSQGYGVNNAALSTALFNNGLSCGACFEIKCSN  366
                               GACGYGNLYSQGYGVN AALSTALFNNGLSCGACFEIKC++
Sbjct  67   SHIFMTLHLIVFFFCCFLGGACGYGNLYSQGYGVNTAALSTALFNNGLSCGACFEIKCAS  126

Query  367  D-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMFLKIAAYRAGIVP  543
            D R C PG+PSIFVTATNFCPPNFALP+DNGGWCNPPRPHFDLAMPMFLKIA YRAGIVP
Sbjct  127  DPRWCHPGSPSIFVTATNFCPPNFALPSDNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVP  186

Query  544  VNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGD  654
            V+FRR+PCRK GGIRFTVNGFRYFNLVL+TNVAGAGD
Sbjct  187  VSFRRVPCRKHGGIRFTVNGFRYFNLVLITNVAGAGD  223



>ref|XP_008371813.1| PREDICTED: expansin-A4-like [Malus domestica]
Length=261

 Score =   308 bits (789),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 151/191 (79%), Positives = 168/191 (88%), Gaps = 4/191 (2%)
 Frame = +1

Query  94   MAAVR-VLCIALL--LCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGN  264
            MAA+  +LCI  L  L S   V ARIPGVY+GGAWQ AHATFYGG+DASGTMGGACGYGN
Sbjct  1    MAAMAPLLCIVSLMALASTIVVDARIPGVYTGGAWQDAHATFYGGSDASGTMGGACGYGN  60

Query  265  LYSQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFAL  441
            LYSQGYGVN AALSTALFN+GLSCGACFE+KC+N  + C  G+PSIFVTATNFCPPNFA 
Sbjct  61   LYSQGYGVNTAALSTALFNSGLSCGACFELKCANQPQWCKSGSPSIFVTATNFCPPNFAQ  120

Query  442  PNDNGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNL  621
            P+D+GGWCNPPR HFDLAMPMFLKIA YRAGIVPV++RR+PCRKQGGIRFT+NG +YFNL
Sbjct  121  PSDDGGWCNPPRTHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKQGGIRFTINGHKYFNL  180

Query  622  VLVTNVAGAGD  654
            VL+ NVAGAGD
Sbjct  181  VLIHNVAGAGD  191



>ref|XP_010534508.1| PREDICTED: expansin-A4 [Tarenaya hassleriana]
Length=261

 Score =   308 bits (789),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 145/185 (78%), Positives = 164/185 (89%), Gaps = 1/185 (1%)
 Frame = +1

Query  103  VRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGY  282
            + V  + L +  L+   ARIPG+YSG AWQ+AHATFYGG+DASGTMGGACGYGNLYSQGY
Sbjct  7    ILVTALPLFVLFLSFADARIPGIYSGSAWQSAHATFYGGSDASGTMGGACGYGNLYSQGY  66

Query  283  GVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGG  459
            GVN AALSTALFNNG SCGACFEIKC+ND + C  G+PSIF+TATNFCPPNFA P+DNGG
Sbjct  67   GVNTAALSTALFNNGFSCGACFEIKCANDPQWCHSGSPSIFITATNFCPPNFAQPSDNGG  126

Query  460  WCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNV  639
            WCNPPR HFDLAMPMFLKIA YRAGIVP+++RR+PCRK+GGIRFT+NG RYFNLVL+TNV
Sbjct  127  WCNPPRAHFDLAMPMFLKIAEYRAGIVPISYRRVPCRKRGGIRFTINGHRYFNLVLITNV  186

Query  640  AGAGD  654
            AGAGD
Sbjct  187  AGAGD  191



>ref|XP_011031225.1| PREDICTED: expansin-A4-like [Populus euphratica]
Length=258

 Score =   308 bits (788),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 150/188 (80%), Positives = 167/188 (89%), Gaps = 1/188 (1%)
 Frame = +1

Query  94   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  273
            MAA   +    L+  L+ V ARIPGVY+G AWQ+AHATFYGG DASGTMGGACGYGNLYS
Sbjct  1    MAARATISFISLVLLLSLVEARIPGVYTGAAWQSAHATFYGGNDASGTMGGACGYGNLYS  60

Query  274  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPND  450
            QGYGVN AALSTALFNNGLSCGACFEIKC+N+ + C  G+PSIF+TATNFCPPN+ALP+D
Sbjct  61   QGYGVNTAALSTALFNNGLSCGACFEIKCANEPQWCHSGSPSIFITATNFCPPNYALPSD  120

Query  451  NGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLV  630
            NGGWCNPPRPHFDLAMPMFLKIA YRAGIVPV++RR+PCRK GGIRFT+NG RYFNLVL+
Sbjct  121  NGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKPGGIRFTINGHRYFNLVLI  180

Query  631  TNVAGAGD  654
            TNVAGAGD
Sbjct  181  TNVAGAGD  188



>ref|XP_009124371.1| PREDICTED: LOW QUALITY PROTEIN: expansin-A6 [Brassica rapa]
Length=260

 Score =   308 bits (788),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 147/184 (80%), Positives = 163/184 (89%), Gaps = 2/184 (1%)
 Frame = +1

Query  109  VLCIALLLCSLTAV-HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYG  285
            VLCI  +L   T +   RIPGVY+GG W+TAHATFYGG+DASGTMGGACGYGNLYSQGYG
Sbjct  7    VLCILTILADFTTITEGRIPGVYNGGGWETAHATFYGGSDASGTMGGACGYGNLYSQGYG  66

Query  286  VNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGW  462
            VN AALSTALFNNG SCGACFE+ C++D + C  G+PSIFVTATNFCPPNFA P+DNGGW
Sbjct  67   VNTAALSTALFNNGYSCGACFELXCASDPKWCHSGSPSIFVTATNFCPPNFAQPSDNGGW  126

Query  463  CNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVA  642
            CNPPRPHFDLAMPMFLKIA YRAGIVPV+FRR+PCRK GG+RFT+NGFRYFNLVLVTNVA
Sbjct  127  CNPPRPHFDLAMPMFLKIAEYRAGIVPVSFRRVPCRKIGGMRFTINGFRYFNLVLVTNVA  186

Query  643  GAGD  654
            G G+
Sbjct  187  GVGN  190



>ref|NP_001288852.1| expansin-A3 precursor [Brassica rapa]
 gb|AGM16345.1| alpha-expansin protein 3 [Brassica rapa]
 emb|CDX91376.1| BnaC04g07740D [Brassica napus]
Length=263

 Score =   307 bits (787),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 147/186 (79%), Positives = 164/186 (88%), Gaps = 2/186 (1%)
 Frame = +1

Query  103  VRVLCIALLLC-SLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQG  279
            +R + +A+     LT  +A+IPGVY+GG WQ AHATFYGG+DASGTMGGACGYGNLYSQG
Sbjct  8    IRFMWLAVTASLMLTVTNAKIPGVYTGGPWQNAHATFYGGSDASGTMGGACGYGNLYSQG  67

Query  280  YGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNG  456
            YGVN AALSTALFNNG SCGACFE+KC++D R C PGNPSI VTATNFCPPNFA P+D+G
Sbjct  68   YGVNTAALSTALFNNGFSCGACFELKCTDDPRWCVPGNPSILVTATNFCPPNFAQPSDDG  127

Query  457  GWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTN  636
            GWCNPPR HFDLAMPMFLKI  YRAGIVPV++RR+PCRK GGIRFT+NGFRYFNLVLVTN
Sbjct  128  GWCNPPREHFDLAMPMFLKIGLYRAGIVPVSYRRVPCRKLGGIRFTINGFRYFNLVLVTN  187

Query  637  VAGAGD  654
            VAGAGD
Sbjct  188  VAGAGD  193



>ref|XP_006294844.1| hypothetical protein CARUB_v10023895mg [Capsella rubella]
 gb|EOA27742.1| hypothetical protein CARUB_v10023895mg [Capsella rubella]
Length=256

 Score =   307 bits (786),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 146/169 (86%), Positives = 159/169 (94%), Gaps = 1/169 (1%)
 Frame = +1

Query  151  HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGL  330
             ARIPGVY+GG W+TAHATFYGG+DASGTMGGACGYGNLYSQGYGVN AALSTALFNNG 
Sbjct  18   EARIPGVYNGGGWETAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGF  77

Query  331  SCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMF  507
            SCGACFE+KC++D R C  G+PSIFVTATNFCPPNFA P+DNGGWCNPPRPHFDLAMPMF
Sbjct  78   SCGACFELKCASDPRWCHSGSPSIFVTATNFCPPNFAQPSDNGGWCNPPRPHFDLAMPMF  137

Query  508  LKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGD  654
            LKIA YRAGIVPV+FRR+PCRK+GGIRFT+NGFRYFNLVLVTNVAGAG+
Sbjct  138  LKIAEYRAGIVPVSFRRVPCRKRGGIRFTINGFRYFNLVLVTNVAGAGN  186



>emb|CDX74942.1| BnaA05g06880D [Brassica napus]
Length=263

 Score =   307 bits (786),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 146/186 (78%), Positives = 164/186 (88%), Gaps = 2/186 (1%)
 Frame = +1

Query  103  VRVLCIALLLC-SLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQG  279
            +R + +A+     LT  +A+IPGVY+GG WQ AHATFYGG+DASGTMGGACGYGNLYSQG
Sbjct  8    IRFMWLAVTASLMLTVTNAKIPGVYTGGPWQNAHATFYGGSDASGTMGGACGYGNLYSQG  67

Query  280  YGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNG  456
            YGVN AALSTALFNNG SCGACFE+KC++D R C PGNPSI VTATNFCPPNFA P+D+G
Sbjct  68   YGVNTAALSTALFNNGFSCGACFELKCTDDPRWCVPGNPSILVTATNFCPPNFAQPSDDG  127

Query  457  GWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTN  636
            GWCNPPR HFDLAMPMFLKI  YRAGIVPV++RR+PCRK GGIRFT+NGFRYFNL+LVTN
Sbjct  128  GWCNPPREHFDLAMPMFLKIGLYRAGIVPVSYRRVPCRKLGGIRFTINGFRYFNLILVTN  187

Query  637  VAGAGD  654
            VAGAGD
Sbjct  188  VAGAGD  193



>ref|XP_002312101.1| alpha-expansin 9 precursor family protein [Populus trichocarpa]
 gb|EEE89468.1| alpha-expansin 9 precursor family protein [Populus trichocarpa]
Length=258

 Score =   306 bits (784),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 144/169 (85%), Positives = 158/169 (93%), Gaps = 1/169 (1%)
 Frame = +1

Query  151  HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGL  330
             ARIPGVY+G AWQ+AHATFYGG DASGTMGGACGYGNLYSQGYGVN AALSTALFNNGL
Sbjct  20   EARIPGVYTGAAWQSAHATFYGGNDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGL  79

Query  331  SCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMF  507
            SCGACFEIKC+N+ + C  G+PSIF+TATNFCPPN+ALP+DNGGWCNPPRPHFDLAMPMF
Sbjct  80   SCGACFEIKCANEPQWCHSGSPSIFITATNFCPPNYALPSDNGGWCNPPRPHFDLAMPMF  139

Query  508  LKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGD  654
            LKIA YRAGIVPV++RR+PCRK GGIRFT+NG RYFNLVL+TNVAGAGD
Sbjct  140  LKIAEYRAGIVPVSYRRVPCRKPGGIRFTINGHRYFNLVLITNVAGAGD  188



>ref|XP_006411198.1| hypothetical protein EUTSA_v10017119mg [Eutrema salsugineum]
 gb|ESQ52651.1| hypothetical protein EUTSA_v10017119mg [Eutrema salsugineum]
Length=258

 Score =   306 bits (784),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 144/188 (77%), Positives = 164/188 (87%), Gaps = 1/188 (1%)
 Frame = +1

Query  94   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  273
            MA V+++ +      L    A+IPGVYSGGAWQTAHATFYGG+DASGTMGGACGYGNLYS
Sbjct  1    MAIVKLVILFTTFLFLNIADAKIPGVYSGGAWQTAHATFYGGSDASGTMGGACGYGNLYS  60

Query  274  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPND  450
            QGYG N AALSTALFNNG+SCGACFE+KC+ND + C  G+PSI +TATNFCPPN A P+D
Sbjct  61   QGYGTNTAALSTALFNNGMSCGACFELKCANDPQWCHSGSPSILITATNFCPPNLAQPSD  120

Query  451  NGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLV  630
            NGGWCNPPR HFDLAMP+FLKIA YRAGIVPV++RR+PCRK+GGIRFT+NG RYFNLVL+
Sbjct  121  NGGWCNPPRAHFDLAMPVFLKIAQYRAGIVPVSYRRVPCRKRGGIRFTINGHRYFNLVLI  180

Query  631  TNVAGAGD  654
            TNVAGAGD
Sbjct  181  TNVAGAGD  188



>ref|XP_004145295.1| PREDICTED: expansin-A4-like [Cucumis sativus]
Length=258

 Score =   306 bits (784),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 148/183 (81%), Positives = 164/183 (90%), Gaps = 2/183 (1%)
 Frame = +1

Query  109  VLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGV  288
            +LCIA L+ ++    ARIPG+YSGG W++AHATFYGG+DASGTMG  CGYGNLYSQGYGV
Sbjct  7    LLCIASLISTMWPAAARIPGIYSGGPWESAHATFYGGSDASGTMG-RCGYGNLYSQGYGV  65

Query  289  NNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWC  465
            N AALSTALFNNGLSCGACFEIKC+ND R C  G+PSI +TATNFCPPNFALP+DNGGWC
Sbjct  66   NTAALSTALFNNGLSCGACFEIKCANDPRWCHSGSPSIVITATNFCPPNFALPSDNGGWC  125

Query  466  NPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAG  645
            NPPRPHFDLAMPMFLKIA YRAGIVPV +RR+ CRK GGIRFT++GFRYFNLVLVTNVAG
Sbjct  126  NPPRPHFDLAMPMFLKIAEYRAGIVPVAYRRVGCRKPGGIRFTIHGFRYFNLVLVTNVAG  185

Query  646  AGD  654
            AGD
Sbjct  186  AGD  188



>ref|XP_008799850.1| PREDICTED: expansin-A6-like [Phoenix dactylifera]
Length=260

 Score =   306 bits (783),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 146/177 (82%), Positives = 159/177 (90%), Gaps = 1/177 (1%)
 Frame = +1

Query  127  LLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALS  306
            LL  LT   ARIPGVY+GG WQ AHATFYGG+DASGTMGGACGYGNLYSQGYGV  AALS
Sbjct  14   LLAFLTLGDARIPGVYTGGPWQQAHATFYGGSDASGTMGGACGYGNLYSQGYGVETAALS  73

Query  307  TALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPH  483
            TALFN+G SCGACFEIKC  D + C  G+PSIF+TATNFCPPN+ALP+DNGGWCNPPRPH
Sbjct  74   TALFNDGQSCGACFEIKCGEDLKWCHHGSPSIFITATNFCPPNYALPSDNGGWCNPPRPH  133

Query  484  FDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGD  654
            FDLAMPMFLKIA YRAGIVPV++RR+PCRK GGIRFT+NGF+YFNLVLVTNVAGAGD
Sbjct  134  FDLAMPMFLKIAEYRAGIVPVSYRRVPCRKPGGIRFTINGFKYFNLVLVTNVAGAGD  190



>ref|XP_006294816.1| hypothetical protein CARUB_v10023867mg [Capsella rubella]
 gb|EOA27714.1| hypothetical protein CARUB_v10023867mg [Capsella rubella]
Length=262

 Score =   306 bits (784),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 150/185 (81%), Positives = 162/185 (88%), Gaps = 4/185 (2%)
 Frame = +1

Query  112  LCIALLLCS---LTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGY  282
            +C+ L + +   LTA  A+I GVYSGG WQ AHATFYGG+DASGTMGGACGYGNLYSQGY
Sbjct  8    ICLWLAVTASFLLTASDAKIAGVYSGGPWQNAHATFYGGSDASGTMGGACGYGNLYSQGY  67

Query  283  GVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGG  459
            GVN AALSTALFNNG SCGACFEIKC++D R C PGNPSI VTATNFCPPNFA  +DNGG
Sbjct  68   GVNTAALSTALFNNGYSCGACFEIKCTDDPRWCVPGNPSILVTATNFCPPNFAQASDNGG  127

Query  460  WCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNV  639
            WCNPPR HFDLAMPMFLKI  YRAGIVPV++RR+PCRK GGIRFTVNGFRYFNLVLVTNV
Sbjct  128  WCNPPREHFDLAMPMFLKIGLYRAGIVPVSYRRVPCRKVGGIRFTVNGFRYFNLVLVTNV  187

Query  640  AGAGD  654
            AGAGD
Sbjct  188  AGAGD  192



>ref|XP_010931278.1| PREDICTED: LOW QUALITY PROTEIN: expansin-A7 [Elaeis guineensis]
Length=258

 Score =   306 bits (783),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 143/188 (76%), Positives = 167/188 (89%), Gaps = 1/188 (1%)
 Frame = +1

Query  94   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  273
            M  +R++ +A +L   +   ARI GV++GG WQ+AHATFYGG+DASGTMGGACGYGNLYS
Sbjct  1    MGIMRLVALASILAFFSPAAARIMGVFTGGPWQSAHATFYGGSDASGTMGGACGYGNLYS  60

Query  274  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPND  450
            QGYGV  AALSTALFN+G SCGACFEIKC ++ + C PG+PSIF+TATNFCPPN+ALP+D
Sbjct  61   QGYGVETAALSTALFNDGQSCGACFEIKCVDEPQWCHPGSPSIFITATNFCPPNYALPSD  120

Query  451  NGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLV  630
            NGGWCNPPRPHFDLAMPMFLKIA YRAGIVPV++RR+PCRK GGIRFT+NGF+YFNLVL+
Sbjct  121  NGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKPGGIRFTINGFQYFNLVLI  180

Query  631  TNVAGAGD  654
            TNVAGAGD
Sbjct  181  TNVAGAGD  188



>emb|CDY07642.1| BnaA03g18690D [Brassica napus]
Length=258

 Score =   306 bits (783),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 143/188 (76%), Positives = 162/188 (86%), Gaps = 1/188 (1%)
 Frame = +1

Query  94   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  273
            MA  ++  +       T   A+IPGVYSGGAWQTAHATFYGG+DASGTMGGACGYGNLYS
Sbjct  1    MAITKLAVLFTTFVLFTLTDAKIPGVYSGGAWQTAHATFYGGSDASGTMGGACGYGNLYS  60

Query  274  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPND  450
            QGYG N AALSTALFNNG+SCGACFE+KC+ND + C  G+PSI +TATNFCPPNFA  +D
Sbjct  61   QGYGTNTAALSTALFNNGMSCGACFELKCANDPQWCHSGSPSILITATNFCPPNFAQASD  120

Query  451  NGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLV  630
            NGGWCNPPR HFDLAMP+FLKIA YRAGIVPV++RR+PCRK+GGIRFT+NG RYFNLVL+
Sbjct  121  NGGWCNPPREHFDLAMPVFLKIAQYRAGIVPVSYRRVPCRKRGGIRFTINGHRYFNLVLI  180

Query  631  TNVAGAGD  654
            TNVAGAGD
Sbjct  181  TNVAGAGD  188



>gb|ABK93541.1| unknown [Populus trichocarpa]
Length=258

 Score =   305 bits (782),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 144/169 (85%), Positives = 158/169 (93%), Gaps = 1/169 (1%)
 Frame = +1

Query  151  HARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGL  330
             ARIPGVY+G AWQ+AHATFYGG DASGTMGGACGYGNLYSQGYGVN AALSTALFNNGL
Sbjct  20   EARIPGVYTGAAWQSAHATFYGGNDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGL  79

Query  331  SCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMF  507
            SCGACFEIKC+N+ + C  G+PSIF+TATNFCPPN+ALP+DNGGWCNPPRPHFDLAMPMF
Sbjct  80   SCGACFEIKCANEPQWCHSGSPSIFITATNFCPPNYALPSDNGGWCNPPRPHFDLAMPMF  139

Query  508  LKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGD  654
            LKIA YRAGIVPV++RR+PCRK GGIRFT+NG RYFNLVL+TNVAGAGD
Sbjct  140  LKIAEYRAGIVPVSYRRVPCRKPGGIRFTINGHRYFNLVLITNVAGAGD  188



>ref|XP_010111457.1| hypothetical protein L484_021280 [Morus notabilis]
 gb|EXC30980.1| hypothetical protein L484_021280 [Morus notabilis]
Length=263

 Score =   305 bits (782),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 152/193 (79%), Positives = 168/193 (87%), Gaps = 6/193 (3%)
 Frame = +1

Query  94   MAAVRVLCIALLLCSLTA-----VHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGY  258
            MAA+  L I L + SL +       ARI GVY+G  W +AHATFYGG+DASGTMGGACGY
Sbjct  1    MAALFTLPILLPIASLLSLLFLSADARIGGVYTGSPWDSAHATFYGGSDASGTMGGACGY  60

Query  259  GNLYSQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNF  435
            GNLYSQGYGVN AALSTALFNNGLSCG+CFE+KC  D + C PG+PSIF+TATNFCPPNF
Sbjct  61   GNLYSQGYGVNTAALSTALFNNGLSCGSCFELKCDGDPKWCHPGSPSIFITATNFCPPNF  120

Query  436  ALPNDNGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYF  615
            ALPNDNGGWCNPPRPHFDLAMPMFLKIA YRAGIVPV++RR+PCRKQGGIRFT+NGFRYF
Sbjct  121  ALPNDNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCRKQGGIRFTINGFRYF  180

Query  616  NLVLVTNVAGAGD  654
            NLVLVTNVAGAG+
Sbjct  181  NLVLVTNVAGAGN  193



>gb|KHN33378.1| Expansin-A4 [Glycine soja]
Length=254

 Score =   305 bits (781),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 149/192 (78%), Positives = 165/192 (86%), Gaps = 13/192 (7%)
 Frame = +1

Query  109  VLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYG---------  261
            VLC+  L+     V ARIPGVY+GGAWQ+AHATFYGG+DASGTMGGACGYG         
Sbjct  7    VLCLMSLM---WMVEARIPGVYTGGAWQSAHATFYGGSDASGTMGGACGYGWVCGACGYG  63

Query  262  NLYSQGYGVNNAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFA  438
            NLYSQGYGVN AALSTALFN+GLSCGACFEIKC+ND+  C  G+PSIF+TATNFCP N+A
Sbjct  64   NLYSQGYGVNTAALSTALFNSGLSCGACFEIKCANDKQWCHSGSPSIFITATNFCPSNYA  123

Query  439  LPNDNGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFN  618
            LPNDNGGWCNPPRPHFDLAMPMFLKIA YRAGIVPV +RR+ CRK GGIRFT+NGFRYFN
Sbjct  124  LPNDNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVAYRRVACRKHGGIRFTINGFRYFN  183

Query  619  LVLVTNVAGAGD  654
            LVL++NVAGAGD
Sbjct  184  LVLISNVAGAGD  195



>ref|XP_010937609.1| PREDICTED: expansin-A4 [Elaeis guineensis]
Length=260

 Score =   305 bits (782),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 144/180 (80%), Positives = 161/180 (89%), Gaps = 1/180 (1%)
 Frame = +1

Query  118  IALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNA  297
            +  LL   T   ARIPGVY+G +WQ AHATFYGG+DASGTMGGACGYGNLYSQGYGV  A
Sbjct  11   VMTLLAFATLGDARIPGVYTGESWQKAHATFYGGSDASGTMGGACGYGNLYSQGYGVETA  70

Query  298  ALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPP  474
            ALSTALFN+GLSCGACFEIKC++D + C  G PSIF+TATNFCPPN+ALP+DNGGWCNPP
Sbjct  71   ALSTALFNDGLSCGACFEIKCADDPQWCHHGGPSIFITATNFCPPNYALPSDNGGWCNPP  130

Query  475  RPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGD  654
            RPHFDLAMPMFLKIA YRAGIVPV++RR+PCRK GGIRFT+NGF+YFNLVL+TNVAGAGD
Sbjct  131  RPHFDLAMPMFLKIAQYRAGIVPVSYRRVPCRKSGGIRFTINGFKYFNLVLITNVAGAGD  190



>gb|ACF87150.1| unknown [Zea mays]
 gb|AFW67135.1| alpha-expansin 6 [Zea mays]
Length=265

 Score =   305 bits (782),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 143/170 (84%), Positives = 155/170 (91%), Gaps = 3/170 (2%)
 Frame = +1

Query  154  ARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLS  333
            ARIPGVY GG WQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGVNNAALSTALFN GLS
Sbjct  25   ARIPGVYGGGGWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNNAALSTALFNQGLS  84

Query  334  CGACFEIKCSND---RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPM  504
            CGACFEIKC +    R C PG+PSI VTATNFCPPN+ALP+D+GGWCNPPRPHFDLAMPM
Sbjct  85   CGACFEIKCEDQPGWRWCRPGSPSILVTATNFCPPNYALPSDDGGWCNPPRPHFDLAMPM  144

Query  505  FLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGD  654
            FL IA YRAGIVPV +RR+PCRK GG+RFT+NGFRYFNLVL+TNVAGAGD
Sbjct  145  FLHIAEYRAGIVPVTYRRVPCRKSGGVRFTINGFRYFNLVLITNVAGAGD  194



>gb|AAV85475.1| expansin [Populus tomentosa]
Length=258

 Score =   305 bits (781),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 148/188 (79%), Positives = 167/188 (89%), Gaps = 1/188 (1%)
 Frame = +1

Query  94   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  273
            MAA   +    L+  L+ V ARIPGVY+G  WQ+AHATFYGG+DASGTMGGACGYGNLYS
Sbjct  1    MAARATISFISLVLLLSLVEARIPGVYTGADWQSAHATFYGGSDASGTMGGACGYGNLYS  60

Query  274  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPND  450
            QGYGVN AALSTALFNNGLSCGACFEIKC+N+ + C  G+PSIF+TATNFCPPN+ALP+D
Sbjct  61   QGYGVNTAALSTALFNNGLSCGACFEIKCANEPQWCHSGSPSIFITATNFCPPNYALPSD  120

Query  451  NGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLV  630
            NGGWCNPPRPHFDLAMPMFLKIA YRAGIVPV++RR+PCR+ GGIRFT+NG RYFNLVL+
Sbjct  121  NGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPVSYRRVPCREPGGIRFTINGHRYFNLVLI  180

Query  631  TNVAGAGD  654
            TNVAGAGD
Sbjct  181  TNVAGAGD  188



>ref|XP_010423881.1| PREDICTED: expansin-A9-like [Camelina sativa]
Length=258

 Score =   305 bits (781),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 145/188 (77%), Positives = 165/188 (88%), Gaps = 1/188 (1%)
 Frame = +1

Query  94   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  273
            MAA  +  +A+++ +   V+A+IPGVY+GG W  AHATFYGGADASGTMGGACGYGNLYS
Sbjct  1    MAAKVLTLMAVMVVTALTVNAKIPGVYNGGPWVNAHATFYGGADASGTMGGACGYGNLYS  60

Query  274  QGYGVNNAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALPND  450
            QGYGVN AALSTALFNNGLSCG+CFE+KC ND   C PGNPSI +TATNFCPPNFA  +D
Sbjct  61   QGYGVNTAALSTALFNNGLSCGSCFELKCVNDPGWCLPGNPSILITATNFCPPNFAQASD  120

Query  451  NGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLV  630
            NGGWCNPPR HFDLAMPMFL IA Y+AGIVPV++RRIPCRK+GGIRFT+NGF++FNLVLV
Sbjct  121  NGGWCNPPREHFDLAMPMFLSIAKYKAGIVPVSYRRIPCRKKGGIRFTINGFKFFNLVLV  180

Query  631  TNVAGAGD  654
            TNVAGAGD
Sbjct  181  TNVAGAGD  188



>ref|XP_002463623.1| hypothetical protein SORBIDRAFT_01g003120 [Sorghum bicolor]
 gb|EER90621.1| hypothetical protein SORBIDRAFT_01g003120 [Sorghum bicolor]
Length=262

 Score =   305 bits (781),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 143/170 (84%), Positives = 156/170 (92%), Gaps = 3/170 (2%)
 Frame = +1

Query  154  ARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLS  333
            ARIPGVY GG WQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGVNNAALSTALFN GLS
Sbjct  23   ARIPGVYGGGGWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNNAALSTALFNEGLS  82

Query  334  CGACFEIKCSND---RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPM  504
            CGACFE+KC N    R C PG+PSI VTATNFCPPN+ALP+D+GGWCNPPRPHFDLAMPM
Sbjct  83   CGACFELKCENQPGWRWCRPGSPSILVTATNFCPPNYALPSDDGGWCNPPRPHFDLAMPM  142

Query  505  FLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGD  654
            FL IA YRAGIVPV++RR+PCRK GG+RFT+NGFRYFNLVL+TNVAGAGD
Sbjct  143  FLHIAEYRAGIVPVSYRRVPCRKSGGVRFTINGFRYFNLVLITNVAGAGD  192



>ref|XP_010452058.1| PREDICTED: expansin-A9-like [Camelina sativa]
Length=258

 Score =   305 bits (781),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 145/188 (77%), Positives = 165/188 (88%), Gaps = 1/188 (1%)
 Frame = +1

Query  94   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  273
            MAA  +  +A+++ +   V+A+IPGVY+GG W  AHATFYGGADASGTMGGACGYGNLYS
Sbjct  1    MAAKVLTLMAVMVATALTVNAKIPGVYNGGPWINAHATFYGGADASGTMGGACGYGNLYS  60

Query  274  QGYGVNNAALSTALFNNGLSCGACFEIKCSNDRS-CSPGNPSIFVTATNFCPPNFALPND  450
            QGYGVN AALSTALFNNGLSCG+CFE+KC ND   C PGNPSI +TATNFCPPNFA  +D
Sbjct  61   QGYGVNTAALSTALFNNGLSCGSCFELKCVNDPGWCLPGNPSILITATNFCPPNFAQASD  120

Query  451  NGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLV  630
            NGGWCNPPR HFDLAMPMFL IA Y+AGIVPV++RRIPCRK+GGIRFT+NGF++FNLVLV
Sbjct  121  NGGWCNPPREHFDLAMPMFLSIAKYKAGIVPVSYRRIPCRKKGGIRFTINGFKFFNLVLV  180

Query  631  TNVAGAGD  654
            TNVAGAGD
Sbjct  181  TNVAGAGD  188



>gb|ACA05164.1| expansin 1 [Dimocarpus longan]
Length=256

 Score =   305 bits (780),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 151/188 (80%), Positives = 164/188 (87%), Gaps = 3/188 (2%)
 Frame = +1

Query  94   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  273
            MA   VLC  L L  LTA +A+IPGVY+G  W++ HATFYGG+DASGTMGGACGYGNLYS
Sbjct  1    MAVFNVLCF-LSLLFLTA-NAKIPGVYTGSPWESGHATFYGGSDASGTMGGACGYGNLYS  58

Query  274  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPND  450
            QGYGVN AALSTALFN+GLSCGACFE+KC  D R C PGNPSI VTATNFCPPNFA P+D
Sbjct  59   QGYGVNTAALSTALFNSGLSCGACFELKCVADPRWCLPGNPSILVTATNFCPPNFAQPSD  118

Query  451  NGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLV  630
            NGGWCNPPR HFDLAMPMF  IA YRAGIVPV++RR+PCRKQGGIRFT+NGFRYFNLVLV
Sbjct  119  NGGWCNPPRTHFDLAMPMFFAIAQYRAGIVPVSYRRVPCRKQGGIRFTINGFRYFNLVLV  178

Query  631  TNVAGAGD  654
            TNVAGAGD
Sbjct  179  TNVAGAGD  186



>ref|XP_010532011.1| PREDICTED: expansin-A4-like [Tarenaya hassleriana]
Length=261

 Score =   305 bits (780),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 146/186 (78%), Positives = 164/186 (88%), Gaps = 3/186 (2%)
 Frame = +1

Query  106  RVL--CIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQG  279
            R+L   + L +   +   ARIPGVYSGGAWQ+AHATFYGG DASGTMGGACGYGNLYSQG
Sbjct  6    RILLNTLPLFVLFFSFADARIPGVYSGGAWQSAHATFYGGNDASGTMGGACGYGNLYSQG  65

Query  280  YGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNG  456
            YGVN AALSTALFNNG SCGACFEIKC++D + C  G+PSIF+TATNFCPPNFA P+DNG
Sbjct  66   YGVNTAALSTALFNNGFSCGACFEIKCADDPQWCHSGSPSIFITATNFCPPNFAQPSDNG  125

Query  457  GWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTN  636
            GWCNPPR HFDLAMPMFLK+A YRAGIVPV++RR+PCRK+GGIRFT+NG RYFNLVL+TN
Sbjct  126  GWCNPPRAHFDLAMPMFLKLAEYRAGIVPVSYRRVPCRKRGGIRFTINGHRYFNLVLITN  185

Query  637  VAGAGD  654
            VAGAGD
Sbjct  186  VAGAGD  191



>gb|EYU26594.1| hypothetical protein MIMGU_mgv1a012061mg [Erythranthe guttata]
Length=262

 Score =   305 bits (780),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 145/189 (77%), Positives = 164/189 (87%), Gaps = 3/189 (2%)
 Frame = +1

Query  97   AAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQ  276
            AA  +L I  +LC +T   A+I GVY+GG WQ AHATFYGG+DASGTMGGACGYGNLYSQ
Sbjct  4    AATLLLYIGSILCFITTARAKIFGVYAGGPWQNAHATFYGGSDASGTMGGACGYGNLYSQ  63

Query  277  GYGVNNAALSTALFNNGLSCGACFEIKC---SNDRSCSPGNPSIFVTATNFCPPNFALPN  447
            GYGVN AALSTALFNNGLSCGACFEIKC    + +SC+PG+PSI +TATNFCPPN ALPN
Sbjct  64   GYGVNTAALSTALFNNGLSCGACFEIKCDAAQDSKSCNPGSPSILITATNFCPPNNALPN  123

Query  448  DNGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVL  627
            DNGGWCNPPR HFDLA+PMF+KIA +RAGIV VN+RR+ CRKQGG+RFTVNG +YFNLVL
Sbjct  124  DNGGWCNPPRTHFDLAVPMFIKIAEFRAGIVAVNYRRVACRKQGGVRFTVNGSKYFNLVL  183

Query  628  VTNVAGAGD  654
            +TNVAGAGD
Sbjct  184  ITNVAGAGD  192



>ref|XP_010558331.1| PREDICTED: expansin-A9 [Tarenaya hassleriana]
Length=268

 Score =   305 bits (780),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 148/189 (78%), Positives = 163/189 (86%), Gaps = 3/189 (2%)
 Frame = +1

Query  91   KMAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLY  270
            K+ AV     A  L +   V A+IPGVYSGG W  AHATFYGGADASGTMGGACGYGNLY
Sbjct  11   KLVAVVPAVTASFLAA--EVDAKIPGVYSGGPWIDAHATFYGGADASGTMGGACGYGNLY  68

Query  271  SQGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPN  447
            SQGYGVN AALSTALFNNGLSCGACFE+KC +D R C PGNPSI +TATNFCPPNFA  +
Sbjct  69   SQGYGVNTAALSTALFNNGLSCGACFELKCIDDPRWCLPGNPSILITATNFCPPNFAQAS  128

Query  448  DNGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVL  627
            DNGGWCNPPR HFDLAMPMFLK+A Y+AGIVPV++RR+PCRK+GGIRFT+NGF+YFNLVL
Sbjct  129  DNGGWCNPPREHFDLAMPMFLKLAQYKAGIVPVSYRRVPCRKKGGIRFTINGFKYFNLVL  188

Query  628  VTNVAGAGD  654
            VTNVAGAGD
Sbjct  189  VTNVAGAGD  197



>ref|XP_004981242.1| PREDICTED: expansin-A7-like [Setaria italica]
Length=262

 Score =   303 bits (777),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 144/169 (85%), Positives = 155/169 (92%), Gaps = 3/169 (2%)
 Frame = +1

Query  157  RIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNGLSC  336
            RIPGVY GGAWQ+AHATFYGG+DASGTMGGACGYGNLYSQGYGVNNAALSTALFN G SC
Sbjct  24   RIPGVYGGGAWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNNAALSTALFNEGQSC  83

Query  337  GACFEIKCSND---RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPMF  507
            GACFEIKC N    R C PG+PSI VTATNFCPPN+ALP+D+GGWCNPPRPHFDLAMPMF
Sbjct  84   GACFEIKCENQPGWRWCHPGSPSILVTATNFCPPNYALPSDDGGWCNPPRPHFDLAMPMF  143

Query  508  LKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGD  654
            L IA YRAGIVPV++RR+PCRK GGIRFT+NGFRYFNLVL+TNVAGAGD
Sbjct  144  LHIAEYRAGIVPVSYRRVPCRKSGGIRFTINGFRYFNLVLITNVAGAGD  192



>ref|XP_009409019.1| PREDICTED: expansin-A4-like [Musa acuminata subsp. malaccensis]
Length=257

 Score =   303 bits (776),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 144/188 (77%), Positives = 164/188 (87%), Gaps = 2/188 (1%)
 Frame = +1

Query  94   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  273
            MA    + +ALL   L  V ARIPG+Y+GG WQ AHATFYGG+DASGTMGGACGYGNLYS
Sbjct  1    MALASFVSVALLAL-LAPVTARIPGLYAGGQWQNAHATFYGGSDASGTMGGACGYGNLYS  59

Query  274  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPND  450
            QGYGV  AALSTALFN G SCGACFEIKC+ D + C  G+PSIF+TATNFCPPN+ALP+D
Sbjct  60   QGYGVQTAALSTALFNEGQSCGACFEIKCAGDPQWCHGGSPSIFITATNFCPPNYALPSD  119

Query  451  NGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLV  630
            +GGWCNPPRPHFDL+MPMFLKIA YRAGIVPV++RR+PCR+ GGIRFT+NGF+YFNLVL+
Sbjct  120  DGGWCNPPRPHFDLSMPMFLKIAEYRAGIVPVSYRRVPCRRSGGIRFTINGFKYFNLVLI  179

Query  631  TNVAGAGD  654
            TNVAGAGD
Sbjct  180  TNVAGAGD  187



>emb|CDY07024.1| BnaA04g22910D [Brassica napus]
Length=258

 Score =   303 bits (776),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 142/188 (76%), Positives = 162/188 (86%), Gaps = 1/188 (1%)
 Frame = +1

Query  94   MAAVRVLCIALLLCSLTAVHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYS  273
            MA  ++  +       T   A+IPGVYSGGAWQTAHATFYGG+DASGTMGGACGYGNLYS
Sbjct  1    MAITKLAVLFTTFVLFTLTDAKIPGVYSGGAWQTAHATFYGGSDASGTMGGACGYGNLYS  60

Query  274  QGYGVNNAALSTALFNNGLSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPND  450
            QGYG N AALSTALFN+G+SCGACFE+KC+ND + C  G+PSI +TATNFCPPNFA  +D
Sbjct  61   QGYGTNTAALSTALFNSGMSCGACFELKCANDPQWCHSGSPSILITATNFCPPNFAQASD  120

Query  451  NGGWCNPPRPHFDLAMPMFLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLV  630
            NGGWCNPPR HFDLAMP+FLKIA YRAGIVPV++RR+PCRK+GGIRFT+NG RYFNLVL+
Sbjct  121  NGGWCNPPRAHFDLAMPVFLKIAQYRAGIVPVSYRRVPCRKRGGIRFTINGHRYFNLVLI  180

Query  631  TNVAGAGD  654
            TNVAGAGD
Sbjct  181  TNVAGAGD  188



>dbj|BAE06067.1| expansin [Sagittaria pygmaea]
Length=266

 Score =   303 bits (776),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 143/170 (84%), Positives = 154/170 (91%), Gaps = 1/170 (1%)
 Frame = +1

Query  148  VHARIPGVYSGGAWQTAHATFYGGADASGTMGGACGYGNLYSQGYGVNNAALSTALFNNG  327
            V AR+PGVYSG  WQ AHATFYGG+DASGTMGGACGYGNLYSQGYGV  AALSTALFN G
Sbjct  27   VDARVPGVYSGSEWQQAHATFYGGSDASGTMGGACGYGNLYSQGYGVQTAALSTALFNQG  86

Query  328  LSCGACFEIKCSND-RSCSPGNPSIFVTATNFCPPNFALPNDNGGWCNPPRPHFDLAMPM  504
            LSCGACFEIKC+ND + C  G PSIF+TATNFCPPN+ALP+DNGGWCNPPRPHFDLAMPM
Sbjct  87   LSCGACFEIKCANDPQWCHGGGPSIFITATNFCPPNYALPSDNGGWCNPPRPHFDLAMPM  146

Query  505  FLKIAAYRAGIVPVNFRRIPCRKQGGIRFTVNGFRYFNLVLVTNVAGAGD  654
            FLKIA YRAGIVPV +RR+PCRK GGIRFT+NG RYFNLVL+TNVAGAGD
Sbjct  147  FLKIAQYRAGIVPVQYRRVPCRKSGGIRFTINGHRYFNLVLITNVAGAGD  196



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1014965446875