BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF047C12

Length=726
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009611378.1|  PREDICTED: zinc finger CCCH domain-containin...    176   2e-69   Nicotiana tomentosiformis
ref|XP_009611380.1|  PREDICTED: zinc finger CCCH domain-containin...    176   3e-69   Nicotiana tomentosiformis
ref|XP_009793876.1|  PREDICTED: zinc finger CCCH domain-containin...    176   4e-69   Nicotiana sylvestris
ref|XP_011014133.1|  PREDICTED: zinc finger CCCH domain-containin...    176   7e-69   Populus euphratica
ref|XP_006376056.1|  hypothetical protein POPTR_0013s08490g             176   1e-68   
ref|XP_002512627.1|  nucleic acid binding protein, putative             177   2e-68   Ricinus communis
ref|XP_006353234.1|  PREDICTED: zinc finger CCCH domain-containin...    174   2e-68   Solanum tuberosum [potatoes]
gb|KDP23293.1|  hypothetical protein JCGZ_23126                         175   2e-68   Jatropha curcas
ref|XP_011015459.1|  PREDICTED: zinc finger CCCH domain-containin...    175   2e-68   Populus euphratica
ref|XP_008218439.1|  PREDICTED: zinc finger CCCH domain-containin...    177   3e-68   Prunus mume [ume]
ref|XP_007205202.1|  hypothetical protein PRUPE_ppa005813mg             177   3e-68   Prunus persica
ref|XP_004250094.1|  PREDICTED: zinc finger CCCH domain-containin...    174   4e-68   Solanum lycopersicum
emb|CDP04213.1|  unnamed protein product                                173   7e-68   Coffea canephora [robusta coffee]
ref|XP_009611374.1|  PREDICTED: zinc finger CCCH domain-containin...    176   1e-67   Nicotiana tomentosiformis
ref|XP_009611379.1|  PREDICTED: zinc finger CCCH domain-containin...    176   2e-67   Nicotiana tomentosiformis
ref|XP_008359920.1|  PREDICTED: zinc finger CCCH domain-containin...    175   2e-67   Malus domestica [apple tree]
gb|KJB26823.1|  hypothetical protein B456_004G261700                    170   3e-67   Gossypium raimondii
ref|XP_009338000.1|  PREDICTED: zinc finger CCCH domain-containin...    171   3e-67   Pyrus x bretschneideri [bai li]
ref|XP_011014371.1|  PREDICTED: zinc finger CCCH domain-containin...    172   4e-67   Populus euphratica
ref|XP_002325901.2|  zinc finger family protein                         172   5e-67   
ref|XP_006428579.1|  hypothetical protein CICLE_v10011741mg             176   7e-67   
ref|XP_007029391.1|  Zinc finger CCCH domain-containing protein 3...    168   8e-67   Theobroma cacao [chocolate]
ref|XP_002278934.2|  PREDICTED: zinc finger CCCH domain-containin...    171   1e-66   Vitis vinifera
gb|KDO47609.1|  hypothetical protein CISIN_1g0472481mg                  176   1e-66   Citrus sinensis [apfelsine]
gb|KCW84568.1|  hypothetical protein EUGRSUZ_B01407                     171   1e-66   Eucalyptus grandis [rose gum]
ref|XP_010038283.1|  PREDICTED: zinc finger CCCH domain-containin...    171   1e-66   Eucalyptus grandis [rose gum]
ref|XP_008812314.1|  PREDICTED: LOW QUALITY PROTEIN: zinc finger ...    174   1e-66   Phoenix dactylifera
ref|XP_007029392.1|  Zinc finger CCCH domain-containing protein 3...    168   2e-66   
gb|KCW84570.1|  hypothetical protein EUGRSUZ_B01407                     171   2e-66   Eucalyptus grandis [rose gum]
gb|KJB82177.1|  hypothetical protein B456_013G179800                    171   2e-66   Gossypium raimondii
ref|XP_008355849.1|  PREDICTED: zinc finger CCCH domain-containin...    169   3e-66   
gb|KJB82178.1|  hypothetical protein B456_013G179800                    171   3e-66   Gossypium raimondii
ref|XP_004302155.1|  PREDICTED: zinc finger CCCH domain-containin...    169   4e-66   Fragaria vesca subsp. vesca
ref|XP_003534518.1|  PREDICTED: zinc finger CCCH domain-containin...    168   5e-66   Glycine max [soybeans]
ref|XP_008359919.1|  PREDICTED: zinc finger CCCH domain-containin...    171   5e-66   Malus domestica [apple tree]
ref|XP_007139732.1|  hypothetical protein PHAVU_008G054800g             167   5e-66   Phaseolus vulgaris [French bean]
ref|XP_009337999.1|  PREDICTED: zinc finger CCCH domain-containin...    166   7e-66   Pyrus x bretschneideri [bai li]
ref|XP_003624157.1|  Zinc finger CCCH domain-containing protein         168   7e-66   Medicago truncatula
ref|XP_006606433.1|  PREDICTED: zinc finger CCCH domain-containin...    173   8e-66   Glycine max [soybeans]
gb|ACC85690.1|  zinc finger protein                                     168   8e-66   Medicago sativa [alfalfa]
ref|XP_003536159.1|  PREDICTED: zinc finger CCCH domain-containin...    172   1e-65   Glycine max [soybeans]
gb|ABD28369.2|  Zinc finger, CCCH-type; Sugar transporter superfa...    167   1e-65   Medicago truncatula
ref|XP_007139733.1|  hypothetical protein PHAVU_008G054800g             167   1e-65   Phaseolus vulgaris [French bean]
ref|XP_009769498.1|  PREDICTED: zinc finger CCCH domain-containin...    168   2e-65   Nicotiana sylvestris
gb|KHG12066.1|  Zinc finger CCCH domain-containing protein ZFN-li...    168   3e-65   Gossypium arboreum [tree cotton]
gb|KEH23393.1|  zinc finger CCCH domain protein                         168   4e-65   Medicago truncatula
ref|XP_010111067.1|  Zinc finger CCCH domain-containing protein Z...    175   4e-65   
ref|XP_006848460.1|  hypothetical protein AMTR_s00013p00248880          170   1e-64   Amborella trichopoda
ref|XP_006602842.1|  PREDICTED: zinc finger CCCH domain-containin...    166   1e-64   
ref|XP_011084651.1|  PREDICTED: zinc finger CCCH domain-containin...    174   1e-64   
gb|KJB75168.1|  hypothetical protein B456_012G028600                    167   2e-64   Gossypium raimondii
gb|KJB75169.1|  hypothetical protein B456_012G028600                    167   2e-64   Gossypium raimondii
ref|XP_008443710.1|  PREDICTED: LOW QUALITY PROTEIN: zinc finger ...    166   3e-64   
ref|XP_010929825.1|  PREDICTED: zinc finger CCCH domain-containin...    171   4e-64   Elaeis guineensis
ref|XP_010913061.1|  PREDICTED: zinc finger CCCH domain-containin...    167   6e-64   Elaeis guineensis
sp|Q9SWF9.1|ZFNL_PEA  RecName: Full=Zinc finger CCCH domain-conta...    161   6e-64   Pisum sativum [garden pea]
ref|XP_006428577.1|  hypothetical protein CICLE_v10011741mg             175   8e-64   
ref|XP_007143976.1|  hypothetical protein PHAVU_007G118500g             162   9e-64   Phaseolus vulgaris [French bean]
ref|XP_006587810.1|  PREDICTED: zinc finger CCCH domain-containin...    167   2e-63   Glycine max [soybeans]
ref|XP_008792910.1|  PREDICTED: zinc finger CCCH domain-containin...    165   2e-63   
ref|XP_010929827.1|  PREDICTED: zinc finger CCCH domain-containin...    171   3e-63   Elaeis guineensis
ref|XP_010245962.1|  PREDICTED: LOW QUALITY PROTEIN: zinc finger ...    167   4e-63   
ref|XP_010929824.1|  PREDICTED: zinc finger CCCH domain-containin...    165   7e-63   
ref|XP_009626542.1|  PREDICTED: zinc finger CCCH domain-containin...    154   1e-62   Nicotiana tomentosiformis
ref|XP_009769503.1|  PREDICTED: zinc finger CCCH domain-containin...    167   3e-62   Nicotiana sylvestris
gb|KHN04981.1|  Zinc finger CCCH domain-containing protein ZFN-like     162   4e-62   Glycine soja [wild soybean]
gb|KHN14776.1|  Zinc finger CCCH domain-containing protein ZFN-like     160   5e-62   Glycine soja [wild soybean]
ref|XP_010525081.1|  PREDICTED: zinc finger CCCH domain-containin...    159   1e-61   Tarenaya hassleriana [spider flower]
ref|XP_010525082.1|  PREDICTED: zinc finger CCCH domain-containin...    159   2e-61   Tarenaya hassleriana [spider flower]
ref|XP_004142565.1|  PREDICTED: zinc finger CCCH domain-containin...    165   5e-61   
gb|ADN33845.1|  nucleic acid binding protein                            165   5e-61   Cucumis melo subsp. melo
gb|EYU39704.1|  hypothetical protein MIMGU_mgv1a0076882mg               164   6e-61   Erythranthe guttata [common monkey flower]
ref|XP_011077184.1|  PREDICTED: zinc finger CCCH domain-containin...    155   6e-61   Sesamum indicum [beniseed]
ref|XP_004172583.1|  PREDICTED: zinc finger CCCH domain-containin...    164   7e-61   
ref|XP_011077187.1|  PREDICTED: zinc finger CCCH domain-containin...    155   9e-61   Sesamum indicum [beniseed]
ref|XP_011077188.1|  PREDICTED: zinc finger CCCH domain-containin...    154   1e-60   
ref|XP_009420318.1|  PREDICTED: zinc finger CCCH domain-containin...    152   4e-60   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009420319.1|  PREDICTED: zinc finger CCCH domain-containin...    152   5e-60   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010929826.1|  PREDICTED: zinc finger CCCH domain-containin...    171   5e-60   
ref|XP_009626543.1|  PREDICTED: zinc finger CCCH domain-containin...    154   1e-59   
ref|XP_008792915.1|  PREDICTED: zinc finger CCCH domain-containin...    164   2e-59   
ref|XP_008792914.1|  PREDICTED: zinc finger CCCH domain-containin...    165   3e-59   
gb|KJB75170.1|  hypothetical protein B456_012G028600                    166   4e-59   Gossypium raimondii
ref|XP_008794629.1|  PREDICTED: zinc finger CCCH domain-containin...    159   9e-59   
ref|XP_010927660.1|  PREDICTED: zinc finger CCCH domain-containin...    156   1e-58   
ref|XP_010673926.1|  PREDICTED: zinc finger CCCH domain-containin...    155   4e-57   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010673925.1|  PREDICTED: zinc finger CCCH domain-containin...    155   4e-57   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009392477.1|  PREDICTED: zinc finger CCCH domain-containin...    156   4e-57   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010558591.1|  PREDICTED: zinc finger CCCH domain-containin...    147   7e-57   Tarenaya hassleriana [spider flower]
gb|EPS74454.1|  hypothetical protein M569_00301                         148   1e-56   Genlisea aurea
ref|XP_006480414.1|  PREDICTED: zinc finger CCCH domain-containin...    197   2e-56   
ref|XP_009406323.1|  PREDICTED: zinc finger CCCH domain-containin...    157   5e-56   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009382899.1|  PREDICTED: zinc finger CCCH domain-containin...    149   9e-56   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008810537.1|  PREDICTED: LOW QUALITY PROTEIN: zinc finger ...    156   1e-55   
gb|EEE52080.1|  hypothetical protein OsJ_33853                          148   2e-55   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001066624.1|  Os12g0405100                                       145   2e-55   
ref|XP_006662931.1|  PREDICTED: zinc finger CCCH domain-containin...    150   3e-55   Oryza brachyantha
sp|Q2R4J4.2|C3H63_ORYSJ  RecName: Full=Zinc finger CCCH domain-co...    147   3e-55   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003576637.1|  PREDICTED: zinc finger CCCH domain-containin...    144   4e-55   Brachypodium distachyon [annual false brome]
ref|NP_001067878.1|  Os11g0472000                                       147   4e-55   
ref|XP_010237293.1|  PREDICTED: zinc finger CCCH domain-containin...    144   4e-55   Brachypodium distachyon [annual false brome]
ref|XP_006663969.1|  PREDICTED: zinc finger CCCH domain-containin...    147   7e-55   Oryza brachyantha
ref|XP_003577562.1|  PREDICTED: zinc finger CCCH domain-containin...    146   1e-54   Brachypodium distachyon [annual false brome]
ref|XP_002450713.1|  hypothetical protein SORBIDRAFT_05g013190          146   1e-54   Sorghum bicolor [broomcorn]
gb|ACN40302.1|  unknown                                                 154   1e-54   Picea sitchensis
ref|XP_008676803.1|  PREDICTED: hypothetical protein isoform X1         145   2e-54   Zea mays [maize]
ref|NP_001141157.1|  hypothetical protein                               145   2e-54   Zea mays [maize]
gb|ABG22481.1|  Zinc finger CCCH type domain containing protein Z...    147   2e-54   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009416573.1|  PREDICTED: zinc finger CCCH domain-containin...    160   3e-54   
ref|XP_009416574.1|  PREDICTED: zinc finger CCCH domain-containin...    159   3e-54   
ref|XP_004979251.1|  PREDICTED: zinc finger CCCH domain-containin...    146   5e-54   Setaria italica
ref|XP_004979252.1|  PREDICTED: zinc finger CCCH domain-containin...    146   5e-54   
ref|XP_004495537.1|  PREDICTED: zinc finger CCCH domain-containin...    147   6e-54   Cicer arietinum [garbanzo]
ref|XP_006663970.1|  PREDICTED: zinc finger CCCH domain-containin...    147   8e-54   Oryza brachyantha
ref|XP_008676804.1|  PREDICTED: hypothetical protein isoform X2         145   1e-53   Zea mays [maize]
ref|XP_010501847.1|  PREDICTED: zinc finger CCCH domain-containin...    135   3e-53   Camelina sativa [gold-of-pleasure]
ref|XP_010501886.1|  PREDICTED: zinc finger CCCH domain-containin...    135   3e-53   Camelina sativa [gold-of-pleasure]
ref|NP_566183.1|  zinc finger protein 1                                 135   3e-53   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010485612.1|  PREDICTED: zinc finger CCCH domain-containin...    135   4e-53   Camelina sativa [gold-of-pleasure]
ref|XP_010463709.1|  PREDICTED: zinc finger CCCH domain-containin...    135   5e-53   Camelina sativa [gold-of-pleasure]
ref|XP_010463710.1|  PREDICTED: zinc finger CCCH domain-containin...    135   5e-53   Camelina sativa [gold-of-pleasure]
gb|AAF26977.1|AC018363_22  zinc finger protein 1 (zfn1)                 135   7e-53   Arabidopsis thaliana [mouse-ear cress]
emb|CDY53749.1|  BnaAnng12770D                                          130   1e-52   Brassica napus [oilseed rape]
ref|XP_002882253.1|  hypothetical protein ARALYDRAFT_477525             135   1e-52   Arabidopsis lyrata subsp. lyrata
ref|NP_001130819.1|  uncharacterized protein LOC100191923               142   1e-52   Zea mays [maize]
emb|CDY67901.1|  BnaCnng56860D                                          130   1e-52   Brassica napus [oilseed rape]
ref|XP_009118612.1|  PREDICTED: zinc finger CCCH domain-containin...    130   2e-52   Brassica rapa
ref|XP_009118604.1|  PREDICTED: zinc finger CCCH domain-containin...    129   2e-52   Brassica rapa
gb|AAD33769.1|AF138743_1  zinc finger protein 1                         135   2e-52   Arabidopsis thaliana [mouse-ear cress]
gb|KFK37691.1|  hypothetical protein AALP_AA3G016100                    134   2e-52   Arabis alpina [alpine rockcress]
gb|EAY76977.1|  hypothetical protein OsI_04935                          142   3e-52   Oryza sativa Indica Group [Indian rice]
ref|NP_001045201.2|  Os01g0917400                                       142   3e-52   
gb|EMS50271.1|  Zinc finger CCCH domain-containing protein 12           137   4e-52   Triticum urartu
ref|XP_004971057.1|  PREDICTED: zinc finger CCCH domain-containin...    137   8e-52   Setaria italica
ref|XP_006408379.1|  hypothetical protein EUTSA_v10020900mg             133   2e-51   Eutrema salsugineum [saltwater cress]
gb|ACU21592.1|  Zinc finger protein                                     135   2e-51   Triticum aestivum [Canadian hard winter wheat]
gb|EEE55890.1|  hypothetical protein OsJ_04549                          142   2e-51   Oryza sativa Japonica Group [Japonica rice]
dbj|BAJ99149.1|  predicted protein                                      136   2e-51   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009147316.1|  PREDICTED: zinc finger CCCH domain-containin...    129   3e-51   Brassica rapa
emb|CDY51531.1|  BnaA05g33310D                                          129   3e-51   Brassica napus [oilseed rape]
ref|XP_006408377.1|  hypothetical protein EUTSA_v10020900mg             133   3e-51   Eutrema salsugineum [saltwater cress]
emb|CDY28712.1|  BnaCnng05980D                                          128   9e-51   Brassica napus [oilseed rape]
emb|CDX74233.1|  BnaA03g28140D                                          127   1e-50   
gb|ACF82040.1|  unknown                                                 132   2e-50   Zea mays [maize]
emb|CDX92015.1|  BnaC03g33170D                                          125   2e-50   
ref|NP_001150019.1|  zinc finger CCCH type domain-containing prot...    132   2e-50   
ref|XP_006645228.1|  PREDICTED: zinc finger CCCH domain-containin...    141   3e-50   
ref|XP_009134712.1|  PREDICTED: zinc finger CCCH domain-containin...    127   8e-50   Brassica rapa
ref|XP_009134713.1|  PREDICTED: zinc finger CCCH domain-containin...    127   8e-50   Brassica rapa
ref|XP_008672228.1|  PREDICTED: uncharacterized protein LOC100194...    130   1e-49   Zea mays [maize]
ref|NP_001132883.1|  uncharacterized protein LOC100194377               130   1e-49   Zea mays [maize]
tpg|DAA56151.1|  TPA: hypothetical protein ZEAMMB73_608000              130   2e-49   
gb|ACN33948.1|  unknown                                                 132   4e-49   Zea mays [maize]
ref|XP_006408378.1|  hypothetical protein EUTSA_v10020900mg             125   5e-49   
ref|NP_568332.2|  zinc finger nuclease 3                                130   8e-49   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003564925.1|  PREDICTED: zinc finger CCCH domain-containin...    130   1e-48   Brachypodium distachyon [annual false brome]
ref|NP_851041.1|  zinc finger nuclease 3                                129   1e-48   Arabidopsis thaliana [mouse-ear cress]
ref|NP_974790.1|  zinc finger nuclease 3                                129   2e-48   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010420350.1|  PREDICTED: zinc finger CCCH domain-containin...    126   4e-48   Camelina sativa [gold-of-pleasure]
ref|XP_010420349.1|  PREDICTED: zinc finger CCCH domain-containin...    126   4e-48   Camelina sativa [gold-of-pleasure]
dbj|BAJ86320.1|  predicted protein                                      132   5e-48   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006606434.1|  PREDICTED: zinc finger CCCH domain-containin...    173   6e-48   Glycine max [soybeans]
ref|XP_010453818.1|  PREDICTED: LOW QUALITY PROTEIN: zinc finger ...    129   7e-48   Camelina sativa [gold-of-pleasure]
ref|XP_006400193.1|  hypothetical protein EUTSA_v10013743mg             125   8e-48   Eutrema salsugineum [saltwater cress]
ref|XP_010929828.1|  PREDICTED: zinc finger CCCH domain-containin...    171   4e-47   
gb|KHG30243.1|  Zinc finger CCCH domain-containing protein ZFN-li...    170   7e-47   Gossypium arboreum [tree cotton]
gb|KJB26822.1|  hypothetical protein B456_004G261700                    169   2e-46   Gossypium raimondii
ref|XP_009769505.1|  PREDICTED: zinc finger CCCH domain-containin...    168   4e-46   Nicotiana sylvestris
ref|XP_006287837.1|  hypothetical protein CARUB_v10001057mg             122   4e-46   Capsella rubella
ref|XP_002871723.1|  hypothetical protein ARALYDRAFT_488510             132   1e-45   
ref|XP_009769504.1|  PREDICTED: zinc finger CCCH domain-containin...    167   1e-45   Nicotiana sylvestris
gb|KFK25872.1|  hypothetical protein AALP_AA8G173100                    130   2e-45   Arabis alpina [alpine rockcress]
gb|KFK25871.1|  hypothetical protein AALP_AA8G173100                    129   5e-45   Arabis alpina [alpine rockcress]
gb|EEC69137.1|  hypothetical protein OsI_38063                          110   7e-45   Oryza sativa Indica Group [Indian rice]
ref|XP_009416576.1|  PREDICTED: zinc finger CCCH domain-containin...    159   9e-43   
ref|XP_010492565.1|  PREDICTED: zinc finger CCCH domain-containin...    109   9e-43   Camelina sativa [gold-of-pleasure]
ref|XP_001768387.1|  predicted protein                                  121   1e-42   
ref|XP_009392482.1|  PREDICTED: zinc finger CCCH domain-containin...    157   5e-42   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009392481.1|  PREDICTED: zinc finger CCCH domain-containin...    157   7e-42   
ref|XP_009626545.1|  PREDICTED: zinc finger CCCH domain-containin...    154   6e-41   Nicotiana tomentosiformis
ref|XP_009626544.1|  PREDICTED: zinc finger CCCH domain-containin...    154   2e-40   
emb|CBI17647.3|  unnamed protein product                                150   6e-40   Vitis vinifera
gb|KJB23207.1|  hypothetical protein B456_004G086700                    120   5e-38   Gossypium raimondii
ref|XP_010241841.1|  PREDICTED: zinc finger CCCH domain-containin...    119   6e-38   Nelumbo nucifera [Indian lotus]
gb|KHG22563.1|  hypothetical protein F383_29382                         117   1e-37   Gossypium arboreum [tree cotton]
ref|XP_010243539.1|  PREDICTED: zinc finger CCCH domain-containin...    117   1e-37   Nelumbo nucifera [Indian lotus]
gb|KJB47069.1|  hypothetical protein B456_008G009500                    117   3e-37   Gossypium raimondii
ref|XP_006855486.1|  hypothetical protein AMTR_s00057p00193570          121   3e-37   Amborella trichopoda
ref|XP_007050814.1|  Zinc finger C-x8-C-x5-C-x3-H type family pro...    117   5e-37   Theobroma cacao [chocolate]
ref|XP_006444253.1|  hypothetical protein CICLE_v10019968mg             124   1e-36   Citrus clementina [clementine]
ref|XP_006380188.1|  hypothetical protein POPTR_0008s22730g             117   1e-36   Populus trichocarpa [western balsam poplar]
ref|XP_011018690.1|  PREDICTED: zinc finger CCCH domain-containin...    118   2e-36   Populus euphratica
dbj|BAD87736.1|  putative zinc finger protein                           142   2e-36   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010684493.1|  PREDICTED: zinc finger CCCH domain-containin...    120   2e-36   Beta vulgaris subsp. vulgaris [field beet]
gb|KEH43245.1|  zinc finger C-x8-C-x5-C-x3-H type protein               118   2e-36   Medicago truncatula
gb|KEH43244.1|  zinc finger C-x8-C-x5-C-x3-H type protein               118   2e-36   Medicago truncatula
gb|KEH43243.1|  zinc finger C-x8-C-x5-C-x3-H type protein               118   2e-36   Medicago truncatula
ref|XP_002993790.1|  hypothetical protein SELMODRAFT_45658              110   3e-36   
ref|XP_002993272.1|  hypothetical protein SELMODRAFT_45667              110   3e-36   
ref|XP_009417932.1|  PREDICTED: zinc finger CCCH domain-containin...    117   5e-36   
gb|KJB41978.1|  hypothetical protein B456_007G130500                    114   6e-36   Gossypium raimondii
ref|XP_009417931.1|  PREDICTED: zinc finger CCCH domain-containin...    117   7e-36   
ref|XP_009417930.1|  PREDICTED: zinc finger CCCH domain-containin...    117   7e-36   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008796231.1|  PREDICTED: zinc finger CCCH domain-containin...    115   8e-36   Phoenix dactylifera
ref|XP_004495983.1|  PREDICTED: zinc finger CCCH domain-containin...    119   8e-36   Cicer arietinum [garbanzo]
gb|KJB22541.1|  hypothetical protein B456_004G053200                    119   9e-36   Gossypium raimondii
ref|XP_008389189.1|  PREDICTED: zinc finger CCCH domain-containin...    121   1e-35   Malus domestica [apple tree]
ref|XP_008796233.1|  PREDICTED: zinc finger CCCH domain-containin...    115   1e-35   
ref|XP_004309682.1|  PREDICTED: zinc finger CCCH domain-containin...    119   1e-35   Fragaria vesca subsp. vesca
gb|KJB22540.1|  hypothetical protein B456_004G053200                    118   1e-35   Gossypium raimondii
ref|XP_009378917.1|  PREDICTED: LOW QUALITY PROTEIN: zinc finger ...    116   1e-35   Pyrus x bretschneideri [bai li]
ref|XP_007200997.1|  hypothetical protein PRUPE_ppa005229mg             119   2e-35   Prunus persica
ref|XP_008386632.1|  PREDICTED: LOW QUALITY PROTEIN: zinc finger ...    120   2e-35   
ref|XP_004495985.1|  PREDICTED: zinc finger CCCH domain-containin...    117   2e-35   Cicer arietinum [garbanzo]
ref|XP_008235007.1|  PREDICTED: zinc finger CCCH domain-containin...    119   2e-35   Prunus mume [ume]
ref|XP_011013662.1|  PREDICTED: zinc finger CCCH domain-containin...    112   3e-35   Populus euphratica
ref|XP_002520668.1|  nucleic acid binding protein, putative             117   3e-35   Ricinus communis
ref|XP_010652064.1|  PREDICTED: zinc finger CCCH domain-containin...    118   3e-35   Vitis vinifera
gb|KDP28101.1|  hypothetical protein JCGZ_13872                         114   6e-35   Jatropha curcas
ref|XP_009631342.1|  PREDICTED: zinc finger CCCH domain-containin...    107   6e-35   Nicotiana tomentosiformis
ref|XP_010112757.1|  Zinc finger CCCH domain-containing protein 32      118   6e-35   Morus notabilis
ref|XP_009339837.1|  PREDICTED: zinc finger CCCH domain-containin...    106   7e-35   Pyrus x bretschneideri [bai li]
gb|KHG04581.1|  hypothetical protein F383_30084                         114   9e-35   Gossypium arboreum [tree cotton]
ref|XP_008340827.1|  PREDICTED: zinc finger CCCH domain-containin...    105   9e-35   
ref|XP_009631343.1|  PREDICTED: zinc finger CCCH domain-containin...    107   1e-34   
ref|XP_009802826.1|  PREDICTED: zinc finger CCCH domain-containin...    107   1e-34   Nicotiana sylvestris
ref|XP_010069978.1|  PREDICTED: zinc finger CCCH domain-containin...    120   1e-34   Eucalyptus grandis [rose gum]
ref|XP_009352233.1|  PREDICTED: zinc finger CCCH domain-containin...    108   1e-34   Pyrus x bretschneideri [bai li]
ref|XP_011090931.1|  PREDICTED: zinc finger CCCH domain-containin...    109   1e-34   Sesamum indicum [beniseed]
ref|XP_003518955.1|  PREDICTED: zinc finger CCCH domain-containin...    118   1e-34   Glycine max [soybeans]
ref|XP_002516892.1|  nucleic acid binding protein, putative             112   1e-34   Ricinus communis
ref|XP_008802110.1|  PREDICTED: zinc finger CCCH domain-containin...    117   1e-34   Phoenix dactylifera
ref|XP_002314462.1|  hypothetical protein POPTR_0010s02320g             110   2e-34   Populus trichocarpa [western balsam poplar]
ref|XP_010921758.1|  PREDICTED: zinc finger CCCH domain-containin...    117   2e-34   Elaeis guineensis
ref|XP_006356704.1|  PREDICTED: zinc finger CCCH domain-containin...    108   2e-34   Solanum tuberosum [potatoes]
gb|KCW58527.1|  hypothetical protein EUGRSUZ_H01196                     119   2e-34   Eucalyptus grandis [rose gum]
ref|XP_006397979.1|  hypothetical protein EUTSA_v10001399mg             108   2e-34   
ref|XP_009369128.1|  PREDICTED: zinc finger CCCH domain-containin...    108   2e-34   Pyrus x bretschneideri [bai li]
ref|XP_011071464.1|  PREDICTED: zinc finger CCCH domain-containin...    108   2e-34   Sesamum indicum [beniseed]
ref|XP_007154244.1|  hypothetical protein PHAVU_003G102600g             109   2e-34   Phaseolus vulgaris [French bean]
ref|XP_010938478.1|  PREDICTED: zinc finger CCCH domain-containin...    109   2e-34   Elaeis guineensis
gb|KDP40004.1|  hypothetical protein JCGZ_02002                         112   2e-34   Jatropha curcas
ref|XP_006575106.1|  PREDICTED: zinc finger CCCH domain-containin...    117   3e-34   Glycine max [soybeans]
ref|XP_006575107.1|  PREDICTED: zinc finger CCCH domain-containin...    117   3e-34   Glycine max [soybeans]
ref|XP_009774842.1|  PREDICTED: zinc finger CCCH domain-containin...    105   3e-34   Nicotiana sylvestris
ref|XP_006296584.1|  hypothetical protein CARUB_v100138730mg            136   3e-34   
ref|XP_009588295.1|  PREDICTED: zinc finger CCCH domain-containin...    105   3e-34   Nicotiana tomentosiformis
gb|KHN46585.1|  Zinc finger CCCH domain-containing protein 32           116   3e-34   Glycine soja [wild soybean]
ref|XP_006356701.1|  PREDICTED: zinc finger CCCH domain-containin...    107   3e-34   Solanum tuberosum [potatoes]
gb|ABR16930.1|  unknown                                                 111   3e-34   Picea sitchensis
ref|XP_006356703.1|  PREDICTED: zinc finger CCCH domain-containin...    107   3e-34   
ref|XP_006359417.1|  PREDICTED: zinc finger CCCH domain-containin...    116   3e-34   Solanum tuberosum [potatoes]
ref|XP_006356705.1|  PREDICTED: zinc finger CCCH domain-containin...    107   4e-34   
ref|XP_010270053.1|  PREDICTED: zinc finger CCCH domain-containin...    107   5e-34   Nelumbo nucifera [Indian lotus]
emb|CDP03533.1|  unnamed protein product                                123   5e-34   Coffea canephora [robusta coffee]
ref|XP_007144548.1|  hypothetical protein PHAVU_007G165200g             116   5e-34   Phaseolus vulgaris [French bean]
ref|XP_010558473.1|  PREDICTED: zinc finger CCCH domain-containin...    106   5e-34   Tarenaya hassleriana [spider flower]
ref|XP_004247451.2|  PREDICTED: LOW QUALITY PROTEIN: zinc finger ...    115   5e-34   
ref|XP_006359420.1|  PREDICTED: zinc finger CCCH domain-containin...    116   6e-34   Solanum tuberosum [potatoes]
ref|XP_007147888.1|  hypothetical protein PHAVU_006G163300g             106   7e-34   Phaseolus vulgaris [French bean]
ref|XP_007147887.1|  hypothetical protein PHAVU_006G163300g             106   8e-34   Phaseolus vulgaris [French bean]
ref|XP_008223126.1|  PREDICTED: zinc finger CCCH domain-containin...    105   9e-34   Prunus mume [ume]
ref|XP_009391577.1|  PREDICTED: LOW QUALITY PROTEIN: zinc finger ...    116   1e-33   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007144549.1|  hypothetical protein PHAVU_007G165200g             115   1e-33   Phaseolus vulgaris [French bean]
ref|XP_007222805.1|  hypothetical protein PRUPE_ppa005056mg             105   1e-33   Prunus persica
ref|XP_004304076.1|  PREDICTED: zinc finger CCCH domain-containin...    105   1e-33   Fragaria vesca subsp. vesca
ref|XP_011007757.1|  PREDICTED: zinc finger CCCH domain-containin...    110   1e-33   Populus euphratica
ref|XP_003518958.1|  PREDICTED: zinc finger CCCH domain-containin...    113   2e-33   Glycine max [soybeans]
gb|AFW84181.1|  hypothetical protein ZEAMMB73_594165                  94.4    2e-33   
ref|XP_009626457.1|  PREDICTED: zinc finger CCCH domain-containin...    115   2e-33   Nicotiana tomentosiformis
gb|ABR16973.1|  unknown                                                 105   2e-33   Picea sitchensis
ref|XP_006447662.1|  hypothetical protein CICLE_v10015215mg             110   2e-33   Citrus clementina [clementine]
gb|KDO59557.1|  hypothetical protein CISIN_1g013033mg                   109   3e-33   Citrus sinensis [apfelsine]
gb|ACL54765.1|  unknown                                               93.2    3e-33   Zea mays [maize]
ref|XP_010666382.1|  PREDICTED: zinc finger CCCH domain-containin...    107   3e-33   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004296815.1|  PREDICTED: zinc finger CCCH domain-containin...    105   3e-33   Fragaria vesca subsp. vesca
ref|XP_010037077.1|  PREDICTED: zinc finger CCCH domain-containin...    107   4e-33   Eucalyptus grandis [rose gum]
ref|XP_003529584.1|  PREDICTED: zinc finger CCCH domain-containin...    105   4e-33   Glycine max [soybeans]
ref|XP_009802825.1|  PREDICTED: zinc finger CCCH domain-containin...    101   6e-33   Nicotiana sylvestris
gb|ACU18099.1|  unknown                                                 113   6e-33   
ref|XP_002320490.1|  ZINC FINGER protein 2                              106   7e-33   
ref|XP_004486037.1|  PREDICTED: zinc finger CCCH domain-containin...    103   7e-33   
ref|XP_002302855.1|  ZINC FINGER protein 2                              108   8e-33   
ref|XP_002528968.1|  zinc finger protein, putative                      106   8e-33   
ref|XP_009776613.1|  PREDICTED: zinc finger CCCH domain-containin...    113   1e-32   
gb|KHN03740.1|  Zinc finger CCCH domain-containing protein 32           114   1e-32   
ref|XP_008438828.1|  PREDICTED: zinc finger CCCH domain-containin...    108   1e-32   
gb|EPS74440.1|  hypothetical protein M569_00316                         105   1e-32   
gb|KHN46586.1|  Zinc finger CCCH domain-containing protein 32           112   1e-32   
ref|XP_003550189.1|  PREDICTED: zinc finger CCCH domain-containin...    103   1e-32   
ref|XP_009392483.1|  PREDICTED: zinc finger CCCH domain-containin...  92.8    2e-32   
ref|XP_009365130.1|  PREDICTED: zinc finger CCCH domain-containin...    104   2e-32   
ref|XP_004241158.2|  PREDICTED: zinc finger CCCH domain-containin...    101   2e-32   
ref|XP_007215353.1|  hypothetical protein PRUPE_ppa005469mg             103   2e-32   
ref|XP_009411695.1|  PREDICTED: zinc finger CCCH domain-containin...    107   2e-32   
ref|XP_010666383.1|  PREDICTED: zinc finger CCCH domain-containin...    106   2e-32   
ref|XP_010322276.1|  PREDICTED: zinc finger CCCH domain-containin...    101   3e-32   
ref|XP_010322275.1|  PREDICTED: zinc finger CCCH domain-containin...    101   3e-32   
ref|XP_004134198.1|  PREDICTED: zinc finger CCCH domain-containin...    107   3e-32   
ref|XP_006342757.1|  PREDICTED: zinc finger CCCH domain-containin...    102   3e-32   
ref|XP_008229811.1|  PREDICTED: zinc finger CCCH domain-containin...    103   3e-32   
ref|XP_010252578.1|  PREDICTED: zinc finger CCCH domain-containin...    108   3e-32   
gb|ACF80171.1|  unknown                                                 130   3e-32   
ref|XP_008379695.1|  PREDICTED: zinc finger CCCH domain-containin...    103   3e-32   
gb|EYU45569.1|  hypothetical protein MIMGU_mgv1a006413mg                102   4e-32   
emb|CDY13900.1|  BnaC09g39260D                                          108   4e-32   
gb|KHN03379.1|  Zinc finger CCCH domain-containing protein 58           103   5e-32   
ref|XP_006419655.1|  hypothetical protein CICLE_v10004882mg             112   5e-32   
ref|XP_004229205.1|  PREDICTED: zinc finger CCCH domain-containin...    100   6e-32   
ref|XP_008353591.1|  PREDICTED: zinc finger CCCH domain-containin...    103   6e-32   
ref|XP_008342144.1|  PREDICTED: zinc finger CCCH domain-containin...    103   6e-32   
ref|XP_009126264.1|  PREDICTED: zinc finger CCCH domain-containin...    107   7e-32   
gb|KDO75084.1|  hypothetical protein CISIN_1g0118532mg                  111   8e-32   
gb|KDO75085.1|  hypothetical protein CISIN_1g0118532mg                  111   8e-32   
ref|XP_006366677.1|  PREDICTED: zinc finger CCCH domain-containin...    111   8e-32   
emb|CDX88932.1|  BnaA03g07170D                                          107   9e-32   
gb|KHF99697.1|  hypothetical protein F383_18975                         110   9e-32   
ref|XP_008803514.1|  PREDICTED: zinc finger CCCH domain-containin...    102   1e-31   
ref|XP_008803515.1|  PREDICTED: zinc finger CCCH domain-containin...    102   1e-31   
ref|XP_008803512.1|  PREDICTED: zinc finger CCCH domain-containin...    102   1e-31   
ref|XP_011008920.1|  PREDICTED: zinc finger CCCH domain-containin...    107   1e-31   
gb|EPS71438.1|  hypothetical protein M569_03319                         103   1e-31   
ref|XP_008803513.1|  PREDICTED: zinc finger CCCH domain-containin...    102   1e-31   
emb|CDX70825.1|  BnaC03g09090D                                          107   1e-31   
ref|XP_010110220.1|  Zinc finger CCCH domain-containing protein 3       109   1e-31   
ref|XP_004508292.1|  PREDICTED: zinc finger CCCH domain-containin...    107   1e-31   
ref|XP_004143196.1|  PREDICTED: zinc finger CCCH domain-containin...    101   2e-31   
emb|CDX92600.1|  BnaA10g16390D                                          105   3e-31   
ref|XP_004240519.2|  PREDICTED: LOW QUALITY PROTEIN: zinc finger ...    110   3e-31   
ref|XP_010524751.1|  PREDICTED: zinc finger CCCH domain-containin...    101   3e-31   
gb|AES91820.2|  zinc finger C-x8-C-x5-C-x3-H type protein               106   3e-31   
ref|XP_008456401.1|  PREDICTED: zinc finger CCCH domain-containin...    101   3e-31   
ref|XP_009120963.1|  PREDICTED: zinc finger CCCH domain-containin...    105   3e-31   
ref|XP_010943246.1|  PREDICTED: zinc finger CCCH domain-containin...    100   4e-31   
ref|XP_010943244.1|  PREDICTED: zinc finger CCCH domain-containin...    100   4e-31   
ref|XP_010426337.1|  PREDICTED: zinc finger CCCH domain-containin...  96.7    4e-31   
ref|XP_003609623.1|  Zinc finger CCCH domain-containing protein         105   4e-31   
gb|KFK26093.1|  hypothetical protein AALP_AA8G202000                    107   4e-31   
gb|KHG07834.1|  hypothetical protein F383_35307                       99.4    4e-31   
ref|XP_003609624.1|  Zinc finger CCCH domain-containing protein         105   5e-31   
gb|EYU43920.1|  hypothetical protein MIMGU_mgv1a0053871mg             98.6    5e-31   
gb|KGN57087.1|  hypothetical protein Csa_3G152140                       108   5e-31   
emb|CDO98891.1|  unnamed protein product                                101   5e-31   
ref|XP_009131674.1|  PREDICTED: zinc finger CCCH domain-containin...    104   6e-31   
ref|XP_009131673.1|  PREDICTED: zinc finger CCCH domain-containin...    104   6e-31   
gb|KHG01635.1|  hypothetical protein F383_21492                         104   8e-31   
ref|XP_008777782.1|  PREDICTED: zinc finger CCCH domain-containin...    100   9e-31   
gb|KJB12614.1|  hypothetical protein B456_002G027000                    110   1e-30   
gb|KJB08673.1|  hypothetical protein B456_001G096900                    103   1e-30   
ref|XP_010426336.1|  PREDICTED: zinc finger CCCH domain-containin...  96.7    1e-30   
ref|XP_003593956.1|  Zinc finger CCCH domain-containing protein       97.4    1e-30   
ref|XP_007049197.1|  Zinc finger C-x8-C-x5-C-x3-H type family pro...    100   2e-30   
ref|XP_007049198.1|  Zinc finger C-x8-C-x5-C-x3-H type family pro...    100   2e-30   
ref|XP_006287665.1|  hypothetical protein CARUB_v10000876mg             100   2e-30   
gb|KJB08672.1|  hypothetical protein B456_001G096900                    103   2e-30   
gb|KJB08671.1|  hypothetical protein B456_001G096900                    103   2e-30   
gb|KJB08674.1|  hypothetical protein B456_001G096900                    103   2e-30   
gb|KHG06790.1|  hypothetical protein F383_05075                         103   2e-30   
gb|KHG05173.1|  hypothetical protein F383_31227                         103   2e-30   
ref|NP_190414.1|  zinc finger CCCH domain-containing protein 43       98.2    2e-30   
ref|XP_010546927.1|  PREDICTED: zinc finger CCCH domain-containin...  96.7    3e-30   
ref|XP_002275775.1|  PREDICTED: zinc finger CCCH domain-containin...    102   3e-30   
ref|XP_006597530.1|  PREDICTED: zinc finger CCCH domain-containin...  99.0    3e-30   
ref|NP_197356.2|  zinc finger CCCH domain-containing protein 58         100   3e-30   
ref|XP_008799408.1|  PREDICTED: zinc finger CCCH domain-containin...    100   3e-30   
ref|XP_002875904.1|  zinc finger (CCCH-type) family protein           95.9    4e-30   
gb|KJB08677.1|  hypothetical protein B456_001G097100                    102   4e-30   
ref|XP_002276435.1|  PREDICTED: zinc finger CCCH domain-containin...    106   5e-30   
ref|XP_006407949.1|  hypothetical protein EUTSA_v10020686mg           99.0    6e-30   
ref|XP_010484523.1|  PREDICTED: zinc finger CCCH domain-containin...    100   7e-30   
gb|KJB72632.1|  hypothetical protein B456_011G188400                    100   7e-30   
emb|CDY02619.1|  BnaC02g08160D                                        96.7    8e-30   
ref|XP_003541660.1|  PREDICTED: zinc finger CCCH domain-containin...  94.4    8e-30   
gb|KHN47309.1|  Zinc finger CCCH domain-containing protein 32         94.4    8e-30   
ref|XP_010522373.1|  PREDICTED: zinc finger CCCH domain-containin...    103   8e-30   
gb|KFK31098.1|  hypothetical protein AALP_AA6G067900                    106   9e-30   
ref|XP_010649761.1|  PREDICTED: zinc finger CCCH domain-containin...    105   9e-30   
ref|XP_010475174.1|  PREDICTED: zinc finger CCCH domain-containin...    102   9e-30   
gb|KJB72635.1|  hypothetical protein B456_011G188400                    100   1e-29   
emb|CAN76191.1|  hypothetical protein VITISV_020358                     100   1e-29   
ref|XP_009415603.1|  PREDICTED: zinc finger CCCH domain-containin...  92.8    1e-29   
ref|XP_010457569.1|  PREDICTED: zinc finger CCCH domain-containin...    103   1e-29   
gb|KJB10313.1|  hypothetical protein B456_001G195600                    101   1e-29   
ref|XP_010484531.1|  PREDICTED: zinc finger CCCH domain-containin...    100   1e-29   
gb|KJB10316.1|  hypothetical protein B456_001G195600                    101   1e-29   
ref|XP_010248777.1|  PREDICTED: zinc finger CCCH domain-containin...  99.0    1e-29   
ref|XP_010248778.1|  PREDICTED: zinc finger CCCH domain-containin...  99.0    1e-29   
ref|XP_009416575.1|  PREDICTED: zinc finger CCCH domain-containin...  79.7    2e-29   
gb|KJB10314.1|  hypothetical protein B456_001G195600                    101   2e-29   
ref|XP_010546925.1|  PREDICTED: zinc finger CCCH domain-containin...  96.7    2e-29   
ref|XP_004491091.1|  PREDICTED: zinc finger CCCH domain-containin...  98.6    2e-29   
ref|XP_010556971.1|  PREDICTED: zinc finger CCCH domain-containin...    102   2e-29   
ref|XP_007035523.1|  Zinc finger C-x8-C-x5-C-x3-H type family pro...  98.6    2e-29   
gb|EYU22370.1|  hypothetical protein MIMGU_mgv1a005385mg              99.0    2e-29   
ref|XP_010460041.1|  PREDICTED: zinc finger CCCH domain-containin...  96.7    2e-29   
gb|KJB10318.1|  hypothetical protein B456_001G195600                    100   3e-29   
ref|XP_007141660.1|  hypothetical protein PHAVU_008G214600g             102   3e-29   
ref|XP_007141661.1|  hypothetical protein PHAVU_008G214600g             102   3e-29   
ref|XP_010454106.1|  PREDICTED: zinc finger CCCH domain-containin...    104   3e-29   
ref|XP_002892258.1|  predicted protein                                  100   3e-29   
ref|XP_011085489.1|  PREDICTED: zinc finger CCCH domain-containin...  95.9    3e-29   
ref|XP_011085488.1|  PREDICTED: zinc finger CCCH domain-containin...  95.9    3e-29   
ref|XP_003616871.1|  Zinc finger CCCH domain-containing protein       98.6    4e-29   
ref|XP_006291144.1|  hypothetical protein CARUB_v10017261mg           93.6    4e-29   
gb|KFK38099.1|  hypothetical protein AALP_AA3G069300                  99.4    4e-29   
emb|CAN78551.1|  hypothetical protein VITISV_003243                     106   4e-29   
ref|XP_006829499.1|  hypothetical protein AMTR_s00074p00110430        90.9    4e-29   
gb|KFK42845.1|  hypothetical protein AALP_AA1G046700                    100   5e-29   
ref|XP_010454104.1|  PREDICTED: zinc finger CCCH domain-containin...    104   5e-29   
ref|XP_011085490.1|  PREDICTED: zinc finger CCCH domain-containin...  95.5    5e-29   
ref|XP_010426339.1|  PREDICTED: zinc finger CCCH domain-containin...  95.5    5e-29   
ref|XP_009132897.1|  PREDICTED: zinc finger CCCH domain-containin...    103   5e-29   
ref|XP_010319044.1|  PREDICTED: zinc finger CCCH domain-containin...  99.8    6e-29   
ref|NP_563725.1|  zinc finger CCCH domain-containing protein 3        98.6    6e-29   
emb|CDY41511.1|  BnaA06g22640D                                        95.9    6e-29   
ref|XP_006852277.1|  hypothetical protein AMTR_s00049p00179390        99.0    6e-29   
ref|XP_010928414.1|  PREDICTED: zinc finger CCCH domain-containin...  97.4    6e-29   
ref|XP_008355482.1|  PREDICTED: LOW QUALITY PROTEIN: zinc finger ...    101   7e-29   
ref|XP_010503474.1|  PREDICTED: zinc finger CCCH domain-containin...  97.4    8e-29   
ref|XP_010503473.1|  PREDICTED: zinc finger CCCH domain-containin...  97.4    8e-29   
ref|XP_006400404.1|  hypothetical protein EUTSA_v10013460mg           95.5    1e-28   
ref|XP_009150385.1|  PREDICTED: zinc finger CCCH domain-containin...  95.1    1e-28   
ref|XP_004236314.1|  PREDICTED: zinc finger CCCH domain-containin...  99.8    1e-28   
emb|CDX74105.1|  BnaA03g29420D                                        96.7    1e-28   
ref|XP_009134895.1|  PREDICTED: zinc finger CCCH domain-containin...  96.7    1e-28   
ref|XP_010688919.1|  PREDICTED: zinc finger CCCH domain-containin...  94.4    1e-28   
emb|CDX79496.1|  BnaC03g18320D                                          102   1e-28   
ref|XP_010688921.1|  PREDICTED: zinc finger CCCH domain-containin...  94.4    1e-28   
ref|XP_003519444.1|  PREDICTED: zinc finger CCCH domain-containin...    102   2e-28   
gb|KHN38500.1|  Zinc finger CCCH domain-containing protein 3            102   2e-28   
ref|XP_002871822.1|  hypothetical protein ARALYDRAFT_488738           97.4    2e-28   
ref|XP_010542997.1|  PREDICTED: zinc finger CCCH domain-containin...    101   2e-28   
ref|XP_009119217.1|  PREDICTED: zinc finger CCCH domain-containin...  99.4    2e-28   
ref|XP_010532994.1|  PREDICTED: zinc finger CCCH domain-containin...    103   2e-28   
emb|CDY53399.1|  BnaAnng12470D                                        99.4    2e-28   
dbj|BAF02113.1|  hypothetical protein                                 94.0    2e-28   
gb|KJB28621.1|  hypothetical protein B456_005G058800                  99.8    2e-28   
ref|NP_187292.2|  zinc finger CCCH domain-containing protein 34       94.0    2e-28   
emb|CDY18279.1|  BnaC05g03020D                                        99.4    2e-28   
ref|XP_010532995.1|  PREDICTED: zinc finger CCCH domain-containin...    103   2e-28   
ref|XP_010484051.1|  PREDICTED: zinc finger CCCH domain-containin...  94.0    2e-28   
ref|XP_010492867.1|  PREDICTED: zinc finger CCCH domain-containin...    105   2e-28   
gb|AAF08587.1|AC011623_20  hypothetical protein                       94.0    2e-28   
emb|CDY58107.1|  BnaA02g35100D                                        96.3    3e-28   
ref|XP_010444209.1|  PREDICTED: zinc finger CCCH domain-containin...  96.3    3e-28   
ref|XP_010492866.1|  PREDICTED: zinc finger CCCH domain-containin...    105   3e-28   
ref|XP_009418524.1|  PREDICTED: zinc finger CCCH domain-containin...  94.7    3e-28   
ref|XP_008367486.1|  PREDICTED: zinc finger CCCH domain-containin...  94.7    3e-28   
ref|XP_009418525.1|  PREDICTED: zinc finger CCCH domain-containin...  94.7    3e-28   
emb|CDY08054.1|  BnaC03g34690D                                        98.2    3e-28   
ref|XP_006394295.1|  hypothetical protein EUTSA_v10004204mg           93.6    4e-28   
ref|XP_010420624.1|  PREDICTED: zinc finger CCCH domain-containin...    100   4e-28   
ref|XP_003545603.1|  PREDICTED: zinc finger CCCH domain-containin...    102   4e-28   
ref|XP_006595836.1|  PREDICTED: zinc finger CCCH domain-containin...    102   4e-28   
ref|XP_009124921.1|  PREDICTED: zinc finger CCCH domain-containin...  95.1    4e-28   
ref|XP_002884577.1|  hypothetical protein ARALYDRAFT_477944           94.4    4e-28   
ref|XP_008367485.1|  PREDICTED: zinc finger CCCH domain-containin...  94.4    4e-28   
ref|XP_006282213.1|  hypothetical protein CARUB_v10028484mg           96.3    4e-28   
ref|XP_009124920.1|  PREDICTED: zinc finger CCCH domain-containin...  94.7    5e-28   
emb|CDY18858.1|  BnaAnng03230D                                        95.5    5e-28   
ref|XP_007037859.1|  Zinc finger C-x8-C-x5-C-x3-H type family pro...  95.1    5e-28   
ref|XP_010024647.1|  PREDICTED: zinc finger CCCH domain-containin...    100   8e-28   
emb|CDP15063.1|  unnamed protein product                              99.4    8e-28   
ref|XP_006351453.1|  PREDICTED: zinc finger CCCH domain-containin...  96.7    9e-28   
ref|XP_006297647.1|  hypothetical protein CARUB_v10013665mg           91.3    9e-28   
ref|XP_010024648.1|  PREDICTED: zinc finger CCCH domain-containin...    100   1e-27   
ref|XP_008439243.1|  PREDICTED: zinc finger CCCH domain-containin...  95.9    1e-27   
gb|KHN44751.1|  Zinc finger CCCH domain-containing protein 3            100   1e-27   
ref|XP_010503475.1|  PREDICTED: zinc finger CCCH domain-containin...  96.3    1e-27   
ref|NP_201131.1|  zinc finger CCCH domain-containing protein 67       89.7    1e-27   
ref|XP_006476950.1|  PREDICTED: zinc finger CCCH domain-containin...  96.7    1e-27   
ref|XP_006351454.1|  PREDICTED: zinc finger CCCH domain-containin...  96.7    1e-27   
ref|XP_006418072.1|  hypothetical protein EUTSA_v10007912mg           99.0    1e-27   
ref|XP_009791088.1|  PREDICTED: zinc finger CCCH domain-containin...  99.4    1e-27   
ref|XP_010515162.1|  PREDICTED: zinc finger CCCH domain-containin...  95.1    1e-27   
ref|XP_010420626.1|  PREDICTED: zinc finger CCCH domain-containin...    100   1e-27   
ref|XP_010523985.1|  PREDICTED: zinc finger CCCH domain-containin...    119   2e-27   
ref|XP_011100471.1|  PREDICTED: zinc finger CCCH domain-containin...  92.4    2e-27   
gb|AGT16495.1|  zinc finger CCCH type domain-containing protein         100   2e-27   
ref|XP_009394545.1|  PREDICTED: zinc finger CCCH domain-containin...  91.7    2e-27   
ref|XP_006476949.1|  PREDICTED: zinc finger CCCH domain-containin...  96.3    2e-27   
ref|XP_011100472.1|  PREDICTED: zinc finger CCCH domain-containin...  92.0    2e-27   
ref|XP_006440010.1|  hypothetical protein CICLE_v10019979mg           96.7    2e-27   
ref|XP_006291143.1|  hypothetical protein CARUB_v10017261mg           92.0    2e-27   
gb|AAV66094.1|  At5g63260                                             89.7    2e-27   
ref|XP_009129667.1|  PREDICTED: zinc finger CCCH domain-containin...  99.4    2e-27   
ref|XP_002457593.1|  hypothetical protein SORBIDRAFT_03g009930          100   2e-27   
ref|XP_009791086.1|  PREDICTED: zinc finger CCCH domain-containin...  99.4    2e-27   
ref|XP_002864843.1|  zinc finger (CCCH-type) family protein           91.7    2e-27   
ref|XP_009791087.1|  PREDICTED: zinc finger CCCH domain-containin...  99.4    3e-27   
emb|CDY05262.1|  BnaC05g45410D                                        99.0    3e-27   
ref|XP_006440012.1|  hypothetical protein CICLE_v10019979mg           96.7    3e-27   
emb|CDY24694.1|  BnaA05g30930D                                        99.0    3e-27   
ref|XP_006404259.1|  hypothetical protein EUTSA_v10010405mg           94.4    3e-27   
ref|NP_001150480.1|  LOC100284111                                       100   3e-27   
gb|KJB82176.1|  hypothetical protein B456_013G179800                    117   3e-27   
gb|ACN33323.1|  unknown                                                 100   3e-27   
emb|CDY23780.1|  BnaC04g43420D                                        96.7    4e-27   
ref|XP_006440009.1|  hypothetical protein CICLE_v10019979mg           96.3    4e-27   
ref|XP_002881253.1|  hypothetical protein ARALYDRAFT_345050             100   4e-27   



>ref|XP_009611378.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X2 [Nicotiana tomentosiformis]
Length=450

 Score =   176 bits (447),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 82/93 (88%), Positives = 85/93 (91%), Gaps = 0/93 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFGATCKFHHP+DKAGIAGRV LNVLGYPLRPN+ EC YYMRTGQCKFGST
Sbjct  115  QYYLKTGTCKFGATCKFHHPKDKAGIAGRVTLNVLGYPLRPNEAECAYYMRTGQCKFGST  174

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQL  726
            CKFHHPQPSNMMV LRGSP YPPV S TTPGQL
Sbjct  175  CKFHHPQPSNMMVSLRGSPVYPPVPSATTPGQL  207


 Score =   114 bits (284),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 49/61 (80%), Positives = 57/61 (93%), Gaps = 0/61 (0%)
 Frame = +3

Query  267  ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARM  446
            +TLWQ++LRS E++ESG YPVR+GEPDCSYYIRTGLCRFG++CRFNHP NRKLAIA ARM
Sbjct  25   DTLWQMNLRSRESIESGHYPVREGEPDCSYYIRTGLCRFGSTCRFNHPPNRKLAIATARM  84

Query  447  K  449
            K
Sbjct  85   K  85


 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 45/66 (68%), Gaps = 0/66 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y+KTG CKFGA C+FHHPR++        L+ +G PLRP +  C +Y R G CKFG +
Sbjct  316  QFYMKTGDCKFGAVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPLCIFYSRYGICKFGPS  375

Query  628  CKFHHP  645
            CKF HP
Sbjct  376  CKFDHP  381


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/57 (37%), Positives = 33/57 (58%), Gaps = 0/57 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKVLLEDGSLQVWGHL  491
            YP+R  E +C+YY+RTG C+FG++C+F+HP    + ++     V     S    G L
Sbjct  151  YPLRPNEAECAYYMRTGQCKFGSTCKFHHPQPSNMMVSLRGSPVYPPVPSATTPGQL  207


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +3

Query  318  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKL  425
             +P R G+P+C +Y++TG C+FGA CRF+HP  R +
Sbjct  305  VFPERHGQPECQFYMKTGDCKFGAVCRFHHPRERLI  340



>ref|XP_009611380.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X4 [Nicotiana tomentosiformis]
Length=433

 Score =   176 bits (446),  Expect(2) = 3e-69, Method: Compositional matrix adjust.
 Identities = 82/93 (88%), Positives = 85/93 (91%), Gaps = 0/93 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFGATCKFHHP+DKAGIAGRV LNVLGYPLRPN+ EC YYMRTGQCKFGST
Sbjct  98   QYYLKTGTCKFGATCKFHHPKDKAGIAGRVTLNVLGYPLRPNEAECAYYMRTGQCKFGST  157

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQL  726
            CKFHHPQPSNMMV LRGSP YPPV S TTPGQL
Sbjct  158  CKFHHPQPSNMMVSLRGSPVYPPVPSATTPGQL  190


 Score =   113 bits (283),  Expect(2) = 3e-69, Method: Compositional matrix adjust.
 Identities = 49/61 (80%), Positives = 57/61 (93%), Gaps = 0/61 (0%)
 Frame = +3

Query  267  ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARM  446
            +TLWQ++LRS E++ESG YPVR+GEPDCSYYIRTGLCRFG++CRFNHP NRKLAIA ARM
Sbjct  25   DTLWQMNLRSRESIESGHYPVREGEPDCSYYIRTGLCRFGSTCRFNHPPNRKLAIATARM  84

Query  447  K  449
            K
Sbjct  85   K  85


 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 45/66 (68%), Gaps = 0/66 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y+KTG CKFGA C+FHHPR++        L+ +G PLRP +  C +Y R G CKFG +
Sbjct  299  QFYMKTGDCKFGAVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPLCIFYSRYGICKFGPS  358

Query  628  CKFHHP  645
            CKF HP
Sbjct  359  CKFDHP  364


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/57 (37%), Positives = 33/57 (58%), Gaps = 0/57 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKVLLEDGSLQVWGHL  491
            YP+R  E +C+YY+RTG C+FG++C+F+HP    + ++     V     S    G L
Sbjct  134  YPLRPNEAECAYYMRTGQCKFGSTCKFHHPQPSNMMVSLRGSPVYPPVPSATTPGQL  190


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +3

Query  318  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKL  425
             +P R G+P+C +Y++TG C+FGA CRF+HP  R +
Sbjct  288  VFPERHGQPECQFYMKTGDCKFGAVCRFHHPRERLI  323



>ref|XP_009793876.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Nicotiana sylvestris]
Length=433

 Score =   176 bits (445),  Expect(2) = 4e-69, Method: Compositional matrix adjust.
 Identities = 82/93 (88%), Positives = 85/93 (91%), Gaps = 0/93 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFGATCKFHHP+DKAGIAGRV LNVLGYPLRPN+ EC YYMRTGQCKFGST
Sbjct  98   QYYLKTGTCKFGATCKFHHPKDKAGIAGRVTLNVLGYPLRPNEAECAYYMRTGQCKFGST  157

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQL  726
            CKFHHPQPSNMMV LRGSP YPPV S TTPGQL
Sbjct  158  CKFHHPQPSNMMVSLRGSPTYPPVPSATTPGQL  190


 Score =   113 bits (283),  Expect(2) = 4e-69, Method: Compositional matrix adjust.
 Identities = 49/61 (80%), Positives = 57/61 (93%), Gaps = 0/61 (0%)
 Frame = +3

Query  267  ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARM  446
            +TLWQ++LRS E++ESG YPVR+GEPDCSYYIRTGLCRFG++CRFNHP NRKLAIA ARM
Sbjct  25   DTLWQMNLRSRESIESGHYPVREGEPDCSYYIRTGLCRFGSTCRFNHPPNRKLAIATARM  84

Query  447  K  449
            K
Sbjct  85   K  85


 Score = 77.0 bits (188),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 45/66 (68%), Gaps = 0/66 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y+KTG CKFGA C+FHHPR++        L+ +G PLRP +  C +Y R G CKFG +
Sbjct  299  QFYMKTGDCKFGAVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPLCIFYSRYGICKFGPS  358

Query  628  CKFHHP  645
            CKF HP
Sbjct  359  CKFDHP  364


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +3

Query  318  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKL  425
             +P R G+P+C +Y++TG C+FGA CRF+HP  R +
Sbjct  288  VFPERPGQPECQFYMKTGDCKFGAVCRFHHPRERLI  323


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 17/38 (45%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIA  434
            YP+R  E +C+YY+RTG C+FG++C+F+HP    + ++
Sbjct  134  YPLRPNEAECAYYMRTGQCKFGSTCKFHHPQPSNMMVS  171



>ref|XP_011014133.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Populus euphratica]
Length=447

 Score =   176 bits (446),  Expect(2) = 7e-69, Method: Compositional matrix adjust.
 Identities = 79/92 (86%), Positives = 87/92 (95%), Gaps = 0/92 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFGATCKFHHPRDKAGI+GRV+LN+LGYPL+PN+IEC YY+RTGQCKFGST
Sbjct  107  QYYLKTGTCKFGATCKFHHPRDKAGISGRVSLNILGYPLQPNEIECAYYLRTGQCKFGST  166

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  723
            CKFHHPQP+NMMVPLRGSP YP V SPTTPGQ
Sbjct  167  CKFHHPQPTNMMVPLRGSPIYPTVSSPTTPGQ  198


 Score =   112 bits (280),  Expect(2) = 7e-69, Method: Compositional matrix adjust.
 Identities = 49/61 (80%), Positives = 55/61 (90%), Gaps = 0/61 (0%)
 Frame = +3

Query  267  ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARM  446
            + +WQ++LRS ETME+G YP R GEPDCSYYIRTGLCRFGA+CRFNHP NRKLAIAAARM
Sbjct  34   DAMWQMNLRSSETMEAGPYPERSGEPDCSYYIRTGLCRFGATCRFNHPPNRKLAIAAARM  93

Query  447  K  449
            K
Sbjct  94   K  94


 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 46/66 (70%), Gaps = 0/66 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y+KTG CKFGA C+FHHPR++   A    L+ +G PLRP +  C +Y R G CKFG +
Sbjct  314  QFYMKTGDCKFGAVCRFHHPRERLIPAPDCVLSPIGLPLRPGEPLCIFYSRYGICKFGPS  373

Query  628  CKFHHP  645
            CKF HP
Sbjct  374  CKFDHP  379


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +3

Query  318  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKL  425
             +P R G+P+C +Y++TG C+FGA CRF+HP  R +
Sbjct  303  VFPERPGQPECQFYMKTGDCKFGAVCRFHHPRERLI  338



>ref|XP_006376056.1| hypothetical protein POPTR_0013s08490g [Populus trichocarpa]
 gb|ERP53853.1| hypothetical protein POPTR_0013s08490g [Populus trichocarpa]
Length=255

 Score =   176 bits (446),  Expect(2) = 1e-68, Method: Compositional matrix adjust.
 Identities = 79/92 (86%), Positives = 87/92 (95%), Gaps = 0/92 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFGATCKFHHPRDKAGI+GRV+LN+LGYPL+PN+IEC YY+RTGQCKFGST
Sbjct  105  QYYLKTGTCKFGATCKFHHPRDKAGISGRVSLNILGYPLQPNEIECAYYLRTGQCKFGST  164

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  723
            CKFHHPQP+NMMVPLRGSP YP V SPTTPGQ
Sbjct  165  CKFHHPQPTNMMVPLRGSPIYPTVSSPTTPGQ  196


 Score =   111 bits (278),  Expect(2) = 1e-68, Method: Compositional matrix adjust.
 Identities = 49/61 (80%), Positives = 55/61 (90%), Gaps = 0/61 (0%)
 Frame = +3

Query  267  ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARM  446
            + +WQ++LRS ETME+G YP R GEPDCSYYIRTGLCRFGA+CRFNHP NRKLAIAAARM
Sbjct  32   DAMWQMNLRSSETMEAGPYPERPGEPDCSYYIRTGLCRFGATCRFNHPPNRKLAIAAARM  91

Query  447  K  449
            K
Sbjct  92   K  92



>ref|XP_002512627.1| nucleic acid binding protein, putative [Ricinus communis]
 gb|EEF50079.1| nucleic acid binding protein, putative [Ricinus communis]
Length=448

 Score =   177 bits (449),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 79/92 (86%), Positives = 87/92 (95%), Gaps = 0/92 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFGATCKFHHP+DKAGIAGRV+LN+LGYPLRPN+IEC YY+RTGQCKFGST
Sbjct  109  QYYLKTGTCKFGATCKFHHPKDKAGIAGRVSLNILGYPLRPNEIECAYYLRTGQCKFGST  168

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  723
            CKFHHPQP+N+MVPLRGSP YP V SPTTPGQ
Sbjct  169  CKFHHPQPTNVMVPLRGSPVYPTVQSPTTPGQ  200


 Score =   110 bits (274),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 48/61 (79%), Positives = 54/61 (89%), Gaps = 0/61 (0%)
 Frame = +3

Query  267  ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARM  446
            + +WQ++LRS ETM+SG YP   GEPDCSYYIRTGLCRFGA+CRFNHP NRKLAIAAARM
Sbjct  36   DAMWQMNLRSSETMDSGPYPEHPGEPDCSYYIRTGLCRFGATCRFNHPPNRKLAIAAARM  95

Query  447  K  449
            K
Sbjct  96   K  96


 Score = 79.7 bits (195),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 52/85 (61%), Gaps = 9/85 (11%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y+KTG CKFGA C+FHHPR++   A    L+ +G PLRP +  C +Y R G CKFG +
Sbjct  315  QFYMKTGDCKFGAVCRFHHPRERLIPAPDCVLSPIGLPLRPGEPLCIFYSRYGVCKFGPS  374

Query  628  CKFHHPQ---------PSNMMVPLR  675
            CKF HP          PS+   P+R
Sbjct  375  CKFDHPMGIFTYNLSAPSSADAPVR  399


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +3

Query  318  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKL  425
             +P R G+P+C +Y++TG C+FGA CRF+HP  R +
Sbjct  304  VFPERPGQPECQFYMKTGDCKFGAVCRFHHPRERLI  339


 Score = 50.1 bits (118),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 17/37 (46%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAI  431
            YP+R  E +C+YY+RTG C+FG++C+F+HP    + +
Sbjct  145  YPLRPNEIECAYYLRTGQCKFGSTCKFHHPQPTNVMV  181



>ref|XP_006353234.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Solanum tuberosum]
Length=433

 Score =   174 bits (442),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 81/93 (87%), Positives = 85/93 (91%), Gaps = 0/93 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +Y+LKTG CKFGATCKFHHP+DKAGIAGRV LNVLGYPLRPN+ EC YYMRTGQCKFGST
Sbjct  98   QYFLKTGTCKFGATCKFHHPKDKAGIAGRVTLNVLGYPLRPNESECAYYMRTGQCKFGST  157

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQL  726
            CKFHHPQPSNMMV LRGSP YPPV S TTPGQL
Sbjct  158  CKFHHPQPSNMMVSLRGSPVYPPVPSATTPGQL  190


 Score =   112 bits (280),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 48/61 (79%), Positives = 57/61 (93%), Gaps = 0/61 (0%)
 Frame = +3

Query  267  ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARM  446
            +TLWQ++LRS +++ESG YPVR+GEPDCSYYIRTGLCRFG++CRFNHP NRKLAIA ARM
Sbjct  25   DTLWQMNLRSRDSIESGHYPVREGEPDCSYYIRTGLCRFGSTCRFNHPPNRKLAIATARM  84

Query  447  K  449
            K
Sbjct  85   K  85


 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 44/66 (67%), Gaps = 0/66 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y+KTG CKFGA C+FHHPR++        L+ +G PLR  +  C +Y R G CKFG +
Sbjct  299  QFYMKTGDCKFGAVCRFHHPRERLIPPPDCLLSPIGLPLRTGEPLCIFYSRYGICKFGPS  358

Query  628  CKFHHP  645
            CKF HP
Sbjct  359  CKFDHP  364


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 21/57 (37%), Positives = 33/57 (58%), Gaps = 0/57 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKVLLEDGSLQVWGHL  491
            YP+R  E +C+YY+RTG C+FG++C+F+HP    + ++     V     S    G L
Sbjct  134  YPLRPNESECAYYMRTGQCKFGSTCKFHHPQPSNMMVSLRGSPVYPPVPSATTPGQL  190


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 32/50 (64%), Gaps = 5/50 (10%)
 Frame = +1

Query  508  RDKAGIAGRVAL---NVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQ  648
            R  +G  G  AL   NV  +P RP   EC +YM+TG CKFG+ C+FHHP+
Sbjct  272  RQASGPMGYYALQGENV--FPERPGQAECQFYMKTGDCKFGAVCRFHHPR  319



>gb|KDP23293.1| hypothetical protein JCGZ_23126 [Jatropha curcas]
Length=442

 Score =   175 bits (444),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 78/92 (85%), Positives = 87/92 (95%), Gaps = 0/92 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFGATCKFHHP+DKAGIAGRV+LN++GYPLRPN+IEC YY+RTGQCKFGST
Sbjct  103  QYYLKTGTCKFGATCKFHHPKDKAGIAGRVSLNIMGYPLRPNEIECAYYLRTGQCKFGST  162

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  723
            CKFHHPQP+N+MVPLRGSP YP V SPTTPGQ
Sbjct  163  CKFHHPQPTNVMVPLRGSPVYPNVQSPTTPGQ  194


 Score =   111 bits (277),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 49/61 (80%), Positives = 54/61 (89%), Gaps = 0/61 (0%)
 Frame = +3

Query  267  ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARM  446
            + +WQ++LRS E MESG YP R GEPDCSYYIRTGLCRFGA+CRFNHP NRKLAIAAARM
Sbjct  30   DAMWQMNLRSGEPMESGPYPERPGEPDCSYYIRTGLCRFGATCRFNHPPNRKLAIAAARM  89

Query  447  K  449
            K
Sbjct  90   K  90


 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 46/66 (70%), Gaps = 0/66 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y+KTG CKFGA C+FHHPR++   A    L+ +G PLRP +  C +Y R G CKFG +
Sbjct  309  QFYMKTGDCKFGAVCRFHHPRERLIPAPDCVLSPIGLPLRPGEPLCIFYSRYGVCKFGPS  368

Query  628  CKFHHP  645
            CK+ HP
Sbjct  369  CKYDHP  374


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 18/35 (51%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKL  425
            +P R G+P+C +Y++TG C+FGA CRF+HP  R +
Sbjct  299  FPERPGQPECQFYMKTGDCKFGAVCRFHHPRERLI  333


 Score = 50.1 bits (118),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 17/37 (46%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAI  431
            YP+R  E +C+YY+RTG C+FG++C+F+HP    + +
Sbjct  139  YPLRPNEIECAYYLRTGQCKFGSTCKFHHPQPTNVMV  175



>ref|XP_011015459.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Populus euphratica]
Length=412

 Score =   175 bits (444),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 79/92 (86%), Positives = 87/92 (95%), Gaps = 0/92 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFGATCKFHHPRDKAGI+GRV+LN+LGYPL+PN+IEC YY+RTGQCKFGST
Sbjct  72   QYYLKTGTCKFGATCKFHHPRDKAGISGRVSLNILGYPLQPNEIECAYYLRTGQCKFGST  131

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  723
            CKFHHPQP+NMMVPLRGSP YP V SPTTPGQ
Sbjct  132  CKFHHPQPTNMMVPLRGSPIYPTVSSPTTPGQ  163


 Score =   111 bits (277),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 49/59 (83%), Positives = 54/59 (92%), Gaps = 0/59 (0%)
 Frame = +3

Query  273  LWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMK  449
            +WQ++LRS ETME+G YP R GEPDCSYYIRTGLCRFGA+CRFNHP NRKLAIAAARMK
Sbjct  1    MWQMNLRSSETMEAGPYPERSGEPDCSYYIRTGLCRFGATCRFNHPPNRKLAIAAARMK  59


 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 46/66 (70%), Gaps = 0/66 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y+KTG CKFGA C+FHHPR++   A    L+ +G PLRP +  C +Y R G CKFG +
Sbjct  279  QFYMKTGDCKFGAVCRFHHPRERLIPAPDCVLSPIGLPLRPGEPLCIFYSRYGICKFGPS  338

Query  628  CKFHHP  645
            CKF HP
Sbjct  339  CKFDHP  344


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +3

Query  318  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKL  425
             +P R G+P+C +Y++TG C+FGA CRF+HP  R +
Sbjct  268  VFPERPGQPECQFYMKTGDCKFGAVCRFHHPRERLI  303



>ref|XP_008218439.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Prunus mume]
Length=442

 Score =   177 bits (448),  Expect(2) = 3e-68, Method: Compositional matrix adjust.
 Identities = 80/92 (87%), Positives = 86/92 (93%), Gaps = 0/92 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFGATCKFHHPRDKAGIAGRVALN+LGYPLRPN+IEC YY+RTGQCKFGST
Sbjct  102  QYYLKTGTCKFGATCKFHHPRDKAGIAGRVALNILGYPLRPNEIECAYYLRTGQCKFGST  161

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  723
            CK+HHPQP+NMMV LRGSP YP V SPTTPGQ
Sbjct  162  CKYHHPQPTNMMVSLRGSPVYPTVQSPTTPGQ  193


 Score =   109 bits (273),  Expect(2) = 3e-68, Method: Compositional matrix adjust.
 Identities = 47/61 (77%), Positives = 54/61 (89%), Gaps = 0/61 (0%)
 Frame = +3

Query  267  ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARM  446
            + +WQ++LRS ET+E G+YP R GEPDCSYYIRTGLCRFGA+CRFNHP NRKLAIA ARM
Sbjct  29   DAMWQMNLRSSETLEPGSYPERTGEPDCSYYIRTGLCRFGATCRFNHPPNRKLAIATARM  88

Query  447  K  449
            K
Sbjct  89   K  89


 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 45/66 (68%), Gaps = 0/66 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y+KTG CKFGA C+FHHPR++        L+ +G PLRP +  C +Y R G CKFG +
Sbjct  309  QFYMKTGDCKFGAVCRFHHPRERLIPTPDCVLSPIGLPLRPGEPLCIFYSRYGICKFGPS  368

Query  628  CKFHHP  645
            CKF HP
Sbjct  369  CKFDHP  374


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +3

Query  318  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKL  425
             +P R G+P+C +Y++TG C+FGA CRF+HP  R +
Sbjct  298  VFPERPGQPECQFYMKTGDCKFGAVCRFHHPRERLI  333



>ref|XP_007205202.1| hypothetical protein PRUPE_ppa005813mg [Prunus persica]
 gb|EMJ06401.1| hypothetical protein PRUPE_ppa005813mg [Prunus persica]
Length=442

 Score =   177 bits (448),  Expect(2) = 3e-68, Method: Compositional matrix adjust.
 Identities = 80/92 (87%), Positives = 86/92 (93%), Gaps = 0/92 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFGATCKFHHPRDKAGIAGRVALN+LGYPLRPN+IEC YY+RTGQCKFGST
Sbjct  102  QYYLKTGTCKFGATCKFHHPRDKAGIAGRVALNILGYPLRPNEIECAYYLRTGQCKFGST  161

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  723
            CK+HHPQP+NMMV LRGSP YP V SPTTPGQ
Sbjct  162  CKYHHPQPTNMMVSLRGSPVYPTVQSPTTPGQ  193


 Score =   109 bits (273),  Expect(2) = 3e-68, Method: Compositional matrix adjust.
 Identities = 47/61 (77%), Positives = 54/61 (89%), Gaps = 0/61 (0%)
 Frame = +3

Query  267  ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARM  446
            + +WQ++LRS ET+E G+YP R GEPDCSYYIRTGLCRFGA+CRFNHP NRKLAIA ARM
Sbjct  29   DAMWQMNLRSSETLEPGSYPERTGEPDCSYYIRTGLCRFGATCRFNHPPNRKLAIATARM  88

Query  447  K  449
            K
Sbjct  89   K  89


 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 46/66 (70%), Gaps = 0/66 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y+KTG CKFGA C+FHHPR++   A    L+ +G PLRP +  C +Y R G CKFG +
Sbjct  309  QFYMKTGDCKFGAVCRFHHPRERLIPAPDCVLSPIGLPLRPGEPLCIFYSRYGICKFGPS  368

Query  628  CKFHHP  645
            CKF HP
Sbjct  369  CKFDHP  374


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +3

Query  318  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKL  425
             +P R G+P+C +Y++TG C+FGA CRF+HP  R +
Sbjct  298  VFPERPGQPECQFYMKTGDCKFGAVCRFHHPRERLI  333



>ref|XP_004250094.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Solanum lycopersicum]
Length=433

 Score =   174 bits (440),  Expect(2) = 4e-68, Method: Compositional matrix adjust.
 Identities = 80/93 (86%), Positives = 85/93 (91%), Gaps = 0/93 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +Y+LKTG CKFGATCKFHHP+DKAGIAGRV LNV+GYPLRPN+ EC YYMRTGQCKFGST
Sbjct  98   QYFLKTGTCKFGATCKFHHPKDKAGIAGRVTLNVMGYPLRPNESECAYYMRTGQCKFGST  157

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQL  726
            CKFHHPQPSNMMV LRGSP YPPV S TTPGQL
Sbjct  158  CKFHHPQPSNMMVSLRGSPVYPPVPSATTPGQL  190


 Score =   112 bits (280),  Expect(2) = 4e-68, Method: Compositional matrix adjust.
 Identities = 48/61 (79%), Positives = 57/61 (93%), Gaps = 0/61 (0%)
 Frame = +3

Query  267  ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARM  446
            +TLWQ++LRS +++ESG YPVR+GEPDCSYYIRTGLCRFG++CRFNHP NRKLAIA ARM
Sbjct  25   DTLWQMNLRSRDSIESGHYPVREGEPDCSYYIRTGLCRFGSTCRFNHPPNRKLAIATARM  84

Query  447  K  449
            K
Sbjct  85   K  85


 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 45/66 (68%), Gaps = 0/66 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y+KTG CKFGA C+FHHPR++        L+ +G PLRP +  C +Y R G CKFG +
Sbjct  299  QFYMKTGDCKFGAVCRFHHPRERLIPPPDCLLSPIGLPLRPGEPLCIFYSRYGICKFGPS  358

Query  628  CKFHHP  645
            CKF HP
Sbjct  359  CKFDHP  364


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 19/39 (49%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = +3

Query  309  ESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKL  425
            E   +P R G+P+C +Y++TG C+FGA CRF+HP  R +
Sbjct  285  EENVFPERPGQPECQFYMKTGDCKFGAVCRFHHPRERLI  323


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/57 (37%), Positives = 33/57 (58%), Gaps = 0/57 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKVLLEDGSLQVWGHL  491
            YP+R  E +C+YY+RTG C+FG++C+F+HP    + ++     V     S    G L
Sbjct  134  YPLRPNESECAYYMRTGQCKFGSTCKFHHPQPSNMMVSLRGSPVYPPVPSATTPGQL  190


 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 23/48 (48%), Positives = 30/48 (63%), Gaps = 1/48 (2%)
 Frame = +1

Query  508  RDKAGIAGRVALNVLG-YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQ  648
            R  +G  G  AL     +P RP   EC +YM+TG CKFG+ C+FHHP+
Sbjct  272  RQASGPMGYYALQEENVFPERPGQPECQFYMKTGDCKFGAVCRFHHPR  319



>emb|CDP04213.1| unnamed protein product [Coffea canephora]
Length=403

 Score =   173 bits (438),  Expect(2) = 7e-68, Method: Compositional matrix adjust.
 Identities = 78/93 (84%), Positives = 84/93 (90%), Gaps = 0/93 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFGATCKFHHPR+KAGIAGRV LN LGYPLRPN+IEC YY+RTG CKFGST
Sbjct  98   QYYLKTGTCKFGATCKFHHPREKAGIAGRVTLNALGYPLRPNEIECAYYLRTGHCKFGST  157

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQL  726
            CKFHHPQP+NMMV +RGSP YP VHSPT PGQL
Sbjct  158  CKFHHPQPANMMVSVRGSPVYPSVHSPTNPGQL  190


 Score =   112 bits (280),  Expect(2) = 7e-68, Method: Compositional matrix adjust.
 Identities = 48/61 (79%), Positives = 56/61 (92%), Gaps = 0/61 (0%)
 Frame = +3

Query  267  ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARM  446
            + LWQ++LRS E ME+GTYPVR+GEPDCSYYIRTGLCR+GA+CRFNHP NRKLAIA ARM
Sbjct  25   DALWQINLRSREPMEAGTYPVREGEPDCSYYIRTGLCRYGATCRFNHPPNRKLAIATARM  84

Query  447  K  449
            +
Sbjct  85   R  85


 Score = 80.5 bits (197),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 46/66 (70%), Gaps = 0/66 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y+KTG CKFGA CKFHHPR++   A    L+ +G PLRP +  C +Y R G CKFG +
Sbjct  271  QFYMKTGDCKFGAVCKFHHPRERILPAPDCVLSPIGLPLRPGEPLCIFYSRYGICKFGPS  330

Query  628  CKFHHP  645
            CKF HP
Sbjct  331  CKFDHP  336


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +3

Query  303  TMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAA  437
            T+ +  YP+R  E +C+YY+RTG C+FG++C+F+HP    + ++ 
Sbjct  128  TLNALGYPLRPNEIECAYYLRTGHCKFGSTCKFHHPQPANMMVSV  172


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +3

Query  318  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKL  425
             +P R G+P+C +Y++TG C+FGA C+F+HP  R L
Sbjct  260  VFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERIL  295


 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 24/56 (43%), Positives = 32/56 (57%), Gaps = 3/56 (5%)
 Frame = +1

Query  556  YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  723
            +P RP   EC +YM+TG CKFG+ CKFHHP+   +  P        P+  P  PG+
Sbjct  261  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERILPAP---DCVLSPIGLPLRPGE  313



>ref|XP_009611374.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009611375.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009611377.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Nicotiana tomentosiformis]
Length=454

 Score =   176 bits (447),  Expect(2) = 1e-67, Method: Compositional matrix adjust.
 Identities = 82/93 (88%), Positives = 85/93 (91%), Gaps = 0/93 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFGATCKFHHP+DKAGIAGRV LNVLGYPLRPN+ EC YYMRTGQCKFGST
Sbjct  119  QYYLKTGTCKFGATCKFHHPKDKAGIAGRVTLNVLGYPLRPNEAECAYYMRTGQCKFGST  178

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQL  726
            CKFHHPQPSNMMV LRGSP YPPV S TTPGQL
Sbjct  179  CKFHHPQPSNMMVSLRGSPVYPPVPSATTPGQL  211


 Score =   108 bits (269),  Expect(2) = 1e-67, Method: Compositional matrix adjust.
 Identities = 49/65 (75%), Positives = 57/65 (88%), Gaps = 4/65 (6%)
 Frame = +3

Query  267  ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKL----AIA  434
            +TLWQ++LRS E++ESG YPVR+GEPDCSYYIRTGLCRFG++CRFNHP NRKL    AIA
Sbjct  25   DTLWQMNLRSRESIESGHYPVREGEPDCSYYIRTGLCRFGSTCRFNHPPNRKLYLMQAIA  84

Query  435  AARMK  449
             ARMK
Sbjct  85   TARMK  89


 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 45/66 (68%), Gaps = 0/66 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y+KTG CKFGA C+FHHPR++        L+ +G PLRP +  C +Y R G CKFG +
Sbjct  320  QFYMKTGDCKFGAVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPLCIFYSRYGICKFGPS  379

Query  628  CKFHHP  645
            CKF HP
Sbjct  380  CKFDHP  385


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/57 (37%), Positives = 33/57 (58%), Gaps = 0/57 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKVLLEDGSLQVWGHL  491
            YP+R  E +C+YY+RTG C+FG++C+F+HP    + ++     V     S    G L
Sbjct  155  YPLRPNEAECAYYMRTGQCKFGSTCKFHHPQPSNMMVSLRGSPVYPPVPSATTPGQL  211


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +3

Query  318  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKL  425
             +P R G+P+C +Y++TG C+FGA CRF+HP  R +
Sbjct  309  VFPERHGQPECQFYMKTGDCKFGAVCRFHHPRERLI  344



>ref|XP_009611379.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X3 [Nicotiana tomentosiformis]
Length=437

 Score =   176 bits (446),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 82/93 (88%), Positives = 85/93 (91%), Gaps = 0/93 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFGATCKFHHP+DKAGIAGRV LNVLGYPLRPN+ EC YYMRTGQCKFGST
Sbjct  102  QYYLKTGTCKFGATCKFHHPKDKAGIAGRVTLNVLGYPLRPNEAECAYYMRTGQCKFGST  161

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQL  726
            CKFHHPQPSNMMV LRGSP YPPV S TTPGQL
Sbjct  162  CKFHHPQPSNMMVSLRGSPVYPPVPSATTPGQL  194


 Score =   107 bits (268),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 49/65 (75%), Positives = 57/65 (88%), Gaps = 4/65 (6%)
 Frame = +3

Query  267  ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKL----AIA  434
            +TLWQ++LRS E++ESG YPVR+GEPDCSYYIRTGLCRFG++CRFNHP NRKL    AIA
Sbjct  25   DTLWQMNLRSRESIESGHYPVREGEPDCSYYIRTGLCRFGSTCRFNHPPNRKLYLMQAIA  84

Query  435  AARMK  449
             ARMK
Sbjct  85   TARMK  89


 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 45/66 (68%), Gaps = 0/66 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y+KTG CKFGA C+FHHPR++        L+ +G PLRP +  C +Y R G CKFG +
Sbjct  303  QFYMKTGDCKFGAVCRFHHPRERLIPPPDCMLSPIGLPLRPGEPLCIFYSRYGICKFGPS  362

Query  628  CKFHHP  645
            CKF HP
Sbjct  363  CKFDHP  368


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/57 (37%), Positives = 33/57 (58%), Gaps = 0/57 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKVLLEDGSLQVWGHL  491
            YP+R  E +C+YY+RTG C+FG++C+F+HP    + ++     V     S    G L
Sbjct  138  YPLRPNEAECAYYMRTGQCKFGSTCKFHHPQPSNMMVSLRGSPVYPPVPSATTPGQL  194


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +3

Query  318  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKL  425
             +P R G+P+C +Y++TG C+FGA CRF+HP  R +
Sbjct  292  VFPERHGQPECQFYMKTGDCKFGAVCRFHHPRERLI  327



>ref|XP_008359920.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X2 [Malus domestica]
Length=443

 Score =   175 bits (444),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 79/92 (86%), Positives = 85/92 (92%), Gaps = 0/92 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFGATCKFHHPRDKAGIAGRVALN+LGYPLRPN+IEC YY+RTGQCKFG T
Sbjct  102  QYYLKTGTCKFGATCKFHHPRDKAGIAGRVALNILGYPLRPNEIECAYYLRTGQCKFGGT  161

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  723
            CKFHHPQP+NMMV +RGSP YP V SPTTPGQ
Sbjct  162  CKFHHPQPTNMMVSVRGSPVYPTVQSPTTPGQ  193


 Score =   108 bits (269),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 47/61 (77%), Positives = 54/61 (89%), Gaps = 0/61 (0%)
 Frame = +3

Query  267  ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARM  446
            + +W ++LRS ET+E+G YP R GEPDCSYYIRTGLCRFGA+CRFNHP NRKLAIAAARM
Sbjct  29   DAMWPMNLRSSETLEAGGYPERTGEPDCSYYIRTGLCRFGATCRFNHPPNRKLAIAAARM  88

Query  447  K  449
            K
Sbjct  89   K  89


 Score = 77.0 bits (188),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 45/66 (68%), Gaps = 0/66 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y+KTG CKFGA C+FHHP ++   A    L+ +G PLRP +  C +Y R G CKFG +
Sbjct  309  QFYMKTGDCKFGAVCRFHHPMERLIPAPDCVLSPIGLPLRPGEPMCIFYSRYGICKFGPS  368

Query  628  CKFHHP  645
            CKF HP
Sbjct  369  CKFDHP  374


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +3

Query  318  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKL  425
             +P R G+P+C +Y++TG C+FGA CRF+HP  R +
Sbjct  298  VFPERPGQPECQFYMKTGDCKFGAVCRFHHPMERLI  333


 Score = 50.1 bits (118),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 17/38 (45%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIA  434
            YP+R  E +C+YY+RTG C+FG +C+F+HP    + ++
Sbjct  138  YPLRPNEIECAYYLRTGQCKFGGTCKFHHPQPTNMMVS  175



>gb|KJB26823.1| hypothetical protein B456_004G261700 [Gossypium raimondii]
Length=449

 Score =   170 bits (431),  Expect(2) = 3e-67, Method: Compositional matrix adjust.
 Identities = 75/92 (82%), Positives = 84/92 (91%), Gaps = 0/92 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFGATCKFHHPR++AGIAGRV+LN+LGYP RPN+ EC YY+RTGQCKFGST
Sbjct  112  QYYLKTGTCKFGATCKFHHPREQAGIAGRVSLNILGYPFRPNETECAYYLRTGQCKFGST  171

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  723
            CKFHHPQP+NMM+ LRGSP YP V SPTTPGQ
Sbjct  172  CKFHHPQPTNMMISLRGSPIYPTVASPTTPGQ  203


 Score =   112 bits (281),  Expect(2) = 3e-67, Method: Compositional matrix adjust.
 Identities = 50/61 (82%), Positives = 55/61 (90%), Gaps = 0/61 (0%)
 Frame = +3

Query  267  ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARM  446
            + +WQ++LRS ETMESG YP R GEPDCSYYIRTGLCRFGA+CRFNHP NRKLAIAAARM
Sbjct  39   DAMWQMNLRSSETMESGYYPERPGEPDCSYYIRTGLCRFGATCRFNHPPNRKLAIAAARM  98

Query  447  K  449
            K
Sbjct  99   K  99


 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 40/85 (47%), Positives = 53/85 (62%), Gaps = 0/85 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y+KTG CKFGA C+FHHPR++   A    L+ +G PLRP +  C +Y R G CKFG +
Sbjct  316  QFYMKTGDCKFGAVCRFHHPRERVPPAPDCLLSPIGLPLRPGEPLCDFYSRYGICKFGPS  375

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVH  702
            CKF+HP           SP+  PVH
Sbjct  376  CKFNHPMGIFTYNYSISSPSGAPVH  400


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIA  434
            YP R  E +C+YY+RTG C+FG++C+F+HP    + I+
Sbjct  148  YPFRPNETECAYYLRTGQCKFGSTCKFHHPQPTNMMIS  185


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 18/34 (53%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = +3

Query  318  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNR  419
             +P R G+P+C +Y++TG C+FGA CRF+HP  R
Sbjct  305  VFPERPGQPECQFYMKTGDCKFGAVCRFHHPRER  338


 Score = 50.1 bits (118),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 18/29 (62%), Positives = 23/29 (79%), Gaps = 0/29 (0%)
 Frame = +3

Query  324  PVRDGEPDCSYYIRTGLCRFGASCRFNHP  410
            P+R GEP C +Y R G+C+FG SC+FNHP
Sbjct  353  PLRPGEPLCDFYSRYGICKFGPSCKFNHP  381



>ref|XP_009338000.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X2 [Pyrus x bretschneideri]
Length=442

 Score =   171 bits (432),  Expect(2) = 3e-67, Method: Compositional matrix adjust.
 Identities = 76/92 (83%), Positives = 84/92 (91%), Gaps = 0/92 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFGATCKFHHPRDKAG+AGRVALN+LGYPLRPN++EC YY+RTGQCKFGST
Sbjct  102  QYYLKTGTCKFGATCKFHHPRDKAGMAGRVALNILGYPLRPNEVECAYYLRTGQCKFGST  161

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  723
            CKFHHPQP+NMMV +  SP YP V SPTTPGQ
Sbjct  162  CKFHHPQPTNMMVSVGASPVYPTVQSPTTPGQ  193


 Score =   112 bits (280),  Expect(2) = 3e-67, Method: Compositional matrix adjust.
 Identities = 49/61 (80%), Positives = 55/61 (90%), Gaps = 0/61 (0%)
 Frame = +3

Query  267  ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARM  446
            + +WQ++LRS ETME+G YP R GEPDCSYYIRTGLCRFGA+CRFNHP NRKLAIAAARM
Sbjct  29   DAMWQMNLRSSETMEAGAYPERTGEPDCSYYIRTGLCRFGATCRFNHPPNRKLAIAAARM  88

Query  447  K  449
            K
Sbjct  89   K  89


 Score = 80.1 bits (196),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 47/66 (71%), Gaps = 0/66 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y+KTG CKFGA C+FHHPR++   A    L+ +G PLRP +  C +Y R G CKFG +
Sbjct  309  QFYMKTGDCKFGAVCRFHHPRERLIPAPDCVLSPMGLPLRPGEPLCIFYSRYGICKFGPS  368

Query  628  CKFHHP  645
            CKF+HP
Sbjct  369  CKFNHP  374


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 18/44 (41%), Positives = 30/44 (68%), Gaps = 0/44 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKV  452
            YP+R  E +C+YY+RTG C+FG++C+F+HP    + ++     V
Sbjct  138  YPLRPNEVECAYYLRTGQCKFGSTCKFHHPQPTNMMVSVGASPV  181


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +3

Query  318  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKL  425
             +P R G+P+C +Y++TG C+FGA CRF+HP  R +
Sbjct  298  VFPERPGQPECQFYMKTGDCKFGAVCRFHHPRERLI  333



>ref|XP_011014371.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Populus euphratica]
Length=445

 Score =   172 bits (435),  Expect(2) = 4e-67, Method: Compositional matrix adjust.
 Identities = 76/92 (83%), Positives = 87/92 (95%), Gaps = 0/92 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFGATCKFHHPRDKAG++GRV+LN+LGYPLR N++EC YY+RTGQCKFGST
Sbjct  105  QYYLKTGTCKFGATCKFHHPRDKAGVSGRVSLNILGYPLRLNEMECAYYLRTGQCKFGST  164

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  723
            CKFHHPQP+N+MVPLRGSP YP V+SPTTPGQ
Sbjct  165  CKFHHPQPTNVMVPLRGSPVYPTVNSPTTPGQ  196


 Score =   110 bits (276),  Expect(2) = 4e-67, Method: Compositional matrix adjust.
 Identities = 48/61 (79%), Positives = 54/61 (89%), Gaps = 0/61 (0%)
 Frame = +3

Query  267  ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARM  446
            + +WQ++LRS ETME+G YP R GEPDCSYYIRTGLCRFG +CRFNHP NRKLAIAAARM
Sbjct  32   DAIWQMNLRSSETMEAGPYPERPGEPDCSYYIRTGLCRFGPTCRFNHPPNRKLAIAAARM  91

Query  447  K  449
            K
Sbjct  92   K  92


 Score = 83.6 bits (205),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 47/66 (71%), Gaps = 0/66 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y+KTG CKFGA C+FHHPR++   A    L+ +G PLRP +  C +Y R G CKFG +
Sbjct  312  QFYMKTGDCKFGAVCRFHHPRERLIPAPDCVLSAIGLPLRPGEPLCIFYSRYGICKFGPS  371

Query  628  CKFHHP  645
            CKFHHP
Sbjct  372  CKFHHP  377


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +3

Query  318  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKL  425
             +P R G+P+C +Y++TG C+FGA CRF+HP  R +
Sbjct  301  VFPERPGQPECQFYMKTGDCKFGAVCRFHHPRERLI  336



>ref|XP_002325901.2| zinc finger family protein [Populus trichocarpa]
 gb|EEF00283.2| zinc finger family protein [Populus trichocarpa]
Length=445

 Score =   172 bits (435),  Expect(2) = 5e-67, Method: Compositional matrix adjust.
 Identities = 76/92 (83%), Positives = 87/92 (95%), Gaps = 0/92 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFGATCKFHHPRDKAG++GRV+LN+LGYPLR N++EC YY+RTGQCKFGST
Sbjct  105  QYYLKTGTCKFGATCKFHHPRDKAGVSGRVSLNILGYPLRLNEMECAYYLRTGQCKFGST  164

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  723
            CKFHHPQP+N+MVPLRGSP YP V+SPTTPGQ
Sbjct  165  CKFHHPQPTNVMVPLRGSPVYPTVNSPTTPGQ  196


 Score =   110 bits (275),  Expect(2) = 5e-67, Method: Compositional matrix adjust.
 Identities = 48/61 (79%), Positives = 54/61 (89%), Gaps = 0/61 (0%)
 Frame = +3

Query  267  ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARM  446
            + +WQ++LRS ETME+G YP R GEPDCSYYIRTGLCRFG +CRFNHP NRKLAIAAARM
Sbjct  32   DAMWQMNLRSSETMEAGPYPERPGEPDCSYYIRTGLCRFGPTCRFNHPPNRKLAIAAARM  91

Query  447  K  449
            K
Sbjct  92   K  92


 Score = 83.6 bits (205),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 47/66 (71%), Gaps = 0/66 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y+KTG CKFGA C+FHHPR++   A    L+ +G PLRP +  C +Y R G CKFG +
Sbjct  312  QFYMKTGDCKFGAVCRFHHPRERLIPAPDCVLSAIGLPLRPGEPLCIFYSRYGICKFGPS  371

Query  628  CKFHHP  645
            CKFHHP
Sbjct  372  CKFHHP  377


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +3

Query  318  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKL  425
             +P R G+P+C +Y++TG C+FGA CRF+HP  R +
Sbjct  301  VFPERPGQPECQFYMKTGDCKFGAVCRFHHPRERLI  336



>ref|XP_006428579.1| hypothetical protein CICLE_v10011741mg [Citrus clementina]
 ref|XP_006428580.1| hypothetical protein CICLE_v10011741mg [Citrus clementina]
 ref|XP_006480413.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Citrus sinensis]
 gb|ESR41819.1| hypothetical protein CICLE_v10011741mg [Citrus clementina]
 gb|ESR41820.1| hypothetical protein CICLE_v10011741mg [Citrus clementina]
Length=439

 Score =   176 bits (446),  Expect(2) = 7e-67, Method: Compositional matrix adjust.
 Identities = 80/92 (87%), Positives = 85/92 (92%), Gaps = 0/92 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFGATCKFHHPRDKAGIAGRV+LNVLGYPLRPN+IEC YY+RTGQCKFGST
Sbjct  101  QYYLKTGTCKFGATCKFHHPRDKAGIAGRVSLNVLGYPLRPNEIECAYYLRTGQCKFGST  160

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  723
            CKFHHPQP+NMMV LRGSP YP V SPTTP Q
Sbjct  161  CKFHHPQPNNMMVSLRGSPVYPTVQSPTTPSQ  192


 Score =   105 bits (263),  Expect(2) = 7e-67, Method: Compositional matrix adjust.
 Identities = 46/61 (75%), Positives = 53/61 (87%), Gaps = 0/61 (0%)
 Frame = +3

Query  267  ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARM  446
            + LWQ++LR+ E MESG+ P R GEPDCSYYIRTGLCRFGA+CRFNHP NRKLAIA AR+
Sbjct  28   DALWQMNLRTNEAMESGSLPERPGEPDCSYYIRTGLCRFGATCRFNHPPNRKLAIATARI  87

Query  447  K  449
            K
Sbjct  88   K  88


 Score = 77.8 bits (190),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 45/66 (68%), Gaps = 0/66 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y+KTG CKFGA C+FHHPR++        L+ +G PLRP +  C +Y R G CKFG +
Sbjct  308  QFYMKTGDCKFGAVCRFHHPRERLLPVPDCVLSPIGLPLRPGEPLCIFYSRYGICKFGPS  367

Query  628  CKFHHP  645
            CKF HP
Sbjct  368  CKFDHP  373


 Score = 53.5 bits (127),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = +3

Query  318  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAI  431
             +P R G+P+C +Y++TG C+FGA CRF+HP  R L +
Sbjct  297  VFPERPGQPECQFYMKTGDCKFGAVCRFHHPRERLLPV  334


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/56 (43%), Positives = 33/56 (59%), Gaps = 3/56 (5%)
 Frame = +1

Query  556  YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  723
            +P RP   EC +YM+TG CKFG+ C+FHHP+   + VP        P+  P  PG+
Sbjct  298  FPERPGQPECQFYMKTGDCKFGAVCRFHHPRERLLPVP---DCVLSPIGLPLRPGE  350


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 17/38 (45%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIA  434
            YP+R  E +C+YY+RTG C+FG++C+F+HP    + ++
Sbjct  137  YPLRPNEIECAYYLRTGQCKFGSTCKFHHPQPNNMMVS  174



>ref|XP_007029391.1| Zinc finger CCCH domain-containing protein 33 isoform 1 [Theobroma 
cacao]
 gb|EOY09893.1| Zinc finger CCCH domain-containing protein 33 isoform 1 [Theobroma 
cacao]
Length=451

 Score =   168 bits (426),  Expect(2) = 8e-67, Method: Compositional matrix adjust.
 Identities = 77/92 (84%), Positives = 84/92 (91%), Gaps = 0/92 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFGATCKFHHPRDKAGIAGRV+LN+LGYPLRPN+ EC YY+RTGQCKFGST
Sbjct  112  QYYLKTGTCKFGATCKFHHPRDKAGIAGRVSLNILGYPLRPNEPECAYYLRTGQCKFGST  171

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  723
            CKFHHPQP+NMMV +RGSP Y  V SPTTPGQ
Sbjct  172  CKFHHPQPTNMMVSVRGSPIYQTVPSPTTPGQ  203


 Score =   113 bits (282),  Expect(2) = 8e-67, Method: Compositional matrix adjust.
 Identities = 50/61 (82%), Positives = 55/61 (90%), Gaps = 0/61 (0%)
 Frame = +3

Query  267  ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARM  446
            + +WQ++LRS ETMESG YP R GEPDCSYYIRTGLCRFGA+CRFNHP NRKLAIAAARM
Sbjct  39   DAMWQMNLRSSETMESGPYPERPGEPDCSYYIRTGLCRFGATCRFNHPPNRKLAIAAARM  98

Query  447  K  449
            K
Sbjct  99   K  99


 Score = 80.5 bits (197),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 52/85 (61%), Gaps = 0/85 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y+KTG CKFG  C+FHHPR++   A    L+ +G PLRP +  C +Y R G CKFG +
Sbjct  318  QFYMKTGDCKFGTVCRFHHPRERVLPAPDCVLSPIGLPLRPGEPLCIFYSRYGICKFGPS  377

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVH  702
            CKF+HP           SP+  PVH
Sbjct  378  CKFNHPMGIFTYNYSTSSPSDAPVH  402


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAA  437
            YP+R  EP+C+YY+RTG C+FG++C+F+HP    + ++ 
Sbjct  148  YPLRPNEPECAYYLRTGQCKFGSTCKFHHPQPTNMMVSV  186


 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 40/82 (49%), Gaps = 4/82 (5%)
 Frame = +1

Query  481  GATCKFHHPRDKAGIAGRVALNVLG-YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSN  657
            G+   F   R  +   G  AL     +P RP   EC +YM+TG CKFG+ C+FHHP+   
Sbjct  282  GSQASFSQFRSGSVPVGFYALQRENVFPERPGQPECQFYMKTGDCKFGTVCRFHHPRERV  341

Query  658  MMVPLRGSPAYPPVHSPTTPGQ  723
            +  P        P+  P  PG+
Sbjct  342  LPAP---DCVLSPIGLPLRPGE  360


 Score = 50.4 bits (119),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +3

Query  318  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKL  425
             +P R G+P+C +Y++TG C+FG  CRF+HP  R L
Sbjct  307  VFPERPGQPECQFYMKTGDCKFGTVCRFHHPRERVL  342



>ref|XP_002278934.2| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Vitis vinifera]
Length=441

 Score =   171 bits (434),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 78/92 (85%), Positives = 86/92 (93%), Gaps = 0/92 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFGATCKFHHPRDKAGIAGRV+LN+LGYPLRP++I+C YY+RTGQCKFGST
Sbjct  100  QYYLKTGTCKFGATCKFHHPRDKAGIAGRVSLNILGYPLRPDEIDCAYYLRTGQCKFGST  159

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  723
            CKFHHPQPS+MMV LRGSP YP V SPTTPGQ
Sbjct  160  CKFHHPQPSSMMVSLRGSPVYPSVPSPTTPGQ  191


 Score =   109 bits (273),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 48/61 (79%), Positives = 53/61 (87%), Gaps = 0/61 (0%)
 Frame = +3

Query  267  ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARM  446
            + +WQ++LRS ETMESG YP R GEPDCSYYIRTGLCRFG +CRFNHP NRKLAIA ARM
Sbjct  27   DAMWQMNLRSSETMESGPYPERPGEPDCSYYIRTGLCRFGITCRFNHPPNRKLAIATARM  86

Query  447  K  449
            K
Sbjct  87   K  87


 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 45/66 (68%), Gaps = 0/66 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y+KTG CKFGA C+FHHPR++        L+ +G PLRP +  C +Y R G CKFG +
Sbjct  307  QFYMKTGDCKFGAVCRFHHPRERLIPTPDCVLSPIGLPLRPGEPLCIFYSRYGICKFGPS  366

Query  628  CKFHHP  645
            CKF HP
Sbjct  367  CKFDHP  372


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIA  434
            YP+R  E DC+YY+RTG C+FG++C+F+HP    + ++
Sbjct  136  YPLRPDEIDCAYYLRTGQCKFGSTCKFHHPQPSSMMVS  173


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +3

Query  318  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKL  425
             +P R G+P+C +Y++TG C+FGA CRF+HP  R +
Sbjct  296  VFPERPGQPECQFYMKTGDCKFGAVCRFHHPRERLI  331



>gb|KDO47609.1| hypothetical protein CISIN_1g0472481mg, partial [Citrus sinensis]
Length=238

 Score =   176 bits (445),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 80/92 (87%), Positives = 85/92 (92%), Gaps = 0/92 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFGATCKFHHPRDKAGIAGRV+LNVLGYPLRPN+IEC YY+RTGQCKFGST
Sbjct  101  QYYLKTGTCKFGATCKFHHPRDKAGIAGRVSLNVLGYPLRPNEIECAYYLRTGQCKFGST  160

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  723
            CKFHHPQP+NMMV LRGSP YP V SPTTP Q
Sbjct  161  CKFHHPQPNNMMVSLRGSPVYPTVQSPTTPSQ  192


 Score =   105 bits (262),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 46/61 (75%), Positives = 53/61 (87%), Gaps = 0/61 (0%)
 Frame = +3

Query  267  ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARM  446
            + LWQ++LR+ E MESG+ P R GEPDCSYYIRTGLCRFGA+CRFNHP NRKLAIA AR+
Sbjct  28   DALWQMNLRTNEAMESGSLPERPGEPDCSYYIRTGLCRFGATCRFNHPPNRKLAIATARI  87

Query  447  K  449
            K
Sbjct  88   K  88


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 17/38 (45%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIA  434
            YP+R  E +C+YY+RTG C+FG++C+F+HP    + ++
Sbjct  137  YPLRPNEIECAYYLRTGQCKFGSTCKFHHPQPNNMMVS  174



>gb|KCW84568.1| hypothetical protein EUGRSUZ_B01407 [Eucalyptus grandis]
Length=419

 Score =   171 bits (433),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 77/92 (84%), Positives = 84/92 (91%), Gaps = 0/92 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFGATCKFHHPRDKAGIAG+VALN+LGYP RPN++EC YY+RTGQCKFGST
Sbjct  97   QYYLKTGTCKFGATCKFHHPRDKAGIAGKVALNILGYPFRPNEMECAYYLRTGQCKFGST  156

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  723
            CKFHHPQP+NMMV LRGSP YP V SPTTP Q
Sbjct  157  CKFHHPQPTNMMVSLRGSPVYPSVQSPTTPTQ  188


 Score =   109 bits (273),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 48/61 (79%), Positives = 55/61 (90%), Gaps = 0/61 (0%)
 Frame = +3

Query  267  ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARM  446
            + +WQ++LRS ET+ESG YP R GEPDCSYYIRTGLCRFGA+CRFNHPS+RKLAIA ARM
Sbjct  24   DAMWQMTLRSNETIESGPYPERPGEPDCSYYIRTGLCRFGATCRFNHPSDRKLAIANARM  83

Query  447  K  449
            K
Sbjct  84   K  84


 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 46/66 (70%), Gaps = 0/66 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y+KTG CKFGA C+FHHPR++   A    L+ +G PLRP +  C +Y R G CKFG +
Sbjct  293  QFYMKTGDCKFGAVCRFHHPRERLLPAPDCLLSPIGLPLRPGEPLCIFYSRYGICKFGPS  352

Query  628  CKFHHP  645
            CKF HP
Sbjct  353  CKFDHP  358


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKL  425
            +P R G+P+C +Y++TG C+FGA CRF+HP  R L
Sbjct  283  FPERPGQPECQFYMKTGDCKFGAVCRFHHPRERLL  317



>ref|XP_010038283.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Eucalyptus grandis]
 gb|KCW84569.1| hypothetical protein EUGRSUZ_B01407 [Eucalyptus grandis]
Length=429

 Score =   171 bits (434),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 77/92 (84%), Positives = 84/92 (91%), Gaps = 0/92 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFGATCKFHHPRDKAGIAG+VALN+LGYP RPN++EC YY+RTGQCKFGST
Sbjct  97   QYYLKTGTCKFGATCKFHHPRDKAGIAGKVALNILGYPFRPNEMECAYYLRTGQCKFGST  156

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  723
            CKFHHPQP+NMMV LRGSP YP V SPTTP Q
Sbjct  157  CKFHHPQPTNMMVSLRGSPVYPSVQSPTTPTQ  188


 Score =   109 bits (273),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 48/61 (79%), Positives = 55/61 (90%), Gaps = 0/61 (0%)
 Frame = +3

Query  267  ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARM  446
            + +WQ++LRS ET+ESG YP R GEPDCSYYIRTGLCRFGA+CRFNHPS+RKLAIA ARM
Sbjct  24   DAMWQMTLRSNETIESGPYPERPGEPDCSYYIRTGLCRFGATCRFNHPSDRKLAIANARM  83

Query  447  K  449
            K
Sbjct  84   K  84


 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 46/66 (70%), Gaps = 0/66 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y+KTG CKFGA C+FHHPR++   A    L+ +G PLRP +  C +Y R G CKFG +
Sbjct  303  QFYMKTGDCKFGAVCRFHHPRERLLPAPDCLLSPIGLPLRPGEPLCIFYSRYGICKFGPS  362

Query  628  CKFHHP  645
            CKF HP
Sbjct  363  CKFDHP  368


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKL  425
            +P R G+P+C +Y++TG C+FGA CRF+HP  R L
Sbjct  293  FPERPGQPECQFYMKTGDCKFGAVCRFHHPRERLL  327



>ref|XP_008812314.1| PREDICTED: LOW QUALITY PROTEIN: zinc finger CCCH domain-containing 
protein ZFN-like [Phoenix dactylifera]
Length=457

 Score =   174 bits (442),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 79/92 (86%), Positives = 85/92 (92%), Gaps = 0/92 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFGATCKFHHP+DKAGIAGRV LN+LGYPLRPN+ EC YY+RTGQCKFG+T
Sbjct  102  QYYLKTGTCKFGATCKFHHPKDKAGIAGRVQLNILGYPLRPNEKECAYYLRTGQCKFGNT  161

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  723
            CKFHHPQPSN MV LRGSP YPPVHSPTTPGQ
Sbjct  162  CKFHHPQPSNAMVDLRGSPVYPPVHSPTTPGQ  193


 Score =   106 bits (264),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 45/61 (74%), Positives = 53/61 (87%), Gaps = 0/61 (0%)
 Frame = +3

Query  267  ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARM  446
            E +WQ++LR  E+MESG YP R GEPDC+YYIRTGLCRFG +C+FNHP NRKLAIAAAR+
Sbjct  29   EAMWQMNLRGSESMESGPYPERPGEPDCAYYIRTGLCRFGMTCKFNHPPNRKLAIAAARI  88

Query  447  K  449
            K
Sbjct  89   K  89


 Score = 80.1 bits (196),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 45/66 (68%), Gaps = 0/66 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y+KTG CKFGA CKFHHPR++       +L+ LG PLRP +  C +Y R G CKFG  
Sbjct  309  QFYMKTGDCKFGAVCKFHHPRERLVPVPNCSLSPLGLPLRPGEPLCVFYARYGICKFGPN  368

Query  628  CKFHHP  645
            CKF HP
Sbjct  369  CKFDHP  374


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/70 (39%), Positives = 38/70 (54%), Gaps = 2/70 (3%)
 Frame = +1

Query  460  KTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFH  639
            +TGA   G    +       G+      N+  +P RP+  EC +YM+TG CKFG+ CKFH
Sbjct  269  ETGAGAQGTFSSYRPGSIPMGVYALQRENI--FPERPDQPECQFYMKTGDCKFGAVCKFH  326

Query  640  HPQPSNMMVP  669
            HP+   + VP
Sbjct  327  HPRERLVPVP  336



>ref|XP_007029392.1| Zinc finger CCCH domain-containing protein 33 isoform 2 [Theobroma 
cacao]
 gb|EOY09894.1| Zinc finger CCCH domain-containing protein 33 isoform 2 [Theobroma 
cacao]
Length=411

 Score =   168 bits (425),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 77/92 (84%), Positives = 84/92 (91%), Gaps = 0/92 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFGATCKFHHPRDKAGIAGRV+LN+LGYPLRPN+ EC YY+RTGQCKFGST
Sbjct  72   QYYLKTGTCKFGATCKFHHPRDKAGIAGRVSLNILGYPLRPNEPECAYYLRTGQCKFGST  131

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  723
            CKFHHPQP+NMMV +RGSP Y  V SPTTPGQ
Sbjct  132  CKFHHPQPTNMMVSVRGSPIYQTVPSPTTPGQ  163


 Score =   112 bits (280),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 50/59 (85%), Positives = 54/59 (92%), Gaps = 0/59 (0%)
 Frame = +3

Query  273  LWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMK  449
            +WQ++LRS ETMESG YP R GEPDCSYYIRTGLCRFGA+CRFNHP NRKLAIAAARMK
Sbjct  1    MWQMNLRSSETMESGPYPERPGEPDCSYYIRTGLCRFGATCRFNHPPNRKLAIAAARMK  59


 Score = 80.5 bits (197),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 52/85 (61%), Gaps = 0/85 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y+KTG CKFG  C+FHHPR++   A    L+ +G PLRP +  C +Y R G CKFG +
Sbjct  278  QFYMKTGDCKFGTVCRFHHPRERVLPAPDCVLSPIGLPLRPGEPLCIFYSRYGICKFGPS  337

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVH  702
            CKF+HP           SP+  PVH
Sbjct  338  CKFNHPMGIFTYNYSTSSPSDAPVH  362


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAA  437
            YP+R  EP+C+YY+RTG C+FG++C+F+HP    + ++ 
Sbjct  108  YPLRPNEPECAYYLRTGQCKFGSTCKFHHPQPTNMMVSV  146


 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 40/82 (49%), Gaps = 4/82 (5%)
 Frame = +1

Query  481  GATCKFHHPRDKAGIAGRVALNVLG-YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSN  657
            G+   F   R  +   G  AL     +P RP   EC +YM+TG CKFG+ C+FHHP+   
Sbjct  242  GSQASFSQFRSGSVPVGFYALQRENVFPERPGQPECQFYMKTGDCKFGTVCRFHHPRERV  301

Query  658  MMVPLRGSPAYPPVHSPTTPGQ  723
            +  P        P+  P  PG+
Sbjct  302  LPAP---DCVLSPIGLPLRPGE  320


 Score = 50.4 bits (119),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +3

Query  318  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKL  425
             +P R G+P+C +Y++TG C+FG  CRF+HP  R L
Sbjct  267  VFPERPGQPECQFYMKTGDCKFGTVCRFHHPRERVL  302



>gb|KCW84570.1| hypothetical protein EUGRSUZ_B01407 [Eucalyptus grandis]
Length=345

 Score =   171 bits (432),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 77/92 (84%), Positives = 84/92 (91%), Gaps = 0/92 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFGATCKFHHPRDKAGIAG+VALN+LGYP RPN++EC YY+RTGQCKFGST
Sbjct  97   QYYLKTGTCKFGATCKFHHPRDKAGIAGKVALNILGYPFRPNEMECAYYLRTGQCKFGST  156

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  723
            CKFHHPQP+NMMV LRGSP YP V SPTTP Q
Sbjct  157  CKFHHPQPTNMMVSLRGSPVYPSVQSPTTPTQ  188


 Score =   109 bits (272),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 48/61 (79%), Positives = 55/61 (90%), Gaps = 0/61 (0%)
 Frame = +3

Query  267  ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARM  446
            + +WQ++LRS ET+ESG YP R GEPDCSYYIRTGLCRFGA+CRFNHPS+RKLAIA ARM
Sbjct  24   DAMWQMTLRSNETIESGPYPERPGEPDCSYYIRTGLCRFGATCRFNHPSDRKLAIANARM  83

Query  447  K  449
            K
Sbjct  84   K  84


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRP  570
            ++Y+KTG CKFGA C+FHHPR++   A    L+ +G PLRP
Sbjct  303  QFYMKTGDCKFGAVCRFHHPRERLLPAPDCLLSPIGLPLRP  343


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKL  425
            +P R G+P+C +Y++TG C+FGA CRF+HP  R L
Sbjct  293  FPERPGQPECQFYMKTGDCKFGAVCRFHHPRERLL  327



>gb|KJB82177.1| hypothetical protein B456_013G179800 [Gossypium raimondii]
Length=447

 Score =   171 bits (433),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 78/92 (85%), Positives = 84/92 (91%), Gaps = 0/92 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFGATCKFHHPRDKAGIAGRV+LN+LGYPLRPN+ EC YY+RTGQCKFGST
Sbjct  107  QYYLKTGTCKFGATCKFHHPRDKAGIAGRVSLNILGYPLRPNETECAYYLRTGQCKFGST  166

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  723
            CKFHHPQP+NMMV LRGSP Y  V SPTTPGQ
Sbjct  167  CKFHHPQPTNMMVSLRGSPIYQTVPSPTTPGQ  198


 Score =   108 bits (271),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 48/61 (79%), Positives = 53/61 (87%), Gaps = 0/61 (0%)
 Frame = +3

Query  267  ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARM  446
            + +WQ++LRS ETMES  YP R GEPDCSYYIRTGLCRFGA+C FNHP NRKLAIAAARM
Sbjct  34   DAMWQMNLRSSETMESSPYPERPGEPDCSYYIRTGLCRFGATCHFNHPPNRKLAIAAARM  93

Query  447  K  449
            K
Sbjct  94   K  94


 Score = 82.4 bits (202),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 41/85 (48%), Positives = 53/85 (62%), Gaps = 0/85 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y+KTG CKFGA CKFHHPR++   A    L+ +G PLRP +  C +Y R G CKFG +
Sbjct  314  QFYMKTGDCKFGAVCKFHHPRERVLPAPDCVLSPIGLPLRPGEPLCIFYSRYGICKFGPS  373

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVH  702
            CKF+HP           SP+  PVH
Sbjct  374  CKFNHPMGIFTYNYSPSSPSDAPVH  398


 Score = 53.5 bits (127),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 41/82 (50%), Gaps = 4/82 (5%)
 Frame = +1

Query  481  GATCKFHHPRDKAGIAGRVALNVLG-YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSN  657
            G+   F   R  +   G  AL     +P RP + EC +YM+TG CKFG+ CKFHHP+   
Sbjct  278  GSQASFSELRSSSVPVGVYALQRENVFPERPGEPECQFYMKTGDCKFGAVCKFHHPRERV  337

Query  658  MMVPLRGSPAYPPVHSPTTPGQ  723
            +  P        P+  P  PG+
Sbjct  338  LPAP---DCVLSPIGLPLRPGE  356


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 19/36 (53%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +3

Query  318  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKL  425
             +P R GEP+C +Y++TG C+FGA C+F+HP  R L
Sbjct  303  VFPERPGEPECQFYMKTGDCKFGAVCKFHHPRERVL  338


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 17/38 (45%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIA  434
            YP+R  E +C+YY+RTG C+FG++C+F+HP    + ++
Sbjct  143  YPLRPNETECAYYLRTGQCKFGSTCKFHHPQPTNMMVS  180



>ref|XP_008355849.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Malus domestica]
Length=442

 Score =   169 bits (427),  Expect(2) = 3e-66, Method: Compositional matrix adjust.
 Identities = 76/92 (83%), Positives = 83/92 (90%), Gaps = 0/92 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFGATCKFHHPRDKAGIAG VALN+LGYPLRPN++EC YY+RTGQCKFGST
Sbjct  102  QYYLKTGTCKFGATCKFHHPRDKAGIAGXVALNILGYPLRPNEVECAYYLRTGQCKFGST  161

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  723
            CKFHHPQP+NMMV + GS  YP V SPTTPGQ
Sbjct  162  CKFHHPQPTNMMVSVGGSTVYPTVQSPTTPGQ  193


 Score =   111 bits (277),  Expect(2) = 3e-66, Method: Compositional matrix adjust.
 Identities = 48/61 (79%), Positives = 55/61 (90%), Gaps = 0/61 (0%)
 Frame = +3

Query  267  ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARM  446
            + +WQ+++RS ETME+G YP R GEPDCSYYIRTGLCRFGA+CRFNHP NRKLAIAAARM
Sbjct  29   DAMWQMNMRSSETMEAGPYPERAGEPDCSYYIRTGLCRFGATCRFNHPPNRKLAIAAARM  88

Query  447  K  449
            K
Sbjct  89   K  89


 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 46/66 (70%), Gaps = 0/66 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y+KTG CKFG  C+FHHPR++   A    L+ +G PLRP +  C +Y R G CKFG +
Sbjct  309  QFYMKTGDCKFGGVCRFHHPRERLIPAPDCVLSPMGLPLRPGEPLCIFYSRYGICKFGPS  368

Query  628  CKFHHP  645
            CKF+HP
Sbjct  369  CKFNHP  374


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 18/44 (41%), Positives = 30/44 (68%), Gaps = 0/44 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKV  452
            YP+R  E +C+YY+RTG C+FG++C+F+HP    + ++     V
Sbjct  138  YPLRPNEVECAYYLRTGQCKFGSTCKFHHPQPTNMMVSVGGSTV  181


 Score = 50.1 bits (118),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 17/36 (47%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +3

Query  318  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKL  425
             +P R G+P+C +Y++TG C+FG  CRF+HP  R +
Sbjct  298  VFPERPGQPECQFYMKTGDCKFGGVCRFHHPRERLI  333



>gb|KJB82178.1| hypothetical protein B456_013G179800 [Gossypium raimondii]
Length=252

 Score =   171 bits (433),  Expect(2) = 3e-66, Method: Compositional matrix adjust.
 Identities = 78/92 (85%), Positives = 84/92 (91%), Gaps = 0/92 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFGATCKFHHPRDKAGIAGRV+LN+LGYPLRPN+ EC YY+RTGQCKFGST
Sbjct  107  QYYLKTGTCKFGATCKFHHPRDKAGIAGRVSLNILGYPLRPNETECAYYLRTGQCKFGST  166

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  723
            CKFHHPQP+NMMV LRGSP Y  V SPTTPGQ
Sbjct  167  CKFHHPQPTNMMVSLRGSPIYQTVPSPTTPGQ  198


 Score =   108 bits (270),  Expect(2) = 3e-66, Method: Compositional matrix adjust.
 Identities = 48/61 (79%), Positives = 53/61 (87%), Gaps = 0/61 (0%)
 Frame = +3

Query  267  ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARM  446
            + +WQ++LRS ETMES  YP R GEPDCSYYIRTGLCRFGA+C FNHP NRKLAIAAARM
Sbjct  34   DAMWQMNLRSSETMESSPYPERPGEPDCSYYIRTGLCRFGATCHFNHPPNRKLAIAAARM  93

Query  447  K  449
            K
Sbjct  94   K  94


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 17/38 (45%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIA  434
            YP+R  E +C+YY+RTG C+FG++C+F+HP    + ++
Sbjct  143  YPLRPNETECAYYLRTGQCKFGSTCKFHHPQPTNMMVS  180



>ref|XP_004302155.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Fragaria vesca subsp. vesca]
Length=442

 Score =   169 bits (429),  Expect(2) = 4e-66, Method: Compositional matrix adjust.
 Identities = 77/92 (84%), Positives = 83/92 (90%), Gaps = 0/92 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFGATCKFHHPRDKAGIAGRVALN+LGYPLRPN+IEC YY+RTGQCKF ST
Sbjct  102  QYYLKTGTCKFGATCKFHHPRDKAGIAGRVALNILGYPLRPNEIECAYYLRTGQCKFAST  161

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  723
            CK+HHP P+NMMV L GSP YP V SPTTPGQ
Sbjct  162  CKYHHPPPTNMMVSLSGSPVYPTVQSPTTPGQ  193


 Score =   110 bits (274),  Expect(2) = 4e-66, Method: Compositional matrix adjust.
 Identities = 48/61 (79%), Positives = 53/61 (87%), Gaps = 0/61 (0%)
 Frame = +3

Query  267  ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARM  446
            + +WQ++LRS ETME G YP R GEPDCSYYIRTGLCRFGA+CRFNHP NRKLAIA ARM
Sbjct  29   DAMWQMNLRSSETMEPGPYPERAGEPDCSYYIRTGLCRFGATCRFNHPPNRKLAIATARM  88

Query  447  K  449
            K
Sbjct  89   K  89


 Score = 79.7 bits (195),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 46/66 (70%), Gaps = 0/66 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y+KTG CKFGA C+FHHPR++   A    L+ +G PLRP +  C +Y R G CKFG +
Sbjct  309  QFYMKTGDCKFGAVCRFHHPRERLIPAPDCVLSPIGLPLRPGEPLCIFYSRYGICKFGPS  368

Query  628  CKFHHP  645
            CKF HP
Sbjct  369  CKFDHP  374


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +3

Query  318  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKL  425
             +P R G+P+C +Y++TG C+FGA CRF+HP  R +
Sbjct  298  VFPERPGQPECQFYMKTGDCKFGAVCRFHHPRERLI  333



>ref|XP_003534518.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoformX2 [Glycine max]
Length=426

 Score =   168 bits (425),  Expect(2) = 5e-66, Method: Compositional matrix adjust.
 Identities = 74/92 (80%), Positives = 85/92 (92%), Gaps = 0/92 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFGATC+FHHPRDKAGIAGRVA+N+LGYPLRPN+ EC YY+RTGQCKFG+T
Sbjct  90   QYYLKTGTCKFGATCRFHHPRDKAGIAGRVAMNILGYPLRPNEPECAYYLRTGQCKFGNT  149

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  723
            CKFHHPQP+NM++ +R SP YP VHSPTTPGQ
Sbjct  150  CKFHHPQPNNMVLSMRSSPVYPTVHSPTTPGQ  181


 Score =   111 bits (277),  Expect(2) = 5e-66, Method: Compositional matrix adjust.
 Identities = 49/61 (80%), Positives = 54/61 (89%), Gaps = 0/61 (0%)
 Frame = +3

Query  267  ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARM  446
            + +WQ++LRS ETMESG YP   GEPDCSYYIRTGLCRFGA+CRFNHP NRKLAIAAARM
Sbjct  17   DAMWQINLRSSETMESGPYPEHPGEPDCSYYIRTGLCRFGATCRFNHPPNRKLAIAAARM  76

Query  447  K  449
            K
Sbjct  77   K  77


 Score = 79.7 bits (195),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 46/66 (70%), Gaps = 0/66 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y+KTG CKFGA C+FHHPR++   A    L+ +G PLRP +  C +Y R G CKFG +
Sbjct  293  QFYMKTGDCKFGAVCRFHHPRERMIPAPDCVLSPIGLPLRPGEPLCVFYSRYGICKFGPS  352

Query  628  CKFHHP  645
            CKF HP
Sbjct  353  CKFDHP  358


 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIA  434
            YP+R  EP+C+YY+RTG C+FG +C+F+HP    + ++
Sbjct  126  YPLRPNEPECAYYLRTGQCKFGNTCKFHHPQPNNMVLS  163


 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 41/81 (51%), Gaps = 5/81 (6%)
 Frame = +1

Query  481  GATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNM  660
            GA  +F       G       N+  +P RP+  EC +YM+TG CKFG+ C+FHHP+    
Sbjct  260  GAYSQFRSGSVPVGFYALQRENI--FPERPDQPECQFYMKTGDCKFGAVCRFHHPR--ER  315

Query  661  MVPLRGSPAYPPVHSPTTPGQ  723
            M+P        P+  P  PG+
Sbjct  316  MIPAPDC-VLSPIGLPLRPGE  335



>ref|XP_008359919.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Malus domestica]
Length=444

 Score =   171 bits (432),  Expect(2) = 5e-66, Method: Compositional matrix adjust.
 Identities = 79/93 (85%), Positives = 85/93 (91%), Gaps = 1/93 (1%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRP-NDIECPYYMRTGQCKFGS  624
            +YYLKTG CKFGATCKFHHPRDKAGIAGRVALN+LGYPLRP N+IEC YY+RTGQCKFG 
Sbjct  102  QYYLKTGTCKFGATCKFHHPRDKAGIAGRVALNILGYPLRPQNEIECAYYLRTGQCKFGG  161

Query  625  TCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  723
            TCKFHHPQP+NMMV +RGSP YP V SPTTPGQ
Sbjct  162  TCKFHHPQPTNMMVSVRGSPVYPTVQSPTTPGQ  194


 Score =   108 bits (269),  Expect(2) = 5e-66, Method: Compositional matrix adjust.
 Identities = 47/61 (77%), Positives = 54/61 (89%), Gaps = 0/61 (0%)
 Frame = +3

Query  267  ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARM  446
            + +W ++LRS ET+E+G YP R GEPDCSYYIRTGLCRFGA+CRFNHP NRKLAIAAARM
Sbjct  29   DAMWPMNLRSSETLEAGGYPERTGEPDCSYYIRTGLCRFGATCRFNHPPNRKLAIAAARM  88

Query  447  K  449
            K
Sbjct  89   K  89


 Score = 77.0 bits (188),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 45/66 (68%), Gaps = 0/66 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y+KTG CKFGA C+FHHP ++   A    L+ +G PLRP +  C +Y R G CKFG +
Sbjct  310  QFYMKTGDCKFGAVCRFHHPMERLIPAPDCVLSPIGLPLRPGEPMCIFYSRYGICKFGPS  369

Query  628  CKFHHP  645
            CKF HP
Sbjct  370  CKFDHP  375


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +3

Query  318  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKL  425
             +P R G+P+C +Y++TG C+FGA CRF+HP  R +
Sbjct  299  VFPERPGQPECQFYMKTGDCKFGAVCRFHHPMERLI  334



>ref|XP_007139732.1| hypothetical protein PHAVU_008G054800g [Phaseolus vulgaris]
 gb|ESW11726.1| hypothetical protein PHAVU_008G054800g [Phaseolus vulgaris]
Length=426

 Score =   167 bits (424),  Expect(2) = 5e-66, Method: Compositional matrix adjust.
 Identities = 75/92 (82%), Positives = 84/92 (91%), Gaps = 0/92 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFGATC+FHHPRDKAGIAGRVALN+LGYPLRPN+ EC YY+RTGQCKFG+T
Sbjct  90   QYYLKTGTCKFGATCRFHHPRDKAGIAGRVALNILGYPLRPNEPECAYYLRTGQCKFGNT  149

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  723
            CKFHHPQPSNM++ +R SP YP V SPTTPGQ
Sbjct  150  CKFHHPQPSNMVLSMRSSPVYPTVQSPTTPGQ  181


 Score =   111 bits (277),  Expect(2) = 5e-66, Method: Compositional matrix adjust.
 Identities = 49/61 (80%), Positives = 54/61 (89%), Gaps = 0/61 (0%)
 Frame = +3

Query  267  ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARM  446
            + +WQ++LRS ETMESG YP   GEPDCSYYIRTGLCRFGA+CRFNHP NRKLAIAAARM
Sbjct  17   DAMWQINLRSSETMESGPYPEHPGEPDCSYYIRTGLCRFGATCRFNHPPNRKLAIAAARM  76

Query  447  K  449
            K
Sbjct  77   K  77


 Score = 79.7 bits (195),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 46/66 (70%), Gaps = 0/66 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y+KTG CKFGA C+FHHPR++   A    L+ +G PLRP +  C +Y R G CKFG +
Sbjct  293  QFYMKTGDCKFGAVCRFHHPRERMIPAPDCVLSPIGLPLRPGEPLCVFYSRYGICKFGPS  352

Query  628  CKFHHP  645
            CKF HP
Sbjct  353  CKFDHP  358


 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIA  434
            YP+R  EP+C+YY+RTG C+FG +C+F+HP    + ++
Sbjct  126  YPLRPNEPECAYYLRTGQCKFGNTCKFHHPQPSNMVLS  163


 Score = 50.1 bits (118),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 18/35 (51%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKL  425
            +P R  +PDC +Y++TG C+FGA CRF+HP  R +
Sbjct  283  FPERPDQPDCQFYMKTGDCKFGAVCRFHHPRERMI  317


 Score = 50.1 bits (118),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 30/87 (34%), Positives = 43/87 (49%), Gaps = 5/87 (6%)
 Frame = +1

Query  463  TGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHH  642
            T A   GA  +F       G       N+  +P RP+  +C +YM+TG CKFG+ C+FHH
Sbjct  254  TNAGSQGAYSQFRSGSVPVGFYALPRENI--FPERPDQPDCQFYMKTGDCKFGAVCRFHH  311

Query  643  PQPSNMMVPLRGSPAYPPVHSPTTPGQ  723
            P+    M+P        P+  P  PG+
Sbjct  312  PR--ERMIPAPDC-VLSPIGLPLRPGE  335



>ref|XP_009337999.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Pyrus x bretschneideri]
Length=443

 Score =   166 bits (420),  Expect(2) = 7e-66, Method: Compositional matrix adjust.
 Identities = 76/93 (82%), Positives = 84/93 (90%), Gaps = 1/93 (1%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRP-NDIECPYYMRTGQCKFGS  624
            +YYLKTG CKFGATCKFHHPRDKAG+AGRVALN+LGYPLRP N++EC YY+RTGQCKFGS
Sbjct  102  QYYLKTGTCKFGATCKFHHPRDKAGMAGRVALNILGYPLRPQNEVECAYYLRTGQCKFGS  161

Query  625  TCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  723
            TCKFHHPQP+NMMV +  SP YP V SPTTPGQ
Sbjct  162  TCKFHHPQPTNMMVSVGASPVYPTVQSPTTPGQ  194


 Score =   112 bits (280),  Expect(2) = 7e-66, Method: Compositional matrix adjust.
 Identities = 49/61 (80%), Positives = 55/61 (90%), Gaps = 0/61 (0%)
 Frame = +3

Query  267  ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARM  446
            + +WQ++LRS ETME+G YP R GEPDCSYYIRTGLCRFGA+CRFNHP NRKLAIAAARM
Sbjct  29   DAMWQMNLRSSETMEAGAYPERTGEPDCSYYIRTGLCRFGATCRFNHPPNRKLAIAAARM  88

Query  447  K  449
            K
Sbjct  89   K  89


 Score = 80.1 bits (196),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 47/66 (71%), Gaps = 0/66 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y+KTG CKFGA C+FHHPR++   A    L+ +G PLRP +  C +Y R G CKFG +
Sbjct  310  QFYMKTGDCKFGAVCRFHHPRERLIPAPDCVLSPMGLPLRPGEPLCIFYSRYGICKFGPS  369

Query  628  CKFHHP  645
            CKF+HP
Sbjct  370  CKFNHP  375


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +3

Query  318  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKL  425
             +P R G+P+C +Y++TG C+FGA CRF+HP  R +
Sbjct  299  VFPERPGQPECQFYMKTGDCKFGAVCRFHHPRERLI  334



>ref|XP_003624157.1| Zinc finger CCCH domain-containing protein [Medicago truncatula]
 gb|AES80375.1| zinc finger CCCH domain protein [Medicago truncatula]
Length=418

 Score =   168 bits (425),  Expect(2) = 7e-66, Method: Compositional matrix adjust.
 Identities = 74/92 (80%), Positives = 85/92 (92%), Gaps = 0/92 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFGATC+FHHP+DKAG+AGRVALN+LGYPLRPN+ EC YY+RTGQCKFG+T
Sbjct  82   QYYLKTGTCKFGATCRFHHPKDKAGVAGRVALNILGYPLRPNESECAYYLRTGQCKFGNT  141

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  723
            CKFHHPQPSNM++P+RGSP YP V SPTT GQ
Sbjct  142  CKFHHPQPSNMVLPMRGSPVYPTVQSPTTAGQ  173


 Score =   110 bits (275),  Expect(2) = 7e-66, Method: Compositional matrix adjust.
 Identities = 49/61 (80%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = +3

Query  267  ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARM  446
            E +WQ+SLR  ETMESG YP   GEPDCSYYIRTGLCRFGA+CRFNHP NRKLAIA ARM
Sbjct  9    EAMWQMSLRPSETMESGPYPEHPGEPDCSYYIRTGLCRFGATCRFNHPPNRKLAIATARM  68

Query  447  K  449
            K
Sbjct  69   K  69


 Score = 80.5 bits (197),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 46/66 (70%), Gaps = 0/66 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y+KTG CKFGA C+FHHPR++   A    L+ LG PLRP +  C +Y R G CKFG +
Sbjct  285  QFYMKTGDCKFGAVCRFHHPRERTIPAPDCVLSPLGLPLRPGEPLCVFYSRYGICKFGPS  344

Query  628  CKFHHP  645
            CKF HP
Sbjct  345  CKFDHP  350


 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = +1

Query  556  YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVP  669
            +P RP+  EC +YM+TG CKFG+ C+FHHP+   +  P
Sbjct  275  FPERPDQPECQFYMKTGDCKFGAVCRFHHPRERTIPAP  312



>ref|XP_006606433.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Glycine max]
Length=430

 Score =   173 bits (438),  Expect(2) = 8e-66, Method: Compositional matrix adjust.
 Identities = 78/92 (85%), Positives = 86/92 (93%), Gaps = 0/92 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFGATCKFHHP+D+AGIAGRVALN+LGYPLRPN+ EC YY+RTGQCKFG+T
Sbjct  89   QYYLKTGTCKFGATCKFHHPKDQAGIAGRVALNILGYPLRPNEPECTYYLRTGQCKFGNT  148

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  723
            CKFHHPQPSNMM+ LRGSP YP VHSPTTPGQ
Sbjct  149  CKFHHPQPSNMMLSLRGSPVYPTVHSPTTPGQ  180


 Score =   105 bits (261),  Expect(2) = 8e-66, Method: Compositional matrix adjust.
 Identities = 45/60 (75%), Positives = 54/60 (90%), Gaps = 0/60 (0%)
 Frame = +3

Query  267  ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARM  446
            ++LW ++LR+ ETM+SG+YP R GEPDCSYYIRTGLCRFGA+CRFNHP NR+LAIA ARM
Sbjct  16   DSLWMMNLRTGETMDSGSYPERPGEPDCSYYIRTGLCRFGATCRFNHPPNRRLAIATARM  75


 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 45/66 (68%), Gaps = 0/66 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y+KTG CKFGA C+FHHPR++   A    L+ +G PLR  +  C +Y R G CKFG +
Sbjct  296  QFYVKTGDCKFGAVCQFHHPRERLIPAPDCVLSPIGLPLRLGEPLCVFYSRYGICKFGPS  355

Query  628  CKFHHP  645
            CKF HP
Sbjct  356  CKFDHP  361


 Score = 50.1 bits (118),  Expect(2) = 5e-07, Method: Compositional matrix adjust.
 Identities = 17/35 (49%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKL  425
            +P R G+P+C +Y++TG C+FGA C+F+HP  R +
Sbjct  286  FPERPGQPECQFYVKTGDCKFGAVCQFHHPRERLI  320


 Score = 31.2 bits (69),  Expect(2) = 5e-07, Method: Compositional matrix adjust.
 Identities = 11/21 (52%), Positives = 15/21 (71%), Gaps = 0/21 (0%)
 Frame = +1

Query  451  YYLKTGACKFGATCKFHHPRD  513
            +Y + G CKFG +CKF HP +
Sbjct  343  FYSRYGICKFGPSCKFDHPME  363


 Score = 53.5 bits (127),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIA  434
            YP+R  EP+C+YY+RTG C+FG +C+F+HP    + ++
Sbjct  125  YPLRPNEPECTYYLRTGQCKFGNTCKFHHPQPSNMMLS  162



>gb|ACC85690.1| zinc finger protein [Medicago sativa]
 gb|AFP86282.1| zinc finger protein [Medicago sativa]
Length=418

 Score =   168 bits (425),  Expect(2) = 8e-66, Method: Compositional matrix adjust.
 Identities = 74/92 (80%), Positives = 85/92 (92%), Gaps = 0/92 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFGATC+FHHP+DKAG+AGRVALN+LGYPLRPN+ EC YY+RTGQCKFG+T
Sbjct  82   QYYLKTGTCKFGATCRFHHPKDKAGVAGRVALNILGYPLRPNESECAYYLRTGQCKFGNT  141

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  723
            CKFHHPQPSNM++P+RGSP YP V SPTT GQ
Sbjct  142  CKFHHPQPSNMVLPMRGSPVYPTVQSPTTAGQ  173


 Score =   110 bits (275),  Expect(2) = 8e-66, Method: Compositional matrix adjust.
 Identities = 49/61 (80%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = +3

Query  267  ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARM  446
            E +WQ+SLR  ETMESG YP   GEPDCSYYIRTGLCRFGA+CRFNHP NRKLAIA ARM
Sbjct  9    EAMWQMSLRPSETMESGPYPEHPGEPDCSYYIRTGLCRFGATCRFNHPPNRKLAIATARM  68

Query  447  K  449
            K
Sbjct  69   K  69


 Score = 80.5 bits (197),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 46/66 (70%), Gaps = 0/66 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y+KTG CKFGA C+FHHPR++   A    L+ LG PLRP +  C +Y R G CKFG +
Sbjct  285  QFYMKTGDCKFGAVCRFHHPRERTIPAPDCVLSPLGLPLRPGEPLCVFYSRYGICKFGPS  344

Query  628  CKFHHP  645
            CKF HP
Sbjct  345  CKFDHP  350


 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = +1

Query  556  YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVP  669
            +P RP+  EC +YM+TG CKFG+ C+FHHP+   +  P
Sbjct  275  FPERPDQPECQFYMKTGDCKFGAVCRFHHPRERTIPAP  312



>ref|XP_003536159.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Glycine max]
Length=421

 Score =   172 bits (437),  Expect(2) = 1e-65, Method: Compositional matrix adjust.
 Identities = 78/92 (85%), Positives = 86/92 (93%), Gaps = 0/92 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFGATCKFHHP+D+AGIAGRVALN+LGYPLRPN+ EC YY+RTGQCKFG+T
Sbjct  90   QYYLKTGTCKFGATCKFHHPKDQAGIAGRVALNILGYPLRPNEPECTYYLRTGQCKFGNT  149

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  723
            CKFHHPQPSNMM+ LRGSP YP VHSPTTPGQ
Sbjct  150  CKFHHPQPSNMMLSLRGSPVYPTVHSPTTPGQ  181


 Score =   105 bits (262),  Expect(2) = 1e-65, Method: Compositional matrix adjust.
 Identities = 45/60 (75%), Positives = 54/60 (90%), Gaps = 0/60 (0%)
 Frame = +3

Query  267  ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARM  446
            ++LW ++LR+ ETM+SG+YP R GEPDCSYY+RTGLCRFGA+CRFNHP NRKLAIA ARM
Sbjct  17   DSLWMMNLRTGETMDSGSYPERPGEPDCSYYMRTGLCRFGATCRFNHPPNRKLAIATARM  76


 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 46/66 (70%), Gaps = 0/66 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y+KTG CKFGA C+FHHP+++   A    L+ +G PLRP +  C +Y R G CKFG +
Sbjct  288  QFYMKTGDCKFGAVCRFHHPQERLVPAPNCVLSPIGLPLRPGEPLCVFYSRYGICKFGPS  347

Query  628  CKFHHP  645
            CKF HP
Sbjct  348  CKFDHP  353


 Score = 51.6 bits (122),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 18/33 (55%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNR  419
            +P R G+P+C +Y++TG C+FGA CRF+HP  R
Sbjct  278  FPERPGQPECQFYMKTGDCKFGAVCRFHHPQER  310


 Score = 30.8 bits (68),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 11/21 (52%), Positives = 15/21 (71%), Gaps = 0/21 (0%)
 Frame = +1

Query  451  YYLKTGACKFGATCKFHHPRD  513
            +Y + G CKFG +CKF HP +
Sbjct  335  FYSRYGICKFGPSCKFDHPME  355


 Score = 53.5 bits (127),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIA  434
            YP+R  EP+C+YY+RTG C+FG +C+F+HP    + ++
Sbjct  126  YPLRPNEPECTYYLRTGQCKFGNTCKFHHPQPSNMMLS  163


 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 24/56 (43%), Positives = 33/56 (59%), Gaps = 3/56 (5%)
 Frame = +1

Query  556  YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  723
            +P RP   EC +YM+TG CKFG+ C+FHHPQ   +  P   +    P+  P  PG+
Sbjct  278  FPERPGQPECQFYMKTGDCKFGAVCRFHHPQERLVPAP---NCVLSPIGLPLRPGE  330


 Score = 50.1 bits (118),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 19/36 (53%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +1

Query  538  ALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHP  645
             ++   YP RP + +C YYMRTG C+FG+TC+F+HP
Sbjct  29   TMDSGSYPERPGEPDCSYYMRTGLCRFGATCRFNHP  64



>gb|ABD28369.2| Zinc finger, CCCH-type; Sugar transporter superfamily [Medicago 
truncatula]
Length=428

 Score =   167 bits (423),  Expect(2) = 1e-65, Method: Compositional matrix adjust.
 Identities = 74/91 (81%), Positives = 84/91 (92%), Gaps = 0/91 (0%)
 Frame = +1

Query  451  YYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTC  630
            YYLKTG CKFGATC+FHHP+DKAG+AGRVALN+LGYPLRPN+ EC YY+RTGQCKFG+TC
Sbjct  93   YYLKTGTCKFGATCRFHHPKDKAGVAGRVALNILGYPLRPNESECAYYLRTGQCKFGNTC  152

Query  631  KFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  723
            KFHHPQPSNM++P+RGSP YP V SPTT GQ
Sbjct  153  KFHHPQPSNMVLPMRGSPVYPTVQSPTTAGQ  183


 Score =   110 bits (274),  Expect(2) = 1e-65, Method: Compositional matrix adjust.
 Identities = 49/61 (80%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = +3

Query  267  ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARM  446
            E +WQ+SLR  ETMESG YP   GEPDCSYYIRTGLCRFGA+CRFNHP NRKLAIA ARM
Sbjct  9    EAMWQMSLRPSETMESGPYPEHPGEPDCSYYIRTGLCRFGATCRFNHPPNRKLAIATARM  68

Query  447  K  449
            K
Sbjct  69   K  69


 Score = 80.5 bits (197),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 46/66 (70%), Gaps = 0/66 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y+KTG CKFGA C+FHHPR++   A    L+ LG PLRP +  C +Y R G CKFG +
Sbjct  295  QFYMKTGDCKFGAVCRFHHPRERTIPAPDCVLSPLGLPLRPGEPLCVFYSRYGICKFGPS  354

Query  628  CKFHHP  645
            CKF HP
Sbjct  355  CKFDHP  360


 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = +1

Query  556  YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVP  669
            +P RP+  EC +YM+TG CKFG+ C+FHHP+   +  P
Sbjct  285  FPERPDQPECQFYMKTGDCKFGAVCRFHHPRERTIPAP  322



>ref|XP_007139733.1| hypothetical protein PHAVU_008G054800g [Phaseolus vulgaris]
 gb|ESW11727.1| hypothetical protein PHAVU_008G054800g [Phaseolus vulgaris]
Length=408

 Score =   167 bits (423),  Expect(2) = 1e-65, Method: Compositional matrix adjust.
 Identities = 75/92 (82%), Positives = 84/92 (91%), Gaps = 0/92 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFGATC+FHHPRDKAGIAGRVALN+LGYPLRPN+ EC YY+RTGQCKFG+T
Sbjct  72   QYYLKTGTCKFGATCRFHHPRDKAGIAGRVALNILGYPLRPNEPECAYYLRTGQCKFGNT  131

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  723
            CKFHHPQPSNM++ +R SP YP V SPTTPGQ
Sbjct  132  CKFHHPQPSNMVLSMRSSPVYPTVQSPTTPGQ  163


 Score =   110 bits (274),  Expect(2) = 1e-65, Method: Compositional matrix adjust.
 Identities = 49/59 (83%), Positives = 53/59 (90%), Gaps = 0/59 (0%)
 Frame = +3

Query  273  LWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMK  449
            +WQ++LRS ETMESG YP   GEPDCSYYIRTGLCRFGA+CRFNHP NRKLAIAAARMK
Sbjct  1    MWQINLRSSETMESGPYPEHPGEPDCSYYIRTGLCRFGATCRFNHPPNRKLAIAAARMK  59


 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 46/66 (70%), Gaps = 0/66 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y+KTG CKFGA C+FHHPR++   A    L+ +G PLRP +  C +Y R G CKFG +
Sbjct  275  QFYMKTGDCKFGAVCRFHHPRERMIPAPDCVLSPIGLPLRPGEPLCVFYSRYGICKFGPS  334

Query  628  CKFHHP  645
            CKF HP
Sbjct  335  CKFDHP  340


 Score = 53.5 bits (127),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIA  434
            YP+R  EP+C+YY+RTG C+FG +C+F+HP    + ++
Sbjct  108  YPLRPNEPECAYYLRTGQCKFGNTCKFHHPQPSNMVLS  145


 Score = 50.1 bits (118),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 18/35 (51%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKL  425
            +P R  +PDC +Y++TG C+FGA CRF+HP  R +
Sbjct  265  FPERPDQPDCQFYMKTGDCKFGAVCRFHHPRERMI  299


 Score = 50.1 bits (118),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 30/87 (34%), Positives = 43/87 (49%), Gaps = 5/87 (6%)
 Frame = +1

Query  463  TGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHH  642
            T A   GA  +F       G       N+  +P RP+  +C +YM+TG CKFG+ C+FHH
Sbjct  236  TNAGSQGAYSQFRSGSVPVGFYALPRENI--FPERPDQPDCQFYMKTGDCKFGAVCRFHH  293

Query  643  PQPSNMMVPLRGSPAYPPVHSPTTPGQ  723
            P+    M+P        P+  P  PG+
Sbjct  294  PR--ERMIPAPDC-VLSPIGLPLRPGE  317



>ref|XP_009769498.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009769499.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009769500.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009769502.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Nicotiana sylvestris]
Length=427

 Score =   168 bits (426),  Expect(2) = 2e-65, Method: Compositional matrix adjust.
 Identities = 78/93 (84%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFGATCKFHHPRDKAGIAGRV LNVLGYPLRPN+ EC YYMRT QCKFGST
Sbjct  92   QYYLKTGTCKFGATCKFHHPRDKAGIAGRVTLNVLGYPLRPNENECTYYMRTAQCKFGST  151

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQL  726
            CKFHHP+PSNMMV  RGSP YPP  S TTPGQ+
Sbjct  152  CKFHHPEPSNMMVSSRGSPVYPPGPSSTTPGQM  184


 Score =   108 bits (270),  Expect(2) = 2e-65, Method: Compositional matrix adjust.
 Identities = 47/63 (75%), Positives = 57/63 (90%), Gaps = 0/63 (0%)
 Frame = +3

Query  261  R*ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAA  440
            R ++LWQ++LRSME+MESG YPVR+GE DCSYYIRTGLCRFG++C+FNHP NRKLA+AAA
Sbjct  17   RQDSLWQMNLRSMESMESGPYPVREGESDCSYYIRTGLCRFGSTCQFNHPPNRKLALAAA  76

Query  441  RMK  449
             M 
Sbjct  77   SMN  79


 Score = 73.9 bits (180),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 44/66 (67%), Gaps = 0/66 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y+KTG CKFGA C+FHHPR++        L+ +G PLR  +  C +Y R G CKFG +
Sbjct  293  QFYMKTGDCKFGAVCRFHHPRERLLPPPDCLLSPIGLPLRAGEPMCIFYSRYGICKFGPS  352

Query  628  CKFHHP  645
            CKF HP
Sbjct  353  CKFDHP  358


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 19/36 (53%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +3

Query  318  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKL  425
             +P R G+P+C +Y++TG C+FGA CRF+HP  R L
Sbjct  282  VFPERVGQPECQFYMKTGDCKFGAVCRFHHPRERLL  317



>gb|KHG12066.1| Zinc finger CCCH domain-containing protein ZFN-like protein [Gossypium 
arboreum]
Length=433

 Score =   168 bits (425),  Expect(2) = 3e-65, Method: Compositional matrix adjust.
 Identities = 77/92 (84%), Positives = 82/92 (89%), Gaps = 0/92 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
             YYLKTG CKFGATCKFHHPRDKAGIAGRV+LN+LGYPLRPN+ EC YY+RTGQCKFGST
Sbjct  113  SYYLKTGTCKFGATCKFHHPRDKAGIAGRVSLNILGYPLRPNETECAYYLRTGQCKFGST  172

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  723
            CKFHHPQP+NMMV LRGSP Y  V SP TPGQ
Sbjct  173  CKFHHPQPTNMMVSLRGSPIYQTVPSPATPGQ  204


 Score =   108 bits (269),  Expect(2) = 3e-65, Method: Compositional matrix adjust.
 Identities = 48/61 (79%), Positives = 53/61 (87%), Gaps = 0/61 (0%)
 Frame = +3

Query  267  ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARM  446
            + +WQ++LRS ETMES  YP R GEPDCSYYIRTGLCRFGA+C FNHP NRKLAIAAARM
Sbjct  34   DAMWQMNLRSSETMESTPYPERPGEPDCSYYIRTGLCRFGATCHFNHPPNRKLAIAAARM  93

Query  447  K  449
            K
Sbjct  94   K  94


 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 47/66 (71%), Gaps = 0/66 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y+KTG CKFGA CKFHHPR++   A    L+ +G PLRP +  C +Y R G CKFG +
Sbjct  300  QFYMKTGDCKFGAVCKFHHPRERVLPAPDCVLSPIGLPLRPGEPLCIFYSRYGICKFGPS  359

Query  628  CKFHHP  645
            CKF+HP
Sbjct  360  CKFNHP  365


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 41/82 (50%), Gaps = 4/82 (5%)
 Frame = +1

Query  481  GATCKFHHPRDKAGIAGRVALNVLG-YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSN  657
            G+   F   R  +   G  AL     +P RP + EC +YM+TG CKFG+ CKFHHP+   
Sbjct  264  GSQASFSELRSGSVPVGVYALQRENVFPERPGEPECQFYMKTGDCKFGAVCKFHHPRERV  323

Query  658  MMVPLRGSPAYPPVHSPTTPGQ  723
            +  P        P+  P  PG+
Sbjct  324  LPAP---DCVLSPIGLPLRPGE  342


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/36 (53%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +3

Query  318  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKL  425
             +P R GEP+C +Y++TG C+FGA C+F+HP  R L
Sbjct  289  VFPERPGEPECQFYMKTGDCKFGAVCKFHHPRERVL  324


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 17/38 (45%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIA  434
            YP+R  E +C+YY+RTG C+FG++C+F+HP    + ++
Sbjct  149  YPLRPNETECAYYLRTGQCKFGSTCKFHHPQPTNMMVS  186



>gb|KEH23393.1| zinc finger CCCH domain protein [Medicago truncatula]
Length=408

 Score =   168 bits (425),  Expect(2) = 4e-65, Method: Compositional matrix adjust.
 Identities = 74/92 (80%), Positives = 85/92 (92%), Gaps = 0/92 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFGATC+FHHP+DKAG+AGRVALN+LGYPLRPN+ EC YY+RTGQCKFG+T
Sbjct  72   QYYLKTGTCKFGATCRFHHPKDKAGVAGRVALNILGYPLRPNESECAYYLRTGQCKFGNT  131

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  723
            CKFHHPQPSNM++P+RGSP YP V SPTT GQ
Sbjct  132  CKFHHPQPSNMVLPMRGSPVYPTVQSPTTAGQ  163


 Score =   108 bits (269),  Expect(2) = 4e-65, Method: Compositional matrix adjust.
 Identities = 48/59 (81%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = +3

Query  273  LWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMK  449
            +WQ+SLR  ETMESG YP   GEPDCSYYIRTGLCRFGA+CRFNHP NRKLAIA ARMK
Sbjct  1    MWQMSLRPSETMESGPYPEHPGEPDCSYYIRTGLCRFGATCRFNHPPNRKLAIATARMK  59


 Score = 80.5 bits (197),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 46/66 (70%), Gaps = 0/66 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y+KTG CKFGA C+FHHPR++   A    L+ LG PLRP +  C +Y R G CKFG +
Sbjct  275  QFYMKTGDCKFGAVCRFHHPRERTIPAPDCVLSPLGLPLRPGEPLCVFYSRYGICKFGPS  334

Query  628  CKFHHP  645
            CKF HP
Sbjct  335  CKFDHP  340


 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = +1

Query  556  YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVP  669
            +P RP+  EC +YM+TG CKFG+ C+FHHP+   +  P
Sbjct  265  FPERPDQPECQFYMKTGDCKFGAVCRFHHPRERTIPAP  302



>ref|XP_010111067.1| Zinc finger CCCH domain-containing protein ZFN-like protein [Morus 
notabilis]
 gb|EXC29929.1| Zinc finger CCCH domain-containing protein ZFN-like protein [Morus 
notabilis]
Length=419

 Score =   175 bits (444),  Expect(2) = 4e-65, Method: Compositional matrix adjust.
 Identities = 78/91 (86%), Positives = 85/91 (93%), Gaps = 0/91 (0%)
 Frame = +1

Query  451  YYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTC  630
            YYLKTG CKFGATCKFHHPRDKAGIAGRV+LN+LGYPLRPN++EC YY+RTGQCKFGSTC
Sbjct  80   YYLKTGTCKFGATCKFHHPRDKAGIAGRVSLNILGYPLRPNEMECAYYLRTGQCKFGSTC  139

Query  631  KFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  723
            KFHHPQP+NMMV +RGSP YP V SPTTPGQ
Sbjct  140  KFHHPQPTNMMVSMRGSPVYPTVQSPTTPGQ  170


 Score =   100 bits (250),  Expect(2) = 4e-65, Method: Compositional matrix adjust.
 Identities = 43/53 (81%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +3

Query  267  ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKL  425
            + +WQ++LRS ETMESGTYP R GEPDCSYYIRTGLCRFGA+CRFNHP NRKL
Sbjct  27   DAIWQMNLRSSETMESGTYPERPGEPDCSYYIRTGLCRFGATCRFNHPPNRKL  79


 Score = 79.7 bits (195),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 46/66 (70%), Gaps = 0/66 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y+KTG CKFGA CKFHHPR++   A    L+ +G PLRP +  C +Y R G CKFG +
Sbjct  285  QFYMKTGDCKFGAVCKFHHPRERLIPAPDCLLSPMGLPLRPGEPLCIFYSRYGICKFGPS  344

Query  628  CKFHHP  645
            CKF HP
Sbjct  345  CKFDHP  350


 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 17/38 (45%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIA  434
            YP+R  E +C+YY+RTG C+FG++C+F+HP    + ++
Sbjct  115  YPLRPNEMECAYYLRTGQCKFGSTCKFHHPQPTNMMVS  152


 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 17/36 (47%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +3

Query  318  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKL  425
             +P R G+P+C +Y++TG C+FGA C+F+HP  R +
Sbjct  274  VFPERTGQPECQFYMKTGDCKFGAVCKFHHPRERLI  309



>ref|XP_006848460.1| hypothetical protein AMTR_s00013p00248880 [Amborella trichopoda]
 gb|ERN10041.1| hypothetical protein AMTR_s00013p00248880 [Amborella trichopoda]
Length=467

 Score =   170 bits (431),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 80/92 (87%), Positives = 84/92 (91%), Gaps = 1/92 (1%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFGATCKFHHPRDKAGIAGRV LN+LGYPLRPN+ EC YY+RTGQCKFGST
Sbjct  115  QYYLKTGTCKFGATCKFHHPRDKAGIAGRVLLNILGYPLRPNEKECAYYLRTGQCKFGST  174

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  723
            CKFHHPQP N MV LRGSP YPPVHSPTTPGQ
Sbjct  175  CKFHHPQP-NAMVSLRGSPVYPPVHSPTTPGQ  205


 Score =   103 bits (258),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 46/61 (75%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = +3

Query  267  ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARM  446
            + +W LSLRS ETMESG YP R GE DC+YYIRTGLCRFG +CRFNHP NRKLA+AAAR+
Sbjct  42   DAMWPLSLRSSETMESGPYPERPGEIDCAYYIRTGLCRFGMTCRFNHPPNRKLAVAAARI  101

Query  447  K  449
            K
Sbjct  102  K  102


 Score = 80.1 bits (196),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 45/66 (68%), Gaps = 0/66 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y+KTG CKFGA CKFHHPR++        L+ +G PLRP +  C +Y R G CKFG T
Sbjct  321  QFYMKTGDCKFGAMCKFHHPRERLLPVPNCMLSPMGLPLRPGEPLCIFYSRYGICKFGPT  380

Query  628  CKFHHP  645
            CKF HP
Sbjct  381  CKFDHP  386


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = +1

Query  556  YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVP  669
            +P RP+  EC +YM+TG CKFG+ CKFHHP+   + VP
Sbjct  311  FPERPDQPECQFYMKTGDCKFGAMCKFHHPRERLLPVP  348


 Score = 50.8 bits (120),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +1

Query  556  YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMV  666
            YP RP +I+C YY+RTG C+FG TC+F+HP    + V
Sbjct  60   YPERPGEIDCAYYIRTGLCRFGMTCRFNHPPNRKLAV  96



>ref|XP_006602842.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Glycine max]
Length=426

 Score =   166 bits (420),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 74/91 (81%), Positives = 84/91 (92%), Gaps = 0/91 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFGATC+FHHPRDKAGIAGRVALN+LGYPLRPN+ EC YY+RTGQCKFG+T
Sbjct  90   QYYLKTGTCKFGATCRFHHPRDKAGIAGRVALNILGYPLRPNEPECGYYLRTGQCKFGNT  149

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTPG  720
            CKFHHPQP+NM++ +R SP YP VHSPTTPG
Sbjct  150  CKFHHPQPNNMVLSMRSSPVYPTVHSPTTPG  180


 Score =   107 bits (268),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 48/61 (79%), Positives = 53/61 (87%), Gaps = 0/61 (0%)
 Frame = +3

Query  267  ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARM  446
            + +WQ++LRS ETMES  YP   GEPDCSYYIRTGLCRFGA+CRFNHP NRKLAIAAARM
Sbjct  17   DAMWQINLRSSETMESEPYPEHPGEPDCSYYIRTGLCRFGATCRFNHPPNRKLAIAAARM  76

Query  447  K  449
            K
Sbjct  77   K  77


 Score = 77.0 bits (188),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 45/66 (68%), Gaps = 0/66 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y+KTG CKFGA C+FHHP ++   A    L+ +G PLRP +  C +Y R G CKFG +
Sbjct  293  QFYMKTGDCKFGAVCRFHHPHERMIPAPDCVLSPIGLPLRPGEPLCVFYSRYGICKFGPS  352

Query  628  CKFHHP  645
            CKF HP
Sbjct  353  CKFDHP  358


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%), Gaps = 0/56 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKVLLEDGSLQVWGH  488
            YP+R  EP+C YY+RTG C+FG +C+F+HP    + ++     V     S    GH
Sbjct  126  YPLRPNEPECGYYLRTGQCKFGNTCKFHHPQPNNMVLSMRSSPVYPTVHSPTTPGH  181


 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 24/56 (43%), Positives = 33/56 (59%), Gaps = 3/56 (5%)
 Frame = +1

Query  556  YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  723
            +P RP+  EC +YM+TG CKFG+ C+FHHP     M+P        P+  P  PG+
Sbjct  283  FPERPDQPECQFYMKTGDCKFGAVCRFHHPH--ERMIPAPDC-VLSPIGLPLRPGE  335



>ref|XP_011084651.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Sesamum indicum]
Length=425

 Score =   174 bits (440),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 81/93 (87%), Positives = 85/93 (91%), Gaps = 1/93 (1%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPN+IEC YYMR GQCKFGST
Sbjct  96   QYYLKTGTCKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNEIECAYYMRNGQCKFGST  155

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQL  726
            CKFHHPQPSNMMV +RGS  YPP+HSPT  GQL
Sbjct  156  CKFHHPQPSNMMVSVRGSAVYPPIHSPTA-GQL  187


 Score =   100 bits (249),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 44/61 (72%), Positives = 53/61 (87%), Gaps = 1/61 (2%)
 Frame = +3

Query  267  ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARM  446
            + LWQ++  + E ++SG YPVR+GEPDCSYYIRTGLCRFG++CRFNHP NRKLAIA ARM
Sbjct  24   DALWQMNT-TREQIDSGPYPVREGEPDCSYYIRTGLCRFGSTCRFNHPPNRKLAIATARM  82

Query  447  K  449
            K
Sbjct  83   K  83


 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 45/66 (68%), Gaps = 0/66 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y+KTG CKFGA CKFHHPR++        L+ +G PLRP +  C +Y R G CKFG +
Sbjct  292  QFYMKTGDCKFGAVCKFHHPRERLIPVPDCILSPIGLPLRPGEPLCVFYSRYGICKFGPS  351

Query  628  CKFHHP  645
            CKF HP
Sbjct  352  CKFDHP  357


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/56 (45%), Positives = 33/56 (59%), Gaps = 3/56 (5%)
 Frame = +1

Query  556  YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  723
            +P RP   EC +YM+TG CKFG+ CKFHHP+   + VP        P+  P  PG+
Sbjct  282  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERLIPVP---DCILSPIGLPLRPGE  334


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 17/38 (45%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = +3

Query  318  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAI  431
             +P R G+P+C +Y++TG C+FGA C+F+HP  R + +
Sbjct  281  VFPERPGQPECQFYMKTGDCKFGAVCKFHHPRERLIPV  318



>gb|KJB75168.1| hypothetical protein B456_012G028600 [Gossypium raimondii]
Length=444

 Score =   167 bits (422),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 77/92 (84%), Positives = 82/92 (89%), Gaps = 0/92 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFGATCKFHHPRDKAGIAGRV+LN LGYPLRPN+ EC YY+RTGQCKFGST
Sbjct  104  QYYLKTGTCKFGATCKFHHPRDKAGIAGRVSLNFLGYPLRPNETECAYYLRTGQCKFGST  163

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  723
            CKFHHPQP+NMMV LRGSP YP   SPTT GQ
Sbjct  164  CKFHHPQPTNMMVSLRGSPIYPTFPSPTTSGQ  195


 Score =   106 bits (265),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 47/58 (81%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = +3

Query  276  WQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMK  449
            WQ++LRS ETME G YP R GEPDCSYYIRTGLCRFGA+CRFNHP NRKLAI  ARMK
Sbjct  34   WQINLRSSETMEPGPYPERPGEPDCSYYIRTGLCRFGATCRFNHPPNRKLAITTARMK  91


 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 40/85 (47%), Positives = 52/85 (61%), Gaps = 0/85 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y+KTG CKFGA C+FHHPR++   A    L+ +G PLRP +  C +Y R G CKFG +
Sbjct  311  QFYMKTGDCKFGAVCRFHHPRERVLPAPDCILSPIGLPLRPGEPLCIFYSRYGICKFGPS  370

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVH  702
            CKF+HP           SP   PVH
Sbjct  371  CKFNHPMGVFTFNYSASSPFEAPVH  395


 Score = 53.9 bits (128),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 42/82 (51%), Gaps = 4/82 (5%)
 Frame = +1

Query  481  GATCKFHHPRDKAGIAGRVALNVLG-YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSN  657
            G+   F   R  +   G  AL     +P RP ++EC +YM+TG CKFG+ C+FHHP+   
Sbjct  275  GSQALFSQFRSGSAPVGFYALQRENVFPERPGELECQFYMKTGDCKFGAVCRFHHPRERV  334

Query  658  MMVPLRGSPAYPPVHSPTTPGQ  723
            +  P        P+  P  PG+
Sbjct  335  LPAP---DCILSPIGLPLRPGE  353


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 17/38 (45%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIA  434
            YP+R  E +C+YY+RTG C+FG++C+F+HP    + ++
Sbjct  140  YPLRPNETECAYYLRTGQCKFGSTCKFHHPQPTNMMVS  177



>gb|KJB75169.1| hypothetical protein B456_012G028600 [Gossypium raimondii]
Length=361

 Score =   167 bits (422),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 77/92 (84%), Positives = 82/92 (89%), Gaps = 0/92 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFGATCKFHHPRDKAGIAGRV+LN LGYPLRPN+ EC YY+RTGQCKFGST
Sbjct  104  QYYLKTGTCKFGATCKFHHPRDKAGIAGRVSLNFLGYPLRPNETECAYYLRTGQCKFGST  163

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  723
            CKFHHPQP+NMMV LRGSP YP   SPTT GQ
Sbjct  164  CKFHHPQPTNMMVSLRGSPIYPTFPSPTTSGQ  195


 Score =   106 bits (265),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 47/58 (81%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = +3

Query  276  WQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMK  449
            WQ++LRS ETME G YP R GEPDCSYYIRTGLCRFGA+CRFNHP NRKLAI  ARMK
Sbjct  34   WQINLRSSETMEPGPYPERPGEPDCSYYIRTGLCRFGATCRFNHPPNRKLAITTARMK  91


 Score = 53.9 bits (128),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 36/64 (56%), Gaps = 1/64 (2%)
 Frame = +1

Query  481  GATCKFHHPRDKAGIAGRVALNVLG-YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSN  657
            G+   F   R  +   G  AL     +P RP ++EC +YM+TG CKFG+ C+FHHP+   
Sbjct  275  GSQALFSQFRSGSAPVGFYALQRENVFPERPGELECQFYMKTGDCKFGAVCRFHHPRERV  334

Query  658  MMVP  669
            +  P
Sbjct  335  LPAP  338


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRP  570
            ++Y+KTG CKFGA C+FHHPR++   A    L+ +G PLRP
Sbjct  311  QFYMKTGDCKFGAVCRFHHPRERVLPAPDCILSPIGLPLRP  351


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 17/38 (45%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIA  434
            YP+R  E +C+YY+RTG C+FG++C+F+HP    + ++
Sbjct  140  YPLRPNETECAYYLRTGQCKFGSTCKFHHPQPTNMMVS  177



>ref|XP_008443710.1| PREDICTED: LOW QUALITY PROTEIN: zinc finger CCCH domain-containing 
protein ZFN-like [Cucumis melo]
Length=437

 Score =   166 bits (420),  Expect(2) = 3e-64, Method: Compositional matrix adjust.
 Identities = 77/92 (84%), Positives = 84/92 (91%), Gaps = 1/92 (1%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFGATCKFHHPRDKAGIAGRVALN+LGYPLRP++ EC YY+RTGQCKFG+T
Sbjct  99   QYYLKTGTCKFGATCKFHHPRDKAGIAGRVALNILGYPLRPSETECAYYLRTGQCKFGNT  158

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  723
            CKFHHPQP+NMMV LRGSP YP V SP TPGQ
Sbjct  159  CKFHHPQPTNMMVSLRGSPIYPTVQSP-TPGQ  189


 Score =   107 bits (266),  Expect(2) = 3e-64, Method: Compositional matrix adjust.
 Identities = 50/71 (70%), Positives = 56/71 (79%), Gaps = 0/71 (0%)
 Frame = +3

Query  237  SKDTAICTR*ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSN  416
            S   A   R + LWQ++L S E M SG+YPVR GEPDCSYYIRTGLCRFGA+CRFNHP N
Sbjct  16   SSALAPSLREDALWQMNLGSGEIMGSGSYPVRPGEPDCSYYIRTGLCRFGATCRFNHPPN  75

Query  417  RKLAIAAARMK  449
            R+LAIA ARMK
Sbjct  76   RELAIATARMK  86


 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 46/66 (70%), Gaps = 0/66 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y+KTG CKFGA C+FHHPR++   A    L+ +G PLRP +  C +Y R G CKFG +
Sbjct  305  QFYMKTGDCKFGAVCRFHHPRERVLPAPDCVLSPIGLPLRPGEPLCIFYSRYGICKFGPS  364

Query  628  CKFHHP  645
            CKF HP
Sbjct  365  CKFDHP  370


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/36 (53%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +3

Query  318  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKL  425
             +P R G+P+C +Y++TG C+FGA CRF+HP  R L
Sbjct  294  VFPERPGQPECQFYMKTGDCKFGAVCRFHHPRERVL  329


 Score = 50.1 bits (118),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 32/56 (57%), Gaps = 3/56 (5%)
 Frame = +1

Query  556  YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  723
            +P RP   EC +YM+TG CKFG+ C+FHHP+   +  P        P+  P  PG+
Sbjct  295  FPERPGQPECQFYMKTGDCKFGAVCRFHHPRERVLPAP---DCVLSPIGLPLRPGE  347


 Score = 50.1 bits (118),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 17/38 (45%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIA  434
            YP+R  E +C+YY+RTG C+FG +C+F+HP    + ++
Sbjct  135  YPLRPSETECAYYLRTGQCKFGNTCKFHHPQPTNMMVS  172



>ref|XP_010929825.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Elaeis guineensis]
Length=460

 Score =   171 bits (434),  Expect(2) = 4e-64, Method: Compositional matrix adjust.
 Identities = 78/92 (85%), Positives = 84/92 (91%), Gaps = 0/92 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFGATCKFHHP+DKAGIAGRV LN+LGYPLRPN+ EC YY+RTGQCKFG+T
Sbjct  102  QYYLKTGTCKFGATCKFHHPKDKAGIAGRVQLNILGYPLRPNEKECAYYIRTGQCKFGNT  161

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  723
            CKFHHPQPSN MV LRGSP YPPVHS TTPGQ
Sbjct  162  CKFHHPQPSNAMVALRGSPVYPPVHSSTTPGQ  193


 Score =   101 bits (251),  Expect(2) = 4e-64, Method: Compositional matrix adjust.
 Identities = 43/61 (70%), Positives = 51/61 (84%), Gaps = 0/61 (0%)
 Frame = +3

Query  267  ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARM  446
            E +WQ++LR  E+MESG YP R GE DC YYIRTGLCRFG +C+FNHP NR+LAIAAAR+
Sbjct  29   EAMWQMNLRGSESMESGPYPERPGEADCGYYIRTGLCRFGMTCKFNHPPNRRLAIAAARI  88

Query  447  K  449
            K
Sbjct  89   K  89


 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 44/66 (67%), Gaps = 0/66 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y+KTG CKFGA CKFHHPR++        L+ LG PLRP +  C +Y R G CKFG  
Sbjct  309  QFYMKTGDCKFGAVCKFHHPRERLVPVPNCLLSPLGLPLRPGEPLCVFYSRYGICKFGPN  368

Query  628  CKFHHP  645
            CKF HP
Sbjct  369  CKFDHP  374


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = +1

Query  556  YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVP  669
            +P RP+  EC +YM+TG CKFG+ CKFHHP+   + VP
Sbjct  299  FPERPDQPECQFYMKTGDCKFGAVCKFHHPRERLVPVP  336


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIA  434
            YP+R  E +C+YYIRTG C+FG +C+F+HP      +A
Sbjct  138  YPLRPNEKECAYYIRTGQCKFGNTCKFHHPQPSNAMVA  175



>ref|XP_010913061.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Elaeis guineensis]
Length=381

 Score =   167 bits (424),  Expect(2) = 6e-64, Method: Compositional matrix adjust.
 Identities = 76/92 (83%), Positives = 82/92 (89%), Gaps = 0/92 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFGATCKFHHP+DKAGIAGRV LN+LGYPLRPN+ EC YY+RTGQCKFG+T
Sbjct  102  QYYLKTGTCKFGATCKFHHPKDKAGIAGRVQLNILGYPLRPNEKECAYYLRTGQCKFGNT  161

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  723
            CKFHHPQPSN MV LRGS  Y PVHSPT PGQ
Sbjct  162  CKFHHPQPSNAMVALRGSSVYSPVHSPTIPGQ  193


 Score =   104 bits (259),  Expect(2) = 6e-64, Method: Compositional matrix adjust.
 Identities = 44/61 (72%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = +3

Query  267  ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARM  446
            E +WQ++LR  E MESG YP R GEPDC+YYIRTGLCRFG +C+FNHP NRK+AIAAAR+
Sbjct  29   EAIWQMNLRGSELMESGPYPKRPGEPDCAYYIRTGLCRFGMTCKFNHPPNRKMAIAAARI  88

Query  447  K  449
            K
Sbjct  89   K  89


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = +1

Query  556  YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVP  669
            +P RP+  EC +YM+TG CKFG+ C+FHHP+   M VP
Sbjct  299  FPNRPDQPECQFYMKTGDCKFGAACRFHHPRERLMPVP  336


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRP  570
            ++Y+KTG CKFGA C+FHHPR++        L+ LG PLRP
Sbjct  309  QFYMKTGDCKFGAACRFHHPRERLMPVPDCVLSPLGLPLRP  349


 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 17/37 (46%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAI  431
            +P R  +P+C +Y++TG C+FGA+CRF+HP  R + +
Sbjct  299  FPNRPDQPECQFYMKTGDCKFGAACRFHHPRERLMPV  335


 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIA  434
            YP+R  E +C+YY+RTG C+FG +C+F+HP      +A
Sbjct  138  YPLRPNEKECAYYLRTGQCKFGNTCKFHHPQPSNAMVA  175



>sp|Q9SWF9.1|ZFNL_PEA RecName: Full=Zinc finger CCCH domain-containing protein ZFN-like 
[Pisum sativum]
 gb|AAD45720.1| zinc finger protein [Pisum sativum]
Length=417

 Score =   161 bits (407),  Expect(2) = 6e-64, Method: Compositional matrix adjust.
 Identities = 72/92 (78%), Positives = 83/92 (90%), Gaps = 0/92 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFGATC+FHHP+DKAG+AGRVALN+LGYPLRPN+ E  YY+RTGQCKFG+T
Sbjct  82   QYYLKTGTCKFGATCRFHHPKDKAGVAGRVALNILGYPLRPNESERAYYLRTGQCKFGNT  141

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  723
            CKFHHPQPSNM++ +RGS  YP V SPTTPGQ
Sbjct  142  CKFHHPQPSNMVLSMRGSTVYPTVQSPTTPGQ  173


 Score =   110 bits (276),  Expect(2) = 6e-64, Method: Compositional matrix adjust.
 Identities = 49/61 (80%), Positives = 53/61 (87%), Gaps = 0/61 (0%)
 Frame = +3

Query  267  ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARM  446
            E +WQ++LRS ETMESG YP   GEPDCSYYIRTGLCRFGA+CRFNHP NRKLAIA ARM
Sbjct  9    EAMWQMNLRSSETMESGPYPEHPGEPDCSYYIRTGLCRFGATCRFNHPPNRKLAIATARM  68

Query  447  K  449
            K
Sbjct  69   K  69


 Score = 80.1 bits (196),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 39/83 (47%), Positives = 52/83 (63%), Gaps = 3/83 (4%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y+KTG CKFGA C+FHHPR++   A    L+ +G PLRP +  C +Y R G CKFG +
Sbjct  285  QFYMKTGDCKFGAVCRFHHPRERQIPAPDCVLSPIGLPLRPGEPLCVFYSRYGICKFGPS  344

Query  628  CKFHHPQ---PSNMMVPLRGSPA  687
            CKF HP      N+  PL  +P 
Sbjct  345  CKFDHPMGIFTYNVASPLADTPG  367


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 33/56 (59%), Gaps = 3/56 (5%)
 Frame = +1

Query  556  YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  723
            +P RP+  EC +YM+TG CKFG+ C+FHHP+   +  P        P+  P  PG+
Sbjct  275  FPERPDQPECQFYMKTGDCKFGAVCRFHHPRERQIPAP---DCVLSPIGLPLRPGE  327



>ref|XP_006428577.1| hypothetical protein CICLE_v10011741mg [Citrus clementina]
 ref|XP_006428578.1| hypothetical protein CICLE_v10011741mg [Citrus clementina]
 ref|XP_006480418.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X6 [Citrus sinensis]
 ref|XP_006480419.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X7 [Citrus sinensis]
 ref|XP_006480420.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X8 [Citrus sinensis]
 gb|ESR41817.1| hypothetical protein CICLE_v10011741mg [Citrus clementina]
 gb|ESR41818.1| hypothetical protein CICLE_v10011741mg [Citrus clementina]
Length=407

 Score =   175 bits (444),  Expect(2) = 8e-64, Method: Compositional matrix adjust.
 Identities = 80/92 (87%), Positives = 85/92 (92%), Gaps = 0/92 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFGATCKFHHPRDKAGIAGRV+LNVLGYPLRPN+IEC YY+RTGQCKFGST
Sbjct  69   QYYLKTGTCKFGATCKFHHPRDKAGIAGRVSLNVLGYPLRPNEIECAYYLRTGQCKFGST  128

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  723
            CKFHHPQP+NMMV LRGSP YP V SPTTP Q
Sbjct  129  CKFHHPQPNNMMVSLRGSPVYPTVQSPTTPSQ  160


 Score = 96.3 bits (238),  Expect(2) = 8e-64, Method: Compositional matrix adjust.
 Identities = 43/56 (77%), Positives = 49/56 (88%), Gaps = 0/56 (0%)
 Frame = +3

Query  282  LSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMK  449
            ++LR+ E MESG+ P R GEPDCSYYIRTGLCRFGA+CRFNHP NRKLAIA AR+K
Sbjct  1    MNLRTNEAMESGSLPERPGEPDCSYYIRTGLCRFGATCRFNHPPNRKLAIATARIK  56


 Score = 77.4 bits (189),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 45/66 (68%), Gaps = 0/66 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y+KTG CKFGA C+FHHPR++        L+ +G PLRP +  C +Y R G CKFG +
Sbjct  276  QFYMKTGDCKFGAVCRFHHPRERLLPVPDCVLSPIGLPLRPGEPLCIFYSRYGICKFGPS  335

Query  628  CKFHHP  645
            CKF HP
Sbjct  336  CKFDHP  341


 Score = 56.6 bits (135),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 21/47 (45%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +3

Query  315  GTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKVL  455
            G YP R G+P+C YY++TG C+FGA+C+F+HP ++        + VL
Sbjct  57   GDYPERLGQPECQYYLKTGTCKFGATCKFHHPRDKAGIAGRVSLNVL  103


 Score = 53.1 bits (126),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = +3

Query  318  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAI  431
             +P R G+P+C +Y++TG C+FGA CRF+HP  R L +
Sbjct  265  VFPERPGQPECQFYMKTGDCKFGAVCRFHHPRERLLPV  302


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/56 (43%), Positives = 33/56 (59%), Gaps = 3/56 (5%)
 Frame = +1

Query  556  YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  723
            +P RP   EC +YM+TG CKFG+ C+FHHP+   + VP        P+  P  PG+
Sbjct  266  FPERPGQPECQFYMKTGDCKFGAVCRFHHPRERLLPVP---DCVLSPIGLPLRPGE  318


 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 17/38 (45%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIA  434
            YP+R  E +C+YY+RTG C+FG++C+F+HP    + ++
Sbjct  105  YPLRPNEIECAYYLRTGQCKFGSTCKFHHPQPNNMMVS  142



>ref|XP_007143976.1| hypothetical protein PHAVU_007G118500g [Phaseolus vulgaris]
 gb|ESW15970.1| hypothetical protein PHAVU_007G118500g [Phaseolus vulgaris]
Length=444

 Score =   162 bits (410),  Expect(2) = 9e-64, Method: Compositional matrix adjust.
 Identities = 73/92 (79%), Positives = 82/92 (89%), Gaps = 0/92 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFGATCKFHHP+D+ GIAGRV+LN LGYPLRPN+ EC YY+RTGQCKFG+T
Sbjct  104  QYYLKTGTCKFGATCKFHHPKDQTGIAGRVSLNTLGYPLRPNEPECTYYLRTGQCKFGNT  163

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  723
            CKFHHPQPSNMM+ L+ S  YP VHSPTTPGQ
Sbjct  164  CKFHHPQPSNMMLSLQDSSLYPTVHSPTTPGQ  195


 Score =   109 bits (272),  Expect(2) = 9e-64, Method: Compositional matrix adjust.
 Identities = 47/75 (63%), Positives = 59/75 (79%), Gaps = 0/75 (0%)
 Frame = +3

Query  222  YAVFMSKDTAICTR*ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRF  401
            + +   +++ I    ++LW ++LR+ ETM+SG YP R GEPDCSYYIRTGLCRFGA+CRF
Sbjct  16   HGIITRRNSPISQGQDSLWVMNLRTSETMDSGAYPERPGEPDCSYYIRTGLCRFGATCRF  75

Query  402  NHPSNRKLAIAAARM  446
            NHP NRKLAIA ARM
Sbjct  76   NHPPNRKLAIATARM  90


 Score = 77.0 bits (188),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 45/66 (68%), Gaps = 0/66 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y+KTG CKFGA C+FHHP ++   A    L+ +G PLRP +  C +Y R G CKFG +
Sbjct  311  QFYMKTGDCKFGAVCRFHHPHERLIPAPDCVLSPMGLPLRPGEPLCVFYSRYGICKFGPS  370

Query  628  CKFHHP  645
            CKF HP
Sbjct  371  CKFDHP  376


 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 25/61 (41%), Positives = 37/61 (61%), Gaps = 7/61 (11%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKVLLEDGSLQVWGHLQVS  500
            YP+R  EP+C+YY+RTG C+FG +C+F+HP         + M + L+D SL    H   +
Sbjct  140  YPLRPNEPECTYYLRTGQCKFGNTCKFHHPQ-------PSNMMLSLQDSSLYPTVHSPTT  192

Query  501  P  503
            P
Sbjct  193  P  193


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 18/33 (55%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNR  419
            +P R G+P+C +Y++TG C+FGA CRF+HP  R
Sbjct  301  FPERPGQPECQFYMKTGDCKFGAVCRFHHPHER  333



>ref|XP_006587810.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X3 [Glycine max]
Length=437

 Score =   167 bits (424),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 74/92 (80%), Positives = 85/92 (92%), Gaps = 0/92 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFGATC+FHHPRDKAGIAGRVA+N+LGYPLRPN+ EC YY+RTGQCKFG+T
Sbjct  101  QYYLKTGTCKFGATCRFHHPRDKAGIAGRVAMNILGYPLRPNEPECAYYLRTGQCKFGNT  160

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  723
            CKFHHPQP+NM++ +R SP YP VHSPTTPGQ
Sbjct  161  CKFHHPQPNNMVLSMRSSPVYPTVHSPTTPGQ  192


 Score =   102 bits (255),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 49/72 (68%), Positives = 54/72 (75%), Gaps = 11/72 (15%)
 Frame = +3

Query  267  ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKL-------  425
            + +WQ++LRS ETMESG YP   GEPDCSYYIRTGLCRFGA+CRFNHP NRKL       
Sbjct  17   DAMWQINLRSSETMESGPYPEHPGEPDCSYYIRTGLCRFGATCRFNHPPNRKLLPDSFFF  76

Query  426  ----AIAAARMK  449
                AIAAARMK
Sbjct  77   ENYQAIAAARMK  88


 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 46/66 (70%), Gaps = 0/66 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y+KTG CKFGA C+FHHPR++   A    L+ +G PLRP +  C +Y R G CKFG +
Sbjct  304  QFYMKTGDCKFGAVCRFHHPRERMIPAPDCVLSPIGLPLRPGEPLCVFYSRYGICKFGPS  363

Query  628  CKFHHP  645
            CKF HP
Sbjct  364  CKFDHP  369


 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 21/47 (45%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +3

Query  315  GTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKVL  455
            G +P R G+P+C YY++TG C+FGA+CRF+HP ++        M +L
Sbjct  89   GEFPERIGQPECQYYLKTGTCKFGATCRFHHPRDKAGIAGRVAMNIL  135


 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIA  434
            YP+R  EP+C+YY+RTG C+FG +C+F+HP    + ++
Sbjct  137  YPLRPNEPECAYYLRTGQCKFGNTCKFHHPQPNNMVLS  174


 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 41/81 (51%), Gaps = 5/81 (6%)
 Frame = +1

Query  481  GATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNM  660
            GA  +F       G       N+  +P RP+  EC +YM+TG CKFG+ C+FHHP+    
Sbjct  271  GAYSQFRSGSVPVGFYALQRENI--FPERPDQPECQFYMKTGDCKFGAVCRFHHPR--ER  326

Query  661  MVPLRGSPAYPPVHSPTTPGQ  723
            M+P        P+  P  PG+
Sbjct  327  MIPAPDC-VLSPIGLPLRPGE  346



>ref|XP_008792910.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Phoenix dactylifera]
 ref|XP_008792911.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Phoenix dactylifera]
 ref|XP_008792912.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Phoenix dactylifera]
Length=473

 Score =   165 bits (418),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 73/92 (79%), Positives = 82/92 (89%), Gaps = 0/92 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFGATCKFHHP+DKAGI GR  LN+LGYP+RPN+ EC YY+RTGQCKFG+T
Sbjct  108  QYYLKTGTCKFGATCKFHHPKDKAGILGRAELNILGYPIRPNEEECAYYLRTGQCKFGNT  167

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  723
            CKFHHPQPSN+MV LRGSP YP VHSPT+P Q
Sbjct  168  CKFHHPQPSNVMVSLRGSPFYPSVHSPTSPSQ  199


 Score =   105 bits (261),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 43/61 (70%), Positives = 54/61 (89%), Gaps = 0/61 (0%)
 Frame = +3

Query  267  ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARM  446
            ETLWQ+++R  E+MESG+YP R GEPDC+YY+RTG CR+G +CR+NHP NRKLAIAAAR+
Sbjct  35   ETLWQMNMRGSESMESGSYPQRQGEPDCAYYLRTGHCRYGVTCRYNHPPNRKLAIAAARL  94

Query  447  K  449
            K
Sbjct  95   K  95


 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 48/73 (66%), Gaps = 0/73 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y+KTG CKFGA CKFHHP+++   A    L+  G PLRP +  C +Y R G CKFG  
Sbjct  315  QFYMKTGDCKFGAACKFHHPKERLITAPNCLLSPSGLPLRPGEPLCVFYSRYGICKFGPN  374

Query  628  CKFHHPQPSNMMV  666
            CKF HP  ++M +
Sbjct  375  CKFDHPVVTSMGI  387


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 17/38 (45%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIA  434
            YP+R  E +C+YY+RTG C+FG +C+F+HP    + ++
Sbjct  144  YPIRPNEEECAYYLRTGQCKFGNTCKFHHPQPSNVMVS  181



>ref|XP_010929827.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X3 [Elaeis guineensis]
Length=430

 Score =   171 bits (433),  Expect(2) = 3e-63, Method: Compositional matrix adjust.
 Identities = 78/92 (85%), Positives = 84/92 (91%), Gaps = 0/92 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFGATCKFHHP+DKAGIAGRV LN+LGYPLRPN+ EC YY+RTGQCKFG+T
Sbjct  72   QYYLKTGTCKFGATCKFHHPKDKAGIAGRVQLNILGYPLRPNEKECAYYIRTGQCKFGNT  131

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  723
            CKFHHPQPSN MV LRGSP YPPVHS TTPGQ
Sbjct  132  CKFHHPQPSNAMVALRGSPVYPPVHSSTTPGQ  163


 Score = 99.0 bits (245),  Expect(2) = 3e-63, Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 50/59 (85%), Gaps = 0/59 (0%)
 Frame = +3

Query  273  LWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMK  449
            +WQ++LR  E+MESG YP R GE DC YYIRTGLCRFG +C+FNHP NR+LAIAAAR+K
Sbjct  1    MWQMNLRGSESMESGPYPERPGEADCGYYIRTGLCRFGMTCKFNHPPNRRLAIAAARIK  59


 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 44/66 (67%), Gaps = 0/66 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y+KTG CKFGA CKFHHPR++        L+ LG PLRP +  C +Y R G CKFG  
Sbjct  279  QFYMKTGDCKFGAVCKFHHPRERLVPVPNCLLSPLGLPLRPGEPLCVFYSRYGICKFGPN  338

Query  628  CKFHHP  645
            CKF HP
Sbjct  339  CKFDHP  344


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = +1

Query  556  YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVP  669
            +P RP+  EC +YM+TG CKFG+ CKFHHP+   + VP
Sbjct  269  FPERPDQPECQFYMKTGDCKFGAVCKFHHPRERLVPVP  306


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIA  434
            YP+R  E +C+YYIRTG C+FG +C+F+HP      +A
Sbjct  108  YPLRPNEKECAYYIRTGQCKFGNTCKFHHPQPSNAMVA  145



>ref|XP_010245962.1| PREDICTED: LOW QUALITY PROTEIN: zinc finger CCCH domain-containing 
protein ZFN-like [Nelumbo nucifera]
Length=457

 Score =   167 bits (422),  Expect(2) = 4e-63, Method: Compositional matrix adjust.
 Identities = 76/92 (83%), Positives = 83/92 (90%), Gaps = 0/92 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFGATCKFHHP+DKAGIAGRV LN+LGYPLRPN+ EC YY+RTGQCKFG+T
Sbjct  100  QYYLKTGTCKFGATCKFHHPKDKAGIAGRVPLNILGYPLRPNERECAYYLRTGQCKFGNT  159

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  723
            CKFHHPQPSN +V L GSP YP VHSPTTPGQ
Sbjct  160  CKFHHPQPSNTVVSLPGSPVYPSVHSPTTPGQ  191


 Score =   102 bits (254),  Expect(2) = 4e-63, Method: Compositional matrix adjust.
 Identities = 44/60 (73%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = +3

Query  267  ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARM  446
            +TLWQ++LR  ETMESG YP R GE DC+YY+RTGLCRFG +CRFNHP NRKLA+ AARM
Sbjct  27   DTLWQMNLRPSETMESGPYPERPGELDCAYYVRTGLCRFGMTCRFNHPPNRKLAVVAARM  86


 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 44/66 (67%), Gaps = 0/66 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y+KTG CKFGA C+FHHPR++        L+ LG PLRP +  C +Y R G CKFG  
Sbjct  309  QFYMKTGDCKFGAVCRFHHPRERLIPVPNCVLSPLGLPLRPGEPLCIFYSRYGICKFGPN  368

Query  628  CKFHHP  645
            CKF HP
Sbjct  369  CKFDHP  374


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/38 (53%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = +1

Query  556  YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVP  669
            +P RP+  EC +YM+TG CKFG+ C+FHHP+   + VP
Sbjct  299  FPERPDQPECQFYMKTGDCKFGAVCRFHHPRERLIPVP  336


 Score = 50.1 bits (118),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 29/46 (63%), Gaps = 0/46 (0%)
 Frame = +3

Query  318  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKVL  455
             +P R  +P+C +Y++TG C+FGA CRF+HP  R + +    +  L
Sbjct  298  VFPERPDQPECQFYMKTGDCKFGAVCRFHHPRERLIPVPNCVLSPL  343



>ref|XP_010929824.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Elaeis guineensis]
Length=263

 Score =   165 bits (418),  Expect(2) = 7e-63, Method: Compositional matrix adjust.
 Identities = 76/92 (83%), Positives = 83/92 (90%), Gaps = 0/92 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFGATCKFHHP+DKAG+AGRV LN+LGYPLR N+ EC YY+RTGQCKFG+T
Sbjct  93   QYYLKTGTCKFGATCKFHHPKDKAGMAGRVQLNILGYPLRLNEKECAYYIRTGQCKFGNT  152

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  723
            CKFHHPQPSN MV LRGSP YPPVHS TTPGQ
Sbjct  153  CKFHHPQPSNAMVALRGSPVYPPVHSLTTPGQ  184


 Score =   103 bits (256),  Expect(2) = 7e-63, Method: Compositional matrix adjust.
 Identities = 44/61 (72%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = +3

Query  267  ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARM  446
            E +WQ++LR  E+MESG YP R GEPDC+YYIRTGLCRFG +C+FNHP NR LAIAAAR+
Sbjct  20   EAMWQMNLRGSESMESGPYPERPGEPDCAYYIRTGLCRFGMTCKFNHPPNRSLAIAAARI  79

Query  447  K  449
            K
Sbjct  80   K  80


 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 31/56 (55%), Gaps = 0/56 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKVLLEDGSLQVWGH  488
            YP+R  E +C+YYIRTG C+FG +C+F+HP      +A     V     SL   G 
Sbjct  129  YPLRLNEKECAYYIRTGQCKFGNTCKFHHPQPSNAMVALRGSPVYPPVHSLTTPGQ  184



>ref|XP_009626542.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Nicotiana tomentosiformis]
Length=427

 Score =   154 bits (390),  Expect(2) = 1e-62, Method: Compositional matrix adjust.
 Identities = 70/81 (86%), Positives = 73/81 (90%), Gaps = 0/81 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFGATCKFHHPRDKAGIAGRV LNVLGYPLRPN+ EC YYMRT QCKFGST
Sbjct  92   QYYLKTGTCKFGATCKFHHPRDKAGIAGRVTLNVLGYPLRPNENECTYYMRTAQCKFGST  151

Query  628  CKFHHPQPSNMMVPLRGSPAY  690
            CKFHHP+PSNMMV  RGSP Y
Sbjct  152  CKFHHPEPSNMMVSSRGSPVY  172


 Score =   113 bits (282),  Expect(2) = 1e-62, Method: Compositional matrix adjust.
 Identities = 49/63 (78%), Positives = 58/63 (92%), Gaps = 0/63 (0%)
 Frame = +3

Query  261  R*ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAA  440
            R ++LWQ++LRSME+MESG YPVR+GEPDCSYYIRTGLCRFG++CRFNHP NRKLA+AAA
Sbjct  17   RQDSLWQMNLRSMESMESGPYPVREGEPDCSYYIRTGLCRFGSTCRFNHPPNRKLALAAA  76

Query  441  RMK  449
             M 
Sbjct  77   SMN  79


 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 48/67 (72%), Gaps = 1/67 (1%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
             YY++TG C+FG+TC+F+HP ++       ++N   YP R   +EC YY++TG CKFG+T
Sbjct  47   SYYIRTGLCRFGSTCRFNHPPNRKLALAAASMNG-EYPERIGQLECQYYLKTGTCKFGAT  105

Query  628  CKFHHPQ  648
            CKFHHP+
Sbjct  106  CKFHHPR  112


 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 45/66 (68%), Gaps = 0/66 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y+KTG CKFGA C+FHHPR++        L+ +G PLRP +  C +Y R G CKFG +
Sbjct  293  QFYMKTGDCKFGAVCRFHHPRERLLPPPDCLLSPIGLPLRPGEPMCIFYSRYGICKFGPS  352

Query  628  CKFHHP  645
            CKF HP
Sbjct  353  CKFDHP  358


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 19/36 (53%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +3

Query  318  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKL  425
             +P R G+P+C +Y++TG C+FGA CRF+HP  R L
Sbjct  282  VFPERLGQPECQFYMKTGDCKFGAVCRFHHPRERLL  317



>ref|XP_009769503.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X2 [Nicotiana sylvestris]
Length=406

 Score =   167 bits (423),  Expect(2) = 3e-62, Method: Compositional matrix adjust.
 Identities = 78/92 (85%), Positives = 81/92 (88%), Gaps = 0/92 (0%)
 Frame = +1

Query  451  YYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTC  630
            YYLKTG CKFGATCKFHHPRDKAGIAGRV LNVLGYPLRPN+ EC YYMRT QCKFGSTC
Sbjct  72   YYLKTGTCKFGATCKFHHPRDKAGIAGRVTLNVLGYPLRPNENECTYYMRTAQCKFGSTC  131

Query  631  KFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQL  726
            KFHHP+PSNMMV  RGSP YPP  S TTPGQ+
Sbjct  132  KFHHPEPSNMMVSSRGSPVYPPGPSSTTPGQM  163


 Score = 99.0 bits (245),  Expect(2) = 3e-62, Method: Compositional matrix adjust.
 Identities = 42/55 (76%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = +3

Query  261  R*ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKL  425
            R ++LWQ++LRSME+MESG YPVR+GE DCSYYIRTGLCRFG++C+FNHP NRKL
Sbjct  17   RQDSLWQMNLRSMESMESGPYPVREGESDCSYYIRTGLCRFGSTCQFNHPPNRKL  71


 Score = 73.9 bits (180),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 44/66 (67%), Gaps = 0/66 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y+KTG CKFGA C+FHHPR++        L+ +G PLR  +  C +Y R G CKFG +
Sbjct  272  QFYMKTGDCKFGAVCRFHHPRERLLPPPDCLLSPIGLPLRAGEPMCIFYSRYGICKFGPS  331

Query  628  CKFHHP  645
            CKF HP
Sbjct  332  CKFDHP  337


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 19/36 (53%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +3

Query  318  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKL  425
             +P R G+P+C +Y++TG C+FGA CRF+HP  R L
Sbjct  261  VFPERVGQPECQFYMKTGDCKFGAVCRFHHPRERLL  296



>gb|KHN04981.1| Zinc finger CCCH domain-containing protein ZFN-like [Glycine 
soja]
Length=428

 Score =   162 bits (410),  Expect(2) = 4e-62, Method: Compositional matrix adjust.
 Identities = 73/88 (83%), Positives = 81/88 (92%), Gaps = 0/88 (0%)
 Frame = +1

Query  460  KTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFH  639
            +T  CKFGATCKFHHP+D+AGIAGRVALN+LGYPLRPN+ EC YY+RTGQCKFG+TCKFH
Sbjct  91   RTRTCKFGATCKFHHPKDQAGIAGRVALNILGYPLRPNEPECTYYLRTGQCKFGNTCKFH  150

Query  640  HPQPSNMMVPLRGSPAYPPVHSPTTPGQ  723
            HPQPSNMM+ LRGSP YP VHSPTTPGQ
Sbjct  151  HPQPSNMMLSLRGSPVYPTVHSPTTPGQ  178


 Score =   103 bits (257),  Expect(2) = 4e-62, Method: Compositional matrix adjust.
 Identities = 44/60 (73%), Positives = 54/60 (90%), Gaps = 0/60 (0%)
 Frame = +3

Query  267  ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARM  446
            ++LW ++LR+ ET++SG+YP R GEPDCSYYIRTGLCRFGA+CRFNHP NR+LAIA ARM
Sbjct  16   DSLWMMNLRTGETVDSGSYPERPGEPDCSYYIRTGLCRFGATCRFNHPPNRRLAIATARM  75


 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 45/66 (68%), Gaps = 0/66 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y+KTG CKFGA C+FHHPR++   A    L+ +G PLR  +  C +Y R G CKFG +
Sbjct  294  QFYVKTGDCKFGAVCQFHHPRERLIPAPDCVLSPIGLPLRLGEPLCVFYSRYGICKFGPS  353

Query  628  CKFHHP  645
            CKF HP
Sbjct  354  CKFDHP  359


 Score = 50.1 bits (118),  Expect(2) = 4e-07, Method: Compositional matrix adjust.
 Identities = 17/35 (49%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKL  425
            +P R G+P+C +Y++TG C+FGA C+F+HP  R +
Sbjct  284  FPERPGQPECQFYVKTGDCKFGAVCQFHHPRERLI  318


 Score = 31.2 bits (69),  Expect(2) = 4e-07, Method: Compositional matrix adjust.
 Identities = 11/21 (52%), Positives = 15/21 (71%), Gaps = 0/21 (0%)
 Frame = +1

Query  451  YYLKTGACKFGATCKFHHPRD  513
            +Y + G CKFG +CKF HP +
Sbjct  341  FYSRYGICKFGPSCKFDHPME  361


 Score = 53.1 bits (126),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIA  434
            YP+R  EP+C+YY+RTG C+FG +C+F+HP    + ++
Sbjct  123  YPLRPNEPECTYYLRTGQCKFGNTCKFHHPQPSNMMLS  160



>gb|KHN14776.1| Zinc finger CCCH domain-containing protein ZFN-like, partial 
[Glycine soja]
Length=405

 Score =   160 bits (405),  Expect(2) = 5e-62, Method: Compositional matrix adjust.
 Identities = 73/87 (84%), Positives = 80/87 (92%), Gaps = 0/87 (0%)
 Frame = +1

Query  463  TGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHH  642
            T  CKFGATCKFHHP+D+AGIAGRVALN+LGYPLRPN+ EC YY+RTGQCKFG+TCKFHH
Sbjct  79   TRTCKFGATCKFHHPKDQAGIAGRVALNILGYPLRPNEPECTYYLRTGQCKFGNTCKFHH  138

Query  643  PQPSNMMVPLRGSPAYPPVHSPTTPGQ  723
            PQPSNMM+ LRGSP YP VHSPTTPGQ
Sbjct  139  PQPSNMMLSLRGSPVYPTVHSPTTPGQ  165


 Score =   105 bits (261),  Expect(2) = 5e-62, Method: Compositional matrix adjust.
 Identities = 45/60 (75%), Positives = 54/60 (90%), Gaps = 0/60 (0%)
 Frame = +3

Query  267  ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARM  446
            ++LW ++LR+ ETM+SG+YP R GEPDCSYY+RTGLCRFGA+CRFNHP NRKLAIA ARM
Sbjct  3    DSLWMMNLRTGETMDSGSYPERPGEPDCSYYMRTGLCRFGATCRFNHPPNRKLAIATARM  62


 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 46/66 (70%), Gaps = 0/66 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y+KTG CKFGA C+FHHP+++   A    L+ +G PLRP +  C +Y R G CKFG +
Sbjct  272  QFYMKTGDCKFGAVCRFHHPQERLVPAPNCVLSPIGLPLRPGEPLCVFYSRYGICKFGPS  331

Query  628  CKFHHP  645
            CKF HP
Sbjct  332  CKFDHP  337


 Score = 51.6 bits (122),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 18/33 (55%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNR  419
            +P R G+P+C +Y++TG C+FGA CRF+HP  R
Sbjct  262  FPERPGQPECQFYMKTGDCKFGAVCRFHHPQER  294


 Score = 30.8 bits (68),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 11/21 (52%), Positives = 15/21 (71%), Gaps = 0/21 (0%)
 Frame = +1

Query  451  YYLKTGACKFGATCKFHHPRD  513
            +Y + G CKFG +CKF HP +
Sbjct  319  FYSRYGICKFGPSCKFDHPME  339


 Score = 53.5 bits (127),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIA  434
            YP+R  EP+C+YY+RTG C+FG +C+F+HP    + ++
Sbjct  110  YPLRPNEPECTYYLRTGQCKFGNTCKFHHPQPSNMMLS  147


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/56 (43%), Positives = 33/56 (59%), Gaps = 3/56 (5%)
 Frame = +1

Query  556  YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  723
            +P RP   EC +YM+TG CKFG+ C+FHHPQ   +  P   +    P+  P  PG+
Sbjct  262  FPERPGQPECQFYMKTGDCKFGAVCRFHHPQERLVPAP---NCVLSPIGLPLRPGE  314


 Score = 50.1 bits (118),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +1

Query  541  LNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHP  645
            ++   YP RP + +C YYMRTG C+FG+TC+F+HP
Sbjct  16   MDSGSYPERPGEPDCSYYMRTGLCRFGATCRFNHP  50



>ref|XP_010525081.1| PREDICTED: zinc finger CCCH domain-containing protein 33-like 
isoform X1 [Tarenaya hassleriana]
Length=440

 Score =   159 bits (402),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 71/92 (77%), Positives = 81/92 (88%), Gaps = 0/92 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFG TCKFHHPR+KAGIAGRV+LNVLGYP+RPN++EC YY+RTG CKFGST
Sbjct  98   QYYLKTGTCKFGVTCKFHHPRNKAGIAGRVSLNVLGYPIRPNEVECSYYLRTGHCKFGST  157

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  723
            CKF+HP P+N+MVPLRGSP YP V SPT   Q
Sbjct  158  CKFNHPPPTNLMVPLRGSPVYPAVQSPTAGQQ  189


 Score =   105 bits (261),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 45/61 (74%), Positives = 53/61 (87%), Gaps = 0/61 (0%)
 Frame = +3

Query  267  ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARM  446
            + +W ++L S+ETME GTYP R GEPDCSYYIRTGLCRFG++CRFNHP +R LAIAAARM
Sbjct  25   DAMWPMNLSSVETMEGGTYPERPGEPDCSYYIRTGLCRFGSTCRFNHPRDRNLAIAAARM  84

Query  447  K  449
            K
Sbjct  85   K  85


 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 45/66 (68%), Gaps = 0/66 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y+KTG CKFGA CKFHHPRD+        L+ +G PLRP +  C +Y R G CKFG +
Sbjct  299  QFYMKTGDCKFGAVCKFHHPRDRQIPPPDCVLSPIGLPLRPGEPLCVFYSRYGICKFGPS  358

Query  628  CKFHHP  645
            CKF HP
Sbjct  359  CKFDHP  364


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAI  431
            YP+R  E +CSYY+RTG C+FG++C+FNHP    L +
Sbjct  134  YPIRPNEVECSYYLRTGHCKFGSTCKFNHPPPTNLMV  170


 Score = 53.1 bits (126),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 41/81 (51%), Gaps = 5/81 (6%)
 Frame = +1

Query  481  GATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNM  660
            G+   FH    + GI      NV  +P RP   EC +YM+TG CKFG+ CKFHHP+   +
Sbjct  266  GSFSGFHSGSAQLGIYALPRENV--FPERPGQPECQFYMKTGDCKFGAVCKFHHPRDRQI  323

Query  661  MVPLRGSPAYPPVHSPTTPGQ  723
              P        P+  P  PG+
Sbjct  324  PPP---DCVLSPIGLPLRPGE  341


 Score = 53.1 bits (126),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +1

Query  556  YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMV  666
            YP RP + +C YY+RTG C+FGSTC+F+HP+  N+ +
Sbjct  43   YPERPGEPDCSYYIRTGLCRFGSTCRFNHPRDRNLAI  79


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 17/36 (47%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +3

Query  318  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKL  425
             +P R G+P+C +Y++TG C+FGA C+F+HP +R++
Sbjct  288  VFPERPGQPECQFYMKTGDCKFGAVCKFHHPRDRQI  323



>ref|XP_010525082.1| PREDICTED: zinc finger CCCH domain-containing protein 33-like 
isoform X2 [Tarenaya hassleriana]
Length=429

 Score =   159 bits (401),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 71/92 (77%), Positives = 81/92 (88%), Gaps = 0/92 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFG TCKFHHPR+KAGIAGRV+LNVLGYP+RPN++EC YY+RTG CKFGST
Sbjct  87   QYYLKTGTCKFGVTCKFHHPRNKAGIAGRVSLNVLGYPIRPNEVECSYYLRTGHCKFGST  146

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  723
            CKF+HP P+N+MVPLRGSP YP V SPT   Q
Sbjct  147  CKFNHPPPTNLMVPLRGSPVYPAVQSPTAGQQ  178


 Score =   104 bits (260),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 45/61 (74%), Positives = 53/61 (87%), Gaps = 0/61 (0%)
 Frame = +3

Query  267  ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARM  446
            + +W ++L S+ETME GTYP R GEPDCSYYIRTGLCRFG++CRFNHP +R LAIAAARM
Sbjct  14   DAMWPMNLSSVETMEGGTYPERPGEPDCSYYIRTGLCRFGSTCRFNHPRDRNLAIAAARM  73

Query  447  K  449
            K
Sbjct  74   K  74


 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 45/66 (68%), Gaps = 0/66 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y+KTG CKFGA CKFHHPRD+        L+ +G PLRP +  C +Y R G CKFG +
Sbjct  288  QFYMKTGDCKFGAVCKFHHPRDRQIPPPDCVLSPIGLPLRPGEPLCVFYSRYGICKFGPS  347

Query  628  CKFHHP  645
            CKF HP
Sbjct  348  CKFDHP  353


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAI  431
            YP+R  E +CSYY+RTG C+FG++C+FNHP    L +
Sbjct  123  YPIRPNEVECSYYLRTGHCKFGSTCKFNHPPPTNLMV  159


 Score = 53.1 bits (126),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 41/81 (51%), Gaps = 5/81 (6%)
 Frame = +1

Query  481  GATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNM  660
            G+   FH    + GI      NV  +P RP   EC +YM+TG CKFG+ CKFHHP+   +
Sbjct  255  GSFSGFHSGSAQLGIYALPRENV--FPERPGQPECQFYMKTGDCKFGAVCKFHHPRDRQI  312

Query  661  MVPLRGSPAYPPVHSPTTPGQ  723
              P        P+  P  PG+
Sbjct  313  PPP---DCVLSPIGLPLRPGE  330


 Score = 53.1 bits (126),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +1

Query  556  YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMV  666
            YP RP + +C YY+RTG C+FGSTC+F+HP+  N+ +
Sbjct  32   YPERPGEPDCSYYIRTGLCRFGSTCRFNHPRDRNLAI  68


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 17/36 (47%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +3

Query  318  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKL  425
             +P R G+P+C +Y++TG C+FGA C+F+HP +R++
Sbjct  277  VFPERPGQPECQFYMKTGDCKFGAVCKFHHPRDRQI  312



>ref|XP_004142565.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Cucumis sativus]
 gb|KGN66679.1| hypothetical protein Csa_1G659020 [Cucumis sativus]
Length=367

 Score =   165 bits (418),  Expect(2) = 5e-61, Method: Compositional matrix adjust.
 Identities = 77/92 (84%), Positives = 84/92 (91%), Gaps = 1/92 (1%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFGATCKFHHPRDKAGIAGRVALN+LGYPLRP++ EC YY+RTGQCKFG+T
Sbjct  69   QYYLKTGTCKFGATCKFHHPRDKAGIAGRVALNILGYPLRPSETECAYYLRTGQCKFGNT  128

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  723
            CKFHHPQP+NMMV LRGSP YP V SP TPGQ
Sbjct  129  CKFHHPQPTNMMVSLRGSPIYPTVQSP-TPGQ  159


 Score = 97.1 bits (240),  Expect(2) = 5e-61, Method: Compositional matrix adjust.
 Identities = 44/56 (79%), Positives = 49/56 (88%), Gaps = 0/56 (0%)
 Frame = +3

Query  282  LSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMK  449
            ++L S E M SG+YPVR GEPDCSYYIRTGLCRFGA+CRFNHP NR+LAIA ARMK
Sbjct  1    MNLGSGEIMGSGSYPVRPGEPDCSYYIRTGLCRFGATCRFNHPPNRELAIATARMK  56


 Score = 79.3 bits (194),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 46/66 (70%), Gaps = 0/66 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y+KTG CKFGA C+FHHPR++   A    L+ +G PLRP +  C +Y R G CKFG +
Sbjct  235  QFYMKTGDCKFGAVCRFHHPRERVLPAPDCVLSPIGLPLRPGEPLCIFYSRYGICKFGPS  294

Query  628  CKFHHP  645
            CKF HP
Sbjct  295  CKFDHP  300


 Score = 52.8 bits (125),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 21/47 (45%), Positives = 30/47 (64%), Gaps = 0/47 (0%)
 Frame = +3

Query  285  SLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKL  425
            S  S +      +P R G+P+C +Y++TG C+FGA CRF+HP  R L
Sbjct  213  SSESPQQTRENVFPERPGQPECQFYMKTGDCKFGAVCRFHHPRERVL  259


 Score = 49.7 bits (117),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 32/56 (57%), Gaps = 3/56 (5%)
 Frame = +1

Query  556  YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  723
            +P RP   EC +YM+TG CKFG+ C+FHHP+   +  P        P+  P  PG+
Sbjct  225  FPERPGQPECQFYMKTGDCKFGAVCRFHHPRERVLPAP---DCVLSPIGLPLRPGE  277


 Score = 49.7 bits (117),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 17/38 (45%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIA  434
            YP+R  E +C+YY+RTG C+FG +C+F+HP    + ++
Sbjct  105  YPLRPSETECAYYLRTGQCKFGNTCKFHHPQPTNMMVS  142



>gb|ADN33845.1| nucleic acid binding protein [Cucumis melo subsp. melo]
Length=367

 Score =   165 bits (418),  Expect(2) = 5e-61, Method: Compositional matrix adjust.
 Identities = 77/92 (84%), Positives = 84/92 (91%), Gaps = 1/92 (1%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFGATCKFHHPRDKAGIAGRVALN+LGYPLRP++ EC YY+RTGQCKFG+T
Sbjct  69   QYYLKTGTCKFGATCKFHHPRDKAGIAGRVALNILGYPLRPSETECAYYLRTGQCKFGNT  128

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  723
            CKFHHPQP+NMMV LRGSP YP V SP TPGQ
Sbjct  129  CKFHHPQPTNMMVSLRGSPIYPTVQSP-TPGQ  159


 Score = 97.1 bits (240),  Expect(2) = 5e-61, Method: Compositional matrix adjust.
 Identities = 44/56 (79%), Positives = 49/56 (88%), Gaps = 0/56 (0%)
 Frame = +3

Query  282  LSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMK  449
            ++L S E M SG+YPVR GEPDCSYYIRTGLCRFGA+CRFNHP NR+LAIA ARMK
Sbjct  1    MNLGSGEIMGSGSYPVRPGEPDCSYYIRTGLCRFGATCRFNHPPNRELAIATARMK  56


 Score = 79.3 bits (194),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 46/66 (70%), Gaps = 0/66 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y+KTG CKFGA C+FHHPR++   A    L+ +G PLRP +  C +Y R G CKFG +
Sbjct  235  QFYMKTGDCKFGAVCRFHHPRERVLPAPDCVLSPIGLPLRPGEPLCIFYSRYGICKFGPS  294

Query  628  CKFHHP  645
            CKF HP
Sbjct  295  CKFDHP  300


 Score = 52.8 bits (125),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 21/47 (45%), Positives = 30/47 (64%), Gaps = 0/47 (0%)
 Frame = +3

Query  285  SLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKL  425
            S  S +      +P R G+P+C +Y++TG C+FGA CRF+HP  R L
Sbjct  213  SSESPQQTRENVFPERPGQPECQFYMKTGDCKFGAVCRFHHPRERVL  259


 Score = 49.7 bits (117),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 32/56 (57%), Gaps = 3/56 (5%)
 Frame = +1

Query  556  YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  723
            +P RP   EC +YM+TG CKFG+ C+FHHP+   +  P        P+  P  PG+
Sbjct  225  FPERPGQPECQFYMKTGDCKFGAVCRFHHPRERVLPAP---DCVLSPIGLPLRPGE  277


 Score = 49.7 bits (117),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 17/38 (45%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIA  434
            YP+R  E +C+YY+RTG C+FG +C+F+HP    + ++
Sbjct  105  YPLRPSETECAYYLRTGQCKFGNTCKFHHPQPTNMMVS  142



>gb|EYU39704.1| hypothetical protein MIMGU_mgv1a0076882mg [Erythranthe guttata]
Length=398

 Score =   164 bits (416),  Expect(2) = 6e-61, Method: Compositional matrix adjust.
 Identities = 74/89 (83%), Positives = 80/89 (90%), Gaps = 0/89 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFGATCKF HPR+KAGIAGRVALNVLGYP+R N++EC YYMR GQCKFGST
Sbjct  69   QYYLKTGTCKFGATCKFDHPREKAGIAGRVALNVLGYPIRANEMECAYYMRNGQCKFGST  128

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTT  714
            CKFHHPQPSNMMV LRGS  YPP+ SPTT
Sbjct  129  CKFHHPQPSNMMVSLRGSAVYPPIQSPTT  157


 Score = 97.4 bits (241),  Expect(2) = 6e-61, Method: Compositional matrix adjust.
 Identities = 42/56 (75%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = +3

Query  282  LSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMK  449
            ++++S E M+SG YPVR+ EPDCSYYIRTGLCRFGA+CRFNHP NRKLAIA A+MK
Sbjct  1    MNMKSSEPMDSGLYPVREDEPDCSYYIRTGLCRFGATCRFNHPPNRKLAIATAKMK  56


 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 39/87 (45%), Positives = 50/87 (57%), Gaps = 4/87 (5%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y+KTG CKFG  CKFHHPR++        L+ +G PLR  +  C +Y R G CKFG +
Sbjct  265  QFYMKTGDCKFGTVCKFHHPRERLMPVPDCVLSPIGLPLRTGEPLCVFYSRYGICKFGPS  324

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSP  708
            CKF HP    M V    + A P   SP
Sbjct  325  CKFDHP----MRVFAYNAAASPSTDSP  347


 Score = 52.8 bits (125),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = +1

Query  556  YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVP  669
            +P RP   EC +YM+TG CKFG+ CKFHHP+   M VP
Sbjct  255  FPERPGQPECQFYMKTGDCKFGTVCKFHHPRERLMPVP  292



>ref|XP_011077184.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Sesamum indicum]
 ref|XP_011077185.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Sesamum indicum]
 ref|XP_011077186.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Sesamum indicum]
Length=417

 Score =   155 bits (391),  Expect(2) = 6e-61, Method: Compositional matrix adjust.
 Identities = 75/94 (80%), Positives = 81/94 (86%), Gaps = 2/94 (2%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFGATCKFHHPRD+ GIAGRVALNVLGYPLRPN+I C YY+R G CKFG T
Sbjct  92   QYYLKTGTCKFGATCKFHHPRDELGIAGRVALNVLGYPLRPNEINCAYYIRNGLCKFGRT  151

Query  628  CKFHHPQPS-NMMVPLRGSPAYPPVHSPTTPGQL  726
            CKFHHPQPS NMMVPLR S  +PP+ SPTT GQL
Sbjct  152  CKFHHPQPSNNMMVPLRDSALHPPIQSPTT-GQL  184


 Score =   107 bits (266),  Expect(2) = 6e-61, Method: Compositional matrix adjust.
 Identities = 47/61 (77%), Positives = 53/61 (87%), Gaps = 0/61 (0%)
 Frame = +3

Query  267  ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARM  446
            + L Q+++R ME MESG YPVR+GEPDCSYYIRTGLCRFGA+CRFNHP NR LAIA ARM
Sbjct  19   DALLQMNMRPMEQMESGPYPVREGEPDCSYYIRTGLCRFGATCRFNHPLNRTLAIATARM  78

Query  447  K  449
            K
Sbjct  79   K  79


 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 45/66 (68%), Gaps = 0/66 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y+KTG CKFGA CKFHHPR++        L+ +G PLRP +  C +Y R G CKFG +
Sbjct  284  QFYMKTGDCKFGAVCKFHHPRERLIPLPDCVLSPIGLPLRPGEPLCVFYSRYGICKFGPS  343

Query  628  CKFHHP  645
            CKF HP
Sbjct  344  CKFDHP  349


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 32/52 (62%), Gaps = 6/52 (12%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKVLLEDGSLQ  476
            YP+R  E +C+YYIR GLC+FG +C+F+HP        +  M V L D +L 
Sbjct  128  YPLRPNEINCAYYIRNGLCKFGRTCKFHHPQ------PSNNMMVPLRDSALH  173


 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 24/56 (43%), Positives = 34/56 (61%), Gaps = 3/56 (5%)
 Frame = +1

Query  556  YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  723
            +P RP   +C +YM+TG CKFG+ CKFHHP+    ++PL       P+  P  PG+
Sbjct  274  FPERPGQPQCQFYMKTGDCKFGAVCKFHHPR--ERLIPLPDC-VLSPIGLPLRPGE  326


 Score = 50.1 bits (118),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 17/38 (45%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = +3

Query  318  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAI  431
             +P R G+P C +Y++TG C+FGA C+F+HP  R + +
Sbjct  273  VFPERPGQPQCQFYMKTGDCKFGAVCKFHHPRERLIPL  310



>ref|XP_004172583.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like, 
partial [Cucumis sativus]
Length=205

 Score =   164 bits (416),  Expect(2) = 7e-61, Method: Compositional matrix adjust.
 Identities = 77/92 (84%), Positives = 84/92 (91%), Gaps = 1/92 (1%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFGATCKFHHPRDKAGIAGRVALN+LGYPLRP++ EC YY+RTGQCKFG+T
Sbjct  69   QYYLKTGTCKFGATCKFHHPRDKAGIAGRVALNILGYPLRPSETECAYYLRTGQCKFGNT  128

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  723
            CKFHHPQP+NMMV LRGSP YP V SP TPGQ
Sbjct  129  CKFHHPQPTNMMVSLRGSPIYPTVQSP-TPGQ  159


 Score = 97.4 bits (241),  Expect(2) = 7e-61, Method: Compositional matrix adjust.
 Identities = 44/56 (79%), Positives = 49/56 (88%), Gaps = 0/56 (0%)
 Frame = +3

Query  282  LSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMK  449
            ++L S E M SG+YPVR GEPDCSYYIRTGLCRFGA+CRFNHP NR+LAIA ARMK
Sbjct  1    MNLGSGEIMGSGSYPVRPGEPDCSYYIRTGLCRFGATCRFNHPPNRELAIATARMK  56


 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 17/38 (45%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIA  434
            YP+R  E +C+YY+RTG C+FG +C+F+HP    + ++
Sbjct  105  YPLRPSETECAYYLRTGQCKFGNTCKFHHPQPTNMMVS  142


 Score = 49.7 bits (117),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 18/37 (49%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +1

Query  556  YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMV  666
            YP+RP + +C YY+RTG C+FG+TC+F+HP    + +
Sbjct  14   YPVRPGEPDCSYYIRTGLCRFGATCRFNHPPNRELAI  50



>ref|XP_011077187.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X2 [Sesamum indicum]
Length=407

 Score =   155 bits (391),  Expect(2) = 9e-61, Method: Compositional matrix adjust.
 Identities = 75/94 (80%), Positives = 81/94 (86%), Gaps = 2/94 (2%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFGATCKFHHPRD+ GIAGRVALNVLGYPLRPN+I C YY+R G CKFG T
Sbjct  82   QYYLKTGTCKFGATCKFHHPRDELGIAGRVALNVLGYPLRPNEINCAYYIRNGLCKFGRT  141

Query  628  CKFHHPQPS-NMMVPLRGSPAYPPVHSPTTPGQL  726
            CKFHHPQPS NMMVPLR S  +PP+ SPTT GQL
Sbjct  142  CKFHHPQPSNNMMVPLRDSALHPPIQSPTT-GQL  174


 Score =   106 bits (265),  Expect(2) = 9e-61, Method: Compositional matrix adjust.
 Identities = 47/61 (77%), Positives = 53/61 (87%), Gaps = 0/61 (0%)
 Frame = +3

Query  267  ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARM  446
            + L Q+++R ME MESG YPVR+GEPDCSYYIRTGLCRFGA+CRFNHP NR LAIA ARM
Sbjct  9    DALLQMNMRPMEQMESGPYPVREGEPDCSYYIRTGLCRFGATCRFNHPLNRTLAIATARM  68

Query  447  K  449
            K
Sbjct  69   K  69


 Score = 77.8 bits (190),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 45/66 (68%), Gaps = 0/66 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y+KTG CKFGA CKFHHPR++        L+ +G PLRP +  C +Y R G CKFG +
Sbjct  274  QFYMKTGDCKFGAVCKFHHPRERLIPLPDCVLSPIGLPLRPGEPLCVFYSRYGICKFGPS  333

Query  628  CKFHHP  645
            CKF HP
Sbjct  334  CKFDHP  339


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 32/52 (62%), Gaps = 6/52 (12%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKVLLEDGSLQ  476
            YP+R  E +C+YYIR GLC+FG +C+F+HP        +  M V L D +L 
Sbjct  118  YPLRPNEINCAYYIRNGLCKFGRTCKFHHPQ------PSNNMMVPLRDSALH  163


 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 24/56 (43%), Positives = 34/56 (61%), Gaps = 3/56 (5%)
 Frame = +1

Query  556  YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  723
            +P RP   +C +YM+TG CKFG+ CKFHHP+    ++PL       P+  P  PG+
Sbjct  264  FPERPGQPQCQFYMKTGDCKFGAVCKFHHPR--ERLIPLPDC-VLSPIGLPLRPGE  316


 Score = 50.1 bits (118),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 17/38 (45%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = +3

Query  318  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAI  431
             +P R G+P C +Y++TG C+FGA C+F+HP  R + +
Sbjct  263  VFPERPGQPQCQFYMKTGDCKFGAVCKFHHPRERLIPL  300



>ref|XP_011077188.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X3 [Sesamum indicum]
Length=327

 Score =   154 bits (389),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 75/94 (80%), Positives = 81/94 (86%), Gaps = 2/94 (2%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFGATCKFHHPRD+ GIAGRVALNVLGYPLRPN+I C YY+R G CKFG T
Sbjct  92   QYYLKTGTCKFGATCKFHHPRDELGIAGRVALNVLGYPLRPNEINCAYYIRNGLCKFGRT  151

Query  628  CKFHHPQPS-NMMVPLRGSPAYPPVHSPTTPGQL  726
            CKFHHPQPS NMMVPLR S  +PP+ SPTT GQL
Sbjct  152  CKFHHPQPSNNMMVPLRDSALHPPIQSPTT-GQL  184


 Score =   107 bits (266),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 47/61 (77%), Positives = 53/61 (87%), Gaps = 0/61 (0%)
 Frame = +3

Query  267  ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARM  446
            + L Q+++R ME MESG YPVR+GEPDCSYYIRTGLCRFGA+CRFNHP NR LAIA ARM
Sbjct  19   DALLQMNMRPMEQMESGPYPVREGEPDCSYYIRTGLCRFGATCRFNHPLNRTLAIATARM  78

Query  447  K  449
            K
Sbjct  79   K  79


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 32/52 (62%), Gaps = 6/52 (12%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKVLLEDGSLQ  476
            YP+R  E +C+YYIR GLC+FG +C+F+HP        +  M V L D +L 
Sbjct  128  YPLRPNEINCAYYIRNGLCKFGRTCKFHHPQ------PSNNMMVPLRDSALH  173


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRP  570
            ++Y+KTG CKFGA CKFHHPR++        L+ +G PLRP
Sbjct  284  QFYMKTGDCKFGAVCKFHHPRERLIPLPDCVLSPIGLPLRP  324


 Score = 50.1 bits (118),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 17/38 (45%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = +3

Query  318  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAI  431
             +P R G+P C +Y++TG C+FGA C+F+HP  R + +
Sbjct  273  VFPERPGQPQCQFYMKTGDCKFGAVCKFHHPRERLIPL  310



>ref|XP_009420318.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=431

 Score =   152 bits (384),  Expect(2) = 4e-60, Method: Compositional matrix adjust.
 Identities = 70/92 (76%), Positives = 76/92 (83%), Gaps = 0/92 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYL+TG CKFGATCKFHHPRDKAGIAGRV LN LGYP+R N+ EC YYMR G CKFGST
Sbjct  116  QYYLRTGTCKFGATCKFHHPRDKAGIAGRVQLNALGYPIRLNETECAYYMRNGVCKFGST  175

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  723
            CKFHHPQPSN M  +RGS  YP VHSPT+  Q
Sbjct  176  CKFHHPQPSNTMANVRGSTMYPGVHSPTSSQQ  207


 Score =   107 bits (266),  Expect(2) = 4e-60, Method: Compositional matrix adjust.
 Identities = 44/61 (72%), Positives = 55/61 (90%), Gaps = 0/61 (0%)
 Frame = +3

Query  267  ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARM  446
            ET+WQ+SLR +E+MESG YP R GEPDC+YY+RTGLCRFG +CR+NHP NR++AIAAAR+
Sbjct  43   ETMWQMSLREIESMESGPYPERPGEPDCTYYLRTGLCRFGMTCRYNHPPNRQMAIAAARI  102

Query  447  K  449
            K
Sbjct  103  K  103


 Score = 77.0 bits (188),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 37/73 (51%), Positives = 47/73 (64%), Gaps = 0/73 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y+KTG CKFGA CKFHHPR++        L+ LG PLRP +  C +Y R G CKFG  
Sbjct  321  QFYMKTGDCKFGAACKFHHPRERLLPPPNCLLSPLGLPLRPGEPLCIFYSRYGICKFGPH  380

Query  628  CKFHHPQPSNMMV  666
            CKF HP  + + V
Sbjct  381  CKFDHPMATPIGV  393


 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 22/45 (49%), Positives = 31/45 (69%), Gaps = 6/45 (13%)
 Frame = +1

Query  556  YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQ------PSNMMVPL  672
            +P RP+  EC +YM+TG CKFG+ CKFHHP+      P+ ++ PL
Sbjct  311  FPERPDQPECQFYMKTGDCKFGAACKFHHPRERLLPPPNCLLSPL  355



>ref|XP_009420319.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=429

 Score =   152 bits (384),  Expect(2) = 5e-60, Method: Compositional matrix adjust.
 Identities = 70/92 (76%), Positives = 76/92 (83%), Gaps = 0/92 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYL+TG CKFGATCKFHHPRDKAGIAGRV LN LGYP+R N+ EC YYMR G CKFGST
Sbjct  114  QYYLRTGTCKFGATCKFHHPRDKAGIAGRVQLNALGYPIRLNETECAYYMRNGVCKFGST  173

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  723
            CKFHHPQPSN M  +RGS  YP VHSPT+  Q
Sbjct  174  CKFHHPQPSNTMANVRGSTMYPGVHSPTSSQQ  205


 Score =   107 bits (266),  Expect(2) = 5e-60, Method: Compositional matrix adjust.
 Identities = 44/61 (72%), Positives = 55/61 (90%), Gaps = 0/61 (0%)
 Frame = +3

Query  267  ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARM  446
            ET+WQ+SLR +E+MESG YP R GEPDC+YY+RTGLCRFG +CR+NHP NR++AIAAAR+
Sbjct  41   ETMWQMSLREIESMESGPYPERPGEPDCTYYLRTGLCRFGMTCRYNHPPNRQMAIAAARI  100

Query  447  K  449
            K
Sbjct  101  K  101


 Score = 77.0 bits (188),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 37/73 (51%), Positives = 47/73 (64%), Gaps = 0/73 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y+KTG CKFGA CKFHHPR++        L+ LG PLRP +  C +Y R G CKFG  
Sbjct  319  QFYMKTGDCKFGAACKFHHPRERLLPPPNCLLSPLGLPLRPGEPLCIFYSRYGICKFGPH  378

Query  628  CKFHHPQPSNMMV  666
            CKF HP  + + V
Sbjct  379  CKFDHPMATPIGV  391


 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 22/45 (49%), Positives = 31/45 (69%), Gaps = 6/45 (13%)
 Frame = +1

Query  556  YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQ------PSNMMVPL  672
            +P RP+  EC +YM+TG CKFG+ CKFHHP+      P+ ++ PL
Sbjct  309  FPERPDQPECQFYMKTGDCKFGAACKFHHPRERLLPPPNCLLSPL  353



>ref|XP_010929826.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X2 [Elaeis guineensis]
Length=439

 Score =   171 bits (433),  Expect(2) = 5e-60, Method: Compositional matrix adjust.
 Identities = 78/91 (86%), Positives = 83/91 (91%), Gaps = 0/91 (0%)
 Frame = +1

Query  451  YYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTC  630
            YYLKTG CKFGATCKFHHP+DKAGIAGRV LN+LGYPLRPN+ EC YY+RTGQCKFG+TC
Sbjct  82   YYLKTGTCKFGATCKFHHPKDKAGIAGRVQLNILGYPLRPNEKECAYYIRTGQCKFGNTC  141

Query  631  KFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  723
            KFHHPQPSN MV LRGSP YPPVHS TTPGQ
Sbjct  142  KFHHPQPSNAMVALRGSPVYPPVHSSTTPGQ  172


 Score = 88.2 bits (217),  Expect(2) = 5e-60, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = +3

Query  267  ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKL  425
            E +WQ++LR  E+MESG YP R GE DC YYIRTGLCRFG +C+FNHP NR+L
Sbjct  29   EAMWQMNLRGSESMESGPYPERPGEADCGYYIRTGLCRFGMTCKFNHPPNRRL  81


 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 44/66 (67%), Gaps = 0/66 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y+KTG CKFGA CKFHHPR++        L+ LG PLRP +  C +Y R G CKFG  
Sbjct  288  QFYMKTGDCKFGAVCKFHHPRERLVPVPNCLLSPLGLPLRPGEPLCVFYSRYGICKFGPN  347

Query  628  CKFHHP  645
            CKF HP
Sbjct  348  CKFDHP  353


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = +1

Query  556  YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVP  669
            +P RP+  EC +YM+TG CKFG+ CKFHHP+   + VP
Sbjct  278  FPERPDQPECQFYMKTGDCKFGAVCKFHHPRERLVPVP  315


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIA  434
            YP+R  E +C+YYIRTG C+FG +C+F+HP      +A
Sbjct  117  YPLRPNEKECAYYIRTGQCKFGNTCKFHHPQPSNAMVA  154



>ref|XP_009626543.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X2 [Nicotiana tomentosiformis]
Length=406

 Score =   154 bits (388),  Expect(2) = 1e-59, Method: Compositional matrix adjust.
 Identities = 70/80 (88%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = +1

Query  451  YYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTC  630
            YYLKTG CKFGATCKFHHPRDKAGIAGRV LNVLGYPLRPN+ EC YYMRT QCKFGSTC
Sbjct  72   YYLKTGTCKFGATCKFHHPRDKAGIAGRVTLNVLGYPLRPNENECTYYMRTAQCKFGSTC  131

Query  631  KFHHPQPSNMMVPLRGSPAY  690
            KFHHP+PSNMMV  RGSP Y
Sbjct  132  KFHHPEPSNMMVSSRGSPVY  151


 Score =   103 bits (258),  Expect(2) = 1e-59, Method: Compositional matrix adjust.
 Identities = 44/55 (80%), Positives = 52/55 (95%), Gaps = 0/55 (0%)
 Frame = +3

Query  261  R*ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKL  425
            R ++LWQ++LRSME+MESG YPVR+GEPDCSYYIRTGLCRFG++CRFNHP NRKL
Sbjct  17   RQDSLWQMNLRSMESMESGPYPVREGEPDCSYYIRTGLCRFGSTCRFNHPPNRKL  71


 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 45/66 (68%), Gaps = 0/66 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y+KTG CKFGA C+FHHPR++        L+ +G PLRP +  C +Y R G CKFG +
Sbjct  272  QFYMKTGDCKFGAVCRFHHPRERLLPPPDCLLSPIGLPLRPGEPMCIFYSRYGICKFGPS  331

Query  628  CKFHHP  645
            CKF HP
Sbjct  332  CKFDHP  337


 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 19/36 (53%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +3

Query  318  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKL  425
             +P R G+P+C +Y++TG C+FGA CRF+HP  R L
Sbjct  261  VFPERLGQPECQFYMKTGDCKFGAVCRFHHPRERLL  296



>ref|XP_008792915.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X3 [Phoenix dactylifera]
Length=434

 Score =   164 bits (416),  Expect(2) = 2e-59, Method: Compositional matrix adjust.
 Identities = 73/92 (79%), Positives = 82/92 (89%), Gaps = 0/92 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFGATCKFHHP+DKAGI GR  LN+LGYP+RPN+ EC YY+RTGQCKFG+T
Sbjct  69   QYYLKTGTCKFGATCKFHHPKDKAGILGRAELNILGYPIRPNEEECAYYLRTGQCKFGNT  128

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  723
            CKFHHPQPSN+MV LRGSP YP VHSPT+P Q
Sbjct  129  CKFHHPQPSNVMVSLRGSPFYPSVHSPTSPSQ  160


 Score = 92.8 bits (229),  Expect(2) = 2e-59, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 49/56 (88%), Gaps = 0/56 (0%)
 Frame = +3

Query  282  LSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMK  449
            +++R  E+MESG+YP R GEPDC+YY+RTG CR+G +CR+NHP NRKLAIAAAR+K
Sbjct  1    MNMRGSESMESGSYPQRQGEPDCAYYLRTGHCRYGVTCRYNHPPNRKLAIAAARLK  56


 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 48/73 (66%), Gaps = 0/73 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y+KTG CKFGA CKFHHP+++   A    L+  G PLRP +  C +Y R G CKFG  
Sbjct  276  QFYMKTGDCKFGAACKFHHPKERLITAPNCLLSPSGLPLRPGEPLCVFYSRYGICKFGPN  335

Query  628  CKFHHPQPSNMMV  666
            CKF HP  ++M +
Sbjct  336  CKFDHPVVTSMGI  348


 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 20/47 (43%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +3

Query  315  GTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKVL  455
            G YP   G+P+C YY++TG C+FGA+C+F+HP ++   +  A + +L
Sbjct  57   GGYPEIVGQPECQYYLKTGTCKFGATCKFHHPKDKAGILGRAELNIL  103


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 17/38 (45%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIA  434
            YP+R  E +C+YY+RTG C+FG +C+F+HP    + ++
Sbjct  105  YPIRPNEEECAYYLRTGQCKFGNTCKFHHPQPSNVMVS  142



>ref|XP_008792914.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X2 [Phoenix dactylifera]
Length=452

 Score =   165 bits (417),  Expect(2) = 3e-59, Method: Compositional matrix adjust.
 Identities = 73/91 (80%), Positives = 81/91 (89%), Gaps = 0/91 (0%)
 Frame = +1

Query  451  YYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTC  630
            YYLKTG CKFGATCKFHHP+DKAGI GR  LN+LGYP+RPN+ EC YY+RTGQCKFG+TC
Sbjct  88   YYLKTGTCKFGATCKFHHPKDKAGILGRAELNILGYPIRPNEEECAYYLRTGQCKFGNTC  147

Query  631  KFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  723
            KFHHPQPSN+MV LRGSP YP VHSPT+P Q
Sbjct  148  KFHHPQPSNVMVSLRGSPFYPSVHSPTSPSQ  178


 Score = 92.0 bits (227),  Expect(2) = 3e-59, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = +3

Query  267  ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKL  425
            ETLWQ+++R  E+MESG+YP R GEPDC+YY+RTG CR+G +CR+NHP NRKL
Sbjct  35   ETLWQMNMRGSESMESGSYPQRQGEPDCAYYLRTGHCRYGVTCRYNHPPNRKL  87


 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 48/73 (66%), Gaps = 0/73 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y+KTG CKFGA CKFHHP+++   A    L+  G PLRP +  C +Y R G CKFG  
Sbjct  294  QFYMKTGDCKFGAACKFHHPKERLITAPNCLLSPSGLPLRPGEPLCVFYSRYGICKFGPN  353

Query  628  CKFHHPQPSNMMV  666
            CKF HP  ++M +
Sbjct  354  CKFDHPVVTSMGI  366


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 17/38 (45%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIA  434
            YP+R  E +C+YY+RTG C+FG +C+F+HP    + ++
Sbjct  123  YPIRPNEEECAYYLRTGQCKFGNTCKFHHPQPSNVMVS  160



>gb|KJB75170.1| hypothetical protein B456_012G028600 [Gossypium raimondii]
Length=401

 Score =   166 bits (421),  Expect(2) = 4e-59, Method: Compositional matrix adjust.
 Identities = 77/92 (84%), Positives = 82/92 (89%), Gaps = 0/92 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFGATCKFHHPRDKAGIAGRV+LN LGYPLRPN+ EC YY+RTGQCKFGST
Sbjct  61   QYYLKTGTCKFGATCKFHHPRDKAGIAGRVSLNFLGYPLRPNETECAYYLRTGQCKFGST  120

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  723
            CKFHHPQP+NMMV LRGSP YP   SPTT GQ
Sbjct  121  CKFHHPQPTNMMVSLRGSPIYPTFPSPTTSGQ  152


 Score = 89.7 bits (221),  Expect(2) = 4e-59, Method: Compositional matrix adjust.
 Identities = 40/48 (83%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +3

Query  306  MESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMK  449
            ME G YP R GEPDCSYYIRTGLCRFGA+CRFNHP NRKLAI  ARMK
Sbjct  1    MEPGPYPERPGEPDCSYYIRTGLCRFGATCRFNHPPNRKLAITTARMK  48


 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 40/85 (47%), Positives = 52/85 (61%), Gaps = 0/85 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y+KTG CKFGA C+FHHPR++   A    L+ +G PLRP +  C +Y R G CKFG +
Sbjct  268  QFYMKTGDCKFGAVCRFHHPRERVLPAPDCILSPIGLPLRPGEPLCIFYSRYGICKFGPS  327

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVH  702
            CKF+HP           SP   PVH
Sbjct  328  CKFNHPMGVFTFNYSASSPFEAPVH  352


 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 42/82 (51%), Gaps = 4/82 (5%)
 Frame = +1

Query  481  GATCKFHHPRDKAGIAGRVALNVLG-YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSN  657
            G+   F   R  +   G  AL     +P RP ++EC +YM+TG CKFG+ C+FHHP+   
Sbjct  232  GSQALFSQFRSGSAPVGFYALQRENVFPERPGELECQFYMKTGDCKFGAVCRFHHPRERV  291

Query  658  MMVPLRGSPAYPPVHSPTTPGQ  723
            +  P        P+  P  PG+
Sbjct  292  LPAP---DCILSPIGLPLRPGE  310


 Score = 53.1 bits (126),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 18/35 (51%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +3

Query  315  GTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNR  419
            G +P R G+P+C YY++TG C+FGA+C+F+HP ++
Sbjct  49   GEFPERVGQPECQYYLKTGTCKFGATCKFHHPRDK  83


 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 17/38 (45%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIA  434
            YP+R  E +C+YY+RTG C+FG++C+F+HP    + ++
Sbjct  97   YPLRPNETECAYYLRTGQCKFGSTCKFHHPQPTNMMVS  134



>ref|XP_008794629.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Phoenix dactylifera]
 ref|XP_008794630.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Phoenix dactylifera]
 ref|XP_008794631.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Phoenix dactylifera]
Length=467

 Score =   159 bits (403),  Expect(2) = 9e-59, Method: Compositional matrix adjust.
 Identities = 74/92 (80%), Positives = 81/92 (88%), Gaps = 1/92 (1%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFGATCKFHHP+DKAGI GR  LNVLGYP+RPN+ EC YY+RTGQCKFG+T
Sbjct  108  QYYLKTGTCKFGATCKFHHPKDKAGIFGRAPLNVLGYPIRPNEKECAYYLRTGQCKFGNT  167

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  723
            CKFHHPQPSN MV LRGSP YPPV SP +PGQ
Sbjct  168  CKFHHPQPSNAMVSLRGSPVYPPV-SPASPGQ  198


 Score = 95.1 bits (235),  Expect(2) = 9e-59, Method: Compositional matrix adjust.
 Identities = 39/61 (64%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = +3

Query  267  ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARM  446
            ET+WQ++ R  E++ESG YP R G PDC+YY+RTGLCR+G +CR+NHP +RKLAIAAAR+
Sbjct  35   ETMWQMNQRGSESVESGLYPERPGVPDCAYYLRTGLCRYGLTCRYNHPPDRKLAIAAARI  94

Query  447  K  449
            +
Sbjct  95   R  95


 Score = 80.9 bits (198),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 37/73 (51%), Positives = 48/73 (66%), Gaps = 0/73 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y+KTG CKFGA CKFHHP+++   A    L+ LG PLRP +  C +Y R G CKFG  
Sbjct  315  QFYMKTGDCKFGAACKFHHPKERLVPAPNCVLSPLGLPLRPGEPLCVFYSRYGICKFGPN  374

Query  628  CKFHHPQPSNMMV  666
            CKF HP  + M +
Sbjct  375  CKFDHPMATPMGI  387


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +1

Query  556  YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQ  648
            +P RP+  EC +YM+TG CKFG+ CKFHHP+
Sbjct  305  FPERPDQPECQFYMKTGDCKFGAACKFHHPK  335


 Score = 50.1 bits (118),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 17/30 (57%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHP  410
            YP+R  E +C+YY+RTG C+FG +C+F+HP
Sbjct  144  YPIRPNEKECAYYLRTGQCKFGNTCKFHHP  173



>ref|XP_010927660.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Elaeis guineensis]
 ref|XP_010927662.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Elaeis guineensis]
 ref|XP_010927663.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Elaeis guineensis]
Length=467

 Score =   156 bits (395),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 73/92 (79%), Positives = 80/92 (87%), Gaps = 1/92 (1%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFGATCKFHHP+DKAGI GR  LN LGYP+RPN+ EC YY+RTGQCKFG+T
Sbjct  108  QYYLKTGTCKFGATCKFHHPKDKAGIFGRAPLNNLGYPIRPNEKECAYYLRTGQCKFGNT  167

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  723
            CKFHHPQPSN MV LRGSP YPPV SP +PGQ
Sbjct  168  CKFHHPQPSNAMVSLRGSPVYPPV-SPASPGQ  198


 Score = 97.8 bits (242),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 40/61 (66%), Positives = 53/61 (87%), Gaps = 0/61 (0%)
 Frame = +3

Query  267  ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARM  446
            ET+WQ++ R  E++ESG YP R GEPDC+YY+RTGLCR+G +CR+NHP +RKLAIAAAR+
Sbjct  35   ETMWQMNKRGSESVESGLYPERPGEPDCAYYLRTGLCRYGLTCRYNHPPDRKLAIAAARI  94

Query  447  K  449
            +
Sbjct  95   R  95


 Score = 80.9 bits (198),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 37/73 (51%), Positives = 48/73 (66%), Gaps = 0/73 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y+KTG CKFGA CKFHHP+++   A    L+ LG PLRP +  C +Y R G CKFG  
Sbjct  315  QFYMKTGDCKFGAACKFHHPKERLVPAPNCVLSPLGLPLRPGEPLCVFYSRYGICKFGPN  374

Query  628  CKFHHPQPSNMMV  666
            CKF HP  + M +
Sbjct  375  CKFDHPMATPMGI  387


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +1

Query  556  YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQ  648
            +P RP+  EC +YM+TG CKFG+ CKFHHP+
Sbjct  305  FPERPDQPECQFYMKTGDCKFGAACKFHHPK  335



>ref|XP_010673926.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X2 [Beta vulgaris subsp. vulgaris]
Length=457

 Score =   155 bits (392),  Expect(2) = 4e-57, Method: Compositional matrix adjust.
 Identities = 74/92 (80%), Positives = 79/92 (86%), Gaps = 3/92 (3%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFGATCKF+HP+DKAGIAGRV LNVLGYPLRPN+ EC YY+RTGQCKFGST
Sbjct  123  QYYLKTGTCKFGATCKFNHPKDKAGIAGRVPLNVLGYPLRPNEPECAYYLRTGQCKFGST  182

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  723
            CKFHHPQPS      RGS  YPPV SPTTPGQ
Sbjct  183  CKFHHPQPS---ASFRGSSVYPPVQSPTTPGQ  211


 Score = 94.0 bits (232),  Expect(2) = 4e-57, Method: Compositional matrix adjust.
 Identities = 40/66 (61%), Positives = 54/66 (82%), Gaps = 5/66 (8%)
 Frame = +3

Query  267  ETLWQLSLRSMETMESGTYPV-----RDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAI  431
            +++WQ+++RS E M++G YP      R+GE DCS+Y+RTGLCRFG++CRFNHP NRKLA+
Sbjct  45   DSMWQVNMRSTEAMDTGIYPPGPYPEREGEADCSFYLRTGLCRFGSTCRFNHPPNRKLAL  104

Query  432  AAARMK  449
            A ARMK
Sbjct  105  ATARMK  110


 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 45/66 (68%), Gaps = 0/66 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YY+KTG CKFGA C+FHHPR++   A    L+ LG PLRP +  C +Y R G CKFG  
Sbjct  324  QYYMKTGDCKFGAVCRFHHPRERLIPAPDCLLSALGLPLRPGEPLCIFYSRYGICKFGPN  383

Query  628  CKFHHP  645
            CKF HP
Sbjct  384  CKFDHP  389


 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 21/47 (45%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +3

Query  315  GTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKVL  455
            G +P R G+P+C YY++TG C+FGA+C+FNHP ++        + VL
Sbjct  111  GEFPERTGQPECQYYLKTGTCKFGATCKFNHPKDKAGIAGRVPLNVL  157


 Score = 53.1 bits (126),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 18/30 (60%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHP  410
            YP+R  EP+C+YY+RTG C+FG++C+F+HP
Sbjct  159  YPLRPNEPECAYYLRTGQCKFGSTCKFHHP  188


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/46 (43%), Positives = 29/46 (63%), Gaps = 0/46 (0%)
 Frame = +3

Query  318  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKVL  455
             +P R G+P+C YY++TG C+FGA CRF+HP  R +      +  L
Sbjct  313  VFPERPGQPECQYYMKTGDCKFGAVCRFHHPRERLIPAPDCLLSAL  358


 Score = 50.4 bits (119),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 24/31 (77%), Gaps = 0/31 (0%)
 Frame = +1

Query  556  YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQ  648
            +P RP   EC YYM+TG CKFG+ C+FHHP+
Sbjct  314  FPERPGQPECQYYMKTGDCKFGAVCRFHHPR  344



>ref|XP_010673925.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Beta vulgaris subsp. vulgaris]
Length=459

 Score =   155 bits (392),  Expect(2) = 4e-57, Method: Compositional matrix adjust.
 Identities = 74/92 (80%), Positives = 79/92 (86%), Gaps = 3/92 (3%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFGATCKF+HP+DKAGIAGRV LNVLGYPLRPN+ EC YY+RTGQCKFGST
Sbjct  123  QYYLKTGTCKFGATCKFNHPKDKAGIAGRVPLNVLGYPLRPNEPECAYYLRTGQCKFGST  182

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  723
            CKFHHPQPS      RGS  YPPV SPTTPGQ
Sbjct  183  CKFHHPQPS---ASFRGSSVYPPVQSPTTPGQ  211


 Score = 94.0 bits (232),  Expect(2) = 4e-57, Method: Compositional matrix adjust.
 Identities = 40/66 (61%), Positives = 54/66 (82%), Gaps = 5/66 (8%)
 Frame = +3

Query  267  ETLWQLSLRSMETMESGTYPV-----RDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAI  431
            +++WQ+++RS E M++G YP      R+GE DCS+Y+RTGLCRFG++CRFNHP NRKLA+
Sbjct  45   DSMWQVNMRSTEAMDTGIYPPGPYPEREGEADCSFYLRTGLCRFGSTCRFNHPPNRKLAL  104

Query  432  AAARMK  449
            A ARMK
Sbjct  105  ATARMK  110


 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 45/66 (68%), Gaps = 0/66 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YY+KTG CKFGA C+FHHPR++   A    L+ LG PLRP +  C +Y R G CKFG  
Sbjct  326  QYYMKTGDCKFGAVCRFHHPRERLIPAPDCLLSALGLPLRPGEPLCIFYSRYGICKFGPN  385

Query  628  CKFHHP  645
            CKF HP
Sbjct  386  CKFDHP  391


 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 21/47 (45%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +3

Query  315  GTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKVL  455
            G +P R G+P+C YY++TG C+FGA+C+FNHP ++        + VL
Sbjct  111  GEFPERTGQPECQYYLKTGTCKFGATCKFNHPKDKAGIAGRVPLNVL  157


 Score = 53.1 bits (126),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 18/30 (60%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHP  410
            YP+R  EP+C+YY+RTG C+FG++C+F+HP
Sbjct  159  YPLRPNEPECAYYLRTGQCKFGSTCKFHHP  188


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/46 (43%), Positives = 29/46 (63%), Gaps = 0/46 (0%)
 Frame = +3

Query  318  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKVL  455
             +P R G+P+C YY++TG C+FGA CRF+HP  R +      +  L
Sbjct  315  VFPERPGQPECQYYMKTGDCKFGAVCRFHHPRERLIPAPDCLLSAL  360


 Score = 50.4 bits (119),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 24/31 (77%), Gaps = 0/31 (0%)
 Frame = +1

Query  556  YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQ  648
            +P RP   EC YYM+TG CKFG+ C+FHHP+
Sbjct  316  FPERPGQPECQYYMKTGDCKFGAVCRFHHPR  346



>ref|XP_009392477.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009392478.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009392479.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009392480.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=411

 Score =   156 bits (395),  Expect(2) = 4e-57, Method: Compositional matrix adjust.
 Identities = 69/92 (75%), Positives = 81/92 (88%), Gaps = 0/92 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFG+TCKFHHP++KAGIA +  LN+LGYPLRPN+ EC YY+RTG+CKFGST
Sbjct  72   QYYLKTGTCKFGSTCKFHHPKEKAGIAKQAQLNILGYPLRPNEQECAYYIRTGECKFGST  131

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  723
            CK+HHPQPSN ++ LRGSP YP  HSPTTPGQ
Sbjct  132  CKYHHPQPSNTILALRGSPIYPSAHSPTTPGQ  163


 Score = 92.8 bits (229),  Expect(2) = 4e-57, Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 49/59 (83%), Gaps = 0/59 (0%)
 Frame = +3

Query  273  LWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMK  449
            +W+ ++R  + +ESG YP R GEPDC+YYIRTGLCRFG +C+FNHP NR LAIAAAR++
Sbjct  1    MWKTNMRGRDPVESGPYPDRPGEPDCAYYIRTGLCRFGMTCKFNHPQNRMLAIAAARIR  59


 Score = 80.5 bits (197),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 44/66 (67%), Gaps = 0/66 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y+KTG CKFGA C+FHHPR++        LN LG PLRP +  C +Y R G CKFG  
Sbjct  277  QFYMKTGDCKFGAVCRFHHPRERLIPTPNCVLNPLGLPLRPGEPLCVFYSRYGICKFGPN  336

Query  628  CKFHHP  645
            CKF HP
Sbjct  337  CKFDHP  342


 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 20/47 (43%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +3

Query  315  GTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKVL  455
            G YP R G+P+C YY++TG C+FG++C+F+HP  +      A++ +L
Sbjct  60   GGYPERVGQPECQYYLKTGTCKFGSTCKFHHPKEKAGIAKQAQLNIL  106


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 34/53 (64%), Gaps = 2/53 (4%)
 Frame = +1

Query  514  KAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPL  672
            K  + GR  +    YP RP + +C YY+RTG C+FG TCKF+HPQ  N M+ +
Sbjct  3    KTNMRGRDPVESGPYPDRPGEPDCAYYIRTGLCRFGMTCKFNHPQ--NRMLAI  53


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 27/66 (41%), Positives = 37/66 (56%), Gaps = 5/66 (8%)
 Frame = +1

Query  460  KTGACKFGATCKFHHPRDKAGIAGRVAL---NVLGYPLRPNDIECPYYMRTGQCKFGSTC  630
            + G    GA  KF   R  +   G  A+   N+  +P RP   EC +YM+TG CKFG+ C
Sbjct  234  QQGETNIGAQGKFSSYRPGSVSMGLYAVPRENI--FPERPGQPECQFYMKTGDCKFGAVC  291

Query  631  KFHHPQ  648
            +FHHP+
Sbjct  292  RFHHPR  297


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 29/45 (64%), Gaps = 0/45 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKVL  455
            +P R G+P+C +Y++TG C+FGA CRF+HP  R +      +  L
Sbjct  267  FPERPGQPECQFYMKTGDCKFGAVCRFHHPRERLIPTPNCVLNPL  311


 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 21/39 (54%), Positives = 31/39 (79%), Gaps = 2/39 (5%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNH--PSNRKLAI  431
            YP+R  E +C+YYIRTG C+FG++C+++H  PSN  LA+
Sbjct  108  YPLRPNEQECAYYIRTGECKFGSTCKYHHPQPSNTILAL  146



>ref|XP_010558591.1| PREDICTED: zinc finger CCCH domain-containing protein 33-like 
[Tarenaya hassleriana]
Length=397

 Score =   147 bits (372),  Expect(2) = 7e-57, Method: Compositional matrix adjust.
 Identities = 64/92 (70%), Positives = 76/92 (83%), Gaps = 0/92 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFG TCKFHHPR+K GIAG V+LN LGYP+RPN+++C YY+RTG CKFGST
Sbjct  97   QYYLKTGTCKFGVTCKFHHPRNKVGIAGNVSLNALGYPIRPNEVDCAYYLRTGHCKFGST  156

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  723
            CKF+HP P+N+M PLRGS  YP V SP+   Q
Sbjct  157  CKFNHPPPTNLMAPLRGSSVYPAVQSPSAGQQ  188


 Score =   100 bits (250),  Expect(2) = 7e-57, Method: Compositional matrix adjust.
 Identities = 43/61 (70%), Positives = 51/61 (84%), Gaps = 0/61 (0%)
 Frame = +3

Query  267  ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARM  446
            + +WQ++L S ETME G YP R GEPDC+YYIRTGLCRFG++CRFNHP +R LAIA ARM
Sbjct  24   DAMWQMNLSSDETMEGGAYPDRPGEPDCAYYIRTGLCRFGSTCRFNHPRDRNLAIATARM  83

Query  447  K  449
            K
Sbjct  84   K  84


 Score = 80.1 bits (196),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 46/66 (70%), Gaps = 0/66 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y+KTG CKFG+ CKFHHPR++   A    L+ +G PLRP +  C +Y R G CKFG +
Sbjct  284  QFYMKTGDCKFGSVCKFHHPRNRQNPAPDCVLSPIGLPLRPGEPLCGFYSRYGICKFGPS  343

Query  628  CKFHHP  645
            CKF HP
Sbjct  344  CKFDHP  349


 Score = 51.2 bits (121),  Expect(2) = 3e-07, Method: Compositional matrix adjust.
 Identities = 22/53 (42%), Positives = 33/53 (62%), Gaps = 8/53 (15%)
 Frame = +3

Query  288  LRSMETMESGTY--------PVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRK  422
            L   E  ESG Y        P + G+P+C +Y++TG C+FG+ C+F+HP NR+
Sbjct  255  LLQNEAKESGFYALPRENVFPEKPGQPECQFYMKTGDCKFGSVCKFHHPRNRQ  307


 Score = 30.8 bits (68),  Expect(2) = 3e-07, Method: Compositional matrix adjust.
 Identities = 11/23 (48%), Positives = 15/23 (65%), Gaps = 0/23 (0%)
 Frame = +1

Query  451  YYLKTGACKFGATCKFHHPRDKA  519
            +Y + G CKFG +CKF HP  + 
Sbjct  331  FYSRYGICKFGPSCKFDHPMQRV  353


 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKL  425
            YP+R  E DC+YY+RTG C+FG++C+FNHP    L
Sbjct  133  YPIRPNEVDCAYYLRTGHCKFGSTCKFNHPPPTNL  167


 Score = 53.1 bits (126),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 20/38 (53%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = +1

Query  553  GYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMV  666
             YP RP + +C YY+RTG C+FGSTC+F+HP+  N+ +
Sbjct  41   AYPDRPGEPDCAYYIRTGLCRFGSTCRFNHPRDRNLAI  78



>gb|EPS74454.1| hypothetical protein M569_00301, partial [Genlisea aurea]
Length=205

 Score =   148 bits (374),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 73/93 (78%), Positives = 79/93 (85%), Gaps = 1/93 (1%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YY+KTG CKFGATCKFHHP DKAGIAGRV LNV GYPLRPN+IEC YYMR G CKFGST
Sbjct  73   QYYIKTGTCKFGATCKFHHPPDKAGIAGRVPLNVHGYPLRPNEIECAYYMRHGFCKFGST  132

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQL  726
            CKF+HPQ SN+MV LRGS  YP +HSPT  GQL
Sbjct  133  CKFNHPQLSNIMVSLRGSTVYPTIHSPTA-GQL  164


 Score = 99.4 bits (246),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 44/60 (73%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = +3

Query  270  TLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMK  449
             LW ++ R  E  +SG YPVR+GEPDCSYYIRTGLCRFGA+CRFNHP NRKLAIA A+MK
Sbjct  1    VLWDMNSRLREPSDSGHYPVREGEPDCSYYIRTGLCRFGATCRFNHPPNRKLAIATAQMK  60


 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 17/38 (45%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIA  434
            YP+R  E +C+YY+R G C+FG++C+FNHP    + ++
Sbjct  109  YPLRPNEIECAYYMRHGFCKFGSTCKFNHPQLSNIMVS  146



>ref|XP_006480414.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X2 [Citrus sinensis]
 ref|XP_006480415.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X3 [Citrus sinensis]
 ref|XP_006480416.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X4 [Citrus sinensis]
 ref|XP_006480417.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X5 [Citrus sinensis]
Length=420

 Score =   197 bits (500),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 102/172 (59%), Positives = 114/172 (66%), Gaps = 31/172 (18%)
 Frame = +1

Query  301  RQWSLGHIQYVMVNQIVLTTSELVFVDLEHLVDLTIHLTGNWQLLRQ-------------  441
            +QW+ G    V+ ++ VLTTSE   VDL   VDL I LTG+W  L+              
Sbjct  2    KQWNPGPCLSVLGSRTVLTTSEQASVDLGQHVDLIILLTGSWYKLQHVLTNICELKSKQK  61

Query  442  ------------------G*KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLR  567
                                +YYLKTG CKFGATCKFHHPRDKAGIAGRV+LNVLGYPLR
Sbjct  62   AIATARIKGDYPERLGQPECQYYLKTGTCKFGATCKFHHPRDKAGIAGRVSLNVLGYPLR  121

Query  568  PNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  723
            PN+IEC YY+RTGQCKFGSTCKFHHPQP+NMMV LRGSP YP V SPTTP Q
Sbjct  122  PNEIECAYYLRTGQCKFGSTCKFHHPQPNNMMVSLRGSPVYPTVQSPTTPSQ  173


 Score = 77.8 bits (190),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 45/66 (68%), Gaps = 0/66 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y+KTG CKFGA C+FHHPR++        L+ +G PLRP +  C +Y R G CKFG +
Sbjct  289  QFYMKTGDCKFGAVCRFHHPRERLLPVPDCVLSPIGLPLRPGEPLCIFYSRYGICKFGPS  348

Query  628  CKFHHP  645
            CKF HP
Sbjct  349  CKFDHP  354


 Score = 56.2 bits (134),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 21/47 (45%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +3

Query  315  GTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKVL  455
            G YP R G+P+C YY++TG C+FGA+C+F+HP ++        + VL
Sbjct  70   GDYPERLGQPECQYYLKTGTCKFGATCKFHHPRDKAGIAGRVSLNVL  116


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAI  431
            +P R G+P+C +Y++TG C+FGA CRF+HP  R L +
Sbjct  279  FPERPGQPECQFYMKTGDCKFGAVCRFHHPRERLLPV  315


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/56 (43%), Positives = 33/56 (59%), Gaps = 3/56 (5%)
 Frame = +1

Query  556  YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  723
            +P RP   EC +YM+TG CKFG+ C+FHHP+   + VP        P+  P  PG+
Sbjct  279  FPERPGQPECQFYMKTGDCKFGAVCRFHHPRERLLPVP---DCVLSPIGLPLRPGE  331


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 17/38 (45%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIA  434
            YP+R  E +C+YY+RTG C+FG++C+F+HP    + ++
Sbjct  118  YPLRPNEIECAYYLRTGQCKFGSTCKFHHPQPNNMMVS  155



>ref|XP_009406323.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Musa acuminata subsp. malaccensis]
Length=411

 Score =   157 bits (396),  Expect(2) = 5e-56, Method: Compositional matrix adjust.
 Identities = 70/92 (76%), Positives = 80/92 (87%), Gaps = 0/92 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFGATCKFHHPR+KAGI+ +V LN+LGYPLRPN+ EC YY+RTG+CKFGST
Sbjct  72   QYYLKTGTCKFGATCKFHHPREKAGISEQVQLNILGYPLRPNEKECAYYLRTGECKFGST  131

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  723
            CKFHHPQPSN ++ L GSP YP  HSPTTP Q
Sbjct  132  CKFHHPQPSNAVLALHGSPVYPSAHSPTTPSQ  163


 Score = 89.0 bits (219),  Expect(2) = 5e-56, Method: Compositional matrix adjust.
 Identities = 36/59 (61%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = +3

Query  273  LWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMK  449
            +W+ + R  ++MESG YP R GEPDC+YYIRTGLCRFG +C+FNHP NR LA+AA  ++
Sbjct  1    MWKRNWRGSDSMESGPYPERPGEPDCAYYIRTGLCRFGMTCKFNHPPNRMLAVAATSIR  59


 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 44/66 (67%), Gaps = 0/66 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y+KTG CKFGA CKFHHPR++        L+ LG PLRP +  C +Y R G CKFG  
Sbjct  277  QFYMKTGDCKFGAVCKFHHPRERLVPVPNCVLSPLGLPLRPGEPLCDFYSRYGICKFGPN  336

Query  628  CKFHHP  645
            CK+ HP
Sbjct  337  CKYDHP  342


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/44 (48%), Positives = 33/44 (75%), Gaps = 2/44 (5%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNH--PSNRKLAIAAARM  446
            YP+R  E +C+YY+RTG C+FG++C+F+H  PSN  LA+  + +
Sbjct  108  YPLRPNEKECAYYLRTGECKFGSTCKFHHPQPSNAVLALHGSPV  151


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 30/45 (67%), Gaps = 0/45 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKVL  455
            +P R G+P+C +Y++TG C+FGA C+F+HP  R + +    +  L
Sbjct  267  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERLVPVPNCVLSPL  311


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = +1

Query  556  YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVP  669
            +P RP   EC +YM+TG CKFG+ CKFHHP+   + VP
Sbjct  267  FPERPGQPECQFYMKTGDCKFGAVCKFHHPRERLVPVP  304



>ref|XP_009382899.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
[Musa acuminata subsp. malaccensis]
Length=467

 Score =   149 bits (376),  Expect(2) = 9e-56, Method: Compositional matrix adjust.
 Identities = 69/92 (75%), Positives = 78/92 (85%), Gaps = 1/92 (1%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++YL+TG CKFGATCKFHHPRDKAGIAGRV LNVLGYPLRP++ EC YYM+ G+CKFG+T
Sbjct  114  EFYLRTGTCKFGATCKFHHPRDKAGIAGRVQLNVLGYPLRPDEAECAYYMKNGECKFGNT  173

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  723
            CKFHHPQP N MV L GS  YP VHSPT+  Q
Sbjct  174  CKFHHPQP-NTMVSLCGSTVYPGVHSPTSGQQ  204


 Score = 95.5 bits (236),  Expect(2) = 9e-56, Method: Compositional matrix adjust.
 Identities = 38/60 (63%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = +3

Query  270  TLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMK  449
            T+WQ+ +R +E++ESG +P R  EPDC+YY+RTGLCRFG +CR+NHP NR++AIAAAR+K
Sbjct  42   TMWQMRMREIESVESGPFPERPREPDCTYYLRTGLCRFGITCRYNHPPNRQMAIAAARIK  101


 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/73 (51%), Positives = 48/73 (66%), Gaps = 0/73 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++YLKTG CK+GA CKFHHPR++        L+ LG PLRP +  C +Y R G CKFG+ 
Sbjct  320  EFYLKTGDCKYGAACKFHHPRERLIPIPDCVLSPLGLPLRPEEPICIFYSRYGICKFGTH  379

Query  628  CKFHHPQPSNMMV  666
            CKF HP  + M +
Sbjct  380  CKFDHPMAAPMGI  392


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = +3

Query  318  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAI  431
             +PVR G+P+C +Y++TG C++GA+C+F+HP  R + I
Sbjct  309  VFPVRPGQPECEFYLKTGDCKYGAACKFHHPRERLIPI  346


 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = +1

Query  556  YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVP  669
            +P+RP   EC +Y++TG CK+G+ CKFHHP+   + +P
Sbjct  310  FPVRPGQPECEFYLKTGDCKYGAACKFHHPRERLIPIP  347



>ref|XP_008810537.1| PREDICTED: LOW QUALITY PROTEIN: zinc finger CCCH domain-containing 
protein ZFN-like [Phoenix dactylifera]
Length=472

 Score =   156 bits (394),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 71/92 (77%), Positives = 79/92 (86%), Gaps = 0/92 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG+CKFGATCKFHHP+DKAGI GRV L++LGYPLRPN+ EC YY+RTGQCKFG+T
Sbjct  102  QYYLKTGSCKFGATCKFHHPKDKAGIVGRVKLSILGYPLRPNEKECAYYLRTGQCKFGNT  161

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  723
            CKFHHPQPSN M  L GSP Y P HS T PGQ
Sbjct  162  CKFHHPQPSNAMDALCGSPVYAPAHSTTIPGQ  193


 Score = 88.6 bits (218),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = +3

Query  267  ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKL  425
            E +WQL+LR  E ME G YP R GEPDC+YY+RTGLCRFG +C+FNHP NRK+
Sbjct  29   EAIWQLNLRGSELMEFGPYPERPGEPDCAYYMRTGLCRFGMTCKFNHPPNRKM  81


 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 43/66 (65%), Gaps = 0/66 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y+KTG CKFG  C+FHHPR++        L+ LG PLRP +  C +Y R G CKFG  
Sbjct  313  QFYMKTGDCKFGPACRFHHPRERLMPVPNCILSPLGLPLRPGEPLCIFYSRYGICKFGPN  372

Query  628  CKFHHP  645
            CKF HP
Sbjct  373  CKFDHP  378


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = +1

Query  556  YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVP  669
            +P RP+  EC +YM+TG CKFG  C+FHHP+   M VP
Sbjct  303  FPERPDQPECQFYMKTGDCKFGPACRFHHPRERLMPVP  340



>gb|EEE52080.1| hypothetical protein OsJ_33853 [Oryza sativa Japonica Group]
Length=529

 Score =   148 bits (373),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 70/92 (76%), Positives = 76/92 (83%), Gaps = 1/92 (1%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFGATCKFHHPR+KA IA RV LN LGYPLRPN+ EC YY+RTGQCKFGST
Sbjct  193  QYYLKTGTCKFGATCKFHHPREKAAIATRVQLNALGYPLRPNEKECAYYLRTGQCKFGST  252

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  723
            CKFHHPQPSN MV +RGS  Y P  S T+P Q
Sbjct  253  CKFHHPQPSNTMVAVRGS-VYSPGQSVTSPSQ  283


 Score = 95.5 bits (236),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 52/61 (85%), Gaps = 2/61 (3%)
 Frame = +3

Query  267  ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARM  446
            E +WQ++L   E ME+G YP R GEPDCSYY+RTGLCRFG +C+FNHP++RK+A+AAARM
Sbjct  122  EAMWQMNLG--EAMEAGPYPERIGEPDCSYYMRTGLCRFGMTCKFNHPADRKMAVAAARM  179

Query  447  K  449
            K
Sbjct  180  K  180


 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 44/102 (43%), Positives = 56/102 (55%), Gaps = 9/102 (9%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y+KTG CKFGA CKFHHP+++       AL+ LG PLRP +  C +Y R G CKFG  
Sbjct  401  QFYMKTGDCKFGAVCKFHHPKERIIPTPNCALSSLGLPLRPGEPICTFYSRYGICKFGPN  460

Query  628  CKFHHPQPSNMM---------VPLRGSPAYPPVHSPTTPGQL  726
            CKF HP  + M          V  R   A  P HS  +P  +
Sbjct  461  CKFDHPMGTVMYGLATSPTGDVSARRMLAPVPAHSEVSPDNV  502


 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 23/46 (50%), Positives = 35/46 (76%), Gaps = 2/46 (4%)
 Frame = +3

Query  315  GTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKV  452
            G YP R G+P+C YY++TG C+FGA+C+F+HP  R+ A  A R+++
Sbjct  181  GEYPQRIGQPECQYYLKTGTCKFGATCKFHHP--REKAAIATRVQL  224


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/39 (51%), Positives = 31/39 (79%), Gaps = 2/39 (5%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNH--PSNRKLAI  431
            YP+R  E +C+YY+RTG C+FG++C+F+H  PSN  +A+
Sbjct  229  YPLRPNEKECAYYLRTGQCKFGSTCKFHHPQPSNTMVAV  267


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 32/50 (64%), Gaps = 10/50 (20%)
 Frame = +1

Query  556  YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQP----------SNMMVPLR  675
            +P RP+  EC +YM+TG CKFG+ CKFHHP+           S++ +PLR
Sbjct  391  FPERPDQPECQFYMKTGDCKFGAVCKFHHPKERIIPTPNCALSSLGLPLR  440



>ref|NP_001066624.1| Os12g0405100 [Oryza sativa Japonica Group]
 sp|Q2QT65.1|C3H66_ORYSJ RecName: Full=Zinc finger CCCH domain-containing protein 66; 
Short=OsC3H66 [Oryza sativa Japonica Group]
 gb|ABA97542.1| Zinc finger CCCH type domain containing protein ZFN, putative, 
expressed [Oryza sativa Japonica Group]
 dbj|BAF29643.1| Os12g0405100 [Oryza sativa Japonica Group]
 dbj|BAG99287.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE53085.1| hypothetical protein OsJ_35844 [Oryza sativa Japonica Group]
Length=454

 Score =   145 bits (365),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 68/92 (74%), Positives = 76/92 (83%), Gaps = 1/92 (1%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFGATCKFHHPR+KA +A RV LNVLGYP+RPN+ EC YY+RTGQCKF ST
Sbjct  118  QYYLKTGTCKFGATCKFHHPREKAALANRVQLNVLGYPMRPNEKECAYYLRTGQCKFAST  177

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  723
            CKFHHPQPSN MV +R S  Y P  S T+PGQ
Sbjct  178  CKFHHPQPSNTMVAVRNS-MYSPGQSATSPGQ  208


 Score = 98.6 bits (244),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = +3

Query  267  ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARM  446
            E +WQ++L   E+MES  YP R GEPDCSYY+RTGLCRFG +C+FNHP NRKLA+AAARM
Sbjct  45   EAMWQMTLGGGESMESTPYPERIGEPDCSYYMRTGLCRFGMTCKFNHPPNRKLAVAAARM  104

Query  447  K  449
             
Sbjct  105  N  105


 Score = 84.0 bits (206),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 39/71 (55%), Positives = 48/71 (68%), Gaps = 0/71 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y+KTG CKFGA CKFHHP+++   A   ALN LG PLRP +  C +Y R G CKFG  
Sbjct  325  QFYMKTGDCKFGAVCKFHHPKERLVPAPNCALNSLGLPLRPGEPVCTFYSRYGICKFGPN  384

Query  628  CKFHHPQPSNM  660
            CKF HP  + M
Sbjct  385  CKFDHPMGTLM  395


 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +1

Query  556  YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQ  648
            +P RP+  EC +YM+TG CKFG+ CKFHHP+
Sbjct  315  FPERPDQPECQFYMKTGDCKFGAVCKFHHPK  345



>ref|XP_006662931.1| PREDICTED: zinc finger CCCH domain-containing protein 63-like 
[Oryza brachyantha]
Length=407

 Score =   150 bits (378),  Expect(2) = 3e-55, Method: Compositional matrix adjust.
 Identities = 71/92 (77%), Positives = 78/92 (85%), Gaps = 1/92 (1%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTGACKFGATCKFHHPR+KA +A RV LN LGYPLRPN+ EC YY+RTGQCKFGST
Sbjct  70   QYYLKTGACKFGATCKFHHPREKAAMATRVQLNALGYPLRPNEKECAYYLRTGQCKFGST  129

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  723
            CKFHHPQPSN MV +RGS  Y P  S T+PGQ
Sbjct  130  CKFHHPQPSNTMVAVRGS-VYSPGQSVTSPGQ  160


 Score = 93.2 bits (230),  Expect(2) = 3e-55, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 51/59 (86%), Gaps = 2/59 (3%)
 Frame = +3

Query  273  LWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMK  449
            +WQ++L   E ME+G YP R GEPDCSYY+RTGLCRFG +C+FNHP++RK+A+AAARMK
Sbjct  1    MWQMNLG--EAMEAGPYPERIGEPDCSYYMRTGLCRFGMTCKFNHPADRKMAVAAARMK  57


 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 44/103 (43%), Positives = 56/103 (54%), Gaps = 10/103 (10%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y+KTG CKFGA CKFHHP+++       AL+ LG PLRP +  C +Y R G CKFG  
Sbjct  278  QFYMKTGDCKFGAVCKFHHPKERIVPTPNCALSSLGLPLRPGEPICTFYSRYGICKFGPN  337

Query  628  CKFHHP----------QPSNMMVPLRGSPAYPPVHSPTTPGQL  726
            CKF HP           P+  M   R   A  P HS  +P  +
Sbjct  338  CKFDHPMGTVMYGLATSPTGDMSTARRMLAPVPAHSEVSPDSV  380


 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 23/46 (50%), Positives = 35/46 (76%), Gaps = 2/46 (4%)
 Frame = +3

Query  315  GTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKV  452
            G YP R G+P+C YY++TG C+FGA+C+F+HP  R+ A  A R+++
Sbjct  58   GEYPQRIGQPECQYYLKTGACKFGATCKFHHP--REKAAMATRVQL  101


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/39 (51%), Positives = 31/39 (79%), Gaps = 2/39 (5%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNH--PSNRKLAI  431
            YP+R  E +C+YY+RTG C+FG++C+F+H  PSN  +A+
Sbjct  106  YPLRPNEKECAYYLRTGQCKFGSTCKFHHPQPSNTMVAV  144


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +1

Query  556  YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQ  648
            +P RP+  EC +YM+TG CKFG+ CKFHHP+
Sbjct  268  FPERPDQPECQFYMKTGDCKFGAVCKFHHPK  298



>sp|Q2R4J4.2|C3H63_ORYSJ RecName: Full=Zinc finger CCCH domain-containing protein 63; 
Short=OsC3H63 [Oryza sativa Japonica Group]
 gb|ABA93650.2| Zinc finger CCCH type domain containing protein ZFN, putative, 
expressed [Oryza sativa Japonica Group]
 gb|AGT38442.1| zinc finger protein [Oryza sativa Japonica Group]
Length=444

 Score =   147 bits (372),  Expect(2) = 3e-55, Method: Compositional matrix adjust.
 Identities = 70/92 (76%), Positives = 76/92 (83%), Gaps = 1/92 (1%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFGATCKFHHPR+KA IA RV LN LGYPLRPN+ EC YY+RTGQCKFGST
Sbjct  108  QYYLKTGTCKFGATCKFHHPREKAAIATRVQLNALGYPLRPNEKECAYYLRTGQCKFGST  167

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  723
            CKFHHPQPSN MV +RGS  Y P  S T+P Q
Sbjct  168  CKFHHPQPSNTMVAVRGS-VYSPGQSVTSPSQ  198


 Score = 95.5 bits (236),  Expect(2) = 3e-55, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 52/61 (85%), Gaps = 2/61 (3%)
 Frame = +3

Query  267  ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARM  446
            E +WQ++L   E ME+G YP R GEPDCSYY+RTGLCRFG +C+FNHP++RK+A+AAARM
Sbjct  37   EAMWQMNLG--EAMEAGPYPERIGEPDCSYYMRTGLCRFGMTCKFNHPADRKMAVAAARM  94

Query  447  K  449
            K
Sbjct  95   K  95


 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 44/102 (43%), Positives = 56/102 (55%), Gaps = 9/102 (9%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y+KTG CKFGA CKFHHP+++       AL+ LG PLRP +  C +Y R G CKFG  
Sbjct  316  QFYMKTGDCKFGAVCKFHHPKERIIPTPNCALSSLGLPLRPGEPICTFYSRYGICKFGPN  375

Query  628  CKFHHPQPSNMM---------VPLRGSPAYPPVHSPTTPGQL  726
            CKF HP  + M          V  R   A  P HS  +P  +
Sbjct  376  CKFDHPMGTVMYGLATSPTGDVSARRMLAPVPAHSEVSPDNV  417


 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 23/46 (50%), Positives = 35/46 (76%), Gaps = 2/46 (4%)
 Frame = +3

Query  315  GTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKV  452
            G YP R G+P+C YY++TG C+FGA+C+F+HP  R+ A  A R+++
Sbjct  96   GEYPQRIGQPECQYYLKTGTCKFGATCKFHHP--REKAAIATRVQL  139


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/39 (51%), Positives = 31/39 (79%), Gaps = 2/39 (5%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNH--PSNRKLAI  431
            YP+R  E +C+YY+RTG C+FG++C+F+H  PSN  +A+
Sbjct  144  YPLRPNEKECAYYLRTGQCKFGSTCKFHHPQPSNTMVAV  182


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +1

Query  556  YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQ  648
            +P RP+  EC +YM+TG CKFG+ CKFHHP+
Sbjct  306  FPERPDQPECQFYMKTGDCKFGAVCKFHHPK  336



>ref|XP_003576637.1| PREDICTED: zinc finger CCCH domain-containing protein 66-like 
isoform X2 [Brachypodium distachyon]
Length=442

 Score =   144 bits (364),  Expect(2) = 4e-55, Method: Compositional matrix adjust.
 Identities = 69/92 (75%), Positives = 76/92 (83%), Gaps = 1/92 (1%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFGATCKFHHPR+KA IA R  LNVLGYPLRPN+ EC YY+RTGQCKF ST
Sbjct  104  QYYLKTGTCKFGATCKFHHPREKAAIATRAQLNVLGYPLRPNEKECAYYLRTGQCKFAST  163

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  723
            CKFHHPQPS+ MV +RGS  Y P  S T+PGQ
Sbjct  164  CKFHHPQPSSTMVAVRGS-MYSPGQSATSPGQ  194


 Score = 98.2 bits (243),  Expect(2) = 4e-55, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 51/62 (82%), Gaps = 1/62 (2%)
 Frame = +3

Query  267  ETLWQLSLRSM-ETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAAR  443
            ET+WQ+SL    E+ME G YP R GEPDCSYY+RTGLCRFG +C+FNHP NRKLA+AAAR
Sbjct  30   ETMWQMSLGGGGESMEPGPYPERIGEPDCSYYMRTGLCRFGMTCKFNHPPNRKLAVAAAR  89

Query  444  MK  449
            M 
Sbjct  90   MN  91


 Score = 80.1 bits (196),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 44/93 (47%), Positives = 55/93 (59%), Gaps = 4/93 (4%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y+KTG CKFGA CKF+HP+++   A   AL+ LG PLRP +  C +Y R G CKFG  
Sbjct  312  QFYMKTGDCKFGAVCKFNHPKERMIPAPNCALSPLGLPLRPGEPVCTFYSRYGICKFGPN  371

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQL  726
            CKF HP    M   + GS   P    PT   QL
Sbjct  372  CKFDHP----MGTVMYGSVTSPTSDVPTLHYQL  400


 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 30/72 (42%), Positives = 40/72 (56%), Gaps = 9/72 (13%)
 Frame = +1

Query  526  AGRVALNVLG------YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPA  687
            AG V L V        +P RP+  EC +YM+TG CKFG+ CKF+HP+    M+P     A
Sbjct  286  AGSVPLGVYAVQGDNVFPERPDQPECQFYMKTGDCKFGAVCKFNHPK--ERMIPAPNC-A  342

Query  688  YPPVHSPTTPGQ  723
              P+  P  PG+
Sbjct  343  LSPLGLPLRPGE  354


 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 28/46 (61%), Gaps = 0/46 (0%)
 Frame = +3

Query  318  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKVL  455
             +P R  +P+C +Y++TG C+FGA C+FNHP  R +      +  L
Sbjct  301  VFPERPDQPECQFYMKTGDCKFGAVCKFNHPKERMIPAPNCALSPL  346



>ref|NP_001067878.1| Os11g0472000 [Oryza sativa Japonica Group]
 dbj|BAF28241.1| Os11g0472000, partial [Oryza sativa Japonica Group]
Length=414

 Score =   147 bits (371),  Expect(2) = 4e-55, Method: Compositional matrix adjust.
 Identities = 70/92 (76%), Positives = 76/92 (83%), Gaps = 1/92 (1%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFGATCKFHHPR+KA IA RV LN LGYPLRPN+ EC YY+RTGQCKFGST
Sbjct  78   QYYLKTGTCKFGATCKFHHPREKAAIATRVQLNALGYPLRPNEKECAYYLRTGQCKFGST  137

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  723
            CKFHHPQPSN MV +RGS  Y P  S T+P Q
Sbjct  138  CKFHHPQPSNTMVAVRGS-VYSPGQSVTSPSQ  168


 Score = 95.5 bits (236),  Expect(2) = 4e-55, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 52/61 (85%), Gaps = 2/61 (3%)
 Frame = +3

Query  267  ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARM  446
            E +WQ++L   E ME+G YP R GEPDCSYY+RTGLCRFG +C+FNHP++RK+A+AAARM
Sbjct  7    EAMWQMNLG--EAMEAGPYPERIGEPDCSYYMRTGLCRFGMTCKFNHPADRKMAVAAARM  64

Query  447  K  449
            K
Sbjct  65   K  65


 Score = 80.9 bits (198),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 44/102 (43%), Positives = 56/102 (55%), Gaps = 9/102 (9%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y+KTG CKFGA CKFHHP+++       AL+ LG PLRP +  C +Y R G CKFG  
Sbjct  286  QFYMKTGDCKFGAVCKFHHPKERIIPTPNCALSSLGLPLRPGEPICTFYSRYGICKFGPN  345

Query  628  CKFHHPQPSNMM---------VPLRGSPAYPPVHSPTTPGQL  726
            CKF HP  + M          V  R   A  P HS  +P  +
Sbjct  346  CKFDHPMGTVMYGLATSPTGDVSARRMLAPVPAHSEVSPDNV  387


 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 23/46 (50%), Positives = 35/46 (76%), Gaps = 2/46 (4%)
 Frame = +3

Query  315  GTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKV  452
            G YP R G+P+C YY++TG C+FGA+C+F+HP  R+ A  A R+++
Sbjct  66   GEYPQRIGQPECQYYLKTGTCKFGATCKFHHP--REKAAIATRVQL  109


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/39 (51%), Positives = 31/39 (79%), Gaps = 2/39 (5%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNH--PSNRKLAI  431
            YP+R  E +C+YY+RTG C+FG++C+F+H  PSN  +A+
Sbjct  114  YPLRPNEKECAYYLRTGQCKFGSTCKFHHPQPSNTMVAV  152


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 32/50 (64%), Gaps = 10/50 (20%)
 Frame = +1

Query  556  YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQP----------SNMMVPLR  675
            +P RP+  EC +YM+TG CKFG+ CKFHHP+           S++ +PLR
Sbjct  276  FPERPDQPECQFYMKTGDCKFGAVCKFHHPKERIIPTPNCALSSLGLPLR  325



>ref|XP_010237293.1| PREDICTED: zinc finger CCCH domain-containing protein 66-like 
isoform X1 [Brachypodium distachyon]
Length=445

 Score =   144 bits (364),  Expect(2) = 4e-55, Method: Compositional matrix adjust.
 Identities = 69/92 (75%), Positives = 76/92 (83%), Gaps = 1/92 (1%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFGATCKFHHPR+KA IA R  LNVLGYPLRPN+ EC YY+RTGQCKF ST
Sbjct  107  QYYLKTGTCKFGATCKFHHPREKAAIATRAQLNVLGYPLRPNEKECAYYLRTGQCKFAST  166

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  723
            CKFHHPQPS+ MV +RGS  Y P  S T+PGQ
Sbjct  167  CKFHHPQPSSTMVAVRGS-MYSPGQSATSPGQ  197


 Score = 98.2 bits (243),  Expect(2) = 4e-55, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 51/62 (82%), Gaps = 1/62 (2%)
 Frame = +3

Query  267  ETLWQLSLRSM-ETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAAR  443
            ET+WQ+SL    E+ME G YP R GEPDCSYY+RTGLCRFG +C+FNHP NRKLA+AAAR
Sbjct  33   ETMWQMSLGGGGESMEPGPYPERIGEPDCSYYMRTGLCRFGMTCKFNHPPNRKLAVAAAR  92

Query  444  MK  449
            M 
Sbjct  93   MN  94


 Score = 80.1 bits (196),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 44/93 (47%), Positives = 55/93 (59%), Gaps = 4/93 (4%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y+KTG CKFGA CKF+HP+++   A   AL+ LG PLRP +  C +Y R G CKFG  
Sbjct  315  QFYMKTGDCKFGAVCKFNHPKERMIPAPNCALSPLGLPLRPGEPVCTFYSRYGICKFGPN  374

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQL  726
            CKF HP    M   + GS   P    PT   QL
Sbjct  375  CKFDHP----MGTVMYGSVTSPTSDVPTLHYQL  403


 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 30/72 (42%), Positives = 40/72 (56%), Gaps = 9/72 (13%)
 Frame = +1

Query  526  AGRVALNVLG------YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPA  687
            AG V L V        +P RP+  EC +YM+TG CKFG+ CKF+HP+    M+P     A
Sbjct  289  AGSVPLGVYAVQGDNVFPERPDQPECQFYMKTGDCKFGAVCKFNHPK--ERMIPAPNC-A  345

Query  688  YPPVHSPTTPGQ  723
              P+  P  PG+
Sbjct  346  LSPLGLPLRPGE  357


 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 28/46 (61%), Gaps = 0/46 (0%)
 Frame = +3

Query  318  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKVL  455
             +P R  +P+C +Y++TG C+FGA C+FNHP  R +      +  L
Sbjct  304  VFPERPDQPECQFYMKTGDCKFGAVCKFNHPKERMIPAPNCALSPL  349



>ref|XP_006663969.1| PREDICTED: zinc finger CCCH domain-containing protein 66-like 
isoform X1 [Oryza brachyantha]
Length=448

 Score =   147 bits (372),  Expect(2) = 7e-55, Method: Compositional matrix adjust.
 Identities = 69/92 (75%), Positives = 77/92 (84%), Gaps = 1/92 (1%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFGATCKFHHPR+KA +A RV LNVLGYP+RPN+ EC YY+RTGQCKF ST
Sbjct  112  QYYLKTGTCKFGATCKFHHPREKAALATRVQLNVLGYPMRPNEKECAYYLRTGQCKFAST  171

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  723
            CKFHHPQPSN MV +RGS  Y P  S T+PGQ
Sbjct  172  CKFHHPQPSNTMVSMRGS-MYSPGQSATSPGQ  202


 Score = 94.4 bits (233),  Expect(2) = 7e-55, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 53/76 (70%), Gaps = 1/76 (1%)
 Frame = +3

Query  225  AVFMSKDTAICTR*ETLWQLSLRSM-ETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRF  401
            AV       +    E +WQ++L    E+MES  YP R GEPDCSYY+RTGLCRFG +C+F
Sbjct  24   AVIGPHHLGVAAAEEAMWQMTLGGGGESMESVPYPERIGEPDCSYYMRTGLCRFGMTCKF  83

Query  402  NHPSNRKLAIAAARMK  449
            NHP NRKLA+AAARM 
Sbjct  84   NHPPNRKLAVAAARMN  99


 Score = 84.3 bits (207),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 39/71 (55%), Positives = 48/71 (68%), Gaps = 0/71 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y+KTG CKFGA CKFHHP+++   A   ALN LG PLRP +  C +Y R G CKFG  
Sbjct  319  QFYMKTGDCKFGAVCKFHHPKERLVPAPNCALNSLGLPLRPGEPVCTFYSRYGICKFGPN  378

Query  628  CKFHHPQPSNM  660
            CKF HP  + M
Sbjct  379  CKFDHPMGTLM  389


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 21/48 (44%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = +3

Query  312  SGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKVL  455
            +G YP R G+P+C YY++TG C+FGA+C+F+HP  +       ++ VL
Sbjct  99   NGEYPYRVGQPECQYYLKTGTCKFGATCKFHHPREKAALATRVQLNVL  146


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +1

Query  556  YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQ  648
            +P RP+  EC +YM+TG CKFG+ CKFHHP+
Sbjct  309  FPERPDQPECQFYMKTGDCKFGAVCKFHHPK  339



>ref|XP_003577562.1| PREDICTED: zinc finger CCCH domain-containing protein 63-like 
[Brachypodium distachyon]
Length=445

 Score =   146 bits (368),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 69/92 (75%), Positives = 77/92 (84%), Gaps = 1/92 (1%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFGATCKFHHPR+KA +A RV LNVLGYPLRPN+ EC YY+RTGQCKFGST
Sbjct  108  QYYLKTGMCKFGATCKFHHPREKAAMATRVQLNVLGYPLRPNEKECSYYLRTGQCKFGST  167

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  723
            CKF+HPQPSN MV LRGS  + P  S T+P Q
Sbjct  168  CKFNHPQPSNTMVALRGS-VFSPGQSATSPSQ  198


 Score = 95.1 bits (235),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 52/61 (85%), Gaps = 2/61 (3%)
 Frame = +3

Query  267  ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARM  446
            E +W +SL   E+ME+G YP R GEPDCSYY+RTGLCRFG +C+FNHP++RK+A+AAARM
Sbjct  37   EAMWHMSLG--ESMEAGLYPERVGEPDCSYYMRTGLCRFGMTCKFNHPADRKMAVAAARM  94

Query  447  K  449
            K
Sbjct  95   K  95


 Score = 77.8 bits (190),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 36/71 (51%), Positives = 47/71 (66%), Gaps = 0/71 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y+KTG CKFGA CKFHHP+++   +   AL+ LG PLR  +  C +Y R G CKFG  
Sbjct  316  QFYMKTGDCKFGAVCKFHHPKERIIPSPSCALSPLGLPLRSGEPICTFYSRYGICKFGPN  375

Query  628  CKFHHPQPSNM  660
            CKF HP  + M
Sbjct  376  CKFDHPMGTVM  386


 Score = 59.3 bits (142),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 21/47 (45%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +3

Query  315  GTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKVL  455
            G YP R G+P+C YY++TG+C+FGA+C+F+HP  +       ++ VL
Sbjct  96   GEYPQRIGQPECQYYLKTGMCKFGATCKFHHPREKAAMATRVQLNVL  142


 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 20/38 (53%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIA  434
            YP+R  E +CSYY+RTG C+FG++C+FNHP      +A
Sbjct  144  YPLRPNEKECSYYLRTGQCKFGSTCKFNHPQPSNTMVA  181


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/45 (51%), Positives = 30/45 (67%), Gaps = 6/45 (13%)
 Frame = +1

Query  556  YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQ------PSNMMVPL  672
            +P RP+  EC +YM+TG CKFG+ CKFHHP+      PS  + PL
Sbjct  306  FPDRPDQPECQFYMKTGDCKFGAVCKFHHPKERIIPSPSCALSPL  350



>ref|XP_002450713.1| hypothetical protein SORBIDRAFT_05g013190 [Sorghum bicolor]
 gb|EES09701.1| hypothetical protein SORBIDRAFT_05g013190 [Sorghum bicolor]
Length=446

 Score =   146 bits (368),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 69/92 (75%), Positives = 76/92 (83%), Gaps = 1/92 (1%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFGATCKFHHPR+KA +A RV LN LGYPLR N+ EC YY+RTGQCKFGST
Sbjct  109  QYYLKTGTCKFGATCKFHHPREKAAMATRVQLNELGYPLRANEKECAYYLRTGQCKFGST  168

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  723
            CKFHHPQPS MMV +RGS  Y P  S T+PGQ
Sbjct  169  CKFHHPQPSTMMVAVRGS-VYSPGQSATSPGQ  199


 Score = 95.1 bits (235),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 52/62 (84%), Gaps = 1/62 (2%)
 Frame = +3

Query  267  ETLWQLSL-RSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAAR  443
            E +WQ++L  +M  ME G YP R GEPDCSYY+RTG+CRFG +C+FNHP++RKLA+AAAR
Sbjct  35   EAMWQMNLGETMAPMELGPYPERVGEPDCSYYMRTGMCRFGMTCKFNHPADRKLAVAAAR  94

Query  444  MK  449
            MK
Sbjct  95   MK  96


 Score = 84.0 bits (206),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 43/89 (48%), Positives = 54/89 (61%), Gaps = 4/89 (4%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y+KTG CKFGA CKFHHPR++       AL+ LG PLRP +  C +Y R G CKFG  
Sbjct  317  QFYMKTGDCKFGAVCKFHHPRERIIPTPNCALSPLGLPLRPGEPICSFYNRYGMCKFGPN  376

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTT  714
            CKF HP  S M     G  + P   +PT+
Sbjct  377  CKFDHPMGSAMY----GHASSPTSEAPTS  401


 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 23/46 (50%), Positives = 35/46 (76%), Gaps = 2/46 (4%)
 Frame = +3

Query  315  GTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKV  452
            G YP R G+P+C YY++TG C+FGA+C+F+HP  R+ A  A R+++
Sbjct  97   GEYPQRIGQPECQYYLKTGTCKFGATCKFHHP--REKAAMATRVQL  140


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIA  434
            YP+R  E +C+YY+RTG C+FG++C+F+HP    + +A
Sbjct  145  YPLRANEKECAYYLRTGQCKFGSTCKFHHPQPSTMMVA  182


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/56 (45%), Positives = 35/56 (63%), Gaps = 3/56 (5%)
 Frame = +1

Query  556  YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  723
            +P RP+  EC +YM+TG CKFG+ CKFHHP+   +  P   + A  P+  P  PG+
Sbjct  307  FPERPDQPECQFYMKTGDCKFGAVCKFHHPRERIIPTP---NCALSPLGLPLRPGE  359



>gb|ACN40302.1| unknown [Picea sitchensis]
Length=468

 Score =   154 bits (390),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 69/91 (76%), Positives = 79/91 (87%), Gaps = 0/91 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG+CKFGATCKFHHPRDKAG  GR  +NV GYPLRPN+ EC YYMRTGQCK+G+T
Sbjct  115  QYYLKTGSCKFGATCKFHHPRDKAGSTGRAVINVYGYPLRPNEKECAYYMRTGQCKYGAT  174

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTPG  720
            CKFHHPQP + +VP+RGS  + PVHSPTTPG
Sbjct  175  CKFHHPQPVSTLVPVRGSSLFTPVHSPTTPG  205


 Score = 86.7 bits (213),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 41/64 (64%), Positives = 48/64 (75%), Gaps = 3/64 (5%)
 Frame = +3

Query  267  ETLWQLSLRSM-ETMES--GTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAA  437
            E +WQ+SL+   E ME+  G +P R GEPDC+YY+RTGLC FG SCRFNHP NRK A AA
Sbjct  39   EAMWQMSLQQQHENMEAEVGPFPERPGEPDCTYYMRTGLCGFGMSCRFNHPPNRKQAAAA  98

Query  438  ARMK  449
            AR K
Sbjct  99   ARNK  102


 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 45/66 (68%), Gaps = 0/66 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y+KTG CKFG TC++HHP+++        LN LG PLRP    C ++ R G CKFG+T
Sbjct  332  QFYMKTGDCKFGMTCRYHHPKERIIPVPNCVLNSLGLPLRPGAPACTFFTRYGICKFGAT  391

Query  628  CKFHHP  645
            CKF HP
Sbjct  392  CKFDHP  397


 Score = 56.6 bits (135),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 21/46 (46%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = +3

Query  315  GTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKV  452
            G YP R G+P+C YY++TG C+FGA+C+F+HP ++  +   A + V
Sbjct  103  GEYPERLGQPECQYYLKTGSCKFGATCKFHHPRDKAGSTGRAVINV  148


 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 20/38 (53%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = +1

Query  556  YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVP  669
            +P RP   EC +YM+TG CKFG TC++HHP+   + VP
Sbjct  322  FPERPGQQECQFYMKTGDCKFGMTCRYHHPKERIIPVP  359



>ref|XP_008676803.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|ACN28340.1| unknown [Zea mays]
 gb|AFW60816.1| hypothetical protein ZEAMMB73_909252 [Zea mays]
Length=441

 Score =   145 bits (367),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 69/92 (75%), Positives = 76/92 (83%), Gaps = 1/92 (1%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFGATCKFHHPR+KA +A RV LN LGYPLRPN+ EC YY+RTGQCKFGST
Sbjct  104  QYYLKTGTCKFGATCKFHHPREKAAMATRVQLNELGYPLRPNEKECAYYLRTGQCKFGST  163

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  723
            CKFHH QPS MMV +RGS  Y P  S T+PGQ
Sbjct  164  CKFHHSQPSTMMVAVRGS-VYSPGQSATSPGQ  194


 Score = 94.7 bits (234),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 51/61 (84%), Gaps = 2/61 (3%)
 Frame = +3

Query  267  ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARM  446
            E +WQ++L   E ME G YP R GEPDCSYY+RTG+CRFG +C+FNHP++RKLA+AAARM
Sbjct  33   EAMWQMNLE--EAMELGPYPERVGEPDCSYYMRTGMCRFGMTCKFNHPADRKLAVAAARM  90

Query  447  K  449
            K
Sbjct  91   K  91


 Score = 82.4 bits (202),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 38/71 (54%), Positives = 47/71 (66%), Gaps = 0/71 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y+KTG CKFGA CKFHHPR++       AL+ LG PLRP +  C +Y R G CKFG  
Sbjct  311  QFYMKTGDCKFGAVCKFHHPRERIIPTPNCALSPLGLPLRPGEPICSFYNRYGMCKFGPN  370

Query  628  CKFHHPQPSNM  660
            CKF HP  + M
Sbjct  371  CKFDHPMGNAM  381


 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 23/46 (50%), Positives = 35/46 (76%), Gaps = 2/46 (4%)
 Frame = +3

Query  315  GTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKV  452
            G YP R G+P+C YY++TG C+FGA+C+F+HP  R+ A  A R+++
Sbjct  92   GEYPQRIGQPECQYYLKTGTCKFGATCKFHHP--REKAAMATRVQL  135


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/56 (45%), Positives = 35/56 (63%), Gaps = 3/56 (5%)
 Frame = +1

Query  556  YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  723
            +P RP+  EC +YM+TG CKFG+ CKFHHP+   +  P   + A  P+  P  PG+
Sbjct  301  FPERPDQPECQFYMKTGDCKFGAVCKFHHPRERIIPTP---NCALSPLGLPLRPGE  353



>ref|NP_001141157.1| hypothetical protein [Zea mays]
 gb|ACF85576.1| unknown [Zea mays]
 gb|ACN34349.1| unknown [Zea mays]
 gb|AFT82654.1| C3H11 C3H type transcription factor, partial [Zea mays subsp. 
mays]
 gb|AFW60815.1| hypothetical protein ZEAMMB73_909252 [Zea mays]
Length=443

 Score =   145 bits (367),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 69/92 (75%), Positives = 76/92 (83%), Gaps = 1/92 (1%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFGATCKFHHPR+KA +A RV LN LGYPLRPN+ EC YY+RTGQCKFGST
Sbjct  106  QYYLKTGTCKFGATCKFHHPREKAAMATRVQLNELGYPLRPNEKECAYYLRTGQCKFGST  165

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  723
            CKFHH QPS MMV +RGS  Y P  S T+PGQ
Sbjct  166  CKFHHSQPSTMMVAVRGS-VYSPGQSATSPGQ  196


 Score = 95.1 bits (235),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 51/61 (84%), Gaps = 2/61 (3%)
 Frame = +3

Query  267  ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARM  446
            E +WQ++L   E ME G YP R GEPDCSYY+RTG+CRFG +C+FNHP++RKLA+AAARM
Sbjct  35   EAMWQMNLE--EAMELGPYPERVGEPDCSYYMRTGMCRFGMTCKFNHPADRKLAVAAARM  92

Query  447  K  449
            K
Sbjct  93   K  93


 Score = 82.4 bits (202),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 38/71 (54%), Positives = 47/71 (66%), Gaps = 0/71 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y+KTG CKFGA CKFHHPR++       AL+ LG PLRP +  C +Y R G CKFG  
Sbjct  313  QFYMKTGDCKFGAVCKFHHPRERIIPTPNCALSPLGLPLRPGEPICSFYNRYGMCKFGPN  372

Query  628  CKFHHPQPSNM  660
            CKF HP  + M
Sbjct  373  CKFDHPMGNAM  383


 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 23/46 (50%), Positives = 35/46 (76%), Gaps = 2/46 (4%)
 Frame = +3

Query  315  GTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKV  452
            G YP R G+P+C YY++TG C+FGA+C+F+HP  R+ A  A R+++
Sbjct  94   GEYPQRIGQPECQYYLKTGTCKFGATCKFHHP--REKAAMATRVQL  137


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/56 (45%), Positives = 35/56 (63%), Gaps = 3/56 (5%)
 Frame = +1

Query  556  YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  723
            +P RP+  EC +YM+TG CKFG+ CKFHHP+   +  P   + A  P+  P  PG+
Sbjct  303  FPERPDQPECQFYMKTGDCKFGAVCKFHHPRERIIPTP---NCALSPLGLPLRPGE  355



>gb|ABG22481.1| Zinc finger CCCH type domain containing protein ZFN, putative, 
expressed [Oryza sativa Japonica Group]
 gb|EEC68139.1| hypothetical protein OsI_36059 [Oryza sativa Indica Group]
Length=406

 Score =   147 bits (371),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 70/92 (76%), Positives = 76/92 (83%), Gaps = 1/92 (1%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFGATCKFHHPR+KA IA RV LN LGYPLRPN+ EC YY+RTGQCKFGST
Sbjct  70   QYYLKTGTCKFGATCKFHHPREKAAIATRVQLNALGYPLRPNEKECAYYLRTGQCKFGST  129

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  723
            CKFHHPQPSN MV +RGS  Y P  S T+P Q
Sbjct  130  CKFHHPQPSNTMVAVRGS-VYSPGQSVTSPSQ  160


 Score = 93.2 bits (230),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 51/59 (86%), Gaps = 2/59 (3%)
 Frame = +3

Query  273  LWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMK  449
            +WQ++L   E ME+G YP R GEPDCSYY+RTGLCRFG +C+FNHP++RK+A+AAARMK
Sbjct  1    MWQMNLG--EAMEAGPYPERIGEPDCSYYMRTGLCRFGMTCKFNHPADRKMAVAAARMK  57


 Score = 80.9 bits (198),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 44/102 (43%), Positives = 56/102 (55%), Gaps = 9/102 (9%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y+KTG CKFGA CKFHHP+++       AL+ LG PLRP +  C +Y R G CKFG  
Sbjct  278  QFYMKTGDCKFGAVCKFHHPKERIIPTPNCALSSLGLPLRPGEPICTFYSRYGICKFGPN  337

Query  628  CKFHHPQPSNMM---------VPLRGSPAYPPVHSPTTPGQL  726
            CKF HP  + M          V  R   A  P HS  +P  +
Sbjct  338  CKFDHPMGTVMYGLATSPTGDVSARRMLAPVPAHSEVSPDNV  379


 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 23/46 (50%), Positives = 35/46 (76%), Gaps = 2/46 (4%)
 Frame = +3

Query  315  GTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKV  452
            G YP R G+P+C YY++TG C+FGA+C+F+HP  R+ A  A R+++
Sbjct  58   GEYPQRIGQPECQYYLKTGTCKFGATCKFHHP--REKAAIATRVQL  101


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/39 (51%), Positives = 31/39 (79%), Gaps = 2/39 (5%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNH--PSNRKLAI  431
            YP+R  E +C+YY+RTG C+FG++C+F+H  PSN  +A+
Sbjct  106  YPLRPNEKECAYYLRTGQCKFGSTCKFHHPQPSNTMVAV  144


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 32/50 (64%), Gaps = 10/50 (20%)
 Frame = +1

Query  556  YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQP----------SNMMVPLR  675
            +P RP+  EC +YM+TG CKFG+ CKFHHP+           S++ +PLR
Sbjct  268  FPERPDQPECQFYMKTGDCKFGAVCKFHHPKERIIPTPNCALSSLGLPLR  317



>ref|XP_009416573.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=444

 Score =   160 bits (404),  Expect(2) = 3e-54, Method: Compositional matrix adjust.
 Identities = 72/92 (78%), Positives = 81/92 (88%), Gaps = 0/92 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFGA CKFHHP++KAGIAGRV LN+LGYPLR N+ +C YY+RTG+CKFG T
Sbjct  104  QYYLKTGTCKFGAICKFHHPKEKAGIAGRVQLNILGYPLRLNEKDCAYYIRTGECKFGGT  163

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  723
            CKFHHPQPSN +V LRGSP YP VHSPTTPGQ
Sbjct  164  CKFHHPQPSNAVVALRGSPVYPAVHSPTTPGQ  195


 Score = 79.7 bits (195),  Expect(2) = 3e-54, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 49/62 (79%), Gaps = 1/62 (2%)
 Frame = +3

Query  267  ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARM  446
            E +W+  +R  ++ME+G YP R GEPDC+YYIRTGLCRFG +C+FNHP NR LA+AAA  
Sbjct  30   EAMWK-RMRESDSMETGPYPERPGEPDCAYYIRTGLCRFGRTCKFNHPPNRMLAVAAAAA  88

Query  447  KV  452
            ++
Sbjct  89   RI  90


 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 44/66 (67%), Gaps = 0/66 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y+KTG CKFGA CKFHHP+++        L+ LG PLRP +  C +Y R G CKFG  
Sbjct  309  QFYMKTGDCKFGAVCKFHHPKERLVPVPNCVLSPLGLPLRPGEPVCVFYSRYGICKFGPN  368

Query  628  CKFHHP  645
            CKF HP
Sbjct  369  CKFDHP  374


 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 20/47 (43%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +3

Query  315  GTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKVL  455
            G YP R G+P+C YY++TG C+FGA C+F+HP  +       ++ +L
Sbjct  92   GGYPERVGQPECQYYLKTGTCKFGAICKFHHPKEKAGIAGRVQLNIL  138


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 20/38 (53%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIA  434
            YP+R  E DC+YYIRTG C+FG +C+F+HP      +A
Sbjct  140  YPLRLNEKDCAYYIRTGECKFGGTCKFHHPQPSNAVVA  177


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 40/73 (55%), Gaps = 5/73 (7%)
 Frame = +1

Query  460  KTGACKFGATCKFHHPRDKAGIAGRVAL---NVLGYPLRPNDIECPYYMRTGQCKFGSTC  630
            + G    GA  KF   R  +   G  A+   N+  +P RP   EC +YM+TG CKFG+ C
Sbjct  266  QQGETSIGAQGKFPSYRPGSTPMGLYAVPGENI--FPERPGQPECQFYMKTGDCKFGAVC  323

Query  631  KFHHPQPSNMMVP  669
            KFHHP+   + VP
Sbjct  324  KFHHPKERLVPVP  336


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 30/45 (67%), Gaps = 0/45 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKVL  455
            +P R G+P+C +Y++TG C+FGA C+F+HP  R + +    +  L
Sbjct  299  FPERPGQPECQFYMKTGDCKFGAVCKFHHPKERLVPVPNCVLSPL  343



>ref|XP_009416574.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=442

 Score =   159 bits (403),  Expect(2) = 3e-54, Method: Compositional matrix adjust.
 Identities = 72/92 (78%), Positives = 81/92 (88%), Gaps = 0/92 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFGA CKFHHP++KAGIAGRV LN+LGYPLR N+ +C YY+RTG+CKFG T
Sbjct  104  QYYLKTGTCKFGAICKFHHPKEKAGIAGRVQLNILGYPLRLNEKDCAYYIRTGECKFGGT  163

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  723
            CKFHHPQPSN +V LRGSP YP VHSPTTPGQ
Sbjct  164  CKFHHPQPSNAVVALRGSPVYPAVHSPTTPGQ  195


 Score = 80.1 bits (196),  Expect(2) = 3e-54, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 49/62 (79%), Gaps = 1/62 (2%)
 Frame = +3

Query  267  ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARM  446
            E +W+  +R  ++ME+G YP R GEPDC+YYIRTGLCRFG +C+FNHP NR LA+AAA  
Sbjct  30   EAMWK-RMRESDSMETGPYPERPGEPDCAYYIRTGLCRFGRTCKFNHPPNRMLAVAAAAA  88

Query  447  KV  452
            ++
Sbjct  89   RI  90


 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 44/66 (67%), Gaps = 0/66 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y+KTG CKFGA CKFHHP+++        L+ LG PLRP +  C +Y R G CKFG  
Sbjct  307  QFYMKTGDCKFGAVCKFHHPKERLVPVPNCVLSPLGLPLRPGEPVCVFYSRYGICKFGPN  366

Query  628  CKFHHP  645
            CKF HP
Sbjct  367  CKFDHP  372


 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 20/47 (43%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +3

Query  315  GTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKVL  455
            G YP R G+P+C YY++TG C+FGA C+F+HP  +       ++ +L
Sbjct  92   GGYPERVGQPECQYYLKTGTCKFGAICKFHHPKEKAGIAGRVQLNIL  138


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 20/38 (53%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIA  434
            YP+R  E DC+YYIRTG C+FG +C+F+HP      +A
Sbjct  140  YPLRLNEKDCAYYIRTGECKFGGTCKFHHPQPSNAVVA  177


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 40/73 (55%), Gaps = 5/73 (7%)
 Frame = +1

Query  460  KTGACKFGATCKFHHPRDKAGIAGRVAL---NVLGYPLRPNDIECPYYMRTGQCKFGSTC  630
            + G    GA  KF   R  +   G  A+   N+  +P RP   EC +YM+TG CKFG+ C
Sbjct  264  QQGETSIGAQGKFPSYRPGSTPMGLYAVPGENI--FPERPGQPECQFYMKTGDCKFGAVC  321

Query  631  KFHHPQPSNMMVP  669
            KFHHP+   + VP
Sbjct  322  KFHHPKERLVPVP  334


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 30/45 (67%), Gaps = 0/45 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKVL  455
            +P R G+P+C +Y++TG C+FGA C+F+HP  R + +    +  L
Sbjct  297  FPERPGQPECQFYMKTGDCKFGAVCKFHHPKERLVPVPNCVLSPL  341



>ref|XP_004979251.1| PREDICTED: zinc finger CCCH domain-containing protein 63-like 
isoform X1 [Setaria italica]
Length=450

 Score =   146 bits (369),  Expect(2) = 5e-54, Method: Compositional matrix adjust.
 Identities = 69/92 (75%), Positives = 76/92 (83%), Gaps = 1/92 (1%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFGATCKFHHPR+KA +A RV LN LGYP RPN+ EC YY+RTGQCKFGST
Sbjct  113  QYYLKTGTCKFGATCKFHHPREKAAMATRVQLNELGYPFRPNEKECAYYLRTGQCKFGST  172

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  723
            CKFHHPQPS MMV +RGS  Y P  S T+PGQ
Sbjct  173  CKFHHPQPSTMMVAVRGS-GYSPGQSATSPGQ  203


 Score = 92.4 bits (228),  Expect(2) = 5e-54, Method: Compositional matrix adjust.
 Identities = 40/61 (66%), Positives = 51/61 (84%), Gaps = 2/61 (3%)
 Frame = +3

Query  267  ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARM  446
            E +WQ++L   E +E G YP R GEPDCSYY+RTG+CRFG +C+FNHP++RKLA+AAARM
Sbjct  42   EAMWQMNLG--EAVELGPYPERVGEPDCSYYMRTGMCRFGMTCKFNHPADRKLAVAAARM  99

Query  447  K  449
            K
Sbjct  100  K  100


 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 45/66 (68%), Gaps = 0/66 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y+KTG CKFGA CKFHHPR++       AL+ LG PLRP +  C +Y R G CKFG  
Sbjct  321  QFYMKTGDCKFGAVCKFHHPRERIIPTPNCALSSLGLPLRPGEPICSFYSRYGMCKFGPN  380

Query  628  CKFHHP  645
            CKF HP
Sbjct  381  CKFDHP  386


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/46 (50%), Positives = 35/46 (76%), Gaps = 2/46 (4%)
 Frame = +3

Query  315  GTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKV  452
            G YP R G+P+C YY++TG C+FGA+C+F+HP  R+ A  A R+++
Sbjct  101  GEYPQRSGQPECQYYLKTGTCKFGATCKFHHP--REKAAMATRVQL  144


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIA  434
            YP R  E +C+YY+RTG C+FG++C+F+HP    + +A
Sbjct  149  YPFRPNEKECAYYLRTGQCKFGSTCKFHHPQPSTMMVA  186


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 32/50 (64%), Gaps = 10/50 (20%)
 Frame = +1

Query  556  YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQP----------SNMMVPLR  675
            +P RP+  EC +YM+TG CKFG+ CKFHHP+           S++ +PLR
Sbjct  311  FPERPDQPECQFYMKTGDCKFGAVCKFHHPRERIIPTPNCALSSLGLPLR  360



>ref|XP_004979252.1| PREDICTED: zinc finger CCCH domain-containing protein 63-like 
isoform X2 [Setaria italica]
Length=448

 Score =   146 bits (369),  Expect(2) = 5e-54, Method: Compositional matrix adjust.
 Identities = 69/92 (75%), Positives = 76/92 (83%), Gaps = 1/92 (1%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFGATCKFHHPR+KA +A RV LN LGYP RPN+ EC YY+RTGQCKFGST
Sbjct  111  QYYLKTGTCKFGATCKFHHPREKAAMATRVQLNELGYPFRPNEKECAYYLRTGQCKFGST  170

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  723
            CKFHHPQPS MMV +RGS  Y P  S T+PGQ
Sbjct  171  CKFHHPQPSTMMVAVRGS-GYSPGQSATSPGQ  201


 Score = 92.4 bits (228),  Expect(2) = 5e-54, Method: Compositional matrix adjust.
 Identities = 40/61 (66%), Positives = 51/61 (84%), Gaps = 2/61 (3%)
 Frame = +3

Query  267  ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARM  446
            E +WQ++L   E +E G YP R GEPDCSYY+RTG+CRFG +C+FNHP++RKLA+AAARM
Sbjct  40   EAMWQMNLG--EAVELGPYPERVGEPDCSYYMRTGMCRFGMTCKFNHPADRKLAVAAARM  97

Query  447  K  449
            K
Sbjct  98   K  98


 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 45/66 (68%), Gaps = 0/66 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y+KTG CKFGA CKFHHPR++       AL+ LG PLRP +  C +Y R G CKFG  
Sbjct  319  QFYMKTGDCKFGAVCKFHHPRERIIPTPNCALSSLGLPLRPGEPICSFYSRYGMCKFGPN  378

Query  628  CKFHHP  645
            CKF HP
Sbjct  379  CKFDHP  384


 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/46 (50%), Positives = 35/46 (76%), Gaps = 2/46 (4%)
 Frame = +3

Query  315  GTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKV  452
            G YP R G+P+C YY++TG C+FGA+C+F+HP  R+ A  A R+++
Sbjct  99   GEYPQRSGQPECQYYLKTGTCKFGATCKFHHP--REKAAMATRVQL  142


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIA  434
            YP R  E +C+YY+RTG C+FG++C+F+HP    + +A
Sbjct  147  YPFRPNEKECAYYLRTGQCKFGSTCKFHHPQPSTMMVA  184


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 32/50 (64%), Gaps = 10/50 (20%)
 Frame = +1

Query  556  YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQP----------SNMMVPLR  675
            +P RP+  EC +YM+TG CKFG+ CKFHHP+           S++ +PLR
Sbjct  309  FPERPDQPECQFYMKTGDCKFGAVCKFHHPRERIIPTPNCALSSLGLPLR  358



>ref|XP_004495537.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X1 [Cicer arietinum]
Length=389

 Score =   147 bits (372),  Expect(2) = 6e-54, Method: Compositional matrix adjust.
 Identities = 69/90 (77%), Positives = 80/90 (89%), Gaps = 2/90 (2%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++YLKTG CKFGATCKFHHPRD+AGI+GRVALN+LGYPLRP + EC YY+RTG+CKFG+T
Sbjct  92   QFYLKTGTCKFGATCKFHHPRDQAGISGRVALNILGYPLRPTEAECSYYLRTGECKFGNT  151

Query  628  CKFHHPQPS-NMMVPLRGSPAY-PPVHSPT  711
            CKFHHPQPS NM +PL+GSP Y   VHSPT
Sbjct  152  CKFHHPQPSNNMTIPLKGSPIYLSTVHSPT  181


 Score = 90.9 bits (224),  Expect(2) = 6e-54, Method: Compositional matrix adjust.
 Identities = 42/60 (70%), Positives = 47/60 (78%), Gaps = 1/60 (2%)
 Frame = +3

Query  270  TLWQLSLRSMET-MESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARM  446
            +LW + LRS +T M+S  YP R GEPDCSYYIRTGLCRFGA+CRFNHP N  LAI  ARM
Sbjct  19   SLWMMKLRSTQTFMDSQFYPHRPGEPDCSYYIRTGLCRFGATCRFNHPPNANLAIVTARM  78


 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 43/67 (64%), Gaps = 1/67 (1%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDK-AGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGS  624
            ++Y+KTG CKFGA C+FHHP  +   +     L+ LG PLR  +  C +Y R G CKFG 
Sbjct  250  QFYMKTGDCKFGAVCRFHHPHQRLIPVPPDCLLSSLGLPLRHGEPLCVFYSRYGICKFGP  309

Query  625  TCKFHHP  645
            +CKF HP
Sbjct  310  SCKFDHP  316


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 18/37 (49%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAI  431
            +P R G+P+C +Y++TG C+FGA CRF+HP  R + +
Sbjct  240  FPDRPGQPECQFYMKTGDCKFGAVCRFHHPHQRLIPV  276


 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +1

Query  556  YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMV  666
            YP RP + +C YY+RTG C+FG+TC+F+HP  +N+ +
Sbjct  37   YPHRPGEPDCSYYIRTGLCRFGATCRFNHPPNANLAI  73



>ref|XP_006663970.1| PREDICTED: zinc finger CCCH domain-containing protein 66-like 
isoform X2 [Oryza brachyantha]
Length=409

 Score =   147 bits (371),  Expect(2) = 8e-54, Method: Compositional matrix adjust.
 Identities = 69/92 (75%), Positives = 77/92 (84%), Gaps = 1/92 (1%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFGATCKFHHPR+KA +A RV LNVLGYP+RPN+ EC YY+RTGQCKF ST
Sbjct  73   QYYLKTGTCKFGATCKFHHPREKAALATRVQLNVLGYPMRPNEKECAYYLRTGQCKFAST  132

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  723
            CKFHHPQPSN MV +RGS  Y P  S T+PGQ
Sbjct  133  CKFHHPQPSNTMVSMRGS-MYSPGQSATSPGQ  163


 Score = 91.3 bits (225),  Expect(2) = 8e-54, Method: Compositional matrix adjust.
 Identities = 41/60 (68%), Positives = 49/60 (82%), Gaps = 1/60 (2%)
 Frame = +3

Query  273  LWQLSLRSM-ETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMK  449
            +WQ++L    E+MES  YP R GEPDCSYY+RTGLCRFG +C+FNHP NRKLA+AAARM 
Sbjct  1    MWQMTLGGGGESMESVPYPERIGEPDCSYYMRTGLCRFGMTCKFNHPPNRKLAVAAARMN  60


 Score = 84.0 bits (206),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 39/71 (55%), Positives = 48/71 (68%), Gaps = 0/71 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y+KTG CKFGA CKFHHP+++   A   ALN LG PLRP +  C +Y R G CKFG  
Sbjct  280  QFYMKTGDCKFGAVCKFHHPKERLVPAPNCALNSLGLPLRPGEPVCTFYSRYGICKFGPN  339

Query  628  CKFHHPQPSNM  660
            CKF HP  + M
Sbjct  340  CKFDHPMGTLM  350


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 21/48 (44%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = +3

Query  312  SGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKVL  455
            +G YP R G+P+C YY++TG C+FGA+C+F+HP  +       ++ VL
Sbjct  60   NGEYPYRVGQPECQYYLKTGTCKFGATCKFHHPREKAALATRVQLNVL  107


 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +1

Query  556  YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQ  648
            +P RP+  EC +YM+TG CKFG+ CKFHHP+
Sbjct  270  FPERPDQPECQFYMKTGDCKFGAVCKFHHPK  300



>ref|XP_008676804.1| PREDICTED: hypothetical protein isoform X2 [Zea mays]
 gb|AFW60817.1| hypothetical protein ZEAMMB73_909252 [Zea mays]
Length=407

 Score =   145 bits (366),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 69/92 (75%), Positives = 76/92 (83%), Gaps = 1/92 (1%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFGATCKFHHPR+KA +A RV LN LGYPLRPN+ EC YY+RTGQCKFGST
Sbjct  70   QYYLKTGTCKFGATCKFHHPREKAAMATRVQLNELGYPLRPNEKECAYYLRTGQCKFGST  129

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  723
            CKFHH QPS MMV +RGS  Y P  S T+PGQ
Sbjct  130  CKFHHSQPSTMMVAVRGS-VYSPGQSATSPGQ  160


 Score = 92.4 bits (228),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 50/59 (85%), Gaps = 2/59 (3%)
 Frame = +3

Query  273  LWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMK  449
            +WQ++L   E ME G YP R GEPDCSYY+RTG+CRFG +C+FNHP++RKLA+AAARMK
Sbjct  1    MWQMNLE--EAMELGPYPERVGEPDCSYYMRTGMCRFGMTCKFNHPADRKLAVAAARMK  57


 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 38/71 (54%), Positives = 47/71 (66%), Gaps = 0/71 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y+KTG CKFGA CKFHHPR++       AL+ LG PLRP +  C +Y R G CKFG  
Sbjct  277  QFYMKTGDCKFGAVCKFHHPRERIIPTPNCALSPLGLPLRPGEPICSFYNRYGMCKFGPN  336

Query  628  CKFHHPQPSNM  660
            CKF HP  + M
Sbjct  337  CKFDHPMGNAM  347


 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 23/46 (50%), Positives = 35/46 (76%), Gaps = 2/46 (4%)
 Frame = +3

Query  315  GTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKV  452
            G YP R G+P+C YY++TG C+FGA+C+F+HP  R+ A  A R+++
Sbjct  58   GEYPQRIGQPECQYYLKTGTCKFGATCKFHHP--REKAAMATRVQL  101


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/56 (45%), Positives = 35/56 (63%), Gaps = 3/56 (5%)
 Frame = +1

Query  556  YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  723
            +P RP+  EC +YM+TG CKFG+ CKFHHP+   +  P   + A  P+  P  PG+
Sbjct  267  FPERPDQPECQFYMKTGDCKFGAVCKFHHPRERIIPTP---NCALSPLGLPLRPGE  319



>ref|XP_010501847.1| PREDICTED: zinc finger CCCH domain-containing protein 33-like 
isoform X1 [Camelina sativa]
Length=402

 Score =   135 bits (341),  Expect(2) = 3e-53, Method: Compositional matrix adjust.
 Identities = 60/84 (71%), Positives = 72/84 (86%), Gaps = 2/84 (2%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFG TCKFHHPR+KAGIAGRV+LN+LGYPLR N+++C Y++RTG CKFG T
Sbjct  92   EYYLKTGTCKFGVTCKFHHPRNKAGIAGRVSLNMLGYPLRSNEVDCAYFLRTGHCKFGGT  151

Query  628  CKFHH--PQPSNMMVPLRGSPAYP  693
            CKF+H  PQP+NMMVP  G  +YP
Sbjct  152  CKFNHPQPQPTNMMVPTSGQQSYP  175


 Score =   100 bits (250),  Expect(2) = 3e-53, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 53/61 (87%), Gaps = 0/61 (0%)
 Frame = +3

Query  267  ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARM  446
            + +WQ++L S ETME+G+YP R GEPDCSYYIRTGLCRFG++CRFNHP +R+L IA ARM
Sbjct  19   DAMWQMNLGSEETMETGSYPERPGEPDCSYYIRTGLCRFGSTCRFNHPRDRELVIATARM  78

Query  447  K  449
            +
Sbjct  79   R  79


 Score = 80.1 bits (196),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 44/66 (67%), Gaps = 0/66 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y+KTG CKFG  CKFHHPRD+        L+ +G PLRP +  C +Y R G CKFG +
Sbjct  282  QFYMKTGDCKFGTVCKFHHPRDRQAPPPDCLLSSIGLPLRPGEPLCVFYTRYGICKFGPS  341

Query  628  CKFHHP  645
            CKF HP
Sbjct  342  CKFDHP  347


 Score = 80.1 bits (196),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 34/67 (51%), Positives = 46/67 (69%), Gaps = 1/67 (1%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
             YY++TG C+FG+TC+F+HPRD+  +     +    YP R    EC YY++TG CKFG T
Sbjct  47   SYYIRTGLCRFGSTCRFNHPRDRELVIATARMRGE-YPERIGQPECEYYLKTGTCKFGVT  105

Query  628  CKFHHPQ  648
            CKFHHP+
Sbjct  106  CKFHHPR  112


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 32/51 (63%), Gaps = 0/51 (0%)
 Frame = +1

Query  514  KAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMV  666
            +  +     +    YP RP + +C YY+RTG C+FGSTC+F+HP+   +++
Sbjct  23   QMNLGSEETMETGSYPERPGEPDCSYYIRTGLCRFGSTCRFNHPRDRELVI  73


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 18/30 (60%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHP  410
            YP+R  E DC+Y++RTG C+FG +C+FNHP
Sbjct  128  YPLRSNEVDCAYFLRTGHCKFGGTCKFNHP  157


 Score = 50.1 bits (118),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 24/31 (77%), Gaps = 0/31 (0%)
 Frame = +1

Query  556  YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQ  648
            +P RP   EC +YM+TG CKFG+ CKFHHP+
Sbjct  272  FPERPGQPECQFYMKTGDCKFGTVCKFHHPR  302



>ref|XP_010501886.1| PREDICTED: zinc finger CCCH domain-containing protein 33-like 
isoform X2 [Camelina sativa]
Length=400

 Score =   135 bits (341),  Expect(2) = 3e-53, Method: Compositional matrix adjust.
 Identities = 60/84 (71%), Positives = 72/84 (86%), Gaps = 2/84 (2%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFG TCKFHHPR+KAGIAGRV+LN+LGYPLR N+++C Y++RTG CKFG T
Sbjct  92   EYYLKTGTCKFGVTCKFHHPRNKAGIAGRVSLNMLGYPLRSNEVDCAYFLRTGHCKFGGT  151

Query  628  CKFHH--PQPSNMMVPLRGSPAYP  693
            CKF+H  PQP+NMMVP  G  +YP
Sbjct  152  CKFNHPQPQPTNMMVPTSGQQSYP  175


 Score =   100 bits (250),  Expect(2) = 3e-53, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 53/61 (87%), Gaps = 0/61 (0%)
 Frame = +3

Query  267  ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARM  446
            + +WQ++L S ETME+G+YP R GEPDCSYYIRTGLCRFG++CRFNHP +R+L IA ARM
Sbjct  19   DAMWQMNLGSEETMETGSYPERPGEPDCSYYIRTGLCRFGSTCRFNHPRDRELVIATARM  78

Query  447  K  449
            +
Sbjct  79   R  79


 Score = 80.1 bits (196),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 44/66 (67%), Gaps = 0/66 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y+KTG CKFG  CKFHHPRD+        L+ +G PLRP +  C +Y R G CKFG +
Sbjct  280  QFYMKTGDCKFGTVCKFHHPRDRQAPPPDCLLSSIGLPLRPGEPLCVFYTRYGICKFGPS  339

Query  628  CKFHHP  645
            CKF HP
Sbjct  340  CKFDHP  345


 Score = 80.1 bits (196),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 34/67 (51%), Positives = 46/67 (69%), Gaps = 1/67 (1%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
             YY++TG C+FG+TC+F+HPRD+  +     +    YP R    EC YY++TG CKFG T
Sbjct  47   SYYIRTGLCRFGSTCRFNHPRDRELVIATARMRGE-YPERIGQPECEYYLKTGTCKFGVT  105

Query  628  CKFHHPQ  648
            CKFHHP+
Sbjct  106  CKFHHPR  112


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 32/51 (63%), Gaps = 0/51 (0%)
 Frame = +1

Query  514  KAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMV  666
            +  +     +    YP RP + +C YY+RTG C+FGSTC+F+HP+   +++
Sbjct  23   QMNLGSEETMETGSYPERPGEPDCSYYIRTGLCRFGSTCRFNHPRDRELVI  73


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 18/30 (60%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHP  410
            YP+R  E DC+Y++RTG C+FG +C+FNHP
Sbjct  128  YPLRSNEVDCAYFLRTGHCKFGGTCKFNHP  157


 Score = 50.1 bits (118),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 24/31 (77%), Gaps = 0/31 (0%)
 Frame = +1

Query  556  YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQ  648
            +P RP   EC +YM+TG CKFG+ CKFHHP+
Sbjct  270  FPERPGQPECQFYMKTGDCKFGTVCKFHHPR  300



>ref|NP_566183.1| zinc finger protein 1 [Arabidopsis thaliana]
 sp|Q8GXX7.1|C3H33_ARATH RecName: Full=Zinc finger CCCH domain-containing protein 33; 
Short=AtC3H33; AltName: Full=Zinc finger CCCH domain-containing 
protein ZFN1 [Arabidopsis thaliana]
 dbj|BAC42614.1| putative zinc finger protein 1 zfn1 [Arabidopsis thaliana]
 gb|ABG25055.1| At3g02830 [Arabidopsis thaliana]
 gb|AEE73864.1| zinc finger protein 1 [Arabidopsis thaliana]
Length=397

 Score =   135 bits (341),  Expect(2) = 3e-53, Method: Compositional matrix adjust.
 Identities = 60/84 (71%), Positives = 72/84 (86%), Gaps = 2/84 (2%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFG TCKFHHPR+KAGIAGRV+LN+LGYPLR N+++C Y++RTG CKFG T
Sbjct  92   EYYLKTGTCKFGVTCKFHHPRNKAGIAGRVSLNMLGYPLRSNEVDCAYFLRTGHCKFGGT  151

Query  628  CKFHH--PQPSNMMVPLRGSPAYP  693
            CKF+H  PQP+NMMVP  G  +YP
Sbjct  152  CKFNHPQPQPTNMMVPTSGQQSYP  175


 Score =   100 bits (250),  Expect(2) = 3e-53, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 53/61 (87%), Gaps = 0/61 (0%)
 Frame = +3

Query  267  ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARM  446
            + +WQ++L S ETME+G+YP R GEPDCSYYIRTGLCRFG++CRFNHP +R+L IA ARM
Sbjct  19   DAMWQMNLSSDETMETGSYPERPGEPDCSYYIRTGLCRFGSTCRFNHPRDRELVIATARM  78

Query  447  K  449
            +
Sbjct  79   R  79


 Score = 80.1 bits (196),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 44/66 (67%), Gaps = 0/66 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y+KTG CKFG  CKFHHPRD+        L+ +G PLRP +  C +Y R G CKFG +
Sbjct  281  QFYMKTGDCKFGTVCKFHHPRDRQAPPPDCLLSSIGLPLRPGEPLCVFYTRYGICKFGPS  340

Query  628  CKFHHP  645
            CKF HP
Sbjct  341  CKFDHP  346


 Score = 79.7 bits (195),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 34/67 (51%), Positives = 46/67 (69%), Gaps = 1/67 (1%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
             YY++TG C+FG+TC+F+HPRD+  +     +    YP R    EC YY++TG CKFG T
Sbjct  47   SYYIRTGLCRFGSTCRFNHPRDRELVIATARMRG-EYPERIGQPECEYYLKTGTCKFGVT  105

Query  628  CKFHHPQ  648
            CKFHHP+
Sbjct  106  CKFHHPR  112


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 33/51 (65%), Gaps = 0/51 (0%)
 Frame = +1

Query  514  KAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMV  666
            +  ++    +    YP RP + +C YY+RTG C+FGSTC+F+HP+   +++
Sbjct  23   QMNLSSDETMETGSYPERPGEPDCSYYIRTGLCRFGSTCRFNHPRDRELVI  73


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 18/30 (60%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHP  410
            YP+R  E DC+Y++RTG C+FG +C+FNHP
Sbjct  128  YPLRSNEVDCAYFLRTGHCKFGGTCKFNHP  157



>ref|XP_010485612.1| PREDICTED: zinc finger CCCH domain-containing protein 33 [Camelina 
sativa]
Length=401

 Score =   135 bits (340),  Expect(2) = 4e-53, Method: Compositional matrix adjust.
 Identities = 60/84 (71%), Positives = 72/84 (86%), Gaps = 2/84 (2%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFG TCKFHHPR+KAGIAGRV+LN+LGYPLR N+++C Y++RTG CKFG T
Sbjct  92   EYYLKTGTCKFGVTCKFHHPRNKAGIAGRVSLNMLGYPLRSNEVDCAYFLRTGHCKFGGT  151

Query  628  CKFHH--PQPSNMMVPLRGSPAYP  693
            CKF+H  PQP+NMMVP  G  +YP
Sbjct  152  CKFNHPQPQPTNMMVPTSGQQSYP  175


 Score =   100 bits (249),  Expect(2) = 4e-53, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 53/61 (87%), Gaps = 0/61 (0%)
 Frame = +3

Query  267  ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARM  446
            + +WQ++L S ETME+G+YP R GEPDCSYYIRTGLCRFG++CRFNHP +R+L IA ARM
Sbjct  19   DAMWQMNLGSEETMETGSYPERPGEPDCSYYIRTGLCRFGSTCRFNHPRDRELVIATARM  78

Query  447  K  449
            +
Sbjct  79   R  79


 Score = 79.7 bits (195),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 44/66 (67%), Gaps = 0/66 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y+KTG CKFG  CKFHHPRD+        L+ +G PLRP +  C +Y R G CKFG +
Sbjct  282  QFYMKTGDCKFGTVCKFHHPRDRQAPPPDCLLSSIGLPLRPGEPLCVFYTRYGICKFGPS  341

Query  628  CKFHHP  645
            CKF HP
Sbjct  342  CKFDHP  347


 Score = 79.7 bits (195),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 34/67 (51%), Positives = 46/67 (69%), Gaps = 1/67 (1%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
             YY++TG C+FG+TC+F+HPRD+  +     +    YP R    EC YY++TG CKFG T
Sbjct  47   SYYIRTGLCRFGSTCRFNHPRDRELVIATARMRG-EYPERIGQPECEYYLKTGTCKFGVT  105

Query  628  CKFHHPQ  648
            CKFHHP+
Sbjct  106  CKFHHPR  112


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 32/51 (63%), Gaps = 0/51 (0%)
 Frame = +1

Query  514  KAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMV  666
            +  +     +    YP RP + +C YY+RTG C+FGSTC+F+HP+   +++
Sbjct  23   QMNLGSEETMETGSYPERPGEPDCSYYIRTGLCRFGSTCRFNHPRDRELVI  73


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 18/30 (60%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHP  410
            YP+R  E DC+Y++RTG C+FG +C+FNHP
Sbjct  128  YPLRSNEVDCAYFLRTGHCKFGGTCKFNHP  157



>ref|XP_010463709.1| PREDICTED: zinc finger CCCH domain-containing protein 33-like 
isoform X1 [Camelina sativa]
Length=404

 Score =   135 bits (339),  Expect(2) = 5e-53, Method: Compositional matrix adjust.
 Identities = 60/84 (71%), Positives = 72/84 (86%), Gaps = 2/84 (2%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFG TCKFHHPR+KAGIAGRV+LN+LGYPLR N+++C Y++RTG CKFG T
Sbjct  92   EYYLKTGTCKFGVTCKFHHPRNKAGIAGRVSLNMLGYPLRSNEVDCAYFIRTGHCKFGGT  151

Query  628  CKFHH--PQPSNMMVPLRGSPAYP  693
            CKF+H  PQP+NMMVP  G  +YP
Sbjct  152  CKFNHPQPQPTNMMVPTSGQQSYP  175


 Score =   100 bits (249),  Expect(2) = 5e-53, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 53/61 (87%), Gaps = 0/61 (0%)
 Frame = +3

Query  267  ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARM  446
            + +WQ++L S ETME+G+YP R GEPDCSYYIRTGLCRFG++CRFNHP +R+L IA ARM
Sbjct  19   DAMWQMNLGSEETMETGSYPERPGEPDCSYYIRTGLCRFGSTCRFNHPRDRELVIATARM  78

Query  447  K  449
            +
Sbjct  79   R  79


 Score = 80.1 bits (196),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 44/66 (67%), Gaps = 0/66 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y+KTG CKFG  CKFHHPRD+        L+ +G PLRP +  C +Y R G CKFG +
Sbjct  283  QFYMKTGDCKFGTVCKFHHPRDRQAPPPDCLLSSIGLPLRPGEPLCVFYTRYGICKFGPS  342

Query  628  CKFHHP  645
            CKF HP
Sbjct  343  CKFDHP  348


 Score = 79.7 bits (195),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 34/67 (51%), Positives = 46/67 (69%), Gaps = 1/67 (1%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
             YY++TG C+FG+TC+F+HPRD+  +     +    YP R    EC YY++TG CKFG T
Sbjct  47   SYYIRTGLCRFGSTCRFNHPRDRELVIATARMRG-EYPERIGQPECEYYLKTGTCKFGVT  105

Query  628  CKFHHPQ  648
            CKFHHP+
Sbjct  106  CKFHHPR  112


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 19/30 (63%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHP  410
            YP+R  E DC+Y+IRTG C+FG +C+FNHP
Sbjct  128  YPLRSNEVDCAYFIRTGHCKFGGTCKFNHP  157


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 32/51 (63%), Gaps = 0/51 (0%)
 Frame = +1

Query  514  KAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMV  666
            +  +     +    YP RP + +C YY+RTG C+FGSTC+F+HP+   +++
Sbjct  23   QMNLGSEETMETGSYPERPGEPDCSYYIRTGLCRFGSTCRFNHPRDRELVI  73



>ref|XP_010463710.1| PREDICTED: zinc finger CCCH domain-containing protein 33-like 
isoform X2 [Camelina sativa]
Length=402

 Score =   135 bits (339),  Expect(2) = 5e-53, Method: Compositional matrix adjust.
 Identities = 60/84 (71%), Positives = 72/84 (86%), Gaps = 2/84 (2%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFG TCKFHHPR+KAGIAGRV+LN+LGYPLR N+++C Y++RTG CKFG T
Sbjct  92   EYYLKTGTCKFGVTCKFHHPRNKAGIAGRVSLNMLGYPLRSNEVDCAYFIRTGHCKFGGT  151

Query  628  CKFHH--PQPSNMMVPLRGSPAYP  693
            CKF+H  PQP+NMMVP  G  +YP
Sbjct  152  CKFNHPQPQPTNMMVPTSGQQSYP  175


 Score =   100 bits (249),  Expect(2) = 5e-53, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 53/61 (87%), Gaps = 0/61 (0%)
 Frame = +3

Query  267  ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARM  446
            + +WQ++L S ETME+G+YP R GEPDCSYYIRTGLCRFG++CRFNHP +R+L IA ARM
Sbjct  19   DAMWQMNLGSEETMETGSYPERPGEPDCSYYIRTGLCRFGSTCRFNHPRDRELVIATARM  78

Query  447  K  449
            +
Sbjct  79   R  79


 Score = 80.1 bits (196),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 44/66 (67%), Gaps = 0/66 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y+KTG CKFG  CKFHHPRD+        L+ +G PLRP +  C +Y R G CKFG +
Sbjct  281  QFYMKTGDCKFGTVCKFHHPRDRQAPPPDCLLSSIGLPLRPGEPLCVFYTRYGICKFGPS  340

Query  628  CKFHHP  645
            CKF HP
Sbjct  341  CKFDHP  346


 Score = 79.7 bits (195),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 34/67 (51%), Positives = 46/67 (69%), Gaps = 1/67 (1%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
             YY++TG C+FG+TC+F+HPRD+  +     +    YP R    EC YY++TG CKFG T
Sbjct  47   SYYIRTGLCRFGSTCRFNHPRDRELVIATARMRG-EYPERIGQPECEYYLKTGTCKFGVT  105

Query  628  CKFHHPQ  648
            CKFHHP+
Sbjct  106  CKFHHPR  112


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 19/30 (63%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHP  410
            YP+R  E DC+Y+IRTG C+FG +C+FNHP
Sbjct  128  YPLRSNEVDCAYFIRTGHCKFGGTCKFNHP  157


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 32/51 (63%), Gaps = 0/51 (0%)
 Frame = +1

Query  514  KAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMV  666
            +  +     +    YP RP + +C YY+RTG C+FGSTC+F+HP+   +++
Sbjct  23   QMNLGSEETMETGSYPERPGEPDCSYYIRTGLCRFGSTCRFNHPRDRELVI  73



>gb|AAF26977.1|AC018363_22 zinc finger protein 1 (zfn1) [Arabidopsis thaliana]
Length=377

 Score =   135 bits (340),  Expect(2) = 7e-53, Method: Compositional matrix adjust.
 Identities = 60/84 (71%), Positives = 72/84 (86%), Gaps = 2/84 (2%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFG TCKFHHPR+KAGIAGRV+LN+LGYPLR N+++C Y++RTG CKFG T
Sbjct  72   EYYLKTGTCKFGVTCKFHHPRNKAGIAGRVSLNMLGYPLRSNEVDCAYFLRTGHCKFGGT  131

Query  628  CKFHH--PQPSNMMVPLRGSPAYP  693
            CKF+H  PQP+NMMVP  G  +YP
Sbjct  132  CKFNHPQPQPTNMMVPTSGQQSYP  155


 Score =   100 bits (248),  Expect(2) = 7e-53, Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 52/59 (88%), Gaps = 0/59 (0%)
 Frame = +3

Query  273  LWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMK  449
            +WQ++L S ETME+G+YP R GEPDCSYYIRTGLCRFG++CRFNHP +R+L IA ARM+
Sbjct  1    MWQMNLSSDETMETGSYPERPGEPDCSYYIRTGLCRFGSTCRFNHPRDRELVIATARMR  59


 Score = 79.7 bits (195),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 44/66 (67%), Gaps = 0/66 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y+KTG CKFG  CKFHHPRD+        L+ +G PLRP +  C +Y R G CKFG +
Sbjct  261  QFYMKTGDCKFGTVCKFHHPRDRQAPPPDCLLSSIGLPLRPGEPLCVFYTRYGICKFGPS  320

Query  628  CKFHHP  645
            CKF HP
Sbjct  321  CKFDHP  326


 Score = 79.3 bits (194),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 46/66 (70%), Gaps = 1/66 (2%)
 Frame = +1

Query  451  YYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTC  630
            YY++TG C+FG+TC+F+HPRD+  +     +    YP R    EC YY++TG CKFG TC
Sbjct  28   YYIRTGLCRFGSTCRFNHPRDRELVIATARMRGE-YPERIGQPECEYYLKTGTCKFGVTC  86

Query  631  KFHHPQ  648
            KFHHP+
Sbjct  87   KFHHPR  92


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 33/51 (65%), Gaps = 0/51 (0%)
 Frame = +1

Query  514  KAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMV  666
            +  ++    +    YP RP + +C YY+RTG C+FGSTC+F+HP+   +++
Sbjct  3    QMNLSSDETMETGSYPERPGEPDCSYYIRTGLCRFGSTCRFNHPRDRELVI  53


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 18/30 (60%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHP  410
            YP+R  E DC+Y++RTG C+FG +C+FNHP
Sbjct  108  YPLRSNEVDCAYFLRTGHCKFGGTCKFNHP  137



>emb|CDY53749.1| BnaAnng12770D [Brassica napus]
Length=374

 Score =   130 bits (327),  Expect(2) = 1e-52, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 70/80 (88%), Gaps = 3/80 (4%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFG TCKFHHPR+KAGIAGRV+LN+LGYPLR N+++C Y++RTG CKFG+T
Sbjct  93   EYYLKTGTCKFGVTCKFHHPRNKAGIAGRVSLNMLGYPLRSNEVDCAYFLRTGHCKFGAT  152

Query  628  CKFHHPQP---SNMMVPLRG  678
            CKF+HPQP   +N+MVP  G
Sbjct  153  CKFNHPQPQPTTNLMVPTSG  172


 Score =   103 bits (258),  Expect(2) = 1e-52, Method: Compositional matrix adjust.
 Identities = 46/75 (61%), Positives = 58/75 (77%), Gaps = 0/75 (0%)
 Frame = +3

Query  225  AVFMSKDTAICTR*ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFN  404
             V MS  + +    E +WQ++L S ETME+G+YP R GEPDCSYYIRTGLCRFG++CRFN
Sbjct  6    GVPMSSLSPLMINQEAMWQMNLSSDETMETGSYPERPGEPDCSYYIRTGLCRFGSTCRFN  65

Query  405  HPSNRKLAIAAARMK  449
            HP +R+L IA ARM+
Sbjct  66   HPRDRELVIATARMR  80


 Score = 79.7 bits (195),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 34/67 (51%), Positives = 46/67 (69%), Gaps = 1/67 (1%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
             YY++TG C+FG+TC+F+HPRD+  +     +    YP R    EC YY++TG CKFG T
Sbjct  48   SYYIRTGLCRFGSTCRFNHPRDRELVIATARMRG-EYPERIGQPECEYYLKTGTCKFGVT  106

Query  628  CKFHHPQ  648
            CKFHHP+
Sbjct  107  CKFHHPR  113


 Score = 79.7 bits (195),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 46/66 (70%), Gaps = 0/66 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y+KTG CKFG  CKFHHPRD+   +    L+ +G PLRP +  C +Y R G CKFG +
Sbjct  258  QFYMKTGDCKFGTVCKFHHPRDRQPPSPDCLLSPIGLPLRPGEPVCVFYSRYGICKFGPS  317

Query  628  CKFHHP  645
            CKF+HP
Sbjct  318  CKFNHP  323


 Score = 52.8 bits (125),  Expect(2) = 7e-08, Method: Compositional matrix adjust.
 Identities = 21/54 (39%), Positives = 36/54 (67%), Gaps = 8/54 (15%)
 Frame = +3

Query  285  SLRSMETMESGT--------YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRK  422
            + R+M+  ESG+        +P R G+P+C +Y++TG C+FG  C+F+HP +R+
Sbjct  228  NYRNMQQNESGSSVQPSENVFPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQ  281


 Score = 31.2 bits (69),  Expect(2) = 7e-08, Method: Compositional matrix adjust.
 Identities = 11/21 (52%), Positives = 16/21 (76%), Gaps = 0/21 (0%)
 Frame = +1

Query  451  YYLKTGACKFGATCKFHHPRD  513
            +Y + G CKFG +CKF+HP +
Sbjct  305  FYSRYGICKFGPSCKFNHPME  325


 Score = 53.5 bits (127),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 19/30 (63%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHP  410
            YP+R  E DC+Y++RTG C+FGA+C+FNHP
Sbjct  129  YPLRSNEVDCAYFLRTGHCKFGATCKFNHP  158


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 33/51 (65%), Gaps = 0/51 (0%)
 Frame = +1

Query  514  KAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMV  666
            +  ++    +    YP RP + +C YY+RTG C+FGSTC+F+HP+   +++
Sbjct  24   QMNLSSDETMETGSYPERPGEPDCSYYIRTGLCRFGSTCRFNHPRDRELVI  74


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/47 (47%), Positives = 34/47 (72%), Gaps = 2/47 (4%)
 Frame = +1

Query  508  RDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQ  648
            ++++G + + + NV  +P RP   EC +YM+TG CKFG+ CKFHHP+
Sbjct  234  QNESGSSVQPSENV--FPERPGQPECQFYMKTGDCKFGTVCKFHHPR  278



>ref|XP_002882253.1| hypothetical protein ARALYDRAFT_477525 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58512.1| hypothetical protein ARALYDRAFT_477525 [Arabidopsis lyrata subsp. 
lyrata]
Length=397

 Score =   135 bits (341),  Expect(2) = 1e-52, Method: Compositional matrix adjust.
 Identities = 60/84 (71%), Positives = 72/84 (86%), Gaps = 2/84 (2%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFG TCKFHHPR+KAGIAGRV+LN+LGYPLR N+++C Y++RTG CKFG T
Sbjct  92   EYYLKTGTCKFGVTCKFHHPRNKAGIAGRVSLNMLGYPLRSNEVDCAYFLRTGHCKFGGT  151

Query  628  CKFHH--PQPSNMMVPLRGSPAYP  693
            CKF+H  PQP+NMMVP  G  +YP
Sbjct  152  CKFNHPQPQPTNMMVPTSGQQSYP  175


 Score = 99.0 bits (245),  Expect(2) = 1e-52, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = +3

Query  267  ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARM  446
            + +WQ++L S E ME+G+YP R GEPDCSYYIRTGLCRFG++CRFNHP +R+L IA ARM
Sbjct  19   DAMWQMNLSSDEIMETGSYPERPGEPDCSYYIRTGLCRFGSTCRFNHPRDRELVIATARM  78

Query  447  K  449
            +
Sbjct  79   R  79


 Score = 80.1 bits (196),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 44/66 (67%), Gaps = 0/66 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y+KTG CKFG  CKFHHPRD+        L+ +G PLRP +  C +Y R G CKFG +
Sbjct  281  QFYMKTGDCKFGTVCKFHHPRDRQAPPPDCLLSSIGLPLRPGEPLCVFYTRYGICKFGPS  340

Query  628  CKFHHP  645
            CKF HP
Sbjct  341  CKFDHP  346


 Score = 79.7 bits (195),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 34/67 (51%), Positives = 46/67 (69%), Gaps = 1/67 (1%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
             YY++TG C+FG+TC+F+HPRD+  +     +    YP R    EC YY++TG CKFG T
Sbjct  47   SYYIRTGLCRFGSTCRFNHPRDRELVIATARMRGE-YPERIGQPECEYYLKTGTCKFGVT  105

Query  628  CKFHHPQ  648
            CKFHHP+
Sbjct  106  CKFHHPR  112


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 33/51 (65%), Gaps = 0/51 (0%)
 Frame = +1

Query  514  KAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMV  666
            +  ++    +    YP RP + +C YY+RTG C+FGSTC+F+HP+   +++
Sbjct  23   QMNLSSDEIMETGSYPERPGEPDCSYYIRTGLCRFGSTCRFNHPRDRELVI  73


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 18/30 (60%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHP  410
            YP+R  E DC+Y++RTG C+FG +C+FNHP
Sbjct  128  YPLRSNEVDCAYFLRTGHCKFGGTCKFNHP  157


 Score = 50.1 bits (118),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 32/52 (62%), Gaps = 5/52 (10%)
 Frame = +1

Query  502  HPRDKAGIAGRVAL---NVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQ  648
            +P     I G  AL   NV  +P RP   EC +YM+TG CKFG+ CKFHHP+
Sbjct  252  NPGSSVPIGGYYALPRENV--FPERPGQPECQFYMKTGDCKFGTVCKFHHPR  301



>ref|NP_001130819.1| uncharacterized protein LOC100191923 [Zea mays]
 gb|ACF79183.1| unknown [Zea mays]
 gb|ACG29102.1| zinc finger CCCH type domain-containing protein ZFN-like [Zea 
mays]
 gb|ACN25540.1| unknown [Zea mays]
 gb|ACN28916.1| unknown [Zea mays]
 gb|ACR36098.1| unknown [Zea mays]
 gb|AFT82657.1| C3H19 transcription factor, partial [Zea mays subsp. mays]
 tpg|DAA38868.1| TPA: putative Zinc finger CCCH type domain-containing protein 
ZFN [Zea mays]
Length=443

 Score =   142 bits (359),  Expect(2) = 1e-52, Method: Compositional matrix adjust.
 Identities = 68/91 (75%), Positives = 75/91 (82%), Gaps = 1/91 (1%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFGATCKFHHPR+KA +A RV LN LGYPLR N+ EC YY+RTGQCKFGST
Sbjct  106  QYYLKTGTCKFGATCKFHHPREKAAMATRVQLNELGYPLRLNEKECAYYLRTGQCKFGST  165

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTPG  720
            CKFHHPQPS MMV +RGS  Y P  S T+PG
Sbjct  166  CKFHHPQPSTMMVAVRGS-VYSPGQSATSPG  195


 Score = 91.7 bits (226),  Expect(2) = 1e-52, Method: Compositional matrix adjust.
 Identities = 39/61 (64%), Positives = 51/61 (84%), Gaps = 2/61 (3%)
 Frame = +3

Query  267  ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARM  446
            E +WQ++L   + ME G YP R G+PDCSYY+RTG+CRFG +C+FNHP++RKLA+AAARM
Sbjct  35   EAMWQMNLG--DAMELGPYPERVGDPDCSYYMRTGMCRFGMTCKFNHPADRKLAVAAARM  92

Query  447  K  449
            K
Sbjct  93   K  93


 Score = 86.7 bits (213),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 44/92 (48%), Positives = 55/92 (60%), Gaps = 9/92 (10%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y+KTG CKFG+ CKFHHPR++       AL+ LG PLRP +  C +Y R G CKFG  
Sbjct  314  QFYMKTGDCKFGSVCKFHHPRERIIPTPNCALSPLGLPLRPGEPICSFYNRYGMCKFGPN  373

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  723
            CKFHHP          G+P Y    SPT+  Q
Sbjct  374  CKFHHPM---------GNPMYGHASSPTSEAQ  396


 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 23/46 (50%), Positives = 35/46 (76%), Gaps = 2/46 (4%)
 Frame = +3

Query  315  GTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKV  452
            G YP R G+P+C YY++TG C+FGA+C+F+HP  R+ A  A R+++
Sbjct  94   GEYPQRIGQPECQYYLKTGTCKFGATCKFHHP--REKAAMATRVQL  137


 Score = 53.1 bits (126),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 35/56 (63%), Gaps = 3/56 (5%)
 Frame = +1

Query  556  YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  723
            +P RP+  EC +YM+TG CKFGS CKFHHP+   +  P   + A  P+  P  PG+
Sbjct  304  FPERPDQPECQFYMKTGDCKFGSVCKFHHPRERIIPTP---NCALSPLGLPLRPGE  356


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 34/56 (61%), Gaps = 1/56 (2%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKVLLEDGSLQVWGH  488
            YP+R  E +C+YY+RTG C+FG++C+F+HP    + + A R  V     S    GH
Sbjct  142  YPLRLNEKECAYYLRTGQCKFGSTCKFHHPQPSTMMV-AVRGSVYSPGQSATSPGH  196


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/43 (51%), Positives = 28/43 (65%), Gaps = 0/43 (0%)
 Frame = +1

Query  538  ALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMV  666
            A+ +  YP R  D +C YYMRTG C+FG TCKF+HP    + V
Sbjct  45   AMELGPYPERVGDPDCSYYMRTGMCRFGMTCKFNHPADRKLAV  87



>emb|CDY67901.1| BnaCnng56860D [Brassica napus]
Length=374

 Score =   130 bits (327),  Expect(2) = 1e-52, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 70/80 (88%), Gaps = 3/80 (4%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFG TCKFHHPR+KAGIAGRV+LN+LGYPLR N+++C Y++RTG CKFG+T
Sbjct  93   EYYLKTGTCKFGVTCKFHHPRNKAGIAGRVSLNMLGYPLRSNEVDCAYFLRTGHCKFGAT  152

Query  628  CKFHHPQP---SNMMVPLRG  678
            CKF+HPQP   +N+MVP  G
Sbjct  153  CKFNHPQPQPTTNLMVPTSG  172


 Score =   103 bits (258),  Expect(2) = 1e-52, Method: Compositional matrix adjust.
 Identities = 46/75 (61%), Positives = 58/75 (77%), Gaps = 0/75 (0%)
 Frame = +3

Query  225  AVFMSKDTAICTR*ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFN  404
             V MS  + +    E +WQ++L S ETME+G+YP R GEPDCSYYIRTGLCRFG++CRFN
Sbjct  6    GVPMSSLSPLMINQEAMWQMNLSSDETMETGSYPERPGEPDCSYYIRTGLCRFGSTCRFN  65

Query  405  HPSNRKLAIAAARMK  449
            HP +R+L IA ARM+
Sbjct  66   HPRDRELVIATARMR  80


 Score = 79.7 bits (195),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 34/67 (51%), Positives = 46/67 (69%), Gaps = 1/67 (1%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
             YY++TG C+FG+TC+F+HPRD+  +     +    YP R    EC YY++TG CKFG T
Sbjct  48   SYYIRTGLCRFGSTCRFNHPRDRELVIATARMRG-EYPERIGQPECEYYLKTGTCKFGVT  106

Query  628  CKFHHPQ  648
            CKFHHP+
Sbjct  107  CKFHHPR  113


 Score = 79.7 bits (195),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 46/66 (70%), Gaps = 0/66 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y+KTG CKFG  CKFHHPRD+   +    L+ +G PLRP +  C +Y R G CKFG +
Sbjct  258  QFYMKTGDCKFGTVCKFHHPRDRQPPSPDCLLSPIGLPLRPGEPVCVFYSRYGICKFGPS  317

Query  628  CKFHHP  645
            CKF+HP
Sbjct  318  CKFNHP  323


 Score = 52.8 bits (125),  Expect(2) = 7e-08, Method: Compositional matrix adjust.
 Identities = 21/54 (39%), Positives = 36/54 (67%), Gaps = 8/54 (15%)
 Frame = +3

Query  285  SLRSMETMESGT--------YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRK  422
            + R+M+  ESG+        +P R G+P+C +Y++TG C+FG  C+F+HP +R+
Sbjct  228  NYRNMQQNESGSSVQPSENVFPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQ  281


 Score = 31.2 bits (69),  Expect(2) = 7e-08, Method: Compositional matrix adjust.
 Identities = 11/21 (52%), Positives = 16/21 (76%), Gaps = 0/21 (0%)
 Frame = +1

Query  451  YYLKTGACKFGATCKFHHPRD  513
            +Y + G CKFG +CKF+HP +
Sbjct  305  FYSRYGICKFGPSCKFNHPME  325


 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 19/30 (63%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHP  410
            YP+R  E DC+Y++RTG C+FGA+C+FNHP
Sbjct  129  YPLRSNEVDCAYFLRTGHCKFGATCKFNHP  158


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 33/51 (65%), Gaps = 0/51 (0%)
 Frame = +1

Query  514  KAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMV  666
            +  ++    +    YP RP + +C YY+RTG C+FGSTC+F+HP+   +++
Sbjct  24   QMNLSSDETMETGSYPERPGEPDCSYYIRTGLCRFGSTCRFNHPRDRELVI  74


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/47 (47%), Positives = 34/47 (72%), Gaps = 2/47 (4%)
 Frame = +1

Query  508  RDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQ  648
            ++++G + + + NV  +P RP   EC +YM+TG CKFG+ CKFHHP+
Sbjct  234  QNESGSSVQPSENV--FPERPGQPECQFYMKTGDCKFGTVCKFHHPR  278



>ref|XP_009118612.1| PREDICTED: zinc finger CCCH domain-containing protein 33-like 
isoform X2 [Brassica rapa]
Length=372

 Score =   130 bits (326),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 56/80 (70%), Positives = 70/80 (88%), Gaps = 3/80 (4%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFG TCKFHHPR+KAG+AGRV+LN+LGYPLR N+++C Y++RTG CKFG+T
Sbjct  93   EYYLKTGTCKFGVTCKFHHPRNKAGVAGRVSLNMLGYPLRSNEVDCAYFLRTGHCKFGAT  152

Query  628  CKFHHPQP---SNMMVPLRG  678
            CKF+HPQP   +N+MVP  G
Sbjct  153  CKFNHPQPQPTTNLMVPTSG  172


 Score =   104 bits (259),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 46/75 (61%), Positives = 58/75 (77%), Gaps = 0/75 (0%)
 Frame = +3

Query  225  AVFMSKDTAICTR*ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFN  404
             V MS  + +    E +WQ++L S ETME+G+YP R GEPDCSYYIRTGLCRFG++CRFN
Sbjct  6    GVPMSSLSPLLINQEAMWQMNLSSDETMETGSYPERPGEPDCSYYIRTGLCRFGSTCRFN  65

Query  405  HPSNRKLAIAAARMK  449
            HP +R+L IA ARM+
Sbjct  66   HPRDRELVIATARMR  80


 Score = 79.7 bits (195),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 34/67 (51%), Positives = 46/67 (69%), Gaps = 1/67 (1%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
             YY++TG C+FG+TC+F+HPRD+  +     +    YP R    EC YY++TG CKFG T
Sbjct  48   SYYIRTGLCRFGSTCRFNHPRDRELVIATARMRG-EYPERIGQPECEYYLKTGTCKFGVT  106

Query  628  CKFHHPQ  648
            CKFHHP+
Sbjct  107  CKFHHPR  113


 Score = 79.7 bits (195),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 46/66 (70%), Gaps = 0/66 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y+KTG CKFG  CKFHHPRD+   +    L+ +G PLRP +  C +Y R G CKFG +
Sbjct  256  QFYMKTGDCKFGTVCKFHHPRDRQPPSPDCLLSPIGLPLRPGEPVCVFYSRYGICKFGPS  315

Query  628  CKFHHP  645
            CKF+HP
Sbjct  316  CKFNHP  321


 Score = 52.8 bits (125),  Expect(2) = 7e-08, Method: Compositional matrix adjust.
 Identities = 21/54 (39%), Positives = 36/54 (67%), Gaps = 8/54 (15%)
 Frame = +3

Query  285  SLRSMETMESGT--------YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRK  422
            + R+M+  ESG+        +P R G+P+C +Y++TG C+FG  C+F+HP +R+
Sbjct  226  NYRNMQQNESGSSVQPSENVFPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQ  279


 Score = 31.2 bits (69),  Expect(2) = 7e-08, Method: Compositional matrix adjust.
 Identities = 11/21 (52%), Positives = 16/21 (76%), Gaps = 0/21 (0%)
 Frame = +1

Query  451  YYLKTGACKFGATCKFHHPRD  513
            +Y + G CKFG +CKF+HP +
Sbjct  303  FYSRYGICKFGPSCKFNHPME  323


 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 19/30 (63%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHP  410
            YP+R  E DC+Y++RTG C+FGA+C+FNHP
Sbjct  129  YPLRSNEVDCAYFLRTGHCKFGATCKFNHP  158


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 33/51 (65%), Gaps = 0/51 (0%)
 Frame = +1

Query  514  KAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMV  666
            +  ++    +    YP RP + +C YY+RTG C+FGSTC+F+HP+   +++
Sbjct  24   QMNLSSDETMETGSYPERPGEPDCSYYIRTGLCRFGSTCRFNHPRDRELVI  74


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/47 (47%), Positives = 34/47 (72%), Gaps = 2/47 (4%)
 Frame = +1

Query  508  RDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQ  648
            ++++G + + + NV  +P RP   EC +YM+TG CKFG+ CKFHHP+
Sbjct  232  QNESGSSVQPSENV--FPERPGQPECQFYMKTGDCKFGTVCKFHHPR  276



>ref|XP_009118604.1| PREDICTED: zinc finger CCCH domain-containing protein 33-like 
isoform X1 [Brassica rapa]
Length=374

 Score =   129 bits (325),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 56/80 (70%), Positives = 70/80 (88%), Gaps = 3/80 (4%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFG TCKFHHPR+KAG+AGRV+LN+LGYPLR N+++C Y++RTG CKFG+T
Sbjct  93   EYYLKTGTCKFGVTCKFHHPRNKAGVAGRVSLNMLGYPLRSNEVDCAYFLRTGHCKFGAT  152

Query  628  CKFHHPQP---SNMMVPLRG  678
            CKF+HPQP   +N+MVP  G
Sbjct  153  CKFNHPQPQPTTNLMVPTSG  172


 Score =   104 bits (259),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 46/75 (61%), Positives = 58/75 (77%), Gaps = 0/75 (0%)
 Frame = +3

Query  225  AVFMSKDTAICTR*ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFN  404
             V MS  + +    E +WQ++L S ETME+G+YP R GEPDCSYYIRTGLCRFG++CRFN
Sbjct  6    GVPMSSLSPLLINQEAMWQMNLSSDETMETGSYPERPGEPDCSYYIRTGLCRFGSTCRFN  65

Query  405  HPSNRKLAIAAARMK  449
            HP +R+L IA ARM+
Sbjct  66   HPRDRELVIATARMR  80


 Score = 79.7 bits (195),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 34/67 (51%), Positives = 46/67 (69%), Gaps = 1/67 (1%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
             YY++TG C+FG+TC+F+HPRD+  +     +    YP R    EC YY++TG CKFG T
Sbjct  48   SYYIRTGLCRFGSTCRFNHPRDRELVIATARMRG-EYPERIGQPECEYYLKTGTCKFGVT  106

Query  628  CKFHHPQ  648
            CKFHHP+
Sbjct  107  CKFHHPR  113


 Score = 79.7 bits (195),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 46/66 (70%), Gaps = 0/66 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y+KTG CKFG  CKFHHPRD+   +    L+ +G PLRP +  C +Y R G CKFG +
Sbjct  258  QFYMKTGDCKFGTVCKFHHPRDRQPPSPDCLLSPIGLPLRPGEPVCVFYSRYGICKFGPS  317

Query  628  CKFHHP  645
            CKF+HP
Sbjct  318  CKFNHP  323


 Score = 52.8 bits (125),  Expect(2) = 7e-08, Method: Compositional matrix adjust.
 Identities = 21/54 (39%), Positives = 36/54 (67%), Gaps = 8/54 (15%)
 Frame = +3

Query  285  SLRSMETMESGT--------YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRK  422
            + R+M+  ESG+        +P R G+P+C +Y++TG C+FG  C+F+HP +R+
Sbjct  228  NYRNMQQNESGSSVQPSENVFPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQ  281


 Score = 31.2 bits (69),  Expect(2) = 7e-08, Method: Compositional matrix adjust.
 Identities = 11/21 (52%), Positives = 16/21 (76%), Gaps = 0/21 (0%)
 Frame = +1

Query  451  YYLKTGACKFGATCKFHHPRD  513
            +Y + G CKFG +CKF+HP +
Sbjct  305  FYSRYGICKFGPSCKFNHPME  325


 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 19/30 (63%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHP  410
            YP+R  E DC+Y++RTG C+FGA+C+FNHP
Sbjct  129  YPLRSNEVDCAYFLRTGHCKFGATCKFNHP  158


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 33/51 (65%), Gaps = 0/51 (0%)
 Frame = +1

Query  514  KAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMV  666
            +  ++    +    YP RP + +C YY+RTG C+FGSTC+F+HP+   +++
Sbjct  24   QMNLSSDETMETGSYPERPGEPDCSYYIRTGLCRFGSTCRFNHPRDRELVI  74


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/47 (47%), Positives = 34/47 (72%), Gaps = 2/47 (4%)
 Frame = +1

Query  508  RDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQ  648
            ++++G + + + NV  +P RP   EC +YM+TG CKFG+ CKFHHP+
Sbjct  234  QNESGSSVQPSENV--FPERPGQPECQFYMKTGDCKFGTVCKFHHPR  278



>gb|AAD33769.1|AF138743_1 zinc finger protein 1 [Arabidopsis thaliana]
Length=424

 Score =   135 bits (341),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 60/84 (71%), Positives = 72/84 (86%), Gaps = 2/84 (2%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFG TCKFHHPR+KAGIAGRV+LN+LGYPLR N+++C Y++RTG CKFG T
Sbjct  92   EYYLKTGTCKFGVTCKFHHPRNKAGIAGRVSLNMLGYPLRSNEVDCAYFLRTGHCKFGGT  151

Query  628  CKFHH--PQPSNMMVPLRGSPAYP  693
            CKF+H  PQP+NMMVP  G  +YP
Sbjct  152  CKFNHPQPQPTNMMVPTSGQQSYP  175


 Score = 98.2 bits (243),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = +3

Query  267  ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARM  446
            + +WQ++L S ETME+G+YP R GEPDCSYYIRTGLCRFG++CR NHP +R+L IA ARM
Sbjct  19   DAMWQMNLSSDETMETGSYPERPGEPDCSYYIRTGLCRFGSTCRVNHPRDRELVIATARM  78

Query  447  K  449
            +
Sbjct  79   R  79


 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 44/66 (67%), Gaps = 0/66 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y+KTG CKFG  CKFHHPRD+        L+ +G PLRP +  C +Y R G CKFG +
Sbjct  281  QFYMKTGDCKFGTVCKFHHPRDRQAPPPDCLLSSIGLPLRPGEPLCVFYTRYGICKFGPS  340

Query  628  CKFHHP  645
            CKF HP
Sbjct  341  CKFDHP  346


 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 45/66 (68%), Gaps = 1/66 (2%)
 Frame = +1

Query  451  YYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTC  630
            YY++TG C+FG+TC+ +HPRD+  +     +    YP R    EC YY++TG CKFG TC
Sbjct  48   YYIRTGLCRFGSTCRVNHPRDRELVIATARMRG-EYPERIGHPECEYYLKTGTCKFGVTC  106

Query  631  KFHHPQ  648
            KFHHP+
Sbjct  107  KFHHPR  112


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 18/30 (60%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHP  410
            YP+R  E DC+Y++RTG C+FG +C+FNHP
Sbjct  128  YPLRSNEVDCAYFLRTGHCKFGGTCKFNHP  157


 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 32/51 (63%), Gaps = 0/51 (0%)
 Frame = +1

Query  514  KAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMV  666
            +  ++    +    YP RP + +C YY+RTG C+FGSTC+ +HP+   +++
Sbjct  23   QMNLSSDETMETGSYPERPGEPDCSYYIRTGLCRFGSTCRVNHPRDRELVI  73



>gb|KFK37691.1| hypothetical protein AALP_AA3G016100 [Arabis alpina]
Length=389

 Score =   134 bits (337),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 59/83 (71%), Positives = 71/83 (86%), Gaps = 2/83 (2%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFG TCKFHHPR+KAGIAGRV+LN+LGYPLRPN+++C Y++RTG CKFG T
Sbjct  92   EYYLKTGTCKFGVTCKFHHPRNKAGIAGRVSLNMLGYPLRPNEVDCAYFLRTGHCKFGGT  151

Query  628  CKFHH--PQPSNMMVPLRGSPAY  690
            CKF+H  PQP+NMMVP     +Y
Sbjct  152  CKFNHPQPQPTNMMVPTSAQQSY  174


 Score = 99.4 bits (246),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 53/61 (87%), Gaps = 0/61 (0%)
 Frame = +3

Query  267  ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARM  446
            + +WQ++L S ETME+G+YP R GEP+CSYYIRTGLCRFG++CRFNHP +R+L IA ARM
Sbjct  19   DAMWQMNLSSDETMETGSYPERQGEPNCSYYIRTGLCRFGSTCRFNHPRDRELVIATARM  78

Query  447  K  449
            +
Sbjct  79   R  79


 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 45/66 (68%), Gaps = 0/66 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y+KTG CKFG  CKFHHPRD+   +    L+ +G PLRP +  C +Y R G CKFG +
Sbjct  279  QFYMKTGDCKFGTVCKFHHPRDRQAPSPDCLLSSIGLPLRPGEPLCVFYTRYGICKFGPS  338

Query  628  CKFHHP  645
            CKF HP
Sbjct  339  CKFDHP  344


 Score = 79.7 bits (195),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 34/67 (51%), Positives = 46/67 (69%), Gaps = 1/67 (1%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
             YY++TG C+FG+TC+F+HPRD+  +     +    YP R    EC YY++TG CKFG T
Sbjct  47   SYYIRTGLCRFGSTCRFNHPRDRELVIATARMRGE-YPERIGQPECEYYLKTGTCKFGVT  105

Query  628  CKFHHPQ  648
            CKFHHP+
Sbjct  106  CKFHHPR  112


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 18/30 (60%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHP  410
            YP+R  E DC+Y++RTG C+FG +C+FNHP
Sbjct  128  YPLRPNEVDCAYFLRTGHCKFGGTCKFNHP  157



>gb|EAY76977.1| hypothetical protein OsI_04935 [Oryza sativa Indica Group]
Length=440

 Score =   142 bits (359),  Expect(2) = 3e-52, Method: Compositional matrix adjust.
 Identities = 65/91 (71%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFG TCKFHHPR+KAGIAGRV LN LGYPLRP++ EC YY++TGQCK+G+T
Sbjct  132  QYYLKTGTCKFGPTCKFHHPREKAGIAGRVQLNTLGYPLRPSEKECAYYLKTGQCKYGNT  191

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTPG  720
            CKFHHP+  N M   RGSP YP VHS  T G
Sbjct  192  CKFHHPELFNAMASSRGSPIYPSVHSSATAG  222


 Score = 90.5 bits (223),  Expect(2) = 3e-52, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 48/62 (77%), Gaps = 1/62 (2%)
 Frame = +3

Query  267  ETLWQ-LSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAAR  443
            E +WQ +++     M+ G YP R GEPDC+YY+RTGLCRFG SCRFNHP +R LAIA+AR
Sbjct  58   EGMWQQMTMSGSGAMQPGPYPERSGEPDCTYYLRTGLCRFGMSCRFNHPQDRNLAIASAR  117

Query  444  MK  449
            MK
Sbjct  118  MK  119


 Score = 80.9 bits (198),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 41/81 (51%), Positives = 50/81 (62%), Gaps = 4/81 (5%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YY+KTG CKFGA CKFHHPR ++       L+ +G PLRP +  C +Y R G CKFG+ 
Sbjct  340  QYYMKTGDCKFGAVCKFHHPRVRSMPTPDCVLSPVGLPLRPGEELCKFYSRYGICKFGAN  399

Query  628  CKFHHPQPSNMMVPLRGSPAY  690
            CKF HP     M P  G  AY
Sbjct  400  CKFDHP----TMAPPMGVYAY  416


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/46 (48%), Positives = 34/46 (74%), Gaps = 2/46 (4%)
 Frame = +3

Query  315  GTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKV  452
            G YP R G+P+C YY++TG C+FG +C+F+HP  R+ A  A R+++
Sbjct  120  GEYPERMGQPECQYYLKTGTCKFGPTCKFHHP--REKAGIAGRVQL  163


 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 34/56 (61%), Gaps = 3/56 (5%)
 Frame = +1

Query  556  YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  723
            +P RP+  EC YYM+TG CKFG+ CKFHHP+  +M  P        PV  P  PG+
Sbjct  330  FPERPDQPECQYYMKTGDCKFGAVCKFHHPRVRSMPTP---DCVLSPVGLPLRPGE  382


 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 20/48 (42%), Positives = 32/48 (67%), Gaps = 0/48 (0%)
 Frame = +1

Query  523  IAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMV  666
            ++G  A+    YP R  + +C YY+RTG C+FG +C+F+HPQ  N+ +
Sbjct  66   MSGSGAMQPGPYPERSGEPDCTYYLRTGLCRFGMSCRFNHPQDRNLAI  113



>ref|NP_001045201.2| Os01g0917400 [Oryza sativa Japonica Group]
 sp|Q5JLB5.2|C3H12_ORYSJ RecName: Full=Zinc finger CCCH domain-containing protein 12; 
Short=OsC3H12; AltName: Full=Zinc finger CCCH domain-containing 
protein ZFN-like 2 [Oryza sativa Japonica Group]
 dbj|BAD87735.1| putative zinc finger protein [Oryza sativa Japonica Group]
 dbj|BAG93826.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAF07115.2| Os01g0917400 [Oryza sativa Japonica Group]
 gb|AEM43044.1| CCCH-type zinc finger protein [Oryza sativa Indica Group]
Length=439

 Score =   142 bits (358),  Expect(2) = 3e-52, Method: Compositional matrix adjust.
 Identities = 65/91 (71%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFG TCKFHHPR+KAGIAGRV LN LGYPLRP++ EC YY++TGQCK+G+T
Sbjct  132  QYYLKTGTCKFGPTCKFHHPREKAGIAGRVQLNTLGYPLRPSEKECAYYLKTGQCKYGNT  191

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTPG  720
            CKFHHP+  N M   RGSP YP VHS  T G
Sbjct  192  CKFHHPELFNAMASSRGSPIYPSVHSSATAG  222


 Score = 90.5 bits (223),  Expect(2) = 3e-52, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 48/62 (77%), Gaps = 1/62 (2%)
 Frame = +3

Query  267  ETLWQ-LSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAAR  443
            E +WQ +++     M+ G YP R GEPDC+YY+RTGLCRFG SCRFNHP +R LAIA+AR
Sbjct  58   EGMWQQMTMSGSGAMQPGPYPERSGEPDCTYYLRTGLCRFGMSCRFNHPQDRNLAIASAR  117

Query  444  MK  449
            MK
Sbjct  118  MK  119


 Score = 80.9 bits (198),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 41/81 (51%), Positives = 50/81 (62%), Gaps = 4/81 (5%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YY+KTG CKFGA CKFHHPR ++       L+ +G PLRP +  C +Y R G CKFG+ 
Sbjct  339  QYYMKTGDCKFGAVCKFHHPRVRSMPTPDCVLSPVGLPLRPGEELCKFYSRYGICKFGAN  398

Query  628  CKFHHPQPSNMMVPLRGSPAY  690
            CKF HP     M P  G  AY
Sbjct  399  CKFDHP----TMAPPMGVYAY  415


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/46 (48%), Positives = 34/46 (74%), Gaps = 2/46 (4%)
 Frame = +3

Query  315  GTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKV  452
            G YP R G+P+C YY++TG C+FG +C+F+HP  R+ A  A R+++
Sbjct  120  GEYPERMGQPECQYYLKTGTCKFGPTCKFHHP--REKAGIAGRVQL  163


 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 34/56 (61%), Gaps = 3/56 (5%)
 Frame = +1

Query  556  YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  723
            +P RP+  EC YYM+TG CKFG+ CKFHHP+  +M  P        PV  P  PG+
Sbjct  329  FPERPDQPECQYYMKTGDCKFGAVCKFHHPRVRSMPTP---DCVLSPVGLPLRPGE  381


 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 20/48 (42%), Positives = 32/48 (67%), Gaps = 0/48 (0%)
 Frame = +1

Query  523  IAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMV  666
            ++G  A+    YP R  + +C YY+RTG C+FG +C+F+HPQ  N+ +
Sbjct  66   MSGSGAMQPGPYPERSGEPDCTYYLRTGLCRFGMSCRFNHPQDRNLAI  113



>gb|EMS50271.1| Zinc finger CCCH domain-containing protein 12 [Triticum urartu]
Length=406

 Score =   137 bits (344),  Expect(2) = 4e-52, Method: Compositional matrix adjust.
 Identities = 62/91 (68%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFG TCKFHHPR+KAGIAG V LN LGYPLRPN+ EC YY++TGQCK+G+T
Sbjct  96   QYYLKTGTCKFGPTCKFHHPREKAGIAGMVQLNTLGYPLRPNERECAYYLKTGQCKYGNT  155

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTPG  720
            CKF+HP+  N +   RGSP YPPVH+  + G
Sbjct  156  CKFNHPEIFNAVASSRGSPIYPPVHNSGSTG  186


 Score = 95.5 bits (236),  Expect(2) = 4e-52, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 51/62 (82%), Gaps = 1/62 (2%)
 Frame = +3

Query  267  ETLWQ-LSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAAR  443
            E +WQ +++ S  TM+SG YPVR GEPDC+YY+RTGLCRFG SCRFNHP +R  AIA+AR
Sbjct  22   EGMWQQMAMSSGATMQSGPYPVRPGEPDCTYYLRTGLCRFGMSCRFNHPQDRNTAIASAR  81

Query  444  MK  449
            MK
Sbjct  82   MK  83


 Score = 79.7 bits (195),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 43/89 (48%), Positives = 51/89 (57%), Gaps = 3/89 (3%)
 Frame = +1

Query  451  YYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTC  630
            YY+KTG CKFGA CKFHHPR ++       L+ +G PLRP +  C +Y R G CKFG  C
Sbjct  305  YYIKTGDCKFGAVCKFHHPRVRSQPPPDCILSPMGLPLRPGEELCKFYSRYGICKFGVNC  364

Query  631  KFHHPQPSNMMVPLRGSPAYPPVHSPTTP  717
            KF HP  + M V   G   Y    SP  P
Sbjct  365  KFDHPMAAPMGVYAYG---YSASASPNAP  390


 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 44/66 (67%), Gaps = 1/66 (2%)
 Frame = +1

Query  451  YYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTC  630
            YYL+TG C+FG +C+F+HP+D+        +    YP R    EC YY++TG CKFG TC
Sbjct  52   YYLRTGLCRFGMSCRFNHPQDRNTAIASARMKGE-YPERVGQPECQYYLKTGTCKFGPTC  110

Query  631  KFHHPQ  648
            KFHHP+
Sbjct  111  KFHHPR  116


 Score = 48.1 bits (113),  Expect(2) = 9e-07, Method: Compositional matrix adjust.
 Identities = 18/34 (53%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = +3

Query  318  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNR  419
             +P R  +P+C YYI+TG C+FGA C+F+HP  R
Sbjct  293  VFPERPDQPECIYYIKTGDCKFGAVCKFHHPRVR  326


 Score = 32.3 bits (72),  Expect(2) = 9e-07, Method: Compositional matrix adjust.
 Identities = 12/20 (60%), Positives = 14/20 (70%), Gaps = 0/20 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHP  507
            K+Y + G CKFG  CKF HP
Sbjct  350  KFYSRYGICKFGVNCKFDHP  369


 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 30/47 (64%), Gaps = 0/47 (0%)
 Frame = +3

Query  315  GTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKVL  455
            G YP R G+P+C YY++TG C+FG +C+F+HP  +       ++  L
Sbjct  84   GEYPERVGQPECQYYLKTGTCKFGPTCKFHHPREKAGIAGMVQLNTL  130


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +1

Query  556  YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMV  666
            YP+RP + +C YY+RTG C+FG +C+F+HPQ  N  +
Sbjct  41   YPVRPGEPDCTYYLRTGLCRFGMSCRFNHPQDRNTAI  77



>ref|XP_004971057.1| PREDICTED: zinc finger CCCH domain-containing protein 12-like 
[Setaria italica]
Length=425

 Score =   137 bits (346),  Expect(2) = 8e-52, Method: Compositional matrix adjust.
 Identities = 63/91 (69%), Positives = 73/91 (80%), Gaps = 0/91 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFG TCKFHHPR+KAGIAGRV LN LGYPLRPN+ EC YY++TGQCK+ +T
Sbjct  120  QYYLKTGTCKFGPTCKFHHPREKAGIAGRVQLNTLGYPLRPNEKECAYYLKTGQCKYANT  179

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTPG  720
            CKFHHP+  N +   RGSP YP VHS  + G
Sbjct  180  CKFHHPELFNAVPSSRGSPIYPSVHSSASAG  210


 Score = 94.0 bits (232),  Expect(2) = 8e-52, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 50/62 (81%), Gaps = 1/62 (2%)
 Frame = +3

Query  267  ETLWQ-LSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAAR  443
            E +WQ +++ S  TM+ G YP R GEPDC+YY+RTGLCRFG SCRFNHP +R LAIA+AR
Sbjct  46   EGMWQQMAMNSGATMQPGPYPERPGEPDCTYYLRTGLCRFGMSCRFNHPPDRNLAIASAR  105

Query  444  MK  449
            MK
Sbjct  106  MK  107


 Score = 80.5 bits (197),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 37/73 (51%), Positives = 48/73 (66%), Gaps = 0/73 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YY+KTG CKFGA CKFHHPR ++       L+ +G P+RP +  C +Y R G CKFG+ 
Sbjct  318  QYYMKTGDCKFGAVCKFHHPRVRSLPPPDCVLSPMGLPIRPGEELCKFYSRYGICKFGAN  377

Query  628  CKFHHPQPSNMMV  666
            CKF HP  + M V
Sbjct  378  CKFDHPMTAPMGV  390


 Score = 74.7 bits (182),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 45/66 (68%), Gaps = 1/66 (2%)
 Frame = +1

Query  451  YYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTC  630
            YYL+TG C+FG +C+F+HP D+  +A   A     YP R    EC YY++TG CKFG TC
Sbjct  76   YYLRTGLCRFGMSCRFNHPPDR-NLAIASARMKGEYPERVGQPECQYYLKTGTCKFGPTC  134

Query  631  KFHHPQ  648
            KFHHP+
Sbjct  135  KFHHPR  140


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/46 (48%), Positives = 34/46 (74%), Gaps = 2/46 (4%)
 Frame = +3

Query  315  GTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKV  452
            G YP R G+P+C YY++TG C+FG +C+F+HP  R+ A  A R+++
Sbjct  108  GEYPERVGQPECQYYLKTGTCKFGPTCKFHHP--REKAGIAGRVQL  151


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +1

Query  556  YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQ  648
            +P RP+  EC YYM+TG CKFG+ CKFHHP+
Sbjct  308  FPERPDQPECQYYMKTGDCKFGAVCKFHHPR  338



>ref|XP_006408379.1| hypothetical protein EUTSA_v10020900mg [Eutrema salsugineum]
 gb|ESQ49832.1| hypothetical protein EUTSA_v10020900mg [Eutrema salsugineum]
Length=389

 Score =   133 bits (334),  Expect(2) = 2e-51, Method: Compositional matrix adjust.
 Identities = 59/85 (69%), Positives = 72/85 (85%), Gaps = 3/85 (4%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFG +CKFHHPR+KAGIAGRV+LN+LGYPLR N+++C Y++RTG CKFG T
Sbjct  92   EYYLKTGTCKFGVSCKFHHPRNKAGIAGRVSLNMLGYPLRSNEVDCAYFLRTGHCKFGGT  151

Query  628  CKFHHPQP---SNMMVPLRGSPAYP  693
            CKF+HPQP   +NMMVP  G  +YP
Sbjct  152  CKFNHPQPQPTTNMMVPASGQQSYP  176


 Score = 97.4 bits (241),  Expect(2) = 2e-51, Method: Compositional matrix adjust.
 Identities = 40/61 (66%), Positives = 53/61 (87%), Gaps = 0/61 (0%)
 Frame = +3

Query  267  ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARM  446
            + +WQ++L S ETME+G+YP R GEP+CSY+IRTGLCRFG++CRFNHP +R+L IA ARM
Sbjct  19   DAMWQMNLSSDETMETGSYPERPGEPNCSYFIRTGLCRFGSTCRFNHPRDRELVIATARM  78

Query  447  K  449
            +
Sbjct  79   R  79


 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 44/66 (67%), Gaps = 0/66 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y+KTG CKFG  CKFHHPRD+        L+ +G PLRP +  C +Y R G CKFG +
Sbjct  282  QFYMKTGDCKFGTVCKFHHPRDRQVPPPDCLLSPIGLPLRPGEPLCVFYTRYGICKFGPS  341

Query  628  CKFHHP  645
            CKF HP
Sbjct  342  CKFDHP  347


 Score = 77.0 bits (188),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 32/67 (48%), Positives = 46/67 (69%), Gaps = 1/67 (1%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
             Y+++TG C+FG+TC+F+HPRD+  +     +    YP R    EC YY++TG CKFG +
Sbjct  47   SYFIRTGLCRFGSTCRFNHPRDRELVIATARMRG-EYPERIGQPECEYYLKTGTCKFGVS  105

Query  628  CKFHHPQ  648
            CKFHHP+
Sbjct  106  CKFHHPR  112


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 18/30 (60%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHP  410
            YP+R  E DC+Y++RTG C+FG +C+FNHP
Sbjct  128  YPLRSNEVDCAYFLRTGHCKFGGTCKFNHP  157


 Score = 50.4 bits (119),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 32/51 (63%), Gaps = 0/51 (0%)
 Frame = +1

Query  514  KAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMV  666
            +  ++    +    YP RP +  C Y++RTG C+FGSTC+F+HP+   +++
Sbjct  23   QMNLSSDETMETGSYPERPGEPNCSYFIRTGLCRFGSTCRFNHPRDRELVI  73


 Score = 50.1 bits (118),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +3

Query  318  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLA  428
             +P R G+P+C +Y++TG C+FG  C+F+HP +R++ 
Sbjct  271  VFPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQVP  307



>gb|ACU21592.1| Zinc finger protein [Triticum aestivum]
 emb|CDM85631.1| unnamed protein product [Triticum aestivum]
Length=435

 Score =   135 bits (339),  Expect(2) = 2e-51, Method: Compositional matrix adjust.
 Identities = 61/91 (67%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFG TCKFHHPR+KAGIAG V LN LGYPLRPN+ EC YY++TGQCK+G+T
Sbjct  125  QYYLKTGTCKFGPTCKFHHPREKAGIAGMVQLNTLGYPLRPNERECAYYLKTGQCKYGNT  184

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTPG  720
            CKF+HP+  + +   RGSP YPPVH+  + G
Sbjct  185  CKFNHPEIFSAVASSRGSPIYPPVHNSGSTG  215


 Score = 95.5 bits (236),  Expect(2) = 2e-51, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 51/62 (82%), Gaps = 1/62 (2%)
 Frame = +3

Query  267  ETLWQ-LSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAAR  443
            E +WQ +++ S  TM+SG YPVR GEPDC+YY+RTGLCRFG SCRFNHP +R  AIA+AR
Sbjct  51   EGMWQQMAMSSGATMQSGPYPVRPGEPDCTYYLRTGLCRFGMSCRFNHPQDRNTAIASAR  110

Query  444  MK  449
            MK
Sbjct  111  MK  112


 Score = 79.7 bits (195),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 38/72 (53%), Positives = 46/72 (64%), Gaps = 0/72 (0%)
 Frame = +1

Query  451  YYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTC  630
            YY+KTG CKFGA CKFHHPR ++       L+ +G PLRP +  C +Y R G CKFG  C
Sbjct  334  YYIKTGDCKFGAVCKFHHPRVRSQPPPDCILSPMGLPLRPGEELCKFYSRYGICKFGVNC  393

Query  631  KFHHPQPSNMMV  666
            KF HP  + M V
Sbjct  394  KFDHPMAAPMGV  405


 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 44/66 (67%), Gaps = 1/66 (2%)
 Frame = +1

Query  451  YYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTC  630
            YYL+TG C+FG +C+F+HP+D+        +    YP R    EC YY++TG CKFG TC
Sbjct  81   YYLRTGLCRFGMSCRFNHPQDRNTAIASARMKGE-YPERVGQPECQYYLKTGTCKFGPTC  139

Query  631  KFHHPQ  648
            KFHHP+
Sbjct  140  KFHHPR  145


 Score = 48.1 bits (113),  Expect(2) = 9e-07, Method: Compositional matrix adjust.
 Identities = 18/34 (53%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = +3

Query  318  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNR  419
             +P R  +P+C YYI+TG C+FGA C+F+HP  R
Sbjct  322  VFPERPDQPECIYYIKTGDCKFGAVCKFHHPRVR  355


 Score = 32.3 bits (72),  Expect(2) = 9e-07, Method: Compositional matrix adjust.
 Identities = 12/20 (60%), Positives = 14/20 (70%), Gaps = 0/20 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHP  507
            K+Y + G CKFG  CKF HP
Sbjct  379  KFYSRYGICKFGVNCKFDHP  398


 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 30/47 (64%), Gaps = 0/47 (0%)
 Frame = +3

Query  315  GTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKVL  455
            G YP R G+P+C YY++TG C+FG +C+F+HP  +       ++  L
Sbjct  113  GEYPERVGQPECQYYLKTGTCKFGPTCKFHHPREKAGIAGMVQLNTL  159


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +1

Query  556  YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMV  666
            YP+RP + +C YY+RTG C+FG +C+F+HPQ  N  +
Sbjct  70   YPVRPGEPDCTYYLRTGLCRFGMSCRFNHPQDRNTAI  106


 Score = 50.1 bits (118),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +1

Query  556  YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQ  648
            +P RP+  EC YY++TG CKFG+ CKFHHP+
Sbjct  323  FPERPDQPECIYYIKTGDCKFGAVCKFHHPR  353



>gb|EEE55890.1| hypothetical protein OsJ_04549 [Oryza sativa Japonica Group]
Length=380

 Score =   142 bits (358),  Expect(2) = 2e-51, Method: Compositional matrix adjust.
 Identities = 65/91 (71%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFG TCKFHHPR+KAGIAGRV LN LGYPLRP++ EC YY++TGQCK+G+T
Sbjct  73   QYYLKTGTCKFGPTCKFHHPREKAGIAGRVQLNTLGYPLRPSEKECAYYLKTGQCKYGNT  132

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTPG  720
            CKFHHP+  N M   RGSP YP VHS  T G
Sbjct  133  CKFHHPELFNAMASSRGSPIYPSVHSSATAG  163


 Score = 88.6 bits (218),  Expect(2) = 2e-51, Method: Compositional matrix adjust.
 Identities = 38/60 (63%), Positives = 47/60 (78%), Gaps = 1/60 (2%)
 Frame = +3

Query  273  LWQ-LSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMK  449
            +WQ +++     M+ G YP R GEPDC+YY+RTGLCRFG SCRFNHP +R LAIA+ARMK
Sbjct  1    MWQQMTMSGSGAMQPGPYPERSGEPDCTYYLRTGLCRFGMSCRFNHPQDRNLAIASARMK  60


 Score = 80.9 bits (198),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 41/81 (51%), Positives = 50/81 (62%), Gaps = 4/81 (5%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YY+KTG CKFGA CKFHHPR ++       L+ +G PLRP +  C +Y R G CKFG+ 
Sbjct  280  QYYMKTGDCKFGAVCKFHHPRVRSMPTPDCVLSPVGLPLRPGEELCKFYSRYGICKFGAN  339

Query  628  CKFHHPQPSNMMVPLRGSPAY  690
            CKF HP     M P  G  AY
Sbjct  340  CKFDHP----TMAPPMGVYAY  356


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/46 (48%), Positives = 34/46 (74%), Gaps = 2/46 (4%)
 Frame = +3

Query  315  GTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKV  452
            G YP R G+P+C YY++TG C+FG +C+F+HP  R+ A  A R+++
Sbjct  61   GEYPERMGQPECQYYLKTGTCKFGPTCKFHHP--REKAGIAGRVQL  104


 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 34/56 (61%), Gaps = 3/56 (5%)
 Frame = +1

Query  556  YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  723
            +P RP+  EC YYM+TG CKFG+ CKFHHP+  +M  P        PV  P  PG+
Sbjct  270  FPERPDQPECQYYMKTGDCKFGAVCKFHHPRVRSMPTP---DCVLSPVGLPLRPGE  322


 Score = 50.1 bits (118),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 20/48 (42%), Positives = 32/48 (67%), Gaps = 0/48 (0%)
 Frame = +1

Query  523  IAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMV  666
            ++G  A+    YP R  + +C YY+RTG C+FG +C+F+HPQ  N+ +
Sbjct  7    MSGSGAMQPGPYPERSGEPDCTYYLRTGLCRFGMSCRFNHPQDRNLAI  54



>dbj|BAJ99149.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=383

 Score =   136 bits (343),  Expect(2) = 2e-51, Method: Compositional matrix adjust.
 Identities = 62/91 (68%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFG TCKFHHPR+KAGIAG V LN LGYPLRPN+ EC YY++TGQCK+G+T
Sbjct  73   QYYLKTGTCKFGPTCKFHHPREKAGIAGMVQLNALGYPLRPNERECAYYLKTGQCKYGNT  132

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTPG  720
            CKF+HP+  N +   RGSP YPPVH+  + G
Sbjct  133  CKFNHPEIFNAVASSRGSPIYPPVHTSGSTG  163


 Score = 93.6 bits (231),  Expect(2) = 2e-51, Method: Compositional matrix adjust.
 Identities = 41/60 (68%), Positives = 50/60 (83%), Gaps = 1/60 (2%)
 Frame = +3

Query  273  LWQ-LSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMK  449
            +WQ +++ S  TM+SG YPVR GEPDC+YY+RTGLCRFG SCRFNHP +R  AIA+ARMK
Sbjct  1    MWQQMTMNSGVTMQSGPYPVRPGEPDCTYYLRTGLCRFGMSCRFNHPQDRNTAIASARMK  60


 Score = 79.7 bits (195),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 38/72 (53%), Positives = 46/72 (64%), Gaps = 0/72 (0%)
 Frame = +1

Query  451  YYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTC  630
            YY+KTG CKFGA CKFHHPR ++       L+ +G PLRP +  C +Y R G CKFG  C
Sbjct  282  YYIKTGDCKFGAVCKFHHPRVRSQPPPDCILSPMGLPLRPGEELCKFYSRYGICKFGVNC  341

Query  631  KFHHPQPSNMMV  666
            KF HP  + M V
Sbjct  342  KFDHPMAAPMGV  353


 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 44/66 (67%), Gaps = 1/66 (2%)
 Frame = +1

Query  451  YYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTC  630
            YYL+TG C+FG +C+F+HP+D+        +    YP R    EC YY++TG CKFG TC
Sbjct  29   YYLRTGLCRFGMSCRFNHPQDRNTAIASARMKGE-YPERVGQPECQYYLKTGTCKFGPTC  87

Query  631  KFHHPQ  648
            KFHHP+
Sbjct  88   KFHHPR  93


 Score = 47.8 bits (112),  Expect(2) = 1e-06, Method: Compositional matrix adjust.
 Identities = 18/34 (53%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = +3

Query  318  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNR  419
             +P R  +P+C YYI+TG C+FGA C+F+HP  R
Sbjct  270  VFPERPDQPECIYYIKTGDCKFGAVCKFHHPRVR  303


 Score = 32.3 bits (72),  Expect(2) = 1e-06, Method: Compositional matrix adjust.
 Identities = 12/20 (60%), Positives = 14/20 (70%), Gaps = 0/20 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHP  507
            K+Y + G CKFG  CKF HP
Sbjct  327  KFYSRYGICKFGVNCKFDHP  346


 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 30/47 (64%), Gaps = 0/47 (0%)
 Frame = +3

Query  315  GTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKVL  455
            G YP R G+P+C YY++TG C+FG +C+F+HP  +       ++  L
Sbjct  61   GEYPERVGQPECQYYLKTGTCKFGPTCKFHHPREKAGIAGMVQLNAL  107


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/44 (45%), Positives = 30/44 (68%), Gaps = 0/44 (0%)
 Frame = +1

Query  535  VALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMV  666
            V +    YP+RP + +C YY+RTG C+FG +C+F+HPQ  N  +
Sbjct  11   VTMQSGPYPVRPGEPDCTYYLRTGLCRFGMSCRFNHPQDRNTAI  54



>ref|XP_009147316.1| PREDICTED: zinc finger CCCH domain-containing protein 33 [Brassica 
rapa]
Length=392

 Score =   129 bits (324),  Expect(2) = 3e-51, Method: Compositional matrix adjust.
 Identities = 57/82 (70%), Positives = 70/82 (85%), Gaps = 5/82 (6%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFG TCKFHHPR+KAGIAGRV+LN+LGYPLR N+++C Y++RTG CKFG+T
Sbjct  92   EYYLKTGTCKFGVTCKFHHPRNKAGIAGRVSLNMLGYPLRSNEVDCAYFLRTGHCKFGAT  151

Query  628  CKFHHPQP-----SNMMVPLRG  678
            CKF+HPQP     +N+MVP  G
Sbjct  152  CKFNHPQPQPQPTTNLMVPTSG  173


 Score =   100 bits (249),  Expect(2) = 3e-51, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 59/75 (79%), Gaps = 1/75 (1%)
 Frame = +3

Query  225  AVFMSKDTAICTR*ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFN  404
             V MS  + + T+ E +WQ++L   ETME+G+YP R GEP+CSYYIRTGLCRFG++CRFN
Sbjct  6    GVPMSSLSPLMTQ-EAMWQMNLSQDETMETGSYPERPGEPNCSYYIRTGLCRFGSTCRFN  64

Query  405  HPSNRKLAIAAARMK  449
            HP +R+L IA ARM+
Sbjct  65   HPPDRELVIATARMR  79


 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 44/66 (67%), Gaps = 0/66 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y+KTG CKFG  CKFHHPRD+        L+ +G PLRP +  C +Y R   CKFG +
Sbjct  283  QFYMKTGDCKFGTVCKFHHPRDRQAPPPDCLLSPIGLPLRPGEPLCVFYSRYRICKFGPS  342

Query  628  CKFHHP  645
            CKFHHP
Sbjct  343  CKFHHP  348


 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 45/67 (67%), Gaps = 1/67 (1%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
             YY++TG C+FG+TC+F+HP D+  +     +    YP R    EC YY++TG CKFG T
Sbjct  47   SYYIRTGLCRFGSTCRFNHPPDRELVIATARMRGE-YPERIGQPECEYYLKTGTCKFGVT  105

Query  628  CKFHHPQ  648
            CKFHHP+
Sbjct  106  CKFHHPR  112


 Score = 49.7 bits (117),  Expect(2) = 9e-07, Method: Compositional matrix adjust.
 Identities = 16/35 (46%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  318  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRK  422
             +P R G+P+C +Y++TG C+FG  C+F+HP +R+
Sbjct  272  VFPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQ  306


 Score = 30.8 bits (68),  Expect(2) = 9e-07, Method: Compositional matrix adjust.
 Identities = 11/21 (52%), Positives = 15/21 (71%), Gaps = 0/21 (0%)
 Frame = +1

Query  451  YYLKTGACKFGATCKFHHPRD  513
            +Y +   CKFG +CKFHHP +
Sbjct  330  FYSRYRICKFGPSCKFHHPME  350


 Score = 53.1 bits (126),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 19/30 (63%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHP  410
            YP+R  E DC+Y++RTG C+FGA+C+FNHP
Sbjct  128  YPLRSNEVDCAYFLRTGHCKFGATCKFNHP  157



>emb|CDY51531.1| BnaA05g33310D [Brassica napus]
Length=395

 Score =   129 bits (324),  Expect(2) = 3e-51, Method: Compositional matrix adjust.
 Identities = 57/82 (70%), Positives = 70/82 (85%), Gaps = 5/82 (6%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFG TCKFHHPR+KAGIAGRV+LN+LGYPLR N+++C Y++RTG CKFG+T
Sbjct  92   EYYLKTGTCKFGVTCKFHHPRNKAGIAGRVSLNMLGYPLRSNEVDCAYFLRTGHCKFGAT  151

Query  628  CKFHHPQP-----SNMMVPLRG  678
            CKF+HPQP     +N+MVP  G
Sbjct  152  CKFNHPQPQPQPTTNLMVPTSG  173


 Score =   100 bits (249),  Expect(2) = 3e-51, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 59/75 (79%), Gaps = 1/75 (1%)
 Frame = +3

Query  225  AVFMSKDTAICTR*ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFN  404
             V MS  + + T+ E +WQ++L   ETME+G+YP R GEP+CSYYIRTGLCRFG++CRFN
Sbjct  6    GVPMSSLSPLMTQ-EAMWQMNLSPDETMETGSYPERPGEPNCSYYIRTGLCRFGSTCRFN  64

Query  405  HPSNRKLAIAAARMK  449
            HP +R+L IA ARM+
Sbjct  65   HPPDRELVIATARMR  79


 Score = 83.2 bits (204),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 45/66 (68%), Gaps = 0/66 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y+KTG CKFG  CKFHHPRD+        L+ +G PLRP +  C +Y R G CKFG +
Sbjct  286  QFYMKTGDCKFGTVCKFHHPRDRQAPPPDCLLSTIGLPLRPGEPLCVFYSRYGICKFGPS  345

Query  628  CKFHHP  645
            CKFHHP
Sbjct  346  CKFHHP  351


 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 45/67 (67%), Gaps = 1/67 (1%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
             YY++TG C+FG+TC+F+HP D+  +     +    YP R    EC YY++TG CKFG T
Sbjct  47   SYYIRTGLCRFGSTCRFNHPPDRELVIATARMRGE-YPERIGQPECEYYLKTGTCKFGVT  105

Query  628  CKFHHPQ  648
            CKFHHP+
Sbjct  106  CKFHHPR  112


 Score = 49.7 bits (117),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRK  422
            +P R G+P+C +Y++TG C+FG  C+F+HP +R+
Sbjct  276  FPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQ  309


 Score = 33.5 bits (75),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 12/21 (57%), Positives = 16/21 (76%), Gaps = 0/21 (0%)
 Frame = +1

Query  451  YYLKTGACKFGATCKFHHPRD  513
            +Y + G CKFG +CKFHHP +
Sbjct  333  FYSRYGICKFGPSCKFHHPME  353


 Score = 53.1 bits (126),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 19/30 (63%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHP  410
            YP+R  E DC+Y++RTG C+FGA+C+FNHP
Sbjct  128  YPLRSNEVDCAYFLRTGHCKFGATCKFNHP  157



>ref|XP_006408377.1| hypothetical protein EUTSA_v10020900mg [Eutrema salsugineum]
 gb|ESQ49830.1| hypothetical protein EUTSA_v10020900mg [Eutrema salsugineum]
Length=369

 Score =   133 bits (334),  Expect(2) = 3e-51, Method: Compositional matrix adjust.
 Identities = 59/85 (69%), Positives = 72/85 (85%), Gaps = 3/85 (4%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFG +CKFHHPR+KAGIAGRV+LN+LGYPLR N+++C Y++RTG CKFG T
Sbjct  72   EYYLKTGTCKFGVSCKFHHPRNKAGIAGRVSLNMLGYPLRSNEVDCAYFLRTGHCKFGGT  131

Query  628  CKFHHPQP---SNMMVPLRGSPAYP  693
            CKF+HPQP   +NMMVP  G  +YP
Sbjct  132  CKFNHPQPQPTTNMMVPASGQQSYP  156


 Score = 96.7 bits (239),  Expect(2) = 3e-51, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 52/59 (88%), Gaps = 0/59 (0%)
 Frame = +3

Query  273  LWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMK  449
            +WQ++L S ETME+G+YP R GEP+CSY+IRTGLCRFG++CRFNHP +R+L IA ARM+
Sbjct  1    MWQMNLSSDETMETGSYPERPGEPNCSYFIRTGLCRFGSTCRFNHPRDRELVIATARMR  59


 Score = 77.8 bits (190),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 44/66 (67%), Gaps = 0/66 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y+KTG CKFG  CKFHHPRD+        L+ +G PLRP +  C +Y R G CKFG +
Sbjct  262  QFYMKTGDCKFGTVCKFHHPRDRQVPPPDCLLSPIGLPLRPGEPLCVFYTRYGICKFGPS  321

Query  628  CKFHHP  645
            CKF HP
Sbjct  322  CKFDHP  327


 Score = 77.0 bits (188),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 32/67 (48%), Positives = 46/67 (69%), Gaps = 1/67 (1%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
             Y+++TG C+FG+TC+F+HPRD+  +     +    YP R    EC YY++TG CKFG +
Sbjct  27   SYFIRTGLCRFGSTCRFNHPRDRELVIATARMRG-EYPERIGQPECEYYLKTGTCKFGVS  85

Query  628  CKFHHPQ  648
            CKFHHP+
Sbjct  86   CKFHHPR  92


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 18/30 (60%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHP  410
            YP+R  E DC+Y++RTG C+FG +C+FNHP
Sbjct  108  YPLRSNEVDCAYFLRTGHCKFGGTCKFNHP  137


 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 32/51 (63%), Gaps = 0/51 (0%)
 Frame = +1

Query  514  KAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMV  666
            +  ++    +    YP RP +  C Y++RTG C+FGSTC+F+HP+   +++
Sbjct  3    QMNLSSDETMETGSYPERPGEPNCSYFIRTGLCRFGSTCRFNHPRDRELVI  53


 Score = 50.1 bits (118),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +3

Query  318  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLA  428
             +P R G+P+C +Y++TG C+FG  C+F+HP +R++ 
Sbjct  251  VFPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQVP  287



>emb|CDY28712.1| BnaCnng05980D [Brassica napus]
Length=390

 Score =   128 bits (321),  Expect(2) = 9e-51, Method: Compositional matrix adjust.
 Identities = 56/80 (70%), Positives = 70/80 (88%), Gaps = 3/80 (4%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFG TCKFHHPR+KAGIAGRV+LN+LGYPLR N+++C Y++RTG CKFG+T
Sbjct  92   EYYLKTGTCKFGVTCKFHHPRNKAGIAGRVSLNMLGYPLRSNEVDCAYFLRTGHCKFGAT  151

Query  628  CKFHHPQP---SNMMVPLRG  678
            CKF+HPQP   +++MVP  G
Sbjct  152  CKFNHPQPQPTTSLMVPTSG  171


 Score =   100 bits (248),  Expect(2) = 9e-51, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 59/75 (79%), Gaps = 1/75 (1%)
 Frame = +3

Query  225  AVFMSKDTAICTR*ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFN  404
             V MS  + + T+ E +WQ++L   ETME+G+YP R GEP+CSYYIRTGLCRFG++CRFN
Sbjct  6    GVPMSSLSPLMTQ-EAMWQMNLSHDETMEAGSYPERPGEPNCSYYIRTGLCRFGSTCRFN  64

Query  405  HPSNRKLAIAAARMK  449
            HP +R+L IA ARM+
Sbjct  65   HPPDRELVIATARMR  79


 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 45/66 (68%), Gaps = 0/66 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y+KTG CKFG  CKFHHPRD+        L+ +G PLRP +  C +Y R G CKFG +
Sbjct  281  QFYMKTGDCKFGTVCKFHHPRDRQAPPPDCLLSPIGLPLRPGEPLCVFYSRYGICKFGPS  340

Query  628  CKFHHP  645
            CKFHHP
Sbjct  341  CKFHHP  346


 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 45/67 (67%), Gaps = 1/67 (1%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
             YY++TG C+FG+TC+F+HP D+  +     +    YP R    EC YY++TG CKFG T
Sbjct  47   SYYIRTGLCRFGSTCRFNHPPDRELVIATARMRGE-YPERIGQPECEYYLKTGTCKFGVT  105

Query  628  CKFHHPQ  648
            CKFHHP+
Sbjct  106  CKFHHPR  112


 Score = 49.7 bits (117),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 16/35 (46%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  318  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRK  422
             +P R G+P+C +Y++TG C+FG  C+F+HP +R+
Sbjct  270  VFPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQ  304


 Score = 33.5 bits (75),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 12/21 (57%), Positives = 16/21 (76%), Gaps = 0/21 (0%)
 Frame = +1

Query  451  YYLKTGACKFGATCKFHHPRD  513
            +Y + G CKFG +CKFHHP +
Sbjct  328  FYSRYGICKFGPSCKFHHPME  348


 Score = 53.1 bits (126),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 19/30 (63%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHP  410
            YP+R  E DC+Y++RTG C+FGA+C+FNHP
Sbjct  128  YPLRSNEVDCAYFLRTGHCKFGATCKFNHP  157



>emb|CDX74233.1| BnaA03g28140D [Brassica napus]
Length=365

 Score =   127 bits (319),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 56/80 (70%), Positives = 69/80 (86%), Gaps = 3/80 (4%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFG TCKFHHPR+KAGIAG V+LN+LGYPLR N+++C Y++RTG CKFG+T
Sbjct  78   EYYLKTGTCKFGVTCKFHHPRNKAGIAGSVSLNMLGYPLRSNEVDCAYFLRTGHCKFGAT  137

Query  628  CKFHHPQP---SNMMVPLRG  678
            CKF+HPQP   +N+MVP  G
Sbjct  138  CKFNHPQPQPTTNLMVPTSG  157


 Score =   100 bits (249),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = +3

Query  267  ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARM  446
            E +WQ+++ S ETME G+YP R GEPDCSYYIRTGLCRFG++CRFNHP +R+L IA ARM
Sbjct  5    EAMWQMNMTSDETMEPGSYPERPGEPDCSYYIRTGLCRFGSTCRFNHPRDRELVIATARM  64

Query  447  K  449
            +
Sbjct  65   R  65


 Score = 79.3 bits (194),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 34/67 (51%), Positives = 46/67 (69%), Gaps = 1/67 (1%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
             YY++TG C+FG+TC+F+HPRD+  +     +    YP R    EC YY++TG CKFG T
Sbjct  33   SYYIRTGLCRFGSTCRFNHPRDRELVIATARMRG-EYPERIGQPECEYYLKTGTCKFGVT  91

Query  628  CKFHHPQ  648
            CKFHHP+
Sbjct  92   CKFHHPR  98


 Score = 77.8 bits (190),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 44/66 (67%), Gaps = 0/66 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y+KTG CKFG  CKFHHPRD+        L+ +G PLRP +  C +Y R   CKFG +
Sbjct  250  QFYMKTGDCKFGTVCKFHHPRDRQTPPPDCLLSPIGLPLRPGEPLCVFYSRYRICKFGPS  309

Query  628  CKFHHP  645
            CKFHHP
Sbjct  310  CKFHHP  315


 Score = 52.8 bits (125),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 19/30 (63%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHP  410
            YP+R  E DC+Y++RTG C+FGA+C+FNHP
Sbjct  114  YPLRSNEVDCAYFLRTGHCKFGATCKFNHP  143


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +1

Query  556  YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMV  666
            YP RP + +C YY+RTG C+FGSTC+F+HP+   +++
Sbjct  23   YPERPGEPDCSYYIRTGLCRFGSTCRFNHPRDRELVI  59



>gb|ACF82040.1| unknown [Zea mays]
 gb|AFT82648.1| C3H49 C3H type transcription factor, partial [Zea mays subsp. 
mays]
 gb|AFW84180.1| zinc finger CCCH type domain-containing protein ZFN-like 2 [Zea 
mays]
Length=427

 Score =   132 bits (333),  Expect(2) = 2e-50, Method: Compositional matrix adjust.
 Identities = 61/91 (67%), Positives = 72/91 (79%), Gaps = 0/91 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFG TCKFHHPR+KAGIAGRV LN LGYPL PN+ EC YY++TGQCK+ +T
Sbjct  121  QYYLKTGTCKFGPTCKFHHPREKAGIAGRVQLNTLGYPLLPNEKECAYYLKTGQCKYANT  180

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTPG  720
            CKFHHP+  N++   RGSP Y  VHS  + G
Sbjct  181  CKFHHPELFNVVPSSRGSPIYTSVHSSASAG  211


 Score = 94.4 bits (233),  Expect(2) = 2e-50, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 51/62 (82%), Gaps = 1/62 (2%)
 Frame = +3

Query  267  ETLWQ-LSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAAR  443
            E +WQ +++ S  TM+ G+YP R GEPDC+YY+RTGLCRFG SCRFNHP +R LAIA+AR
Sbjct  47   EGMWQQMAMNSGATMQPGSYPERPGEPDCTYYLRTGLCRFGMSCRFNHPPDRNLAIASAR  106

Query  444  MK  449
            MK
Sbjct  107  MK  108


 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 45/66 (68%), Gaps = 0/66 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YY+KTG CKFGA CKFHHPR ++       L+ +G P+RP +  C +Y R G CKFG+ 
Sbjct  319  QYYMKTGDCKFGAVCKFHHPRVRSQPPPDCVLSPMGLPIRPGEELCKFYSRYGICKFGAN  378

Query  628  CKFHHP  645
            CKF HP
Sbjct  379  CKFDHP  384


 Score = 74.3 bits (181),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 45/66 (68%), Gaps = 1/66 (2%)
 Frame = +1

Query  451  YYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTC  630
            YYL+TG C+FG +C+F+HP D+  +A   A     YP R    EC YY++TG CKFG TC
Sbjct  77   YYLRTGLCRFGMSCRFNHPPDR-NLAIASARMKGEYPERVGQPECQYYLKTGTCKFGPTC  135

Query  631  KFHHPQ  648
            KFHHP+
Sbjct  136  KFHHPR  141


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/46 (48%), Positives = 34/46 (74%), Gaps = 2/46 (4%)
 Frame = +3

Query  315  GTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKV  452
            G YP R G+P+C YY++TG C+FG +C+F+HP  R+ A  A R+++
Sbjct  109  GEYPERVGQPECQYYLKTGTCKFGPTCKFHHP--REKAGIAGRVQL  152


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +1

Query  556  YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQ  648
            +P RP++ EC YYM+TG CKFG+ CKFHHP+
Sbjct  309  FPERPDEPECQYYMKTGDCKFGAVCKFHHPR  339



>emb|CDX92015.1| BnaC03g33170D [Brassica napus]
Length=371

 Score =   125 bits (315),  Expect(2) = 2e-50, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 70/80 (88%), Gaps = 4/80 (5%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFG TCKFHHPR+KAGIAGRV+LN+LGYPLR N+++C Y++RTG CKFG+T
Sbjct  85   EYYLKTGTCKFGVTCKFHHPRNKAGIAGRVSLNMLGYPLR-NEVDCAYFLRTGHCKFGAT  143

Query  628  CKFHHPQP---SNMMVPLRG  678
            CKF+HPQP   +N+MVP  G
Sbjct  144  CKFNHPQPQPTTNLMVPTSG  163


 Score =   101 bits (251),  Expect(2) = 2e-50, Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 56/72 (78%), Gaps = 0/72 (0%)
 Frame = +3

Query  234  MSKDTAICTR*ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPS  413
            MS  + +    E +WQ+++ S ETME G+YP R GEPDCSYYIRTGLCRFG++CRFNHP 
Sbjct  1    MSSLSPLMINQEAMWQMNMTSDETMEPGSYPERPGEPDCSYYIRTGLCRFGSTCRFNHPR  60

Query  414  NRKLAIAAARMK  449
            +R+L IA ARM+
Sbjct  61   DRELVIATARMR  72


 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 45/66 (68%), Gaps = 0/66 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y+KTG CKFG  CKFHHPRD+        L+ +G PLRP +  C +Y R G CKFG +
Sbjct  256  QFYVKTGDCKFGTVCKFHHPRDRQTPPPDCLLSPIGLPLRPGEPSCVFYSRYGICKFGPS  315

Query  628  CKFHHP  645
            CKFHHP
Sbjct  316  CKFHHP  321


 Score = 79.7 bits (195),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 34/67 (51%), Positives = 46/67 (69%), Gaps = 1/67 (1%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
             YY++TG C+FG+TC+F+HPRD+  +     +    YP R    EC YY++TG CKFG T
Sbjct  40   SYYIRTGLCRFGSTCRFNHPRDRELVIATARMRG-EYPERIGQPECEYYLKTGTCKFGVT  98

Query  628  CKFHHPQ  648
            CKFHHP+
Sbjct  99   CKFHHPR  105


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +1

Query  556  YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMV  666
            YP RP + +C YY+RTG C+FGSTC+F+HP+   +++
Sbjct  30   YPERPGEPDCSYYIRTGLCRFGSTCRFNHPRDRELVI  66


 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRK  422
            +P R G+P+C +Y++TG C+FG  C+F+HP +R+
Sbjct  246  FPERPGQPECQFYVKTGDCKFGTVCKFHHPRDRQ  279



>ref|NP_001150019.1| zinc finger CCCH type domain-containing protein ZFN-like 2 [Zea 
mays]
 gb|ACG37517.1| zinc finger CCCH type domain-containing protein ZFN-like 2 [Zea 
mays]
Length=427

 Score =   132 bits (333),  Expect(2) = 2e-50, Method: Compositional matrix adjust.
 Identities = 61/91 (67%), Positives = 72/91 (79%), Gaps = 0/91 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFG TCKFHHPR+KAGIAGRV LN LGYPL PN+ EC YY++TGQCK+ +T
Sbjct  121  QYYLKTGTCKFGPTCKFHHPREKAGIAGRVQLNTLGYPLLPNEKECAYYLKTGQCKYANT  180

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTPG  720
            CKFHHP+  N++   RGSP Y  VHS  + G
Sbjct  181  CKFHHPELFNVVPSSRGSPIYTSVHSSASAG  211


 Score = 94.4 bits (233),  Expect(2) = 2e-50, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 51/62 (82%), Gaps = 1/62 (2%)
 Frame = +3

Query  267  ETLWQ-LSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAAR  443
            E +WQ +++ S  TM+ G+YP R GEPDC+YY+RTGLCRFG SCRFNHP +R LAIA+AR
Sbjct  47   EGMWQQMAMNSGATMQPGSYPERPGEPDCTYYLRTGLCRFGMSCRFNHPPDRNLAIASAR  106

Query  444  MK  449
            MK
Sbjct  107  MK  108


 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 45/66 (68%), Gaps = 0/66 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YY+KTG CKFGA CKFHHPR ++       L+ +G P+RP +  C +Y R G CKFG+ 
Sbjct  319  QYYMKTGDCKFGAVCKFHHPRVRSQPPPDCVLSPMGLPIRPGEELCKFYSRYGICKFGAN  378

Query  628  CKFHHP  645
            CKF HP
Sbjct  379  CKFDHP  384


 Score = 74.3 bits (181),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 45/66 (68%), Gaps = 1/66 (2%)
 Frame = +1

Query  451  YYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTC  630
            YYL+TG C+FG +C+F+HP D+  +A   A     YP R    EC YY++TG CKFG TC
Sbjct  77   YYLRTGLCRFGMSCRFNHPPDR-NLAIASARMKGEYPERVGQPECQYYLKTGTCKFGPTC  135

Query  631  KFHHPQ  648
            KFHHP+
Sbjct  136  KFHHPR  141


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/46 (48%), Positives = 34/46 (74%), Gaps = 2/46 (4%)
 Frame = +3

Query  315  GTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKV  452
            G YP R G+P+C YY++TG C+FG +C+F+HP  R+ A  A R+++
Sbjct  109  GEYPERVGQPECQYYLKTGTCKFGPTCKFHHP--REKAGIAGRVQL  152


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +1

Query  556  YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQ  648
            +P RP++ EC YYM+TG CKFG+ CKFHHP+
Sbjct  309  FPERPDEPECQYYMKTGDCKFGAVCKFHHPR  339



>ref|XP_006645228.1| PREDICTED: zinc finger CCCH domain-containing protein 12-like 
[Oryza brachyantha]
Length=381

 Score =   141 bits (356),  Expect(2) = 3e-50, Method: Compositional matrix adjust.
 Identities = 65/91 (71%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFG TCKFHHPR+KAGIAGRV LN LGYPLRP++ EC YY++TGQCK+G+T
Sbjct  73   QYYLKTGTCKFGPTCKFHHPREKAGIAGRVQLNTLGYPLRPSEKECAYYLKTGQCKYGNT  132

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTPG  720
            CKFHHP+  N M   RGSP YP VHS  T G
Sbjct  133  CKFHHPELFNAMASSRGSPIYPSVHSSATTG  163


 Score = 85.1 bits (209),  Expect(2) = 3e-50, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 46/60 (77%), Gaps = 1/60 (2%)
 Frame = +3

Query  273  LWQ-LSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMK  449
            +WQ +++     M+ G YP R  EPDC+YY+RTGLCRFG SCRFNHP +R LAIA+ARMK
Sbjct  1    MWQQMTMSGSGAMQPGPYPERPEEPDCTYYLRTGLCRFGMSCRFNHPPDRNLAIASARMK  60


 Score = 80.9 bits (198),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 41/81 (51%), Positives = 50/81 (62%), Gaps = 4/81 (5%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YY+KTG CKFGA CKFHHPR ++       L+ +G PLRP +  C +Y R G CKFG+ 
Sbjct  281  QYYMKTGDCKFGAVCKFHHPRVRSMPTPDCVLSPVGLPLRPGEELCKFYSRYGICKFGAN  340

Query  628  CKFHHPQPSNMMVPLRGSPAY  690
            CKF HP     M P  G  AY
Sbjct  341  CKFDHPS----MAPPMGVYAY  357


 Score = 74.3 bits (181),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 45/66 (68%), Gaps = 1/66 (2%)
 Frame = +1

Query  451  YYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTC  630
            YYL+TG C+FG +C+F+HP D+  +A   A     YP R    EC YY++TG CKFG TC
Sbjct  29   YYLRTGLCRFGMSCRFNHPPDR-NLAIASARMKGEYPERMGQPECQYYLKTGTCKFGPTC  87

Query  631  KFHHPQ  648
            KFHHP+
Sbjct  88   KFHHPR  93


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/46 (48%), Positives = 34/46 (74%), Gaps = 2/46 (4%)
 Frame = +3

Query  315  GTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKV  452
            G YP R G+P+C YY++TG C+FG +C+F+HP  R+ A  A R+++
Sbjct  61   GEYPERMGQPECQYYLKTGTCKFGPTCKFHHP--REKAGIAGRVQL  104


 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 34/56 (61%), Gaps = 3/56 (5%)
 Frame = +1

Query  556  YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  723
            +P RP+  EC YYM+TG CKFG+ CKFHHP+  +M  P        PV  P  PG+
Sbjct  271  FPERPDQPECQYYMKTGDCKFGAVCKFHHPRVRSMPTP---DCVLSPVGLPLRPGE  323


 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 20/48 (42%), Positives = 32/48 (67%), Gaps = 0/48 (0%)
 Frame = +1

Query  523  IAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMV  666
            ++G  A+    YP RP + +C YY+RTG C+FG +C+F+HP   N+ +
Sbjct  7    MSGSGAMQPGPYPERPEEPDCTYYLRTGLCRFGMSCRFNHPPDRNLAI  54



>ref|XP_009134712.1| PREDICTED: zinc finger CCCH domain-containing protein 33-like 
isoform X1 [Brassica rapa]
Length=379

 Score =   127 bits (319),  Expect(2) = 8e-50, Method: Compositional matrix adjust.
 Identities = 56/80 (70%), Positives = 69/80 (86%), Gaps = 3/80 (4%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFG TCKFHHPR+KAGIAG V+LN+LGYPLR N+++C Y++RTG CKFG+T
Sbjct  92   EYYLKTGTCKFGVTCKFHHPRNKAGIAGSVSLNMLGYPLRSNEVDCAYFLRTGHCKFGAT  151

Query  628  CKFHHPQP---SNMMVPLRG  678
            CKF+HPQP   +N+MVP  G
Sbjct  152  CKFNHPQPQPTTNLMVPTSG  171


 Score = 97.4 bits (241),  Expect(2) = 8e-50, Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 54/72 (75%), Gaps = 0/72 (0%)
 Frame = +3

Query  225  AVFMSKDTAICTR*ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFN  404
             V MS  + +    E +WQ++L S ETME G+YP R GEPDCSYYIRTGLCRFG++CRFN
Sbjct  6    GVPMSSLSPLMINQEAMWQMNLSSDETMELGSYPERPGEPDCSYYIRTGLCRFGSTCRFN  65

Query  405  HPSNRKLAIAAA  440
            HP +R+L IA A
Sbjct  66   HPRDRELVIATA  77


 Score = 80.1 bits (196),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 36/68 (53%), Positives = 49/68 (72%), Gaps = 4/68 (6%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLG-YPLRPNDIECPYYMRTGQCKFGS  624
             YY++TG C+FG+TC+F+HPRD+  +   +A  + G YP R    EC YY++TG CKFG 
Sbjct  48   SYYIRTGLCRFGSTCRFNHPRDRELV---IATAMRGEYPERIGQPECEYYLKTGTCKFGV  104

Query  625  TCKFHHPQ  648
            TCKFHHP+
Sbjct  105  TCKFHHPR  112


 Score = 74.3 bits (181),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 43/66 (65%), Gaps = 0/66 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y+KTG CKFG  CKFHHPRD+        L+ +G PLRP +  C +Y R   CKFG +
Sbjct  264  QFYMKTGDCKFGTVCKFHHPRDRQTPPPDCLLSPIGLPLRPGEPLCVFYSRYRICKFGPS  323

Query  628  CKFHHP  645
            CKFH P
Sbjct  324  CKFHPP  329


 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 36/60 (60%), Gaps = 0/60 (0%)
 Frame = +1

Query  514  KAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYP  693
            +  ++    + +  YP RP + +C YY+RTG C+FGSTC+F+HP+   +++       YP
Sbjct  24   QMNLSSDETMELGSYPERPGEPDCSYYIRTGLCRFGSTCRFNHPRDRELVIATAMRGEYP  83


 Score = 53.1 bits (126),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 19/30 (63%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHP  410
            YP+R  E DC+Y++RTG C+FGA+C+FNHP
Sbjct  128  YPLRSNEVDCAYFLRTGHCKFGATCKFNHP  157


 Score = 49.7 bits (117),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRK  422
            +P R G+P+C +Y++TG C+FG  C+F+HP +R+
Sbjct  254  FPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQ  287



>ref|XP_009134713.1| PREDICTED: zinc finger CCCH domain-containing protein 33-like 
isoform X2 [Brassica rapa]
Length=377

 Score =   127 bits (319),  Expect(2) = 8e-50, Method: Compositional matrix adjust.
 Identities = 56/80 (70%), Positives = 69/80 (86%), Gaps = 3/80 (4%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFG TCKFHHPR+KAGIAG V+LN+LGYPLR N+++C Y++RTG CKFG+T
Sbjct  92   EYYLKTGTCKFGVTCKFHHPRNKAGIAGSVSLNMLGYPLRSNEVDCAYFLRTGHCKFGAT  151

Query  628  CKFHHPQP---SNMMVPLRG  678
            CKF+HPQP   +N+MVP  G
Sbjct  152  CKFNHPQPQPTTNLMVPTSG  171


 Score = 97.4 bits (241),  Expect(2) = 8e-50, Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 54/72 (75%), Gaps = 0/72 (0%)
 Frame = +3

Query  225  AVFMSKDTAICTR*ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFN  404
             V MS  + +    E +WQ++L S ETME G+YP R GEPDCSYYIRTGLCRFG++CRFN
Sbjct  6    GVPMSSLSPLMINQEAMWQMNLSSDETMELGSYPERPGEPDCSYYIRTGLCRFGSTCRFN  65

Query  405  HPSNRKLAIAAA  440
            HP +R+L IA A
Sbjct  66   HPRDRELVIATA  77


 Score = 80.1 bits (196),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 36/68 (53%), Positives = 49/68 (72%), Gaps = 4/68 (6%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLG-YPLRPNDIECPYYMRTGQCKFGS  624
             YY++TG C+FG+TC+F+HPRD+  +   +A  + G YP R    EC YY++TG CKFG 
Sbjct  48   SYYIRTGLCRFGSTCRFNHPRDRELV---IATAMRGEYPERIGQPECEYYLKTGTCKFGV  104

Query  625  TCKFHHPQ  648
            TCKFHHP+
Sbjct  105  TCKFHHPR  112


 Score = 74.3 bits (181),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 43/66 (65%), Gaps = 0/66 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y+KTG CKFG  CKFHHPRD+        L+ +G PLRP +  C +Y R   CKFG +
Sbjct  262  QFYMKTGDCKFGTVCKFHHPRDRQTPPPDCLLSPIGLPLRPGEPLCVFYSRYRICKFGPS  321

Query  628  CKFHHP  645
            CKFH P
Sbjct  322  CKFHPP  327


 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 36/60 (60%), Gaps = 0/60 (0%)
 Frame = +1

Query  514  KAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYP  693
            +  ++    + +  YP RP + +C YY+RTG C+FGSTC+F+HP+   +++       YP
Sbjct  24   QMNLSSDETMELGSYPERPGEPDCSYYIRTGLCRFGSTCRFNHPRDRELVIATAMRGEYP  83


 Score = 53.1 bits (126),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 19/30 (63%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHP  410
            YP+R  E DC+Y++RTG C+FGA+C+FNHP
Sbjct  128  YPLRSNEVDCAYFLRTGHCKFGATCKFNHP  157


 Score = 49.7 bits (117),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRK  422
            +P R G+P+C +Y++TG C+FG  C+F+HP +R+
Sbjct  252  FPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQ  285



>ref|XP_008672228.1| PREDICTED: uncharacterized protein LOC100194377 isoform X1 [Zea 
mays]
Length=410

 Score =   130 bits (328),  Expect(2) = 1e-49, Method: Compositional matrix adjust.
 Identities = 60/91 (66%), Positives = 71/91 (78%), Gaps = 0/91 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFG TCKFHHPR+KAGIAGRV LN  GYPLRPN+ EC YY++TG CK+ +T
Sbjct  125  QYYLKTGTCKFGPTCKFHHPREKAGIAGRVQLNTSGYPLRPNEKECAYYLKTGHCKYANT  184

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTPG  720
            CKFHHP+  N++   RGSP Y  VHS  + G
Sbjct  185  CKFHHPELFNVVPSSRGSPIYTSVHSSASAG  215


 Score = 94.0 bits (232),  Expect(2) = 1e-49, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 51/62 (82%), Gaps = 1/62 (2%)
 Frame = +3

Query  267  ETLWQ-LSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAAR  443
            E +WQ +++ S  TM+ G+YP R GEPDC+YY+RTGLCRFG SCRFNHP +R LAIA+AR
Sbjct  51   EGMWQQMAMDSGATMQPGSYPERPGEPDCTYYLRTGLCRFGMSCRFNHPPDRNLAIASAR  110

Query  444  MK  449
            MK
Sbjct  111  MK  112


 Score = 74.7 bits (182),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 45/66 (68%), Gaps = 1/66 (2%)
 Frame = +1

Query  451  YYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTC  630
            YYL+TG C+FG +C+F+HP D+  +A   A     YP R    EC YY++TG CKFG TC
Sbjct  81   YYLRTGLCRFGMSCRFNHPPDR-NLAIASARMKGEYPERAGQPECQYYLKTGTCKFGPTC  139

Query  631  KFHHPQ  648
            KFHHP+
Sbjct  140  KFHHPR  145


 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 37/73 (51%), Gaps = 20/73 (27%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YY+KTG CKFGA CKFHHPR                     +  C +Y R G CKFG+ 
Sbjct  323  QYYMKTGDCKFGAVCKFHHPR--------------------GEELCKFYSRYGICKFGAN  362

Query  628  CKFHHPQPSNMMV  666
            CKF HP     MV
Sbjct  363  CKFDHPTVVAPMV  375


 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/46 (48%), Positives = 34/46 (74%), Gaps = 2/46 (4%)
 Frame = +3

Query  315  GTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKV  452
            G YP R G+P+C YY++TG C+FG +C+F+HP  R+ A  A R+++
Sbjct  113  GEYPERAGQPECQYYLKTGTCKFGPTCKFHHP--REKAGIAGRVQL  156


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +1

Query  556  YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNM  660
            +P RP++ EC YYM+TG CKFG+ CKFHHP+   +
Sbjct  313  FPERPDEPECQYYMKTGDCKFGAVCKFHHPRGEEL  347


 Score = 50.1 bits (118),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 29/45 (64%), Gaps = 0/45 (0%)
 Frame = +3

Query  318  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKV  452
             +P R  EP+C YY++TG C+FGA C+F+HP   +L    +R  +
Sbjct  312  VFPERPDEPECQYYMKTGDCKFGAVCKFHHPRGEELCKFYSRYGI  356



>ref|NP_001132883.1| uncharacterized protein LOC100194377 [Zea mays]
 gb|ACF81912.1| unknown [Zea mays]
Length=430

 Score =   130 bits (327),  Expect(2) = 1e-49, Method: Compositional matrix adjust.
 Identities = 60/91 (66%), Positives = 71/91 (78%), Gaps = 0/91 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFG TCKFHHPR+KAGIAGRV LN  GYPLRPN+ EC YY++TG CK+ +T
Sbjct  125  QYYLKTGTCKFGPTCKFHHPREKAGIAGRVQLNTSGYPLRPNEKECAYYLKTGHCKYANT  184

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTPG  720
            CKFHHP+  N++   RGSP Y  VHS  + G
Sbjct  185  CKFHHPELFNVVPSSRGSPIYTSVHSSASAG  215


 Score = 94.0 bits (232),  Expect(2) = 1e-49, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 51/62 (82%), Gaps = 1/62 (2%)
 Frame = +3

Query  267  ETLWQ-LSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAAR  443
            E +WQ +++ S  TM+ G+YP R GEPDC+YY+RTGLCRFG SCRFNHP +R LAIA+AR
Sbjct  51   EGMWQQMAMDSGATMQPGSYPERPGEPDCTYYLRTGLCRFGMSCRFNHPPDRNLAIASAR  110

Query  444  MK  449
            MK
Sbjct  111  MK  112


 Score = 80.1 bits (196),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 38/73 (52%), Positives = 47/73 (64%), Gaps = 0/73 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YY+KTG CKFGA CKFHHPR ++       L+ +G PLRP +  C +Y R G CKFG+ 
Sbjct  323  QYYMKTGDCKFGAVCKFHHPRVRSLPPPDCVLSPMGLPLRPGEELCKFYSRYGICKFGAN  382

Query  628  CKFHHPQPSNMMV  666
            CKF HP     MV
Sbjct  383  CKFDHPTVVAPMV  395


 Score = 74.7 bits (182),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 45/66 (68%), Gaps = 1/66 (2%)
 Frame = +1

Query  451  YYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTC  630
            YYL+TG C+FG +C+F+HP D+  +A   A     YP R    EC YY++TG CKFG TC
Sbjct  81   YYLRTGLCRFGMSCRFNHPPDR-NLAIASARMKGEYPERAGQPECQYYLKTGTCKFGPTC  139

Query  631  KFHHPQ  648
            KFHHP+
Sbjct  140  KFHHPR  145


 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/46 (48%), Positives = 34/46 (74%), Gaps = 2/46 (4%)
 Frame = +3

Query  315  GTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKV  452
            G YP R G+P+C YY++TG C+FG +C+F+HP  R+ A  A R+++
Sbjct  113  GEYPERAGQPECQYYLKTGTCKFGPTCKFHHP--REKAGIAGRVQL  156


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +1

Query  556  YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQ  648
            +P RP++ EC YYM+TG CKFG+ CKFHHP+
Sbjct  313  FPERPDEPECQYYMKTGDCKFGAVCKFHHPR  343


 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 19/36 (53%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +3

Query  318  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKL  425
             +P R  EP+C YY++TG C+FGA C+F+HP  R L
Sbjct  312  VFPERPDEPECQYYMKTGDCKFGAVCKFHHPRVRSL  347



>tpg|DAA56151.1| TPA: hypothetical protein ZEAMMB73_608000 [Zea mays]
Length=430

 Score =   130 bits (327),  Expect(2) = 2e-49, Method: Compositional matrix adjust.
 Identities = 60/91 (66%), Positives = 71/91 (78%), Gaps = 0/91 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFG TCKFHHPR+KAGIAGRV LN  GYPLRPN+ EC YY++TG CK+ +T
Sbjct  125  QYYLKTGTCKFGPTCKFHHPREKAGIAGRVQLNTSGYPLRPNEKECAYYLKTGHCKYANT  184

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTPG  720
            CKFHHP+  N++   RGSP Y  VHS  + G
Sbjct  185  CKFHHPELFNVVPSSRGSPIYTSVHSSASAG  215


 Score = 93.6 bits (231),  Expect(2) = 2e-49, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 51/62 (82%), Gaps = 1/62 (2%)
 Frame = +3

Query  267  ETLWQ-LSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAAR  443
            E +WQ +++ S  TM+ G+YP R GEPDC+YY+RTGLCRFG SCRFNHP +R LAIA+AR
Sbjct  51   EGMWQQMAMDSGATMQPGSYPERPGEPDCTYYLRTGLCRFGMSCRFNHPPDRNLAIASAR  110

Query  444  MK  449
            MK
Sbjct  111  MK  112


 Score = 79.7 bits (195),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 38/73 (52%), Positives = 47/73 (64%), Gaps = 0/73 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YY+KTG CKFGA CKFHHPR ++       L+ +G PLRP +  C +Y R G CKFG+ 
Sbjct  323  QYYMKTGDCKFGAVCKFHHPRVRSLPPPDCVLSPMGLPLRPGEELCKFYSRYGICKFGAN  382

Query  628  CKFHHPQPSNMMV  666
            CKF HP     MV
Sbjct  383  CKFDHPTVVAPMV  395


 Score = 74.7 bits (182),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 45/66 (68%), Gaps = 1/66 (2%)
 Frame = +1

Query  451  YYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTC  630
            YYL+TG C+FG +C+F+HP D+  +A   A     YP R    EC YY++TG CKFG TC
Sbjct  81   YYLRTGLCRFGMSCRFNHPPDR-NLAIASARMKGEYPERAGQPECQYYLKTGTCKFGPTC  139

Query  631  KFHHPQ  648
            KFHHP+
Sbjct  140  KFHHPR  145


 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/46 (48%), Positives = 34/46 (74%), Gaps = 2/46 (4%)
 Frame = +3

Query  315  GTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKV  452
            G YP R G+P+C YY++TG C+FG +C+F+HP  R+ A  A R+++
Sbjct  113  GEYPERAGQPECQYYLKTGTCKFGPTCKFHHP--REKAGIAGRVQL  156


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +1

Query  556  YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQ  648
            +P RP++ EC YYM+TG CKFG+ CKFHHP+
Sbjct  313  FPERPDEPECQYYMKTGDCKFGAVCKFHHPR  343


 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 19/36 (53%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +3

Query  318  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKL  425
             +P R  EP+C YY++TG C+FGA C+F+HP  R L
Sbjct  312  VFPERPDEPECQYYMKTGDCKFGAVCKFHHPRVRSL  347



>gb|ACN33948.1| unknown [Zea mays]
 gb|AFW84182.1| hypothetical protein ZEAMMB73_594165 [Zea mays]
Length=377

 Score =   132 bits (332),  Expect(2) = 4e-49, Method: Compositional matrix adjust.
 Identities = 61/91 (67%), Positives = 72/91 (79%), Gaps = 0/91 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFG TCKFHHPR+KAGIAGRV LN LGYPL PN+ EC YY++TGQCK+ +T
Sbjct  71   QYYLKTGTCKFGPTCKFHHPREKAGIAGRVQLNTLGYPLLPNEKECAYYLKTGQCKYANT  130

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTPG  720
            CKFHHP+  N++   RGSP Y  VHS  + G
Sbjct  131  CKFHHPELFNVVPSSRGSPIYTSVHSSASAG  161


 Score = 90.5 bits (223),  Expect(2) = 4e-49, Method: Compositional matrix adjust.
 Identities = 38/57 (67%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = +3

Query  279  QLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMK  449
            ++++ S  TM+ G+YP R GEPDC+YY+RTGLCRFG SCRFNHP +R LAIA+ARMK
Sbjct  2    KMAMNSGATMQPGSYPERPGEPDCTYYLRTGLCRFGMSCRFNHPPDRNLAIASARMK  58


 Score = 79.3 bits (194),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 45/66 (68%), Gaps = 0/66 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YY+KTG CKFGA CKFHHPR ++       L+ +G P+RP +  C +Y R G CKFG+ 
Sbjct  269  QYYMKTGDCKFGAVCKFHHPRVRSQPPPDCVLSPMGLPIRPGEELCKFYSRYGICKFGAN  328

Query  628  CKFHHP  645
            CKF HP
Sbjct  329  CKFDHP  334


 Score = 74.3 bits (181),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 45/66 (68%), Gaps = 1/66 (2%)
 Frame = +1

Query  451  YYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTC  630
            YYL+TG C+FG +C+F+HP D+  +A   A     YP R    EC YY++TG CKFG TC
Sbjct  27   YYLRTGLCRFGMSCRFNHPPDR-NLAIASARMKGEYPERVGQPECQYYLKTGTCKFGPTC  85

Query  631  KFHHPQ  648
            KFHHP+
Sbjct  86   KFHHPR  91


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/46 (48%), Positives = 34/46 (74%), Gaps = 2/46 (4%)
 Frame = +3

Query  315  GTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKV  452
            G YP R G+P+C YY++TG C+FG +C+F+HP  R+ A  A R+++
Sbjct  59   GEYPERVGQPECQYYLKTGTCKFGPTCKFHHP--REKAGIAGRVQL  102


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +1

Query  556  YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQ  648
            +P RP++ EC YYM+TG CKFG+ CKFHHP+
Sbjct  259  FPERPDEPECQYYMKTGDCKFGAVCKFHHPR  289



>ref|XP_006408378.1| hypothetical protein EUTSA_v10020900mg [Eutrema salsugineum]
 gb|ESQ49831.1| hypothetical protein EUTSA_v10020900mg [Eutrema salsugineum]
Length=385

 Score =   125 bits (313),  Expect(2) = 5e-49, Method: Compositional matrix adjust.
 Identities = 55/81 (68%), Positives = 68/81 (84%), Gaps = 3/81 (4%)
 Frame = +1

Query  460  KTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFH  639
            +TG CKFG +CKFHHPR+KAGIAGRV+LN+LGYPLR N+++C Y++RTG CKFG TCKF+
Sbjct  92   ETGTCKFGVSCKFHHPRNKAGIAGRVSLNMLGYPLRSNEVDCAYFLRTGHCKFGGTCKFN  151

Query  640  HPQP---SNMMVPLRGSPAYP  693
            HPQP   +NMMVP  G  +YP
Sbjct  152  HPQPQPTTNMMVPASGQQSYP  172


 Score = 97.4 bits (241),  Expect(2) = 5e-49, Method: Compositional matrix adjust.
 Identities = 40/61 (66%), Positives = 53/61 (87%), Gaps = 0/61 (0%)
 Frame = +3

Query  267  ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARM  446
            + +WQ++L S ETME+G+YP R GEP+CSY+IRTGLCRFG++CRFNHP +R+L IA ARM
Sbjct  19   DAMWQMNLSSDETMETGSYPERPGEPNCSYFIRTGLCRFGSTCRFNHPRDRELVIATARM  78

Query  447  K  449
            +
Sbjct  79   R  79


 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 44/66 (67%), Gaps = 0/66 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y+KTG CKFG  CKFHHPRD+        L+ +G PLRP +  C +Y R G CKFG +
Sbjct  278  QFYMKTGDCKFGTVCKFHHPRDRQVPPPDCLLSPIGLPLRPGEPLCVFYTRYGICKFGPS  337

Query  628  CKFHHP  645
            CKF HP
Sbjct  338  CKFDHP  343


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 18/30 (60%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHP  410
            YP+R  E DC+Y++RTG C+FG +C+FNHP
Sbjct  124  YPLRSNEVDCAYFLRTGHCKFGGTCKFNHP  153


 Score = 50.1 bits (118),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 32/51 (63%), Gaps = 0/51 (0%)
 Frame = +1

Query  514  KAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMV  666
            +  ++    +    YP RP +  C Y++RTG C+FGSTC+F+HP+   +++
Sbjct  23   QMNLSSDETMETGSYPERPGEPNCSYFIRTGLCRFGSTCRFNHPRDRELVI  73


 Score = 50.1 bits (118),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +3

Query  318  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLA  428
             +P R G+P+C +Y++TG C+FG  C+F+HP +R++ 
Sbjct  267  VFPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQVP  303



>ref|NP_568332.2| zinc finger nuclease 3 [Arabidopsis thaliana]
 gb|AAD27875.1|AF138872_1 zinc finger protein 3 [Arabidopsis thaliana]
 dbj|BAB09623.1| zinc finger protein 3 [Arabidopsis thaliana]
 gb|AED92306.1| zinc finger nuclease 3 [Arabidopsis thaliana]
Length=368

 Score =   130 bits (326),  Expect(2) = 8e-49, Method: Compositional matrix adjust.
 Identities = 58/90 (64%), Positives = 72/90 (80%), Gaps = 2/90 (2%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++YLKTG CKFG TCKFHHPR+KAGI G V++NVL YPLRPN+ +C Y++R GQCKFG T
Sbjct  94   EFYLKTGTCKFGVTCKFHHPRNKAGIDGSVSVNVLSYPLRPNEDDCSYFLRIGQCKFGGT  153

Query  628  CKFHHP--QPSNMMVPLRGSPAYPPVHSPT  711
            CKF+HP  Q +N+MV +RGSP Y  + S T
Sbjct  154  CKFNHPQTQSTNLMVSVRGSPVYSALQSLT  183


 Score = 91.7 bits (226),  Expect(2) = 8e-49, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 50/60 (83%), Gaps = 1/60 (2%)
 Frame = +3

Query  273  LWQLSLRSMETME-SGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMK  449
            +WQ++L S +TM   G+YP R GEPDC+YYIRTGLCRFG++CRFNHP +RKL IA AR+K
Sbjct  22   MWQMNLGSDDTMGVDGSYPERHGEPDCAYYIRTGLCRFGSTCRFNHPHDRKLVIATARIK  81


 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 45/66 (68%), Gaps = 1/66 (2%)
 Frame = +1

Query  451  YYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTC  630
            YY++TG C+FG+TC+F+HP D+  +     +    YP R    EC +Y++TG CKFG TC
Sbjct  50   YYIRTGLCRFGSTCRFNHPHDRKLVIATARIKG-EYPERIGQPECEFYLKTGTCKFGVTC  108

Query  631  KFHHPQ  648
            KFHHP+
Sbjct  109  KFHHPR  114


 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 40/66 (61%), Gaps = 7/66 (11%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y+KTG CKFG  CKFHHPRD+        L+  G PL      C +Y R G CKFG +
Sbjct  250  QFYMKTGDCKFGTVCKFHHPRDRQTPPPDCVLSS-GEPL------CVFYSRYGICKFGPS  302

Query  628  CKFHHP  645
            CKF HP
Sbjct  303  CKFDHP  308


 Score = 56.2 bits (134),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 20/47 (43%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +3

Query  315  GTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKVL  455
            G YP R G+P+C +Y++TG C+FG +C+F+HP N+     +  + VL
Sbjct  82   GEYPERIGQPECEFYLKTGTCKFGVTCKFHHPRNKAGIDGSVSVNVL  128


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 18/41 (44%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +3

Query  318  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAA  440
            +YP+R  E DCSY++R G C+FG +C+FNHP  +   +  +
Sbjct  129  SYPLRPNEDDCSYFLRIGQCKFGGTCKFNHPQTQSTNLMVS  169


 Score = 49.7 bits (117),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 24/31 (77%), Gaps = 0/31 (0%)
 Frame = +1

Query  556  YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQ  648
            +P RP   EC +YM+TG CKFG+ CKFHHP+
Sbjct  240  FPERPGQPECQFYMKTGDCKFGTVCKFHHPR  270



>ref|XP_003564925.1| PREDICTED: zinc finger CCCH domain-containing protein 12-like 
[Brachypodium distachyon]
Length=442

 Score =   130 bits (326),  Expect(2) = 1e-48, Method: Compositional matrix adjust.
 Identities = 59/91 (65%), Positives = 72/91 (79%), Gaps = 0/91 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFG TCKFHHPR+KAGIAG V LN LGYPLR N+ EC YY++TGQCK+G+T
Sbjct  132  QYYLKTGTCKFGPTCKFHHPREKAGIAGMVQLNTLGYPLRLNEKECAYYLKTGQCKYGNT  191

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTPG  720
            CKF+HP+  N +   RGSP YP +H+  + G
Sbjct  192  CKFNHPELFNAVASSRGSPIYPSLHTSASAG  222


 Score = 91.3 bits (225),  Expect(2) = 1e-48, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 49/62 (79%), Gaps = 1/62 (2%)
 Frame = +3

Query  267  ETLWQ-LSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAAR  443
            E +WQ +++ S   M+ G YP R GEPDC+YY+RTGLCRFG SCRFNHP +R LAIA+AR
Sbjct  58   EGMWQEMTMSSGAPMQPGPYPERPGEPDCTYYLRTGLCRFGISCRFNHPPDRNLAIASAR  117

Query  444  MK  449
            MK
Sbjct  118  MK  119


 Score = 80.9 bits (198),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 42/86 (49%), Positives = 51/86 (59%), Gaps = 0/86 (0%)
 Frame = +1

Query  451  YYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTC  630
            YY+KTG CKFGA CKFHHPR ++       L+ +G PLRP +  C +Y R G CKFG  C
Sbjct  341  YYIKTGDCKFGAVCKFHHPRVRSLPPPDCVLSPMGLPLRPGEELCKFYSRYGICKFGINC  400

Query  631  KFHHPQPSNMMVPLRGSPAYPPVHSP  708
            KF HP  S M V   G  A    ++P
Sbjct  401  KFDHPMASPMGVYAYGFSASASTNAP  426


 Score = 74.3 bits (181),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 45/66 (68%), Gaps = 1/66 (2%)
 Frame = +1

Query  451  YYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTC  630
            YYL+TG C+FG +C+F+HP D+  +A   A     YP R    EC YY++TG CKFG TC
Sbjct  88   YYLRTGLCRFGISCRFNHPPDR-NLAIASARMKGEYPERVGQPECQYYLKTGTCKFGPTC  146

Query  631  KFHHPQ  648
            KFHHP+
Sbjct  147  KFHHPR  152


 Score = 49.3 bits (116),  Expect(2) = 4e-07, Method: Compositional matrix adjust.
 Identities = 19/36 (53%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +3

Query  318  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKL  425
             +P R  +P+C YYI+TG C+FGA C+F+HP  R L
Sbjct  329  VFPERPDQPECIYYIKTGDCKFGAVCKFHHPRVRSL  364


 Score = 32.0 bits (71),  Expect(2) = 4e-07, Method: Compositional matrix adjust.
 Identities = 12/20 (60%), Positives = 14/20 (70%), Gaps = 0/20 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHP  507
            K+Y + G CKFG  CKF HP
Sbjct  386  KFYSRYGICKFGINCKFDHP  405


 Score = 53.9 bits (128),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 30/47 (64%), Gaps = 0/47 (0%)
 Frame = +3

Query  315  GTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKVL  455
            G YP R G+P+C YY++TG C+FG +C+F+HP  +       ++  L
Sbjct  120  GEYPERVGQPECQYYLKTGTCKFGPTCKFHHPREKAGIAGMVQLNTL  166



>ref|NP_851041.1| zinc finger nuclease 3 [Arabidopsis thaliana]
 sp|Q8L7N8.2|C3H57_ARATH RecName: Full=Zinc finger CCCH domain-containing protein 57; 
Short=AtC3H57; AltName: Full=Zinc finger type domain-containing 
protein ZFN3 [Arabidopsis thaliana]
 gb|AED92308.1| zinc finger nuclease 3 [Arabidopsis thaliana]
Length=375

 Score =   129 bits (325),  Expect(2) = 1e-48, Method: Compositional matrix adjust.
 Identities = 58/90 (64%), Positives = 72/90 (80%), Gaps = 2/90 (2%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++YLKTG CKFG TCKFHHPR+KAGI G V++NVL YPLRPN+ +C Y++R GQCKFG T
Sbjct  94   EFYLKTGTCKFGVTCKFHHPRNKAGIDGSVSVNVLSYPLRPNEDDCSYFLRIGQCKFGGT  153

Query  628  CKFHHP--QPSNMMVPLRGSPAYPPVHSPT  711
            CKF+HP  Q +N+MV +RGSP Y  + S T
Sbjct  154  CKFNHPQTQSTNLMVSVRGSPVYSALQSLT  183


 Score = 91.7 bits (226),  Expect(2) = 1e-48, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 50/60 (83%), Gaps = 1/60 (2%)
 Frame = +3

Query  273  LWQLSLRSMETME-SGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMK  449
            +WQ++L S +TM   G+YP R GEPDC+YYIRTGLCRFG++CRFNHP +RKL IA AR+K
Sbjct  22   MWQMNLGSDDTMGVDGSYPERHGEPDCAYYIRTGLCRFGSTCRFNHPHDRKLVIATARIK  81


 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 44/66 (67%), Gaps = 0/66 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y+KTG CKFG  CKFHHPRD+        L+ +G PLRP +  C +Y R G CKFG +
Sbjct  250  QFYMKTGDCKFGTVCKFHHPRDRQTPPPDCVLSSVGLPLRPGEPLCVFYSRYGICKFGPS  309

Query  628  CKFHHP  645
            CKF HP
Sbjct  310  CKFDHP  315


 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 45/66 (68%), Gaps = 1/66 (2%)
 Frame = +1

Query  451  YYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTC  630
            YY++TG C+FG+TC+F+HP D+  +     +    YP R    EC +Y++TG CKFG TC
Sbjct  50   YYIRTGLCRFGSTCRFNHPHDRKLVIATARIKG-EYPERIGQPECEFYLKTGTCKFGVTC  108

Query  631  KFHHPQ  648
            KFHHP+
Sbjct  109  KFHHPR  114


 Score = 56.2 bits (134),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 20/47 (43%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +3

Query  315  GTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKVL  455
            G YP R G+P+C +Y++TG C+FG +C+F+HP N+     +  + VL
Sbjct  82   GEYPERIGQPECEFYLKTGTCKFGVTCKFHHPRNKAGIDGSVSVNVL  128


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 18/41 (44%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +3

Query  318  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAA  440
            +YP+R  E DCSY++R G C+FG +C+FNHP  +   +  +
Sbjct  129  SYPLRPNEDDCSYFLRIGQCKFGGTCKFNHPQTQSTNLMVS  169


 Score = 49.7 bits (117),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 24/31 (77%), Gaps = 0/31 (0%)
 Frame = +1

Query  556  YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQ  648
            +P RP   EC +YM+TG CKFG+ CKFHHP+
Sbjct  240  FPERPGQPECQFYMKTGDCKFGTVCKFHHPR  270



>ref|NP_974790.1| zinc finger nuclease 3 [Arabidopsis thaliana]
 gb|AAM61197.1| zinc finger protein 3 [Arabidopsis thaliana]
 gb|AED92307.1| zinc finger nuclease 3 [Arabidopsis thaliana]
Length=354

 Score =   129 bits (324),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 58/90 (64%), Positives = 72/90 (80%), Gaps = 2/90 (2%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++YLKTG CKFG TCKFHHPR+KAGI G V++NVL YPLRPN+ +C Y++R GQCKFG T
Sbjct  73   EFYLKTGTCKFGVTCKFHHPRNKAGIDGSVSVNVLSYPLRPNEDDCSYFLRIGQCKFGGT  132

Query  628  CKFHHP--QPSNMMVPLRGSPAYPPVHSPT  711
            CKF+HP  Q +N+MV +RGSP Y  + S T
Sbjct  133  CKFNHPQTQSTNLMVSVRGSPVYSALQSLT  162


 Score = 91.3 bits (225),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 50/60 (83%), Gaps = 1/60 (2%)
 Frame = +3

Query  273  LWQLSLRSMETME-SGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMK  449
            +WQ++L S +TM   G+YP R GEPDC+YYIRTGLCRFG++CRFNHP +RKL IA AR+K
Sbjct  1    MWQMNLGSDDTMGVDGSYPERHGEPDCAYYIRTGLCRFGSTCRFNHPHDRKLVIATARIK  60


 Score = 78.6 bits (192),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 44/66 (67%), Gaps = 0/66 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y+KTG CKFG  CKFHHPRD+        L+ +G PLRP +  C +Y R G CKFG +
Sbjct  229  QFYMKTGDCKFGTVCKFHHPRDRQTPPPDCVLSSVGLPLRPGEPLCVFYSRYGICKFGPS  288

Query  628  CKFHHP  645
            CKF HP
Sbjct  289  CKFDHP  294


 Score = 75.5 bits (184),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 45/66 (68%), Gaps = 1/66 (2%)
 Frame = +1

Query  451  YYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTC  630
            YY++TG C+FG+TC+F+HP D+  +     +    YP R    EC +Y++TG CKFG TC
Sbjct  29   YYIRTGLCRFGSTCRFNHPHDRKLVIATARIKG-EYPERIGQPECEFYLKTGTCKFGVTC  87

Query  631  KFHHPQ  648
            KFHHP+
Sbjct  88   KFHHPR  93


 Score = 56.2 bits (134),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 20/47 (43%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +3

Query  315  GTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKVL  455
            G YP R G+P+C +Y++TG C+FG +C+F+HP N+     +  + VL
Sbjct  61   GEYPERIGQPECEFYLKTGTCKFGVTCKFHHPRNKAGIDGSVSVNVL  107


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 18/41 (44%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +3

Query  318  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAA  440
            +YP+R  E DCSY++R G C+FG +C+FNHP  +   +  +
Sbjct  108  SYPLRPNEDDCSYFLRIGQCKFGGTCKFNHPQTQSTNLMVS  148



>ref|XP_010420350.1| PREDICTED: zinc finger CCCH domain-containing protein 57-like 
isoform X2 [Camelina sativa]
Length=413

 Score =   126 bits (317),  Expect(2) = 4e-48, Method: Compositional matrix adjust.
 Identities = 55/90 (61%), Positives = 70/90 (78%), Gaps = 2/90 (2%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y+KTG CKFG TCKFHHPR+  G  GRV+++VLGYPLRPN+ +C Y++RTG CKFG T
Sbjct  98   EFYMKTGTCKFGVTCKFHHPRNNVGTDGRVSVDVLGYPLRPNEDDCSYFLRTGHCKFGGT  157

Query  628  CKFHHP--QPSNMMVPLRGSPAYPPVHSPT  711
            CKF+HP  Q + +MV LRGSP Y  + S T
Sbjct  158  CKFNHPQTQSTKLMVSLRGSPVYSALQSLT  187


 Score = 92.8 bits (229),  Expect(2) = 4e-48, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 48/61 (79%), Gaps = 2/61 (3%)
 Frame = +3

Query  273  LWQLSLRSMETMESGT--YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARM  446
            +WQ++L S ETM  G   YP R GEPDCSYYIRTGLCRFG++CRFNHP +RKL IA AR 
Sbjct  25   MWQMNLGSDETMSGGDGFYPERQGEPDCSYYIRTGLCRFGSTCRFNHPHDRKLVIATART  84

Query  447  K  449
            K
Sbjct  85   K  85


 Score = 77.4 bits (189),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 34/67 (51%), Positives = 45/67 (67%), Gaps = 1/67 (1%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
             YY++TG C+FG+TC+F+HP D+  +    A     YP R    EC +YM+TG CKFG T
Sbjct  53   SYYIRTGLCRFGSTCRFNHPHDRKLVIA-TARTKGEYPERIGQPECEFYMKTGTCKFGVT  111

Query  628  CKFHHPQ  648
            CKFHHP+
Sbjct  112  CKFHHPR  118


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 40/66 (61%), Gaps = 6/66 (9%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y+KTG       CKFHHPRD+   A    L+ +G PLR  +  C +Y R G CKFG +
Sbjct  291  QFYMKTG------DCKFHHPRDRQTPAPDCVLSTVGLPLRLGEPLCVFYSRYGICKFGPS  344

Query  628  CKFHHP  645
            CKF HP
Sbjct  345  CKFDHP  350


 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 19/40 (48%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAA  440
            YP+R  E DCSY++RTG C+FG +C+FNHP  +   +  +
Sbjct  134  YPLRPNEDDCSYFLRTGHCKFGGTCKFNHPQTQSTKLMVS  173



>ref|XP_010420349.1| PREDICTED: zinc finger CCCH domain-containing protein 57-like 
isoform X1 [Camelina sativa]
Length=415

 Score =   126 bits (317),  Expect(2) = 4e-48, Method: Compositional matrix adjust.
 Identities = 55/90 (61%), Positives = 70/90 (78%), Gaps = 2/90 (2%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y+KTG CKFG TCKFHHPR+  G  GRV+++VLGYPLRPN+ +C Y++RTG CKFG T
Sbjct  98   EFYMKTGTCKFGVTCKFHHPRNNVGTDGRVSVDVLGYPLRPNEDDCSYFLRTGHCKFGGT  157

Query  628  CKFHHP--QPSNMMVPLRGSPAYPPVHSPT  711
            CKF+HP  Q + +MV LRGSP Y  + S T
Sbjct  158  CKFNHPQTQSTKLMVSLRGSPVYSALQSLT  187


 Score = 92.8 bits (229),  Expect(2) = 4e-48, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 48/61 (79%), Gaps = 2/61 (3%)
 Frame = +3

Query  273  LWQLSLRSMETMESGT--YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARM  446
            +WQ++L S ETM  G   YP R GEPDCSYYIRTGLCRFG++CRFNHP +RKL IA AR 
Sbjct  25   MWQMNLGSDETMSGGDGFYPERQGEPDCSYYIRTGLCRFGSTCRFNHPHDRKLVIATART  84

Query  447  K  449
            K
Sbjct  85   K  85


 Score = 77.4 bits (189),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 34/67 (51%), Positives = 45/67 (67%), Gaps = 1/67 (1%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
             YY++TG C+FG+TC+F+HP D+  +    A     YP R    EC +YM+TG CKFG T
Sbjct  53   SYYIRTGLCRFGSTCRFNHPHDRKLVIA-TARTKGEYPERIGQPECEFYMKTGTCKFGVT  111

Query  628  CKFHHPQ  648
            CKFHHP+
Sbjct  112  CKFHHPR  118


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 40/66 (61%), Gaps = 6/66 (9%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y+KTG       CKFHHPRD+   A    L+ +G PLR  +  C +Y R G CKFG +
Sbjct  293  QFYMKTG------DCKFHHPRDRQTPAPDCVLSTVGLPLRLGEPLCVFYSRYGICKFGPS  346

Query  628  CKFHHP  645
            CKF HP
Sbjct  347  CKFDHP  352


 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 19/40 (48%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAA  440
            YP+R  E DCSY++RTG C+FG +C+FNHP  +   +  +
Sbjct  134  YPLRPNEDDCSYFLRTGHCKFGGTCKFNHPQTQSTKLMVS  173



>dbj|BAJ86320.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=442

 Score =   132 bits (333),  Expect(2) = 5e-48, Method: Compositional matrix adjust.
 Identities = 65/92 (71%), Positives = 72/92 (78%), Gaps = 1/92 (1%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFGATCKFHHPR+KA IA    LNVLGYPLR N+ EC YY+RTGQCKF ST
Sbjct  106  QYYLKTGTCKFGATCKFHHPREKAAIAISAQLNVLGYPLRLNEKECVYYLRTGQCKFAST  165

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  723
            CKFHHPQPS+ MV +R S    P  S T+PGQ
Sbjct  166  CKFHHPQPSSTMVAIRSSIC-SPGQSTTSPGQ  196


 Score = 86.7 bits (213),  Expect(2) = 5e-48, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 48/62 (77%), Gaps = 1/62 (2%)
 Frame = +3

Query  267  ETLWQLSLR-SMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAAR  443
            E  WQ++L     +ME G YP R GE DCSYY+RTG CRFG +C+FNHP++RKLA+AAAR
Sbjct  32   EATWQMTLGCGGLSMEPGPYPERIGERDCSYYMRTGFCRFGVTCKFNHPADRKLAVAAAR  91

Query  444  MK  449
            MK
Sbjct  92   MK  93


 Score = 80.1 bits (196),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 42/82 (51%), Positives = 51/82 (62%), Gaps = 4/82 (5%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y+KTG CKFGA CKF+HP+ +   A   AL+ LG PLRP +  C +Y R G CKFG  
Sbjct  313  QFYMKTGDCKFGAVCKFNHPKKRMVPAPNCALSPLGLPLRPGEPICTFYSRYGICKFGPN  372

Query  628  CKFHHPQPSNMMVPLRGSPAYP  693
            CKF HP    M   L GSP  P
Sbjct  373  CKFDHP----MGTILYGSPTSP  390


 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 36/67 (54%), Positives = 46/67 (69%), Gaps = 1/67 (1%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
             YY++TG C+FG TCKF+HP D+  +A   A     YP R    EC YY++TG CKFG+T
Sbjct  61   SYYMRTGFCRFGVTCKFNHPADRK-LAVAAARMKGEYPYRVGQPECQYYLKTGTCKFGAT  119

Query  628  CKFHHPQ  648
            CKFHHP+
Sbjct  120  CKFHHPR  126


 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 22/47 (47%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +3

Query  315  GTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKVL  455
            G YP R G+P+C YY++TG C+FGA+C+F+HP  +     +A++ VL
Sbjct  94   GEYPYRVGQPECQYYLKTGTCKFGATCKFHHPREKAAIAISAQLNVL  140


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 29/46 (63%), Gaps = 0/46 (0%)
 Frame = +3

Query  318  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKVL  455
            T+P R  +P+C +Y++TG C+FGA C+FNHP  R +      +  L
Sbjct  302  TFPERPEQPECQFYMKTGDCKFGAVCKFNHPKKRMVPAPNCALSPL  347



>ref|XP_006606434.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X2 [Glycine max]
Length=356

 Score =   173 bits (438),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 78/92 (85%), Positives = 86/92 (93%), Gaps = 0/92 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFGATCKFHHP+D+AGIAGRVALN+LGYPLRPN+ EC YY+RTGQCKFG+T
Sbjct  15   QYYLKTGTCKFGATCKFHHPKDQAGIAGRVALNILGYPLRPNEPECTYYLRTGQCKFGNT  74

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  723
            CKFHHPQPSNMM+ LRGSP YP VHSPTTPGQ
Sbjct  75   CKFHHPQPSNMMLSLRGSPVYPTVHSPTTPGQ  106


 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 45/66 (68%), Gaps = 0/66 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y+KTG CKFGA C+FHHPR++   A    L+ +G PLR  +  C +Y R G CKFG +
Sbjct  222  QFYVKTGDCKFGAVCQFHHPRERLIPAPDCVLSPIGLPLRLGEPLCVFYSRYGICKFGPS  281

Query  628  CKFHHP  645
            CKF HP
Sbjct  282  CKFDHP  287


 Score = 49.7 bits (117),  Expect(2) = 7e-07, Method: Compositional matrix adjust.
 Identities = 17/35 (49%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKL  425
            +P R G+P+C +Y++TG C+FGA C+F+HP  R +
Sbjct  212  FPERPGQPECQFYVKTGDCKFGAVCQFHHPRERLI  246


 Score = 30.8 bits (68),  Expect(2) = 7e-07, Method: Compositional matrix adjust.
 Identities = 11/21 (52%), Positives = 15/21 (71%), Gaps = 0/21 (0%)
 Frame = +1

Query  451  YYLKTGACKFGATCKFHHPRD  513
            +Y + G CKFG +CKF HP +
Sbjct  269  FYSRYGICKFGPSCKFDHPME  289


 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +3

Query  315  GTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKVL  455
            G +P R G+P+C YY++TG C+FGA+C+F+HP ++        + +L
Sbjct  3    GEFPERIGQPECQYYLKTGTCKFGATCKFHHPKDQAGIAGRVALNIL  49


 Score = 53.1 bits (126),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIA  434
            YP+R  EP+C+YY+RTG C+FG +C+F+HP    + ++
Sbjct  51   YPLRPNEPECTYYLRTGQCKFGNTCKFHHPQPSNMMLS  88



>ref|XP_010453818.1| PREDICTED: LOW QUALITY PROTEIN: zinc finger CCCH domain-containing 
protein 57-like [Camelina sativa]
Length=420

 Score =   129 bits (325),  Expect(2) = 7e-48, Method: Compositional matrix adjust.
 Identities = 57/90 (63%), Positives = 72/90 (80%), Gaps = 2/90 (2%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y+KTG CKFG TCKFHHP +KAGI GRV++NVLGYPLRPN+ +C Y++RTG CKFG T
Sbjct  98   EFYMKTGTCKFGVTCKFHHPSNKAGIDGRVSINVLGYPLRPNEDDCSYFLRTGHCKFGGT  157

Query  628  CKFHHP--QPSNMMVPLRGSPAYPPVHSPT  711
            CKF+HP  Q + +MV +RGSP Y  + S T
Sbjct  158  CKFNHPQTQSTKLMVSVRGSPVYSALQSFT  187


 Score = 89.0 bits (219),  Expect(2) = 7e-48, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 47/62 (76%), Gaps = 2/62 (3%)
 Frame = +3

Query  270  TLWQLSLRSMETME--SGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAAR  443
            T+WQ+++ S E M    G YP R GEPDCSYYIRTGLCRFG++CRFNHP +RKL IA A 
Sbjct  24   TMWQMNMGSDEIMSGSDGFYPERQGEPDCSYYIRTGLCRFGSTCRFNHPHDRKLVIATAM  83

Query  444  MK  449
             K
Sbjct  84   TK  85


 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 45/66 (68%), Gaps = 1/66 (2%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
             YY++TG C+FG+TC+F+HP D+  +    A+    YP R    EC +YM+TG CKFG T
Sbjct  53   SYYIRTGLCRFGSTCRFNHPHDRKLVIA-TAMTKGEYPERIGQPECEFYMKTGTCKFGVT  111

Query  628  CKFHHP  645
            CKFHHP
Sbjct  112  CKFHHP  117


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 44/66 (67%), Gaps = 0/66 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y+KTG CKFG  CKFHHPRD+   A    L+ +G PLR  +  C +Y R G CKFG +
Sbjct  293  QFYMKTGDCKFGTVCKFHHPRDRQTPAPDCVLSTVGLPLRLGEPLCVFYSRYGICKFGPS  352

Query  628  CKFHHP  645
            CKF HP
Sbjct  353  CKFDHP  358


 Score = 58.9 bits (141),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +3

Query  306  MESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKVL  455
            M  G YP R G+P+C +Y++TG C+FG +C+F+HPSN+        + VL
Sbjct  83   MTKGEYPERIGQPECEFYMKTGTCKFGVTCKFHHPSNKAGIDGRVSINVL  132


 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = +1

Query  535  VALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQ  648
            V L +  +P RP  +EC +YM+TG CKFG+ CKFHHP+
Sbjct  276  VPLGLYAFPERPGQLECQFYMKTGDCKFGTVCKFHHPR  313


 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 19/40 (48%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAA  440
            YP+R  E DCSY++RTG C+FG +C+FNHP  +   +  +
Sbjct  134  YPLRPNEDDCSYFLRTGHCKFGGTCKFNHPQTQSTKLMVS  173



>ref|XP_006400193.1| hypothetical protein EUTSA_v10013743mg [Eutrema salsugineum]
 gb|ESQ41646.1| hypothetical protein EUTSA_v10013743mg [Eutrema salsugineum]
Length=395

 Score =   125 bits (314),  Expect(2) = 8e-48, Method: Compositional matrix adjust.
 Identities = 59/90 (66%), Positives = 72/90 (80%), Gaps = 5/90 (6%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++YLKTG CKFG TCKFHHPR+KAG   RV+ +VLGYPLRPN+ +C Y++RTG CKFG T
Sbjct  74   EFYLKTGTCKFGVTCKFHHPRNKAG---RVSHSVLGYPLRPNEDDCSYFLRTGHCKFGGT  130

Query  628  CKFHHP--QPSNMMVPLRGSPAYPPVHSPT  711
            CKF+HP  Q +N+MV LRGSP Y  + SPT
Sbjct  131  CKFNHPQSQSTNLMVSLRGSPVYSALQSPT  160


 Score = 92.8 bits (229),  Expect(2) = 8e-48, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 50/61 (82%), Gaps = 2/61 (3%)
 Frame = +3

Query  273  LWQLSLRSMETM--ESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARM  446
            +WQ++L S ETM  + G+YP R GEPDCSYYIRTGLCRFG++CRFNHP +RKL IA  R+
Sbjct  1    MWQMNLGSDETMSGDDGSYPERPGEPDCSYYIRTGLCRFGSTCRFNHPHDRKLVIATERI  60

Query  447  K  449
            K
Sbjct  61   K  61


 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 44/66 (67%), Gaps = 0/66 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y+KTG CKFG  CKFHHPRD+   A    L+ +G PLR  +  C +Y R G CKFG +
Sbjct  268  EFYMKTGDCKFGTVCKFHHPRDRQTPAPDCLLSPVGLPLRLGEPLCVFYSRYGICKFGPS  327

Query  628  CKFHHP  645
            CKF HP
Sbjct  328  CKFDHP  333


 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 19/40 (48%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAA  440
            YP+R  E DCSY++RTG C+FG +C+FNHP ++   +  +
Sbjct  107  YPLRPNEDDCSYFLRTGHCKFGGTCKFNHPQSQSTNLMVS  146


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +1

Query  556  YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMV  666
            YP RP + +C YY+RTG C+FGSTC+F+HP    +++
Sbjct  19   YPERPGEPDCSYYIRTGLCRFGSTCRFNHPHDRKLVI  55


 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 20/38 (53%), Positives = 25/38 (66%), Gaps = 0/38 (0%)
 Frame = +1

Query  556  YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVP  669
            +P RP   EC +YM+TG CKFG+ CKFHHP+      P
Sbjct  258  FPERPGQPECEFYMKTGDCKFGTVCKFHHPRDRQTPAP  295



>ref|XP_010929828.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X4 [Elaeis guineensis]
Length=380

 Score =   171 bits (434),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 78/92 (85%), Positives = 84/92 (91%), Gaps = 0/92 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFGATCKFHHP+DKAGIAGRV LN+LGYPLRPN+ EC YY+RTGQCKFG+T
Sbjct  22   QYYLKTGTCKFGATCKFHHPKDKAGIAGRVQLNILGYPLRPNEKECAYYIRTGQCKFGNT  81

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  723
            CKFHHPQPSN MV LRGSP YPPVHS TTPGQ
Sbjct  82   CKFHHPQPSNAMVALRGSPVYPPVHSSTTPGQ  113


 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 44/66 (67%), Gaps = 0/66 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y+KTG CKFGA CKFHHPR++        L+ LG PLRP +  C +Y R G CKFG  
Sbjct  229  QFYMKTGDCKFGAVCKFHHPRERLVPVPNCLLSPLGLPLRPGEPLCVFYSRYGICKFGPN  288

Query  628  CKFHHP  645
            CKF HP
Sbjct  289  CKFDHP  294


 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 20/47 (43%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +3

Query  315  GTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKVL  455
            G YP R G+P+C YY++TG C+FGA+C+F+HP ++       ++ +L
Sbjct  10   GGYPERVGQPECQYYLKTGTCKFGATCKFHHPKDKAGIAGRVQLNIL  56


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = +1

Query  556  YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVP  669
            +P RP+  EC +YM+TG CKFG+ CKFHHP+   + VP
Sbjct  219  FPERPDQPECQFYMKTGDCKFGAVCKFHHPRERLVPVP  256


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIA  434
            YP+R  E +C+YYIRTG C+FG +C+F+HP      +A
Sbjct  58   YPLRPNEKECAYYIRTGQCKFGNTCKFHHPQPSNAMVA  95



>gb|KHG30243.1| Zinc finger CCCH domain-containing protein ZFN-like protein [Gossypium 
arboreum]
Length=347

 Score =   170 bits (430),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 75/92 (82%), Positives = 84/92 (91%), Gaps = 0/92 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFGATCKFHHPR++AGIAGRV+LN+LGYP RPN+ EC YY+RTGQCKFGST
Sbjct  10   RYYLKTGTCKFGATCKFHHPREQAGIAGRVSLNILGYPFRPNETECAYYLRTGQCKFGST  69

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  723
            CKFHHPQP+NMM+ LRGSP YP V SPTTPGQ
Sbjct  70   CKFHHPQPTNMMISLRGSPIYPTVASPTTPGQ  101


 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 41/85 (48%), Positives = 54/85 (64%), Gaps = 0/85 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y+KTG CKFGA C+FHHPR++   A    L+ +G PLRP +  C +Y R G CKFGS+
Sbjct  214  QFYMKTGDCKFGAVCRFHHPRERVPPAPDCLLSPIGLPLRPGEPLCDFYSRYGICKFGSS  273

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVH  702
            CKF+HP           SP+  PVH
Sbjct  274  CKFNHPMGIFTYNYSISSPSGAPVH  298


 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIA  434
            YP R  E +C+YY+RTG C+FG++C+F+HP    + I+
Sbjct  46   YPFRPNETECAYYLRTGQCKFGSTCKFHHPQPTNMMIS  83


 Score = 49.7 bits (117),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 18/34 (53%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = +3

Query  318  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNR  419
             +P R G+P+C +Y++TG C+FGA CRF+HP  R
Sbjct  203  VFPERPGQPECQFYMKTGDCKFGAVCRFHHPRER  236



>gb|KJB26822.1| hypothetical protein B456_004G261700 [Gossypium raimondii]
Length=370

 Score =   169 bits (429),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 75/92 (82%), Positives = 84/92 (91%), Gaps = 0/92 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFGATCKFHHPR++AGIAGRV+LN+LGYP RPN+ EC YY+RTGQCKFGST
Sbjct  33   QYYLKTGTCKFGATCKFHHPREQAGIAGRVSLNILGYPFRPNETECAYYLRTGQCKFGST  92

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  723
            CKFHHPQP+NMM+ LRGSP YP V SPTTPGQ
Sbjct  93   CKFHHPQPTNMMISLRGSPIYPTVASPTTPGQ  124


 Score = 81.3 bits (199),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 40/85 (47%), Positives = 53/85 (62%), Gaps = 0/85 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y+KTG CKFGA C+FHHPR++   A    L+ +G PLRP +  C +Y R G CKFG +
Sbjct  237  QFYMKTGDCKFGAVCRFHHPRERVPPAPDCLLSPIGLPLRPGEPLCDFYSRYGICKFGPS  296

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVH  702
            CKF+HP           SP+  PVH
Sbjct  297  CKFNHPMGIFTYNYSISSPSGAPVH  321


 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/59 (41%), Positives = 39/59 (66%), Gaps = 6/59 (10%)
 Frame = +3

Query  276  WQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKV  452
            W ++   M+    G +P R G+P+C YY++TG C+FGA+C+F+HP  R+ A  A R+ +
Sbjct  12   WAIAAARMK----GEFPERVGQPECQYYLKTGTCKFGATCKFHHP--REQAGIAGRVSL  64


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIA  434
            YP R  E +C+YY+RTG C+FG++C+F+HP    + I+
Sbjct  69   YPFRPNETECAYYLRTGQCKFGSTCKFHHPQPTNMMIS  106


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 18/34 (53%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = +3

Query  318  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNR  419
             +P R G+P+C +Y++TG C+FGA CRF+HP  R
Sbjct  226  VFPERPGQPECQFYMKTGDCKFGAVCRFHHPRER  259



>ref|XP_009769505.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X4 [Nicotiana sylvestris]
Length=350

 Score =   168 bits (425),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 78/93 (84%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFGATCKFHHPRDKAGIAGRV LNVLGYPLRPN+ EC YYMRT QCKFGST
Sbjct  15   QYYLKTGTCKFGATCKFHHPRDKAGIAGRVTLNVLGYPLRPNENECTYYMRTAQCKFGST  74

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQL  726
            CKFHHP+PSNMMV  RGSP YPP  S TTPGQ+
Sbjct  75   CKFHHPEPSNMMVSSRGSPVYPPGPSSTTPGQM  107


 Score = 73.6 bits (179),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 44/66 (67%), Gaps = 0/66 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y+KTG CKFGA C+FHHPR++        L+ +G PLR  +  C +Y R G CKFG +
Sbjct  216  QFYMKTGDCKFGAVCRFHHPRERLLPPPDCLLSPIGLPLRAGEPMCIFYSRYGICKFGPS  275

Query  628  CKFHHP  645
            CKF HP
Sbjct  276  CKFDHP  281


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/48 (42%), Positives = 32/48 (67%), Gaps = 0/48 (0%)
 Frame = +3

Query  312  SGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKVL  455
            +G YP R G+ +C YY++TG C+FGA+C+F+HP ++        + VL
Sbjct  2    NGEYPERIGQLECQYYLKTGTCKFGATCKFHHPRDKAGIAGRVTLNVL  49


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKL  425
            +P R G+P+C +Y++TG C+FGA CRF+HP  R L
Sbjct  206  FPERVGQPECQFYMKTGDCKFGAVCRFHHPRERLL  240



>ref|XP_006287837.1| hypothetical protein CARUB_v10001057mg [Capsella rubella]
 gb|EOA20735.1| hypothetical protein CARUB_v10001057mg [Capsella rubella]
Length=418

 Score =   122 bits (306),  Expect(2) = 4e-46, Method: Compositional matrix adjust.
 Identities = 56/90 (62%), Positives = 71/90 (79%), Gaps = 3/90 (3%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y+KTG CKFG TCKFHHPR+KAGI  RV++NVLGYPLRPN+ +C Y++RTG CKFG +
Sbjct  97   EFYIKTGTCKFGVTCKFHHPRNKAGIDERVSVNVLGYPLRPNEDDCSYFLRTGHCKFGGS  156

Query  628  CKFHHP--QPSNMMVPLRGSPAYPPVHSPT  711
            CKF+HP  Q + +MV LR SP Y  + S T
Sbjct  157  CKFNHPQTQSTKLMVSLR-SPVYSALQSLT  185


 Score = 90.5 bits (223),  Expect(2) = 4e-46, Method: Compositional matrix adjust.
 Identities = 42/60 (70%), Positives = 47/60 (78%), Gaps = 1/60 (2%)
 Frame = +3

Query  273  LWQLSLRSMETME-SGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMK  449
            +WQ +L S ETM   G YP R GEPDCSYYIRTGLCRFG++CRFNHP +RKL IA AR K
Sbjct  25   MWQTNLGSDETMGGDGLYPERPGEPDCSYYIRTGLCRFGSTCRFNHPYDRKLVIATARTK  84


 Score = 79.7 bits (195),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 45/66 (68%), Gaps = 0/66 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y+KTG CKFG  CKFHHPR++   A    L+ +G PLRP +  C +Y R G CKFG +
Sbjct  292  EFYMKTGDCKFGTVCKFHHPRNRQTPAPDCVLSTVGLPLRPGEPLCVFYSRYGICKFGPS  351

Query  628  CKFHHP  645
            CKF HP
Sbjct  352  CKFDHP  357


 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 45/67 (67%), Gaps = 1/67 (1%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
             YY++TG C+FG+TC+F+HP D+  +    A     YP R    EC +Y++TG CKFG T
Sbjct  52   SYYIRTGLCRFGSTCRFNHPYDRKLVIA-TARTKGEYPERIGQPECEFYIKTGTCKFGVT  110

Query  628  CKFHHPQ  648
            CKFHHP+
Sbjct  111  CKFHHPR  117


 Score = 55.8 bits (133),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 21/47 (45%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +3

Query  315  GTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKVL  455
            G YP R G+P+C +YI+TG C+FG +C+F+HP N+        + VL
Sbjct  85   GEYPERIGQPECEFYIKTGTCKFGVTCKFHHPRNKAGIDERVSVNVL  131


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAA  440
            YP+R  E DCSY++RTG C+FG SC+FNHP  +   +  +
Sbjct  133  YPLRPNEDDCSYFLRTGHCKFGGSCKFNHPQTQSTKLMVS  172


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +1

Query  556  YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQ  648
            +P RP  +EC +YM+TG CKFG+ CKFHHP+
Sbjct  282  FPERPGQLECEFYMKTGDCKFGTVCKFHHPR  312


 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +1

Query  556  YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMV  666
            YP RP + +C YY+RTG C+FGSTC+F+HP    +++
Sbjct  42   YPERPGEPDCSYYIRTGLCRFGSTCRFNHPYDRKLVI  78



>ref|XP_002871723.1| hypothetical protein ARALYDRAFT_488510 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47982.1| hypothetical protein ARALYDRAFT_488510 [Arabidopsis lyrata subsp. 
lyrata]
Length=344

 Score =   132 bits (331),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 61/94 (65%), Positives = 74/94 (79%), Gaps = 2/94 (2%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++YLKTG CKFG TCKFHHPR+KAG  GRV++NVLGYPLRPN+ +C Y++RTG CKFG T
Sbjct  62   EFYLKTGTCKFGVTCKFHHPRNKAGNDGRVSVNVLGYPLRPNEDDCSYFLRTGHCKFGGT  121

Query  628  CKFHHP--QPSNMMVPLRGSPAYPPVHSPTTPGQ  723
            CKF+HP  Q +N+MV LRGSP Y  +  PT   Q
Sbjct  122  CKFNHPQTQSTNLMVSLRGSPVYSALQPPTDGQQ  155


 Score = 79.0 bits (193),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 34/45 (76%), Positives = 39/45 (87%), Gaps = 0/45 (0%)
 Frame = +3

Query  315  GTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMK  449
            G+YP R GEPDC+YYIRTGLCRFG +CRFNHP +RKL IA AR+K
Sbjct  5    GSYPERHGEPDCAYYIRTGLCRFGFTCRFNHPHDRKLVIATARIK  49


 Score = 79.3 bits (194),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 45/66 (68%), Gaps = 0/66 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y+KTG CKFG  CKFHHPRD+   A   AL+ +G PLR  +  C +Y R G CKFG +
Sbjct  219  QFYMKTGDCKFGTVCKFHHPRDRQTPAPDCALSSVGLPLRQGEPLCVFYSRYGICKFGPS  278

Query  628  CKFHHP  645
            CKF HP
Sbjct  279  CKFDHP  284


 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 20/47 (43%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +3

Query  315  GTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKVL  455
            G YP R G+P+C +Y++TG C+FG +C+F+HP N+        + VL
Sbjct  50   GEYPERIGQPECEFYLKTGTCKFGVTCKFHHPRNKAGNDGRVSVNVL  96


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 19/40 (48%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAA  440
            YP+R  E DCSY++RTG C+FG +C+FNHP  +   +  +
Sbjct  98   YPLRPNEDDCSYFLRTGHCKFGGTCKFNHPQTQSTNLMVS  137



>ref|XP_009769504.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X3 [Nicotiana sylvestris]
Length=381

 Score =   167 bits (424),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 78/93 (84%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFGATCKFHHPRDKAGIAGRV LNVLGYPLRPN+ EC YYMRT QCKFGST
Sbjct  46   QYYLKTGTCKFGATCKFHHPRDKAGIAGRVTLNVLGYPLRPNENECTYYMRTAQCKFGST  105

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQL  726
            CKFHHP+PSNMMV  RGSP YPP  S TTPGQ+
Sbjct  106  CKFHHPEPSNMMVSSRGSPVYPPGPSSTTPGQM  138


 Score = 73.6 bits (179),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 44/66 (67%), Gaps = 0/66 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y+KTG CKFGA C+FHHPR++        L+ +G PLR  +  C +Y R G CKFG +
Sbjct  247  QFYMKTGDCKFGAVCRFHHPRERLLPPPDCLLSPIGLPLRAGEPMCIFYSRYGICKFGPS  306

Query  628  CKFHHP  645
            CKF HP
Sbjct  307  CKFDHP  312


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/48 (42%), Positives = 32/48 (67%), Gaps = 0/48 (0%)
 Frame = +3

Query  312  SGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKVL  455
            +G YP R G+ +C YY++TG C+FGA+C+F+HP ++        + VL
Sbjct  33   NGEYPERIGQLECQYYLKTGTCKFGATCKFHHPRDKAGIAGRVTLNVL  80


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 19/36 (53%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +3

Query  318  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKL  425
             +P R G+P+C +Y++TG C+FGA CRF+HP  R L
Sbjct  236  VFPERVGQPECQFYMKTGDCKFGAVCRFHHPRERLL  271



>gb|KFK25872.1| hypothetical protein AALP_AA8G173100 [Arabis alpina]
Length=410

 Score =   130 bits (327),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 58/90 (64%), Positives = 70/90 (78%), Gaps = 2/90 (2%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++YLKTG CKFG TCKFHHPR+ A IAG V++N LGYPLRP + +C Y++RTG CKFG T
Sbjct  87   QFYLKTGTCKFGVTCKFHHPRNNADIAGSVSVNALGYPLRPEEDDCSYFLRTGHCKFGGT  146

Query  628  CKFHHP--QPSNMMVPLRGSPAYPPVHSPT  711
            CKF+HP  Q SN+MV L GSP Y  + SPT
Sbjct  147  CKFNHPQSQSSNLMVSLSGSPVYSALQSPT  176


 Score = 79.7 bits (195),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 34/45 (76%), Positives = 39/45 (87%), Gaps = 0/45 (0%)
 Frame = +3

Query  315  GTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMK  449
            G YP R GEPDCSYYIRTGLCRFG++CRFNHP +RKL IA AR++
Sbjct  30   GLYPERPGEPDCSYYIRTGLCRFGSTCRFNHPRDRKLVIATARIR  74


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 44/66 (67%), Gaps = 0/66 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y+KTG CKFG  CKFHHPRD+   A    L+ +  PLRP +  C +Y R G CKFG +
Sbjct  283  QFYMKTGDCKFGTVCKFHHPRDRQAPAPDCVLSPVDLPLRPGEPLCVFYSRYGICKFGPS  342

Query  628  CKFHHP  645
            CKF HP
Sbjct  343  CKFDHP  348


 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 4/58 (7%)
 Frame = +1

Query  493  KFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMV  666
               H  ++  I G V L    YP RP + +C YY+RTG C+FGSTC+F+HP+   +++
Sbjct  15   SLSHLLNQNEIIGGVGL----YPERPGEPDCSYYIRTGLCRFGSTCRFNHPRDRKLVI  68


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/56 (45%), Positives = 31/56 (55%), Gaps = 3/56 (5%)
 Frame = +1

Query  556  YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  723
            +P RP   EC +YM+TG CKFG+ CKFHHP+      P        PV  P  PG+
Sbjct  273  FPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQAPAP---DCVLSPVDLPLRPGE  325


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 29/47 (62%), Gaps = 0/47 (0%)
 Frame = +3

Query  315  GTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKVL  455
            G YP R  +PDC +Y++TG C+FG +C+F+HP N      +  +  L
Sbjct  75   GEYPERIDQPDCQFYLKTGTCKFGVTCKFHHPRNNADIAGSVSVNAL  121


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 37/56 (66%), Gaps = 4/56 (7%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHP----SNRKLAIAAARMKVLLEDGSLQ  476
            YP+R  E DCSY++RTG C+FG +C+FNHP    SN  ++++ + +   L+  + Q
Sbjct  123  YPLRPEEDDCSYFLRTGHCKFGGTCKFNHPQSQSSNLMVSLSGSPVYSALQSPTGQ  178



>gb|KFK25871.1| hypothetical protein AALP_AA8G173100 [Arabis alpina]
Length=325

 Score =   129 bits (325),  Expect(2) = 5e-45, Method: Compositional matrix adjust.
 Identities = 58/90 (64%), Positives = 70/90 (78%), Gaps = 2/90 (2%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++YLKTG CKFG TCKFHHPR+ A IAG V++N LGYPLRP + +C Y++RTG CKFG T
Sbjct  87   QFYLKTGTCKFGVTCKFHHPRNNADIAGSVSVNALGYPLRPEEDDCSYFLRTGHCKFGGT  146

Query  628  CKFHHP--QPSNMMVPLRGSPAYPPVHSPT  711
            CKF+HP  Q SN+MV L GSP Y  + SPT
Sbjct  147  CKFNHPQSQSSNLMVSLSGSPVYSALQSPT  176


 Score = 79.3 bits (194),  Expect(2) = 5e-45, Method: Compositional matrix adjust.
 Identities = 34/45 (76%), Positives = 39/45 (87%), Gaps = 0/45 (0%)
 Frame = +3

Query  315  GTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMK  449
            G YP R GEPDCSYYIRTGLCRFG++CRFNHP +RKL IA AR++
Sbjct  30   GLYPERPGEPDCSYYIRTGLCRFGSTCRFNHPRDRKLVIATARIR  74


 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 36/58 (62%), Gaps = 4/58 (7%)
 Frame = +1

Query  493  KFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMV  666
               H  ++  I G V L    YP RP + +C YY+RTG C+FGSTC+F+HP+   +++
Sbjct  15   SLSHLLNQNEIIGGVGL----YPERPGEPDCSYYIRTGLCRFGSTCRFNHPRDRKLVI  68


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 29/47 (62%), Gaps = 0/47 (0%)
 Frame = +3

Query  315  GTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKVL  455
            G YP R  +PDC +Y++TG C+FG +C+F+HP N      +  +  L
Sbjct  75   GEYPERIDQPDCQFYLKTGTCKFGVTCKFHHPRNNADIAGSVSVNAL  121


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 37/56 (66%), Gaps = 4/56 (7%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHP----SNRKLAIAAARMKVLLEDGSLQ  476
            YP+R  E DCSY++RTG C+FG +C+FNHP    SN  ++++ + +   L+  + Q
Sbjct  123  YPLRPEEDDCSYFLRTGHCKFGGTCKFNHPQSQSSNLMVSLSGSPVYSALQSPTGQ  178


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRP  570
            ++Y+KTG CKFG  CKFHHPRD+   A    L+ +  PLRP
Sbjct  283  QFYMKTGDCKFGTVCKFHHPRDRQAPAPDCVLSPVDLPLRP  323


 Score = 50.1 bits (118),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 20/38 (53%), Positives = 25/38 (66%), Gaps = 0/38 (0%)
 Frame = +1

Query  556  YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVP  669
            +P RP   EC +YM+TG CKFG+ CKFHHP+      P
Sbjct  273  FPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQAPAP  310



>gb|EEC69137.1| hypothetical protein OsI_38063 [Oryza sativa Indica Group]
Length=395

 Score =   110 bits (274),  Expect(2) = 7e-45, Method: Compositional matrix adjust.
 Identities = 48/61 (79%), Positives = 54/61 (89%), Gaps = 0/61 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFGATCKFHHPR+KA +A RV LNVLGYP+RPN+ EC YY+RTGQCKF ST
Sbjct  118  QYYLKTGTCKFGATCKFHHPREKAALANRVQLNVLGYPMRPNEKECAYYLRTGQCKFAST  177

Query  628  C  630
            C
Sbjct  178  C  178


 Score = 98.6 bits (244),  Expect(2) = 7e-45, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = +3

Query  267  ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARM  446
            E +WQ++L   E+MES  YP R GEPDCSYY+RTGLCRFG +C+FNHP NRKLA+AAARM
Sbjct  45   EAMWQMTLGGGESMESTPYPERIGEPDCSYYMRTGLCRFGMTCKFNHPPNRKLAVAAARM  104

Query  447  K  449
             
Sbjct  105  N  105


 Score = 84.0 bits (206),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 39/71 (55%), Positives = 48/71 (68%), Gaps = 0/71 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y+KTG CKFGA CKFHHP+++   A   ALN LG PLRP +  C +Y R G CKFG  
Sbjct  266  QFYMKTGDCKFGAVCKFHHPKERLVPAPNCALNSLGLPLRPGEPVCTFYSRYGICKFGPN  325

Query  628  CKFHHPQPSNM  660
            CKF HP  + M
Sbjct  326  CKFDHPMGTLM  336


 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/67 (51%), Positives = 45/67 (67%), Gaps = 1/67 (1%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
             YY++TG C+FG TCKF+HP ++        +N   YP R    EC YY++TG CKFG+T
Sbjct  73   SYYMRTGLCRFGMTCKFNHPPNRKLAVAAARMNGE-YPYRVGQPECQYYLKTGTCKFGAT  131

Query  628  CKFHHPQ  648
            CKFHHP+
Sbjct  132  CKFHHPR  138


 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +1

Query  556  YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQ  648
            +P RP+  EC +YM+TG CKFG+ CKFHHP+
Sbjct  256  FPERPDQPECQFYMKTGDCKFGAVCKFHHPK  286



>ref|XP_009416576.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X4 [Musa acuminata subsp. malaccensis]
Length=368

 Score =   159 bits (403),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 72/92 (78%), Positives = 81/92 (88%), Gaps = 0/92 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFGA CKFHHP++KAGIAGRV LN+LGYPLR N+ +C YY+RTG+CKFG T
Sbjct  28   QYYLKTGTCKFGAICKFHHPKEKAGIAGRVQLNILGYPLRLNEKDCAYYIRTGECKFGGT  87

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  723
            CKFHHPQPSN +V LRGSP YP VHSPTTPGQ
Sbjct  88   CKFHHPQPSNAVVALRGSPVYPAVHSPTTPGQ  119


 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 44/66 (67%), Gaps = 0/66 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y+KTG CKFGA CKFHHP+++        L+ LG PLRP +  C +Y R G CKFG  
Sbjct  233  QFYMKTGDCKFGAVCKFHHPKERLVPVPNCVLSPLGLPLRPGEPVCVFYSRYGICKFGPN  292

Query  628  CKFHHP  645
            CKF HP
Sbjct  293  CKFDHP  298


 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 20/47 (43%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +3

Query  315  GTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKVL  455
            G YP R G+P+C YY++TG C+FGA C+F+HP  +       ++ +L
Sbjct  16   GGYPERVGQPECQYYLKTGTCKFGAICKFHHPKEKAGIAGRVQLNIL  62


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 40/73 (55%), Gaps = 5/73 (7%)
 Frame = +1

Query  460  KTGACKFGATCKFHHPRDKAGIAGRVAL---NVLGYPLRPNDIECPYYMRTGQCKFGSTC  630
            + G    GA  KF   R  +   G  A+   N+  +P RP   EC +YM+TG CKFG+ C
Sbjct  190  QQGETSIGAQGKFPSYRPGSTPMGLYAVPGENI--FPERPGQPECQFYMKTGDCKFGAVC  247

Query  631  KFHHPQPSNMMVP  669
            KFHHP+   + VP
Sbjct  248  KFHHPKERLVPVP  260


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/38 (53%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIA  434
            YP+R  E DC+YYIRTG C+FG +C+F+HP      +A
Sbjct  64   YPLRLNEKDCAYYIRTGECKFGGTCKFHHPQPSNAVVA  101


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 17/37 (46%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAI  431
            +P R G+P+C +Y++TG C+FGA C+F+HP  R + +
Sbjct  223  FPERPGQPECQFYMKTGDCKFGAVCKFHHPKERLVPV  259



>ref|XP_010492565.1| PREDICTED: zinc finger CCCH domain-containing protein 57-like 
[Camelina sativa]
Length=418

 Score =   109 bits (273),  Expect(2) = 9e-43, Method: Compositional matrix adjust.
 Identities = 52/91 (57%), Positives = 67/91 (74%), Gaps = 7/91 (8%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIA-GRVALNVLGYPLRPNDIECPYYMRTGQCKFGS  624
            ++Y+KTG CKFG TCKFHHPR+ AG   GRV++    YPLRPN+ +C Y++RTG CKFG 
Sbjct  98   EFYMKTGTCKFGVTCKFHHPRNNAGTDDGRVSV----YPLRPNEDDCSYFLRTGHCKFGG  153

Query  625  TCKFHHP--QPSNMMVPLRGSPAYPPVHSPT  711
            TCKF+HP  Q + +MV +RGSP Y  + S T
Sbjct  154  TCKFNHPPTQSTKLMVSVRGSPVYSALQSLT  184


 Score = 92.0 bits (227),  Expect(2) = 9e-43, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 48/61 (79%), Gaps = 2/61 (3%)
 Frame = +3

Query  273  LWQLSLRSMETME--SGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARM  446
            +WQ++L S ETM    G YP R GEPDCSYYIRTGLCRFG++CRFNHP +RKL IA AR 
Sbjct  25   MWQMNLGSDETMSGCDGFYPERQGEPDCSYYIRTGLCRFGSTCRFNHPHDRKLVIATARA  84

Query  447  K  449
            K
Sbjct  85   K  85


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 44/66 (67%), Gaps = 0/66 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y+KTG CKFG  CKFHHPRD+   A    L+ +G PLR  +  C +Y R G CKFG +
Sbjct  290  QFYMKTGDCKFGTVCKFHHPRDRQTPAPDCVLSTVGLPLRLGEPLCVFYSRYGICKFGPS  349

Query  628  CKFHHP  645
            CKF HP
Sbjct  350  CKFDHP  355


 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/67 (51%), Positives = 45/67 (67%), Gaps = 1/67 (1%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
             YY++TG C+FG+TC+F+HP D+  +    A     YP R    EC +YM+TG CKFG T
Sbjct  53   SYYIRTGLCRFGSTCRFNHPHDRKLVIA-TARAKGEYPERIGQPECEFYMKTGTCKFGVT  111

Query  628  CKFHHPQ  648
            CKFHHP+
Sbjct  112  CKFHHPR  118


 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 22/45 (49%), Positives = 29/45 (64%), Gaps = 0/45 (0%)
 Frame = +1

Query  535  VALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVP  669
            V L +  +P RP  +EC +YM+TG CKFG+ CKFHHP+      P
Sbjct  273  VPLCLYAFPERPGQLECQFYMKTGDCKFGTVCKFHHPRDRQTPAP  317


 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 19/40 (48%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAA  440
            YP+R  E DCSY++RTG C+FG +C+FNHP  +   +  +
Sbjct  131  YPLRPNEDDCSYFLRTGHCKFGGTCKFNHPPTQSTKLMVS  170



>ref|XP_001768387.1| predicted protein [Physcomitrella patens]
 gb|EDQ66749.1| predicted protein, partial [Physcomitrella patens]
Length=332

 Score =   121 bits (304),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 61/92 (66%), Positives = 70/92 (76%), Gaps = 5/92 (5%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFGATCK+HHPR+KAG  GRV LNVLG PLR  + EC YYMRTG CK+G T
Sbjct  76   QYYLKTGTCKFGATCKYHHPREKAGSTGRVHLNVLGLPLRLGEKECAYYMRTGSCKYGVT  135

Query  628  CKFHHPQPSNM--MVPL---RGSPAYPPVHSP  708
            CKFHHPQP+ +  MVPL    G P++P   SP
Sbjct  136  CKFHHPQPATVGGMVPLPFGSGVPSWPLTRSP  167


 Score = 79.7 bits (195),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 35/63 (56%), Positives = 44/63 (70%), Gaps = 2/63 (3%)
 Frame = +3

Query  267  ETLWQLSLRSMETMESG--TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAA  440
            E  W ++++  E ++ G   YP R GEPDC YY+RTGLC FG +CR+NHP NRKLA AA 
Sbjct  1    EAGWAMAMQGQEGVDGGQGPYPERPGEPDCVYYMRTGLCGFGMTCRYNHPPNRKLAAAAT  60

Query  441  RMK  449
            R K
Sbjct  61   RGK  63


 Score = 80.9 bits (198),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 48/66 (73%), Gaps = 0/66 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YY+KTG CKFG+TC++HHP+D+A  +    L+ +G PLRP +  C +Y R G CKFG T
Sbjct  266  QYYMKTGDCKFGSTCRYHHPKDRATPSPTCHLSPMGLPLRPGNPPCSFYSRYGICKFGPT  325

Query  628  CKFHHP  645
            CKF HP
Sbjct  326  CKFDHP  331


 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 44/66 (67%), Gaps = 1/66 (2%)
 Frame = +1

Query  451  YYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTC  630
            YY++TG C FG TC+++HP ++  +A         YP R    EC YY++TG CKFG+TC
Sbjct  32   YYMRTGLCGFGMTCRYNHPPNRK-LAAAATRGKGEYPERVGHPECQYYLKTGTCKFGATC  90

Query  631  KFHHPQ  648
            K+HHP+
Sbjct  91   KYHHPR  96


 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 34/56 (61%), Gaps = 0/56 (0%)
 Frame = +3

Query  288  LRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKVL  455
            L +  T   G YP R G P+C YY++TG C+FGA+C+++HP  +  +     + VL
Sbjct  55   LAAAATRGKGEYPERVGHPECQYYLKTGTCKFGATCKYHHPREKAGSTGRVHLNVL  110


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/69 (35%), Positives = 41/69 (59%), Gaps = 5/69 (7%)
 Frame = +3

Query  213  VPTYAVFMSKDTAICTR*ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGAS  392
            V  Y  +M   +A+        Q ++   ET+    +P R G+P+C YY++TG C+FG++
Sbjct  225  VSGYGPYMQGSSAVGLPAHQATQ-AVGGQETV----FPERPGQPECQYYMKTGDCKFGST  279

Query  393  CRFNHPSNR  419
            CR++HP +R
Sbjct  280  CRYHHPKDR  288


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 34/57 (60%), Gaps = 12/57 (21%)
 Frame = +1

Query  556  YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQP----------SNMMVPLRGSPAYPP  696
            +P RP   EC YYM+TG CKFGSTC++HHP+           S M +PLR  P  PP
Sbjct  256  FPERPGQPECQYYMKTGDCKFGSTCRYHHPKDRATPSPTCHLSPMGLPLR--PGNPP  310



>ref|XP_009392482.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X3 [Musa acuminata subsp. malaccensis]
Length=362

 Score =   157 bits (397),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 69/92 (75%), Positives = 81/92 (88%), Gaps = 0/92 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFG+TCKFHHP++KAGIA +  LN+LGYPLRPN+ EC YY+RTG+CKFGST
Sbjct  23   QYYLKTGTCKFGSTCKFHHPKEKAGIAKQAQLNILGYPLRPNEQECAYYIRTGECKFGST  82

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  723
            CK+HHPQPSN ++ LRGSP YP  HSPTTPGQ
Sbjct  83   CKYHHPQPSNTILALRGSPIYPSAHSPTTPGQ  114


 Score = 80.5 bits (197),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 44/66 (67%), Gaps = 0/66 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y+KTG CKFGA C+FHHPR++        LN LG PLRP +  C +Y R G CKFG  
Sbjct  228  QFYMKTGDCKFGAVCRFHHPRERLIPTPNCVLNPLGLPLRPGEPLCVFYSRYGICKFGPN  287

Query  628  CKFHHP  645
            CKF HP
Sbjct  288  CKFDHP  293


 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 20/47 (43%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +3

Query  315  GTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKVL  455
            G YP R G+P+C YY++TG C+FG++C+F+HP  +      A++ +L
Sbjct  11   GGYPERVGQPECQYYLKTGTCKFGSTCKFHHPKEKAGIAKQAQLNIL  57


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/66 (41%), Positives = 37/66 (56%), Gaps = 5/66 (8%)
 Frame = +1

Query  460  KTGACKFGATCKFHHPRDKAGIAGRVAL---NVLGYPLRPNDIECPYYMRTGQCKFGSTC  630
            + G    GA  KF   R  +   G  A+   N+  +P RP   EC +YM+TG CKFG+ C
Sbjct  185  QQGETNIGAQGKFSSYRPGSVSMGLYAVPRENI--FPERPGQPECQFYMKTGDCKFGAVC  242

Query  631  KFHHPQ  648
            +FHHP+
Sbjct  243  RFHHPR  248


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 21/39 (54%), Positives = 31/39 (79%), Gaps = 2/39 (5%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNH--PSNRKLAI  431
            YP+R  E +C+YYIRTG C+FG++C+++H  PSN  LA+
Sbjct  59   YPLRPNEQECAYYIRTGECKFGSTCKYHHPQPSNTILAL  97


 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 18/33 (55%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNR  419
            +P R G+P+C +Y++TG C+FGA CRF+HP  R
Sbjct  218  FPERPGQPECQFYMKTGDCKFGAVCRFHHPRER  250



>ref|XP_009392481.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=371

 Score =   157 bits (397),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 69/92 (75%), Positives = 81/92 (88%), Gaps = 0/92 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFG+TCKFHHP++KAGIA +  LN+LGYPLRPN+ EC YY+RTG+CKFGST
Sbjct  32   QYYLKTGTCKFGSTCKFHHPKEKAGIAKQAQLNILGYPLRPNEQECAYYIRTGECKFGST  91

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  723
            CK+HHPQPSN ++ LRGSP YP  HSPTTPGQ
Sbjct  92   CKYHHPQPSNTILALRGSPIYPSAHSPTTPGQ  123


 Score = 80.5 bits (197),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 44/66 (67%), Gaps = 0/66 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y+KTG CKFGA C+FHHPR++        LN LG PLRP +  C +Y R G CKFG  
Sbjct  237  QFYMKTGDCKFGAVCRFHHPRERLIPTPNCVLNPLGLPLRPGEPLCVFYSRYGICKFGPN  296

Query  628  CKFHHP  645
            CKF HP
Sbjct  297  CKFDHP  302


 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 20/47 (43%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +3

Query  315  GTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKVL  455
            G YP R G+P+C YY++TG C+FG++C+F+HP  +      A++ +L
Sbjct  20   GGYPERVGQPECQYYLKTGTCKFGSTCKFHHPKEKAGIAKQAQLNIL  66


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/66 (41%), Positives = 37/66 (56%), Gaps = 5/66 (8%)
 Frame = +1

Query  460  KTGACKFGATCKFHHPRDKAGIAGRVAL---NVLGYPLRPNDIECPYYMRTGQCKFGSTC  630
            + G    GA  KF   R  +   G  A+   N+  +P RP   EC +YM+TG CKFG+ C
Sbjct  194  QQGETNIGAQGKFSSYRPGSVSMGLYAVPRENI--FPERPGQPECQFYMKTGDCKFGAVC  251

Query  631  KFHHPQ  648
            +FHHP+
Sbjct  252  RFHHPR  257


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 21/39 (54%), Positives = 31/39 (79%), Gaps = 2/39 (5%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNH--PSNRKLAI  431
            YP+R  E +C+YYIRTG C+FG++C+++H  PSN  LA+
Sbjct  68   YPLRPNEQECAYYIRTGECKFGSTCKYHHPQPSNTILAL  106


 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 18/33 (55%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNR  419
            +P R G+P+C +Y++TG C+FGA CRF+HP  R
Sbjct  227  FPERPGQPECQFYMKTGDCKFGAVCRFHHPRER  259



>ref|XP_009626545.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X4 [Nicotiana tomentosiformis]
Length=350

 Score =   154 bits (390),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 70/81 (86%), Positives = 73/81 (90%), Gaps = 0/81 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFGATCKFHHPRDKAGIAGRV LNVLGYPLRPN+ EC YYMRT QCKFGST
Sbjct  15   QYYLKTGTCKFGATCKFHHPRDKAGIAGRVTLNVLGYPLRPNENECTYYMRTAQCKFGST  74

Query  628  CKFHHPQPSNMMVPLRGSPAY  690
            CKFHHP+PSNMMV  RGSP Y
Sbjct  75   CKFHHPEPSNMMVSSRGSPVY  95


 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 45/66 (68%), Gaps = 0/66 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y+KTG CKFGA C+FHHPR++        L+ +G PLRP +  C +Y R G CKFG +
Sbjct  216  QFYMKTGDCKFGAVCRFHHPRERLLPPPDCLLSPIGLPLRPGEPMCIFYSRYGICKFGPS  275

Query  628  CKFHHP  645
            CKF HP
Sbjct  276  CKFDHP  281


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/48 (42%), Positives = 32/48 (67%), Gaps = 0/48 (0%)
 Frame = +3

Query  312  SGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKVL  455
            +G YP R G+ +C YY++TG C+FGA+C+F+HP ++        + VL
Sbjct  2    NGEYPERIGQLECQYYLKTGTCKFGATCKFHHPRDKAGIAGRVTLNVL  49


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +1

Query  556  YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQ  648
            YP R   +EC YY++TG CKFG+TCKFHHP+
Sbjct  5    YPERIGQLECQYYLKTGTCKFGATCKFHHPR  35


 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKL  425
            +P R G+P+C +Y++TG C+FGA CRF+HP  R L
Sbjct  206  FPERLGQPECQFYMKTGDCKFGAVCRFHHPRERLL  240



>ref|XP_009626544.1| PREDICTED: zinc finger CCCH domain-containing protein ZFN-like 
isoform X3 [Nicotiana tomentosiformis]
Length=381

 Score =   154 bits (388),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 70/81 (86%), Positives = 73/81 (90%), Gaps = 0/81 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFGATCKFHHPRDKAGIAGRV LNVLGYPLRPN+ EC YYMRT QCKFGST
Sbjct  46   QYYLKTGTCKFGATCKFHHPRDKAGIAGRVTLNVLGYPLRPNENECTYYMRTAQCKFGST  105

Query  628  CKFHHPQPSNMMVPLRGSPAY  690
            CKFHHP+PSNMMV  RGSP Y
Sbjct  106  CKFHHPEPSNMMVSSRGSPVY  126


 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 45/66 (68%), Gaps = 0/66 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y+KTG CKFGA C+FHHPR++        L+ +G PLRP +  C +Y R G CKFG +
Sbjct  247  QFYMKTGDCKFGAVCRFHHPRERLLPPPDCLLSPIGLPLRPGEPMCIFYSRYGICKFGPS  306

Query  628  CKFHHP  645
            CKF HP
Sbjct  307  CKFDHP  312


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/48 (42%), Positives = 32/48 (67%), Gaps = 0/48 (0%)
 Frame = +3

Query  312  SGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKVL  455
            +G YP R G+ +C YY++TG C+FGA+C+F+HP ++        + VL
Sbjct  33   NGEYPERIGQLECQYYLKTGTCKFGATCKFHHPRDKAGIAGRVTLNVL  80


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +1

Query  556  YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQ  648
            YP R   +EC YY++TG CKFG+TCKFHHP+
Sbjct  36   YPERIGQLECQYYLKTGTCKFGATCKFHHPR  66


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 19/36 (53%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +3

Query  318  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKL  425
             +P R G+P+C +Y++TG C+FGA CRF+HP  R L
Sbjct  236  VFPERLGQPECQFYMKTGDCKFGAVCRFHHPRERLL  271



>emb|CBI17647.3| unnamed protein product [Vitis vinifera]
Length=304

 Score =   150 bits (380),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 67/81 (83%), Positives = 75/81 (93%), Gaps = 0/81 (0%)
 Frame = +1

Query  451  YYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTC  630
            YYLKTG CKFGATCKFHHPRDKAGIAGRV+LN+LGYPLRP++I+C YY+RTGQCKFGSTC
Sbjct  14   YYLKTGTCKFGATCKFHHPRDKAGIAGRVSLNILGYPLRPDEIDCAYYLRTGQCKFGSTC  73

Query  631  KFHHPQPSNMMVPLRGSPAYP  693
            KFHHPQPS+MMV LRG   +P
Sbjct  74   KFHHPQPSSMMVSLRGITNWP  94


 Score = 77.0 bits (188),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 45/66 (68%), Gaps = 0/66 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y+KTG CKFGA C+FHHPR++        L+ +G PLRP +  C +Y R G CKFG +
Sbjct  199  QFYMKTGDCKFGAVCRFHHPRERLIPTPDCVLSPIGLPLRPGEPLCIFYSRYGICKFGPS  258

Query  628  CKFHHP  645
            CKF HP
Sbjct  259  CKFDHP  264


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIA  434
            YP+R  E DC+YY+RTG C+FG++C+F+HP    + ++
Sbjct  49   YPLRPDEIDCAYYLRTGQCKFGSTCKFHHPQPSSMMVS  86


 Score = 50.1 bits (118),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +3

Query  318  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKL  425
             +P R G+P+C +Y++TG C+FGA CRF+HP  R +
Sbjct  188  VFPERPGQPECQFYMKTGDCKFGAVCRFHHPRERLI  223


 Score = 49.7 bits (117),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 32/56 (57%), Gaps = 3/56 (5%)
 Frame = +1

Query  556  YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  723
            +P RP   EC +YM+TG CKFG+ C+FHHP+   +  P        P+  P  PG+
Sbjct  189  FPERPGQPECQFYMKTGDCKFGAVCRFHHPRERLIPTP---DCVLSPIGLPLRPGE  241



>gb|KJB23207.1| hypothetical protein B456_004G086700 [Gossypium raimondii]
Length=473

 Score =   120 bits (301),  Expect(2) = 5e-38, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 65/90 (72%), Gaps = 0/90 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++YLKTG CKFGA+CKFHHP+   G  G V LN+ GYPLRP + EC YY++TGQCKFG T
Sbjct  101  QFYLKTGTCKFGASCKFHHPKHGGGSFGHVPLNIYGYPLRPGEKECSYYLKTGQCKFGVT  160

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTP  717
            CKFHHPQP+   +P      Y PV SP+ P
Sbjct  161  CKFHHPQPAGTSMPASAPQFYQPVQSPSVP  190


 Score = 65.1 bits (157),  Expect(2) = 5e-38, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 35/50 (70%), Gaps = 5/50 (10%)
 Frame = +3

Query  267  ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSN  416
            E++WQLSLR      +G+YP R G PDC YY+RTG C +G  CR+NHP N
Sbjct  33   ESMWQLSLRG-----TGSYPERPGVPDCVYYMRTGFCGYGNRCRYNHPRN  77


 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 47/66 (71%), Gaps = 0/66 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYL+TG CKFG++C++HHPRDK        L+ +G PLRP    C +Y++ G CKFGST
Sbjct  304  QYYLRTGNCKFGSSCRYHHPRDKVVQQTNCILSPMGLPLRPGVQPCAFYLQNGHCKFGST  363

Query  628  CKFHHP  645
            CKF HP
Sbjct  364  CKFDHP  369


 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/66 (44%), Positives = 45/66 (68%), Gaps = 1/66 (2%)
 Frame = +1

Query  451  YYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTC  630
            YY++TG C +G  C+++HPR++A +          YP RP +  C +Y++TG CKFG++C
Sbjct  57   YYMRTGFCGYGNRCRYNHPRNRAAVE-AAVRATGEYPERPGEPACQFYLKTGTCKFGASC  115

Query  631  KFHHPQ  648
            KFHHP+
Sbjct  116  KFHHPK  121


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 20/47 (43%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +3

Query  312  SGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKV  452
            +G YP R GEP C +Y++TG C+FGASC+F+HP +   +     + +
Sbjct  88   TGEYPERPGEPACQFYLKTGTCKFGASCKFHHPKHGGGSFGHVPLNI  134


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 19/40 (48%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAA  440
            YP+R GE +CSYY++TG C+FG +C+F+HP     ++ A+
Sbjct  137  YPLRPGEKECSYYLKTGQCKFGVTCKFHHPQPAGTSMPAS  176


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 34/54 (63%), Gaps = 5/54 (9%)
 Frame = +1

Query  556  YPLRPNDIECPYYMRTGQCKFGSTCKFHHP-----QPSNMMVPLRGSPAYPPVH  702
            +P RP + EC YY+RTG CKFGS+C++HHP     Q +N ++   G P  P V 
Sbjct  294  FPERPGERECQYYLRTGNCKFGSSCRYHHPRDKVVQQTNCILSPMGLPLRPGVQ  347


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 19/34 (56%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +3

Query  318  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNR  419
            T+P R GE +C YY+RTG C+FG+SCR++HP ++
Sbjct  293  TFPERPGERECQYYLRTGNCKFGSSCRYHHPRDK  326



>ref|XP_010241841.1| PREDICTED: zinc finger CCCH domain-containing protein 32-like 
[Nelumbo nucifera]
Length=475

 Score =   119 bits (298),  Expect(2) = 6e-38, Method: Compositional matrix adjust.
 Identities = 55/92 (60%), Positives = 66/92 (72%), Gaps = 0/92 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +Y++KTG CKFGA+CK+HHPR   G    V+LN  GYPLRP + EC YY++TGQCKFG T
Sbjct  101  QYFMKTGTCKFGASCKYHHPRHGGGSVSPVSLNYHGYPLRPGEKECSYYVKTGQCKFGVT  160

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  723
            CKFHHPQP+   VP   S  YP V SP+ P Q
Sbjct  161  CKFHHPQPAGSSVPAPASSFYPMVQSPSVPSQ  192


 Score = 65.9 bits (159),  Expect(2) = 6e-38, Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 38/59 (64%), Gaps = 5/59 (8%)
 Frame = +3

Query  267  ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAAR  443
            E +WQ+ L S ++     YP R  EPDC YY+RTG C +GA CR+NHP +R   + +AR
Sbjct  32   EPMWQMGLVSRDS-----YPERPNEPDCVYYMRTGFCGYGARCRYNHPRDRSAVLGSAR  85


 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 46/66 (70%), Gaps = 0/66 (0%)
 Frame = +1

Query  451  YYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTC  630
            YY++TG C +GA C+++HPRD++ + G      + YP R     C Y+M+TG CKFG++C
Sbjct  56   YYMRTGFCGYGARCRYNHPRDRSAVLGSARPGGVEYPERVGQPVCQYFMKTGTCKFGASC  115

Query  631  KFHHPQ  648
            K+HHP+
Sbjct  116  KYHHPR  121


 Score = 70.9 bits (172),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 42/66 (64%), Gaps = 0/66 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YY++TG CKFG++CK+HHP +         L+ +G PLR     C +Y + G CKFG T
Sbjct  303  QYYMRTGECKFGSSCKYHHPPEWITPKTNCILSPIGLPLRSGASPCAFYTQYGICKFGPT  362

Query  628  CKFHHP  645
            CKF HP
Sbjct  363  CKFDHP  368


 Score = 53.9 bits (128),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 19/39 (49%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAA  437
            YP+R GE +CSYY++TG C+FG +C+F+HP     ++ A
Sbjct  137  YPLRPGEKECSYYVKTGQCKFGVTCKFHHPQPAGSSVPA  175


 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = +1

Query  556  YPLRPNDIECPYYMRTGQCKFGSTCKFHHP  645
            YP RP   EC YYMRTG+CKFGS+CK+HHP
Sbjct  293  YPERPGHPECQYYMRTGECKFGSSCKYHHP  322


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +3

Query  318  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHP  410
             YP R G P+C YY+RTG C+FG+SC+++HP
Sbjct  292  VYPERPGHPECQYYMRTGECKFGSSCKYHHP  322



>gb|KHG22563.1| hypothetical protein F383_29382 [Gossypium arboreum]
Length=475

 Score =   117 bits (294),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 52/90 (58%), Positives = 65/90 (72%), Gaps = 0/90 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++YLKTG CKFGA+CKFHHP+   G   +V LN+ GYPLRP + EC YY++ GQCKFG T
Sbjct  100  QFYLKTGTCKFGASCKFHHPKHGGGSFSQVPLNIYGYPLRPGEEECSYYLKMGQCKFGVT  159

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTP  717
            CKFHHPQP+   +P+     Y PV SP+ P
Sbjct  160  CKFHHPQPAGTSMPVSAPQFYQPVQSPSVP  189


 Score = 66.6 bits (161),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 36/50 (72%), Gaps = 5/50 (10%)
 Frame = +3

Query  267  ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSN  416
            E++WQLSLR  E+     YP R G PDC YY+RTGLC +G+ CR+NHP N
Sbjct  32   ESMWQLSLRGAES-----YPERPGVPDCVYYMRTGLCGYGSRCRYNHPRN  76


 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 47/66 (71%), Gaps = 0/66 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYL+TG CKFG+TC++HHPRD+        L+ +G PLRP    C +Y++ G CKFGST
Sbjct  303  QYYLRTGDCKFGSTCRYHHPRDRVVPRTNCILSPMGLPLRPGVQPCSFYLQNGHCKFGST  362

Query  628  CKFHHP  645
            CKF HP
Sbjct  363  CKFDHP  368


 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/66 (44%), Positives = 46/66 (70%), Gaps = 1/66 (2%)
 Frame = +1

Query  451  YYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTC  630
            YY++TG C +G+ C+++HPR++A +          YP RP +  C +Y++TG CKFG++C
Sbjct  56   YYMRTGLCGYGSRCRYNHPRNRAAVE-AAVRATGEYPERPGEPACQFYLKTGTCKFGASC  114

Query  631  KFHHPQ  648
            KFHHP+
Sbjct  115  KFHHPK  120


 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 20/47 (43%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +3

Query  312  SGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKV  452
            +G YP R GEP C +Y++TG C+FGASC+F+HP +   + +   + +
Sbjct  87   TGEYPERPGEPACQFYLKTGTCKFGASCKFHHPKHGGGSFSQVPLNI  133


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 20/34 (59%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +3

Query  318  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNR  419
            T+P R GEP+C YY+RTG C+FG++CR++HP +R
Sbjct  292  TFPERPGEPECQYYLRTGDCKFGSTCRYHHPRDR  325


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +1

Query  556  YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQ  648
            +P RP + EC YY+RTG CKFGSTC++HHP+
Sbjct  293  FPERPGEPECQYYLRTGDCKFGSTCRYHHPR  323


 Score = 50.4 bits (119),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 19/55 (35%), Positives = 36/55 (65%), Gaps = 2/55 (4%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNH--PSNRKLAIAAARMKVLLEDGSLQV  479
            YP+R GE +CSYY++ G C+FG +C+F+H  P+   + ++A +    ++  S+ +
Sbjct  136  YPLRPGEEECSYYLKMGQCKFGVTCKFHHPQPAGTSMPVSAPQFYQPVQSPSVPM  190



>ref|XP_010243539.1| PREDICTED: zinc finger CCCH domain-containing protein 32 [Nelumbo 
nucifera]
Length=471

 Score =   117 bits (293),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 55/92 (60%), Positives = 66/92 (72%), Gaps = 0/92 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +Y+LKTG CKFGA+CK+HHPR   G A  V+LN  GYPLRP + EC YY++TG CKFG T
Sbjct  101  QYFLKTGTCKFGASCKYHHPRHGGGSAIPVSLNYHGYPLRPGEKECAYYVKTGHCKFGVT  160

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  723
            CKFHHPQP+ + VP      YP V SP+ P Q
Sbjct  161  CKFHHPQPAGVSVPAPAPQFYPTVQSPSVPSQ  192


 Score = 67.0 bits (162),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 38/59 (64%), Gaps = 5/59 (8%)
 Frame = +3

Query  267  ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAAR  443
            E +WQL L S ++     YP R  EPDC Y++RTG C +GA CRFNHP +R   + +AR
Sbjct  32   EPMWQLGLGSRDS-----YPERPNEPDCVYFMRTGFCGYGARCRFNHPRDRSAVLGSAR  85


 Score = 74.7 bits (182),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 29/66 (44%), Positives = 45/66 (68%), Gaps = 0/66 (0%)
 Frame = +1

Query  451  YYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTC  630
            Y+++TG C +GA C+F+HPRD++ + G        YP R     C Y+++TG CKFG++C
Sbjct  56   YFMRTGFCGYGARCRFNHPRDRSAVLGSARPGAGEYPERVGQPVCQYFLKTGTCKFGASC  115

Query  631  KFHHPQ  648
            K+HHP+
Sbjct  116  KYHHPR  121


 Score = 74.3 bits (181),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 43/66 (65%), Gaps = 0/66 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YY++TG CKFG++CK+HHP +         L+ +G PLRP    C +Y + G CKFG T
Sbjct  303  QYYMRTGECKFGSSCKYHHPLEWITPKTNCVLSPMGLPLRPGAQPCTFYTQHGVCKFGPT  362

Query  628  CKFHHP  645
            CKF HP
Sbjct  363  CKFDHP  368


 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = +1

Query  556  YPLRPNDIECPYYMRTGQCKFGSTCKFHHP  645
            YP RP   EC YYMRTG+CKFGS+CK+HHP
Sbjct  293  YPERPGQPECQYYMRTGECKFGSSCKYHHP  322


 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAA  437
            YP+R GE +C+YY++TG C+FG +C+F+HP    +++ A
Sbjct  137  YPLRPGEKECAYYVKTGHCKFGVTCKFHHPQPAGVSVPA  175


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +3

Query  318  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHP  410
             YP R G+P+C YY+RTG C+FG+SC+++HP
Sbjct  292  VYPERPGQPECQYYMRTGECKFGSSCKYHHP  322


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 18/33 (55%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = +3

Query  312  SGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHP  410
            +G YP R G+P C Y+++TG C+FGASC+++HP
Sbjct  88   AGEYPERVGQPVCQYFLKTGTCKFGASCKYHHP  120



>gb|KJB47069.1| hypothetical protein B456_008G009500 [Gossypium raimondii]
Length=475

 Score =   117 bits (292),  Expect(2) = 3e-37, Method: Compositional matrix adjust.
 Identities = 52/90 (58%), Positives = 64/90 (71%), Gaps = 0/90 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++YLKTG CKFGA+CKFHHP+   G    V LN+ GYPLRP + EC YY++ GQCKFG T
Sbjct  100  QFYLKTGTCKFGASCKFHHPKHGGGSFSHVPLNIYGYPLRPGEEECSYYLKMGQCKFGVT  159

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTP  717
            CKFHHPQP+   +P+     Y PV SP+ P
Sbjct  160  CKFHHPQPAGTSMPVSAPQFYQPVQSPSVP  189


 Score = 66.2 bits (160),  Expect(2) = 3e-37, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 36/50 (72%), Gaps = 5/50 (10%)
 Frame = +3

Query  267  ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSN  416
            E++WQLSLR  E+     YP R G PDC YY+RTGLC +G+ CR+NHP N
Sbjct  32   ESMWQLSLRGPES-----YPERPGVPDCVYYMRTGLCGYGSRCRYNHPRN  76


 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 47/66 (71%), Gaps = 0/66 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYL+TG CKFG+TC++HHPRD+        L+ +G PLRP    C +Y++ G CKFGST
Sbjct  303  QYYLRTGDCKFGSTCRYHHPRDRVVPRTNCILSPMGLPLRPGVQPCSFYLQNGHCKFGST  362

Query  628  CKFHHP  645
            CKF HP
Sbjct  363  CKFDHP  368


 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/66 (44%), Positives = 46/66 (70%), Gaps = 1/66 (2%)
 Frame = +1

Query  451  YYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTC  630
            YY++TG C +G+ C+++HPR++A +          YP RP +  C +Y++TG CKFG++C
Sbjct  56   YYMRTGLCGYGSRCRYNHPRNRAAVE-AAVRATGEYPERPGEPACQFYLKTGTCKFGASC  114

Query  631  KFHHPQ  648
            KFHHP+
Sbjct  115  KFHHPK  120


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 20/47 (43%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +3

Query  312  SGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKV  452
            +G YP R GEP C +Y++TG C+FGASC+F+HP +   + +   + +
Sbjct  87   TGEYPERPGEPACQFYLKTGTCKFGASCKFHHPKHGGGSFSHVPLNI  133


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 20/34 (59%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +3

Query  318  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNR  419
            T+P R GEP+C YY+RTG C+FG++CR++HP +R
Sbjct  292  TFPERPGEPECQYYLRTGDCKFGSTCRYHHPRDR  325


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +1

Query  556  YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQ  648
            +P RP + EC YY+RTG CKFGSTC++HHP+
Sbjct  293  FPERPGEPECQYYLRTGDCKFGSTCRYHHPR  323


 Score = 50.4 bits (119),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 19/55 (35%), Positives = 36/55 (65%), Gaps = 2/55 (4%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNH--PSNRKLAIAAARMKVLLEDGSLQV  479
            YP+R GE +CSYY++ G C+FG +C+F+H  P+   + ++A +    ++  S+ +
Sbjct  136  YPLRPGEEECSYYLKMGQCKFGVTCKFHHPQPAGTSMPVSAPQFYQPVQSPSVPM  190



>ref|XP_006855486.1| hypothetical protein AMTR_s00057p00193570 [Amborella trichopoda]
 gb|ERN16953.1| hypothetical protein AMTR_s00057p00193570 [Amborella trichopoda]
Length=458

 Score =   121 bits (304),  Expect(2) = 3e-37, Method: Compositional matrix adjust.
 Identities = 57/91 (63%), Positives = 68/91 (75%), Gaps = 1/91 (1%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +Y++KTG CKFGATCK+HHPR   G+   V LN+LGYPLRP D EC YY++TGQCKFG T
Sbjct  100  QYFIKTGTCKFGATCKYHHPRYGGGLMSPVGLNILGYPLRPGDKECSYYVKTGQCKFGPT  159

Query  628  CKFHHPQPSNMMVPLRGSPA-YPPVHSPTTP  717
            CKFHHPQP N  +    +P  YP VHSP+ P
Sbjct  160  CKFHHPQPVNTSLQTTPAPQFYPTVHSPSQP  190


 Score = 60.8 bits (146),  Expect(2) = 3e-37, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 37/54 (69%), Gaps = 2/54 (4%)
 Frame = +3

Query  267  ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLA  428
            E++W+LSL      E   YP R GE DC +Y++TG CR+GA+CR+NHP +R  A
Sbjct  28   ESMWRLSLGRESGGE--YYPERPGEADCMFYMKTGFCRYGANCRYNHPHDRNPA  79


 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 45/66 (68%), Gaps = 0/66 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y++TG CK+G+TC++HHP D+        L+ +G+PLRP    C +Y + G CKFG T
Sbjct  300  QFYMRTGDCKYGSTCRYHHPPDRIVPQTNCTLSPIGFPLRPGAPTCSFYAQHGVCKFGPT  359

Query  628  CKFHHP  645
            CKF HP
Sbjct  360  CKFDHP  365


 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/66 (44%), Positives = 44/66 (67%), Gaps = 0/66 (0%)
 Frame = +1

Query  451  YYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTC  630
            +Y+KTG C++GA C+++HP D+   A  +      YP R     C Y+++TG CKFG+TC
Sbjct  55   FYMKTGFCRYGANCRYNHPHDRNPAADVLQTGGGEYPERVGQPTCQYFIKTGTCKFGATC  114

Query  631  KFHHPQ  648
            K+HHP+
Sbjct  115  KYHHPR  120


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +3

Query  315  GTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKVL  455
            G YP R G+P C Y+I+TG C+FGA+C+++HP      ++   + +L
Sbjct  88   GEYPERVGQPTCQYFIKTGTCKFGATCKYHHPRYGGGLMSPVGLNIL  134


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +3

Query  285  SLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNR  419
            S+      +  T+P R G+P+C +Y+RTG C++G++CR++HP +R
Sbjct  278  SVAGPSGTKENTFPERPGQPECQFYMRTGDCKYGSTCRYHHPPDR  322


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/44 (48%), Positives = 28/44 (64%), Gaps = 0/44 (0%)
 Frame = +1

Query  514  KAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHP  645
             + +AG        +P RP   EC +YMRTG CK+GSTC++HHP
Sbjct  276  SSSVAGPSGTKENTFPERPGQPECQFYMRTGDCKYGSTCRYHHP  319


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 17/30 (57%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHP  410
            YP+R G+ +CSYY++TG C+FG +C+F+HP
Sbjct  136  YPLRPGDKECSYYVKTGQCKFGPTCKFHHP  165



>ref|XP_007050814.1| Zinc finger C-x8-C-x5-C-x3-H type family protein [Theobroma cacao]
 gb|EOX94971.1| Zinc finger C-x8-C-x5-C-x3-H type family protein [Theobroma cacao]
Length=476

 Score =   117 bits (294),  Expect(2) = 5e-37, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 64/90 (71%), Gaps = 0/90 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++YLKTG CKFGA+CKFHHP+   G    V LN+ GYPLRP + EC YY++TGQCKFG T
Sbjct  100  QFYLKTGTCKFGASCKFHHPKHGGGSFSHVPLNIYGYPLRPGEKECSYYLKTGQCKFGIT  159

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTP  717
            CKFHHPQP+   +P      Y PV SP+ P
Sbjct  160  CKFHHPQPAGTSMPASAPQFYQPVQSPSVP  189


 Score = 64.3 bits (155),  Expect(2) = 5e-37, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 34/50 (68%), Gaps = 5/50 (10%)
 Frame = +3

Query  267  ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSN  416
            E++WQLSLR  E+     YP R G PDC YY+RTG C +G  CR+NHP N
Sbjct  32   ESMWQLSLRGTES-----YPERPGVPDCVYYMRTGFCGYGNRCRYNHPRN  76


 Score = 84.0 bits (206),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 47/66 (71%), Gaps = 0/66 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYL+TG CKFG++C++HHPRD+        L+ +G PLRP    C +Y++ G CKFGST
Sbjct  303  QYYLRTGDCKFGSSCRYHHPRDRVVPRTNCVLSPMGLPLRPGVQPCSFYLQNGHCKFGST  362

Query  628  CKFHHP  645
            CKF HP
Sbjct  363  CKFDHP  368


 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/66 (44%), Positives = 45/66 (68%), Gaps = 1/66 (2%)
 Frame = +1

Query  451  YYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTC  630
            YY++TG C +G  C+++HPR++A +          YP RP +  C +Y++TG CKFG++C
Sbjct  56   YYMRTGFCGYGNRCRYNHPRNRAAVE-AAVRATGEYPERPGEPACQFYLKTGTCKFGASC  114

Query  631  KFHHPQ  648
            KFHHP+
Sbjct  115  KFHHPK  120


 Score = 56.6 bits (135),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +3

Query  318  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNR  419
            T+P R GEP+C YY+RTG C+FG+SCR++HP +R
Sbjct  292  TFPERPGEPECQYYLRTGDCKFGSSCRYHHPRDR  325


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 20/47 (43%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +3

Query  312  SGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKV  452
            +G YP R GEP C +Y++TG C+FGASC+F+HP +   + +   + +
Sbjct  87   TGEYPERPGEPACQFYLKTGTCKFGASCKFHHPKHGGGSFSHVPLNI  133


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 19/40 (48%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAA  440
            YP+R GE +CSYY++TG C+FG +C+F+HP     ++ A+
Sbjct  136  YPLRPGEKECSYYLKTGQCKFGITCKFHHPQPAGTSMPAS  175


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +1

Query  556  YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQ  648
            +P RP + EC YY+RTG CKFGS+C++HHP+
Sbjct  293  FPERPGEPECQYYLRTGDCKFGSSCRYHHPR  323



>ref|XP_006444253.1| hypothetical protein CICLE_v10019968mg [Citrus clementina]
 ref|XP_006479891.1| PREDICTED: zinc finger CCCH domain-containing protein 32-like 
[Citrus sinensis]
 gb|ESR57493.1| hypothetical protein CICLE_v10019968mg [Citrus clementina]
 gb|KDO87366.1| hypothetical protein CISIN_1g011776mg [Citrus sinensis]
Length=477

 Score =   124 bits (310),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 55/90 (61%), Positives = 65/90 (72%), Gaps = 0/90 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++YLKTG CKFGA+CKFHHP+   G    V LN+ GYPLRP + EC YY++TGQCKFG T
Sbjct  101  QFYLKTGTCKFGASCKFHHPKHSGGSMSHVPLNIYGYPLRPGEKECSYYLKTGQCKFGIT  160

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTP  717
            CKFHHPQP+   +P      YPPV SPT P
Sbjct  161  CKFHHPQPAGTSLPASAPQFYPPVQSPTVP  190


 Score = 57.4 bits (137),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 33/50 (66%), Gaps = 5/50 (10%)
 Frame = +3

Query  267  ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSN  416
            E++WQ  L+  E+     YP R G PDC +Y+RTG+C +G  CR+NHP N
Sbjct  33   ESMWQSDLKVNES-----YPQRHGVPDCVFYMRTGVCGYGDRCRYNHPRN  77


 Score = 87.4 bits (215),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 44/91 (48%), Positives = 59/91 (65%), Gaps = 6/91 (7%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +Y+LKTG CKFG++C+FHHPRD+       AL+ LG PLRP    C +Y++ G+CKFG+T
Sbjct  304  QYFLKTGDCKFGSSCRFHHPRDRVVPRTNCALSPLGLPLRPGAQPCTFYLQNGRCKFGAT  363

Query  628  CKFHHPQPSNMMVPLRGSP-AYPPVHSPTTP  717
            CKF HP     M  +R SP A   + +P  P
Sbjct  364  CKFDHP-----MGAMRYSPSASSLIETPVAP  389


 Score = 65.9 bits (159),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 45/66 (68%), Gaps = 1/66 (2%)
 Frame = +1

Query  451  YYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTC  630
            +Y++TG C +G  C+++HPR++A +          YP RP +  C +Y++TG CKFG++C
Sbjct  57   FYMRTGVCGYGDRCRYNHPRNRAAVE-AAVRATGDYPDRPGEPICQFYLKTGTCKFGASC  115

Query  631  KFHHPQ  648
            KFHHP+
Sbjct  116  KFHHPK  121


 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 20/47 (43%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +3

Query  312  SGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKV  452
            +G YP R GEP C +Y++TG C+FGASC+F+HP +   +++   + +
Sbjct  88   TGDYPDRPGEPICQFYLKTGTCKFGASCKFHHPKHSGGSMSHVPLNI  134


 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 19/34 (56%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +3

Query  318  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNR  419
            ++P R GEP+C Y+++TG C+FG+SCRF+HP +R
Sbjct  293  SFPERPGEPECQYFLKTGDCKFGSSCRFHHPRDR  326


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 19/40 (48%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAA  440
            YP+R GE +CSYY++TG C+FG +C+F+HP     ++ A+
Sbjct  137  YPLRPGEKECSYYLKTGQCKFGITCKFHHPQPAGTSLPAS  176


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 38/55 (69%), Gaps = 3/55 (5%)
 Frame = +1

Query  556  YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPG  720
            +P RP + EC Y+++TG CKFGS+C+FHHP+  + +VP R + A  P+  P  PG
Sbjct  294  FPERPGEPECQYFLKTGDCKFGSSCRFHHPR--DRVVP-RTNCALSPLGLPLRPG  345



>ref|XP_006380188.1| hypothetical protein POPTR_0008s22730g [Populus trichocarpa]
 gb|ERP57985.1| hypothetical protein POPTR_0008s22730g [Populus trichocarpa]
Length=477

 Score =   117 bits (292),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 52/89 (58%), Positives = 67/89 (75%), Gaps = 1/89 (1%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YY++TG CKFGA+CK+HHP+   G A  V+LN  GYPLRP + EC YY++TGQCKFG+T
Sbjct  100  QYYMRTGTCKFGASCKYHHPKQGGGSASPVSLNYYGYPLRPGERECTYYIKTGQCKFGAT  159

Query  628  CKFHHPQPSNMMVPLRG-SPAYPPVHSPT  711
            CKFHHPQP N+ +P +  +P   PV  PT
Sbjct  160  CKFHHPQPGNIQIPAQSLAPQIAPVPGPT  188


 Score = 64.3 bits (155),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 36/59 (61%), Gaps = 4/59 (7%)
 Frame = +3

Query  267  ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAAR  443
            E +WQL L   E+     YP R  E DC YY+RTG C +GA CR+NHP +R   + AAR
Sbjct  30   EGVWQLGLGETES----EYPERSNEQDCMYYLRTGFCGYGARCRYNHPRDRNAVLGAAR  84


 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 44/66 (67%), Gaps = 0/66 (0%)
 Frame = +1

Query  451  YYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTC  630
            YYL+TG C +GA C+++HPRD+  + G        YP R     C YYMRTG CKFG++C
Sbjct  55   YYLRTGFCGYGARCRYNHPRDRNAVLGAARAGGAEYPERAGQPLCQYYMRTGTCKFGASC  114

Query  631  KFHHPQ  648
            K+HHP+
Sbjct  115  KYHHPK  120


 Score = 74.7 bits (182),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 49/84 (58%), Gaps = 0/84 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YY+KTG CKF ++C++HHP +       V L+ +G PLRP    C +Y + GQCKFG  
Sbjct  308  QYYIKTGDCKFRSSCRYHHPPELVVSKSNVVLSPIGLPLRPGAPTCSHYTQRGQCKFGPA  367

Query  628  CKFHHPQPSNMMVPLRGSPAYPPV  699
            CKF HP  +    P   S A  PV
Sbjct  368  CKFDHPMGTLSYSPSASSLADMPV  391


 Score = 56.2 bits (134),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARM  446
            YP+R GE +C+YYI+TG C+FGA+C+F+HP    + I A  +
Sbjct  136  YPLRPGERECTYYIKTGQCKFGATCKFHHPQPGNIQIPAQSL  177


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 19/30 (63%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHP  410
            YP R G+P C YY+RTG C+FGASC+++HP
Sbjct  90   YPERAGQPLCQYYMRTGTCKFGASCKYHHP  119


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 36/144 (25%), Positives = 63/144 (44%), Gaps = 23/144 (16%)
 Frame = +3

Query  36   GNFMTLPFSFWILTFNLLQYFLVIPESWCIYAG--FKLSDSYI*ASIGQLCLYCFHC*YP  209
            G+++  P+   +L+ +++ Y      SW  Y      ++      ++G   +Y      P
Sbjct  216  GSYVQGPYGPVLLSPSVVPY-----PSWNPYPAPVSPVASPNTQPAVGSGSVYGMSALSP  270

Query  210  LVPTY-AVFMSKDTAICTR*ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFG  386
              P Y   F S   A              S  T +   +P R G+P+C YYI+TG C+F 
Sbjct  271  SAPAYTGAFQSIPPATGP-----------SSSTQKEHLFPERPGQPECQYYIKTGDCKFR  319

Query  387  ASCRFNHPSNRKLAIAAARMKVLL  458
            +SCR++HP      +  ++  V+L
Sbjct  320  SSCRYHHPPE----LVVSKSNVVL  339



>ref|XP_011018690.1| PREDICTED: zinc finger CCCH domain-containing protein 34-like 
[Populus euphratica]
Length=479

 Score =   118 bits (295),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 53/89 (60%), Positives = 68/89 (76%), Gaps = 1/89 (1%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YY++TG CKFGA+CK+HHP+   G A  V+LN  GYPLRP + EC YY++TGQCKFG+T
Sbjct  100  QYYMRTGTCKFGASCKYHHPKQGGGSASPVSLNYYGYPLRPGERECTYYIKTGQCKFGAT  159

Query  628  CKFHHPQPSNMMVPLRG-SPAYPPVHSPT  711
            CKFHHPQP N+ +P +  +P   PV SPT
Sbjct  160  CKFHHPQPGNIQIPAQSLAPQIAPVPSPT  188


 Score = 62.4 bits (150),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 36/59 (61%), Gaps = 4/59 (7%)
 Frame = +3

Query  267  ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAAR  443
            E +WQL L   E++    YP R  E DC YY+RTG C +GA CR+NHP +R   + A R
Sbjct  30   EGVWQLGLGETESV----YPERPNEQDCMYYLRTGWCGYGARCRYNHPRDRSAVLGAPR  84


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 45/66 (68%), Gaps = 0/66 (0%)
 Frame = +1

Query  451  YYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTC  630
            YYL+TG C +GA C+++HPRD++ + G        YP R     C YYMRTG CKFG++C
Sbjct  55   YYLRTGWCGYGARCRYNHPRDRSAVLGAPRAGGAEYPERVGQPLCQYYMRTGTCKFGASC  114

Query  631  KFHHPQ  648
            K+HHP+
Sbjct  115  KYHHPK  120


 Score = 73.9 bits (180),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 49/84 (58%), Gaps = 0/84 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YY+KTG CKF ++C++HHP +       V L+ +G PLRP    C +Y + GQCKFG  
Sbjct  308  QYYIKTGDCKFRSSCRYHHPPELVVSKTNVVLSPIGLPLRPGAPTCSHYTQRGQCKFGPA  367

Query  628  CKFHHPQPSNMMVPLRGSPAYPPV  699
            CKF HP  +    P   S A  PV
Sbjct  368  CKFDHPMGTLSYSPSASSLADMPV  391


 Score = 56.2 bits (134),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARM  446
            YP+R GE +C+YYI+TG C+FGA+C+F+HP    + I A  +
Sbjct  136  YPLRPGERECTYYIKTGQCKFGATCKFHHPQPGNIQIPAQSL  177


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 37/151 (25%), Positives = 65/151 (43%), Gaps = 23/151 (15%)
 Frame = +3

Query  36   GNFMTLPFSFWILTFNLLQYFLVIPESWCIYAG--FKLSDSYI*ASIGQLCLYCFHC*YP  209
            G+++  P+   +L+ +++ Y      SW  Y      ++      ++G   +Y      P
Sbjct  216  GSYVQGPYGPVLLSPSVVPY-----PSWNPYPAPVSPVASPNTQPAVGSGSVYGLSALSP  270

Query  210  LVPTY-AVFMSKDTAICTR*ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFG  386
              P Y   F S   A              S  T +   +P R G+P+C YYI+TG C+F 
Sbjct  271  SAPAYTGAFQSIPPATGP-----------SSSTQKEHLFPERPGQPECQYYIKTGDCKFR  319

Query  387  ASCRFNHPSNRKLAIAAARMKVLLEDGSLQV  479
            +SCR++HP      +  ++  V+L    L +
Sbjct  320  SSCRYHHPPE----LVVSKTNVVLSPIGLPL  346


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 19/30 (63%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHP  410
            YP R G+P C YY+RTG C+FGASC+++HP
Sbjct  90   YPERVGQPLCQYYMRTGTCKFGASCKYHHP  119



>dbj|BAD87736.1| putative zinc finger protein [Oryza sativa Japonica Group]
Length=322

 Score =   142 bits (357),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 65/91 (71%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFG TCKFHHPR+KAGIAGRV LN LGYPLRP++ EC YY++TGQCK+G+T
Sbjct  15   QYYLKTGTCKFGPTCKFHHPREKAGIAGRVQLNTLGYPLRPSEKECAYYLKTGQCKYGNT  74

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTPG  720
            CKFHHP+  N M   RGSP YP VHS  T G
Sbjct  75   CKFHHPELFNAMASSRGSPIYPSVHSSATAG  105


 Score = 80.9 bits (198),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 41/81 (51%), Positives = 50/81 (62%), Gaps = 4/81 (5%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YY+KTG CKFGA CKFHHPR ++       L+ +G PLRP +  C +Y R G CKFG+ 
Sbjct  222  QYYMKTGDCKFGAVCKFHHPRVRSMPTPDCVLSPVGLPLRPGEELCKFYSRYGICKFGAN  281

Query  628  CKFHHPQPSNMMVPLRGSPAY  690
            CKF HP     M P  G  AY
Sbjct  282  CKFDHP----TMAPPMGVYAY  298


 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/46 (48%), Positives = 34/46 (74%), Gaps = 2/46 (4%)
 Frame = +3

Query  315  GTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKV  452
            G YP R G+P+C YY++TG C+FG +C+F+HP  R+ A  A R+++
Sbjct  3    GEYPERMGQPECQYYLKTGTCKFGPTCKFHHP--REKAGIAGRVQL  46


 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 34/56 (61%), Gaps = 3/56 (5%)
 Frame = +1

Query  556  YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPGQ  723
            +P RP+  EC YYM+TG CKFG+ CKFHHP+  +M  P        PV  P  PG+
Sbjct  212  FPERPDQPECQYYMKTGDCKFGAVCKFHHPRVRSMPTP---DCVLSPVGLPLRPGE  264



>ref|XP_010684493.1| PREDICTED: zinc finger CCCH domain-containing protein 32-like 
[Beta vulgaris subsp. vulgaris]
Length=462

 Score =   120 bits (301),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 65/90 (72%), Gaps = 0/90 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +Y+LKTG CKFG TCKF+HPR+  G      LN+ G+PLRP + EC YY++TGQCKFG T
Sbjct  94   QYFLKTGTCKFGTTCKFNHPRNAGGSLTNAPLNIQGFPLRPGEKECSYYLKTGQCKFGIT  153

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTP  717
            CKFHHPQP+ M +P    P YP V SP+ P
Sbjct  154  CKFHHPQPAGMSMPAAAPPFYPTVQSPSVP  183


 Score = 59.7 bits (143),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 31/60 (52%), Positives = 39/60 (65%), Gaps = 5/60 (8%)
 Frame = +3

Query  267  ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARM  446
            E++W+L L   ET     YP R G  DC YY+RTG C FG  CR+NHP +R  A+AAAR+
Sbjct  25   ESMWRLGLSGRET-----YPERPGVSDCVYYMRTGFCGFGTRCRYNHPHDRAAAVAAARL  79


 Score = 80.5 bits (197),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 43/66 (65%), Gaps = 0/66 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +Y+LKTG CKFG +C++HHP D    A    L  LG PLRP    C +YM+ G CKFG T
Sbjct  296  QYFLKTGNCKFGGSCRYHHPPDGGASAAACFLGPLGLPLRPGTQPCTFYMQHGYCKFGPT  355

Query  628  CKFHHP  645
            CKF HP
Sbjct  356  CKFDHP  361


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 21/49 (43%), Positives = 32/49 (65%), Gaps = 0/49 (0%)
 Frame = +3

Query  306  MESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKV  452
            +  G YP R GEP C Y+++TG C+FG +C+FNHP N   ++  A + +
Sbjct  79   LVGGEYPERPGEPVCQYFLKTGTCKFGTTCKFNHPRNAGGSLTNAPLNI  127


 Score = 53.9 bits (128),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 19/40 (48%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAA  440
            +P+R GE +CSYY++TG C+FG +C+F+HP    +++ AA
Sbjct  130  FPLRPGEKECSYYLKTGQCKFGITCKFHHPQPAGMSMPAA  169


 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKVL  455
            +P R GEP+C Y+++TG C+FG SCR++HP +   + AA  +  L
Sbjct  286  FPERPGEPECQYFLKTGNCKFGGSCRYHHPPDGGASAAACFLGPL  330



>gb|KEH43245.1| zinc finger C-x8-C-x5-C-x3-H type protein [Medicago truncatula]
Length=348

 Score =   118 bits (295),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 64/90 (71%), Gaps = 0/90 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFGA+CKFHHP++  G   +  LN+ GYPLRP + EC YY++TGQCKFG T
Sbjct  101  QYYLKTGTCKFGASCKFHHPKNGGGYLSQAPLNIYGYPLRPGESECSYYLKTGQCKFGVT  160

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTP  717
            CKFHHPQP+   +P      Y  V SPT P
Sbjct  161  CKFHHPQPAGTSLPASAPQFYQQVQSPTVP  190


 Score = 62.0 bits (149),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 34/48 (71%), Gaps = 2/48 (4%)
 Frame = +3

Query  267  ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHP  410
            E++W LSL S   +ES  YP R G P+C+YY+RTG C +G  CRFNHP
Sbjct  30   ESMWHLSLGSGGGVES--YPERHGVPNCAYYMRTGFCGYGGRCRFNHP  75


 Score = 67.4 bits (163),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 45/66 (68%), Gaps = 1/66 (2%)
 Frame = +1

Query  451  YYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTC  630
            YY++TG C +G  C+F+HPRD+A +A         YP R  +  C YY++TG CKFG++C
Sbjct  57   YYMRTGFCGYGGRCRFNHPRDRAAVA-AAVRATGDYPERLGEPPCQYYLKTGTCKFGASC  115

Query  631  KFHHPQ  648
            KFHHP+
Sbjct  116  KFHHPK  121


 Score = 59.3 bits (142),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +3

Query  312  SGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKV  452
            +G YP R GEP C YY++TG C+FGASC+F+HP N    ++ A + +
Sbjct  88   TGDYPERLGEPPCQYYLKTGTCKFGASCKFHHPKNGGGYLSQAPLNI  134


 Score = 53.1 bits (126),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 19/40 (48%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAA  440
            YP+R GE +CSYY++TG C+FG +C+F+HP     ++ A+
Sbjct  137  YPLRPGESECSYYLKTGQCKFGVTCKFHHPQPAGTSLPAS  176


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/45 (49%), Positives = 31/45 (69%), Gaps = 2/45 (4%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIE  582
            +YY++TG CKFG  C++HHPRD+  +A R  L+  G PLRP   +
Sbjct  305  QYYMRTGDCKFGLACRYHHPRDQ--VAARPLLSPFGLPLRPEGSQ  347


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/42 (48%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = +3

Query  303  TMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLA  428
            T++   +P R GEP C YY+RTG C+FG +CR++HP ++  A
Sbjct  289  TLQEKVFPERPGEPVCQYYMRTGDCKFGLACRYHHPRDQVAA  330



>gb|KEH43244.1| zinc finger C-x8-C-x5-C-x3-H type protein [Medicago truncatula]
Length=344

 Score =   118 bits (295),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 64/90 (71%), Gaps = 0/90 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFGA+CKFHHP++  G   +  LN+ GYPLRP + EC YY++TGQCKFG T
Sbjct  101  QYYLKTGTCKFGASCKFHHPKNGGGYLSQAPLNIYGYPLRPGESECSYYLKTGQCKFGVT  160

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTP  717
            CKFHHPQP+   +P      Y  V SPT P
Sbjct  161  CKFHHPQPAGTSLPASAPQFYQQVQSPTVP  190


 Score = 62.0 bits (149),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 34/48 (71%), Gaps = 2/48 (4%)
 Frame = +3

Query  267  ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHP  410
            E++W LSL S   +ES  YP R G P+C+YY+RTG C +G  CRFNHP
Sbjct  30   ESMWHLSLGSGGGVES--YPERHGVPNCAYYMRTGFCGYGGRCRFNHP  75


 Score = 67.4 bits (163),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 45/66 (68%), Gaps = 1/66 (2%)
 Frame = +1

Query  451  YYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTC  630
            YY++TG C +G  C+F+HPRD+A +A         YP R  +  C YY++TG CKFG++C
Sbjct  57   YYMRTGFCGYGGRCRFNHPRDRAAVA-AAVRATGDYPERLGEPPCQYYLKTGTCKFGASC  115

Query  631  KFHHPQ  648
            KFHHP+
Sbjct  116  KFHHPK  121


 Score = 59.3 bits (142),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +3

Query  312  SGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKV  452
            +G YP R GEP C YY++TG C+FGASC+F+HP N    ++ A + +
Sbjct  88   TGDYPERLGEPPCQYYLKTGTCKFGASCKFHHPKNGGGYLSQAPLNI  134


 Score = 52.8 bits (125),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 19/40 (48%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAA  440
            YP+R GE +CSYY++TG C+FG +C+F+HP     ++ A+
Sbjct  137  YPLRPGESECSYYLKTGQCKFGVTCKFHHPQPAGTSLPAS  176


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/42 (48%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = +3

Query  303  TMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLA  428
            T++   +P R GEP C YY+RTG C+FG +CR++HP ++  A
Sbjct  289  TLQEKVFPERPGEPVCQYYMRTGDCKFGLACRYHHPRDQVAA  330


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 30/41 (73%), Gaps = 2/41 (5%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRP  570
            +YY++TG CKFG  C++HHPRD+  +A R  L+  G PLRP
Sbjct  305  QYYMRTGDCKFGLACRYHHPRDQ--VAARPLLSPFGLPLRP  343



>gb|KEH43243.1| zinc finger C-x8-C-x5-C-x3-H type protein [Medicago truncatula]
Length=351

 Score =   118 bits (295),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 64/90 (71%), Gaps = 0/90 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFGA+CKFHHP++  G   +  LN+ GYPLRP + EC YY++TGQCKFG T
Sbjct  101  QYYLKTGTCKFGASCKFHHPKNGGGYLSQAPLNIYGYPLRPGESECSYYLKTGQCKFGVT  160

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTP  717
            CKFHHPQP+   +P      Y  V SPT P
Sbjct  161  CKFHHPQPAGTSLPASAPQFYQQVQSPTVP  190


 Score = 62.0 bits (149),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 34/48 (71%), Gaps = 2/48 (4%)
 Frame = +3

Query  267  ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHP  410
            E++W LSL S   +ES  YP R G P+C+YY+RTG C +G  CRFNHP
Sbjct  30   ESMWHLSLGSGGGVES--YPERHGVPNCAYYMRTGFCGYGGRCRFNHP  75


 Score = 67.4 bits (163),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 45/66 (68%), Gaps = 1/66 (2%)
 Frame = +1

Query  451  YYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTC  630
            YY++TG C +G  C+F+HPRD+A +A         YP R  +  C YY++TG CKFG++C
Sbjct  57   YYMRTGFCGYGGRCRFNHPRDRAAVA-AAVRATGDYPERLGEPPCQYYLKTGTCKFGASC  115

Query  631  KFHHPQ  648
            KFHHP+
Sbjct  116  KFHHPK  121


 Score = 59.3 bits (142),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +3

Query  312  SGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKV  452
            +G YP R GEP C YY++TG C+FGASC+F+HP N    ++ A + +
Sbjct  88   TGDYPERLGEPPCQYYLKTGTCKFGASCKFHHPKNGGGYLSQAPLNI  134


 Score = 52.8 bits (125),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 19/40 (48%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAA  440
            YP+R GE +CSYY++TG C+FG +C+F+HP     ++ A+
Sbjct  137  YPLRPGESECSYYLKTGQCKFGVTCKFHHPQPAGTSLPAS  176


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/42 (52%), Positives = 31/42 (74%), Gaps = 2/42 (5%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPN  573
            +YY++TG CKFG  C++HHPRD+  +A R  L+  G PLRP+
Sbjct  305  QYYMRTGDCKFGLACRYHHPRDQ--VAARPLLSPFGLPLRPD  344


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/42 (48%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = +3

Query  303  TMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLA  428
            T++   +P R GEP C YY+RTG C+FG +CR++HP ++  A
Sbjct  289  TLQEKVFPERPGEPVCQYYMRTGDCKFGLACRYHHPRDQVAA  330



>ref|XP_002993790.1| hypothetical protein SELMODRAFT_45658, partial [Selaginella moellendorffii]
 gb|EFJ05156.1| hypothetical protein SELMODRAFT_45658, partial [Selaginella moellendorffii]
Length=295

 Score =   110 bits (275),  Expect(2) = 3e-36, Method: Compositional matrix adjust.
 Identities = 48/69 (70%), Positives = 57/69 (83%), Gaps = 0/69 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +Y+LKTG CKFG+TCK+ HPRDKAGI  RV LN++G P RP + EC YYMRTG CK+G T
Sbjct  61   QYFLKTGTCKFGSTCKYDHPRDKAGIQSRVQLNIVGLPYRPGEKECAYYMRTGSCKYGVT  120

Query  628  CKFHHPQPS  654
            CKFHHPQP+
Sbjct  121  CKFHHPQPA  129


 Score = 68.9 bits (167),  Expect(2) = 3e-36, Method: Compositional matrix adjust.
 Identities = 32/45 (71%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = +3

Query  315  GTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMK  449
            G YP R GE DC YY+RTGLC FG SC+FNHP NRKLA A AR K
Sbjct  4    GPYPERPGEQDCVYYMRTGLCAFGMSCKFNHPPNRKLAAAIARGK  48


 Score = 82.0 bits (201),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 46/66 (70%), Gaps = 0/66 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CK+GA+C+FHHPRD+   +    L+ +G PLR     C YY+R G CKFG T
Sbjct  211  QYYLKTGDCKYGASCRFHHPRDRISASAPTMLSPMGLPLRTGVQPCSYYIRFGICKFGPT  270

Query  628  CKFHHP  645
            CKF HP
Sbjct  271  CKFDHP  276


 Score = 73.6 bits (179),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 46/66 (70%), Gaps = 1/66 (2%)
 Frame = +1

Query  451  YYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTC  630
            YY++TG C FG +CKF+HP ++  +A  +A     YP RP   EC Y+++TG CKFGSTC
Sbjct  17   YYMRTGLCAFGMSCKFNHPPNRK-LAAAIARGKGEYPERPGQPECQYFLKTGTCKFGSTC  75

Query  631  KFHHPQ  648
            K+ HP+
Sbjct  76   KYDHPR  81


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +3

Query  315  GTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKVL  455
            G YP R G+P+C Y+++TG C+FG++C+++HP ++    +  ++ ++
Sbjct  49   GEYPERPGQPECQYFLKTGTCKFGSTCKYDHPRDKAGIQSRVQLNIV  95



>ref|XP_002993272.1| hypothetical protein SELMODRAFT_45667, partial [Selaginella moellendorffii]
 gb|EFJ05693.1| hypothetical protein SELMODRAFT_45667, partial [Selaginella moellendorffii]
Length=294

 Score =   110 bits (275),  Expect(2) = 3e-36, Method: Compositional matrix adjust.
 Identities = 48/69 (70%), Positives = 57/69 (83%), Gaps = 0/69 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +Y+LKTG CKFG+TCK+ HPRDKAGI  RV LN++G P RP + EC YYMRTG CK+G T
Sbjct  61   QYFLKTGTCKFGSTCKYDHPRDKAGIQSRVQLNIVGLPYRPGEKECAYYMRTGSCKYGVT  120

Query  628  CKFHHPQPS  654
            CKFHHPQP+
Sbjct  121  CKFHHPQPA  129


 Score = 68.9 bits (167),  Expect(2) = 3e-36, Method: Compositional matrix adjust.
 Identities = 32/45 (71%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = +3

Query  315  GTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMK  449
            G YP R GE DC YY+RTGLC FG SC+FNHP NRKLA A AR K
Sbjct  4    GPYPERPGEQDCVYYMRTGLCAFGMSCKFNHPPNRKLAAAIARGK  48


 Score = 82.0 bits (201),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 46/66 (70%), Gaps = 0/66 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CK+GA+C+FHHPRD+   +    L+ +G PLR     C YY+R G CKFG T
Sbjct  210  QYYLKTGDCKYGASCRFHHPRDRISASAPTMLSPMGLPLRTGVQPCSYYIRFGICKFGPT  269

Query  628  CKFHHP  645
            CKF HP
Sbjct  270  CKFDHP  275


 Score = 73.6 bits (179),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 46/66 (70%), Gaps = 1/66 (2%)
 Frame = +1

Query  451  YYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTC  630
            YY++TG C FG +CKF+HP ++  +A  +A     YP RP   EC Y+++TG CKFGSTC
Sbjct  17   YYMRTGLCAFGMSCKFNHPPNRK-LAAAIARGKGEYPERPGQPECQYFLKTGTCKFGSTC  75

Query  631  KFHHPQ  648
            K+ HP+
Sbjct  76   KYDHPR  81


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +3

Query  315  GTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKVL  455
            G YP R G+P+C Y+++TG C+FG++C+++HP ++    +  ++ ++
Sbjct  49   GEYPERPGQPECQYFLKTGTCKFGSTCKYDHPRDKAGIQSRVQLNIV  95



>ref|XP_009417932.1| PREDICTED: zinc finger CCCH domain-containing protein 6-like 
isoform X3 [Musa acuminata subsp. malaccensis]
Length=340

 Score =   117 bits (294),  Expect(2) = 5e-36, Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 67/91 (74%), Gaps = 1/91 (1%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YY++TG+CKFG++CK+ HPR   G A  V+LN  GYPLRP + EC YYM+TGQCKFGST
Sbjct  94   EYYMRTGSCKFGSSCKYDHPRQGGGSAQPVSLNYYGYPLRPGEKECGYYMKTGQCKFGST  153

Query  628  CKFHHPQPSNMMVPLRGSPA-YPPVHSPTTP  717
            CKFHHPQP    VP   +PA YP V  P+ P
Sbjct  154  CKFHHPQPGGASVPSASAPAFYPSVQHPSVP  184


 Score = 60.8 bits (146),  Expect(2) = 5e-36, Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 35/63 (56%), Gaps = 3/63 (5%)
 Frame = +3

Query  267  ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARM  446
            E++W+L            YP R GEPDC+YY+RTG C +G  CR+NHP +R     A R 
Sbjct  23   ESMWRLGFGGGGDAH---YPERPGEPDCAYYMRTGTCSYGEKCRYNHPRDRGSLTGAGRT  79

Query  447  KVL  455
              +
Sbjct  80   GAV  82


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 30/45 (67%), Gaps = 0/45 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKVL  455
            YP+R GE +C YY++TG C+FG++C+F+HP     ++ +A     
Sbjct  130  YPLRPGEKECGYYMKTGQCKFGSTCKFHHPQPGGASVPSASAPAF  174


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 37/59 (63%), Gaps = 6/59 (10%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKVLLEDGSLQVWGHLQV  497
            +P R G+P+C ++++TG C+FGA C+++HP        ++ + +L     +QVW  +Q+
Sbjct  288  FPERPGQPECQFFMKTGDCKFGAKCKYHHPP------GSSTLHLLHAAWIMQVWADMQI  340



>gb|KJB41978.1| hypothetical protein B456_007G130500 [Gossypium raimondii]
Length=472

 Score =   114 bits (284),  Expect(2) = 6e-36, Method: Compositional matrix adjust.
 Identities = 50/90 (56%), Positives = 63/90 (70%), Gaps = 0/90 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++YLKTG CKFGA+CKFHHP+       +V LN+ GYPLRP + EC YY++TG CKF +T
Sbjct  100  QFYLKTGTCKFGASCKFHHPKQGDQSFSQVPLNIYGYPLRPGEKECSYYLKTGHCKFDTT  159

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTP  717
            CKFHHPQP+   +P      Y PV SP+ P
Sbjct  160  CKFHHPQPAGTSIPASAPQFYQPVQSPSVP  189


 Score = 64.7 bits (156),  Expect(2) = 6e-36, Method: Compositional matrix adjust.
 Identities = 30/59 (51%), Positives = 36/59 (61%), Gaps = 5/59 (8%)
 Frame = +3

Query  267  ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAAR  443
            E++WQLSL   E+     YP R G PDC YY+RTG C +G  CR+NHP N     AA R
Sbjct  32   ESMWQLSLGGTES-----YPERPGVPDCVYYMRTGFCGYGNRCRYNHPRNPAWVEAAVR  85


 Score = 84.3 bits (207),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 47/66 (71%), Gaps = 0/66 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYL+TG CKFG++C++HHPRDK        L+ +G PLR     C +Y++ G+CKFGST
Sbjct  300  QYYLRTGDCKFGSSCRYHHPRDKVAPWTNCILSPMGLPLRSGGQPCSFYLQNGRCKFGST  359

Query  628  CKFHHP  645
            CKF HP
Sbjct  360  CKFDHP  365


 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/77 (43%), Positives = 50/77 (65%), Gaps = 4/77 (5%)
 Frame = +1

Query  451  YYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTC  630
            YY++TG C +G  C+++HPR+ A +   V    + YP RP +  C +Y++TG CKFG++C
Sbjct  56   YYMRTGFCGYGNRCRYNHPRNPAWVEAAVRATGV-YPERPGEPTCQFYLKTGTCKFGASC  114

Query  631  KFHHPQPSNM---MVPL  672
            KFHHP+  +     VPL
Sbjct  115  KFHHPKQGDQSFSQVPL  131


 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 20/47 (43%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +3

Query  312  SGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKV  452
            +G YP R GEP C +Y++TG C+FGASC+F+HP     + +   + +
Sbjct  87   TGVYPERPGEPTCQFYLKTGTCKFGASCKFHHPKQGDQSFSQVPLNI  133


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 20/34 (59%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +3

Query  318  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNR  419
            T+P R GEP+C YY+RTG C+FG+SCR++HP ++
Sbjct  289  TFPERPGEPECQYYLRTGDCKFGSSCRYHHPRDK  322


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +1

Query  544  NVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQ  648
            N   +P RP + EC YY+RTG CKFGS+C++HHP+
Sbjct  286  NNQTFPERPGEPECQYYLRTGDCKFGSSCRYHHPR  320


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 19/40 (48%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAA  440
            YP+R GE +CSYY++TG C+F  +C+F+HP     +I A+
Sbjct  136  YPLRPGEKECSYYLKTGHCKFDTTCKFHHPQPAGTSIPAS  175



>ref|XP_009417931.1| PREDICTED: zinc finger CCCH domain-containing protein 6-like 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=341

 Score =   117 bits (293),  Expect(2) = 7e-36, Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 67/91 (74%), Gaps = 1/91 (1%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YY++TG+CKFG++CK+ HPR   G A  V+LN  GYPLRP + EC YYM+TGQCKFGST
Sbjct  94   EYYMRTGSCKFGSSCKYDHPRQGGGSAQPVSLNYYGYPLRPGEKECGYYMKTGQCKFGST  153

Query  628  CKFHHPQPSNMMVPLRGSPA-YPPVHSPTTP  717
            CKFHHPQP    VP   +PA YP V  P+ P
Sbjct  154  CKFHHPQPGGASVPSASAPAFYPSVQHPSVP  184


 Score = 60.8 bits (146),  Expect(2) = 7e-36, Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 35/63 (56%), Gaps = 3/63 (5%)
 Frame = +3

Query  267  ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARM  446
            E++W+L            YP R GEPDC+YY+RTG C +G  CR+NHP +R     A R 
Sbjct  23   ESMWRLGFGGGGDAH---YPERPGEPDCAYYMRTGTCSYGEKCRYNHPRDRGSLTGAGRT  79

Query  447  KVL  455
              +
Sbjct  80   GAV  82


 Score = 77.4 bits (189),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 43/66 (65%), Gaps = 0/66 (0%)
 Frame = +1

Query  451  YYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTC  630
            YY++TG C +G  C+++HPRD+  + G      + YP R     C YYMRTG CKFGS+C
Sbjct  49   YYMRTGTCSYGEKCRYNHPRDRGSLTGAGRTGAVEYPERVGQPVCEYYMRTGSCKFGSSC  108

Query  631  KFHHPQ  648
            K+ HP+
Sbjct  109  KYDHPR  114


 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 17/45 (38%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKVL  455
            +P R G+P+C ++++TG C+FGA C+++HP  R++ +    + VL
Sbjct  288  FPERPGQPECQFFMKTGDCKFGAKCKYHHPPGRRMPMTNVVLNVL  332


 Score = 53.1 bits (126),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPN  573
            ++++KTG CKFGA CK+HHP  +      V LNVLG PLRP+
Sbjct  298  QFFMKTGDCKFGAKCKYHHPPGRRMPMTNVVLNVLGLPLRPD  339


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 30/45 (67%), Gaps = 0/45 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKVL  455
            YP+R GE +C YY++TG C+FG++C+F+HP     ++ +A     
Sbjct  130  YPLRPGEKECGYYMKTGQCKFGSTCKFHHPQPGGASVPSASAPAF  174



>ref|XP_009417930.1| PREDICTED: zinc finger CCCH domain-containing protein 6-like 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=467

 Score =   117 bits (293),  Expect(2) = 7e-36, Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 67/91 (74%), Gaps = 1/91 (1%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YY++TG+CKFG++CK+ HPR   G A  V+LN  GYPLRP + EC YYM+TGQCKFGST
Sbjct  94   EYYMRTGSCKFGSSCKYDHPRQGGGSAQPVSLNYYGYPLRPGEKECGYYMKTGQCKFGST  153

Query  628  CKFHHPQPSNMMVPLRGSPA-YPPVHSPTTP  717
            CKFHHPQP    VP   +PA YP V  P+ P
Sbjct  154  CKFHHPQPGGASVPSASAPAFYPSVQHPSVP  184


 Score = 60.8 bits (146),  Expect(2) = 7e-36, Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 35/63 (56%), Gaps = 3/63 (5%)
 Frame = +3

Query  267  ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARM  446
            E++W+L            YP R GEPDC+YY+RTG C +G  CR+NHP +R     A R 
Sbjct  23   ESMWRLGFGGGGDAH---YPERPGEPDCAYYMRTGTCSYGEKCRYNHPRDRGSLTGAGRT  79

Query  447  KVL  455
              +
Sbjct  80   GAV  82


 Score = 83.2 bits (204),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 45/66 (68%), Gaps = 0/66 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++++KTG CKFGA CK+HHP  +      V LNVLG PLRP    C YYM+ G CKFG T
Sbjct  298  QFFMKTGDCKFGAKCKYHHPPGRRMPMTNVVLNVLGLPLRPGAQPCTYYMQHGLCKFGQT  357

Query  628  CKFHHP  645
            CKF HP
Sbjct  358  CKFDHP  363


 Score = 77.4 bits (189),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 43/66 (65%), Gaps = 0/66 (0%)
 Frame = +1

Query  451  YYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTC  630
            YY++TG C +G  C+++HPRD+  + G      + YP R     C YYMRTG CKFGS+C
Sbjct  49   YYMRTGTCSYGEKCRYNHPRDRGSLTGAGRTGAVEYPERVGQPVCEYYMRTGSCKFGSSC  108

Query  631  KFHHPQ  648
            K+ HP+
Sbjct  109  KYDHPR  114


 Score = 53.5 bits (127),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 17/45 (38%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKVL  455
            +P R G+P+C ++++TG C+FGA C+++HP  R++ +    + VL
Sbjct  288  FPERPGQPECQFFMKTGDCKFGAKCKYHHPPGRRMPMTNVVLNVL  332


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 30/45 (67%), Gaps = 0/45 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKVL  455
            YP+R GE +C YY++TG C+FG++C+F+HP     ++ +A     
Sbjct  130  YPLRPGEKECGYYMKTGQCKFGSTCKFHHPQPGGASVPSASAPAF  174



>ref|XP_008796231.1| PREDICTED: zinc finger CCCH domain-containing protein 6-like 
isoform X1 [Phoenix dactylifera]
Length=464

 Score =   115 bits (289),  Expect(2) = 8e-36, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 62/90 (69%), Gaps = 0/90 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YY+KTG CKFG+TCK+HHPR   G    V LN  GYPLRP + EC YYM+TGQCKFG T
Sbjct  93   EYYMKTGTCKFGSTCKYHHPRQGGGSEQPVLLNYYGYPLRPGEKECSYYMKTGQCKFGLT  152

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTP  717
            CKFHHPQP    +PL     YP V  P+ P
Sbjct  153  CKFHHPQPDGASMPLPAPIFYPTVQPPSVP  182


 Score = 62.4 bits (150),  Expect(2) = 8e-36, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 37/62 (60%), Gaps = 4/62 (6%)
 Frame = +3

Query  270  TLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMK  449
            ++W+L L   ++     YP R GEPDC+YYIRTG C +G  CR+NHP +      A R  
Sbjct  24   SMWRLGLGGGDS----PYPERPGEPDCAYYIRTGSCGYGERCRYNHPRDHGALAGAGRTG  79

Query  450  VL  455
            V+
Sbjct  80   VV  81


 Score = 80.9 bits (198),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 45/66 (68%), Gaps = 0/66 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y++TG CKFGATCK+HHPRD +       L+ LG PLRP    C YY + G CKFG T
Sbjct  296  QFYMRTGDCKFGATCKYHHPRDWSIPKTNCVLSPLGLPLRPGAQICSYYAQHGVCKFGPT  355

Query  628  CKFHHP  645
            CKF HP
Sbjct  356  CKFDHP  361


 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 45/66 (68%), Gaps = 0/66 (0%)
 Frame = +1

Query  451  YYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTC  630
            YY++TG+C +G  C+++HPRD   +AG     V+ YP       C YYM+TG CKFGSTC
Sbjct  48   YYIRTGSCGYGERCRYNHPRDHGALAGAGRTGVVEYPQHVGQPVCEYYMKTGTCKFGSTC  107

Query  631  KFHHPQ  648
            K+HHP+
Sbjct  108  KYHHPR  113


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +1

Query  556  YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQ  648
            +P RP   EC +YMRTG CKFG+TCK+HHP+
Sbjct  286  FPERPGQPECQFYMRTGDCKFGATCKYHHPR  316


 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 18/30 (60%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHP  410
            YP+R GE +CSYY++TG C+FG +C+F+HP
Sbjct  129  YPLRPGEKECSYYMKTGQCKFGLTCKFHHP  158



>ref|XP_004495983.1| PREDICTED: zinc finger CCCH domain-containing protein 32-like 
isoform X1 [Cicer arietinum]
Length=466

 Score =   119 bits (297),  Expect(2) = 8e-36, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 64/90 (71%), Gaps = 0/90 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFGA+CKFHHP++  G   +  LN+ GYPLRP + EC YY++TGQCKFG T
Sbjct  103  QYYLKTGTCKFGASCKFHHPKNGGGYLSQAPLNIYGYPLRPGEKECSYYLKTGQCKFGVT  162

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTP  717
            CKFHHPQP+   +P      Y  V SPT P
Sbjct  163  CKFHHPQPAGTSMPASAPQFYQQVQSPTVP  192


 Score = 59.3 bits (142),  Expect(2) = 8e-36, Method: Compositional matrix adjust.
 Identities = 23/48 (48%), Positives = 30/48 (63%), Gaps = 0/48 (0%)
 Frame = +3

Query  267  ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHP  410
            E++W L+L         +YP R G P+C YY+RTG C +G  CRFNHP
Sbjct  30   ESMWHLTLGGGGGGGGESYPERHGVPNCVYYMRTGFCGYGGRCRFNHP  77


 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 48/66 (73%), Gaps = 2/66 (3%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYL+TG CKFG  C++HHP+D+  +A R  L+ +G PLRP    C +Y++ G CKFGS+
Sbjct  306  QYYLRTGDCKFGLACRYHHPQDQ--VAARPLLSPIGLPLRPGVQPCSFYLQNGHCKFGSS  363

Query  628  CKFHHP  645
            CKF HP
Sbjct  364  CKFDHP  369


 Score = 67.8 bits (164),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 45/66 (68%), Gaps = 1/66 (2%)
 Frame = +1

Query  451  YYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTC  630
            YY++TG C +G  C+F+HPRD+A +A         YP R  +  C YY++TG CKFG++C
Sbjct  59   YYMRTGFCGYGGRCRFNHPRDRAAVA-AAVRATGDYPERLGEPPCQYYLKTGTCKFGASC  117

Query  631  KFHHPQ  648
            KFHHP+
Sbjct  118  KFHHPK  123


 Score = 59.3 bits (142),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +3

Query  312  SGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKV  452
            +G YP R GEP C YY++TG C+FGASC+F+HP N    ++ A + +
Sbjct  90   TGDYPERLGEPPCQYYLKTGTCKFGASCKFHHPKNGGGYLSQAPLNI  136


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/45 (47%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = +3

Query  294  SMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLA  428
            S   ++   +P R GEPDC YY+RTG C+FG +CR++HP ++  A
Sbjct  287  SRSNLQEKVFPERPGEPDCQYYLRTGDCKFGLACRYHHPQDQVAA  331


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 19/40 (48%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAA  440
            YP+R GE +CSYY++TG C+FG +C+F+HP     ++ A+
Sbjct  139  YPLRPGEKECSYYLKTGQCKFGVTCKFHHPQPAGTSMPAS  178


 Score = 50.8 bits (120),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 33/63 (52%), Gaps = 5/63 (8%)
 Frame = +1

Query  532  RVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPT  711
            R  L    +P RP + +C YY+RTG CKFG  C++HHPQ      PL       P+  P 
Sbjct  288  RSNLQEKVFPERPGEPDCQYYLRTGDCKFGLACRYHHPQDQVAARPLLS-----PIGLPL  342

Query  712  TPG  720
             PG
Sbjct  343  RPG  345



>gb|KJB22541.1| hypothetical protein B456_004G053200 [Gossypium raimondii]
Length=274

 Score =   119 bits (297),  Expect(2) = 9e-36, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 65/90 (72%), Gaps = 0/90 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++YLKTG CKFGA+CKFHHP+D  G    V+LN+ GYPLRP + EC YY++TGQCKFG T
Sbjct  100  QFYLKTGTCKFGASCKFHHPKDGGGSFSHVSLNMHGYPLRPGEKECSYYLKTGQCKFGIT  159

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTP  717
            CKFHHPQPS   +       Y PV SP+ P
Sbjct  160  CKFHHPQPSGTSMSASAPQFYQPVQSPSVP  189


 Score = 59.3 bits (142),  Expect(2) = 9e-36, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 34/50 (68%), Gaps = 5/50 (10%)
 Frame = +3

Query  267  ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSN  416
            E+ WQLS+R +E+     YP R G  DC YY+RTG C +G SCR+NHP N
Sbjct  32   ESRWQLSVRGVES-----YPERLGVTDCVYYMRTGFCGYGNSCRYNHPRN  76


 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/66 (44%), Positives = 46/66 (70%), Gaps = 1/66 (2%)
 Frame = +1

Query  451  YYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTC  630
            YY++TG C +G +C+++HPR++A +          YP RP +  C +Y++TG CKFG++C
Sbjct  56   YYMRTGFCGYGNSCRYNHPRNRAAVE-AAVRATGEYPERPGEPVCQFYLKTGTCKFGASC  114

Query  631  KFHHPQ  648
            KFHHP+
Sbjct  115  KFHHPK  120


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +3

Query  312  SGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSN  416
            +G YP R GEP C +Y++TG C+FGASC+F+HP +
Sbjct  87   TGEYPERPGEPVCQFYLKTGTCKFGASCKFHHPKD  121


 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 37/55 (67%), Gaps = 2/55 (4%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNH--PSNRKLAIAAARMKVLLEDGSLQV  479
            YP+R GE +CSYY++TG C+FG +C+F+H  PS   ++ +A +    ++  S+ V
Sbjct  136  YPLRPGEKECSYYLKTGQCKFGITCKFHHPQPSGTSMSASAPQFYQPVQSPSVPV  190



>ref|XP_008389189.1| PREDICTED: zinc finger CCCH domain-containing protein 32-like 
[Malus domestica]
Length=579

 Score =   121 bits (304),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 54/88 (61%), Positives = 63/88 (72%), Gaps = 0/88 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFGA+CKFHHP+  AG   R  LN+ GYPLRP + EC YY++TGQCKFG T
Sbjct  203  QYYLKTGTCKFGASCKFHHPKHGAGSLNRAPLNIYGYPLRPGENECSYYLKTGQCKFGIT  262

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPT  711
            CKFHHPQP+   +P      YP V SP 
Sbjct  263  CKFHHPQPAGTTIPASAPQFYPSVQSPV  290


 Score = 56.2 bits (134),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 30/48 (63%), Gaps = 5/48 (10%)
 Frame = +3

Query  267  ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHP  410
            E +WQL L   E+     YP R G P+C YY+RTG C +G  CR+NHP
Sbjct  135  EQMWQLGLTGGES-----YPERPGVPNCVYYMRTGFCGYGGRCRYNHP  177


 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 47/66 (71%), Gaps = 0/66 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CK+G +C++HHPRD+        L+ +G PLRP    C +Y++ GQCKFGST
Sbjct  406  QYYLKTGDCKYGPSCRYHHPRDRTVPRITCLLSPMGLPLRPGVQPCTFYLQNGQCKFGST  465

Query  628  CKFHHP  645
            CKF HP
Sbjct  466  CKFDHP  471


 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 44/66 (67%), Gaps = 1/66 (2%)
 Frame = +1

Query  451  YYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTC  630
            YY++TG C +G  C+++HPRD+A +          YP R  +  C YY++TG CKFG++C
Sbjct  159  YYMRTGFCGYGGRCRYNHPRDRAAVV-AAVRATGDYPDRVGEPVCQYYLKTGTCKFGASC  217

Query  631  KFHHPQ  648
            KFHHP+
Sbjct  218  KFHHPK  223


 Score = 56.6 bits (135),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 22/47 (47%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +3

Query  312  SGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKV  452
            +G YP R GEP C YY++TG C+FGASC+F+HP +   ++  A + +
Sbjct  190  TGDYPDRVGEPVCQYYLKTGTCKFGASCKFHHPKHGAGSLNRAPLNI  236


 Score = 53.5 bits (127),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAA  440
            YP+R GE +CSYY++TG C+FG +C+F+HP      I A+
Sbjct  239  YPLRPGENECSYYLKTGQCKFGITCKFHHPQPAGTTIPAS  278



>ref|XP_008796233.1| PREDICTED: zinc finger CCCH domain-containing protein 6-like 
isoform X3 [Phoenix dactylifera]
Length=343

 Score =   115 bits (288),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 62/90 (69%), Gaps = 0/90 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YY+KTG CKFG+TCK+HHPR   G    V LN  GYPLRP + EC YYM+TGQCKFG T
Sbjct  93   EYYMKTGTCKFGSTCKYHHPRQGGGSEQPVLLNYYGYPLRPGEKECSYYMKTGQCKFGLT  152

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTP  717
            CKFHHPQP    +PL     YP V  P+ P
Sbjct  153  CKFHHPQPDGASMPLPAPIFYPTVQPPSVP  182


 Score = 62.4 bits (150),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 37/62 (60%), Gaps = 4/62 (6%)
 Frame = +3

Query  270  TLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMK  449
            ++W+L L   ++     YP R GEPDC+YYIRTG C +G  CR+NHP +      A R  
Sbjct  24   SMWRLGLGGGDS----PYPERPGEPDCAYYIRTGSCGYGERCRYNHPRDHGALAGAGRTG  79

Query  450  VL  455
            V+
Sbjct  80   VV  81


 Score = 79.0 bits (193),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 45/66 (68%), Gaps = 0/66 (0%)
 Frame = +1

Query  451  YYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTC  630
            YY++TG+C +G  C+++HPRD   +AG     V+ YP       C YYM+TG CKFGSTC
Sbjct  48   YYIRTGSCGYGERCRYNHPRDHGALAGAGRTGVVEYPQHVGQPVCEYYMKTGTCKFGSTC  107

Query  631  KFHHPQ  648
            K+HHP+
Sbjct  108  KYHHPR  113


 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPND  576
            ++Y++TG CKFGATCK+HHPRD +       L+ LG PLRP+ 
Sbjct  296  QFYMRTGDCKFGATCKYHHPRDWSIPKTNCVLSPLGLPLRPHS  338


 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +1

Query  556  YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQ  648
            +P RP   EC +YMRTG CKFG+TCK+HHP+
Sbjct  286  FPERPGQPECQFYMRTGDCKFGATCKYHHPR  316


 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 18/30 (60%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHP  410
            YP+R GE +CSYY++TG C+FG +C+F+HP
Sbjct  129  YPLRPGEKECSYYMKTGQCKFGLTCKFHHP  158



>ref|XP_004309682.1| PREDICTED: zinc finger CCCH domain-containing protein 32 [Fragaria 
vesca subsp. vesca]
Length=462

 Score =   119 bits (297),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 63/90 (70%), Gaps = 0/90 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFGA+CKFHHP+   G   R  LN+ GYPLRP + EC YY++TGQCKFG T
Sbjct  96   QYYLKTGTCKFGASCKFHHPKHGGGSLTRAPLNIYGYPLRPGESECSYYLKTGQCKFGLT  155

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTP  717
            CKFHHPQP+   VP      Y  V SP+ P
Sbjct  156  CKFHHPQPAGTTVPASAPQFYQSVQSPSVP  185


 Score = 58.5 bits (140),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 31/48 (65%), Gaps = 5/48 (10%)
 Frame = +3

Query  267  ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHP  410
            E +WQL L S E+     YP R G P+C YY+RTG C +G  CR+NHP
Sbjct  28   EQMWQLGLTSTES-----YPERPGVPNCVYYMRTGFCGYGVRCRYNHP  70


 Score = 83.2 bits (204),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 40/90 (44%), Positives = 55/90 (61%), Gaps = 5/90 (6%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYL+TG CKFG +C++HHPRD+        L+ +G PLRP    C +Y++ G CKFGS+
Sbjct  299  QYYLRTGDCKFGPSCRYHHPRDRIAPRTNCLLSPVGLPLRPGVQPCTFYLQNGHCKFGSS  358

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTP  717
            CKF HP     M  +R SP+   +  P  P
Sbjct  359  CKFDHP-----MGTMRYSPSASSLDMPVAP  383


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 44/66 (67%), Gaps = 1/66 (2%)
 Frame = +1

Query  451  YYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTC  630
            YY++TG C +G  C+++HPRD+A +          YP R  +  C YY++TG CKFG++C
Sbjct  52   YYMRTGFCGYGVRCRYNHPRDRAAVV-AAVRATGDYPERVGEPVCQYYLKTGTCKFGASC  110

Query  631  KFHHPQ  648
            KFHHP+
Sbjct  111  KFHHPK  116


 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 27/59 (46%), Positives = 36/59 (61%), Gaps = 4/59 (7%)
 Frame = +3

Query  318  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKVLLEDGSLQVWGHLQ  494
            T+P R GEP+C YY+RTG C+FG SCR++HP +R     A R   LL    L +   +Q
Sbjct  288  TFPERPGEPECQYYLRTGDCKFGPSCRYHHPRDR----IAPRTNCLLSPVGLPLRPGVQ  342


 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 22/47 (47%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +3

Query  312  SGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKV  452
            +G YP R GEP C YY++TG C+FGASC+F+HP +   ++  A + +
Sbjct  83   TGDYPERVGEPVCQYYLKTGTCKFGASCKFHHPKHGGGSLTRAPLNI  129


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 19/40 (48%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAA  440
            YP+R GE +CSYY++TG C+FG +C+F+HP      + A+
Sbjct  132  YPLRPGESECSYYLKTGQCKFGLTCKFHHPQPAGTTVPAS  171



>gb|KJB22540.1| hypothetical protein B456_004G053200 [Gossypium raimondii]
Length=377

 Score =   118 bits (296),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 65/90 (72%), Gaps = 0/90 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++YLKTG CKFGA+CKFHHP+D  G    V+LN+ GYPLRP + EC YY++TGQCKFG T
Sbjct  100  QFYLKTGTCKFGASCKFHHPKDGGGSFSHVSLNMHGYPLRPGEKECSYYLKTGQCKFGIT  159

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTP  717
            CKFHHPQPS   +       Y PV SP+ P
Sbjct  160  CKFHHPQPSGTSMSASAPQFYQPVQSPSVP  189


 Score = 58.9 bits (141),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 34/50 (68%), Gaps = 5/50 (10%)
 Frame = +3

Query  267  ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSN  416
            E+ WQLS+R +E+     YP R G  DC YY+RTG C +G SCR+NHP N
Sbjct  32   ESRWQLSVRGVES-----YPERLGVTDCVYYMRTGFCGYGNSCRYNHPRN  76


 Score = 83.6 bits (205),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 47/66 (71%), Gaps = 0/66 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYL+TG CKFG++C++HHPRD+        L+ +G PLRP    C +Y++ G CKFGST
Sbjct  304  QYYLRTGDCKFGSSCRYHHPRDRVVPQTNCVLSPMGLPLRPGVQPCAFYLQNGHCKFGST  363

Query  628  CKFHHP  645
            CKF HP
Sbjct  364  CKFDHP  369


 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/66 (44%), Positives = 46/66 (70%), Gaps = 1/66 (2%)
 Frame = +1

Query  451  YYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTC  630
            YY++TG C +G +C+++HPR++A +          YP RP +  C +Y++TG CKFG++C
Sbjct  56   YYMRTGFCGYGNSCRYNHPRNRAAVE-AAVRATGEYPERPGEPVCQFYLKTGTCKFGASC  114

Query  631  KFHHPQ  648
            KFHHP+
Sbjct  115  KFHHPK  120


 Score = 56.2 bits (134),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +3

Query  318  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNR  419
            T+P R GEP+C YY+RTG C+FG+SCR++HP +R
Sbjct  293  TFPERPGEPECQYYLRTGDCKFGSSCRYHHPRDR  326


 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +3

Query  312  SGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSN  416
            +G YP R GEP C +Y++TG C+FGASC+F+HP +
Sbjct  87   TGEYPERPGEPVCQFYLKTGTCKFGASCKFHHPKD  121


 Score = 53.5 bits (127),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 37/55 (67%), Gaps = 2/55 (4%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNH--PSNRKLAIAAARMKVLLEDGSLQV  479
            YP+R GE +CSYY++TG C+FG +C+F+H  PS   ++ +A +    ++  S+ V
Sbjct  136  YPLRPGEKECSYYLKTGQCKFGITCKFHHPQPSGTSMSASAPQFYQPVQSPSVPV  190


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +1

Query  556  YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQ  648
            +P RP + EC YY+RTG CKFGS+C++HHP+
Sbjct  294  FPERPGEPECQYYLRTGDCKFGSSCRYHHPR  324



>ref|XP_009378917.1| PREDICTED: LOW QUALITY PROTEIN: zinc finger CCCH domain-containing 
protein 32 [Pyrus x bretschneideri]
Length=571

 Score =   116 bits (290),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 52/88 (59%), Positives = 61/88 (69%), Gaps = 0/88 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFGA+CK+HHP+  AG   R  LN+ GYPLRP + EC YY++TGQCKFG T
Sbjct  208  QYYLKTGTCKFGASCKYHHPKHGAGSLNRAPLNIYGYPLRPGENECSYYLKTGQCKFGIT  267

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPT  711
            CKFHHP P+    P      YP V SP 
Sbjct  268  CKFHHPHPAGTTSPASAPQFYPSVQSPV  295


 Score = 61.2 bits (147),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 27/59 (46%), Positives = 36/59 (61%), Gaps = 5/59 (8%)
 Frame = +3

Query  267  ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAAR  443
            E +WQL L S E+     YP R G P+C YY+RTG C +G  CR++HP +R   +A  R
Sbjct  140  EQMWQLGLTSSES-----YPERLGVPNCVYYMRTGFCGYGGRCRYSHPRDRAAVVATVR  193


 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 47/66 (71%), Gaps = 0/66 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CK+G +C++HHPRD+        L+ +G PLRP +  C +Y++ GQC FGST
Sbjct  410  QYYLKTGDCKYGPSCRYHHPRDRTVPGITCLLSPIGLPLRPGEPPCRFYLKNGQCMFGST  469

Query  628  CKFHHP  645
            CKF HP
Sbjct  470  CKFDHP  475


 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 44/66 (67%), Gaps = 1/66 (2%)
 Frame = +1

Query  451  YYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTC  630
            YY++TG C +G  C++ HPRD+A +   V      YP R  +  C YY++TG CKFG++C
Sbjct  164  YYMRTGFCGYGGRCRYSHPRDRAAVVATVRATG-DYPERVGEPVCQYYLKTGTCKFGASC  222

Query  631  KFHHPQ  648
            K+HHP+
Sbjct  223  KYHHPK  228


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/47 (45%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +3

Query  312  SGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKV  452
            +G YP R GEP C YY++TG C+FGASC+++HP +   ++  A + +
Sbjct  195  TGDYPERVGEPVCQYYLKTGTCKFGASCKYHHPKHGAGSLNRAPLNI  241


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 18/30 (60%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHP  410
            YP+R GE +CSYY++TG C+FG +C+F+HP
Sbjct  244  YPLRPGENECSYYLKTGQCKFGITCKFHHP  273



>ref|XP_007200997.1| hypothetical protein PRUPE_ppa005229mg [Prunus persica]
 gb|EMJ02196.1| hypothetical protein PRUPE_ppa005229mg [Prunus persica]
Length=471

 Score =   119 bits (298),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 63/90 (70%), Gaps = 0/90 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFGA+CKFHHP+   G   R  LN+ G PLRP + EC YY++TGQCKFG T
Sbjct  96   QYYLKTGTCKFGASCKFHHPKHGGGSLSRAPLNIYGLPLRPGENECSYYLKTGQCKFGIT  155

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTP  717
            CKFHHPQP+   +P      YP V SP+ P
Sbjct  156  CKFHHPQPAGTTIPASAPQFYPSVQSPSVP  185


 Score = 57.8 bits (138),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 31/48 (65%), Gaps = 5/48 (10%)
 Frame = +3

Query  267  ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHP  410
            E +WQL L S E+     YP R G P+C YY+RTG C +G  CR+NHP
Sbjct  28   EQMWQLGLTSSES-----YPERPGVPNCVYYMRTGFCGYGIRCRYNHP  70


 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 46/66 (70%), Gaps = 0/66 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CK+G +C++HHPRD+        L+ +G PLRP    C +Y++ G CKFGST
Sbjct  298  QYYLKTGDCKYGPSCRYHHPRDRVIPRTNCLLSPIGLPLRPGVQPCTFYLQNGHCKFGST  357

Query  628  CKFHHP  645
            CKF HP
Sbjct  358  CKFDHP  363


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 44/66 (67%), Gaps = 1/66 (2%)
 Frame = +1

Query  451  YYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTC  630
            YY++TG C +G  C+++HPRD+A +          YP R  +  C YY++TG CKFG++C
Sbjct  52   YYMRTGFCGYGIRCRYNHPRDRAAVV-AAVRATGDYPERVGEPICQYYLKTGTCKFGASC  110

Query  631  KFHHPQ  648
            KFHHP+
Sbjct  111  KFHHPK  116


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 22/47 (47%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +3

Query  312  SGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKV  452
            +G YP R GEP C YY++TG C+FGASC+F+HP +   +++ A + +
Sbjct  83   TGDYPERVGEPICQYYLKTGTCKFGASCKFHHPKHGGGSLSRAPLNI  129


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +3

Query  318  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKL  425
             +P R GEP+C YY++TG C++G SCR++HP +R +
Sbjct  287  VFPERPGEPECQYYLKTGDCKYGPSCRYHHPRDRVI  322


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 19/39 (49%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = +3

Query  324  PVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAA  440
            P+R GE +CSYY++TG C+FG +C+F+HP      I A+
Sbjct  133  PLRPGENECSYYLKTGQCKFGITCKFHHPQPAGTTIPAS  171



>ref|XP_008386632.1| PREDICTED: LOW QUALITY PROTEIN: zinc finger CCCH domain-containing 
protein 32-like [Malus domestica]
Length=472

 Score =   120 bits (301),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 64/90 (71%), Gaps = 0/90 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKT  CKFGA+CK+HHP+  AG   R  LN+ GYPLRP + EC YY++TGQCKFG T
Sbjct  96   QYYLKTATCKFGASCKYHHPKHGAGSLSRAPLNIYGYPLRPGENECSYYLKTGQCKFGIT  155

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTP  717
            CKFHHPQP+   +P      YP V SP+ P
Sbjct  156  CKFHHPQPAGTAIPASAPQFYPSVQSPSVP  185


 Score = 56.2 bits (134),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 30/48 (63%), Gaps = 5/48 (10%)
 Frame = +3

Query  267  ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHP  410
            E +W L L S E+     YP R G P+C YY+RTG C +G  CR+NHP
Sbjct  28   EQMWHLGLTSSES-----YPERPGVPNCVYYMRTGFCGYGGRCRYNHP  70


 Score = 86.7 bits (213),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 48/66 (73%), Gaps = 0/66 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CK+GA+C++HHPRD+        L+ +G PLRP    C +Y++ GQCKFGST
Sbjct  299  QYYLKTGDCKYGASCRYHHPRDRTAPRITCLLSPMGLPLRPGVQPCTFYLQNGQCKFGST  358

Query  628  CKFHHP  645
            CKF HP
Sbjct  359  CKFDHP  364


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 43/66 (65%), Gaps = 1/66 (2%)
 Frame = +1

Query  451  YYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTC  630
            YY++TG C +G  C+++HPRD+A +          YP R  +  C YY++T  CKFG++C
Sbjct  52   YYMRTGFCGYGGRCRYNHPRDRAAVV-AAVRATGDYPERXGEPICQYYLKTATCKFGASC  110

Query  631  KFHHPQ  648
            K+HHP+
Sbjct  111  KYHHPK  116


 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/40 (53%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAA  440
            YP+R GE +CSYY++TG C+FG +C+F+HP     AI A+
Sbjct  132  YPLRPGENECSYYLKTGQCKFGITCKFHHPQPAGTAIPAS  171


 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 20/47 (43%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +3

Query  312  SGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKV  452
            +G YP R GEP C YY++T  C+FGASC+++HP +   +++ A + +
Sbjct  83   TGDYPERXGEPICQYYLKTATCKFGASCKYHHPKHGAGSLSRAPLNI  129


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/59 (41%), Positives = 36/59 (61%), Gaps = 4/59 (7%)
 Frame = +3

Query  318  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKVLLEDGSLQVWGHLQ  494
             +P R GE +C YY++TG C++GASCR++HP +R     A R+  LL    L +   +Q
Sbjct  288  VFPERPGELECQYYLKTGDCKYGASCRYHHPRDR----TAPRITCLLSPMGLPLRPGVQ  342


 Score = 50.1 bits (118),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 16/31 (52%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +1

Query  556  YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQ  648
            +P RP ++EC YY++TG CK+G++C++HHP+
Sbjct  289  FPERPGELECQYYLKTGDCKYGASCRYHHPR  319



>ref|XP_004495985.1| PREDICTED: zinc finger CCCH domain-containing protein 32-like 
isoform X3 [Cicer arietinum]
Length=352

 Score =   117 bits (294),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 64/90 (71%), Gaps = 0/90 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFGA+CKFHHP++  G   +  LN+ GYPLRP + EC YY++TGQCKFG T
Sbjct  103  QYYLKTGTCKFGASCKFHHPKNGGGYLSQAPLNIYGYPLRPGEKECSYYLKTGQCKFGVT  162

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTP  717
            CKFHHPQP+   +P      Y  V SPT P
Sbjct  163  CKFHHPQPAGTSMPASAPQFYQQVQSPTVP  192


 Score = 58.9 bits (141),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 31/50 (62%), Gaps = 0/50 (0%)
 Frame = +3

Query  267  ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSN  416
            E++W L+L         +YP R G P+C YY+RTG C +G  CRFNHP +
Sbjct  30   ESMWHLTLGGGGGGGGESYPERHGVPNCVYYMRTGFCGYGGRCRFNHPRD  79


 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 45/66 (68%), Gaps = 1/66 (2%)
 Frame = +1

Query  451  YYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTC  630
            YY++TG C +G  C+F+HPRD+A +A         YP R  +  C YY++TG CKFG++C
Sbjct  59   YYMRTGFCGYGGRCRFNHPRDRAAVA-AAVRATGDYPERLGEPPCQYYLKTGTCKFGASC  117

Query  631  KFHHPQ  648
            KFHHP+
Sbjct  118  KFHHPK  123


 Score = 59.3 bits (142),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +3

Query  312  SGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKV  452
            +G YP R GEP C YY++TG C+FGASC+F+HP N    ++ A + +
Sbjct  90   TGDYPERLGEPPCQYYLKTGTCKFGASCKFHHPKNGGGYLSQAPLNI  136


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/45 (47%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = +3

Query  294  SMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLA  428
            S   ++   +P R GEPDC YY+RTG C+FG +CR++HP ++  A
Sbjct  287  SRSNLQEKVFPERPGEPDCQYYLRTGDCKFGLACRYHHPQDQVAA  331


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 19/40 (48%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAA  440
            YP+R GE +CSYY++TG C+FG +C+F+HP     ++ A+
Sbjct  139  YPLRPGEKECSYYLKTGQCKFGVTCKFHHPQPAGTSMPAS  178


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/42 (52%), Positives = 32/42 (76%), Gaps = 2/42 (5%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPN  573
            +YYL+TG CKFG  C++HHP+D+  +A R  L+ +G PLRP+
Sbjct  306  QYYLRTGDCKFGLACRYHHPQDQ--VAARPLLSPIGLPLRPD  345


 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 22/47 (47%), Positives = 28/47 (60%), Gaps = 0/47 (0%)
 Frame = +1

Query  532  RVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPL  672
            R  L    +P RP + +C YY+RTG CKFG  C++HHPQ      PL
Sbjct  288  RSNLQEKVFPERPGEPDCQYYLRTGDCKFGLACRYHHPQDQVAARPL  334



>ref|XP_008235007.1| PREDICTED: zinc finger CCCH domain-containing protein 32 [Prunus 
mume]
Length=472

 Score =   119 bits (297),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 63/90 (70%), Gaps = 0/90 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFGA+CKFHHP+   G   R  LN+ G PLRP + EC YY++TGQCKFG T
Sbjct  96   QYYLKTGTCKFGASCKFHHPKHGGGSLSRAPLNIYGLPLRPGENECSYYLKTGQCKFGIT  155

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTP  717
            CKFHHPQP+   +P      YP V SP+ P
Sbjct  156  CKFHHPQPAGTTIPSSAPQFYPSVQSPSVP  185


 Score = 57.8 bits (138),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 31/48 (65%), Gaps = 5/48 (10%)
 Frame = +3

Query  267  ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHP  410
            E +WQL L S E+     YP R G P+C YY+RTG C +G  CR+NHP
Sbjct  28   EQMWQLGLTSSES-----YPERPGVPNCVYYMRTGFCGYGIRCRYNHP  70


 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 46/66 (70%), Gaps = 0/66 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CK+G +C++HHPRD+        L+ +G PLRP    C +Y++ G CKFGST
Sbjct  299  QYYLKTGDCKYGPSCRYHHPRDRVVPRTNCLLSPIGLPLRPGVQPCTFYLQNGHCKFGST  358

Query  628  CKFHHP  645
            CKF HP
Sbjct  359  CKFDHP  364


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 44/66 (67%), Gaps = 1/66 (2%)
 Frame = +1

Query  451  YYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTC  630
            YY++TG C +G  C+++HPRD+A +          YP R  +  C YY++TG CKFG++C
Sbjct  52   YYMRTGFCGYGIRCRYNHPRDRAAVV-AAVRATGDYPERVGEPICQYYLKTGTCKFGASC  110

Query  631  KFHHPQ  648
            KFHHP+
Sbjct  111  KFHHPK  116


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 22/47 (47%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +3

Query  312  SGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKV  452
            +G YP R GEP C YY++TG C+FGASC+F+HP +   +++ A + +
Sbjct  83   TGDYPERVGEPICQYYLKTGTCKFGASCKFHHPKHGGGSLSRAPLNI  129


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 18/33 (55%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNR  419
            +P R GEP+C YY++TG C++G SCR++HP +R
Sbjct  289  FPERPGEPECQYYLKTGDCKYGPSCRYHHPRDR  321


 Score = 50.1 bits (118),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = +3

Query  324  PVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAA  440
            P+R GE +CSYY++TG C+FG +C+F+HP      I ++
Sbjct  133  PLRPGENECSYYLKTGQCKFGITCKFHHPQPAGTTIPSS  171



>ref|XP_011013662.1| PREDICTED: zinc finger CCCH domain-containing protein 34-like 
[Populus euphratica]
Length=476

 Score =   112 bits (281),  Expect(2) = 3e-35, Method: Compositional matrix adjust.
 Identities = 53/100 (53%), Positives = 69/100 (69%), Gaps = 10/100 (10%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YY++TG CKFGA+CK++HP+        V+LN  GYPLRP D EC YY++TGQCKFG+T
Sbjct  100  QYYMRTGTCKFGASCKYNHPKQGGSSVRPVSLNFYGYPLRPGDKECTYYIKTGQCKFGAT  159

Query  628  CKFHHPQPSNMMVP-------LRGSPA---YPPVHSPTTP  717
            CKFHHPQP+NM +P       +   PA   YP + SP+ P
Sbjct  160  CKFHHPQPANMQIPAQSLAPQVASVPAPTLYPTMQSPSVP  199


 Score = 63.5 bits (153),  Expect(2) = 3e-35, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 36/59 (61%), Gaps = 4/59 (7%)
 Frame = +3

Query  267  ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAAR  443
            E +WQL L   E+     YP R  E DC YY+RTG C +GA CR+NHP +R  A+ A R
Sbjct  30   EGVWQLGLGETES----EYPERPNEQDCMYYLRTGFCGYGARCRYNHPRDRTAALEAGR  84


 Score = 77.0 bits (188),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 50/84 (60%), Gaps = 0/84 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YY+KTG CKF ++C++HHP +       V L+ +G+PLRP    C +Y + GQCKFG  
Sbjct  308  QYYMKTGDCKFESSCRYHHPPELVASKTNVVLSPMGFPLRPGAPTCTHYTQHGQCKFGPA  367

Query  628  CKFHHPQPSNMMVPLRGSPAYPPV  699
            CKF HP  +    P   S A  PV
Sbjct  368  CKFDHPMGTLSYSPSASSLADMPV  391


 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/68 (49%), Positives = 45/68 (66%), Gaps = 4/68 (6%)
 Frame = +1

Query  451  YYLKTGACKFGATCKFHHPRDKAGI--AGRVALNVLGYPLRPNDIECPYYMRTGQCKFGS  624
            YYL+TG C +GA C+++HPRD+     AGR       +P R     C YYMRTG CKFG+
Sbjct  55   YYLRTGFCGYGARCRYNHPRDRTAALEAGRTGGGE--FPERVGQPLCQYYMRTGTCKFGA  112

Query  625  TCKFHHPQ  648
            +CK++HP+
Sbjct  113  SCKYNHPK  120


 Score = 56.2 bits (134),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 20/42 (48%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARM  446
            YP+R G+ +C+YYI+TG C+FGA+C+F+HP    + I A  +
Sbjct  136  YPLRPGDKECTYYIKTGQCKFGATCKFHHPQPANMQIPAQSL  177


 Score = 53.9 bits (128),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 20/32 (63%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +3

Query  315  GTYPVRDGEPDCSYYIRTGLCRFGASCRFNHP  410
            G +P R G+P C YY+RTG C+FGASC++NHP
Sbjct  88   GEFPERVGQPLCQYYMRTGTCKFGASCKYNHP  119


 Score = 50.1 bits (118),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 33/141 (23%), Positives = 64/141 (45%), Gaps = 17/141 (12%)
 Frame = +3

Query  36   GNFMTLPFSFWILTFNLLQYFLVIPESWCIYAGFKLSDSYI*ASIGQLCLYCFHC*YPLV  215
            G+++  P+   +L+  L+ Y      SW  Y    +S      +   +C    +   PL 
Sbjct  216  GSYVQGPYGPMLLSPGLVPY-----PSWSPYPA-PVSPIASPNAQPAVCSGSVYGISPLS  269

Query  216  PTYAVFMSKDTAICTR*ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASC  395
            P+   +     ++ +           S  + +   +P R G+P+C YY++TG C+F +SC
Sbjct  270  PSAPAYTGAYQSVTS-------AKGPSSSSQKEHVFPERPGQPECQYYMKTGDCKFESSC  322

Query  396  RFNHPSNRKLAIAAARMKVLL  458
            R++HP      + A++  V+L
Sbjct  323  RYHHPPE----LVASKTNVVL  339



>ref|XP_002520668.1| nucleic acid binding protein, putative [Ricinus communis]
 gb|EEF41630.1| nucleic acid binding protein, putative [Ricinus communis]
Length=478

 Score =   117 bits (293),  Expect(2) = 3e-35, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 63/90 (70%), Gaps = 0/90 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++YLKTG CKFGA+CKFHHP+   G    V LN  GYPLRP + EC YY++TGQCKFG T
Sbjct  103  EFYLKTGTCKFGASCKFHHPKHGGGSLSHVPLNTHGYPLRPGENECSYYLKTGQCKFGIT  162

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTP  717
            CKFHHPQP+   +P      Y PV SP+ P
Sbjct  163  CKFHHPQPAGSSLPESAPQFYQPVQSPSIP  192


 Score = 58.9 bits (141),  Expect(2) = 3e-35, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 33/50 (66%), Gaps = 2/50 (4%)
 Frame = +3

Query  267  ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSN  416
            E++W+L L +    ES  YP R G PDC YY+RTG C +G  CR+NHP N
Sbjct  32   ESMWRLGLNNSGGGES--YPERPGVPDCVYYMRTGFCGYGNRCRYNHPRN  79


 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/80 (51%), Positives = 53/80 (66%), Gaps = 5/80 (6%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYL+TG CKFG++C++HHPRD+        L+ LG PLRP    C +Y+R G CKFGST
Sbjct  309  QYYLRTGDCKFGSSCRYHHPRDRVVPRTNCVLSPLGLPLRPGAQHCTFYLRNGHCKFGST  368

Query  628  CKFHHPQPSNMMVPLRGSPA  687
            CKF HP     M  +R SP+
Sbjct  369  CKFDHP-----METMRYSPS  383


 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +3

Query  303  TMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNR  419
            T +  T+P R GEP+C YY+RTG C+FG+SCR++HP +R
Sbjct  293  TQKEQTFPERPGEPECQYYLRTGDCKFGSSCRYHHPRDR  331


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +3

Query  312  SGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSN  416
            +G YP R GEP C +Y++TG C+FGASC+F+HP +
Sbjct  90   TGEYPERIGEPSCEFYLKTGTCKFGASCKFHHPKH  124


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +1

Query  556  YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQ  648
            +P RP + EC YY+RTG CKFGS+C++HHP+
Sbjct  299  FPERPGEPECQYYLRTGDCKFGSSCRYHHPR  329


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 36/55 (65%), Gaps = 2/55 (4%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNH--PSNRKLAIAAARMKVLLEDGSLQV  479
            YP+R GE +CSYY++TG C+FG +C+F+H  P+   L  +A +    ++  S+ +
Sbjct  139  YPLRPGENECSYYLKTGQCKFGITCKFHHPQPAGSSLPESAPQFYQPVQSPSIPI  193



>ref|XP_010652064.1| PREDICTED: zinc finger CCCH domain-containing protein 32 [Vitis 
vinifera]
 emb|CBI32253.3| unnamed protein product [Vitis vinifera]
Length=475

 Score =   118 bits (296),  Expect(2) = 3e-35, Method: Compositional matrix adjust.
 Identities = 52/90 (58%), Positives = 65/90 (72%), Gaps = 0/90 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++YLKTG CKFGA+C+FHHPR+  G    V+LN+ GYPLR  + EC YY++TGQCKFG T
Sbjct  100  QFYLKTGTCKFGASCRFHHPRNGGGSMSHVSLNIYGYPLRLGEKECSYYLKTGQCKFGIT  159

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTP  717
            CKFHHPQP+   +P      YP V SP+ P
Sbjct  160  CKFHHPQPAGTSLPASAPTFYPTVQSPSVP  189


 Score = 57.4 bits (137),  Expect(2) = 3e-35, Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 39/65 (60%), Gaps = 5/65 (8%)
 Frame = +3

Query  225  AVFMSKDTAICTR*ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFN  404
            +V  S   A+    E++W+L L S E+     YP R G  DC YY++TG C FG+ CR+N
Sbjct  18   SVEWSPVRAVSGLEESMWRLGLSSRES-----YPERPGVADCVYYMKTGFCGFGSRCRYN  72

Query  405  HPSNR  419
            HP +R
Sbjct  73   HPRDR  77


 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 36/70 (51%), Positives = 48/70 (69%), Gaps = 0/70 (0%)
 Frame = +1

Query  436  RQG*KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCK  615
            +Q  +YYL+TG CKFG++C++HHPR+         L+ LG PLRP    C +Y++ G CK
Sbjct  298  QQECQYYLRTGDCKFGSSCRYHHPREWVVPKTNCVLSPLGLPLRPGVQPCTFYLQNGYCK  357

Query  616  FGSTCKFHHP  645
            FGSTCKF HP
Sbjct  358  FGSTCKFDHP  367


 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 31/68 (46%), Positives = 48/68 (71%), Gaps = 5/68 (7%)
 Frame = +1

Query  451  YYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLG--YPLRPNDIECPYYMRTGQCKFGS  624
            YY+KTG C FG+ C+++HPRD++ ++    L   G  YP R  +  C +Y++TG CKFG+
Sbjct  56   YYMKTGFCGFGSRCRYNHPRDRSSVS---TLRSGGGEYPERIGEPACQFYLKTGTCKFGA  112

Query  625  TCKFHHPQ  648
            +C+FHHP+
Sbjct  113  SCRFHHPR  120


 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 37/55 (67%), Gaps = 2/55 (4%)
 Frame = +3

Query  294  SMETMESG--TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKV  452
            S+ T+ SG   YP R GEP C +Y++TG C+FGASCRF+HP N   +++   + +
Sbjct  79   SVSTLRSGGGEYPERIGEPACQFYLKTGTCKFGASCRFHHPRNGGGSMSHVSLNI  133


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/40 (48%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAA  440
            YP+R GE +CSYY++TG C+FG +C+F+HP     ++ A+
Sbjct  136  YPLRLGEKECSYYLKTGQCKFGITCKFHHPQPAGTSLPAS  175


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +1

Query  556  YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQ  648
            +P RP   EC YY+RTG CKFGS+C++HHP+
Sbjct  292  FPERPGQQECQYYLRTGDCKFGSSCRYHHPR  322



>gb|KDP28101.1| hypothetical protein JCGZ_13872 [Jatropha curcas]
Length=468

 Score =   114 bits (285),  Expect(2) = 6e-35, Method: Compositional matrix adjust.
 Identities = 52/90 (58%), Positives = 63/90 (70%), Gaps = 0/90 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++YLKTG CKFGA+CKFHHP+   G    V LN+ GYPLRP + EC YY++TGQCKFG T
Sbjct  100  QFYLKTGTCKFGASCKFHHPKHGGGSLSHVPLNIHGYPLRPGEKECSYYLKTGQCKFGIT  159

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTP  717
            CKFHHP P+   +P      Y PV SP+ P
Sbjct  160  CKFHHPPPAGTSMPESAPQFYQPVQSPSIP  189


 Score = 60.8 bits (146),  Expect(2) = 6e-35, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 34/50 (68%), Gaps = 5/50 (10%)
 Frame = +3

Query  267  ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSN  416
            E++W+L L S E+     YP R G PDC YY+RTG C +GA CR+NHP N
Sbjct  32   ESMWRLGLASSES-----YPERSGVPDCVYYMRTGCCGYGARCRYNHPRN  76


 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 47/66 (71%), Gaps = 0/66 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYL+TG CKFG++C++HHPRD+        L+ LG PLRP    C +YMR G CKFGST
Sbjct  298  QYYLRTGDCKFGSSCRYHHPRDRIVPRTNCVLSPLGLPLRPGVQHCTFYMRNGHCKFGST  357

Query  628  CKFHHP  645
            CKF HP
Sbjct  358  CKFDHP  363


 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 29/66 (44%), Positives = 45/66 (68%), Gaps = 1/66 (2%)
 Frame = +1

Query  451  YYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTC  630
            YY++TG C +GA C+++HPR++A +          YP R  +  C +Y++TG CKFG++C
Sbjct  56   YYMRTGCCGYGARCRYNHPRNRAAVE-AAVRATGEYPERAGEPLCQFYLKTGTCKFGASC  114

Query  631  KFHHPQ  648
            KFHHP+
Sbjct  115  KFHHPK  120


 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = +3

Query  294  SMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNR  419
            S  T +  T+P R GEP+C YY+RTG C+FG+SCR++HP +R
Sbjct  279  SSGTQKELTFPERPGEPECQYYLRTGDCKFGSSCRYHHPRDR  320


 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 20/47 (43%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +3

Query  312  SGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKV  452
            +G YP R GEP C +Y++TG C+FGASC+F+HP +   +++   + +
Sbjct  87   TGEYPERAGEPLCQFYLKTGTCKFGASCKFHHPKHGGGSLSHVPLNI  133


 Score = 53.5 bits (127),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 30/72 (42%), Positives = 43/72 (60%), Gaps = 4/72 (6%)
 Frame = +1

Query  505  PRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSP  684
            P   AG++       L +P RP + EC YY+RTG CKFGS+C++HHP+  + +VP R + 
Sbjct  272  PSSVAGLSSGTQ-KELTFPERPGEPECQYYLRTGDCKFGSSCRYHHPR--DRIVP-RTNC  327

Query  685  AYPPVHSPTTPG  720
               P+  P  PG
Sbjct  328  VLSPLGLPLRPG  339


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 18/30 (60%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHP  410
            YP+R GE +CSYY++TG C+FG +C+F+HP
Sbjct  136  YPLRPGEKECSYYLKTGQCKFGITCKFHHP  165



>ref|XP_009631342.1| PREDICTED: zinc finger CCCH domain-containing protein 32-like 
isoform X1 [Nicotiana tomentosiformis]
Length=488

 Score =   107 bits (268),  Expect(2) = 6e-35, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 57/74 (77%), Gaps = 0/74 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YY++TG CKFGA+CK+HHPR   G    +  N+ GYPLRP + EC +YM+TGQCKFG T
Sbjct  102  QYYMRTGMCKFGASCKYHHPRQGGGSPALMTHNIYGYPLRPGEKECLFYMKTGQCKFGIT  161

Query  628  CKFHHPQPSNMMVP  669
            CKFHHPQP+ + VP
Sbjct  162  CKFHHPQPAGVQVP  175


 Score = 67.8 bits (164),  Expect(2) = 6e-35, Method: Compositional matrix adjust.
 Identities = 31/59 (53%), Positives = 39/59 (66%), Gaps = 4/59 (7%)
 Frame = +3

Query  267  ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAAR  443
            E +WQLS+ S     S +YP R  E DC YY+RTG C +G+ CRFNHP +R L + AAR
Sbjct  29   EAMWQLSVGS----GSESYPERPNEADCIYYLRTGFCGYGSRCRFNHPPDRNLVMGAAR  83


 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 44/66 (67%), Gaps = 0/66 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YY+K G CKFG++C++HHP + +G      L+ +G PLRP    C +Y + G CKFG +
Sbjct  317  QYYIKYGDCKFGSSCRYHHPPEWSGPKSGFILSAMGLPLRPGAPICSHYSQNGVCKFGPS  376

Query  628  CKFHHP  645
            CKF HP
Sbjct  377  CKFDHP  382


 Score = 71.2 bits (173),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 33/69 (48%), Positives = 44/69 (64%), Gaps = 3/69 (4%)
 Frame = +1

Query  451  YYLKTGACKFGATCKFHHPRDK---AGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFG  621
            YYL+TG C +G+ C+F+HP D+    G A  +      YP R     C YYMRTG CKFG
Sbjct  54   YYLRTGFCGYGSRCRFNHPPDRNLVMGAARAIGGGEEKYPERVGQPVCQYYMRTGMCKFG  113

Query  622  STCKFHHPQ  648
            ++CK+HHP+
Sbjct  114  ASCKYHHPR  122


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 19/30 (63%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHP  410
            YP R G+P C YY+RTG+C+FGASC+++HP
Sbjct  92   YPERVGQPVCQYYMRTGMCKFGASCKYHHP  121


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/53 (42%), Positives = 33/53 (62%), Gaps = 3/53 (6%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHP---SNRKLAIAAARMKVLLEDGS  470
            +P R G+P+C YYI+ G C+FG+SCR++HP   S  K     + M + L  G+
Sbjct  307  FPERPGQPECQYYIKYGDCKFGSSCRYHHPPEWSGPKSGFILSAMGLPLRPGA  359



>ref|XP_010112757.1| Zinc finger CCCH domain-containing protein 32 [Morus notabilis]
 gb|EXC34715.1| Zinc finger CCCH domain-containing protein 32 [Morus notabilis]
Length=466

 Score =   118 bits (296),  Expect(2) = 6e-35, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 63/90 (70%), Gaps = 0/90 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFGA+CKFHHP+   G   +  LN+ GYPLRP + EC YY++TGQCKFG T
Sbjct  97   QYYLKTGTCKFGASCKFHHPKHGGGSLSQAPLNIYGYPLRPGETECSYYLKTGQCKFGIT  156

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTP  717
            CKFHHP P+   V       YPPV SP+ P
Sbjct  157  CKFHHPHPAGTSVTASAPQFYPPVQSPSVP  186


 Score = 56.6 bits (135),  Expect(2) = 6e-35, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 31/48 (65%), Gaps = 5/48 (10%)
 Frame = +3

Query  267  ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHP  410
            E++WQL L   E+     YP R G P+C YY+RTG C +G  CR+NHP
Sbjct  29   ESMWQLGLTGGES-----YPERPGVPNCVYYMRTGYCGYGVRCRYNHP  71


 Score = 83.2 bits (204),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 47/66 (71%), Gaps = 0/66 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYL+TG CKFG++C++HHPRD+        L+ +G PLRP    C +Y++ G CKFGST
Sbjct  300  QYYLRTGDCKFGSSCRYHHPRDRVMPRTNCLLSPVGLPLRPGVQPCTFYLQNGHCKFGST  359

Query  628  CKFHHP  645
            CKF HP
Sbjct  360  CKFDHP  365


 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 45/66 (68%), Gaps = 1/66 (2%)
 Frame = +1

Query  451  YYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTC  630
            YY++TG C +G  C+++HPRD+A +A         YP R  +  C YY++TG CKFG++C
Sbjct  53   YYMRTGYCGYGVRCRYNHPRDRAAVA-AAVRATGEYPERVGEPVCQYYLKTGTCKFGASC  111

Query  631  KFHHPQ  648
            KFHHP+
Sbjct  112  KFHHPK  117


 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 22/47 (47%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +3

Query  312  SGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKV  452
            +G YP R GEP C YY++TG C+FGASC+F+HP +   +++ A + +
Sbjct  84   TGEYPERVGEPVCQYYLKTGTCKFGASCKFHHPKHGGGSLSQAPLNI  130


 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +3

Query  318  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKL  425
             +P R GEP+C YY+RTG C+FG+SCR++HP +R +
Sbjct  289  VFPERHGEPECQYYLRTGDCKFGSSCRYHHPRDRVM  324


 Score = 53.1 bits (126),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 19/40 (48%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAA  440
            YP+R GE +CSYY++TG C+FG +C+F+HP     ++ A+
Sbjct  133  YPLRPGETECSYYLKTGQCKFGITCKFHHPHPAGTSVTAS  172



>ref|XP_009339837.1| PREDICTED: zinc finger CCCH domain-containing protein 58-like 
[Pyrus x bretschneideri]
Length=473

 Score =   106 bits (265),  Expect(2) = 7e-35, Method: Compositional matrix adjust.
 Identities = 43/74 (58%), Positives = 58/74 (78%), Gaps = 0/74 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YY++TG CKFGA+CK+HHP+        V+LN  GYPLRP + +C YY++TGQCKFG+T
Sbjct  99   QYYMRTGTCKFGASCKYHHPKQGGSSDSPVSLNYYGYPLRPGERDCSYYVKTGQCKFGAT  158

Query  628  CKFHHPQPSNMMVP  669
            CKFHHPQP+ + +P
Sbjct  159  CKFHHPQPAGIQLP  172


 Score = 68.6 bits (166),  Expect(2) = 7e-35, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 40/63 (63%), Gaps = 5/63 (8%)
 Frame = +3

Query  267  ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARM  446
            E +WQL L   E+     YP R  E DCSYY+RTG+C +G+ CR+NHP +R + I AAR 
Sbjct  30   EAMWQLGLGPGES-----YPERSDEADCSYYLRTGICGYGSRCRYNHPRDRSVVIGAART  84

Query  447  KVL  455
              L
Sbjct  85   GGL  87


 Score = 80.9 bits (198),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 46/67 (69%), Gaps = 0/67 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
             YYL+TG C +G+ C+++HPRD++ + G      L YP R     C YYMRTG CKFG++
Sbjct  53   SYYLRTGICGYGSRCRYNHPRDRSVVIGAARTGGLEYPERVGQPVCQYYMRTGTCKFGAS  112

Query  628  CKFHHPQ  648
            CK+HHP+
Sbjct  113  CKYHHPK  119


 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 42/66 (64%), Gaps = 0/66 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YY++TG CKFG++C++HHP +       V L+  G P RP    C +Y + G CKFGS 
Sbjct  304  QYYMRTGDCKFGSSCRYHHPPEVVQSKTTVLLSSSGLPSRPGAPLCTHYQQRGACKFGSA  363

Query  628  CKFHHP  645
            CKF HP
Sbjct  364  CKFDHP  369


 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 20/39 (51%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAA  437
            YP+R GE DCSYY++TG C+FGA+C+F+HP    + +  
Sbjct  135  YPLRPGERDCSYYVKTGQCKFGATCKFHHPQPAGIQLPG  173


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 33/51 (65%), Gaps = 4/51 (8%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKVLLEDGSL  473
            +P R G+P+C YY+RTG C+FG+SCR++HP      +  ++  VLL    L
Sbjct  294  FPERPGQPECQYYMRTGDCKFGSSCRYHHPPE----VVQSKTTVLLSSSGL  340


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/30 (67%), Positives = 24/30 (80%), Gaps = 0/30 (0%)
 Frame = +1

Query  556  YPLRPNDIECPYYMRTGQCKFGSTCKFHHP  645
            +P RP   EC YYMRTG CKFGS+C++HHP
Sbjct  294  FPERPGQPECQYYMRTGDCKFGSSCRYHHP  323


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/30 (63%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHP  410
            YP R G+P C YY+RTG C+FGASC+++HP
Sbjct  89   YPERVGQPVCQYYMRTGTCKFGASCKYHHP  118



>gb|KHG04581.1| hypothetical protein F383_30084 [Gossypium arboreum]
Length=365

 Score =   114 bits (284),  Expect(2) = 9e-35, Method: Compositional matrix adjust.
 Identities = 53/89 (60%), Positives = 62/89 (70%), Gaps = 0/89 (0%)
 Frame = +1

Query  436  RQG*KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCK  615
            R G  +YLKTG CKFGA+CKFHHP+D  G    V+LN+ GYPLRP + EC YY++TGQCK
Sbjct  93   RPGEPFYLKTGTCKFGASCKFHHPKDGGGSFSHVSLNMHGYPLRPGEKECSYYLKTGQCK  152

Query  616  FGSTCKFHHPQPSNMMVPLRGSPAYPPVH  702
            FG TCKFHHPQPS   +       Y PV 
Sbjct  153  FGITCKFHHPQPSGTSMSASAPQFYQPVQ  181


 Score = 60.8 bits (146),  Expect(2) = 9e-35, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 35/50 (70%), Gaps = 5/50 (10%)
 Frame = +3

Query  267  ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSN  416
            E++WQLS+R +E+     YP R G  DC YY+RTG C +G SCR+NHP N
Sbjct  32   ESMWQLSVRGVES-----YPERLGVTDCVYYMRTGFCGYGNSCRYNHPRN  76


 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 47/66 (71%), Gaps = 0/66 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYL+TG CKFG++C++HHPRD+        L+ +G PLRP    C +Y++ G CKFGST
Sbjct  292  QYYLRTGDCKFGSSCRYHHPRDRVVPQTNCVLSPMGLPLRPGVQPCAFYLQNGHCKFGST  351

Query  628  CKFHHP  645
            CKF HP
Sbjct  352  CKFDHP  357


 Score = 56.2 bits (134),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +3

Query  318  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNR  419
            T+P R GEP+C YY+RTG C+FG+SCR++HP +R
Sbjct  281  TFPERPGEPECQYYLRTGDCKFGSSCRYHHPRDR  314


 Score = 53.1 bits (126),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 19/40 (48%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAA  440
            YP+R GE +CSYY++TG C+FG +C+F+HP     +++A+
Sbjct  133  YPLRPGEKECSYYLKTGQCKFGITCKFHHPQPSGTSMSAS  172


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +1

Query  556  YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQ  648
            +P RP + EC YY+RTG CKFGS+C++HHP+
Sbjct  282  FPERPGEPECQYYLRTGDCKFGSSCRYHHPR  312



>ref|XP_008340827.1| PREDICTED: zinc finger CCCH domain-containing protein 34 [Malus 
domestica]
Length=476

 Score =   105 bits (263),  Expect(2) = 9e-35, Method: Compositional matrix adjust.
 Identities = 43/75 (57%), Positives = 58/75 (77%), Gaps = 0/75 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YY++TG CKFGA+CK+HHP+        V+LN  GYPLRP + EC YY++TGQCKFG+T
Sbjct  99   QYYMRTGTCKFGASCKYHHPKQGGSSDSPVSLNYYGYPLRPGERECSYYVKTGQCKFGAT  158

Query  628  CKFHHPQPSNMMVPL  672
            CKFHHP P+ + +P+
Sbjct  159  CKFHHPLPAGIQLPV  173


 Score = 68.9 bits (167),  Expect(2) = 9e-35, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 40/63 (63%), Gaps = 5/63 (8%)
 Frame = +3

Query  267  ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARM  446
            E +WQL L   E+     YP R  E DCSYY+RTG+C +G+ CR+NHP +R + I AAR 
Sbjct  30   EPMWQLGLGPGES-----YPERPDEADCSYYLRTGICGYGSRCRYNHPRDRSVVIGAART  84

Query  447  KVL  455
              L
Sbjct  85   GXL  87


 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 46/67 (69%), Gaps = 0/67 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
             YYL+TG C +G+ C+++HPRD++ + G      L YP R     C YYMRTG CKFG++
Sbjct  53   SYYLRTGICGYGSRCRYNHPRDRSVVIGAARTGXLEYPERAGQPVCQYYMRTGTCKFGAS  112

Query  628  CKFHHPQ  648
            CK+HHP+
Sbjct  113  CKYHHPK  119


 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 42/66 (64%), Gaps = 0/66 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YY++TG CKFG++C++HHP +       V L+  G P RP    C +Y + G CKFGS 
Sbjct  307  QYYMRTGDCKFGSSCRYHHPPEVVQSKTTVLLSSSGLPSRPGAPLCTHYQQRGACKFGSA  366

Query  628  CKFHHP  645
            CKF HP
Sbjct  367  CKFDHP  372


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 33/51 (65%), Gaps = 4/51 (8%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKVLLEDGSL  473
            +P R G+P+C YY+RTG C+FG+SCR++HP      +  ++  VLL    L
Sbjct  297  FPERPGQPECQYYMRTGDCKFGSSCRYHHPPE----VVQSKTTVLLSSSGL  343


 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 43/64 (67%), Gaps = 3/64 (5%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNH--PSNRKLAIAAARMKVLLEDGSLQVWGHLQ  494
            YP+R GE +CSYY++TG C+FGA+C+F+H  P+  +L + +   +V     +  ++ ++Q
Sbjct  135  YPLRPGERECSYYVKTGQCKFGATCKFHHPLPAGIQLPVPSPVPQVSPVPATHTLYQNVQ  194

Query  495  VSPS  506
             SPS
Sbjct  195  -SPS  197


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/30 (63%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHP  410
            YP R G+P C YY+RTG C+FGASC+++HP
Sbjct  89   YPERAGQPVCQYYMRTGTCKFGASCKYHHP  118


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/30 (67%), Positives = 24/30 (80%), Gaps = 0/30 (0%)
 Frame = +1

Query  556  YPLRPNDIECPYYMRTGQCKFGSTCKFHHP  645
            +P RP   EC YYMRTG CKFGS+C++HHP
Sbjct  297  FPERPGQPECQYYMRTGDCKFGSSCRYHHP  326



>ref|XP_009631343.1| PREDICTED: zinc finger CCCH domain-containing protein 32-like 
isoform X2 [Nicotiana tomentosiformis]
Length=380

 Score =   107 bits (267),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 57/74 (77%), Gaps = 0/74 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YY++TG CKFGA+CK+HHPR   G    +  N+ GYPLRP + EC +YM+TGQCKFG T
Sbjct  102  QYYMRTGMCKFGASCKYHHPRQGGGSPALMTHNIYGYPLRPGEKECLFYMKTGQCKFGIT  161

Query  628  CKFHHPQPSNMMVP  669
            CKFHHPQP+ + VP
Sbjct  162  CKFHHPQPAGVQVP  175


 Score = 67.4 bits (163),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 31/59 (53%), Positives = 39/59 (66%), Gaps = 4/59 (7%)
 Frame = +3

Query  267  ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAAR  443
            E +WQLS+ S     S +YP R  E DC YY+RTG C +G+ CRFNHP +R L + AAR
Sbjct  29   EAMWQLSVGS----GSESYPERPNEADCIYYLRTGFCGYGSRCRFNHPPDRNLVMGAAR  83


 Score = 70.9 bits (172),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 33/69 (48%), Positives = 44/69 (64%), Gaps = 3/69 (4%)
 Frame = +1

Query  451  YYLKTGACKFGATCKFHHPRDK---AGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFG  621
            YYL+TG C +G+ C+F+HP D+    G A  +      YP R     C YYMRTG CKFG
Sbjct  54   YYLRTGFCGYGSRCRFNHPPDRNLVMGAARAIGGGEEKYPERVGQPVCQYYMRTGMCKFG  113

Query  622  STCKFHHPQ  648
            ++CK+HHP+
Sbjct  114  ASCKYHHPR  122


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 19/30 (63%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHP  410
            YP R G+P C YY+RTG+C+FGASC+++HP
Sbjct  92   YPERVGQPVCQYYMRTGMCKFGASCKYHHP  121


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDI  579
            +YY+K G CKFG++C++HHP + +G      L+ +G PLRP+++
Sbjct  317  QYYIKYGDCKFGSSCRYHHPPEWSGPKSGFILSAMGLPLRPSEL  360



>ref|XP_009802826.1| PREDICTED: zinc finger CCCH domain-containing protein 34-like 
isoform X2 [Nicotiana sylvestris]
Length=492

 Score =   107 bits (268),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 57/74 (77%), Gaps = 0/74 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YY++TG CKFGA+CK+HHPR   G    +  N+ GYPLRP + EC +YM+TGQCKFG T
Sbjct  104  QYYMRTGMCKFGASCKYHHPRQGGGSPALMTHNIYGYPLRPGEKECLFYMKTGQCKFGIT  163

Query  628  CKFHHPQPSNMMVP  669
            CKFHHPQP+ + VP
Sbjct  164  CKFHHPQPAGVQVP  177


 Score = 67.0 bits (162),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 30/59 (51%), Positives = 38/59 (64%), Gaps = 4/59 (7%)
 Frame = +3

Query  267  ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAAR  443
            E +WQLS+ S       +YP R  E DC YY+RTG C +G+ CRFNHP +R L + AAR
Sbjct  29   EAMWQLSVGSGPE----SYPERPNEADCIYYLRTGFCGYGSRCRFNHPPDRNLVMGAAR  83


 Score = 72.8 bits (177),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 44/66 (67%), Gaps = 0/66 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YY+K G CKFG++C++HHP + +G      L+ +G PLRP    C +Y + G CKFG +
Sbjct  321  QYYMKYGDCKFGSSCRYHHPPEWSGPKLGFILSAMGLPLRPGAPICSHYSQNGVCKFGPS  380

Query  628  CKFHHP  645
            CKF HP
Sbjct  381  CKFDHP  386


 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 43/71 (61%), Gaps = 5/71 (7%)
 Frame = +1

Query  451  YYLKTGACKFGATCKFHHPRDKAGIAGRV-----ALNVLGYPLRPNDIECPYYMRTGQCK  615
            YYL+TG C +G+ C+F+HP D+  + G             YP R     C YYMRTG CK
Sbjct  54   YYLRTGFCGYGSRCRFNHPPDRNLVMGAARAIGGGGGEGEYPERVGQPVCQYYMRTGMCK  113

Query  616  FGSTCKFHHPQ  648
            FG++CK+HHP+
Sbjct  114  FGASCKYHHPR  124


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 19/30 (63%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHP  410
            YP R G+P C YY+RTG+C+FGASC+++HP
Sbjct  94   YPERVGQPVCQYYMRTGMCKFGASCKYHHP  123


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/53 (42%), Positives = 34/53 (64%), Gaps = 3/53 (6%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHP---SNRKLAIAAARMKVLLEDGS  470
            +P R G+P+C YY++ G C+FG+SCR++HP   S  KL    + M + L  G+
Sbjct  311  FPERPGQPECQYYMKYGDCKFGSSCRYHHPPEWSGPKLGFILSAMGLPLRPGA  363



>ref|XP_010069978.1| PREDICTED: zinc finger CCCH domain-containing protein 32 [Eucalyptus 
grandis]
 gb|KCW58526.1| hypothetical protein EUGRSUZ_H01196 [Eucalyptus grandis]
Length=485

 Score =   120 bits (301),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 66/90 (73%), Gaps = 0/90 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++YLKTG CKFGA+CKFHHP++  G   RV LN+ GYPLR  + EC YY++TGQCKFG+T
Sbjct  111  QFYLKTGTCKFGASCKFHHPKNGGGSLNRVPLNMYGYPLRLGEQECSYYLKTGQCKFGTT  170

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTP  717
            CKFHHPQP+   +P      Y PV SP+ P
Sbjct  171  CKFHHPQPAGASIPASAPQFYSPVQSPSVP  200


 Score = 53.9 bits (128),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +3

Query  318  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHP  410
            +YP R G PDC+YY+RTG C FG+ CR+NHP
Sbjct  55   SYPERSGMPDCAYYMRTGFCGFGSRCRYNHP  85


 Score = 86.3 bits (212),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 48/66 (73%), Gaps = 0/66 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YY++TG CKFG++C++HHPRD+        LN LG PLRP  + C +Y++ G CK+GST
Sbjct  314  QYYMRTGDCKFGSSCRYHHPRDRMVQGTSFLLNPLGLPLRPGVLPCAFYVQNGHCKYGST  373

Query  628  CKFHHP  645
            CKF HP
Sbjct  374  CKFDHP  379


 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 46/66 (70%), Gaps = 1/66 (2%)
 Frame = +1

Query  451  YYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTC  630
            YY++TG C FG+ C+++HPRD+A +          YP RP +  C +Y++TG CKFG++C
Sbjct  67   YYMRTGFCGFGSRCRYNHPRDRAAVV-AAVRATGDYPERPGEPACQFYLKTGTCKFGASC  125

Query  631  KFHHPQ  648
            KFHHP+
Sbjct  126  KFHHPK  131


 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +3

Query  312  SGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSN  416
            +G YP R GEP C +Y++TG C+FGASC+F+HP N
Sbjct  98   TGDYPERPGEPACQFYLKTGTCKFGASCKFHHPKN  132


 Score = 56.2 bits (134),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKL  425
            +P R GEPDC YY+RTG C+FG+SCR++HP +R +
Sbjct  304  FPQRAGEPDCQYYMRTGDCKFGSSCRYHHPRDRMV  338


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAA  440
            YP+R GE +CSYY++TG C+FG +C+F+HP     +I A+
Sbjct  147  YPLRLGEQECSYYLKTGQCKFGTTCKFHHPQPAGASIPAS  186



>ref|XP_009352233.1| PREDICTED: zinc finger CCCH domain-containing protein 34-like 
[Pyrus x bretschneideri]
Length=472

 Score =   108 bits (270),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 44/75 (59%), Positives = 58/75 (77%), Gaps = 0/75 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YY++TG CKFGA+CKFHHP+        V+LN  GYPLRP + EC YY++TGQCKF +T
Sbjct  99   QYYMRTGTCKFGASCKFHHPKQGGSSGSPVSLNYYGYPLRPGERECSYYVKTGQCKFSAT  158

Query  628  CKFHHPQPSNMMVPL  672
            CKFHHPQP+ + +P+
Sbjct  159  CKFHHPQPAGIQLPV  173


 Score = 66.2 bits (160),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 39/63 (62%), Gaps = 5/63 (8%)
 Frame = +3

Query  267  ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARM  446
            E++W L LR  E+     YP R  E DCSYY+RTG+C +G+ CR+NHP +R     AAR 
Sbjct  30   ESMWPLGLRPGES-----YPERPDEADCSYYLRTGICGYGSRCRYNHPRDRSTVTGAARP  84

Query  447  KVL  455
              L
Sbjct  85   GGL  87


 Score = 82.4 bits (202),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 34/67 (51%), Positives = 46/67 (69%), Gaps = 0/67 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
             YYL+TG C +G+ C+++HPRD++ + G      L YP R     C YYMRTG CKFG++
Sbjct  53   SYYLRTGICGYGSRCRYNHPRDRSTVTGAARPGGLEYPERAGQPVCQYYMRTGTCKFGAS  112

Query  628  CKFHHPQ  648
            CKFHHP+
Sbjct  113  CKFHHPK  119


 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 41/66 (62%), Gaps = 0/66 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YY++TG CKFG++C++HHP +       V L+  G P RP    C +Y + G CKFG  
Sbjct  306  QYYMRTGDCKFGSSCRYHHPPEAVQPKTTVVLSSSGLPSRPGAPLCTHYQQRGACKFGPA  365

Query  628  CKFHHP  645
            CKF HP
Sbjct  366  CKFDHP  371


 Score = 53.9 bits (128),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 24/43 (56%), Positives = 29/43 (67%), Gaps = 4/43 (9%)
 Frame = +1

Query  550  LGYPLRPNDIECPYYMRTGQCKFGSTCKFHHP----QPSNMMV  666
            L +P RP   EC YYMRTG CKFGS+C++HHP    QP   +V
Sbjct  294  LSFPERPGQPECQYYMRTGDCKFGSSCRYHHPPEAVQPKTTVV  336


 Score = 53.5 bits (127),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 20/30 (67%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHP  410
            YP R G+P C YY+RTG C+FGASC+F+HP
Sbjct  89   YPERAGQPVCQYYMRTGTCKFGASCKFHHP  118


 Score = 53.1 bits (126),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 32/50 (64%), Gaps = 3/50 (6%)
 Frame = +3

Query  318  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKVLLEDG  467
            ++P R G+P+C YY+RTG C+FG+SCR++HP     A+      VL   G
Sbjct  295  SFPERPGQPECQYYMRTGDCKFGSSCRYHHPPE---AVQPKTTVVLSSSG  341


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 18/37 (49%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAI  431
            YP+R GE +CSYY++TG C+F A+C+F+HP    + +
Sbjct  135  YPLRPGERECSYYVKTGQCKFSATCKFHHPQPAGIQL  171



>ref|XP_011090931.1| PREDICTED: zinc finger CCCH domain-containing protein 32 [Sesamum 
indicum]
Length=496

 Score =   109 bits (272),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 46/73 (63%), Positives = 58/73 (79%), Gaps = 0/73 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YY++TG CKFGA+CK+HHP+   G +  V LNV GYPLRP + EC YY++TGQCKFG T
Sbjct  112  QYYMRTGMCKFGASCKYHHPKHGVGSSAPVTLNVYGYPLRPGEKECSYYVKTGQCKFGVT  171

Query  628  CKFHHPQPSNMMV  666
            CKFHHPQP+ + V
Sbjct  172  CKFHHPQPAGIQV  184


 Score = 64.7 bits (156),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 36/59 (61%), Gaps = 4/59 (7%)
 Frame = +3

Query  267  ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAAR  443
            E +WQL L         +YP R  EPDC YY+RTG C +G  CRFNHP +R +A+ A R
Sbjct  42   EPMWQLGLGGGPE----SYPERPDEPDCIYYLRTGFCGYGNRCRFNHPRDRSMAMGALR  96


 Score = 77.4 bits (189),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 44/66 (67%), Gaps = 0/66 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFGATCK+HHP + +       L+ +G PLRP    C +Y + G CKFG +
Sbjct  324  QYYLKTGDCKFGATCKYHHPPEWSAPKINFVLSPMGLPLRPGAPLCSHYAQNGVCKFGPS  383

Query  628  CKFHHP  645
            CKF HP
Sbjct  384  CKFDHP  389


 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 44/66 (67%), Gaps = 0/66 (0%)
 Frame = +1

Query  451  YYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTC  630
            YYL+TG C +G  C+F+HPRD++   G +      YP R     C YYMRTG CKFG++C
Sbjct  67   YYLRTGFCGYGNRCRFNHPRDRSMAMGALRAGGGEYPERAGQPVCQYYMRTGMCKFGASC  126

Query  631  KFHHPQ  648
            K+HHP+
Sbjct  127  KYHHPK  132


 Score = 56.2 bits (134),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 22/46 (48%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = +3

Query  315  GTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKV  452
            G YP R G+P C YY+RTG+C+FGASC+++HP +   + A   + V
Sbjct  100  GEYPERAGQPVCQYYMRTGMCKFGASCKYHHPKHGVGSSAPVTLNV  145


 Score = 53.5 bits (127),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 18/37 (49%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAI  431
            YP+R GE +CSYY++TG C+FG +C+F+HP    + +
Sbjct  148  YPLRPGEKECSYYVKTGQCKFGVTCKFHHPQPAGIQV  184


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/53 (40%), Positives = 35/53 (66%), Gaps = 3/53 (6%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHP---SNRKLAIAAARMKVLLEDGS  470
            +P R G+P+C YY++TG C+FGA+C+++HP   S  K+    + M + L  G+
Sbjct  314  FPERPGQPECQYYLKTGDCKFGATCKYHHPPEWSAPKINFVLSPMGLPLRPGA  366


 Score = 50.1 bits (118),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 19/30 (63%), Positives = 24/30 (80%), Gaps = 0/30 (0%)
 Frame = +1

Query  556  YPLRPNDIECPYYMRTGQCKFGSTCKFHHP  645
            +P RP   EC YY++TG CKFG+TCK+HHP
Sbjct  314  FPERPGQPECQYYLKTGDCKFGATCKYHHP  343



>ref|XP_003518955.1| PREDICTED: zinc finger CCCH domain-containing protein 32-like 
isoform X1 [Glycine max]
Length=471

 Score =   118 bits (295),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 64/90 (71%), Gaps = 0/90 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFGA+CKFHHP++  G   +  LNV GYPLRP + EC YY++TGQCKFG +
Sbjct  100  QYYLKTGTCKFGASCKFHHPKNGGGYLSQAPLNVYGYPLRPGEKECSYYLKTGQCKFGIS  159

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTP  717
            CKFHHPQP+   +P      Y  V SPT P
Sbjct  160  CKFHHPQPAGTSLPASAPQFYQQVQSPTVP  189


 Score = 56.2 bits (134),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 36/56 (64%), Gaps = 8/56 (14%)
 Frame = +3

Query  243  DTAICTR*ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHP  410
            DTA+    E++W L+L   E+     YP R G P+C YY+RTG+C +G  CR+NHP
Sbjct  27   DTALE---ESMWHLTLGGGES-----YPERSGVPNCVYYMRTGVCGYGGRCRYNHP  74


 Score = 82.4 bits (202),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 46/66 (70%), Gaps = 2/66 (3%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYL+TG CKFG  C++HHPRD   I  R  L+ +G PLRP    C +Y++ G CKFGST
Sbjct  303  QYYLRTGDCKFGLACRYHHPRDH--IVARPLLSPVGLPLRPGLQPCAFYLQNGHCKFGST  360

Query  628  CKFHHP  645
            CKF HP
Sbjct  361  CKFDHP  366


 Score = 68.2 bits (165),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 45/66 (68%), Gaps = 1/66 (2%)
 Frame = +1

Query  451  YYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTC  630
            YY++TG C +G  C+++HPRD+A +A         YP R  +  C YY++TG CKFG++C
Sbjct  56   YYMRTGVCGYGGRCRYNHPRDRAAVA-AAVRATGDYPERVGEPPCQYYLKTGTCKFGASC  114

Query  631  KFHHPQ  648
            KFHHP+
Sbjct  115  KFHHPK  120


 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +3

Query  312  SGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKV  452
            +G YP R GEP C YY++TG C+FGASC+F+HP N    ++ A + V
Sbjct  87   TGDYPERVGEPPCQYYLKTGTCKFGASCKFHHPKNGGGYLSQAPLNV  133


 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAA  440
            YP+R GE +CSYY++TG C+FG SC+F+HP     ++ A+
Sbjct  136  YPLRPGEKECSYYLKTGQCKFGISCKFHHPQPAGTSLPAS  175


 Score = 53.5 bits (127),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLA  428
            YP R GEP+C YY+RTG C+FG +CR++HP +  +A
Sbjct  293  YPERPGEPECQYYLRTGDCKFGLACRYHHPRDHIVA  328


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 32/55 (58%), Gaps = 5/55 (9%)
 Frame = +1

Query  556  YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPG  720
            YP RP + EC YY+RTG CKFG  C++HHP+   +  PL       PV  P  PG
Sbjct  293  YPERPGEPECQYYLRTGDCKFGLACRYHHPRDHIVARPLLS-----PVGLPLRPG  342



>ref|XP_002516892.1| nucleic acid binding protein, putative [Ricinus communis]
 gb|EEF45506.1| nucleic acid binding protein, putative [Ricinus communis]
Length=481

 Score =   112 bits (281),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 55/105 (52%), Positives = 70/105 (67%), Gaps = 16/105 (15%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YY++TG CKFGA+CK+HHP+   G A  V+LN  GYPLRP + EC YY++TGQCKFG T
Sbjct  100  QYYMRTGTCKFGASCKYHHPKQGGGSANPVSLNYYGYPLRPGEKECTYYVKTGQCKFGVT  159

Query  628  CKFHHPQPSNMMVPLRGSPA---------------YPPVHSPTTP  717
            CKFHHPQP+N+ +  + SPA               YP V SP+ P
Sbjct  160  CKFHHPQPANLQIQAQ-SPALQVAPVPAPVPASALYPNVQSPSVP  203


 Score = 61.2 bits (147),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 35/59 (59%), Gaps = 4/59 (7%)
 Frame = +3

Query  267  ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAAR  443
            E  WQL L  +E      YP R  E DC YY+RTG C +G+ CRFNHP +R   + AAR
Sbjct  30   EGDWQLGLGEVEP----GYPERPEEADCIYYLRTGFCGYGSRCRFNHPRDRGAVLGAAR  84


 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/95 (39%), Positives = 51/95 (54%), Gaps = 13/95 (14%)
 Frame = +1

Query  403  TIHLTGNWQL-------------LRQG*KYYLKTGACKFGATCKFHHPRDKAGIAGRVAL  543
            T+   G+WQL                   YYL+TG C +G+ C+F+HPRD+  + G    
Sbjct  26   TVLEEGDWQLGLGEVEPGYPERPEEADCIYYLRTGFCGYGSRCRFNHPRDRGAVLGAARA  85

Query  544  NVLGYPLRPNDIECPYYMRTGQCKFGSTCKFHHPQ  648
                +P R     C YYMRTG CKFG++CK+HHP+
Sbjct  86   GAAEFPERVGQPVCQYYMRTGTCKFGASCKYHHPK  120


 Score = 78.2 bits (191),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 44/66 (67%), Gaps = 0/66 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YY+KTG CKFG++CK+HHP +       V L+ +G PLRP    C +Y + GQCKFG  
Sbjct  307  QYYMKTGDCKFGSSCKYHHPPELIAPKTNVVLSPMGLPLRPGAPHCTHYTQRGQCKFGPA  366

Query  628  CKFHHP  645
            CKF HP
Sbjct  367  CKFDHP  372


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 20/39 (51%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAA  437
            YP+R GE +C+YY++TG C+FG +C+F+HP    L I A
Sbjct  136  YPLRPGEKECTYYVKTGQCKFGVTCKFHHPQPANLQIQA  174


 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 23/68 (34%), Positives = 39/68 (57%), Gaps = 3/68 (4%)
 Frame = +3

Query  276  WQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSN---RKLAIAAARM  446
            +Q    S    E  ++P R G+P+C YY++TG C+FG+SC+++HP      K  +  + M
Sbjct  282  YQAMPSSSNQKEQPSFPERPGQPECQYYMKTGDCKFGSSCKYHHPPELIAPKTNVVLSPM  341

Query  447  KVLLEDGS  470
             + L  G+
Sbjct  342  GLPLRPGA  349


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 20/30 (67%), Positives = 24/30 (80%), Gaps = 0/30 (0%)
 Frame = +1

Query  556  YPLRPNDIECPYYMRTGQCKFGSTCKFHHP  645
            +P RP   EC YYM+TG CKFGS+CK+HHP
Sbjct  297  FPERPGQPECQYYMKTGDCKFGSSCKYHHP  326



>ref|XP_008802110.1| PREDICTED: zinc finger CCCH domain-containing protein 6-like 
[Phoenix dactylifera]
Length=466

 Score =   117 bits (292),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 63/90 (70%), Gaps = 0/90 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YY++TG CKFG+TCK+HHPR   G    V  N  G+PLRP + EC YYM+TGQCKFGST
Sbjct  96   EYYMRTGTCKFGSTCKYHHPRQGGGSVRPVLFNYYGFPLRPGEKECSYYMKTGQCKFGST  155

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTP  717
            CKFHHPQP+   VP      YP V SPT P
Sbjct  156  CKFHHPQPAGASVPSPAPTFYPTVQSPTVP  185


 Score = 57.0 bits (136),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 36/62 (58%), Gaps = 1/62 (2%)
 Frame = +3

Query  267  ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARM  446
            E++W+L L      +   YP R GEPDC+YY+RTG C +G  CR+NHP +R       R 
Sbjct  23   ESMWRLGLGGGGGGDM-PYPERPGEPDCAYYMRTGSCGYGERCRYNHPRDRGARSGGGRT  81

Query  447  KV  452
             V
Sbjct  82   GV  83


 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 46/66 (70%), Gaps = 0/66 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y++TG CKFGATC++HHPRD +      AL+ LG PLRP    C YY + G CKFG T
Sbjct  298  QFYMRTGDCKFGATCRYHHPRDWSIPKTNCALSPLGLPLRPGAQPCAYYAQHGVCKFGPT  357

Query  628  CKFHHP  645
            CKF HP
Sbjct  358  CKFDHP  363


 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 45/66 (68%), Gaps = 0/66 (0%)
 Frame = +1

Query  451  YYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTC  630
            YY++TG+C +G  C+++HPRD+   +G     V  YP R     C YYMRTG CKFGSTC
Sbjct  51   YYMRTGSCGYGERCRYNHPRDRGARSGGGRTGVGEYPERVGQPVCEYYMRTGTCKFGSTC  110

Query  631  KFHHPQ  648
            K+HHP+
Sbjct  111  KYHHPR  116


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/54 (43%), Positives = 36/54 (67%), Gaps = 3/54 (6%)
 Frame = +3

Query  318  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHP---SNRKLAIAAARMKVLLEDGS  470
            T+P R G+P+C +Y+RTG C+FGA+CR++HP   S  K   A + + + L  G+
Sbjct  287  TFPERPGQPECQFYMRTGDCKFGATCRYHHPRDWSIPKTNCALSPLGLPLRPGA  340


 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 17/40 (43%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAA  440
            +P+R GE +CSYY++TG C+FG++C+F+HP     ++ + 
Sbjct  132  FPLRPGEKECSYYMKTGQCKFGSTCKFHHPQPAGASVPSP  171


 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +1

Query  556  YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQ  648
            +P RP   EC +YMRTG CKFG+TC++HHP+
Sbjct  288  FPERPGQPECQFYMRTGDCKFGATCRYHHPR  318


 Score = 50.1 bits (118),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 18/32 (56%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +3

Query  315  GTYPVRDGEPDCSYYIRTGLCRFGASCRFNHP  410
            G YP R G+P C YY+RTG C+FG++C+++HP
Sbjct  84   GEYPERVGQPVCEYYMRTGTCKFGSTCKYHHP  115



>ref|XP_002314462.1| hypothetical protein POPTR_0010s02320g [Populus trichocarpa]
 gb|EEF00633.1| hypothetical protein POPTR_0010s02320g [Populus trichocarpa]
Length=456

 Score =   110 bits (275),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 52/100 (52%), Positives = 69/100 (69%), Gaps = 10/100 (10%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YY++TG CKFGA+CK++HP+        V+LN  GYPLRP + EC YY++TGQCKFG+T
Sbjct  100  QYYMRTGTCKFGASCKYNHPKQGGSSVRPVSLNYYGYPLRPGERECTYYIKTGQCKFGAT  159

Query  628  CKFHHPQPSNMMVPLR-------GSPA---YPPVHSPTTP  717
            CKFHHPQP+NM +P +         PA   YP + SP+ P
Sbjct  160  CKFHHPQPANMQIPAQSLAPQVASVPAHTLYPTMQSPSVP  199


 Score = 63.2 bits (152),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 36/59 (61%), Gaps = 4/59 (7%)
 Frame = +3

Query  267  ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAAR  443
            E +WQL +   E+     YP R  E DC YY+RTG C +GA CR+NHP +R   + AAR
Sbjct  30   EGVWQLEIGETES----EYPERPNEQDCMYYLRTGFCGYGARCRYNHPRDRTAVLGAAR  84


 Score = 74.7 bits (182),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 44/66 (67%), Gaps = 0/66 (0%)
 Frame = +1

Query  451  YYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTC  630
            YYL+TG C +GA C+++HPRD+  + G        +P R     C YYMRTG CKFG++C
Sbjct  55   YYLRTGFCGYGARCRYNHPRDRTAVLGAARAGGGEFPERVGQPLCQYYMRTGTCKFGASC  114

Query  631  KFHHPQ  648
            K++HP+
Sbjct  115  KYNHPK  120


 Score = 74.7 bits (182),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 49/84 (58%), Gaps = 0/84 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YY+KTG CKF ++C++HHP +       V L+ +G PLRP    C +Y + GQCKFG  
Sbjct  308  QYYMKTGDCKFESSCRYHHPPELVTSKTNVVLSPMGLPLRPGAPTCTHYTQHGQCKFGPA  367

Query  628  CKFHHPQPSNMMVPLRGSPAYPPV  699
            CKF HP  +    P   S A  PV
Sbjct  368  CKFDHPMGTLSYSPSASSLADMPV  391


 Score = 56.6 bits (135),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARM  446
            YP+R GE +C+YYI+TG C+FGA+C+F+HP    + I A  +
Sbjct  136  YPLRPGERECTYYIKTGQCKFGATCKFHHPQPANMQIPAQSL  177


 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 20/32 (63%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +3

Query  315  GTYPVRDGEPDCSYYIRTGLCRFGASCRFNHP  410
            G +P R G+P C YY+RTG C+FGASC++NHP
Sbjct  88   GEFPERVGQPLCQYYMRTGTCKFGASCKYNHP  119


 Score = 53.1 bits (126),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 36/150 (24%), Positives = 67/150 (45%), Gaps = 20/150 (13%)
 Frame = +3

Query  36   GNFMTLPFSFWILTFNLLQYFLVIPESWCIYAG--FKLSDSYI*ASIGQLCLYCFHC*YP  209
            G+++  P+   +L+ +L+ Y      SW  Y      ++      ++G   +Y      P
Sbjct  216  GSYVQGPYGPVLLSPSLVPY-----PSWSPYPAPVSPVASPNAQPAVGSGSVYGIS---P  267

Query  210  LVPTYAVFMSKDTAICTR*ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGA  389
            L P+   +     +I T           S  + +   +P R G+P+C YY++TG C+F +
Sbjct  268  LSPSAPAYTGAYQSIPT-------AKGPSSSSQKEHVFPERPGQPECQYYMKTGDCKFES  320

Query  390  SCRFNHPS---NRKLAIAAARMKVLLEDGS  470
            SCR++HP      K  +  + M + L  G+
Sbjct  321  SCRYHHPPELVTSKTNVVLSPMGLPLRPGA  350



>ref|XP_010921758.1| PREDICTED: zinc finger CCCH domain-containing protein 6 [Elaeis 
guineensis]
Length=466

 Score =   117 bits (292),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 55/90 (61%), Positives = 62/90 (69%), Gaps = 0/90 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YY++TG CKFG+TCK+HHPR   G    V LN  GYPLRP + EC YYM+TGQCKFGST
Sbjct  95   EYYMRTGTCKFGSTCKYHHPRQGGGSVRPVLLNYSGYPLRPGEKECSYYMKTGQCKFGST  154

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTP  717
            CKFHHPQP    VP      YP V  PT P
Sbjct  155  CKFHHPQPGGASVPSPAPTFYPTVQPPTVP  184


 Score = 56.6 bits (135),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAAR  443
            YP R GEPDC+YY+RTG C +G  CR+NHP +R     A R
Sbjct  39   YPERPGEPDCAYYMRTGSCGYGERCRYNHPRDRGARSGAGR  79


 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 46/66 (70%), Gaps = 0/66 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y++TG CKFG+TC++HHPRD +      AL+ LG PLRP    C YY + G CKFG T
Sbjct  298  QFYMRTGDCKFGSTCRYHHPRDWSMPKTNCALSPLGLPLRPGAQPCAYYAQHGVCKFGPT  357

Query  628  CKFHHP  645
            CKF HP
Sbjct  358  CKFDHP  363


 Score = 77.8 bits (190),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 44/66 (67%), Gaps = 0/66 (0%)
 Frame = +1

Query  451  YYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTC  630
            YY++TG+C +G  C+++HPRD+   +G        YP R     C YYMRTG CKFGSTC
Sbjct  50   YYMRTGSCGYGERCRYNHPRDRGARSGAGRTAAGEYPERVGQPVCEYYMRTGTCKFGSTC  109

Query  631  KFHHPQ  648
            K+HHP+
Sbjct  110  KYHHPR  115


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +1

Query  556  YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNM  660
            +P RP   EC +YMRTG CKFGSTC++HHP+  +M
Sbjct  288  FPERPGQPECQFYMRTGDCKFGSTCRYHHPRDWSM  322


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAA  437
            YP+R GE +CSYY++TG C+FG++C+F+HP     ++ +
Sbjct  131  YPLRPGEKECSYYMKTGQCKFGSTCKFHHPQPGGASVPS  169


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/54 (41%), Positives = 36/54 (67%), Gaps = 3/54 (6%)
 Frame = +3

Query  318  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHP---SNRKLAIAAARMKVLLEDGS  470
            T+P R G+P+C +Y+RTG C+FG++CR++HP   S  K   A + + + L  G+
Sbjct  287  TFPERPGQPECQFYMRTGDCKFGSTCRYHHPRDWSMPKTNCALSPLGLPLRPGA  340


 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 18/33 (55%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = +3

Query  312  SGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHP  410
            +G YP R G+P C YY+RTG C+FG++C+++HP
Sbjct  82   AGEYPERVGQPVCEYYMRTGTCKFGSTCKYHHP  114



>ref|XP_006356704.1| PREDICTED: zinc finger CCCH domain-containing protein 32-like 
isoform X4 [Solanum tuberosum]
Length=327

 Score =   108 bits (269),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 57/74 (77%), Gaps = 0/74 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YY++TG CKFGA+CK+HHPR        V  N+ GYPLRPN+ EC +YM+TGQCKFG T
Sbjct  99   QYYMRTGMCKFGASCKYHHPRQGGESPSLVIHNIYGYPLRPNEKECSHYMKTGQCKFGIT  158

Query  628  CKFHHPQPSNMMVP  669
            CKFHHPQP+ + VP
Sbjct  159  CKFHHPQPAGVQVP  172


 Score = 65.5 bits (158),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 40/59 (68%), Gaps = 4/59 (7%)
 Frame = +3

Query  267  ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAAR  443
            E + QLS+ +    E+G+YP R  EPDC YY+R G+C +G+ CRFNHP +R LA+   R
Sbjct  29   EPMGQLSVGT----EAGSYPERLNEPDCIYYLRNGICGYGSRCRFNHPRDRSLAVGERR  83


 Score = 77.4 bits (189),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 43/66 (65%), Gaps = 0/66 (0%)
 Frame = +1

Query  451  YYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTC  630
            YYL+ G C +G+ C+F+HPRD++   G        YP R     C YYMRTG CKFG++C
Sbjct  54   YYLRNGICGYGSRCRFNHPRDRSLAVGERRATGGEYPERAGQFVCQYYMRTGMCKFGASC  113

Query  631  KFHHPQ  648
            K+HHP+
Sbjct  114  KYHHPR  119


 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +3

Query  315  GTYPVRDGEPDCSYYIRTGLCRFGASCRFNHP  410
            G YP R G+  C YY+RTG+C+FGASC+++HP
Sbjct  87   GEYPERAGQFVCQYYMRTGMCKFGASCKYHHP  118



>gb|KCW58527.1| hypothetical protein EUGRSUZ_H01196 [Eucalyptus grandis]
Length=424

 Score =   119 bits (299),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 66/90 (73%), Gaps = 0/90 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++YLKTG CKFGA+CKFHHP++  G   RV LN+ GYPLR  + EC YY++TGQCKFG+T
Sbjct  111  QFYLKTGTCKFGASCKFHHPKNGGGSLNRVPLNMYGYPLRLGEQECSYYLKTGQCKFGTT  170

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTP  717
            CKFHHPQP+   +P      Y PV SP+ P
Sbjct  171  CKFHHPQPAGASIPASAPQFYSPVQSPSVP  200


 Score = 53.5 bits (127),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +3

Query  318  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHP  410
            +YP R G PDC+YY+RTG C FG+ CR+NHP
Sbjct  55   SYPERSGMPDCAYYMRTGFCGFGSRCRYNHP  85


 Score = 85.5 bits (210),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 48/66 (73%), Gaps = 0/66 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YY++TG CKFG++C++HHPRD+        LN LG PLRP  + C +Y++ G CK+GST
Sbjct  314  QYYMRTGDCKFGSSCRYHHPRDRMVQGTSFLLNPLGLPLRPGVLPCAFYVQNGHCKYGST  373

Query  628  CKFHHP  645
            CKF HP
Sbjct  374  CKFDHP  379


 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 46/66 (70%), Gaps = 1/66 (2%)
 Frame = +1

Query  451  YYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTC  630
            YY++TG C FG+ C+++HPRD+A +          YP RP +  C +Y++TG CKFG++C
Sbjct  67   YYMRTGFCGFGSRCRYNHPRDRAAVV-AAVRATGDYPERPGEPACQFYLKTGTCKFGASC  125

Query  631  KFHHPQ  648
            KFHHP+
Sbjct  126  KFHHPK  131


 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +3

Query  312  SGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSN  416
            +G YP R GEP C +Y++TG C+FGASC+F+HP N
Sbjct  98   TGDYPERPGEPACQFYLKTGTCKFGASCKFHHPKN  132


 Score = 56.2 bits (134),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKL  425
            +P R GEPDC YY+RTG C+FG+SCR++HP +R +
Sbjct  304  FPQRAGEPDCQYYMRTGDCKFGSSCRYHHPRDRMV  338


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAA  440
            YP+R GE +CSYY++TG C+FG +C+F+HP     +I A+
Sbjct  147  YPLRLGEQECSYYLKTGQCKFGTTCKFHHPQPAGASIPAS  186



>ref|XP_006397979.1| hypothetical protein EUTSA_v10001399mg [Eutrema salsugineum]
 gb|ESQ39432.1| hypothetical protein EUTSA_v10001399mg [Eutrema salsugineum]
Length=525

 Score =   108 bits (269),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 57/74 (77%), Gaps = 0/74 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++YLKTG CKFGA+CKFHHP++  G    V LN+ GYP+R  + +C YY++TGQCKFG T
Sbjct  152  QFYLKTGTCKFGASCKFHHPKNAGGSMSHVPLNIYGYPVREGEKDCSYYLKTGQCKFGIT  211

Query  628  CKFHHPQPSNMMVP  669
            CKFHHPQP+   VP
Sbjct  212  CKFHHPQPAGTTVP  225


 Score = 65.1 bits (157),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 30/59 (51%), Positives = 38/59 (64%), Gaps = 6/59 (10%)
 Frame = +3

Query  267  ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAAR  443
            E++WQL L S       TYP R G PDC+YY+RTG+C +G  CR+NHP +R    AA R
Sbjct  85   ESMWQLRLGSE------TYPERPGAPDCAYYMRTGVCGYGNRCRYNHPRDRATVEAAVR  137


 Score = 87.0 bits (214),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 43/84 (51%), Positives = 52/84 (62%), Gaps = 0/84 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFG +CKFHHPRD+        L+ +G PLRP    C +Y++ G CKFGST
Sbjct  352  QYYLKTGDCKFGTSCKFHHPRDRIPPRANCVLSPIGLPLRPGVQRCTFYVQNGFCKFGST  411

Query  628  CKFHHPQPSNMMVPLRGSPAYPPV  699
            CKF HP  +    P   S A  PV
Sbjct  412  CKFDHPMGTIRYNPSASSLADAPV  435


 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 47/67 (70%), Gaps = 3/67 (4%)
 Frame = +1

Query  451  YYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLG-YPLRPNDIECPYYMRTGQCKFGST  627
            YY++TG C +G  C+++HPRD+A +    A+   G YP R  +  C +Y++TG CKFG++
Sbjct  108  YYMRTGVCGYGNRCRYNHPRDRATV--EAAVRATGQYPERIGEPPCQFYLKTGTCKFGAS  165

Query  628  CKFHHPQ  648
            CKFHHP+
Sbjct  166  CKFHHPK  172


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 21/47 (45%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +3

Query  312  SGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKV  452
            +G YP R GEP C +Y++TG C+FGASC+F+HP N   +++   + +
Sbjct  139  TGQYPERIGEPPCQFYLKTGTCKFGASCKFHHPKNAGGSMSHVPLNI  185


 Score = 55.8 bits (133),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 20/30 (67%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHP  410
            YPVR+GE DCSYY++TG C+FG +C+F+HP
Sbjct  188  YPVREGEKDCSYYLKTGQCKFGITCKFHHP  217


 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 20/34 (59%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +3

Query  318  TYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNR  419
            T+P R GEP+C YY++TG C+FG SC+F+HP +R
Sbjct  341  TFPERPGEPECQYYLKTGDCKFGTSCKFHHPRDR  374


 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 35/55 (64%), Gaps = 3/55 (5%)
 Frame = +1

Query  556  YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPLRGSPAYPPVHSPTTPG  720
            +P RP + EC YY++TG CKFG++CKFHHP+     +P R +    P+  P  PG
Sbjct  342  FPERPGEPECQYYLKTGDCKFGTSCKFHHPRD---RIPPRANCVLSPIGLPLRPG  393



>ref|XP_009369128.1| PREDICTED: zinc finger CCCH domain-containing protein 58-like 
[Pyrus x bretschneideri]
Length=473

 Score =   108 bits (270),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 44/74 (59%), Positives = 59/74 (80%), Gaps = 0/74 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YY++TG CKFGA+CK+HHP+        V+LN  GYPLRP++ +C YY++TGQCKFGST
Sbjct  99   QYYMRTGTCKFGASCKYHHPKQGGSSDSPVSLNYYGYPLRPSERDCSYYVKTGQCKFGST  158

Query  628  CKFHHPQPSNMMVP  669
            CKFHHPQP+ + +P
Sbjct  159  CKFHHPQPAGIQLP  172


 Score = 65.1 bits (157),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 40/63 (63%), Gaps = 0/63 (0%)
 Frame = +3

Query  267  ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARM  446
            ET  + S+R +      +YP R  E DCSYY+RTG+C +G+ CR+NHP +R + I AAR 
Sbjct  25   ETGLEGSMRQLGLGTGESYPERSNEADCSYYLRTGICGYGSRCRYNHPRDRSVVIGAART  84

Query  447  KVL  455
              L
Sbjct  85   GGL  87


 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 46/67 (69%), Gaps = 0/67 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
             YYL+TG C +G+ C+++HPRD++ + G      L YP R     C YYMRTG CKFG++
Sbjct  53   SYYLRTGICGYGSRCRYNHPRDRSVVIGAARTGGLEYPERAGQPVCQYYMRTGTCKFGAS  112

Query  628  CKFHHPQ  648
            CK+HHP+
Sbjct  113  CKYHHPK  119


 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 43/66 (65%), Gaps = 0/66 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +Y+++TG CKFG++C++HHP +       V L+  G PLRP    C +Y + G CKFGS 
Sbjct  304  QYFMRTGDCKFGSSCRYHHPPEVVQSKTTVLLSSSGLPLRPGAPLCTHYQQRGACKFGSA  363

Query  628  CKFHHP  645
            CKF HP
Sbjct  364  CKFDHP  369


 Score = 53.5 bits (127),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 21/53 (40%), Positives = 34/53 (64%), Gaps = 4/53 (8%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKVLLEDGSLQV  479
            +P R G+P+C Y++RTG C+FG+SCR++HP      +  ++  VLL    L +
Sbjct  294  FPERPGQPECQYFMRTGDCKFGSSCRYHHPPE----VVQSKTTVLLSSSGLPL  342


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 19/30 (63%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHP  410
            YP R G+P C YY+RTG C+FGASC+++HP
Sbjct  89   YPERAGQPVCQYYMRTGTCKFGASCKYHHP  118


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAA  437
            YP+R  E DCSYY++TG C+FG++C+F+HP    + +  
Sbjct  135  YPLRPSERDCSYYVKTGQCKFGSTCKFHHPQPAGIQLPG  173


 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 19/30 (63%), Positives = 24/30 (80%), Gaps = 0/30 (0%)
 Frame = +1

Query  556  YPLRPNDIECPYYMRTGQCKFGSTCKFHHP  645
            +P RP   EC Y+MRTG CKFGS+C++HHP
Sbjct  294  FPERPGQPECQYFMRTGDCKFGSSCRYHHP  323



>ref|XP_011071464.1| PREDICTED: zinc finger CCCH domain-containing protein 34-like 
[Sesamum indicum]
 ref|XP_011071465.1| PREDICTED: zinc finger CCCH domain-containing protein 34-like 
[Sesamum indicum]
Length=488

 Score =   108 bits (270),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 58/74 (78%), Gaps = 0/74 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YY++TG CKFGA+CK+HHP+   G +  + LN  GYPLRP + EC YY++TGQCKFG T
Sbjct  98   QYYMRTGMCKFGASCKYHHPKQGIGSSAPIMLNFYGYPLRPGEKECSYYVKTGQCKFGVT  157

Query  628  CKFHHPQPSNMMVP  669
            CKFHHPQP+ + VP
Sbjct  158  CKFHHPQPTGVRVP  171


 Score = 65.1 bits (157),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 30/59 (51%), Positives = 35/59 (59%), Gaps = 8/59 (14%)
 Frame = +3

Query  267  ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAAR  443
            E +WQL L S        YP R  EPDC YY+RTG C +G  CRFNHP +R  A+ A R
Sbjct  32   EPMWQLGLES--------YPERPDEPDCIYYLRTGSCGYGTRCRFNHPRDRGAAVGALR  82


 Score = 82.4 bits (202),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 47/66 (71%), Gaps = 0/66 (0%)
 Frame = +1

Query  451  YYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTC  630
            YYL+TG+C +G  C+F+HPRD+    G +  +  GYP R +   C YYMRTG CKFG++C
Sbjct  53   YYLRTGSCGYGTRCRFNHPRDRGAAVGALRASGGGYPERISQPVCQYYMRTGMCKFGASC  112

Query  631  KFHHPQ  648
            K+HHP+
Sbjct  113  KYHHPK  118


 Score = 77.0 bits (188),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 44/66 (67%), Gaps = 0/66 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFG+TCK+HHP + +       L+ +G PLRP    C +Y + G CKFG +
Sbjct  321  QYYLKTGDCKFGSTCKYHHPPEWSAPKSNFLLSPMGLPLRPGAPLCSHYAQNGVCKFGPS  380

Query  628  CKFHHP  645
            CKF HP
Sbjct  381  CKFDHP  386


 Score = 53.5 bits (127),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 21/57 (37%), Positives = 33/57 (58%), Gaps = 0/57 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKVLLEDGSLQVWGHL  491
            YP+R GE +CSYY++TG C+FG +C+F+HP    + +    +        + V G L
Sbjct  134  YPLRPGEKECSYYVKTGQCKFGVTCKFHHPQPTGVRVPGPAVAPGPTLAPVPVPGPL  190


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/30 (67%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = +1

Query  556  YPLRPNDIECPYYMRTGQCKFGSTCKFHHP  645
            +P RP + EC YY++TG CKFGSTCK+HHP
Sbjct  311  FPERPGEPECQYYLKTGDCKFGSTCKYHHP  340


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +3

Query  315  GTYPVRDGEPDCSYYIRTGLCRFGASCRFNHP  410
            G YP R  +P C YY+RTG+C+FGASC+++HP
Sbjct  86   GGYPERISQPVCQYYMRTGMCKFGASCKYHHP  117


 Score = 50.1 bits (118),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 21/53 (40%), Positives = 34/53 (64%), Gaps = 3/53 (6%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHP---SNRKLAIAAARMKVLLEDGS  470
            +P R GEP+C YY++TG C+FG++C+++HP   S  K     + M + L  G+
Sbjct  311  FPERPGEPECQYYLKTGDCKFGSTCKYHHPPEWSAPKSNFLLSPMGLPLRPGA  363



>ref|XP_007154244.1| hypothetical protein PHAVU_003G102600g [Phaseolus vulgaris]
 ref|XP_007154245.1| hypothetical protein PHAVU_003G102600g [Phaseolus vulgaris]
 gb|ESW26238.1| hypothetical protein PHAVU_003G102600g [Phaseolus vulgaris]
 gb|ESW26239.1| hypothetical protein PHAVU_003G102600g [Phaseolus vulgaris]
Length=483

 Score =   109 bits (273),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 47/73 (64%), Positives = 59/73 (81%), Gaps = 0/73 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YY++TG+CKFGA+CK+HHPR  AG A  V LN  GYPLR  + EC YY++TGQCKFG+T
Sbjct  99   QYYMRTGSCKFGASCKYHHPRQAAGTATPVPLNYYGYPLRVGEKECSYYVKTGQCKFGAT  158

Query  628  CKFHHPQPSNMMV  666
            CKFHHPQP+ + V
Sbjct  159  CKFHHPQPAGVQV  171


 Score = 63.9 bits (154),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 36/58 (62%), Gaps = 5/58 (9%)
 Frame = +3

Query  267  ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAA  440
            E+ WQL L + E+     YP+R  E DC YY+RTG C +G  CRFNHP +R   I AA
Sbjct  30   ESSWQLGLAAAES-----YPLRPDEADCIYYLRTGFCGYGTRCRFNHPRDRAAVIGAA  82


 Score = 80.5 bits (197),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 45/66 (68%), Gaps = 0/66 (0%)
 Frame = +1

Query  451  YYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTC  630
            YYL+TG C +G  C+F+HPRD+A + G  A     +P R     C YYMRTG CKFG++C
Sbjct  54   YYLRTGFCGYGTRCRFNHPRDRAAVIGAAARTGGEFPERVGQPVCQYYMRTGSCKFGASC  113

Query  631  KFHHPQ  648
            K+HHP+
Sbjct  114  KYHHPR  119


 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +1

Query  451  YYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTC  630
            YY+KTG CKFG +C++HHP DK      V L+ +G PLRP    C +Y + G CKFGS C
Sbjct  312  YYMKTGECKFGPSCRYHHPPDKGAPKANVILSPVGLPLRPGAQPCTHYTQRGVCKFGSAC  371

Query  631  KFHHP  645
            KF HP
Sbjct  372  KFDHP  376


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 20/39 (51%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAA  437
            YP+R GE +CSYY++TG C+FGA+C+F+HP    + + A
Sbjct  135  YPLRVGEKECSYYVKTGQCKFGATCKFHHPQPAGVQVIA  173


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +3

Query  315  GTYPVRDGEPDCSYYIRTGLCRFGASCRFNHP  410
            G +P R G+P C YY+RTG C+FGASC+++HP
Sbjct  87   GEFPERVGQPVCQYYMRTGSCKFGASCKYHHP  118


 Score = 50.4 bits (119),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 20/53 (38%), Positives = 33/53 (62%), Gaps = 4/53 (8%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKVLLEDGSLQV  479
            +P R  +P+C YY++TG C+FG SCR++HP ++     A +  V+L    L +
Sbjct  301  FPERPDQPECHYYMKTGECKFGPSCRYHHPPDK----GAPKANVILSPVGLPL  349



>ref|XP_010938478.1| PREDICTED: zinc finger CCCH domain-containing protein 6-like 
[Elaeis guineensis]
Length=463

 Score =   109 bits (273),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 62/90 (69%), Gaps = 1/90 (1%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YY+KTG CKFG+TCK+HHPR   G    V LN  GYPLRP + EC YYM+TGQCKFGST
Sbjct  93   EYYMKTGTCKFGSTCKYHHPRQGGGSEQPVLLNYCGYPLRPGEKECSYYMKTGQCKFGST  152

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTP  717
            CKFHHPQ     +P   S  YP V  P+ P
Sbjct  153  CKFHHPQLGGASMP-PASMFYPTVQPPSIP  181


 Score = 63.5 bits (153),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 38/63 (60%), Gaps = 4/63 (6%)
 Frame = +3

Query  267  ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARM  446
            E++W+L L   +      YP R GEPDC+YYIRTG C +G  CR+NHP +R     + R 
Sbjct  23   ESMWRLGLAGGDL----PYPERPGEPDCAYYIRTGSCGYGERCRYNHPPDRGALARSGRT  78

Query  447  KVL  455
             V+
Sbjct  79   GVV  81


 Score = 77.0 bits (188),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 44/66 (67%), Gaps = 0/66 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y++TG CK+G TCK+HHPRD +       L+ LG PLRP    C +Y + G CKFG T
Sbjct  295  QFYMRTGDCKYGVTCKYHHPRDWSIPKTNCVLSPLGLPLRPGAQICAFYAQHGVCKFGPT  354

Query  628  CKFHHP  645
            CKF HP
Sbjct  355  CKFDHP  360


 Score = 74.7 bits (182),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 44/66 (67%), Gaps = 0/66 (0%)
 Frame = +1

Query  451  YYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTC  630
            YY++TG+C +G  C+++HP D+  +A      V+ YP       C YYM+TG CKFGSTC
Sbjct  48   YYIRTGSCGYGERCRYNHPPDRGALARSGRTGVVEYPEHVGQPVCEYYMKTGTCKFGSTC  107

Query  631  KFHHPQ  648
            K+HHP+
Sbjct  108  KYHHPR  113


 Score = 53.9 bits (128),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 20/42 (48%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARM  446
            YP+R GE +CSYY++TG C+FG++C+F+HP     ++  A M
Sbjct  129  YPLRPGEKECSYYMKTGQCKFGSTCKFHHPQLGGASMPPASM  170



>gb|KDP40004.1| hypothetical protein JCGZ_02002 [Jatropha curcas]
Length=473

 Score =   112 bits (280),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 45/73 (62%), Positives = 60/73 (82%), Gaps = 0/73 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YY++TG CKFGA+CK+HHP+ + G    V+LN  GYPLRP + EC YY++TGQCKFG+T
Sbjct  100  QYYMRTGTCKFGASCKYHHPKQEGGSVSPVSLNYYGYPLRPGEKECTYYVKTGQCKFGAT  159

Query  628  CKFHHPQPSNMMV  666
            CKFHHPQP+N+ +
Sbjct  160  CKFHHPQPANLQI  172


 Score = 60.8 bits (146),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 35/59 (59%), Gaps = 4/59 (7%)
 Frame = +3

Query  267  ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAAR  443
            E +W L L   E+     YP R  E +C YY+RTG C +GA CRFNHP +R   I AAR
Sbjct  30   EGVWPLGLGEGES----GYPERPDEANCIYYLRTGFCGYGARCRFNHPRDRGAVIGAAR  84


 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 44/66 (67%), Gaps = 0/66 (0%)
 Frame = +1

Query  451  YYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTC  630
            YYL+TG C +GA C+F+HPRD+  + G        +P R     C YYMRTG CKFG++C
Sbjct  55   YYLRTGFCGYGARCRFNHPRDRGAVIGAARAGAGEFPERVGQPVCQYYMRTGTCKFGASC  114

Query  631  KFHHPQ  648
            K+HHP+
Sbjct  115  KYHHPK  120


 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 44/66 (67%), Gaps = 0/66 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YY+KTG CKFG++C++HHP +       V L+ +G PLRP    C +Y + GQCKFG  
Sbjct  305  QYYMKTGNCKFGSSCRYHHPPELIAPKTNVVLSPIGLPLRPGAPPCTHYTQRGQCKFGPA  364

Query  628  CKFHHP  645
            CKF HP
Sbjct  365  CKFDHP  370


 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAI  431
            YP+R GE +C+YY++TG C+FGA+C+F+HP    L I
Sbjct  136  YPLRPGEKECTYYVKTGQCKFGATCKFHHPQPANLQI  172


 Score = 53.5 bits (127),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = +3

Query  312  SGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMK  449
            +G +P R G+P C YY+RTG C+FGASC+++HP     +++   + 
Sbjct  87   AGEFPERVGQPVCQYYMRTGTCKFGASCKYHHPKQEGGSVSPVSLN  132


 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 19/30 (63%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = +1

Query  556  YPLRPNDIECPYYMRTGQCKFGSTCKFHHP  645
            +P RP+  EC YYM+TG CKFGS+C++HHP
Sbjct  295  FPERPDQPECQYYMKTGNCKFGSSCRYHHP  324



>ref|XP_006575106.1| PREDICTED: zinc finger CCCH domain-containing protein 32-like 
isoform X2 [Glycine max]
Length=365

 Score =   117 bits (293),  Expect(2) = 3e-34, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 64/90 (71%), Gaps = 0/90 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFGA+CKFHHP++  G   +  LNV GYPLRP + EC YY++TGQCKFG +
Sbjct  100  QYYLKTGTCKFGASCKFHHPKNGGGYLSQAPLNVYGYPLRPGEKECSYYLKTGQCKFGIS  159

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTP  717
            CKFHHPQP+   +P      Y  V SPT P
Sbjct  160  CKFHHPQPAGTSLPASAPQFYQQVQSPTVP  189


 Score = 55.8 bits (133),  Expect(2) = 3e-34, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 33/50 (66%), Gaps = 5/50 (10%)
 Frame = +3

Query  267  ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSN  416
            E++W L+L   E+     YP R G P+C YY+RTG+C +G  CR+NHP +
Sbjct  32   ESMWHLTLGGGES-----YPERSGVPNCVYYMRTGVCGYGGRCRYNHPRD  76


 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 45/66 (68%), Gaps = 1/66 (2%)
 Frame = +1

Query  451  YYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTC  630
            YY++TG C +G  C+++HPRD+A +A         YP R  +  C YY++TG CKFG++C
Sbjct  56   YYMRTGVCGYGGRCRYNHPRDRAAVA-AAVRATGDYPERVGEPPCQYYLKTGTCKFGASC  114

Query  631  KFHHPQ  648
            KFHHP+
Sbjct  115  KFHHPK  120


 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +3

Query  312  SGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKV  452
            +G YP R GEP C YY++TG C+FGASC+F+HP N    ++ A + V
Sbjct  87   TGDYPERVGEPPCQYYLKTGTCKFGASCKFHHPKNGGGYLSQAPLNV  133


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/73 (36%), Positives = 39/73 (53%), Gaps = 14/73 (19%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLA--------------IAAARMKVLL  458
            YP R GEP+C YY+RTG C+FG +CR++HP +  +A                   + +L 
Sbjct  293  YPERPGEPECQYYLRTGDCKFGLACRYHHPRDHIVARPLLSPVGLPLRPKTGVTTLCILF  352

Query  459  EDGSLQVWGHLQV  497
               +LQ+  HLQ+
Sbjct  353  AKWALQIRLHLQI  365


 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAA  440
            YP+R GE +CSYY++TG C+FG SC+F+HP     ++ A+
Sbjct  136  YPLRPGEKECSYYLKTGQCKFGISCKFHHPQPAGTSLPAS  175


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 29/42 (69%), Gaps = 2/42 (5%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPN  573
            +YYL+TG CKFG  C++HHPRD   I  R  L+ +G PLRP 
Sbjct  303  QYYLRTGDCKFGLACRYHHPRDH--IVARPLLSPVGLPLRPK  342


 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 21/39 (54%), Positives = 27/39 (69%), Gaps = 0/39 (0%)
 Frame = +1

Query  556  YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPL  672
            YP RP + EC YY+RTG CKFG  C++HHP+   +  PL
Sbjct  293  YPERPGEPECQYYLRTGDCKFGLACRYHHPRDHIVARPL  331



>ref|XP_006575107.1| PREDICTED: zinc finger CCCH domain-containing protein 32-like 
isoform X3 [Glycine max]
Length=353

 Score =   117 bits (293),  Expect(2) = 3e-34, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 64/90 (71%), Gaps = 0/90 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFGA+CKFHHP++  G   +  LNV GYPLRP + EC YY++TGQCKFG +
Sbjct  100  QYYLKTGTCKFGASCKFHHPKNGGGYLSQAPLNVYGYPLRPGEKECSYYLKTGQCKFGIS  159

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTP  717
            CKFHHPQP+   +P      Y  V SPT P
Sbjct  160  CKFHHPQPAGTSLPASAPQFYQQVQSPTVP  189


 Score = 55.8 bits (133),  Expect(2) = 3e-34, Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 36/56 (64%), Gaps = 8/56 (14%)
 Frame = +3

Query  243  DTAICTR*ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHP  410
            DTA+    E++W L+L   E+     YP R G P+C YY+RTG+C +G  CR+NHP
Sbjct  27   DTALE---ESMWHLTLGGGES-----YPERSGVPNCVYYMRTGVCGYGGRCRYNHP  74


 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 45/66 (68%), Gaps = 1/66 (2%)
 Frame = +1

Query  451  YYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTC  630
            YY++TG C +G  C+++HPRD+A +A         YP R  +  C YY++TG CKFG++C
Sbjct  56   YYMRTGVCGYGGRCRYNHPRDRAAVA-AAVRATGDYPERVGEPPCQYYLKTGTCKFGASC  114

Query  631  KFHHPQ  648
            KFHHP+
Sbjct  115  KFHHPK  120


 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +3

Query  312  SGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKV  452
            +G YP R GEP C YY++TG C+FGASC+F+HP N    ++ A + V
Sbjct  87   TGDYPERVGEPPCQYYLKTGTCKFGASCKFHHPKNGGGYLSQAPLNV  133


 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/43 (56%), Positives = 31/43 (72%), Gaps = 2/43 (5%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPND  576
            +YYL+TG CKFG  C++HHPRD   I  R  L+ +G PLRPN+
Sbjct  303  QYYLRTGDCKFGLACRYHHPRDH--IVARPLLSPVGLPLRPNN  343


 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 22/53 (42%), Positives = 34/53 (64%), Gaps = 0/53 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKVLLEDGSLQV  479
            YP+R GE +CSYY++TG C+FG SC+F+HP     ++ A+  +   +  S  V
Sbjct  136  YPLRPGEKECSYYLKTGQCKFGISCKFHHPQPAGTSLPASAPQFYQQVQSPTV  188


 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLA  428
            YP R GEP+C YY+RTG C+FG +CR++HP +  +A
Sbjct  293  YPERPGEPECQYYLRTGDCKFGLACRYHHPRDHIVA  328


 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 21/39 (54%), Positives = 27/39 (69%), Gaps = 0/39 (0%)
 Frame = +1

Query  556  YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPL  672
            YP RP + EC YY+RTG CKFG  C++HHP+   +  PL
Sbjct  293  YPERPGEPECQYYLRTGDCKFGLACRYHHPRDHIVARPL  331



>ref|XP_009774842.1| PREDICTED: zinc finger CCCH domain-containing protein 58-like 
[Nicotiana sylvestris]
Length=492

 Score =   105 bits (263),  Expect(2) = 3e-34, Method: Compositional matrix adjust.
 Identities = 44/73 (60%), Positives = 55/73 (75%), Gaps = 0/73 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YY++TG CKFGA+CK+HHPR   G    V +N+ GYPLRP + EC YY++TGQCKFG T
Sbjct  103  QYYMRTGMCKFGASCKYHHPRQGGGSPAPVTVNIYGYPLRPGEKECSYYVKTGQCKFGVT  162

Query  628  CKFHHPQPSNMMV  666
            CKFHHP P+   V
Sbjct  163  CKFHHPHPAGAQV  175


 Score = 67.0 bits (162),  Expect(2) = 3e-34, Method: Compositional matrix adjust.
 Identities = 30/59 (51%), Positives = 37/59 (63%), Gaps = 4/59 (7%)
 Frame = +3

Query  267  ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAAR  443
            E +WQLSL +       +YP R  EPDC YY+RTG C +GA CRFNHP +R   + A R
Sbjct  33   EPMWQLSLNTGPE----SYPERPNEPDCIYYLRTGFCGYGARCRFNHPRDRNSVLGAMR  87


 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/86 (45%), Positives = 53/86 (62%), Gaps = 5/86 (6%)
 Frame = +1

Query  451  YYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTC  630
            YYL+TG C +GA C+F+HPRD+  + G +      YP R     C YYMRTG CKFG++C
Sbjct  58   YYLRTGFCGYGARCRFNHPRDRNSVLGAMRATGGEYPERVGQPVCQYYMRTGMCKFGASC  117

Query  631  KFHHPQ-----PSNMMVPLRGSPAYP  693
            K+HHP+     P+ + V + G P  P
Sbjct  118  KYHHPRQGGGSPAPVTVNIYGYPLRP  143


 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 44/66 (67%), Gaps = 0/66 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YY+K G CK+G++C++HHP + +G      L+ +G PLRP    C +Y + G CKFG +
Sbjct  320  QYYMKYGDCKYGSSCRYHHPPEWSGPKTSFILSAMGLPLRPGAPICSHYAQNGVCKFGPS  379

Query  628  CKFHHP  645
            CKF HP
Sbjct  380  CKFDHP  385


 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 21/46 (46%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = +3

Query  315  GTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKV  452
            G YP R G+P C YY+RTG+C+FGASC+++HP     + A   + +
Sbjct  91   GEYPERVGQPVCQYYMRTGMCKFGASCKYHHPRQGGGSPAPVTVNI  136


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 18/30 (60%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHP  410
            YP+R GE +CSYY++TG C+FG +C+F+HP
Sbjct  139  YPLRPGEKECSYYVKTGQCKFGVTCKFHHP  168



>ref|XP_006296584.1| hypothetical protein CARUB_v100138730mg, partial [Capsella rubella]
 gb|EOA29482.1| hypothetical protein CARUB_v100138730mg, partial [Capsella rubella]
Length=329

 Score =   136 bits (342),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 60/84 (71%), Positives = 72/84 (86%), Gaps = 2/84 (2%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFG TCKFHHPR+KAGIAGRV+LN+LGYPLR N+++C Y++RTG CKFG T
Sbjct  21   EYYLKTGTCKFGVTCKFHHPRNKAGIAGRVSLNMLGYPLRSNEVDCAYFLRTGHCKFGGT  80

Query  628  CKFHH--PQPSNMMVPLRGSPAYP  693
            CKF+H  PQP+NMMVP  G  +YP
Sbjct  81   CKFNHPQPQPTNMMVPTSGQQSYP  104


 Score = 79.7 bits (195),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 44/66 (67%), Gaps = 0/66 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y+KTG CKFG  CKFHHPRD+        L+ +G PLRP +  C +Y R G CKFG +
Sbjct  210  QFYMKTGDCKFGTVCKFHHPRDRQAPPPDCLLSSIGLPLRPGEPLCVFYTRYGICKFGPS  269

Query  628  CKFHHP  645
            CKF HP
Sbjct  270  CKFDHP  275


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 20/47 (43%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +3

Query  315  GTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKVL  455
            G YP R G+P+C YY++TG C+FG +C+F+HP N+        + +L
Sbjct  9    GEYPERIGQPECEYYLKTGTCKFGVTCKFHHPRNKAGIAGRVSLNML  55


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 18/30 (60%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHP  410
            YP+R  E DC+Y++RTG C+FG +C+FNHP
Sbjct  57   YPLRSNEVDCAYFLRTGHCKFGGTCKFNHP  86


 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 24/31 (77%), Gaps = 0/31 (0%)
 Frame = +1

Query  556  YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQ  648
            +P RP   EC +YM+TG CKFG+ CKFHHP+
Sbjct  200  FPERPGQPECQFYMKTGDCKFGTVCKFHHPR  230



>ref|XP_009588295.1| PREDICTED: zinc finger CCCH domain-containing protein 58 [Nicotiana 
tomentosiformis]
Length=494

 Score =   105 bits (263),  Expect(2) = 3e-34, Method: Compositional matrix adjust.
 Identities = 44/73 (60%), Positives = 55/73 (75%), Gaps = 0/73 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YY++TG CKFGA+CK+HHPR   G    V +N+ GYPLRP + EC YY++TGQCKFG T
Sbjct  103  QYYMRTGMCKFGASCKYHHPRQGGGSPAPVTVNIYGYPLRPGEKECSYYVKTGQCKFGVT  162

Query  628  CKFHHPQPSNMMV  666
            CKFHHP P+   V
Sbjct  163  CKFHHPHPAGAQV  175


 Score = 67.0 bits (162),  Expect(2) = 3e-34, Method: Compositional matrix adjust.
 Identities = 30/59 (51%), Positives = 37/59 (63%), Gaps = 4/59 (7%)
 Frame = +3

Query  267  ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAAR  443
            E +WQLSL +       +YP R  EPDC YY+RTG C +GA CRFNHP +R   + A R
Sbjct  33   EPMWQLSLNTGPE----SYPERPNEPDCIYYLRTGFCGYGARCRFNHPRDRNSVLGAMR  87


 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/86 (45%), Positives = 53/86 (62%), Gaps = 5/86 (6%)
 Frame = +1

Query  451  YYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTC  630
            YYL+TG C +GA C+F+HPRD+  + G +      YP R     C YYMRTG CKFG++C
Sbjct  58   YYLRTGFCGYGARCRFNHPRDRNSVLGAMRATGGEYPERVGQPVCQYYMRTGMCKFGASC  117

Query  631  KFHHPQ-----PSNMMVPLRGSPAYP  693
            K+HHP+     P+ + V + G P  P
Sbjct  118  KYHHPRQGGGSPAPVTVNIYGYPLRP  143


 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 44/66 (67%), Gaps = 0/66 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YY+K G CK+G++C++HHP + +G      L+ +G PLRP    C +Y + G CKFG +
Sbjct  320  QYYMKYGDCKYGSSCRYHHPPEWSGPKTSFILSAMGLPLRPGAPICSHYAQNGVCKFGPS  379

Query  628  CKFHHP  645
            CKF HP
Sbjct  380  CKFDHP  385


 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 21/46 (46%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = +3

Query  315  GTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKV  452
            G YP R G+P C YY+RTG+C+FGASC+++HP     + A   + +
Sbjct  91   GEYPERVGQPVCQYYMRTGMCKFGASCKYHHPRQGGGSPAPVTVNI  136


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 18/30 (60%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHP  410
            YP+R GE +CSYY++TG C+FG +C+F+HP
Sbjct  139  YPLRPGEKECSYYVKTGQCKFGVTCKFHHP  168



>gb|KHN46585.1| Zinc finger CCCH domain-containing protein 32 [Glycine soja]
Length=467

 Score =   116 bits (291),  Expect(2) = 3e-34, Method: Compositional matrix adjust.
 Identities = 52/90 (58%), Positives = 64/90 (71%), Gaps = 0/90 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYLKTG CKFGA+CKF HP++  G   +  LNV GYPLRP + EC YY++TGQCKFG +
Sbjct  100  QYYLKTGTCKFGASCKFRHPKNGGGYLSQAPLNVYGYPLRPGEKECSYYLKTGQCKFGIS  159

Query  628  CKFHHPQPSNMMVPLRGSPAYPPVHSPTTP  717
            CKFHHPQP+   +P   +  Y  V SPT P
Sbjct  160  CKFHHPQPAGTSLPASAAQFYQQVQSPTVP  189


 Score = 56.2 bits (134),  Expect(2) = 3e-34, Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 36/56 (64%), Gaps = 8/56 (14%)
 Frame = +3

Query  243  DTAICTR*ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHP  410
            DTA+    E++W L+L   E+     YP R G P+C YY+RTG+C +G  CR+NHP
Sbjct  27   DTALE---ESMWHLTLGGGES-----YPERSGVPNCVYYMRTGVCGYGGRCRYNHP  74


 Score = 74.7 bits (182),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 43/66 (65%), Gaps = 6/66 (9%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YYL+TG CKFG  C++HHP        R  L+ +G PLRP    C +Y++ G CKFGST
Sbjct  303  QYYLRTGDCKFGLACRYHHP------VARPLLSPVGLPLRPGLQPCAFYLQNGHCKFGST  356

Query  628  CKFHHP  645
            CKF HP
Sbjct  357  CKFDHP  362


 Score = 65.5 bits (158),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 44/66 (67%), Gaps = 1/66 (2%)
 Frame = +1

Query  451  YYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTC  630
            YY++TG C +G  C+++HPRD+A +A         YP R  +  C YY++TG CKFG++C
Sbjct  56   YYMRTGVCGYGGRCRYNHPRDRAAVA-AAVRATGDYPERVGEPPCQYYLKTGTCKFGASC  114

Query  631  KFHHPQ  648
            KF HP+
Sbjct  115  KFRHPK  120


 Score = 59.7 bits (143),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +3

Query  312  SGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAARMKV  452
            +G YP R GEP C YY++TG C+FGASC+F HP N    ++ A + V
Sbjct  87   TGDYPERVGEPPCQYYLKTGTCKFGASCKFRHPKNGGGYLSQAPLNV  133


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKL  425
            YP R GEP+C YY+RTG C+FG +CR++HP  R L
Sbjct  293  YPERPGEPECQYYLRTGDCKFGLACRYHHPVARPL  327


 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +3

Query  321  YPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAA  440
            YP+R GE +CSYY++TG C+FG SC+F+HP     ++ A+
Sbjct  136  YPLRPGEKECSYYLKTGQCKFGISCKFHHPQPAGTSLPAS  175


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 20/39 (51%), Positives = 27/39 (69%), Gaps = 0/39 (0%)
 Frame = +1

Query  556  YPLRPNDIECPYYMRTGQCKFGSTCKFHHPQPSNMMVPL  672
            YP RP + EC YY+RTG CKFG  C++HHP    ++ P+
Sbjct  293  YPERPGEPECQYYLRTGDCKFGLACRYHHPVARPLLSPV  331



>ref|XP_006356701.1| PREDICTED: zinc finger CCCH domain-containing protein 32-like 
isoform X1 [Solanum tuberosum]
 ref|XP_006356702.1| PREDICTED: zinc finger CCCH domain-containing protein 32-like 
isoform X2 [Solanum tuberosum]
Length=397

 Score =   107 bits (268),  Expect(2) = 3e-34, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 57/74 (77%), Gaps = 0/74 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YY++TG CKFGA+CK+HHPR        V  N+ GYPLRPN+ EC +YM+TGQCKFG T
Sbjct  99   QYYMRTGMCKFGASCKYHHPRQGGESPSLVIHNIYGYPLRPNEKECSHYMKTGQCKFGIT  158

Query  628  CKFHHPQPSNMMVP  669
            CKFHHPQP+ + VP
Sbjct  159  CKFHHPQPAGVQVP  172


 Score = 65.1 bits (157),  Expect(2) = 3e-34, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 40/59 (68%), Gaps = 4/59 (7%)
 Frame = +3

Query  267  ETLWQLSLRSMETMESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLAIAAAR  443
            E + QLS+ +    E+G+YP R  EPDC YY+R G+C +G+ CRFNHP +R LA+   R
Sbjct  29   EPMGQLSVGT----EAGSYPERLNEPDCIYYLRNGICGYGSRCRFNHPRDRSLAVGERR  83


 Score = 77.0 bits (188),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 43/66 (65%), Gaps = 0/66 (0%)
 Frame = +1

Query  451  YYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGSTC  630
            YYL+ G C +G+ C+F+HPRD++   G        YP R     C YYMRTG CKFG++C
Sbjct  54   YYLRNGICGYGSRCRFNHPRDRSLAVGERRATGGEYPERAGQFVCQYYMRTGMCKFGASC  113

Query  631  KFHHPQ  648
            K+HHP+
Sbjct  114  KYHHPR  119


 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +3

Query  315  GTYPVRDGEPDCSYYIRTGLCRFGASCRFNHP  410
            G YP R G+  C YY+RTG+C+FGASC+++HP
Sbjct  87   GEYPERAGQFVCQYYMRTGMCKFGASCKYHHP  118



>gb|ABR16930.1| unknown [Picea sitchensis]
Length=554

 Score =   111 bits (278),  Expect(2) = 3e-34, Method: Compositional matrix adjust.
 Identities = 50/93 (54%), Positives = 70/93 (75%), Gaps = 3/93 (3%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            ++Y+KTG CKFGATCK+HHPRD+ G AG+V LN++G P+R  + EC YY+RTG CK+G++
Sbjct  127  QFYMKTGTCKFGATCKYHHPRDRLG-AGQVQLNMIGLPMRMGEKECTYYIRTGYCKYGAS  185

Query  628  CKFHHPQPSNM--MVPLRGSPAYPPVHSPTTPG  720
            CK+ HPQP+ +  +VP+ GSP Y  +  P  P 
Sbjct  186  CKYDHPQPAALGTLVPVSGSPLYATIRPPIAPA  218


 Score = 61.2 bits (147),  Expect(2) = 3e-34, Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 54/89 (61%), Gaps = 7/89 (8%)
 Frame = +3

Query  213  VPTYAVFMSKDTAICTR*ETLWQLSLRSMETME-----SGTYPVRDGEPDCSYYIRTGLC  377
            +P +A   S  +A  +  E++ +++L+  ++       S +YP R G+ DCS+Y+RTG C
Sbjct  33   LPYHAGLNSTKSAAESMKESMRRMTLQPQDSRSRMNGYSESYPERFGQADCSHYMRTGYC  92

Query  378  RFGASCRFNHPSNRKLAIAAARMKVLLED  464
             +G +CRFNHP+N KL   AAR K  L +
Sbjct  93   GYGMNCRFNHPTNMKL--QAARNKGELPE  119


 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 42/66 (64%), Gaps = 0/66 (0%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
            +YY+KTG CKFG  C++HHP ++   +    L+ +G PLRP    C YY   G CKFG T
Sbjct  347  QYYIKTGDCKFGFACRYHHPHERVSQSSTCVLSPIGLPLRPTQPTCTYYSHYGICKFGPT  406

Query  628  CKFHHP  645
            CKF HP
Sbjct  407  CKFDHP  412


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 41/67 (61%), Gaps = 3/67 (4%)
 Frame = +1

Query  448  KYYLKTGACKFGATCKFHHPRDKAGIAGRVALNVLGYPLRPNDIECPYYMRTGQCKFGST  627
             +Y++TG C +G  C+F+HP +    A R   N    P R     C +YM+TG CKFG+T
Sbjct  84   SHYMRTGYCGYGMNCRFNHPTNMKLQAAR---NKGELPERVGHNACQFYMKTGTCKFGAT  140

Query  628  CKFHHPQ  648
            CK+HHP+
Sbjct  141  CKYHHPR  147


 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +3

Query  309  ESGTYPVRDGEPDCSYYIRTGLCRFGASCRFNHPSNR  419
            ++ TYP R G+P+C YYI+TG C+FG +CR++HP  R
Sbjct  333  QTETYPERPGQPECQYYIKTGDCKFGFACRYHHPHER  369


 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  324  PVRDGEPDCSYYIRTGLCRFGASCRFNHPSNRKLA  428
            P+R GE +C+YYIRTG C++GASC+++HP    L 
Sbjct  163  PMRMGEKECTYYIRTGYCKYGASCKYDHPQPAALG  197



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1300407706455