BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF047B21

Length=674
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004239372.1|  PREDICTED: probable serine/threonine-protein...    105   2e-22   Solanum lycopersicum
ref|XP_006357240.1|  PREDICTED: probable serine/threonine-protein...    105   2e-22   Solanum tuberosum [potatoes]
ref|XP_010552604.1|  PREDICTED: probable serine/threonine-protein...    104   5e-22   Tarenaya hassleriana [spider flower]
ref|XP_010551637.1|  PREDICTED: probable serine/threonine-protein...    103   2e-21   Tarenaya hassleriana [spider flower]
ref|XP_007225115.1|  hypothetical protein PRUPE_ppa002671mg           97.1    2e-19   Prunus persica
ref|NP_177149.2|  Protein kinase superfamily protein                  96.7    3e-19   Arabidopsis thaliana [mouse-ear cress]
gb|AAG52555.1|AC010675_3  putative protein kinase; 23181-21271        96.3    3e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008339953.1|  PREDICTED: probable serine/threonine-protein...  95.9    5e-19   
ref|XP_008221705.1|  PREDICTED: probable serine/threonine-protein...  95.5    7e-19   Prunus mume [ume]
gb|KFK41415.1|  hypothetical protein AALP_AA2G128000                  95.1    8e-19   Arabis alpina [alpine rockcress]
ref|XP_011011859.1|  PREDICTED: probable serine/threonine-protein...  94.4    1e-18   Populus euphratica
ref|XP_010272197.1|  PREDICTED: probable serine/threonine-protein...  92.4    7e-18   Nelumbo nucifera [Indian lotus]
ref|XP_008389548.1|  PREDICTED: probable serine/threonine-protein...  92.4    8e-18   Malus domestica [apple tree]
ref|XP_009360415.1|  PREDICTED: probable serine/threonine-protein...  92.0    1e-17   Pyrus x bretschneideri [bai li]
ref|XP_006378174.1|  hypothetical protein POPTR_0010s04470g           91.7    1e-17   Populus trichocarpa [western balsam poplar]
ref|XP_002863111.1|  kinase family protein                            90.5    3e-17   Arabidopsis lyrata subsp. lyrata
ref|XP_002520164.1|  kinase, putative                                 90.1    4e-17   Ricinus communis
ref|XP_004300632.1|  PREDICTED: probable serine/threonine-protein...  90.1    4e-17   Fragaria vesca subsp. vesca
gb|KDO82708.1|  hypothetical protein CISIN_1g045480mg                 87.0    5e-17   Citrus sinensis [apfelsine]
ref|XP_006300627.1|  hypothetical protein CARUB_v10019905mg           89.7    6e-17   
ref|XP_010415660.1|  PREDICTED: probable serine/threonine-protein...  88.2    2e-16   Camelina sativa [gold-of-pleasure]
ref|XP_008446290.1|  PREDICTED: probable serine/threonine-protein...  87.4    3e-16   Cucumis melo [Oriental melon]
ref|XP_004135207.1|  PREDICTED: probable serine/threonine-protein...  87.4    3e-16   Cucumis sativus [cucumbers]
gb|KGN51865.1|  hypothetical protein Csa_5G604100                     87.8    3e-16   Cucumis sativus [cucumbers]
gb|KDP21248.1|  hypothetical protein JCGZ_21719                       88.2    3e-16   Jatropha curcas
ref|XP_007044396.1|  Kinase, putative                                 86.7    6e-16   
ref|XP_006483266.1|  PREDICTED: probable serine/threonine-protein...  86.3    8e-16   Citrus sinensis [apfelsine]
ref|XP_010512057.1|  PREDICTED: probable serine/threonine-protein...  86.3    8e-16   Camelina sativa [gold-of-pleasure]
ref|XP_006438552.1|  hypothetical protein CICLE_v10030927mg           86.3    9e-16   Citrus clementina [clementine]
ref|XP_010470994.1|  PREDICTED: probable serine/threonine-protein...  85.5    2e-15   Camelina sativa [gold-of-pleasure]
ref|XP_003613504.1|  Wall-associated receptor kinase-like protein     85.1    2e-15   
ref|XP_009609054.1|  PREDICTED: probable serine/threonine-protein...  85.1    2e-15   Nicotiana tomentosiformis
ref|XP_010096313.1|  putative serine/threonine-protein kinase         84.7    3e-15   Morus notabilis
emb|CDY48385.1|  BnaA07g24040D                                        84.0    5e-15   Brassica napus [oilseed rape]
ref|XP_009104977.1|  PREDICTED: probable serine/threonine-protein...  83.6    6e-15   Brassica rapa
ref|XP_010683296.1|  PREDICTED: probable serine/threonine-protein...  83.2    8e-15   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009770043.1|  PREDICTED: probable serine/threonine-protein...  83.2    1e-14   Nicotiana sylvestris
emb|CDY23541.1|  BnaC06g25100D                                        82.4    1e-14   Brassica napus [oilseed rape]
ref|XP_011086418.1|  PREDICTED: LOW QUALITY PROTEIN: probable ser...  82.4    2e-14   
ref|XP_002268965.1|  PREDICTED: probable serine/threonine-protein...  81.6    3e-14   Vitis vinifera
ref|XP_006390949.1|  hypothetical protein EUTSA_v10018260mg           81.3    4e-14   Eutrema salsugineum [saltwater cress]
ref|XP_007157572.1|  hypothetical protein PHAVU_002G080400g           77.4    8e-13   Phaseolus vulgaris [French bean]
gb|EPS60026.1|  hypothetical protein M569_14776                       72.8    2e-11   Genlisea aurea
gb|KJB31395.1|  hypothetical protein B456_005G189300                  72.4    3e-11   Gossypium raimondii
ref|XP_004489958.1|  PREDICTED: probable serine/threonine-protein...  69.7    2e-10   Cicer arietinum [garbanzo]
ref|XP_003519780.1|  PREDICTED: probable serine/threonine-protein...  60.8    2e-07   Glycine max [soybeans]
ref|XP_010255997.1|  PREDICTED: probable serine/threonine-protein...  58.9    8e-07   Nelumbo nucifera [Indian lotus]



>ref|XP_004239372.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
[Solanum lycopersicum]
Length=640

 Score =   105 bits (263),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 67/112 (60%), Positives = 78/112 (70%), Gaps = 10/112 (9%)
 Frame = +3

Query  360  GCGHPSFQIHCSSLRFALISINNLSFSLRHYDpastsl-------llspassMYXSRRNC  518
            GCGHPSFQI CS    A+ISINNLSFSL HY+  S++L         +  SS+    +NC
Sbjct  49   GCGHPSFQIQCSP-SHAVISINNLSFSLLHYESTSSTLLLSPASLSQNEISSVSTDSKNC  107

Query  519  SVSVPARSISLSGSPXRVSDSSCSRLSALRPXRTASLPNCSHXPWECKLTKN  674
            S+    RSISLSGSP +VSDSSCSRLSALRP    +LPNCSH PW+CKL KN
Sbjct  108  SLH--HRSISLSGSPFKVSDSSCSRLSALRPCPPTNLPNCSHCPWQCKLIKN  157



>ref|XP_006357240.1| PREDICTED: probable serine/threonine-protein kinase At1g18390-like 
[Solanum tuberosum]
Length=640

 Score =   105 bits (262),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 67/112 (60%), Positives = 78/112 (70%), Gaps = 10/112 (9%)
 Frame = +3

Query  360  GCGHPSFQIHCSSLRFALISINNLSFSLRHYDpastsl-------llspassMYXSRRNC  518
            GCGHPSFQI CS    A+ISINNLSFSL HY+  S++L         +  SS+    +NC
Sbjct  49   GCGHPSFQIQCSP-SHAVISINNLSFSLLHYESTSSTLLLSPASLSQNEISSVSTDFKNC  107

Query  519  SVSVPARSISLSGSPXRVSDSSCSRLSALRPXRTASLPNCSHXPWECKLTKN  674
            S+    RSISLSGSP +VSDSSCSRLSALRP    +LPNCSH PW+CKL KN
Sbjct  108  SLH--HRSISLSGSPFKVSDSSCSRLSALRPCPPTNLPNCSHCPWQCKLIKN  157



>ref|XP_010552604.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
[Tarenaya hassleriana]
Length=643

 Score =   104 bits (260),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 71/111 (64%), Positives = 82/111 (74%), Gaps = 7/111 (6%)
 Frame = +3

Query  360  GCGHPSFQIHCSSLRFALISINNLSFSLRHYDpastslllspass--MYXSRRNCSV---  524
            GCGHP+FQIHC++ R A++ INNLSFSL  YDP ST+LLLSP SS  ++ +R  CS    
Sbjct  53   GCGHPNFQIHCATPR-AVVLINNLSFSLLRYDPQSTTLLLSPVSSPRLHSNRSYCSSHRF  111

Query  525  -SVPARSISLSGSPXRVSDSSCSRLSALRPXRTASLPNCSHXPWECKLTKN  674
             SVP + I LSGSP RVSDSSCSRLS LRP     LPNCSH PW+CKL KN
Sbjct  112  SSVPVQFIDLSGSPFRVSDSSCSRLSLLRPCSPLILPNCSHCPWDCKLLKN  162



>ref|XP_010551637.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
[Tarenaya hassleriana]
Length=661

 Score =   103 bits (256),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 62/111 (56%), Positives = 70/111 (63%), Gaps = 7/111 (6%)
 Frame = +3

Query  360  GCGHPSFQIHCSSLRFALISINNLSFSLRHYDpa--stslllspassMYXSRRNCS----  521
            GCGHP+FQIHC S R A +SINNLSFSL  YD    +  L          +R +CS    
Sbjct  85   GCGHPNFQIHCVSPR-ATVSINNLSFSLLRYDAVSNTLLLSPVSPPPHSPNRSSCSSHRF  143

Query  522  VSVPARSISLSGSPXRVSDSSCSRLSALRPXRTASLPNCSHXPWECKLTKN  674
             SVP R I L+GSP RVSDSSCSRLS LRP     LP CSH PW+CKL +N
Sbjct  144  TSVPDRVIDLTGSPFRVSDSSCSRLSLLRPCSRLILPKCSHCPWDCKLLEN  194



>ref|XP_007225115.1| hypothetical protein PRUPE_ppa002671mg [Prunus persica]
 gb|EMJ26314.1| hypothetical protein PRUPE_ppa002671mg [Prunus persica]
Length=646

 Score = 97.1 bits (240),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 64/115 (56%), Positives = 79/115 (69%), Gaps = 11/115 (10%)
 Frame = +3

Query  360  GCGHPSFQIHCSSLRFALISINNLSFSLRHYDpastsllls------passMYXSRRNCS  521
            GCGHPSFQI C++   + ISINN SFSL  Y+P+S SL+LS       +S    +  NCS
Sbjct  59   GCGHPSFQIKCAAPH-STISINNFSFSLLRYEPSSASLVLSPHITTSTSSLTKSADTNCS  117

Query  522  ----VSVPARSISLSGSPXRVSDSSCSRLSALRPXRTASLPNCSHXPWECKLTKN  674
                +S+P RSI+LS SP R+SD+SCSRLS L+P    +LPNCSH PWECKL KN
Sbjct  118  FPHFLSIPDRSINLSASPFRISDASCSRLSVLKPCSPPTLPNCSHCPWECKLIKN  172



>ref|NP_177149.2| Protein kinase superfamily protein [Arabidopsis thaliana]
 gb|AEE34997.1| Protein kinase superfamily protein [Arabidopsis thaliana]
Length=636

 Score = 96.7 bits (239),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 64/109 (59%), Positives = 75/109 (69%), Gaps = 5/109 (5%)
 Frame = +3

Query  360  GCGHPSFQIHCSSLRFALISINNLSFSLRHYDpastslllspassMYXSRRNCSV----S  527
            GCGHP+FQI CSS R A I+I NL+FS+ HY   S+SL LSP ++   +  NCS     S
Sbjct  52   GCGHPNFQIQCSSSR-ATITIKNLTFSILHYSSISSSLTLSPITNTNRNTNNCSSLRFSS  110

Query  528  VPARSISLSGSPXRVSDSSCSRLSALRPXRTASLPNCSHXPWECKLTKN  674
             P R I L+GSP RVSDSSCSRLS LRP    +LPNCS  PW+CKL KN
Sbjct  111  SPNRFIDLTGSPFRVSDSSCSRLSLLRPCSPFTLPNCSRCPWDCKLLKN  159



>gb|AAG52555.1|AC010675_3 putative protein kinase; 23181-21271 [Arabidopsis thaliana]
Length=625

 Score = 96.3 bits (238),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 64/109 (59%), Positives = 75/109 (69%), Gaps = 5/109 (5%)
 Frame = +3

Query  360  GCGHPSFQIHCSSLRFALISINNLSFSLRHYDpastslllspassMYXSRRNCSV----S  527
            GCGHP+FQI CSS R A I+I NL+FS+ HY   S+SL LSP ++   +  NCS     S
Sbjct  52   GCGHPNFQIQCSSSR-ATITIKNLTFSILHYSSISSSLTLSPITNTNRNTNNCSSLRFSS  110

Query  528  VPARSISLSGSPXRVSDSSCSRLSALRPXRTASLPNCSHXPWECKLTKN  674
             P R I L+GSP RVSDSSCSRLS LRP    +LPNCS  PW+CKL KN
Sbjct  111  SPNRFIDLTGSPFRVSDSSCSRLSLLRPCSPFTLPNCSRCPWDCKLLKN  159



>ref|XP_008339953.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
isoform X1 [Malus domestica]
 ref|XP_008339954.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
isoform X2 [Malus domestica]
Length=719

 Score = 95.9 bits (237),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 62/109 (57%), Positives = 81/109 (74%), Gaps = 6/109 (6%)
 Frame = +3

Query  360  GCGHPSFQIHCSSLRFALISINNLSFSLRHYDpastslllspassMYXSRRNCSVS----  527
            GCGHPSFQI CS+   + ISINNLSFSL  YDP ++S LLSP ++   +  NCS S    
Sbjct  138  GCGHPSFQIKCSAPH-STISINNLSFSLISYDPIASSJLLSPHTTN-STVTNCSSSNYPS  195

Query  528  VPARSISLSGSPXRVSDSSCSRLSALRPXRTASLPNCSHXPWECKLTKN  674
            +P+RSI++S +P R+SD+SCSRLS L+P  + +LPNCSH PW+CKL K+
Sbjct  196  IPSRSINISATPFRISDASCSRLSVLKPCFSPNLPNCSHCPWDCKLIKH  244



>ref|XP_008221705.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
[Prunus mume]
Length=647

 Score = 95.5 bits (236),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 62/115 (54%), Positives = 76/115 (66%), Gaps = 11/115 (10%)
 Frame = +3

Query  360  GCGHPSFQIHCSSLRFALISINNLSFSLRHYDpasts------lllspassMYXSRRNCS  521
            GCGHP FQI CS+   + I+INN SFSL  Y+P STS      +  S +S    +  NCS
Sbjct  60   GCGHPFFQIKCSAPH-STITINNFSFSLLRYEPNSTSLVLSPHITNSTSSLTKSADTNCS  118

Query  522  ----VSVPARSISLSGSPXRVSDSSCSRLSALRPXRTASLPNCSHXPWECKLTKN  674
                +S+P RSI+LS SP R+SD+SCSRLS L+P    +LPNCSH PWECKL KN
Sbjct  119  FPHFLSIPDRSINLSASPFRISDASCSRLSVLKPCSPPTLPNCSHCPWECKLIKN  173



>gb|KFK41415.1| hypothetical protein AALP_AA2G128000 [Arabis alpina]
Length=627

 Score = 95.1 bits (235),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 63/105 (60%), Positives = 72/105 (69%), Gaps = 2/105 (2%)
 Frame = +3

Query  360  GCGHPSFQIHCSSLRFALISINNLSFSLRHYDpastslllspassMYXSRRNCSVSVPAR  539
            GCGHP+FQI CS L  A ISI NLSFSL HY+  S+SL LSP  +      NCS    + 
Sbjct  59   GCGHPNFQIQCS-LPKATISIKNLSFSLLHYNSLSSSLFLSPILNP-NHNNNCSSLRLSH  116

Query  540  SISLSGSPXRVSDSSCSRLSALRPXRTASLPNCSHXPWECKLTKN  674
            SI L+G+P R+SDSSCSRLS LRP     LPNCSH PW+CKL KN
Sbjct  117  SIDLTGTPFRISDSSCSRLSLLRPCSPLLLPNCSHCPWDCKLLKN  161



>ref|XP_011011859.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
[Populus euphratica]
Length=636

 Score = 94.4 bits (233),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 67/114 (59%), Positives = 76/114 (67%), Gaps = 10/114 (9%)
 Frame = +3

Query  360  GCGHPSFQIHCSSLRFALISINNLSFSLRHYDpastslllspassMYXSRRNCS------  521
            GCGHP FQ+ CSS   ++ISINNLSF+L H+DP S+SLLLSP  S   S           
Sbjct  65   GCGHPFFQLKCSSPH-SIISINNLSFALLHFDPNSSSLLLSPQLSSLTSSTTIRPAATCF  123

Query  522  ---VSVPARSISLSGSPXRVSDSSCSRLSALRPXRTASLPNCSHXPWECKLTKN  674
                S+PA SI+LSGSP RVSDS CSRLS LR     +LPNCSH PWECKL KN
Sbjct  124  SDLSSIPAHSINLSGSPFRVSDSYCSRLSVLRSCSPPNLPNCSHCPWECKLVKN  177



>ref|XP_010272197.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
[Nelumbo nucifera]
Length=639

 Score = 92.4 bits (228),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 62/106 (58%), Positives = 76/106 (72%), Gaps = 3/106 (3%)
 Frame = +3

Query  360  GCGHPSFQIHCSSLRFALISINNLSFSLRHYDpastslllspassMYX-SRRNC-SVSVP  533
            GCGHPSFQI CSS R + ISINN SF L  +DP S++L+LSP S +   + R+C S S+P
Sbjct  59   GCGHPSFQILCSSNR-SFISINNFSFVLLRHDPNSSTLVLSPQSYVSDPTHRSCPSASLP  117

Query  534  ARSISLSGSPXRVSDSSCSRLSALRPXRTASLPNCSHXPWECKLTK  671
             R+I LSGSP R SD+ C+RLS LR    +SLPNCS  PW+CKL K
Sbjct  118  DRAIDLSGSPFRFSDAPCARLSVLRQCNISSLPNCSRCPWDCKLLK  163



>ref|XP_008389548.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
[Malus domestica]
Length=636

 Score = 92.4 bits (228),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 64/109 (59%), Positives = 78/109 (72%), Gaps = 6/109 (6%)
 Frame = +3

Query  360  GCGHPSFQIHCSSLRFALISINNLSFSLRHYDpastslllspassMYXSRRNCSVSVPA-  536
            GCGHPSFQI CS+   + ISINNLSFSL  YD  ++SLLLSP S+   +  NCS S  + 
Sbjct  55   GCGHPSFQIQCSAPH-STISINNLSFSLISYDANASSLLLSPHSTNLTAT-NCSSSHYSS  112

Query  537  ---RSISLSGSPXRVSDSSCSRLSALRPXRTASLPNCSHXPWECKLTKN  674
               RSI++S SP R+SD+SCSRLS L+P    +LPNCSH PWECKL K+
Sbjct  113  IPSRSINISASPFRISDASCSRLSVLKPCSPPNLPNCSHCPWECKLIKD  161



>ref|XP_009360415.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
[Pyrus x bretschneideri]
Length=636

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 62/109 (57%), Positives = 78/109 (72%), Gaps = 6/109 (6%)
 Frame = +3

Query  360  GCGHPSFQIHCSSLRFALISINNLSFSLRHYDpastslllspassMYXSRRNCSVSVPA-  536
            GCGHPSFQI CS+   ++ISINNL+FSL  YD  ++SLLLSP ++   +  NCS S  + 
Sbjct  55   GCGHPSFQIQCSAPH-SIISINNLTFSLISYDANASSLLLSPHTTNLTAT-NCSSSHYSS  112

Query  537  ---RSISLSGSPXRVSDSSCSRLSALRPXRTASLPNCSHXPWECKLTKN  674
               RSI++S SP R+SD SCSRLS L+P    +LPNCSH PWECKL K+
Sbjct  113  IPSRSINISASPFRISDGSCSRLSVLKPCSPPNLPNCSHCPWECKLIKD  161



>ref|XP_006378174.1| hypothetical protein POPTR_0010s04470g [Populus trichocarpa]
 gb|ERP55971.1| hypothetical protein POPTR_0010s04470g [Populus trichocarpa]
Length=637

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 66/114 (58%), Positives = 75/114 (66%), Gaps = 10/114 (9%)
 Frame = +3

Query  360  GCGHPSFQIHCSSLRFALISINNLSFSLRHYDpastslllspassMYXSRRNCS------  521
            GCGHP FQ+ CSS   ++ISINNLSF+L H+DP S+SLLLSP  S   S           
Sbjct  65   GCGHPFFQLKCSSPH-SIISINNLSFALLHFDPNSSSLLLSPQLSSLTSSTTIRPAATCF  123

Query  522  ---VSVPARSISLSGSPXRVSDSSCSRLSALRPXRTASLPNCSHXPWECKLTKN  674
                S+PA SI+LS SP RVSDS CSRLS LR     +LPNCSH PWECKL KN
Sbjct  124  SDLSSIPAHSINLSSSPFRVSDSYCSRLSVLRSCSPPNLPNCSHCPWECKLVKN  177



>ref|XP_002863111.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH39370.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
Length=633

 Score = 90.5 bits (223),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 64/109 (59%), Positives = 75/109 (69%), Gaps = 5/109 (5%)
 Frame = +3

Query  360  GCGHPSFQIHCSSLRFALISINNLSFSLRHYDpastslllspassMYXSRRNCSV----S  527
            GCGHP+FQI CSS R A I+I NL+FS+ HY   S+SL LSP ++   +  NCS     S
Sbjct  50   GCGHPNFQIQCSSSR-ATITIKNLTFSILHYSSLSSSLTLSPITNSTRTNNNCSSARFSS  108

Query  528  VPARSISLSGSPXRVSDSSCSRLSALRPXRTASLPNCSHXPWECKLTKN  674
             P R I L+GSP RVSDSSCSRLS LRP    +LPNCS  PW+CKL KN
Sbjct  109  SPNRFIDLTGSPFRVSDSSCSRLSLLRPCSPLTLPNCSRCPWDCKLLKN  157



>ref|XP_002520164.1| kinase, putative [Ricinus communis]
 gb|EEF42219.1| kinase, putative [Ricinus communis]
Length=641

 Score = 90.1 bits (222),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 60/113 (53%), Positives = 76/113 (67%), Gaps = 9/113 (8%)
 Frame = +3

Query  360  GCGHPSFQIHCSSLRFALISINNLSFSLRHYDpastslllspassMYXSRR-------NC  518
            GCGHPSFQ+ CSS  +++ISINN+SFSL  ++P S+SL LSP    + +         NC
Sbjct  51   GCGHPSFQLKCSS-PYSIISINNVSFSLLSFEPNSSSLTLSPQPHSFTTTATTTHTRTNC  109

Query  519  S-VSVPARSISLSGSPXRVSDSSCSRLSALRPXRTASLPNCSHXPWECKLTKN  674
            S  S+P  SI LSGSP + S+S CSRLS +R     +LPNCSH PWEC+L KN
Sbjct  110  SAFSIPTHSIDLSGSPFKFSESDCSRLSVVRSCSVPNLPNCSHCPWECRLIKN  162



>ref|XP_004300632.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
[Fragaria vesca subsp. vesca]
Length=621

 Score = 90.1 bits (222),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 62/109 (57%), Positives = 76/109 (70%), Gaps = 6/109 (6%)
 Frame = +3

Query  360  GCGHPSFQIHCSSLRFALISINNLSFSLRHYDpastsllls-passMYXSRRNCS----V  524
             CGHPSFQ+ CSS   +LISINNL+FS+  Y+P STSLLLS   ++   +  NCS    +
Sbjct  49   ACGHPSFQLKCSS-NHSLISINNLTFSILRYEPNSTSLLLSPHFTNSTLTPSNCSYPHFL  107

Query  525  SVPARSISLSGSPXRVSDSSCSRLSALRPXRTASLPNCSHXPWECKLTK  671
            S+P RSI+LS SP R SD SC+RLS L P    +LPNCSH PWECKL +
Sbjct  108  SIPTRSINLSSSPFRFSDGSCNRLSVLEPCSPPNLPNCSHCPWECKLIQ  156



>gb|KDO82708.1| hypothetical protein CISIN_1g045480mg, partial [Citrus sinensis]
Length=254

 Score = 87.0 bits (214),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 61/112 (54%), Positives = 75/112 (67%), Gaps = 8/112 (7%)
 Frame = +3

Query  360  GCGHPSFQIHCSSLRFALISINNLSFSLRHYDpastslllspassMYXSRRNCSV-----  524
            GCGHPSFQI CSS   ++ISIN+L+FS+ H++P STSL+LSP         NCS      
Sbjct  62   GCGHPSFQIRCSSPH-SVISINHLNFSILHFEPNSTSLILSPHYPNAKPNPNCSSSSSSD  120

Query  525  --SVPARSISLSGSPXRVSDSSCSRLSALRPXRTASLPNCSHXPWECKLTKN  674
              ++P  SI+ SG+P R SDSSCSRLS LRP    +LPNCS   WEC+L KN
Sbjct  121  LSTLPNHSINFSGTPFRASDSSCSRLSLLRPCSPPNLPNCSRCLWECRLIKN  172



>ref|XP_006300627.1| hypothetical protein CARUB_v10019905mg, partial [Capsella rubella]
 gb|EOA33525.1| hypothetical protein CARUB_v10019905mg, partial [Capsella rubella]
Length=674

 Score = 89.7 bits (221),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 61/111 (55%), Positives = 74/111 (67%), Gaps = 7/111 (6%)
 Frame = +3

Query  360  GCGHPSFQIHCSSLRFALISINNLSFSLRHYDpastslllspassMYXSRRNCSV-----  524
            GCGHP+FQI CS+ R + I+I NL+FS+ HY   S+SL LSP ++   +  N S      
Sbjct  90   GCGHPNFQIQCSAPR-STITIKNLTFSILHYSFLSSSLTLSPIANSNRNNNNNSCSALRF  148

Query  525  -SVPARSISLSGSPXRVSDSSCSRLSALRPXRTASLPNCSHXPWECKLTKN  674
             S P R I L+GSP RVSDSSCSRLS LRP    +LPNCS  PW+CKL KN
Sbjct  149  SSSPNRFIDLTGSPFRVSDSSCSRLSLLRPCSPLTLPNCSRCPWDCKLLKN  199



>ref|XP_010415660.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
[Camelina sativa]
Length=641

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 65/109 (60%), Positives = 76/109 (70%), Gaps = 6/109 (6%)
 Frame = +3

Query  360  GCGHPSFQIHCSSLRFALISINNLSFSLRHYDpastslllspassMYXSRRNCSV----S  527
            GCGHP+FQI CSS R A I+I NL+FS+ HY   S+SL LSP ++ Y +  NCS     S
Sbjct  58   GCGHPNFQIQCSSPR-ATITIKNLTFSILHYSSLSSSLTLSPITNSYRNP-NCSSLRFSS  115

Query  528  VPARSISLSGSPXRVSDSSCSRLSALRPXRTASLPNCSHXPWECKLTKN  674
             P R I L+GSP RVSDSSCSRLS LRP    +LPNCS  PW+CKL KN
Sbjct  116  SPNRFIDLTGSPFRVSDSSCSRLSLLRPCSPLTLPNCSRCPWDCKLLKN  164



>ref|XP_008446290.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
[Cucumis melo]
Length=622

 Score = 87.4 bits (215),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 63/114 (55%), Positives = 72/114 (63%), Gaps = 10/114 (9%)
 Frame = +3

Query  360  GCGHPSFQIHCSSLRFALISINNLSFSLRHYDpastslllspassMY-----XSRRNC--  518
            G GHPSFQ+HCSS   +LISIN LSFSL  ++ +ST+LLLSP           S  +C  
Sbjct  42   GHGHPSFQVHCSSPH-SLISINGLSFSLLSFNISSTTLLLSPLPLNLTPTPKQSNHSCFS  100

Query  519  --SVSVPARSISLSGSPXRVSDSSCSRLSALRPXRTASLPNCSHXPWECKLTKN  674
              S S+P RSI  SGSP R+SD  CSRLS LRP     LPNCSH PWEC L K 
Sbjct  101  LRSSSIPTRSIDFSGSPFRISDGYCSRLSLLRPCSPPHLPNCSHCPWECNLIKK  154



>ref|XP_004135207.1| PREDICTED: probable serine/threonine-protein kinase At1g18390-like 
[Cucumis sativus]
 ref|XP_004155330.1| PREDICTED: probable serine/threonine-protein kinase At1g18390-like 
[Cucumis sativus]
Length=622

 Score = 87.4 bits (215),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 63/114 (55%), Positives = 72/114 (63%), Gaps = 10/114 (9%)
 Frame = +3

Query  360  GCGHPSFQIHCSSLRFALISINNLSFSLRHYDpastslllspassMY-----XSRRNC--  518
            G GHPSFQ+HCSS   +LISIN LSFSL  ++ +ST+LLLSP           S  +C  
Sbjct  42   GHGHPSFQVHCSSPH-SLISINGLSFSLLSFNISSTTLLLSPLPLNLTPTPKQSNHSCFS  100

Query  519  --SVSVPARSISLSGSPXRVSDSSCSRLSALRPXRTASLPNCSHXPWECKLTKN  674
              S S+P RSI  SGSP R+SD  CSRLS LRP     LPNCSH PWEC L K 
Sbjct  101  LRSSSIPTRSIDFSGSPFRISDGYCSRLSLLRPCSPPHLPNCSHCPWECNLIKK  154



>gb|KGN51865.1| hypothetical protein Csa_5G604100 [Cucumis sativus]
Length=652

 Score = 87.8 bits (216),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 63/114 (55%), Positives = 72/114 (63%), Gaps = 10/114 (9%)
 Frame = +3

Query  360  GCGHPSFQIHCSSLRFALISINNLSFSLRHYDpastslllspassMY-----XSRRNC--  518
            G GHPSFQ+HCSS   +LISIN LSFSL  ++ +ST+LLLSP           S  +C  
Sbjct  42   GHGHPSFQVHCSSPH-SLISINGLSFSLLSFNISSTTLLLSPLPLNLTPTPKQSNHSCFS  100

Query  519  --SVSVPARSISLSGSPXRVSDSSCSRLSALRPXRTASLPNCSHXPWECKLTKN  674
              S S+P RSI  SGSP R+SD  CSRLS LRP     LPNCSH PWEC L K 
Sbjct  101  LRSSSIPTRSIDFSGSPFRISDGYCSRLSLLRPCSPPHLPNCSHCPWECNLIKK  154



>gb|KDP21248.1| hypothetical protein JCGZ_21719 [Jatropha curcas]
Length=1258

 Score = 88.2 bits (217),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 61/112 (54%), Positives = 77/112 (69%), Gaps = 8/112 (7%)
 Frame = +3

Query  360  GCGHPSFQIHCSSLRFALISINNLSFSLRHYDpastslllspas------sMYXSRRNCS  521
            GCGHPSFQ+ CS L ++ ISIN+ SFS+  ++P S+SL LSP +      +   +  NCS
Sbjct  59   GCGHPSFQLKCS-LPYSTISINDFSFSVIEFEPNSSSLTLSPQTHHSFTSTETTTNSNCS  117

Query  522  -VSVPARSISLSGSPXRVSDSSCSRLSALRPXRTASLPNCSHXPWECKLTKN  674
             +S+P RSI+LSGSP R SDS CSRLS +R     +LPNCSH  WECKL KN
Sbjct  118  SLSIPTRSINLSGSPFRFSDSDCSRLSVVRSCSPLNLPNCSHCSWECKLIKN  169


 Score = 88.2 bits (217),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 61/112 (54%), Positives = 77/112 (69%), Gaps = 8/112 (7%)
 Frame = +3

Query  360  GCGHPSFQIHCSSLRFALISINNLSFSLRHYDpastslllspas------sMYXSRRNCS  521
            GCGHPSFQ+ CS L ++ ISIN+ SFS+  ++P S+SL LSP +      +   +  NCS
Sbjct  672  GCGHPSFQLKCS-LPYSTISINDFSFSVIEFEPNSSSLTLSPQTHHSFTSTETTTNSNCS  730

Query  522  -VSVPARSISLSGSPXRVSDSSCSRLSALRPXRTASLPNCSHXPWECKLTKN  674
             +S+P RSI+LSGSP R SDS CSRLS +R     +LPNCSH  WECKL KN
Sbjct  731  SLSIPTRSINLSGSPFRFSDSDCSRLSVVRSCSPLNLPNCSHCSWECKLIKN  782



>ref|XP_007044396.1| Kinase, putative [Theobroma cacao]
 gb|EOY00228.1| Kinase, putative [Theobroma cacao]
Length=632

 Score = 86.7 bits (213),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 61/109 (56%), Positives = 70/109 (64%), Gaps = 6/109 (6%)
 Frame = +3

Query  360  GCGHPSFQIHCSSLRFALISINNLSFSLRHYDpastslllspassMYXSRRNCS----VS  527
            GCGHPSF I CS+  ++ ISINN SF+L  Y+P STSL LSP       R NCS    +S
Sbjct  61   GCGHPSFHIKCST-PYSTISINNFSFALLRYEPNSTSLTLSPQPPT-KPRSNCSSFHFLS  118

Query  528  VPARSISLSGSPXRVSDSSCSRLSALRPXRTASLPNCSHXPWECKLTKN  674
            +   SI LSGSP R+SD SCSRLS L      +LPNCS  PWEC L KN
Sbjct  119  ISTHSIDLSGSPFRISDGSCSRLSVLHSCSPPNLPNCSQCPWECGLIKN  167



>ref|XP_006483266.1| PREDICTED: probable serine/threonine-protein kinase At1g18390-like 
[Citrus sinensis]
Length=649

 Score = 86.3 bits (212),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 61/111 (55%), Positives = 75/111 (68%), Gaps = 7/111 (6%)
 Frame = +3

Query  360  GCGHPSFQIHCSSLRFALISINNLSFSLRHYDpastslllspassMYXSRRNCSV-----  524
            GCGHPSFQI CSS   ++ISIN+L+FS+ H++P STSL+LSP         NCS      
Sbjct  62   GCGHPSFQIRCSSPH-SVISINHLNFSILHFEPNSTSLILSPHYPNANPNPNCSSSSSDL  120

Query  525  -SVPARSISLSGSPXRVSDSSCSRLSALRPXRTASLPNCSHXPWECKLTKN  674
             ++P  SI+ SG+P R SDSSCSRLS LRP    +LPNCS   WEC+L KN
Sbjct  121  STLPNHSINFSGTPFRASDSSCSRLSLLRPCSPPNLPNCSRCLWECRLIKN  171



>ref|XP_010512057.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
[Camelina sativa]
Length=637

 Score = 86.3 bits (212),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 60/111 (54%), Positives = 69/111 (62%), Gaps = 10/111 (9%)
 Frame = +3

Query  360  GCGHPSFQIHCSSLRFALISINNLSFSLRHYDpastslllspassMYXSRR--NCSV---  524
            GCGHP+FQI CSS R A I+I NL+FS+      S+       S +  S R  NCS    
Sbjct  56   GCGHPNFQIQCSSPR-ATITIKNLTFSIL---HYSSLSSSLTLSPITNSNRTSNCSSLRF  111

Query  525  -SVPARSISLSGSPXRVSDSSCSRLSALRPXRTASLPNCSHXPWECKLTKN  674
             S P R I L+GSP RVSDSSCSRLS LRP    +LPNCS  PW+CKL KN
Sbjct  112  SSSPNRFIDLTGSPFRVSDSSCSRLSLLRPCSPLTLPNCSRCPWDCKLLKN  162



>ref|XP_006438552.1| hypothetical protein CICLE_v10030927mg [Citrus clementina]
 gb|ESR51792.1| hypothetical protein CICLE_v10030927mg [Citrus clementina]
Length=649

 Score = 86.3 bits (212),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 61/111 (55%), Positives = 75/111 (68%), Gaps = 7/111 (6%)
 Frame = +3

Query  360  GCGHPSFQIHCSSLRFALISINNLSFSLRHYDpastslllspassMYXSRRNCSV-----  524
            GCGHPSFQI CSS   ++ISIN+L+FS+ H++P STSL+LSP         NCS      
Sbjct  62   GCGHPSFQIRCSSPH-SVISINHLNFSILHFEPNSTSLILSPHYPNANPNPNCSSSSSDL  120

Query  525  -SVPARSISLSGSPXRVSDSSCSRLSALRPXRTASLPNCSHXPWECKLTKN  674
             ++P  SI+ SG+P R SDSSCSRLS LRP    +LPNCS   WEC+L KN
Sbjct  121  STLPNHSINFSGTPFRASDSSCSRLSLLRPCSPPNLPNCSRCLWECRLIKN  171



>ref|XP_010470994.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
[Camelina sativa]
Length=648

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 59/111 (53%), Positives = 69/111 (62%), Gaps = 10/111 (9%)
 Frame = +3

Query  360  GCGHPSFQIHCSSLRFALISINNLSFSLRHYDpastslllspassMYXSRR--NCSV---  524
            GCGHP+FQI C+S R A I+I NL+FS+      S+       S +  S R  NCS    
Sbjct  65   GCGHPNFQIQCASPR-ATITIKNLTFSIL---HYSSLSSSLTLSPITNSNRTSNCSSLRF  120

Query  525  -SVPARSISLSGSPXRVSDSSCSRLSALRPXRTASLPNCSHXPWECKLTKN  674
             S P R I L+GSP RVSDSSCSRLS LRP    +LPNCS  PW+CKL KN
Sbjct  121  SSSPNRFIDLTGSPFRVSDSSCSRLSLLRPCSPLTLPNCSRCPWDCKLLKN  171



>ref|XP_003613504.1| Wall-associated receptor kinase-like protein [Medicago truncatula]
 gb|AES96462.1| tyrosine kinase family protein [Medicago truncatula]
Length=630

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 54/109 (50%), Positives = 74/109 (68%), Gaps = 5/109 (5%)
 Frame = +3

Query  360  GCGHPSFQIHCSSLRFALISINNLSFSLRHYDpastslllspassMYXSRRNC----SVS  527
            GCGHPSFQ+ CS+   + I+INNL+FS+  Y P STS++LSP + +     N     + S
Sbjct  51   GCGHPSFQLTCSTPH-SFITINNLTFSILSYKPNSTSIILSPHNPISQQNNNTKCPTTSS  109

Query  528  VPARSISLSGSPXRVSDSSCSRLSALRPXRTASLPNCSHXPWECKLTKN  674
            +P + I+LS +P  +SD +CSRLS L+P    +LPNCSH PW+CKL KN
Sbjct  110  IPNKPINLSNTPFTLSDETCSRLSFLQPCSPPNLPNCSHCPWQCKLIKN  158



>ref|XP_009609054.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
[Nicotiana tomentosiformis]
Length=635

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 67/105 (64%), Positives = 77/105 (73%), Gaps = 7/105 (7%)
 Frame = +3

Query  360  GCGHPSFQIHCSSLRFALISINNLSFSLRHYDpastslllspassMYXSRRNCSVSVPAR  539
            GCGHPSFQI CS    A+ISINN +FSL HY+  S++LLLSP  S +    NCS S   R
Sbjct  54   GCGHPSFQIQCSP-SHAIISINNFTFSLLHYELNSSTLLLSPQESDF---NNCSFS---R  106

Query  540  SISLSGSPXRVSDSSCSRLSALRPXRTASLPNCSHXPWECKLTKN  674
            SISLSGSP +VSDSSCSRLSAL+P    +LPNCSH P +CKL KN
Sbjct  107  SISLSGSPFKVSDSSCSRLSALKPCPPPNLPNCSHCPMQCKLIKN  151



>ref|XP_010096313.1| putative serine/threonine-protein kinase [Morus notabilis]
 gb|EXB63788.1| putative serine/threonine-protein kinase [Morus notabilis]
Length=635

 Score = 84.7 bits (208),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 60/108 (56%), Positives = 74/108 (69%), Gaps = 8/108 (7%)
 Frame = +3

Query  360  GCGHPSFQIHCSSLRFALISINNLSFSLRHYDpastslllspassMYXSRRNCS----VS  527
            GCGHP+FQ+ CS+   + ISIN+LSFS+  Y+P S+SLLLSP  S       CS    VS
Sbjct  54   GCGHPAFQVKCSTPH-STISINDLSFSVLSYEPNSSSLLLSPNPS---DPETCSSLRFVS  109

Query  528  VPARSISLSGSPXRVSDSSCSRLSALRPXRTASLPNCSHXPWECKLTK  671
            +P R I+L+GSP RVS++ CSRLS LR      LPNCSH PW+CKL K
Sbjct  110  IPRRPINLTGSPFRVSEAYCSRLSVLRSCSPPVLPNCSHCPWQCKLVK  157



>emb|CDY48385.1| BnaA07g24040D [Brassica napus]
Length=599

 Score = 84.0 bits (206),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 61/109 (56%), Positives = 71/109 (65%), Gaps = 7/109 (6%)
 Frame = +3

Query  360  GCGHPSFQIHCSSLRFALISINNLSFSLRHYDpastslllspassMYXSRRNCSV----S  527
            GCGHP FQI CSS R A ISI NL+FSL H   +S S  L+ +  +  ++ NCS     S
Sbjct  54   GCGHPHFQIQCSSPR-ATISIKNLTFSLLH--YSSLSSSLTLSPQLDSNQNNCSSLRFSS  110

Query  528  VPARSISLSGSPXRVSDSSCSRLSALRPXRTASLPNCSHXPWECKLTKN  674
             P R I L+GSP RVSDSSCSRLS LRP    +LPNCS  P +CKL KN
Sbjct  111  SPNRFIDLTGSPFRVSDSSCSRLSLLRPCSPLTLPNCSRCPQDCKLLKN  159



>ref|XP_009104977.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
[Brassica rapa]
Length=622

 Score = 83.6 bits (205),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 61/109 (56%), Positives = 71/109 (65%), Gaps = 7/109 (6%)
 Frame = +3

Query  360  GCGHPSFQIHCSSLRFALISINNLSFSLRHYDpastslllspassMYXSRRNCSV----S  527
            GCGHP FQI CSS R A ISI NL+FSL H   +S S  L+ +  +  ++ NCS     S
Sbjct  54   GCGHPHFQIQCSSPR-ATISIKNLTFSLLH--YSSLSSSLTLSPQLDSNQNNCSSLRFSS  110

Query  528  VPARSISLSGSPXRVSDSSCSRLSALRPXRTASLPNCSHXPWECKLTKN  674
             P R I L+GSP RVSDSSCSRLS LRP    +LPNCS  P +CKL KN
Sbjct  111  SPNRFIDLTGSPFRVSDSSCSRLSLLRPCSPLTLPNCSRCPQDCKLLKN  159



>ref|XP_010683296.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
[Beta vulgaris subsp. vulgaris]
Length=644

 Score = 83.2 bits (204),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 62/118 (53%), Positives = 76/118 (64%), Gaps = 14/118 (12%)
 Frame = +3

Query  360  GCGHPSFQIHCSSLRFALISINNLSFSLRHYDpastslllspassMYXSRRNCSV-----  524
            GCGHPSF++HCSS  F+L+ INNLSFSL HYDP  +SLLLSP S    S ++ S      
Sbjct  49   GCGHPSFKLHCSS-TFSLLKINNLSFSLLHYDPIFSSLLLSPISLSSISNKSKSKSKSCP  107

Query  525  ------SVPARSISLSGSPXRVSDSSCSRLSALRP--XRTASLPNCSHXPWECKLTKN  674
                  S+P+  I+LS +P ++SDSSCSR S L+P    T SLPNCS   W C L KN
Sbjct  108  SISHFPSIPSHPINLSNTPFKISDSSCSRFSLLKPCSGPTLSLPNCSICSWHCSLVKN  165



>ref|XP_009770043.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
[Nicotiana sylvestris]
Length=634

 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 64/105 (61%), Positives = 77/105 (73%), Gaps = 7/105 (7%)
 Frame = +3

Query  360  GCGHPSFQIHCSSLRFALISINNLSFSLRHYDpastslllspassMYXSRRNCSVSVPAR  539
            GCGHPSFQI CS    ALIS+NN +FSL H++  S++LLLSP  S +   +NCS S   R
Sbjct  51   GCGHPSFQIQCSP-SHALISVNNFNFSLLHFELNSSTLLLSPQESEF---KNCSFS---R  103

Query  540  SISLSGSPXRVSDSSCSRLSALRPXRTASLPNCSHXPWECKLTKN  674
            SIS+SGSP +VSDSSCSRLS L+P    +LPNCSH P +CKL KN
Sbjct  104  SISISGSPFKVSDSSCSRLSVLKPCPPPNLPNCSHCPMQCKLIKN  148



>emb|CDY23541.1| BnaC06g25100D [Brassica napus]
Length=599

 Score = 82.4 bits (202),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 59/109 (54%), Positives = 71/109 (65%), Gaps = 7/109 (6%)
 Frame = +3

Query  360  GCGHPSFQIHCSSLRFALISINNLSFSLRHYDpastslllspassMYXSRRNCSV----S  527
            GCGHP FQI CSS R A IS+ NL+FSL H   +S S  L+ +  +  ++ NCS     S
Sbjct  56   GCGHPHFQIQCSSPR-ATISVKNLTFSLLH--YSSLSSSLTLSPQLGSNQNNCSSLRFSS  112

Query  528  VPARSISLSGSPXRVSDSSCSRLSALRPXRTASLPNCSHXPWECKLTKN  674
             P R I L+GSP RVSDSSCSRLS LRP    +LPNCS  P +CK+ KN
Sbjct  113  SPNRFIDLTGSPFRVSDSSCSRLSLLRPCSPLTLPNCSRCPQDCKVVKN  161



>ref|XP_011086418.1| PREDICTED: LOW QUALITY PROTEIN: probable serine/threonine-protein 
kinase At1g18390 [Sesamum indicum]
Length=648

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 56/109 (51%), Positives = 61/109 (56%), Gaps = 11/109 (10%)
 Frame = +3

Query  360  GCGHPSFQIHCSSLRFALISINNLSFSLRHYDpastslllspassMYXSRRNCS----VS  527
            GCGHPSFQ+HC     A I INNLS       P           +     RNC+    +S
Sbjct  63   GCGHPSFQVHCLPSSGATIYINNLS-------PPPLPPTPPQPLAPPPHYRNCTSTSILS  115

Query  528  VPARSISLSGSPXRVSDSSCSRLSALRPXRTASLPNCSHXPWECKLTKN  674
               RSIS SGSP RVSDSSCSRLS LRP    +LPNCS   WECKL KN
Sbjct  116  TLNRSISFSGSPFRVSDSSCSRLSVLRPCAPPNLPNCSRCSWECKLIKN  164



>ref|XP_002268965.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
[Vitis vinifera]
Length=640

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 65/110 (59%), Positives = 78/110 (71%), Gaps = 6/110 (5%)
 Frame = +3

Query  360  GCGHPSFQIHCSSLRFALISINNLSFSLRHYDpastslllspassM-YXSRRNCSV----  524
            GCGHPSFQI CS    ++ISINNLSF+L  Y P S+SL L+P   +   + RNCS+    
Sbjct  63   GCGHPSFQIRCS-FPHSIISINNLSFALVQYQPNSSSLNLAPQPLIPATAHRNCSLPQLL  121

Query  525  SVPARSISLSGSPXRVSDSSCSRLSALRPXRTASLPNCSHXPWECKLTKN  674
            S+P RSI+LSGSP RVSD+SCSRLS LRP    +LPNCS   WEC+L KN
Sbjct  122  SIPNRSINLSGSPFRVSDASCSRLSLLRPCPPPNLPNCSRCSWECRLIKN  171



>ref|XP_006390949.1| hypothetical protein EUTSA_v10018260mg [Eutrema salsugineum]
 gb|ESQ28235.1| hypothetical protein EUTSA_v10018260mg [Eutrema salsugineum]
Length=634

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 65/115 (57%), Positives = 73/115 (63%), Gaps = 11/115 (10%)
 Frame = +3

Query  360  GCGHPSFQIHCSSLRFALISINNLSFSLRHYDpastslll------spassMYXSRRNCS  521
            GCGHP+FQI CSS R A ISI NL+FSL  YD  S+SLLL         S+   ++ NCS
Sbjct  53   GCGHPNFQIQCSSPR-ATISIKNLTFSLLRYDSLSSSLLLSPISPPQLDSNRNKNKNNCS  111

Query  522  V----SVPARSISLSGSPXRVSDSSCSRLSALRPXRTASLPNCSHXPWECKLTKN  674
                 S   R I L+GSP RVSDSSCSRLS LRP     LPNCS  PW+CKL KN
Sbjct  112  SLRFSSSHNRFIDLTGSPFRVSDSSCSRLSLLRPCSPLILPNCSRCPWDCKLLKN  166



>ref|XP_007157572.1| hypothetical protein PHAVU_002G080400g [Phaseolus vulgaris]
 gb|ESW29566.1| hypothetical protein PHAVU_002G080400g [Phaseolus vulgaris]
Length=620

 Score = 77.4 bits (189),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 55/110 (50%), Positives = 70/110 (64%), Gaps = 6/110 (5%)
 Frame = +3

Query  360  GCGHPSFQIHCSSLRFALISINNLSFSLRHYDpastslllspassMY---XSRRNCSV--  524
            GCGHPSF + CS+   + ISINNLSFS+  Y+  ++S+ LSP    +    S  NC    
Sbjct  58   GCGHPSFHLTCSTPH-SFISINNLSFSILSYNSNTSSITLSPHPHPHPHPTSFPNCPSFP  116

Query  525  SVPARSISLSGSPXRVSDSSCSRLSALRPXRTASLPNCSHXPWECKLTKN  674
            S+P R I+LS +P RVS ++CSRLS LRP    SLPNCSH P +C L K 
Sbjct  117  SIPTRPINLSATPFRVSAATCSRLSFLRPCSPPSLPNCSHCPSQCHLIKT  166



>gb|EPS60026.1| hypothetical protein M569_14776 [Genlisea aurea]
Length=613

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 59/119 (50%), Positives = 70/119 (59%), Gaps = 18/119 (15%)
 Frame = +3

Query  360  GCGHPSFQIHCSSLRFALISINNLSFSLRHYDpastslllspassMYXSRRNCSVSVPAR  539
            GCGHPSFQI CS    A+IS+N+LSFS+   DP STSL LSPA     ++   S S P +
Sbjct  48   GCGHPSFQIQCSPPSPAVISVNDLSFSILRVDPNSTSLTLSPAL----TQGAVSESAPPK  103

Query  540  --------------SISLSGSPXRVSDSSCSRLSALRPXRTASLPNCSHXPWECKLTKN  674
                           IS SGSP RVSDS+CSRLSALRP    +L NC+    EC L +N
Sbjct  104  CRPSAETLAFLDGSPISFSGSPFRVSDSACSRLSALRPCPRRNLTNCTSCSLECDLIEN  162



>gb|KJB31395.1| hypothetical protein B456_005G189300 [Gossypium raimondii]
Length=635

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 57/105 (54%), Positives = 69/105 (66%), Gaps = 4/105 (4%)
 Frame = +3

Query  360  GCGHPSFQIHCSSLRFALISINNLSFSLRHYDpastslllspassMYXSRRNCSVSVPAR  539
            GCGHPSF I+CS+   + ISINNLSFSL ++DP STSL LSP      S   CS S    
Sbjct  59   GCGHPSFPINCSTPS-STISINNLSFSLLYFDPNSTSLTLSPLPPTTTSP--CS-SFNFL  114

Query  540  SISLSGSPXRVSDSSCSRLSALRPXRTASLPNCSHXPWECKLTKN  674
             I+LSGSP R+SD+SCSRLS LR    ++L NC    WEC + K+
Sbjct  115  HINLSGSPFRISDASCSRLSILRSCSPSNLSNCDQCAWECGIIKH  159



>ref|XP_004489958.1| PREDICTED: probable serine/threonine-protein kinase At1g18390-like 
[Cicer arietinum]
Length=642

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 52/112 (46%), Positives = 73/112 (65%), Gaps = 8/112 (7%)
 Frame = +3

Query  360  GCGHPSFQIHCSSLRFALISINNLSFSLRHYDpastslllspassM----YXSRRNC---  518
            GCGHPSFQ++CS+   +LI+INNLSFS+  + P S+S L+SP + +    +     C   
Sbjct  66   GCGHPSFQLNCSTPH-SLITINNLSFSILTFKPNSSSFLISPYTPISSHSHPLNNTCPYS  124

Query  519  SVSVPARSISLSGSPXRVSDSSCSRLSALRPXRTASLPNCSHXPWECKLTKN  674
            + S+P+  I+LS SP  +SD SCSRLS L+     +LPNCS   ++CKL KN
Sbjct  125  TSSIPSTPINLSNSPFTLSDESCSRLSFLQSCSPPTLPNCSSCHYQCKLIKN  176



>ref|XP_003519780.1| PREDICTED: probable serine/threonine-protein kinase At1g18390-like 
[Glycine max]
Length=615

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 48/106 (45%), Positives = 64/106 (60%), Gaps = 5/106 (5%)
 Frame = +3

Query  360  GCGHPSFQIHCSSLRFALISINNLSFSLRHYDpastslllspassMYXSRRNCSVSVPAR  539
            GCGHPSF + CS+   + ISINN SFS+  Y+P ++S+ LSP         N   S+P  
Sbjct  55   GCGHPSFHLTCSTPH-SQISINNFSFSILSYNPNTSSITLSPHQQ---HPNNIFPSIPTH  110

Query  540  SISLSGSPXRVSDSSCSRLS-ALRPXRTASLPNCSHXPWECKLTKN  674
             I+LS +P R+S ++CSRLS          LPNCSH P++C L KN
Sbjct  111  PINLSSTPFRISAATCSRLSFLRPCFPPPPLPNCSHSPFQCHLLKN  156



>ref|XP_010255997.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
[Nelumbo nucifera]
Length=633

 Score = 58.9 bits (141),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 45/105 (43%), Positives = 59/105 (56%), Gaps = 4/105 (4%)
 Frame = +3

Query  360  GCGHPSFQIHCSSLRFALISINNLSFSLRHYDpastslll--spassMYXSRRNC-SVSV  530
            GCGHPSFQI CS    +LISIN+ +F + H D  S +L L     S    +  +C S S+
Sbjct  56   GCGHPSFQIKCSP-NGSLISINDFTFHIFHLDHNSRTLTLYPETPSVHNLTHGSCPSTSL  114

Query  531  PARSISLSGSPXRVSDSSCSRLSALRPXRTASLPNCSHXPWECKL  665
                I+L+GSP R S + CSR S L     ++L NC    W+CKL
Sbjct  115  SDPPINLTGSPFRFSGALCSRFSDLPQCDNSNLQNCISCSWDCKL  159



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1077565505600