BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF047A21

Length=703
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004228404.1|  PREDICTED: uncharacterized protein LOC101255911    207   3e-60   Solanum lycopersicum
ref|XP_004155395.1|  PREDICTED: uncharacterized protein LOC101229960    202   8e-60   
ref|XP_002890619.1|  hypothetical protein ARALYDRAFT_472693             204   2e-59   Arabidopsis lyrata subsp. lyrata
ref|XP_006365138.1|  PREDICTED: uncharacterized protein LOC102597833    204   2e-59   Solanum tuberosum [potatoes]
gb|KDP21243.1|  hypothetical protein JCGZ_21714                         204   6e-59   Jatropha curcas
ref|XP_010551493.1|  PREDICTED: uncharacterized protein LOC104822...    203   9e-59   Tarenaya hassleriana [spider flower]
ref|XP_010551492.1|  PREDICTED: uncharacterized protein LOC104822...    203   1e-58   Tarenaya hassleriana [spider flower]
ref|XP_008446299.1|  PREDICTED: uncharacterized protein LOC103489...    202   1e-58   Cucumis melo [Oriental melon]
ref|XP_008446298.1|  PREDICTED: uncharacterized protein LOC103489...    202   3e-58   Cucumis melo [Oriental melon]
ref|XP_009613040.1|  PREDICTED: uncharacterized protein LOC104106...    202   3e-58   Nicotiana tomentosiformis
ref|XP_009613041.1|  PREDICTED: uncharacterized protein LOC104106...    201   3e-58   Nicotiana tomentosiformis
ref|NP_174029.1|  uncharacterized glycine-rich protein                  200   6e-58   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006307636.1|  hypothetical protein CARUB_v10009264mg             199   2e-57   Capsella rubella
ref|XP_004135203.1|  PREDICTED: uncharacterized protein LOC101205164    200   3e-57   Cucumis sativus [cucumbers]
ref|XP_009594283.1|  PREDICTED: ATP-dependent RNA helicase A-like...    199   3e-57   
ref|XP_009594282.1|  PREDICTED: ATP-dependent RNA helicase A-like...    198   4e-57   
ref|XP_010477771.1|  PREDICTED: uncharacterized protein LOC104756820    198   4e-57   Camelina sativa [gold-of-pleasure]
ref|XP_009785486.1|  PREDICTED: uncharacterized protein LOC104233...    198   8e-57   Nicotiana sylvestris
ref|XP_009785484.1|  PREDICTED: uncharacterized protein LOC104233...    197   9e-57   Nicotiana sylvestris
gb|EPS60452.1|  hypothetical protein M569_14351                         191   2e-56   Genlisea aurea
gb|KJB77127.1|  hypothetical protein B456_012G121700                    197   3e-56   Gossypium raimondii
ref|XP_010272218.1|  PREDICTED: uncharacterized protein LOC104608...    196   3e-56   Nelumbo nucifera [Indian lotus]
ref|XP_010460222.1|  PREDICTED: uncharacterized protein LOC104741134    195   5e-56   Camelina sativa [gold-of-pleasure]
ref|XP_010272217.1|  PREDICTED: uncharacterized protein LOC104608...    196   6e-56   Nelumbo nucifera [Indian lotus]
ref|XP_010096321.1|  hypothetical protein L484_021067                   196   7e-56   Morus notabilis
ref|XP_010272216.1|  PREDICTED: uncharacterized protein LOC104608...    196   3e-55   Nelumbo nucifera [Indian lotus]
ref|XP_010256182.1|  PREDICTED: uncharacterized protein LOC104596615    194   3e-55   Nelumbo nucifera [Indian lotus]
gb|KJB61232.1|  hypothetical protein B456_009G346800                    191   5e-55   Gossypium raimondii
ref|XP_010498969.1|  PREDICTED: uncharacterized protein LOC104776570    192   9e-55   Camelina sativa [gold-of-pleasure]
ref|XP_008221700.1|  PREDICTED: keratin, type I cytoskeletal 10         192   9e-55   Prunus mume [ume]
gb|KJB61231.1|  hypothetical protein B456_009G346800                    191   6e-54   Gossypium raimondii
emb|CDP00272.1|  unnamed protein product                                187   8e-54   Coffea canephora [robusta coffee]
ref|XP_009762263.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    187   2e-53   Nicotiana sylvestris
ref|XP_009759105.1|  PREDICTED: uncharacterized protein LOC104211710    189   2e-53   Nicotiana sylvestris
ref|XP_002520157.1|  conserved hypothetical protein                     189   3e-53   Ricinus communis
ref|XP_006415997.1|  hypothetical protein EUTSA_v10007745mg             187   7e-53   Eutrema salsugineum [saltwater cress]
ref|XP_007044389.1|  Glycine-rich protein, putative isoform 2           184   9e-53   
ref|XP_006378167.1|  glycine-rich family protein                        182   1e-52   
ref|XP_007157411.1|  hypothetical protein PHAVU_002G067800g             184   1e-51   Phaseolus vulgaris [French bean]
ref|XP_007044388.1|  Glycine-rich protein, putative isoform 1           184   3e-51   
ref|XP_004238757.1|  PREDICTED: uncharacterized protein LOC101253779    183   3e-51   Solanum lycopersicum
ref|XP_002312704.1|  glycine-rich family protein                        182   5e-51   
ref|XP_008389541.1|  PREDICTED: uncharacterized protein LOC103451881    182   7e-51   
ref|XP_011011854.1|  PREDICTED: uncharacterized protein LOC105116275    182   9e-51   Populus euphratica
ref|XP_011086413.1|  PREDICTED: uncharacterized protein LOC105168156    182   9e-51   Sesamum indicum [beniseed]
ref|XP_004489967.1|  PREDICTED: keratin, type I cytoskeletal 10-like    182   1e-50   Cicer arietinum [garbanzo]
ref|XP_008352995.1|  PREDICTED: uncharacterized protein LOC103416528    181   1e-50   
ref|XP_003613550.1|  hypothetical protein MTR_5g037960                  181   3e-50   Medicago truncatula
gb|EYU28691.1|  hypothetical protein MIMGU_mgv1a007116mg                178   4e-50   Erythranthe guttata [common monkey flower]
ref|XP_004297812.1|  PREDICTED: uncharacterized protein LOC101315...    180   6e-50   Fragaria vesca subsp. vesca
ref|XP_004297813.1|  PREDICTED: uncharacterized protein LOC101315...    179   6e-50   Fragaria vesca subsp. vesca
gb|AGV54212.1|  hypothetical protein                                    180   6e-50   Phaseolus vulgaris [French bean]
ref|XP_011034203.1|  PREDICTED: uncharacterized protein LOC105132411    179   1e-49   Populus euphratica
ref|XP_009115436.1|  PREDICTED: uncharacterized protein LOC103840676    178   2e-49   Brassica rapa
ref|XP_003517917.1|  PREDICTED: uncharacterized protein LOC100819759    178   3e-49   Glycine max [soybeans]
gb|EYU28690.1|  hypothetical protein MIMGU_mgv1a007116mg                177   4e-49   Erythranthe guttata [common monkey flower]
ref|XP_003519125.1|  PREDICTED: uncharacterized protein LOC100816406    176   1e-48   Glycine max [soybeans]
ref|XP_009360410.1|  PREDICTED: uncharacterized protein LOC103950885    176   2e-48   Pyrus x bretschneideri [bai li]
ref|XP_006357249.1|  PREDICTED: uncharacterized protein LOC102594597    174   7e-48   Solanum tuberosum [potatoes]
emb|CDY52255.1|  BnaC08g20270D                                          172   3e-47   Brassica napus [oilseed rape]
ref|XP_010683287.1|  PREDICTED: uncharacterized protein LOC104897...    172   9e-47   Beta vulgaris subsp. vulgaris [field beet]
emb|CDY46422.1|  BnaA08g20080D                                          171   1e-46   Brassica napus [oilseed rape]
gb|EYU22447.1|  hypothetical protein MIMGU_mgv1a006912mg                171   1e-46   Erythranthe guttata [common monkey flower]
gb|EYU22446.1|  hypothetical protein MIMGU_mgv1a006912mg                171   1e-46   Erythranthe guttata [common monkey flower]
ref|XP_010683286.1|  PREDICTED: uncharacterized protein LOC104897...    172   1e-46   
gb|KDO82716.1|  hypothetical protein CISIN_1g013233mg                   168   3e-46   Citrus sinensis [apfelsine]
emb|CAN72059.1|  hypothetical protein VITISV_039073                     169   6e-46   Vitis vinifera
ref|XP_009110060.1|  PREDICTED: uncharacterized protein LOC103835629    168   7e-46   Brassica rapa
ref|XP_002269144.1|  PREDICTED: uncharacterized protein LOC100248339    168   2e-45   Vitis vinifera
ref|XP_010043853.1|  PREDICTED: uncharacterized protein LOC104432951    167   6e-45   Eucalyptus grandis [rose gum]
gb|KDO82715.1|  hypothetical protein CISIN_1g013233mg                   166   9e-45   Citrus sinensis [apfelsine]
ref|XP_006438557.1|  hypothetical protein CICLE_v10031519mg             165   2e-44   Citrus clementina [clementine]
ref|XP_006438558.1|  hypothetical protein CICLE_v10031519mg             165   2e-44   
emb|CDY14707.1|  BnaC05g19640D                                          164   3e-44   Brassica napus [oilseed rape]
ref|XP_006838798.1|  hypothetical protein AMTR_s00002p00260390          160   1e-42   Amborella trichopoda
ref|XP_010923301.1|  PREDICTED: uncharacterized protein LOC105046420    157   3e-41   Elaeis guineensis
ref|XP_008807869.1|  PREDICTED: uncharacterized protein LOC103720...    154   5e-41   
ref|XP_008807868.1|  PREDICTED: uncharacterized protein LOC103720...    154   5e-41   
ref|XP_009396953.1|  PREDICTED: uncharacterized protein LOC103981916    154   2e-40   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009398398.1|  PREDICTED: uncharacterized protein LOC103983002    154   4e-40   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008807865.1|  PREDICTED: uncharacterized protein LOC103720...    153   7e-40   Phoenix dactylifera
ref|XP_008807866.1|  PREDICTED: uncharacterized protein LOC103720...    153   8e-40   Phoenix dactylifera
ref|XP_003561154.1|  PREDICTED: uncharacterized protein LOC100834871    152   2e-39   Brachypodium distachyon [annual false brome]
ref|XP_010933750.1|  PREDICTED: uncharacterized protein LOC105054054    147   8e-38   
ref|NP_001168517.1|  hypothetical protein                               147   1e-37   Zea mays [maize]
ref|NP_001168582.1|  uncharacterized protein LOC100382366               141   2e-35   Zea mays [maize]
ref|XP_002466649.1|  hypothetical protein SORBIDRAFT_01g011640          140   6e-35   Sorghum bicolor [broomcorn]
ref|XP_008796647.1|  PREDICTED: uncharacterized protein LOC103712049    139   9e-35   Phoenix dactylifera
gb|ABR16221.1|  unknown                                                 134   1e-32   Picea sitchensis
ref|XP_004982143.1|  PREDICTED: glycine, alanine and asparagine-r...    133   1e-32   Setaria italica
emb|CDM83736.1|  unnamed protein product                                133   6e-32   Triticum aestivum [Canadian hard winter wheat]
ref|XP_001771935.1|  predicted protein                                  129   3e-31   
gb|EMS56397.1|  hypothetical protein TRIUR3_34734                       128   1e-30   Triticum urartu
gb|EMT18822.1|  hypothetical protein F775_06861                         129   3e-30   
gb|EMS62622.1|  hypothetical protein TRIUR3_18305                       125   2e-29   Triticum urartu
ref|XP_002988977.1|  hypothetical protein SELMODRAFT_129003             122   8e-29   
gb|KHN01223.1|  Abietadienol/abietadienal oxidase                       120   1e-28   Glycine soja [wild soybean]
emb|CBI32031.3|  unnamed protein product                                121   1e-28   Vitis vinifera
ref|XP_006573960.1|  PREDICTED: uncharacterized protein LOC100816385    120   4e-28   
gb|EEC75970.1|  hypothetical protein OsI_13079                          120   5e-28   Oryza sativa Indica Group [Indian rice]
ref|XP_001761769.1|  predicted protein                                  118   2e-27   
ref|NP_001050943.1|  Os03g0688200                                       117   5e-27   
gb|EAZ28187.1|  hypothetical protein OsJ_12160                          117   6e-27   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002975088.1|  hypothetical protein SELMODRAFT_442638             115   3e-26   Selaginella moellendorffii
gb|ABR16471.1|  unknown                                                 106   9e-23   Picea sitchensis
gb|EMT18821.1|  hypothetical protein F775_02142                         102   6e-21   
ref|XP_002883544.1|  hypothetical protein ARALYDRAFT_479980           87.0    1e-17   
ref|NP_189112.1|  uncharacterized protein                             84.0    2e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010513678.1|  PREDICTED: uncharacterized protein LOC104789722  78.2    2e-14   Camelina sativa [gold-of-pleasure]
ref|XP_010488577.1|  PREDICTED: uncharacterized protein LOC104766398  77.8    3e-14   Camelina sativa [gold-of-pleasure]
ref|XP_010466896.1|  PREDICTED: uncharacterized protein LOC104747029  77.8    3e-14   Camelina sativa [gold-of-pleasure]
ref|XP_005652064.1|  hypothetical protein COCSUDRAFT_64270            78.6    3e-13   Coccomyxa subellipsoidea C-169
ref|XP_006396698.1|  hypothetical protein EUTSA_v10029189mg           74.7    3e-13   
emb|CDX94550.1|  BnaC09g22860D                                        74.3    5e-13   
ref|XP_003613551.1|  hypothetical protein MTR_5g037970                73.2    8e-13   
gb|KFK44624.1|  hypothetical protein AALP_AA1G282900                  75.9    9e-13   Arabis alpina [alpine rockcress]
ref|XP_009114578.1|  PREDICTED: uncharacterized protein LOC103839843  73.2    1e-12   Brassica rapa
gb|ABA92081.1|  hypothetical protein LOC_Os11g11180                   74.3    2e-12   Oryza sativa Japonica Group [Japonica rice]
gb|KFK37826.1|  hypothetical protein AALP_AA3G034300                  71.2    5e-12   Arabis alpina [alpine rockcress]
gb|EEE59723.1|  hypothetical protein OsJ_12161                        62.8    2e-08   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009626346.1|  PREDICTED: uncharacterized protein LOC104117072  58.9    7e-08   
emb|CCI41035.1|  unnamed protein product                              61.2    1e-07   Albugo candida
emb|CCI41034.1|  unnamed protein product                              60.8    1e-07   Albugo candida
gb|KHN23080.1|  hypothetical protein glysoja_040901                   56.6    2e-07   Glycine soja [wild soybean]
ref|XP_006651701.1|  PREDICTED: heterogeneous nuclear ribonucleop...  60.1    3e-07   Oryza brachyantha
gb|EEE51859.1|  hypothetical protein OsJ_33386                        54.3    3e-06   Oryza sativa Japonica Group [Japonica rice]
emb|CCA21941.1|  conserved hypothetical protein                       54.3    2e-05   Albugo laibachii Nc14
emb|CCA24791.1|  conserved hypothetical protein                       54.7    2e-05   Albugo laibachii Nc14
gb|AFW67957.1|  hypothetical protein ZEAMMB73_254492                  50.1    5e-05   
gb|EEC67891.1|  hypothetical protein OsI_35559                        53.1    6e-05   Oryza sativa Indica Group [Indian rice]
ref|XP_011397224.1|  hypothetical protein F751_3054                   51.6    2e-04   Auxenochlorella protothecoides



>ref|XP_004228404.1| PREDICTED: uncharacterized protein LOC101255911 [Solanum lycopersicum]
Length=442

 Score =   207 bits (526),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 137/212 (65%), Positives = 166/212 (78%), Gaps = 12/212 (6%)
 Frame = +1

Query  82   MAATEVSDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVL  261
            MA+T VS++SDGPVLSVINKR+RAL+KK +RI QME+S +KGKTLNKEQEETLR+K AV+
Sbjct  1    MASTPVSELSDGPVLSVINKRLRALRKKHSRILQMEESRTKGKTLNKEQEETLRSKSAVI  60

Query  262  AGIDELEKIRQPLSAALEEEISLSVQRHQVSALETPAPSEESGKEPEGDVENKGES--DG  435
            A IDELEK+RQPL+AA+ EEI+LS  +HQVS    PA   ES      D  +KGE   +G
Sbjct  61   AAIDELEKLRQPLAAAVVEEINLSTGQHQVS----PA---ESAVNISIDSTDKGEPAREG  113

Query  436  GVVIEDLLNLLYFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYM---Kdddsidllge  606
             +V+EDLLNLLYFGSMFDVK+LQ+ FT  ML+R  ER+ CLSYD M   +  D +DLLGE
Sbjct  114  VLVVEDLLNLLYFGSMFDVKSLQSDFTPTMLTRTMERACCLSYDCMPDDESTDVMDLLGE  173

Query  607  sdldllsllsgllisRSANSSLPHKNALQKCI  702
             DLDL+S+LSGLL+SR  NS L HK+ALQKCI
Sbjct  174  RDLDLISMLSGLLVSRPVNSPLSHKHALQKCI  205



>ref|XP_004155395.1| PREDICTED: uncharacterized protein LOC101229960 [Cucumis sativus]
Length=294

 Score =   202 bits (513),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 125/211 (59%), Positives = 163/211 (77%), Gaps = 9/211 (4%)
 Frame = +1

Query  82   MAATEVSDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVL  261
            MAA   SDV DGPVLS+INKR+RAL+KK NRI QME+++S GK +NKEQEE LR+KP+V 
Sbjct  1    MAAPSPSDVIDGPVLSLINKRLRALRKKHNRILQMEEAISLGKPINKEQEEVLRSKPSVT  60

Query  262  AGIDELEKIRQPLSAALEEEISLSVQRHQVSALETPAPSEESGK----EPEGDVENKGES  429
            A IDELEK+RQPL++A+ EEI+L+VQR Q S    P  +++S      E   DV+++ E 
Sbjct  61   ALIDELEKLRQPLASAVSEEINLAVQRQQASVSSLPVSTDDSHTEVRDEDTSDVKDQSE-  119

Query  430  DGGVVIEDLLNLLYFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidllges  609
                V+EDLLNLLYFGS+FDVK+ Q+ FT  ML+R HERS C++YDY+  DD+ DLL E 
Sbjct  120  --HAVVEDLLNLLYFGSLFDVKS-QSDFTSTMLTRTHERSCCITYDYV-TDDATDLLVER  175

Query  610  dldllsllsgllisRSANSSLPHKNALQKCI  702
            DLDL+S++SGLL+SR  +S+LPHKNAL++CI
Sbjct  176  DLDLISMMSGLLVSRPVDSNLPHKNALERCI  206



>ref|XP_002890619.1| hypothetical protein ARALYDRAFT_472693 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66878.1| hypothetical protein ARALYDRAFT_472693 [Arabidopsis lyrata subsp. 
lyrata]
Length=419

 Score =   204 bits (520),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 121/207 (58%), Positives = 160/207 (77%), Gaps = 5/207 (2%)
 Frame = +1

Query  82   MAATEVSDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVL  261
            MAAT  S+ S+GPV+ +INKR+RAL+KK NRI+QME+S+S+GKTLNKEQEE LR+KPAV+
Sbjct  1    MAATASSEASEGPVMGLINKRLRALRKKYNRITQMEESISQGKTLNKEQEEVLRSKPAVV  60

Query  262  AGIDELEKIRQPLSAALEEEISLSVQRHQVSALETPAPSEESGKEPEGDVENKGESDGGV  441
              I+ELEKIR PLSAA+ EEISL+ Q ++  + +T AP ++   +   +V      DGG 
Sbjct  61   ILIEELEKIRAPLSAAVAEEISLATQHNRAPSDQTTAPEQKEVTDIPQEVSG---GDGGA  117

Query  442  VIEDLLNLLYFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidllgesdldl  621
             +EDL+NLLYFGS+FDVK+ QN FT +ML+R HERS CLSYDY+  DD+ DLLG+ DLD 
Sbjct  118  KLEDLVNLLYFGSLFDVKS-QNEFTSIMLTRTHERSCCLSYDYV-TDDATDLLGDRDLDS  175

Query  622  lsllsgllisRSANSSLPHKNALQKCI  702
            +S L  L++SR  +SSL HKNAL++C+
Sbjct  176  ISQLWSLMVSRPVDSSLSHKNALERCV  202



>ref|XP_006365138.1| PREDICTED: uncharacterized protein LOC102597833 [Solanum tuberosum]
Length=437

 Score =   204 bits (520),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 136/212 (64%), Positives = 166/212 (78%), Gaps = 12/212 (6%)
 Frame = +1

Query  82   MAATEVSDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVL  261
            MA+T VS++SDGPVLSVINKR+RAL+KK +RI QME+S +KGKTLNKEQEETLR+K AV+
Sbjct  1    MASTPVSELSDGPVLSVINKRLRALRKKHSRILQMEESRTKGKTLNKEQEETLRSKSAVI  60

Query  262  AGIDELEKIRQPLSAALEEEISLSVQRHQVSALETPAPSEESGKEPEGDVENKGES--DG  435
            A IDELEK+RQPL+AA+ EEI+LS ++ QVS    PA   E   +   D  NKGE   +G
Sbjct  61   AAIDELEKLRQPLAAAVVEEINLSTEQRQVS----PA---EFALDTAIDSTNKGEPAREG  113

Query  436  GVVIEDLLNLLYFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYM---Kdddsidllge  606
             + +EDLLNLLYFGSMFDVK+LQ+ FT  ML+R  ER+ CLSYD M   +  D +DLLGE
Sbjct  114  VLEVEDLLNLLYFGSMFDVKSLQSDFTPTMLTRTMERACCLSYDCMPDDESTDVMDLLGE  173

Query  607  sdldllsllsgllisRSANSSLPHKNALQKCI  702
             DLDL+S+LSGLL+SR  NSSL HK+ALQKCI
Sbjct  174  RDLDLISMLSGLLVSRPVNSSLSHKHALQKCI  205



>gb|KDP21243.1| hypothetical protein JCGZ_21714 [Jatropha curcas]
Length=449

 Score =   204 bits (518),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 120/209 (57%), Positives = 160/209 (77%), Gaps = 4/209 (2%)
 Frame = +1

Query  82   MAATEVSDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVL  261
            MAAT  S+ +DGPVLS INKR+RAL+KK NRI QME+++S+GK +NKEQE+ LR+KP+V 
Sbjct  1    MAATAASEATDGPVLSFINKRLRALRKKYNRILQMEEAISQGKPINKEQEDVLRSKPSVC  60

Query  262  AGIDELEKIRQPLSAALEEEISLSVQRHQVSAL--ETPAPSEESGKEPEGDVENKGESDG  435
            A I+ELEK+RQPL+ A+ EEI+L++QRHQ  +       P ++  ++ + D +     DG
Sbjct  61   AAIEELEKLRQPLATAVSEEIALAIQRHQQQSFVSNNAIPDKDDSEKTDCDSDEDTRGDG  120

Query  436  GVVIEDLLNLLYFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidllgesdl  615
            G ++EDLLNLLYFGS+FDVK+ QN FT  ML+R HER  CL+YDY+  DD+ DLLGE DL
Sbjct  121  GSMVEDLLNLLYFGSLFDVKS-QNDFTATMLTRTHERGCCLTYDYV-TDDATDLLGERDL  178

Query  616  dllsllsgllisRSANSSLPHKNALQKCI  702
            D++S L GLLISR  +S+L H+NALQ+CI
Sbjct  179  DMISKLGGLLISRPVDSNLSHRNALQRCI  207



>ref|XP_010551493.1| PREDICTED: uncharacterized protein LOC104822090 isoform X2 [Tarenaya 
hassleriana]
Length=432

 Score =   203 bits (516),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 121/207 (58%), Positives = 158/207 (76%), Gaps = 2/207 (1%)
 Frame = +1

Query  82   MAATEVSDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVL  261
            MAA   SD +DGPVLS+INKR+RAL+KK NRI QME+S+++GKT+NKEQEE LR+KP ++
Sbjct  1    MAAIASSDATDGPVLSLINKRLRALRKKYNRILQMEESIAQGKTINKEQEEVLRSKPGLV  60

Query  262  AGIDELEKIRQPLSAALEEEISLSVQRHQVSALETPAPSEESGKEPEGDVENKGESDGGV  441
            A IDELEK+R PLSAA+ EEISL++Q HQVS+ +T A   +  +  +  V  +    GG 
Sbjct  61   ATIDELEKLRAPLSAAVSEEISLAIQCHQVSSDQTNALDNKERQSDDSAVPQESGGHGGA  120

Query  442  VIEDLLNLLYFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidllgesdldl  621
             ++DL+NLLYFGS+FDVK+ Q+ F   ML+R HER  CL+YDY+  DD+ DLLGE DLDL
Sbjct  121  AVDDLMNLLYFGSLFDVKS-QSEFASTMLTRTHERGCCLTYDYV-TDDATDLLGERDLDL  178

Query  622  lsllsgllisRSANSSLPHKNALQKCI  702
            +S L  L+ISR  +SSL HKNAL++CI
Sbjct  179  ISRLGSLMISRPVDSSLSHKNALERCI  205



>ref|XP_010551492.1| PREDICTED: uncharacterized protein LOC104822090 isoform X1 [Tarenaya 
hassleriana]
Length=452

 Score =   203 bits (516),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 121/207 (58%), Positives = 158/207 (76%), Gaps = 2/207 (1%)
 Frame = +1

Query  82   MAATEVSDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVL  261
            MAA   SD +DGPVLS+INKR+RAL+KK NRI QME+S+++GKT+NKEQEE LR+KP ++
Sbjct  1    MAAIASSDATDGPVLSLINKRLRALRKKYNRILQMEESIAQGKTINKEQEEVLRSKPGLV  60

Query  262  AGIDELEKIRQPLSAALEEEISLSVQRHQVSALETPAPSEESGKEPEGDVENKGESDGGV  441
            A IDELEK+R PLSAA+ EEISL++Q HQVS+ +T A   +  +  +  V  +    GG 
Sbjct  61   ATIDELEKLRAPLSAAVSEEISLAIQCHQVSSDQTNALDNKERQSDDSAVPQESGGHGGA  120

Query  442  VIEDLLNLLYFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidllgesdldl  621
             ++DL+NLLYFGS+FDVK+ Q+ F   ML+R HER  CL+YDY+  DD+ DLLGE DLDL
Sbjct  121  AVDDLMNLLYFGSLFDVKS-QSEFASTMLTRTHERGCCLTYDYV-TDDATDLLGERDLDL  178

Query  622  lsllsgllisRSANSSLPHKNALQKCI  702
            +S L  L+ISR  +SSL HKNAL++CI
Sbjct  179  ISRLGSLMISRPVDSSLSHKNALERCI  205



>ref|XP_008446299.1| PREDICTED: uncharacterized protein LOC103489075 isoform X2 [Cucumis 
melo]
Length=443

 Score =   202 bits (515),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 128/209 (61%), Positives = 164/209 (78%), Gaps = 5/209 (2%)
 Frame = +1

Query  82   MAATEVSDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVL  261
            MAA   SDVSDGPVLS+INKR+RAL+KK NRI QME+++S+GK +NKEQEE LR+KP+V 
Sbjct  1    MAALAPSDVSDGPVLSLINKRLRALRKKHNRILQMEEAISQGKPINKEQEEVLRSKPSVT  60

Query  262  AGIDELEKIRQPLSAALEEEISLSVQRHQVSALETPAPSEESGKE--PEGDVENKGESDG  435
            A IDELEK+R PLS+A+ EEI L+VQR Q S    P  +++S  E   E D + K +S+ 
Sbjct  61   ALIDELEKLRLPLSSAVSEEICLAVQRQQASVSSQPVSTDDSPTEVRDENDSDVKDQSEH  120

Query  436  GVVIEDLLNLLYFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidllgesdl  615
             VV EDLLNLLYFGS+FDVK+ Q+ FT  ML+R HERS C++YDY+  DD+ DLL E DL
Sbjct  121  AVV-EDLLNLLYFGSLFDVKS-QSDFTSTMLTRTHERSCCITYDYV-TDDATDLLVERDL  177

Query  616  dllsllsgllisRSANSSLPHKNALQKCI  702
            DL+S++SGLL+SR  +S+LPHKNAL++CI
Sbjct  178  DLISMMSGLLVSRPVDSNLPHKNALERCI  206



>ref|XP_008446298.1| PREDICTED: uncharacterized protein LOC103489075 isoform X1 [Cucumis 
melo]
Length=469

 Score =   202 bits (515),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 128/209 (61%), Positives = 164/209 (78%), Gaps = 5/209 (2%)
 Frame = +1

Query  82   MAATEVSDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVL  261
            MAA   SDVSDGPVLS+INKR+RAL+KK NRI QME+++S+GK +NKEQEE LR+KP+V 
Sbjct  1    MAALAPSDVSDGPVLSLINKRLRALRKKHNRILQMEEAISQGKPINKEQEEVLRSKPSVT  60

Query  262  AGIDELEKIRQPLSAALEEEISLSVQRHQVSALETPAPSEESGKE--PEGDVENKGESDG  435
            A IDELEK+R PLS+A+ EEI L+VQR Q S    P  +++S  E   E D + K +S+ 
Sbjct  61   ALIDELEKLRLPLSSAVSEEICLAVQRQQASVSSQPVSTDDSPTEVRDENDSDVKDQSEH  120

Query  436  GVVIEDLLNLLYFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidllgesdl  615
             VV EDLLNLLYFGS+FDVK+ Q+ FT  ML+R HERS C++YDY+  DD+ DLL E DL
Sbjct  121  AVV-EDLLNLLYFGSLFDVKS-QSDFTSTMLTRTHERSCCITYDYV-TDDATDLLVERDL  177

Query  616  dllsllsgllisRSANSSLPHKNALQKCI  702
            DL+S++SGLL+SR  +S+LPHKNAL++CI
Sbjct  178  DLISMMSGLLVSRPVDSNLPHKNALERCI  206



>ref|XP_009613040.1| PREDICTED: uncharacterized protein LOC104106247 isoform X1 [Nicotiana 
tomentosiformis]
Length=436

 Score =   202 bits (513),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 124/213 (58%), Positives = 151/213 (71%), Gaps = 17/213 (8%)
 Frame = +1

Query  82   MAATEVSDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVL  261
            MA+T  S++SDGPVLSVINKR+RAL+KK NRI QME+SLSKGK LNKEQEET R+K AVL
Sbjct  1    MASTPASELSDGPVLSVINKRLRALRKKYNRIVQMEESLSKGKILNKEQEETFRSKSAVL  60

Query  262  AGIDELEKIRQPLSAALEEEISLSV-QRHQVSALETPAPSEESGKEPEGDVENKGESDGG  438
             GIDELEK+RQPL+AA+ EEI+L+V Q+ QV       PSE +   P  D  NKGES   
Sbjct  61   VGIDELEKLRQPLAAAVAEEINLAVGQQRQV------PPSESAADTPIDDPNNKGES---  111

Query  439  VVIEDLLNLLYFGSMFDVKTL-QNHFTEVMLSREHERSSCLSYDYMKdddsidllgesdl  615
              +EDLLNLLYFGSMFDVK+L Q+  T  ML+R  ER+ CLSYD M +D+S D + +   
Sbjct  112  --VEDLLNLLYFGSMFDVKSLQQSDLTATMLTRTMERACCLSYDCMPEDESTDDVMDLLG  169

Query  616  dllsllsglli----sRSANSSLPHKNALQKCI  702
            +    L  +L     SR  NS L HK++LQKCI
Sbjct  170  ERDLDLISILSGLLVSRPVNSPLSHKHSLQKCI  202



>ref|XP_009613041.1| PREDICTED: uncharacterized protein LOC104106247 isoform X2 [Nicotiana 
tomentosiformis]
Length=433

 Score =   201 bits (512),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 133/213 (62%), Positives = 160/213 (75%), Gaps = 17/213 (8%)
 Frame = +1

Query  82   MAATEVSDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVL  261
            MA+T  S++SDGPVLSVINKR+RAL+KK NRI QME+SLSKGK LNKEQEET R+K AVL
Sbjct  1    MASTPASELSDGPVLSVINKRLRALRKKYNRIVQMEESLSKGKILNKEQEETFRSKSAVL  60

Query  262  AGIDELEKIRQPLSAALEEEISLSV-QRHQVSALETPAPSEESGKEPEGDVENKGESDGG  438
             GIDELEK+RQPL+AA+ EEI+L+V Q+ QV       PSE +   P  D  NKGES   
Sbjct  61   VGIDELEKLRQPLAAAVAEEINLAVGQQRQV------PPSESAADTPIDDPNNKGES---  111

Query  439  VVIEDLLNLLYFGSMFDVKTL-QNHFTEVMLSREHERSSCLSYDYMKdddsidllg----  603
              +EDLLNLLYFGSMFDVK+L Q+  T  ML+R  ER+ CLSYD M +D+S D +     
Sbjct  112  --VEDLLNLLYFGSMFDVKSLQQSDLTATMLTRTMERACCLSYDCMPEDESTDDVMDLLG  169

Query  604  esdldllsllsgllisRSANSSLPHKNALQKCI  702
            E DLDL+S+LSGLL+SR  NS L HK++LQKCI
Sbjct  170  ERDLDLISILSGLLVSRPVNSPLSHKHSLQKCI  202



>ref|NP_174029.1| uncharacterized glycine-rich protein [Arabidopsis thaliana]
 gb|AAF79875.1|AC000348_28 T7N9.15 [Arabidopsis thaliana]
 gb|AAL67063.1| unknown protein [Arabidopsis thaliana]
 gb|AAM14329.1| unknown protein [Arabidopsis thaliana]
 gb|AEE30778.1| uncharacterized glycine-rich protein [Arabidopsis thaliana]
Length=420

 Score =   200 bits (509),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 120/207 (58%), Positives = 158/207 (76%), Gaps = 5/207 (2%)
 Frame = +1

Query  82   MAATEVSDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVL  261
            MAAT  S+ S+GPV+ +INKR+RAL+KK NRI+QME+S+S+GKTLNKEQEE LR+KPAV+
Sbjct  1    MAATASSEASEGPVMGLINKRLRALRKKYNRITQMEESISQGKTLNKEQEEVLRSKPAVV  60

Query  262  AGIDELEKIRQPLSAALEEEISLSVQRHQVSALETPAPSEESGKEPEGDVENKGESDGGV  441
              IDELEKIR PLSAA+ EEISL+ Q ++ S+ +T A  ++   +   +V      D G 
Sbjct  61   ILIDELEKIRAPLSAAVTEEISLATQLNRASSDQTTASEQKEVTDIPQEVSG---GDDGA  117

Query  442  VIEDLLNLLYFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidllgesdldl  621
             +EDL+N LYFGS+FDVK+ QN FT +ML+R HERS CLSYDY+  DD+ DLLG+ DLD 
Sbjct  118  KLEDLVNFLYFGSLFDVKS-QNEFTSIMLTRTHERSCCLSYDYV-TDDATDLLGDRDLDS  175

Query  622  lsllsgllisRSANSSLPHKNALQKCI  702
            +S L  L++SR  +SSL HKNAL++C+
Sbjct  176  ISQLWSLMVSRPVDSSLSHKNALERCV  202



>ref|XP_006307636.1| hypothetical protein CARUB_v10009264mg [Capsella rubella]
 gb|EOA40534.1| hypothetical protein CARUB_v10009264mg [Capsella rubella]
Length=418

 Score =   199 bits (506),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 122/210 (58%), Positives = 159/210 (76%), Gaps = 9/210 (4%)
 Frame = +1

Query  82   MAATEVSDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVL  261
            MAAT  S+ S+GPV+ +INKR+RAL+KKLNRI+QME+S+S+GKTLNKEQEE LR+KPAV+
Sbjct  1    MAATASSEASEGPVMGLINKRLRALRKKLNRITQMEESVSQGKTLNKEQEEVLRSKPAVV  60

Query  262  AGIDELEKIRQPLSAALEEEISLSVQRHQVSALETPAPSE---ESGKEPEGDVENKGESD  432
              I+ELEK+R PLSAA+ EEISL+ + H+ S+  T A  +   E    P+G       SD
Sbjct  61   VLIEELEKLRAPLSAAVSEEISLATKHHRDSSDPTTASEQKEIEVCDPPQG----VSGSD  116

Query  433  GGVVIEDLLNLLYFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidllgesd  612
             G  +EDL+NLLYFGS+FDVK+ QN FT +ML+R HER  CLSYDY+  DD+ DLLG+ D
Sbjct  117  DGAKLEDLVNLLYFGSLFDVKS-QNEFTSIMLTRTHERGCCLSYDYV-ADDATDLLGDRD  174

Query  613  ldllsllsgllisRSANSSLPHKNALQKCI  702
            LD +S L  L++SR  +SSL HKNAL++C+
Sbjct  175  LDSISQLWSLMVSRPMDSSLSHKNALERCV  204



>ref|XP_004135203.1| PREDICTED: uncharacterized protein LOC101205164 [Cucumis sativus]
 gb|KGN51871.1| hypothetical protein Csa_5G604160 [Cucumis sativus]
Length=470

 Score =   200 bits (508),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 125/211 (59%), Positives = 163/211 (77%), Gaps = 9/211 (4%)
 Frame = +1

Query  82   MAATEVSDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVL  261
            MAA   SDV DGPVLS+INKR+RAL+KK NRI QME+++S GK +NKEQEE LR+KP+V 
Sbjct  1    MAAPSPSDVIDGPVLSLINKRLRALRKKHNRILQMEEAISLGKPINKEQEEVLRSKPSVT  60

Query  262  AGIDELEKIRQPLSAALEEEISLSVQRHQVSALETPAPSEESG----KEPEGDVENKGES  429
            A IDELEK+RQPL++A+ EEI+L+VQR Q S    P  +++S      E   DV+++ E 
Sbjct  61   ALIDELEKLRQPLASAVSEEINLAVQRQQASVSSLPVSTDDSHTEVRDEDTSDVKDQSEH  120

Query  430  DGGVVIEDLLNLLYFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidllges  609
                V+EDLLNLLYFGS+FDVK+ Q+ FT  ML+R HERS C++YDY+  DD+ DLL E 
Sbjct  121  ---AVVEDLLNLLYFGSLFDVKS-QSDFTSTMLTRTHERSCCITYDYV-TDDATDLLVER  175

Query  610  dldllsllsgllisRSANSSLPHKNALQKCI  702
            DLDL+S++SGLL+SR  +S+LPHKNAL++CI
Sbjct  176  DLDLISMMSGLLVSRPVDSNLPHKNALERCI  206



>ref|XP_009594283.1| PREDICTED: ATP-dependent RNA helicase A-like protein isoform 
X2 [Nicotiana tomentosiformis]
Length=422

 Score =   199 bits (505),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 131/211 (62%), Positives = 162/211 (77%), Gaps = 22/211 (10%)
 Frame = +1

Query  82   MAATEVSDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVL  261
            MAA   SDVS+GPVLSVINKR+RAL+KK NRI QME+S+SKGKTLNKEQEETLR+KPAV+
Sbjct  1    MAA---SDVSEGPVLSVINKRLRALRKKYNRIVQMEESVSKGKTLNKEQEETLRSKPAVI  57

Query  262  AGIDELEKIRQPLSAALEEEISLSVQRHQVSALETPAPSEESGKEPEGDVENKGESDGGV  441
            AGIDELEK+R+PL++A+ EEI+L+      SA  T          P+ + +N+GE +G +
Sbjct  58   AGIDELEKLREPLASAIAEEINLA-----TSASAT----------PDNNPKNEGEGEGVM  102

Query  442  VIEDLLNLLYFGSMFDVKTLQNHF-TEVMLSREHERSSCLSYDYM---Kdddsidllges  609
             +EDLLNLLYFG MFDVK+LQ+ F T  ML+R HER+ CLSYD M   +  D IDLLGE+
Sbjct  103  CVEDLLNLLYFGCMFDVKSLQSEFSTATMLTRTHERACCLSYDCMPEDESSDVIDLLGEN  162

Query  610  dldllsllsgllisRSANSSLPHKNALQKCI  702
            DLDL+S+LSGLLI R  NS L HK AL++CI
Sbjct  163  DLDLISMLSGLLIYRPVNSPLSHKRALRQCI  193



>ref|XP_009594282.1| PREDICTED: ATP-dependent RNA helicase A-like protein isoform 
X1 [Nicotiana tomentosiformis]
Length=425

 Score =   198 bits (504),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 131/211 (62%), Positives = 162/211 (77%), Gaps = 22/211 (10%)
 Frame = +1

Query  82   MAATEVSDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVL  261
            MAA   SDVS+GPVLSVINKR+RAL+KK NRI QME+S+SKGKTLNKEQEETLR+KPAV+
Sbjct  1    MAA---SDVSEGPVLSVINKRLRALRKKYNRIVQMEESVSKGKTLNKEQEETLRSKPAVI  57

Query  262  AGIDELEKIRQPLSAALEEEISLSVQRHQVSALETPAPSEESGKEPEGDVENKGESDGGV  441
            AGIDELEK+R+PL++A+ EEI+L+      SA  T          P+ + +N+GE +G +
Sbjct  58   AGIDELEKLREPLASAIAEEINLA-----TSASAT----------PDNNPKNEGEGEGVM  102

Query  442  VIEDLLNLLYFGSMFDVKTLQNHF-TEVMLSREHERSSCLSYDYM---Kdddsidllges  609
             +EDLLNLLYFG MFDVK+LQ+ F T  ML+R HER+ CLSYD M   +  D IDLLGE+
Sbjct  103  CVEDLLNLLYFGCMFDVKSLQSEFSTATMLTRTHERACCLSYDCMPEDESSDVIDLLGEN  162

Query  610  dldllsllsgllisRSANSSLPHKNALQKCI  702
            DLDL+S+LSGLLI R  NS L HK AL++CI
Sbjct  163  DLDLISMLSGLLIYRPVNSPLSHKRALRQCI  193



>ref|XP_010477771.1| PREDICTED: uncharacterized protein LOC104756820 [Camelina sativa]
Length=421

 Score =   198 bits (504),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 123/210 (59%), Positives = 160/210 (76%), Gaps = 7/210 (3%)
 Frame = +1

Query  82   MAATEVSDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVL  261
            MAAT  S+ S+GPV+ ++NKR+RAL+KKLNRI+QME+S+S+GKTLNKEQEE LR+KPAV+
Sbjct  1    MAATASSEASEGPVMGLVNKRLRALRKKLNRITQMEESVSQGKTLNKEQEEVLRSKPAVV  60

Query  262  AGIDELEKIRQPLSAALEEEISLSVQRHQ---VSALETPAPSEESGKEPEGDVENKGESD  432
              I+ELEK+R PLSAA+ EEISL+  ++     SA +   PSE+  KE E     +   D
Sbjct  61   VLIEELEKLRAPLSAAVSEEISLATNKNHNRDSSASDPTTPSEQ--KEIEVAEPPQSGDD  118

Query  433  GGVVIEDLLNLLYFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidllgesd  612
             GV +EDL+NLLYFGS+FDVK+ QN FT +ML+R HER  CLSYDY+  DD+ DLLG+ D
Sbjct  119  DGVKLEDLVNLLYFGSLFDVKS-QNEFTSIMLTRSHERGCCLSYDYV-SDDATDLLGDRD  176

Query  613  ldllsllsgllisRSANSSLPHKNALQKCI  702
            LD LS L  L++SR  +SSL HKNAL++C+
Sbjct  177  LDSLSQLWSLMVSRPVDSSLSHKNALERCV  206



>ref|XP_009785486.1| PREDICTED: uncharacterized protein LOC104233745 isoform X2 [Nicotiana 
sylvestris]
Length=434

 Score =   198 bits (503),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 123/212 (58%), Positives = 150/212 (71%), Gaps = 17/212 (8%)
 Frame = +1

Query  82   MAATEVSDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVL  261
            MA+T  S++SDGPVLSVINKR+RAL+KK NRI QME+SLSKGKTLNKEQEET R+K AVL
Sbjct  1    MASTPASELSDGPVLSVINKRLRALRKKYNRIVQMEESLSKGKTLNKEQEETFRSKSAVL  60

Query  262  AGIDELEKIRQPLSAALEEEISLSV-QRHQVSALETPAPSEESGKEPEGDVENKGESDGG  438
            AGIDELEK+RQPL+AA+ EEI+L+V Q+ QV       PSE +   P  D   KGE    
Sbjct  61   AGIDELEKLRQPLAAAVAEEINLAVEQQRQV------PPSESAVDTPIDDSNIKGE----  110

Query  439  VVIEDLLNLLYFGSMFDVKTL-QNHFTEVMLSREHERSSCLSYDYMKdddsidllgesdl  615
              +EDLLNLLYFGS+FDVK+L Q+  T  ML+R  ER+ CLSYD M +D+S D + +   
Sbjct  111  -CVEDLLNLLYFGSLFDVKSLQQSDLTATMLTRTMERACCLSYDCMPEDESTDDVMDLLG  169

Query  616  dllsllsglli----sRSANSSLPHKNALQKC  699
            +    L  +L     SR  NS L HK+ALQKC
Sbjct  170  ERDLDLISMLSGLLVSRPVNSPLSHKHALQKC  201



>ref|XP_009785484.1| PREDICTED: uncharacterized protein LOC104233745 isoform X1 [Nicotiana 
sylvestris]
Length=437

 Score =   197 bits (502),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 123/212 (58%), Positives = 150/212 (71%), Gaps = 17/212 (8%)
 Frame = +1

Query  82   MAATEVSDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVL  261
            MA+T  S++SDGPVLSVINKR+RAL+KK NRI QME+SLSKGKTLNKEQEET R+K AVL
Sbjct  1    MASTPASELSDGPVLSVINKRLRALRKKYNRIVQMEESLSKGKTLNKEQEETFRSKSAVL  60

Query  262  AGIDELEKIRQPLSAALEEEISLSV-QRHQVSALETPAPSEESGKEPEGDVENKGESDGG  438
            AGIDELEK+RQPL+AA+ EEI+L+V Q+ QV       PSE +   P  D   KGE    
Sbjct  61   AGIDELEKLRQPLAAAVAEEINLAVEQQRQV------PPSESAVDTPIDDSNIKGE----  110

Query  439  VVIEDLLNLLYFGSMFDVKTL-QNHFTEVMLSREHERSSCLSYDYMKdddsidllgesdl  615
              +EDLLNLLYFGS+FDVK+L Q+  T  ML+R  ER+ CLSYD M +D+S D + +   
Sbjct  111  -CVEDLLNLLYFGSLFDVKSLQQSDLTATMLTRTMERACCLSYDCMPEDESTDDVMDLLG  169

Query  616  dllsllsglli----sRSANSSLPHKNALQKC  699
            +    L  +L     SR  NS L HK+ALQKC
Sbjct  170  ERDLDLISMLSGLLVSRPVNSPLSHKHALQKC  201



>gb|EPS60452.1| hypothetical protein M569_14351 [Genlisea aurea]
Length=225

 Score =   191 bits (484),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 125/209 (60%), Positives = 157/209 (75%), Gaps = 9/209 (4%)
 Frame = +1

Query  82   MAATEVSDVS-DGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAV  258
            MAAT  S+V+ +GPVL +INKR+RALKKKLNRI  ME+S+S+GKTLNKEQEETLR+K +V
Sbjct  1    MAATLGSEVAAEGPVLGLINKRLRALKKKLNRIMLMEESVSQGKTLNKEQEETLRSKASV  60

Query  259  LAGIDELEKIRQPLSAALEEEISLSVQRHQVSALETPAPSEESGKEPEGDVENKGESDGG  438
            LAGIDELEK+RQPLS A+++EI L+V+++Q S   T      SG + EG V  + E DG 
Sbjct  61   LAGIDELEKLRQPLSQAVDQEIQLAVEKNQKSDALT------SGVQSEGAVHAEAEGDGT  114

Query  439  VVIEDLLNLLYFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidl-lgesdl  615
              + DLL LLYFGS+FDVKTL     + ML+R HER+ CL+YDY+ DDD+    L E DL
Sbjct  115  PAVSDLLALLYFGSIFDVKTLFG-APDNMLARTHERNCCLTYDYVTDDDTAGDPLKEHDL  173

Query  616  dllsllsgllisRSANSSLPHKNALQKCI  702
            DL+S+L  LL+SR  NSS  HKNALQKC+
Sbjct  174  DLISMLGSLLVSRPMNSSSSHKNALQKCM  202



>gb|KJB77127.1| hypothetical protein B456_012G121700 [Gossypium raimondii]
Length=440

 Score =   197 bits (500),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 128/210 (61%), Positives = 159/210 (76%), Gaps = 10/210 (5%)
 Frame = +1

Query  85   AATEVSD----VSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKP  252
            AAT  SD    VS+GPVLS INKR+RAL+KK NRI QME+S+S+GKTLNKEQ++ LR+KP
Sbjct  6    AATISSDSLATVSNGPVLSFINKRLRALRKKYNRILQMEESVSQGKTLNKEQDDVLRSKP  65

Query  253  AVLAGIDELEKIRQPLSAALEEEISLSVQRHQVSALETPAPSEESGKEPEGDVENKGESD  432
             V A IDELEK+RQPLS+A+ EEISL++QR  VS+ ET + ++    EP+  + N  +  
Sbjct  66   TVSALIDELEKLRQPLSSAVSEEISLALQRQTVSSSETTSQAQPDKTEPQEQLPNVPDH-  124

Query  433  GGVVIEDLLNLLYFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidllgesd  612
                IEDLLNLLYFGS+FDVK+ Q+ FT  ML+R HER  CL+YDY+  DD+ DLL E D
Sbjct  125  ---AIEDLLNLLYFGSLFDVKS-QSDFTSTMLTRTHERGCCLTYDYV-TDDATDLLNEKD  179

Query  613  ldllsllsgllisRSANSSLPHKNALQKCI  702
            LDL+S LSGLL SR A+SSL HKNAL +CI
Sbjct  180  LDLISTLSGLLTSRPADSSLSHKNALHRCI  209



>ref|XP_010272218.1| PREDICTED: uncharacterized protein LOC104608055 isoform X3 [Nelumbo 
nucifera]
Length=424

 Score =   196 bits (498),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 127/216 (59%), Positives = 162/216 (75%), Gaps = 14/216 (6%)
 Frame = +1

Query  82   MAATEVSDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVL  261
            MAA+  S+V+DGPVLS+INKR+RAL+KK NRI QME+ +++GK +NKEQEE LR+KP V 
Sbjct  1    MAASAASEVTDGPVLSLINKRLRALRKKYNRILQMEEGIAQGKPINKEQEEVLRSKPTVA  60

Query  262  AGIDELEKIRQPLSAALEEEISLSVQRHQVSALETPAPSEES------GKEPEGDVENKG  423
            A IDE EK+RQPL+AAL+EE+ L+VQ HQVSA  TP   +++      GKE  G+ E KG
Sbjct  61   ALIDEFEKLRQPLTAALQEELKLTVQHHQVSA--TPHVVDDNVEDSKDGKEESGESE-KG  117

Query  424  ESDGG---VVIEDLLNLLYFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsid  594
             SDG     ++EDLLNLLYF S+FDVK  Q+ FT  ML+R HER  CL+YDY+  DD+ D
Sbjct  118  RSDGDRDESILEDLLNLLYFASLFDVKP-QSDFTSTMLTRTHERGCCLTYDYV-TDDATD  175

Query  595  llgesdldllsllsgllisRSANSSLPHKNALQKCI  702
            LLGE DLD++S+L  LLISR  +S L HKNAL+ C+
Sbjct  176  LLGERDLDMISMLGSLLISRPVHSILSHKNALRSCV  211



>ref|XP_010460222.1| PREDICTED: uncharacterized protein LOC104741134 [Camelina sativa]
Length=418

 Score =   195 bits (496),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 120/207 (58%), Positives = 157/207 (76%), Gaps = 5/207 (2%)
 Frame = +1

Query  82   MAATEVSDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVL  261
            MAAT  S+ S+GPV+ ++NKR+RAL+KKLNRI+QME+S+S+GKTLNKEQEE LR+KPAV+
Sbjct  1    MAATASSEASEGPVMGLVNKRLRALRKKLNRITQMEESVSQGKTLNKEQEEVLRSKPAVV  60

Query  262  AGIDELEKIRQPLSAALEEEISLSVQRHQVSALETPAPSEESGKEPEGDVENKGESDGGV  441
              I+ELEK+R PLSAA+ EEISL+  +    + +    SE+  KE E   E     D GV
Sbjct  61   VLIEELEKLRAPLSAAVSEEISLATTKDHRDSSDPTTASEQ--KEIEV-AEPPQSGDDGV  117

Query  442  VIEDLLNLLYFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidllgesdldl  621
             +EDL+NLLYFGS+FDVK+ QN FT +ML+R HER  CLSYDY+  DD+ DLLG+ DLD 
Sbjct  118  KLEDLVNLLYFGSLFDVKS-QNEFTSIMLTRSHERGCCLSYDYV-SDDATDLLGDRDLDS  175

Query  622  lsllsgllisRSANSSLPHKNALQKCI  702
            +S L  L++SR  +SSL HKNAL++C+
Sbjct  176  ISQLWSLMVSRPVDSSLSHKNALERCV  202



>ref|XP_010272217.1| PREDICTED: uncharacterized protein LOC104608055 isoform X2 [Nelumbo 
nucifera]
Length=452

 Score =   196 bits (498),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 127/216 (59%), Positives = 162/216 (75%), Gaps = 14/216 (6%)
 Frame = +1

Query  82   MAATEVSDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVL  261
            MAA+  S+V+DGPVLS+INKR+RAL+KK NRI QME+ +++GK +NKEQEE LR+KP V 
Sbjct  1    MAASAASEVTDGPVLSLINKRLRALRKKYNRILQMEEGIAQGKPINKEQEEVLRSKPTVA  60

Query  262  AGIDELEKIRQPLSAALEEEISLSVQRHQVSALETPAPSEES------GKEPEGDVENKG  423
            A IDE EK+RQPL+AAL+EE+ L+VQ HQVSA  TP   +++      GKE  G+ E KG
Sbjct  61   ALIDEFEKLRQPLTAALQEELKLTVQHHQVSA--TPHVVDDNVEDSKDGKEESGESE-KG  117

Query  424  ESDGG---VVIEDLLNLLYFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsid  594
             SDG     ++EDLLNLLYF S+FDVK  Q+ FT  ML+R HER  CL+YDY+  DD+ D
Sbjct  118  RSDGDRDESILEDLLNLLYFASLFDVKP-QSDFTSTMLTRTHERGCCLTYDYV-TDDATD  175

Query  595  llgesdldllsllsgllisRSANSSLPHKNALQKCI  702
            LLGE DLD++S+L  LLISR  +S L HKNAL+ C+
Sbjct  176  LLGERDLDMISMLGSLLISRPVHSILSHKNALRSCV  211



>ref|XP_010096321.1| hypothetical protein L484_021067 [Morus notabilis]
 gb|EXB63796.1| hypothetical protein L484_021067 [Morus notabilis]
Length=458

 Score =   196 bits (498),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 129/207 (62%), Positives = 160/207 (77%), Gaps = 8/207 (4%)
 Frame = +1

Query  82   MAATEVSDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVL  261
            MAATEVSD   GPVLS+INKR+RAL+KKLNRI+QME+++S+GK +N+EQEE LR+KP V 
Sbjct  1    MAATEVSD---GPVLSLINKRLRALRKKLNRITQMEEAISQGKPINREQEEVLRSKPGVS  57

Query  262  AGIDELEKIRQPLSAALEEEISLSVQRHQVSALETPAPSEESGKEPEGDVENKGESDGGV  441
            A IDELEK+RQP++ A+ EE+SL+VQ HQVS+L + A  +E   EPE  V      +  V
Sbjct  58   ALIDELEKLRQPIADAVAEEVSLAVQLHQVSSL-SDADRQEKPDEPETAVPEPDRREAEV  116

Query  442  VIEDLLNLLYFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidllgesdldl  621
              EDLLNLLYFGS+FDVK  Q+ FT  ML+R HER  CL+YDY+  DD+ DLLGE DLDL
Sbjct  117  --EDLLNLLYFGSLFDVKP-QSDFTSTMLTRTHERGCCLTYDYV-TDDATDLLGERDLDL  172

Query  622  lsllsgllisRSANSSLPHKNALQKCI  702
            +S L GLLISR  +SSL HKNALQ+C+
Sbjct  173  ISKLGGLLISRPVDSSLSHKNALQRCL  199



>ref|XP_010272216.1| PREDICTED: uncharacterized protein LOC104608055 isoform X1 [Nelumbo 
nucifera]
Length=516

 Score =   196 bits (497),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 127/216 (59%), Positives = 162/216 (75%), Gaps = 14/216 (6%)
 Frame = +1

Query  82   MAATEVSDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVL  261
            MAA+  S+V+DGPVLS+INKR+RAL+KK NRI QME+ +++GK +NKEQEE LR+KP V 
Sbjct  1    MAASAASEVTDGPVLSLINKRLRALRKKYNRILQMEEGIAQGKPINKEQEEVLRSKPTVA  60

Query  262  AGIDELEKIRQPLSAALEEEISLSVQRHQVSALETPAPSEES------GKEPEGDVENKG  423
            A IDE EK+RQPL+AAL+EE+ L+VQ HQVSA  TP   +++      GKE  G+ E KG
Sbjct  61   ALIDEFEKLRQPLTAALQEELKLTVQHHQVSA--TPHVVDDNVEDSKDGKEESGESE-KG  117

Query  424  ESDGG---VVIEDLLNLLYFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsid  594
             SDG     ++EDLLNLLYF S+FDVK  Q+ FT  ML+R HER  CL+YDY+  DD+ D
Sbjct  118  RSDGDRDESILEDLLNLLYFASLFDVKP-QSDFTSTMLTRTHERGCCLTYDYV-TDDATD  175

Query  595  llgesdldllsllsgllisRSANSSLPHKNALQKCI  702
            LLGE DLD++S+L  LLISR  +S L HKNAL+ C+
Sbjct  176  LLGERDLDMISMLGSLLISRPVHSILSHKNALRSCV  211



>ref|XP_010256182.1| PREDICTED: uncharacterized protein LOC104596615 [Nelumbo nucifera]
Length=445

 Score =   194 bits (493),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 125/219 (57%), Positives = 163/219 (74%), Gaps = 23/219 (11%)
 Frame = +1

Query  82   MAATEVSDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVL  261
            MAA+  S+V+DGPVLS+INKR+RAL+KK NRI QMED +S+GK +NKEQEE LR+KPAV 
Sbjct  1    MAASAASEVTDGPVLSLINKRLRALRKKYNRILQMEDGISQGKPINKEQEEVLRSKPAVA  60

Query  262  AGIDELEKIRQPLSAALEEEISLSVQRHQVSALETPAPSEESGKE------------PEG  405
            A IDE+EK+RQPL+AAL+EE++L+VQRHQVSA  TP   +++ K+            P+ 
Sbjct  61   ALIDEVEKLRQPLTAALQEELNLAVQRHQVSA--TPPVVDDNVKDSEEEGGEPEETRPDW  118

Query  406  DVENKGESDGGVVIEDLLNLLYFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKddd  585
            D   + E+    V+EDLLNLLYFGS+FDVK  Q+ FT  ML+R HER  CL+YDY+  DD
Sbjct  119  D---RNEA----VLEDLLNLLYFGSLFDVKP-QSDFTSTMLTRTHERGCCLTYDYV-TDD  169

Query  586  sidllgesdldllsllsgllisRSANSSLPHKNALQKCI  702
            + DLLGE DLD++S+L  L+ISR  +S   HKNAL+ C+
Sbjct  170  ATDLLGEKDLDMISMLGSLVISRPVHSIFSHKNALRSCV  208



>gb|KJB61232.1| hypothetical protein B456_009G346800 [Gossypium raimondii]
Length=365

 Score =   191 bits (486),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 123/198 (62%), Positives = 151/198 (76%), Gaps = 11/198 (6%)
 Frame = +1

Query  109  SDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVLAGIDELEKI  288
            SDGPVLS+INKRIRAL+KK NRI QME+S+S+GK LNKEQEE LR+KP+V A IDELEK+
Sbjct  20   SDGPVLSLINKRIRALRKKYNRILQMEESVSQGKPLNKEQEEVLRSKPSVSALIDELEKL  79

Query  289  RQPLSAALEEEISLSVQRHQVSALETPAPSEESGKEPEGDVENKGESDGGVVIEDLLNLL  468
            R PLS+A+ EEISL++QR  +SA       EE+  E +   +   E D  V  EDLLNLL
Sbjct  80   RHPLSSAVSEEISLALQRQTISA-------EETTSEAQQQQQPPSEPDHAV--EDLLNLL  130

Query  469  YFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidllgesdldllsllsglli  648
            YFGS+FDVK+ QN FT +ML+R HER  CL+YDY+  DD+ DLL E DLD +S LSGLL 
Sbjct  131  YFGSLFDVKS-QNDFTSMMLTRTHERGCCLTYDYV-TDDATDLLSEKDLDSISTLSGLLT  188

Query  649  sRSANSSLPHKNALQKCI  702
            SRSA+SSL HK+AL +C+
Sbjct  189  SRSADSSLSHKSALHRCL  206



>ref|XP_010498969.1| PREDICTED: uncharacterized protein LOC104776570 [Camelina sativa]
Length=418

 Score =   192 bits (488),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 118/207 (57%), Positives = 157/207 (76%), Gaps = 5/207 (2%)
 Frame = +1

Query  82   MAATEVSDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVL  261
            MAAT  S+ S+GPV+ ++NKR+RAL+KKLNRI+QME+S+S+GKTLNKEQEE LR+KPAV+
Sbjct  1    MAATASSEASEGPVMGLVNKRLRALRKKLNRITQMEESVSQGKTLNKEQEEVLRSKPAVV  60

Query  262  AGIDELEKIRQPLSAALEEEISLSVQRHQVSALETPAPSEESGKEPEGDVENKGESDGGV  441
              I+ELEK+R PLSAA+ EEISL+  ++   + +    SE+  KE E   E     D GV
Sbjct  61   VLIEELEKLRAPLSAAVSEEISLATTKNHRDSSDPTTASEQ--KEIEV-AEPPQSGDDGV  117

Query  442  VIEDLLNLLYFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidllgesdldl  621
             +EDL+NLLYFGS+FDVK+ QN FT +ML+R HER  CLSYD++  DD+ DLLG+ DLD 
Sbjct  118  KLEDLVNLLYFGSLFDVKS-QNEFTSIMLTRSHERGCCLSYDFV-SDDATDLLGDRDLDS  175

Query  622  lsllsgllisRSANSSLPHKNALQKCI  702
            +S L  L++SR  +S L HKNAL++C+
Sbjct  176  ISQLWSLMVSRPVDSRLSHKNALERCV  202



>ref|XP_008221700.1| PREDICTED: keratin, type I cytoskeletal 10 [Prunus mume]
Length=443

 Score =   192 bits (489),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 124/209 (59%), Positives = 155/209 (74%), Gaps = 4/209 (2%)
 Frame = +1

Query  82   MAATEVSDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVL  261
            MAAT  SD+SDGPVLS+INKRIRAL+KK NRI QME++LS+GK LNKEQEE LR+KPAV+
Sbjct  1    MAATAASDLSDGPVLSLINKRIRALRKKQNRIIQMEEALSQGKVLNKEQEEVLRSKPAVI  60

Query  262  AGIDELEKIRQPLSAALEEEISLSVQRHQVSALETPAPSEESGKEPEGDVENKGESDG--  435
              I+ELEK+RQPLS A+ EE  L+V RHQVSA   P   ++  +E + +V    ESD   
Sbjct  61   VLIEELEKLRQPLSVAVTEEHDLAVHRHQVSASTQPLLDDKPQEEDKSNVAQPTESDDRQ  120

Query  436  GVVIEDLLNLLYFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidllgesdl  615
            G  +E+LLNLLYFGS+FDVK+  + FT ++L+R HER  CL+      DD  ++LG  DL
Sbjct  121  GASVEELLNLLYFGSLFDVKSPSD-FTRIILTRTHERECCLT-YDTITDDDTEMLGARDL  178

Query  616  dllsllsgllisRSANSSLPHKNALQKCI  702
            DL+S L GLLISR  +SSL HKNALQ+CI
Sbjct  179  DLISTLGGLLISRPVDSSLSHKNALQRCI  207



>gb|KJB61231.1| hypothetical protein B456_009G346800 [Gossypium raimondii]
Length=451

 Score =   191 bits (484),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 123/198 (62%), Positives = 151/198 (76%), Gaps = 11/198 (6%)
 Frame = +1

Query  109  SDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVLAGIDELEKI  288
            SDGPVLS+INKRIRAL+KK NRI QME+S+S+GK LNKEQEE LR+KP+V A IDELEK+
Sbjct  20   SDGPVLSLINKRIRALRKKYNRILQMEESVSQGKPLNKEQEEVLRSKPSVSALIDELEKL  79

Query  289  RQPLSAALEEEISLSVQRHQVSALETPAPSEESGKEPEGDVENKGESDGGVVIEDLLNLL  468
            R PLS+A+ EEISL++QR  +SA       EE+  E +   +   E D  V  EDLLNLL
Sbjct  80   RHPLSSAVSEEISLALQRQTISA-------EETTSEAQQQQQPPSEPDHAV--EDLLNLL  130

Query  469  YFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidllgesdldllsllsglli  648
            YFGS+FDVK+ QN FT +ML+R HER  CL+YDY+  DD+ DLL E DLD +S LSGLL 
Sbjct  131  YFGSLFDVKS-QNDFTSMMLTRTHERGCCLTYDYV-TDDATDLLSEKDLDSISTLSGLLT  188

Query  649  sRSANSSLPHKNALQKCI  702
            SRSA+SSL HK+AL +C+
Sbjct  189  SRSADSSLSHKSALHRCL  206



>emb|CDP00272.1| unnamed protein product [Coffea canephora]
Length=316

 Score =   187 bits (474),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 123/199 (62%), Positives = 145/199 (73%), Gaps = 13/199 (7%)
 Frame = +1

Query  109  SDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVLAGIDELEKI  288
            +DGPVLS+INKR+RAL+KK NRI QME+SLS GK LNKEQEETLR+KP V+A IDELEK+
Sbjct  14   TDGPVLSLINKRLRALRKKHNRILQMEESLSLGKALNKEQEETLRSKPYVIAAIDELEKL  73

Query  289  RQPLSAALEEEISLSVQRHQVSALETPAPSEESGKEPEGDVENKGESDGGVVIEDLLNLL  468
            +QPL+ A+ EEI+ ++Q H            E+         +K ES    V EDLLNLL
Sbjct  74   KQPLAVAVSEEINAAIQSHS-----------ENSPTTTDSTTDKAESGEHGVAEDLLNLL  122

Query  469  YFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidllg-esdldllsllsgll  645
            YFGSMFDVK  QN FT  ML+R HER  CL+YDY+ DDD+ DLL  E DLDL+S+L GLL
Sbjct  123  YFGSMFDVKN-QNDFTATMLTRTHERGCCLTYDYVTDDDAADLLLGERDLDLISMLGGLL  181

Query  646  isRSANSSLPHKNALQKCI  702
            ISR  NSSL HKNALQKCI
Sbjct  182  ISRPVNSSLSHKNALQKCI  200



>ref|XP_009762263.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC104214311 
[Nicotiana sylvestris]
Length=349

 Score =   187 bits (474),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 122/213 (57%), Positives = 148/213 (69%), Gaps = 17/213 (8%)
 Frame = +1

Query  82   MAATEVSDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVL  261
            MA+T  S++SD PVLSVINKR+ AL+KK N I QME+SLSKGKTLNKEQEE  R+K AVL
Sbjct  1    MASTPASELSDRPVLSVINKRLCALRKKYNHIVQMEESLSKGKTLNKEQEEIFRSKSAVL  60

Query  262  AGIDELEKIRQPLSAALEEEISLSV-QRHQVSALETPAPSEESGKEPEGDVENKGESDGG  438
            AGIDELEK+RQPL+AA+ EEI+L+V Q+ QV       PSE +   P  D   KGE    
Sbjct  61   AGIDELEKLRQPLAAAVAEEINLTVEQQRQV------PPSEFAVDTPIDDSNIKGE----  110

Query  439  VVIEDLLNLLYFGSMFDVKTLQ-NHFTEVMLSREHERSSCLSYDYM----Kdddsidllg  603
              +EDLLNL YFGSMFDVK+LQ +    +ML+R  ER+ CLSYD M    +         
Sbjct  111  -CVEDLLNLFYFGSMFDVKSLQESDLIAMMLTRTMERACCLSYDCMPEDNRLTTXWICXA  169

Query  604  esdldllsllsgllisRSANSSLPHKNALQKCI  702
            + DLDL+S+LSG L+SR  NS L HK+AL KCI
Sbjct  170  KKDLDLISMLSGFLVSRPVNSPLSHKHALHKCI  202



>ref|XP_009759105.1| PREDICTED: uncharacterized protein LOC104211710 [Nicotiana sylvestris]
Length=429

 Score =   189 bits (479),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 117/211 (55%), Positives = 150/211 (71%), Gaps = 22/211 (10%)
 Frame = +1

Query  82   MAATEVSDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVL  261
            MAA   SDVS+GPV SVINKR+RAL+KK NRI QME+S+SKGKTLNKEQEETLR+KP+V+
Sbjct  1    MAA---SDVSEGPVRSVINKRLRALRKKYNRIVQMEESVSKGKTLNKEQEETLRSKPSVI  57

Query  262  AGIDELEKIRQPLSAALEEEISLSVQRHQVSALETPAPSEESGKEPEGDVENKGESDGGV  441
            AGIDELEK+R+PL++A+ EEI+L        A    AP       P+ + +N+GE +  +
Sbjct  58   AGIDELEKLREPLASAVAEEINL--------ATSVSAP-------PDNNSKNEGEGEVIM  102

Query  442  VIEDLLNLLYFGSMFDVKTLQNHF-TEVMLSREHERSSCLSYDYMKdddsidllgesdld  618
             +EDLL LLYFG MFDVK+LQ+ F T  ML+R HER+ CL+YD M++D+S D++      
Sbjct  103  CVEDLLYLLYFGCMFDVKSLQSDFSTATMLTRTHERACCLNYDCMQEDESSDVIDLLGEK  162

Query  619  llsllsglli---sRSANSSLPHKNALQKCI  702
             L L+S L     SR  NS L HK ALQ+CI
Sbjct  163  DLDLISMLSGLLISRPVNSPLSHKRALQQCI  193



>ref|XP_002520157.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF42212.1| conserved hypothetical protein [Ricinus communis]
Length=440

 Score =   189 bits (479),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 119/207 (57%), Positives = 153/207 (74%), Gaps = 11/207 (5%)
 Frame = +1

Query  82   MAATEVSDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVL  261
            MAAT  S+ ++GPVL++INKR+RAL+KK NRI QME+S+S+GK +NKEQE+ LR+KP V 
Sbjct  1    MAATSSSEATEGPVLNLINKRLRALRKKYNRIIQMEESISQGKPINKEQEDVLRSKPYVT  60

Query  262  AGIDELEKIRQPLSAALEEEISLSVQRHQVSALETPAPSEESGKEPEGDVENKGESDGGV  441
            A I+ELEK++QPLS A+ EEI L++QR Q  +  +   + E+  +  G         GG+
Sbjct  61   ASIEELEKLKQPLSVAVSEEIDLAIQRQQQQSSSSDRTTNEANGDSNG---------GGL  111

Query  442  VIEDLLNLLYFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidllgesdldl  621
             IEDLLNLLYFGS+FDVK+ QN FT  ML+R HER  CL+YDY+  DD+ DLLGE DLD+
Sbjct  112  AIEDLLNLLYFGSLFDVKS-QNEFTATMLTRTHERGCCLTYDYV-TDDATDLLGERDLDM  169

Query  622  lsllsgllisRSANSSLPHKNALQKCI  702
            +S L  LLISR  +SSL HKNAL KCI
Sbjct  170  ISKLGALLISRPVDSSLSHKNALVKCI  196



>ref|XP_006415997.1| hypothetical protein EUTSA_v10007745mg [Eutrema salsugineum]
 gb|ESQ34350.1| hypothetical protein EUTSA_v10007745mg [Eutrema salsugineum]
Length=417

 Score =   187 bits (475),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 111/198 (56%), Positives = 153/198 (77%), Gaps = 10/198 (5%)
 Frame = +1

Query  112  DGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVLAGIDELEKIR  291
            +GPV+++INKR+RAL+KK NRI+QME+S+S+GKTLNKEQ+E LR+KPAV+  I+ELEK+R
Sbjct  13   EGPVMALINKRLRALRKKYNRITQMEESISQGKTLNKEQQEVLRSKPAVVVLIEELEKLR  72

Query  292  QPLSAALEEEISL-SVQRHQVSALETPAPSEESGKEPEGDVENKGESDGGVVIEDLLNLL  468
             PLSAA+ EEISL + Q H+ S+ +TPA         + ++  +  SDG   +EDL+NLL
Sbjct  73   APLSAAVSEEISLATTQHHRESSDQTPAC-------VQVNIPEESHSDGDAKLEDLVNLL  125

Query  469  YFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidllgesdldllsllsglli  648
            YFGS+FDVK+ QN FT +M++R HER  CL+YDY+  DD+ +LL + DLDL+S L  ++I
Sbjct  126  YFGSLFDVKS-QNDFTSIMMTRMHERGCCLTYDYV-TDDAEELLSDRDLDLISNLWSMMI  183

Query  649  sRSANSSLPHKNALQKCI  702
            SR  +SSL HKNAL++CI
Sbjct  184  SRPVDSSLSHKNALERCI  201



>ref|XP_007044389.1| Glycine-rich protein, putative isoform 2 [Theobroma cacao]
 gb|EOY00221.1| Glycine-rich protein, putative isoform 2 [Theobroma cacao]
Length=325

 Score =   184 bits (468),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 117/197 (59%), Positives = 153/197 (78%), Gaps = 6/197 (3%)
 Frame = +1

Query  112  DGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVLAGIDELEKIR  291
            +GPVL++INKR+RAL+KK NRI QME+S+S+GK LNKEQEE LR+KPAV A IDELEK+R
Sbjct  20   EGPVLNLINKRLRALRKKYNRILQMEESVSQGKPLNKEQEEVLRSKPAVSALIDELEKLR  79

Query  292  QPLSAALEEEISLSVQRHQVSALETPAPSEESGKEPEGDVENKGESDGGVVIEDLLNLLY  471
            QPLS+A+ EEISL++Q   +   ET + +++     E +V+ +  ++    +EDLLNLLY
Sbjct  80   QPLSSAVSEEISLALQCQTIFPDETASEAQQD----ETEVQEQQPNEPDHAVEDLLNLLY  135

Query  472  FGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidllgesdldllsllsgllis  651
            FGS+FDVK+ QN FT  ML+R HER  CL+YDY+  DD+ DLL E DLDL+S+LSGLL S
Sbjct  136  FGSIFDVKS-QNDFTSTMLTRTHERGCCLTYDYV-TDDATDLLSEKDLDLISMLSGLLTS  193

Query  652  RSANSSLPHKNALQKCI  702
            R A+SSL HKNAL +C+
Sbjct  194  RPADSSLSHKNALHRCL  210



>ref|XP_006378167.1| glycine-rich family protein [Populus trichocarpa]
 gb|ERP55964.1| glycine-rich family protein [Populus trichocarpa]
Length=273

 Score =   182 bits (462),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 119/207 (57%), Positives = 151/207 (73%), Gaps = 19/207 (9%)
 Frame = +1

Query  82   MAATEVSDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVL  261
            MAAT  S+++DGPVLS+I KR+RALKKK NRI QME+S+++GK +NKEQE+ LR+KP+V 
Sbjct  1    MAATPTSEMADGPVLSLITKRLRALKKKHNRILQMEESIAQGKPINKEQEDFLRSKPSVS  60

Query  262  AGIDELEKIRQPLSAALEEEISLSVQRHQVSALETPAPSEESGKEPEGDVENKGESDGGV  441
            A IDELEK+RQPLS A+ EEI L+  R          P  +S   PE   E         
Sbjct  61   AAIDELEKLRQPLSIAVSEEIELAAHRLN--------PKSDSTVVPEASDE---------  103

Query  442  VIEDLLNLLYFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidllgesdldl  621
            ++EDLL+LLYFGS+FDVK+ QN FT  ML+R HER  CL+YDY+  DD+ DLLGE DLD+
Sbjct  104  MLEDLLHLLYFGSLFDVKS-QNDFTATMLTRTHERGCCLTYDYV-TDDATDLLGERDLDM  161

Query  622  lsllsgllisRSANSSLPHKNALQKCI  702
            +S+L GLLISR  N+SL HKNALQ+C+
Sbjct  162  ISMLGGLLISRPGNTSLSHKNALQRCM  188



>ref|XP_007157411.1| hypothetical protein PHAVU_002G067800g [Phaseolus vulgaris]
 gb|ESW29405.1| hypothetical protein PHAVU_002G067800g [Phaseolus vulgaris]
Length=438

 Score =   184 bits (468),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 118/207 (57%), Positives = 150/207 (72%), Gaps = 9/207 (4%)
 Frame = +1

Query  82   MAATEVSDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVL  261
            MA     DV+DGPV+++INKRIRA +KK+NRI  ME+SLS+GKTLNKEQEE LRTKP++L
Sbjct  1    MATPASPDVADGPVMNLINKRIRAYRKKINRIQAMEESLSQGKTLNKEQEEFLRTKPSIL  60

Query  262  AGIDELEKIRQPLSAALEEEISLSVQRHQVSALETPAPSEESGKEPEGDVENKGESDGGV  441
            A IDE EK+RQPL++AL EE+  +         ETP  +E SG   +   ++   S+  V
Sbjct  61   ALIDEFEKLRQPLASALTEELQGAAPN--ARGAETPTLAESSGSFEQPPPQH---SEDDV  115

Query  442  VIEDLLNLLYFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidllgesdldl  621
            V+EDLLNLLYFGS+FDVK+    F   ML+R HER  CL+YDY+  DD+ DLLGE DLD 
Sbjct  116  VVEDLLNLLYFGSLFDVKS---DFASTMLTRTHERGCCLTYDYV-TDDATDLLGEKDLDS  171

Query  622  lsllsgllisRSANSSLPHKNALQKCI  702
            +S L GLL+SR A+SS  HKNALQ+C+
Sbjct  172  ISALRGLLVSRPADSSFSHKNALQRCV  198



>ref|XP_007044388.1| Glycine-rich protein, putative isoform 1 [Theobroma cacao]
 gb|EOY00220.1| Glycine-rich protein, putative isoform 1 [Theobroma cacao]
Length=453

 Score =   184 bits (466),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 117/197 (59%), Positives = 153/197 (78%), Gaps = 6/197 (3%)
 Frame = +1

Query  112  DGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVLAGIDELEKIR  291
            +GPVL++INKR+RAL+KK NRI QME+S+S+GK LNKEQEE LR+KPAV A IDELEK+R
Sbjct  20   EGPVLNLINKRLRALRKKYNRILQMEESVSQGKPLNKEQEEVLRSKPAVSALIDELEKLR  79

Query  292  QPLSAALEEEISLSVQRHQVSALETPAPSEESGKEPEGDVENKGESDGGVVIEDLLNLLY  471
            QPLS+A+ EEISL++Q   +   ET + +++     E +V+ +  ++    +EDLLNLLY
Sbjct  80   QPLSSAVSEEISLALQCQTIFPDETASEAQQD----ETEVQEQQPNEPDHAVEDLLNLLY  135

Query  472  FGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidllgesdldllsllsgllis  651
            FGS+FDVK+ QN FT  ML+R HER  CL+YDY+  DD+ DLL E DLDL+S+LSGLL S
Sbjct  136  FGSIFDVKS-QNDFTSTMLTRTHERGCCLTYDYV-TDDATDLLSEKDLDLISMLSGLLTS  193

Query  652  RSANSSLPHKNALQKCI  702
            R A+SSL HKNAL +C+
Sbjct  194  RPADSSLSHKNALHRCL  210



>ref|XP_004238757.1| PREDICTED: uncharacterized protein LOC101253779 [Solanum lycopersicum]
Length=428

 Score =   183 bits (464),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 111/213 (52%), Positives = 142/213 (67%), Gaps = 18/213 (8%)
 Frame = +1

Query  82   MAATEVSDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVL  261
            M AT  S+ SDGPVL+VINKR+RAL+KK NRI QME+SL+ GKTLNKEQEET R+KP+V+
Sbjct  1    MEATAASETSDGPVLNVINKRLRALRKKYNRILQMEESLANGKTLNKEQEETFRSKPSVV  60

Query  262  AGIDELEKIRQPLSAALEEEISLSVQRHQVSALETPAPSEESGKEPEGDVENKGESDGGV  441
            A IDELEK+RQPL+AA+ EEI+L+ Q H VSA ++P            D +  G+ D   
Sbjct  61   AAIDELEKLRQPLAAAVTEEINLATQHHLVSAADSP------------DEKLAGKGDNSC  108

Query  442  V-IEDLLNLLYFGSMFDVKTL-QNHFTEVMLSRE-HERSSCLSYDYMKdddsidllgesd  612
            V +EDLLN++YFGSMF      +N F   M  R  HER+ CL+YD M +D+S D++    
Sbjct  109  VEVEDLLNIIYFGSMFAHANWGKNDFVSTMWKRAMHERACCLNYDCMPEDESTDVIDMLS  168

Query  613  ldllsllsglli---sRSANSSLPHKNALQKCI  702
               L L+S L      R  NS+L HK+ALQ CI
Sbjct  169  EKDLDLISMLSELLICRPVNSTLSHKHALQACI  201



>ref|XP_002312704.1| glycine-rich family protein [Populus trichocarpa]
 gb|EEE90071.1| glycine-rich family protein [Populus trichocarpa]
Length=434

 Score =   182 bits (463),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 104/207 (50%), Positives = 136/207 (66%), Gaps = 18/207 (9%)
 Frame = +1

Query  82   MAATEVSDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVL  261
            MAA   S++++GPVLS+I KR+R LKKK NRI QME+S+++GK +NKEQE+ LR+KP+V 
Sbjct  1    MAAASTSEITEGPVLSLITKRLRGLKKKFNRIVQMEESIAQGKPINKEQEDFLRSKPSVA  60

Query  262  AGIDELEKIRQPLSAALEEEISLSVQRHQVSALETPAPSEESGKEPEGDVENKGESDGGV  441
            A IDELEK+RQPLS A+ EEI L+  R    +  T  P   +G                 
Sbjct  61   AAIDELEKLRQPLSVAVSEEIELAAHRLNPKSDSTVVPEASNG-----------------  103

Query  442  VIEDLLNLLYFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidllgesdldl  621
            V+EDLL+L YFG +FDV++ QN FT  ML+R HER  CL+YDY+ DD +  L       +
Sbjct  104  VVEDLLHLFYFGCLFDVRS-QNDFTATMLTRTHERGCCLTYDYVTDDATDLLSERDLDMI  162

Query  622  lsllsgllisRSANSSLPHKNALQKCI  702
              L  GL+ISR  NSSL HKNALQ+C+
Sbjct  163  SILGGGLIISRPVNSSLSHKNALQRCM  189



>ref|XP_008389541.1| PREDICTED: uncharacterized protein LOC103451881 [Malus domestica]
Length=435

 Score =   182 bits (462),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 120/209 (57%), Positives = 152/209 (73%), Gaps = 10/209 (5%)
 Frame = +1

Query  82   MAATEVSDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVL  261
            M AT  SD+SDGPVLS+INKRIRAL+KK NRI QME+SL++GK LNKEQE  L++KP V 
Sbjct  1    MEATAASDLSDGPVLSLINKRIRALRKKQNRIIQMEESLAQGKVLNKEQEGVLKSKPGVF  60

Query  262  AGIDELEKIRQPLSAALEEEISLSVQRHQVSALETPAPSEESGKEPEGDVENKGESDG--  435
            A I+ELEK+RQPL+ A+ EE SL+VQRHQVSA  TP  S++     + +V    ESD   
Sbjct  61   ALIEELEKLRQPLADAVAEEQSLAVQRHQVSA-PTPPISDD-----KPNVLQPSESDDRQ  114

Query  436  GVVIEDLLNLLYFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidllgesdl  615
               +E+LLNLLYFGS+FDVK+ Q+ FT ++L+R HER  CL+      DD  ++L   DL
Sbjct  115  AAAVEELLNLLYFGSLFDVKS-QSDFTRIILTRTHERECCLT-YDTITDDDTEMLAPRDL  172

Query  616  dllsllsgllisRSANSSLPHKNALQKCI  702
            DL+S L G LISR  +SSL HKNALQ+C+
Sbjct  173  DLISSLGGFLISRPGDSSLSHKNALQQCL  201



>ref|XP_011011854.1| PREDICTED: uncharacterized protein LOC105116275 [Populus euphratica]
Length=425

 Score =   182 bits (461),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 119/207 (57%), Positives = 151/207 (73%), Gaps = 19/207 (9%)
 Frame = +1

Query  82   MAATEVSDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVL  261
            MAAT  S+++DGP+LSVI KR+RALKKK NRI QME+S+++GK +NKEQE+ LR+KP+V 
Sbjct  1    MAATPTSEMTDGPILSVITKRLRALKKKHNRILQMEESIAQGKPINKEQEDFLRSKPSVS  60

Query  262  AGIDELEKIRQPLSAALEEEISLSVQRHQVSALETPAPSEESGKEPEGDVENKGESDGGV  441
            A IDELEK+RQPLS A+ EEI L+  R          P  +S   PE   E         
Sbjct  61   AAIDELEKLRQPLSIAVSEEIELAAHRLN--------PKSDSTVVPEASDE---------  103

Query  442  VIEDLLNLLYFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidllgesdldl  621
            ++EDLL+LLYFGS+FDVK+ QN FT  ML+R HER  CL+YDY+  DD+ DLLGE DLD+
Sbjct  104  MLEDLLHLLYFGSLFDVKS-QNDFTATMLTRTHERGCCLTYDYV-TDDATDLLGERDLDM  161

Query  622  lsllsgllisRSANSSLPHKNALQKCI  702
            +S+L GLLISR  N+SL HKNALQ+C+
Sbjct  162  ISMLGGLLISRPGNTSLSHKNALQRCM  188



>ref|XP_011086413.1| PREDICTED: uncharacterized protein LOC105168156 [Sesamum indicum]
Length=448

 Score =   182 bits (462),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 122/216 (56%), Positives = 155/216 (72%), Gaps = 14/216 (6%)
 Frame = +1

Query  82   MAATEVSDVS------DGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLR  243
            MAAT V+  S      DGPVL++INKR+RAL+KKLNRI+QME+S+S+GKTLNKEQEETLR
Sbjct  1    MAATAVALSSSSEMGSDGPVLNLINKRLRALRKKLNRITQMEESVSQGKTLNKEQEETLR  60

Query  244  TKPAVLAGIDELEKIRQPLSAALEEEISLSVQRHQVS--ALETPAPSEESGKEPEGDVEN  417
            +KP+VLAGIDELEK+RQPLS A+ +EI L++++++ S          EE   EP  D   
Sbjct  61   SKPSVLAGIDELEKLRQPLSQAVNQEIQLALEKNKQSPETTTEERTEEEGTLEPGAD---  117

Query  418  KGESDGGVVIEDLLNLLYFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidl  597
             GE DG   + DLL L+YF S+FDVKTL     + ML+R HER+ CL+YDY+ DDD+   
Sbjct  118  -GEKDGVSAVSDLLGLVYFASIFDVKTLM-RAQDNMLTRTHERNCCLTYDYVTDDDAAGD  175

Query  598  l-gesdldllsllsgllisRSANSSLPHKNALQKCI  702
               E DLDL+++L  LLISR  NSSL HKNALQ C+
Sbjct  176  PLQEWDLDLIAMLGSLLISRPVNSSLSHKNALQTCV  211



>ref|XP_004489967.1| PREDICTED: keratin, type I cytoskeletal 10-like [Cicer arietinum]
Length=433

 Score =   182 bits (461),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 119/207 (57%), Positives = 153/207 (74%), Gaps = 13/207 (6%)
 Frame = +1

Query  82   MAATEVSDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVL  261
            MAA   S  +DGPV+S+INKR+RAL+KKLNRI+ ME+S S+GK LNKEQEE LR+K +VL
Sbjct  1    MAA---STTTDGPVMSLINKRLRALRKKLNRITAMEESQSQGKPLNKEQEEVLRSKSSVL  57

Query  262  AGIDELEKIRQPLSAALEEEISLSVQRHQVSALETPAPSEESGKEPEGDVENKGESDGGV  441
            A IDE EK+RQPLS+AL EE+ L++Q  + +  E  AP  E          N+ ++  G 
Sbjct  58   ALIDEFEKLRQPLSSALTEELDLALQNTRETLPENSAPVSER--------LNESQNKNGD  109

Query  442  VIEDLLNLLYFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidllgesdldl  621
            V+ED++NLLYFGS+F+VK+ QN FT  ML+R HER  CL+YDY+  DD+ DLLGE DLD 
Sbjct  110  VVEDVINLLYFGSLFEVKS-QNDFTSTMLTRTHERGCCLTYDYV-TDDATDLLGEKDLDS  167

Query  622  lsllsgllisRSANSSLPHKNALQKCI  702
            +S L GLLISR A+SS  HKNAL++CI
Sbjct  168  ISALFGLLISRPADSSFSHKNALRRCI  194



>ref|XP_008352995.1| PREDICTED: uncharacterized protein LOC103416528 [Malus domestica]
Length=433

 Score =   181 bits (460),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 117/209 (56%), Positives = 150/209 (72%), Gaps = 4/209 (2%)
 Frame = +1

Query  82   MAATEVSDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVL  261
            MAAT  SD+SDGPVLS+INKR+RAL+KK NRI QME+SL++GK LNKEQE  L++K  V+
Sbjct  1    MAATSASDLSDGPVLSLINKRLRALRKKQNRIVQMEESLAQGKALNKEQEGVLQSKAGVV  60

Query  262  AGIDELEKIRQPLSAALEEEISLSVQRHQVSALETPAPSEESGKEPEGDVENKGESDG--  435
            A I+ELEK+RQPL+ A+ EE SL+VQRH VSA   P   E+   +   +V    ESD   
Sbjct  61   ALIEELEKLRQPLADAVAEEQSLAVQRHXVSASTQPISDEKPQHDDMPNVVQPSESDDRQ  120

Query  436  GVVIEDLLNLLYFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidllgesdl  615
               +E+LLNLLYFGS+FDVK+ Q+ FT ++L+R HER  CL+      DD  ++L   DL
Sbjct  121  AAAVEELLNLLYFGSLFDVKS-QSDFTRIILTRTHERECCLT-YDTITDDDTEMLAPRDL  178

Query  616  dllsllsgllisRSANSSLPHKNALQKCI  702
            DL+S L  LLISR  +SSL HKNALQ+C+
Sbjct  179  DLISSLGELLISRPGDSSLSHKNALQQCL  207



>ref|XP_003613550.1| hypothetical protein MTR_5g037960 [Medicago truncatula]
 gb|AES96508.1| hypothetical protein MTR_5g037960 [Medicago truncatula]
Length=433

 Score =   181 bits (458),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 120/201 (60%), Positives = 150/201 (75%), Gaps = 11/201 (5%)
 Frame = +1

Query  100  SDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVLAGIDEL  279
            S  +DGPVL++INKR+RAL+KKLNRI+ ME+SLS+GK+LN EQ+E LR+K +VL  IDEL
Sbjct  5    STTTDGPVLNLINKRLRALRKKLNRITSMEESLSQGKSLNSEQQEVLRSKSSVLVLIDEL  64

Query  280  EKIRQPLSAALEEEISLSVQRHQVSALETPAPSEESGKEPEGDVENKGESDGGVVIEDLL  459
            EK+RQPLS+AL EE+ L+ Q     A ET   +E S   P G+      SD   V+ED+L
Sbjct  65   EKLRQPLSSALTEELELATQTKN-DARETETQAENSEPRPSGE-----NSD---VVEDIL  115

Query  460  NLLYFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidllgesdldllsllsg  639
            NLLYFGS+F+VKT QN FT  ML+R HER  CL+YDY+  DD+ DLLGE DLD +S L G
Sbjct  116  NLLYFGSLFEVKT-QNDFTSTMLTRTHERGCCLTYDYV-TDDATDLLGEKDLDAISGLYG  173

Query  640  llisRSANSSLPHKNALQKCI  702
            LLISR A+SS  HKNAL++CI
Sbjct  174  LLISRPADSSFSHKNALRRCI  194



>gb|EYU28691.1| hypothetical protein MIMGU_mgv1a007116mg [Erythranthe guttata]
Length=355

 Score =   178 bits (452),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 114/202 (56%), Positives = 157/202 (78%), Gaps = 6/202 (3%)
 Frame = +1

Query  106  VSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVLAGIDELEK  285
            +++GPVL++INKR+RAL+KK+NRISQME+SLS+GK LNKEQEETLR+K +VLAGIDELEK
Sbjct  14   ITEGPVLNLINKRLRALRKKMNRISQMEESLSQGKALNKEQEETLRSKSSVLAGIDELEK  73

Query  286  IRQPLSAALEEEISLSVQRHQVSALETPAPSEESGKEPEGDVENK--GESDGGVVIEDLL  459
            +RQPLS A+ +EI L+++++   + ET    E S +E +G VE    GE+DG   + DLL
Sbjct  74   LRQPLSEAVNQEIQLALEKNTQRS-ET-LTGERSDEEEDGTVEPNAGGENDGVSALSDLL  131

Query  460  NLLYFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidl-lgesdldllslls  636
            +L+YFGS+FDV+ L +   + +L+R HER+ CL+YDY+ DDD+    L E DLDL++++ 
Sbjct  132  SLVYFGSIFDVQALMSAH-DNLLTRTHERNCCLTYDYVTDDDAEGDPLREWDLDLIAMMG  190

Query  637  gllisRSANSSLPHKNALQKCI  702
            GLLISR  NS L HK+ALQKC+
Sbjct  191  GLLISRPVNSCLSHKDALQKCV  212



>ref|XP_004297812.1| PREDICTED: uncharacterized protein LOC101315141 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=439

 Score =   180 bits (456),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 125/216 (58%), Positives = 148/216 (69%), Gaps = 13/216 (6%)
 Frame = +1

Query  82   MAATEVSDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVL  261
            MA T  S+VSDGPVLS+INKRIR L+KK NRISQME+SL++GKTLN EQ E LRTK A++
Sbjct  1    MATTASSEVSDGPVLSLINKRIRGLRKKQNRISQMEESLAQGKTLNNEQLEVLRTKSAIV  60

Query  262  AGIDELEKIRQPLSAALEEEISLSVQRHQVSAL---------ETPAPSEESGKEPEGDVE  414
            A IDELEK+RQPLS A+ EEISL+VQ     A          ETP  + +   E   DV+
Sbjct  61   ASIDELEKLRQPLSVAVAEEISLAVQVTAPPAAAATEPEEHHETPPNAVQQSGESAADVD  120

Query  415  NKGESDGGVVIEDLLNLLYFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsid  594
             +      V  E+LLNLLYFGS+FDVKT Q+ FT +M +R HER  CL+      DD  D
Sbjct  121  EQNHHQAAV--EELLNLLYFGSLFDVKT-QSDFTSIMFTRSHERGCCLT-YDTVTDDDTD  176

Query  595  llgesdldllsllsgllisRSANSSLPHKNALQKCI  702
            +L E DLDLLS LSGLLISR   S L HKNALQ+CI
Sbjct  177  MLAEKDLDLLSSLSGLLISRPVASGLSHKNALQRCI  212



>ref|XP_004297813.1| PREDICTED: uncharacterized protein LOC101315141 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=422

 Score =   179 bits (455),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 124/216 (57%), Positives = 147/216 (68%), Gaps = 13/216 (6%)
 Frame = +1

Query  82   MAATEVSDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVL  261
            MA T  S+VSDGPVLS+INKRIR L+KK NRISQME+SL++GKTLN EQ E LRTK A++
Sbjct  1    MATTASSEVSDGPVLSLINKRIRGLRKKQNRISQMEESLAQGKTLNNEQLEVLRTKSAIV  60

Query  262  AGIDELEKIRQPLSAALEEEISLSVQ---------RHQVSALETPAPSEESGKEPEGDVE  414
            A IDELEK+RQPLS A+ EEISL+VQ                ETP  + +   E   DV+
Sbjct  61   ASIDELEKLRQPLSVAVAEEISLAVQVTAPPAAAATEPEEHHETPPNAVQQSGESAADVD  120

Query  415  NKGESDGGVVIEDLLNLLYFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsid  594
             +      V  E+LLNLLYFGS+FDVKT Q+ FT +M +R HER  CL+      DD  D
Sbjct  121  EQNHHQAAV--EELLNLLYFGSLFDVKT-QSDFTSIMFTRSHERGCCLT-YDTVTDDDTD  176

Query  595  llgesdldllsllsgllisRSANSSLPHKNALQKCI  702
            +L E DLDLLS LSGLLISR   S L HKNALQ+CI
Sbjct  177  MLAEKDLDLLSSLSGLLISRPVASGLSHKNALQRCI  212



>gb|AGV54212.1| hypothetical protein [Phaseolus vulgaris]
Length=438

 Score =   180 bits (456),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 114/207 (55%), Positives = 146/207 (71%), Gaps = 9/207 (4%)
 Frame = +1

Query  82   MAATEVSDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVL  261
            MA     DV+DGPV+++INKRIRA +KK+NRI  ME+SLS+GKTLNKEQEE LRTKP++L
Sbjct  1    MATPASPDVADGPVMNLINKRIRAYRKKINRIQAMEESLSQGKTLNKEQEEFLRTKPSIL  60

Query  262  AGIDELEKIRQPLSAALEEEISLSVQRHQVSALETPAPSEESGKEPEGDVENKGESDGGV  441
            A IDE EK+RQPL++AL EE+  +         ETP  +E SG   +   ++   S+  V
Sbjct  61   ALIDEFEKLRQPLASALTEELQGAAPN--ARGAETPTLAESSGSFEQPPPQH---SEDDV  115

Query  442  VIEDLLNLLYFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidllgesdldl  621
            V+EDLLNLLYFGS+FDVK+    F   ML+R HER  CL+YDY+  DD+ DLL E DLD 
Sbjct  116  VVEDLLNLLYFGSLFDVKS---DFASTMLTRTHERGCCLTYDYV-TDDATDLLSEKDLDS  171

Query  622  lsllsgllisRSANSSLPHKNALQKCI  702
            +S L GL +S  A+SS  HKNAL +C+
Sbjct  172  ISALRGLFVSWPADSSFSHKNALARCV  198



>ref|XP_011034203.1| PREDICTED: uncharacterized protein LOC105132411 [Populus euphratica]
Length=437

 Score =   179 bits (454),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 108/207 (52%), Positives = 138/207 (67%), Gaps = 18/207 (9%)
 Frame = +1

Query  82   MAATEVSDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVL  261
            MAA   S++++GPVLS+I KR+R LKKK NRI QME+S+++GK +NKEQE+ LR+KP+V 
Sbjct  1    MAAVSTSEITEGPVLSLITKRLRGLKKKFNRIVQMEESIAQGKPINKEQEDFLRSKPSVS  60

Query  262  AGIDELEKIRQPLSAALEEEISLSVQRHQVSALETPAPSEESGKEPEGDVENKGESDGGV  441
            A IDELEK+RQPLS A+ EEI L+  R          P  +S   PE        S+G  
Sbjct  61   AAIDELEKLRQPLSVAVSEEIELAAHRLN--------PKSDSTVFPEA-------SNG--  103

Query  442  VIEDLLNLLYFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidllgesdldl  621
            V EDLL+L YFGS+FDV++ QN FT  ML+R HER  CL+YDY+ DD +  L       +
Sbjct  104  VAEDLLHLFYFGSLFDVRS-QNDFTATMLTRTHERGCCLTYDYVTDDATDLLSERDLDMI  162

Query  622  lsllsgllisRSANSSLPHKNALQKCI  702
              L  GLLISR  NSS  HKNALQ+C+
Sbjct  163  SILGGGLLISRPVNSSSSHKNALQRCM  189



>ref|XP_009115436.1| PREDICTED: uncharacterized protein LOC103840676 [Brassica rapa]
 emb|CDY16217.1| BnaA09g29510D [Brassica napus]
Length=407

 Score =   178 bits (451),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 108/201 (54%), Positives = 143/201 (71%), Gaps = 18/201 (9%)
 Frame = +1

Query  100  SDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVLAGIDEL  279
            SD S+GPV+ +INKR+RAL+KKLNRI+QME+S+S+GKTLNKEQ+E LR+KP+VL  I+EL
Sbjct  15   SDASEGPVMGLINKRLRALRKKLNRITQMEESISQGKTLNKEQQEVLRSKPSVLILIEEL  74

Query  280  EKIRQPLSAALEEEISLSVQRHQVSALETPAPSEESGKEPEGDVENKGESDGGVVIEDLL  459
            +K+R PLSAA+ EEI+L+   H   A    AP EE  K                 +EDL+
Sbjct  75   DKLRAPLSAAVSEEITLATTHHHDQAHVADAPEEEEAK----------------TLEDLV  118

Query  460  NLLYFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidllgesdldllsllsg  639
            NLLYFGS+FDVK+ QN    +ML+R HER  CL YD +  D+S DLL + DLDL+S L  
Sbjct  119  NLLYFGSLFDVKS-QNELASIMLTRTHERGCCLVYDTV-TDESTDLLCDKDLDLISELWT  176

Query  640  llisRSANSSLPHKNALQKCI  702
            +++SR A+S L HKNAL++C+
Sbjct  177  MMVSRPADSFLSHKNALERCV  197



>ref|XP_003517917.1| PREDICTED: uncharacterized protein LOC100819759 [Glycine max]
Length=446

 Score =   178 bits (451),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 119/212 (56%), Positives = 151/212 (71%), Gaps = 9/212 (4%)
 Frame = +1

Query  82   MAAT----EVSDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTK  249
            MAAT    +V+  +DGPV+S+INKR+RAL+KKLNRI  ME+++++GK LNKEQEE LR+K
Sbjct  1    MAATASNNDVAAAADGPVMSLINKRLRALRKKLNRILAMEEAVTQGKPLNKEQEEVLRSK  60

Query  250  PAVLAGIDELEKIRQPLSAALEEEISLSVQRHQVSALETPAPSEESGKEPEGDVE-NKGE  426
            P+VLA IDELEK+RQPL+ AL EE+  +    Q S         E+  E  G VE N   
Sbjct  61   PSVLALIDELEKLRQPLATALSEELQNNGTSSQNSRETETETENETLAESSGSVEPNTNS  120

Query  427  SDGGVVIEDLLNLLYFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidllge  606
            +   VV+EDLLNLLYFGS+FDVK+    F   ML+R HER  CL+YDY+  DD+ DLLGE
Sbjct  121  TTNDVVVEDLLNLLYFGSLFDVKS---DFASTMLTRTHERGCCLTYDYV-TDDATDLLGE  176

Query  607  sdldllsllsgllisRSANSSLPHKNALQKCI  702
             DLD +S L GLL+SR A+SS  HKNALQ+C+
Sbjct  177  KDLDSISALRGLLVSRPADSSFSHKNALQRCL  208



>gb|EYU28690.1| hypothetical protein MIMGU_mgv1a007116mg [Erythranthe guttata]
Length=418

 Score =   177 bits (449),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 114/203 (56%), Positives = 156/203 (77%), Gaps = 8/203 (4%)
 Frame = +1

Query  106  VSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVLAGIDELEK  285
            +++GPVL++INKR+RAL+KK+NRISQME+SLS+GK LNKEQEETLR+K +VLAGIDELEK
Sbjct  14   ITEGPVLNLINKRLRALRKKMNRISQMEESLSQGKALNKEQEETLRSKSSVLAGIDELEK  73

Query  286  IRQPLSAALEEEISLSVQRH-QVSALETPAPSEESGKEPEGDVENK--GESDGGVVIEDL  456
            +RQPLS A+ +EI L+++++ Q S   T    E S +E +G VE    GE+DG   + DL
Sbjct  74   LRQPLSEAVNQEIQLALEKNTQRSETLT---GERSDEEEDGTVEPNAGGENDGVSALSDL  130

Query  457  LNLLYFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidll-gesdldllsll  633
            L+L+YFGS+FDV+ L +   + +L+R HER+ CL+YDY+ DDD+      E DLDL++++
Sbjct  131  LSLVYFGSIFDVQALMSAH-DNLLTRTHERNCCLTYDYVTDDDAEGDPLREWDLDLIAMM  189

Query  634  sgllisRSANSSLPHKNALQKCI  702
             GLLISR  NS L HK+ALQKC+
Sbjct  190  GGLLISRPVNSCLSHKDALQKCV  212



>ref|XP_003519125.1| PREDICTED: uncharacterized protein LOC100816406 [Glycine max]
Length=445

 Score =   176 bits (447),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 117/211 (55%), Positives = 150/211 (71%), Gaps = 9/211 (4%)
 Frame = +1

Query  82   MAAT----EVSDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTK  249
            MAAT    +V+  +DGPV+S+INKR+RAL+KKLNRI  ME++++ GK LNKEQEE LR+K
Sbjct  1    MAATASNNDVAAANDGPVMSLINKRLRALRKKLNRILAMEEAVTLGKPLNKEQEEVLRSK  60

Query  250  PAVLAGIDELEKIRQPLSAALEEEISLSVQRHQVSALETPAPSEESGKEPEGDVENKGES  429
            P+VLA IDEL+K+RQPL+ AL EE+ ++    Q    ET   + E+  E  G  E    S
Sbjct  61   PSVLALIDELDKLRQPLATALSEELQINGTSSQNPRHETETEN-ETLAESSGSTEPNSNS  119

Query  430  DGGVVIEDLLNLLYFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidllges  609
               VV+EDLLNLLYFGS+FDVK+    F   ML+R HER  CL+YDY+  DD+ DLLGE 
Sbjct  120  RNDVVVEDLLNLLYFGSLFDVKS---DFASTMLTRTHERGCCLTYDYV-TDDATDLLGEK  175

Query  610  dldllsllsgllisRSANSSLPHKNALQKCI  702
            DLD +S L GLL+SR A+SS  HKNAL +C+
Sbjct  176  DLDSISALRGLLVSRPADSSFSHKNALHRCV  206



>ref|XP_009360410.1| PREDICTED: uncharacterized protein LOC103950885 [Pyrus x bretschneideri]
Length=434

 Score =   176 bits (445),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 117/208 (56%), Positives = 148/208 (71%), Gaps = 9/208 (4%)
 Frame = +1

Query  82   MAATEVSDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVL  261
            M AT  SD+SDGPVLS+INKRIRAL+KK NRI QME+SL++GK LNKEQE  L++K  V 
Sbjct  1    MEATAASDLSDGPVLSLINKRIRALRKKQNRIIQMEESLAQGKVLNKEQEGVLKSKSGVF  60

Query  262  AGIDELEKIRQPLSAALEEEISLSVQRHQVSALETPAPSEESGKEPEGDVENKGESD-GG  438
            A I+ELEK+RQPL+ A+ EE SL++QRHQVSA   P     S  +P  +V    E D   
Sbjct  61   ALIEELEKLRQPLADAVAEEQSLALQRHQVSASTQPI----SDDKP--NVVQPSEDDCQA  114

Query  439  VVIEDLLNLLYFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidllgesdld  618
              +E+LLNLLYFGS+FDVK+ Q+ FT ++L+R HER  CL+      DD  ++L   DLD
Sbjct  115  AAVEELLNLLYFGSLFDVKS-QSDFTRIILTRTHERECCLT-YDTITDDDTEMLAPRDLD  172

Query  619  llsllsgllisRSANSSLPHKNALQKCI  702
            L+S L G LISR  +SSL HKNALQ+C+
Sbjct  173  LISSLGGFLISRPGDSSLSHKNALQQCL  200



>ref|XP_006357249.1| PREDICTED: uncharacterized protein LOC102594597 [Solanum tuberosum]
Length=428

 Score =   174 bits (441),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 108/212 (51%), Positives = 140/212 (66%), Gaps = 16/212 (8%)
 Frame = +1

Query  82   MAATEVSDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVL  261
            M AT  S+ SDGPVL+VINKR+RAL+KK NRI QME+SL+ GKTLNKEQEET R+K +V+
Sbjct  1    MEATAASETSDGPVLNVINKRLRALRKKHNRILQMEESLANGKTLNKEQEETFRSKTSVV  60

Query  262  AGIDELEKIRQPLSAALEEEISLSVQRHQVSALETPAPSEESGKEPEGDVENKGESDGGV  441
              IDELEK+RQPL+AA+ EEI+L+ Q H VSA ++          P+  +  KG++  G 
Sbjct  61   VAIDELEKLRQPLAAAVTEEINLATQHHLVSAADS----------PDEKLAGKGDNSCGE  110

Query  442  VIEDLLNLLYFGSMFDVKTL-QNHFTEVMLSRE-HERSSCLSYDYMKdddsidllgesdl  615
            V EDLLN++YFGSMF      +N F   M  R  HER+ CL+YD M +D+S D++     
Sbjct  111  V-EDLLNIIYFGSMFAHANWGKNDFVSTMWKRAMHERACCLNYDCMPEDESTDVMDMLSE  169

Query  616  dllsllsglli---sRSANSSLPHKNALQKCI  702
              L L+S L      R  NS+L HK+ALQ C 
Sbjct  170  KDLDLISMLSELLICRPVNSTLSHKHALQACF  201



>emb|CDY52255.1| BnaC08g20270D [Brassica napus]
Length=411

 Score =   172 bits (436),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 105/204 (51%), Positives = 145/204 (71%), Gaps = 8/204 (4%)
 Frame = +1

Query  91   TEVSDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVLAGI  270
            T  SD  +GPV+++INKR+RAL+KKLNRI+QME+S+S+GKTLNKEQ+E LR+KP+VL  I
Sbjct  5    TATSDAGEGPVMALINKRLRALRKKLNRIAQMEESISQGKTLNKEQQEVLRSKPSVLVLI  64

Query  271  DELEKIRQPLSAALEEEISLSVQRHQVSALETPAPSEESGKEPEGDVENKGESDGGVVIE  450
            +EL+K+R PLS A+ EEI+L+   H        APS +         E K +      +E
Sbjct  65   EELDKLRNPLSNAVSEEIALATTHHN-------APSSDQNTTVAVAPEEKEKEKEVEKLE  117

Query  451  DLLNLLYFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidllgesdldllsl  630
            DL+NLLYFGS+FDVK+ QN    +M++R HER  CL YD + D+ + DLL + DLDL+S 
Sbjct  118  DLVNLLYFGSLFDVKS-QNELASIMMTRTHERGCCLVYDTVTDESTADLLCDKDLDLISR  176

Query  631  lsgllisRSANSSLPHKNALQKCI  702
            L  +++SR A+SSL HKNAL++C+
Sbjct  177  LWSMMVSRPADSSLSHKNALERCV  200



>ref|XP_010683287.1| PREDICTED: uncharacterized protein LOC104897994 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=451

 Score =   172 bits (435),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 114/213 (54%), Positives = 156/213 (73%), Gaps = 14/213 (7%)
 Frame = +1

Query  82   MAATEVSD---VSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKP  252
            MAAT  S     ++GPVLSVI+KR+RAL+KK NRI+QME+SL++GKTLNKEQ++ LR+KP
Sbjct  1    MAATSTSSDPATTEGPVLSVISKRLRALRKKHNRITQMEESLAQGKTLNKEQQDVLRSKP  60

Query  253  AVLAGIDELEKIRQPLSAALEEEISLSVQRHQVSALETPAPSEESGKEPEGDVENKGESD  432
            +VL  IDELEK+R PLS+A++EEISL++      + +T   + +S  E   D ++  E +
Sbjct  61   SVLTLIDELEKLRAPLSSAVDEEISLAI------SSKTSPENHQSSTENHRDNDDVDEVE  114

Query  433  GGV---VIEDLLNLLYFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidllg  603
                  V++DLL L+YFGS+FDVK  Q+ FT +ML+R HER  CL+YDY+  DD+ DLL 
Sbjct  115  VDRIEGVVKDLLYLMYFGSLFDVKP-QSEFTSLMLTRTHERGCCLTYDYV-TDDATDLLA  172

Query  604  esdldllsllsgllisRSANSSLPHKNALQKCI  702
            E DLDL+S +  L+ISR  NS+L H+NAL+KCI
Sbjct  173  ERDLDLISAVQALMISRPVNSALSHQNALEKCI  205



>emb|CDY46422.1| BnaA08g20080D [Brassica napus]
Length=404

 Score =   171 bits (432),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 106/204 (52%), Positives = 150/204 (74%), Gaps = 17/204 (8%)
 Frame = +1

Query  91   TEVSDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVLAGI  270
            T  SD  +GPV+++INKR+RAL+KKLNRI+QME+S+S+GKTLNKEQ+E LR+KP+V+  I
Sbjct  5    TATSDAGEGPVMALINKRLRALRKKLNRITQMEESISQGKTLNKEQQEVLRSKPSVVVLI  64

Query  271  DELEKIRQPLSAALEEEISLSVQRHQVSALETPAPSEESGKEPEGDVENKGESDGGVVIE  450
            +EL+K+R PLSAA+ EEI+L+   H  S+ +T A + E  KE +              +E
Sbjct  65   EELDKLRAPLSAAVSEEIALAT--HHTSSDQTTAVAPEEEKEVQK-------------LE  109

Query  451  DLLNLLYFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidllgesdldllsl  630
            DL+NLLYFGS+F+VK+ Q+    +M++R HER  CL YD +  D+S DLL + DLDL+S 
Sbjct  110  DLVNLLYFGSLFEVKS-QSELASIMMTRTHERGCCLVYDTV-TDESTDLLCDKDLDLISR  167

Query  631  lsgllisRSANSSLPHKNALQKCI  702
            L G+++SR A+SSL HKNAL++C+
Sbjct  168  LWGMMVSRPADSSLSHKNALERCV  191



>gb|EYU22447.1| hypothetical protein MIMGU_mgv1a006912mg [Erythranthe guttata]
Length=423

 Score =   171 bits (432),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 115/202 (57%), Positives = 148/202 (73%), Gaps = 8/202 (4%)
 Frame = +1

Query  106  VSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVLAGIDELEK  285
             ++GPVL++INKR+RAL+KKLNRISQME+SLS+GK LNKEQEET R+K AVLAGIDELEK
Sbjct  13   ANEGPVLNLINKRLRALRKKLNRISQMEESLSQGKILNKEQEETYRSKSAVLAGIDELEK  72

Query  286  IRQPLSAALEEEI--SLSVQRHQVSALETPAPSEESGKEPEGDVENKGESDGGVVIEDLL  459
            IRQP+  A+++EI  +L  ++     L    P+EE   E    VE  G  D   V  DLL
Sbjct  73   IRQPILQAVDQEIEAALEKKKQDPEILTAETPNEEEYVET---VEKAGNDDVSSV-SDLL  128

Query  460  NLLYFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidl-lgesdldllslls  636
            NLLYFG++FDVKTL +   + ML+R HER+ CL+YDY+ DDD+    L E DLDL+++L 
Sbjct  129  NLLYFGAVFDVKTLMSAH-DNMLTRTHERNCCLTYDYVTDDDAAGAPLKEWDLDLIAILG  187

Query  637  gllisRSANSSLPHKNALQKCI  702
            G LISR  +SSL HK++LQKC+
Sbjct  188  GSLISRPVHSSLSHKDSLQKCV  209



>gb|EYU22446.1| hypothetical protein MIMGU_mgv1a006912mg [Erythranthe guttata]
Length=426

 Score =   171 bits (432),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 115/202 (57%), Positives = 148/202 (73%), Gaps = 8/202 (4%)
 Frame = +1

Query  106  VSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVLAGIDELEK  285
             ++GPVL++INKR+RAL+KKLNRISQME+SLS+GK LNKEQEET R+K AVLAGIDELEK
Sbjct  13   ANEGPVLNLINKRLRALRKKLNRISQMEESLSQGKILNKEQEETYRSKSAVLAGIDELEK  72

Query  286  IRQPLSAALEEEI--SLSVQRHQVSALETPAPSEESGKEPEGDVENKGESDGGVVIEDLL  459
            IRQP+  A+++EI  +L  ++     L    P+EE   E    VE  G  D   V  DLL
Sbjct  73   IRQPILQAVDQEIEAALEKKKQDPEILTAETPNEEEYVET---VEKAGNDDVSSV-SDLL  128

Query  460  NLLYFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidl-lgesdldllslls  636
            NLLYFG++FDVKTL +   + ML+R HER+ CL+YDY+ DDD+    L E DLDL+++L 
Sbjct  129  NLLYFGAVFDVKTLMSAH-DNMLTRTHERNCCLTYDYVTDDDAAGAPLKEWDLDLIAILG  187

Query  637  gllisRSANSSLPHKNALQKCI  702
            G LISR  +SSL HK++LQKC+
Sbjct  188  GSLISRPVHSSLSHKDSLQKCV  209



>ref|XP_010683286.1| PREDICTED: uncharacterized protein LOC104897994 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=478

 Score =   172 bits (435),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 115/210 (55%), Positives = 157/210 (75%), Gaps = 8/210 (4%)
 Frame = +1

Query  82   MAATEVSD---VSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKP  252
            MAAT  S     ++GPVLSVI+KR+RAL+KK NRI+QME+SL++GKTLNKEQ++ LR+KP
Sbjct  1    MAATSTSSDPATTEGPVLSVISKRLRALRKKHNRITQMEESLAQGKTLNKEQQDVLRSKP  60

Query  253  AVLAGIDELEKIRQPLSAALEEEISLSVQRHQVSALETPAPSEESGKEPEGDVENKGESD  432
            +VL  IDELEK+R PLS+A++EEISL++     ++ E    S E+ ++ +   E + +  
Sbjct  61   SVLTLIDELEKLRAPLSSAVDEEISLAISSK--TSPENHQSSTENHRDNDDVDEVEVDRI  118

Query  433  GGVVIEDLLNLLYFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidllgesd  612
             GVV +DLL L+YFGS+FDVK  Q+ FT +ML+R HER  CL+YDY+  DD+ DLL E D
Sbjct  119  EGVV-KDLLYLMYFGSLFDVKP-QSEFTSLMLTRTHERGCCLTYDYV-TDDATDLLAERD  175

Query  613  ldllsllsgllisRSANSSLPHKNALQKCI  702
            LDL+S +  L+ISR  NS+L H+NAL+KCI
Sbjct  176  LDLISAVQALMISRPVNSALSHQNALEKCI  205



>gb|KDO82716.1| hypothetical protein CISIN_1g013233mg [Citrus sinensis]
Length=337

 Score =   168 bits (425),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 122/208 (59%), Positives = 149/208 (72%), Gaps = 5/208 (2%)
 Frame = +1

Query  79   SMAATEVSDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAV  258
            +  A   SD+SDGPVLSVINKR+RAL+KK NRI QME+S+S+GKTLNKEQEE LR+KP V
Sbjct  5    TATAAPASDMSDGPVLSVINKRLRALRKKYNRIVQMEESVSQGKTLNKEQEEVLRSKPIV  64

Query  259  LAGIDELEKIRQPLSAALEEEISLSVQRHQVSALETPAPSEESGKEPEGDVENKGESDGG  438
             A IDEL+K+R PL +AL EE+SL  QR   SA  TP            D  +  + D  
Sbjct  65   TALIDELDKLRSPLCSALSEELSLH-QRQ--SAPPTPDNQPNHVANSTKDDNDDNDDDDS  121

Query  439  VVIEDLLNLLYFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidllgesdld  618
              + DLLNLLYFGS+FDVK+ Q+ FT  ML+R HER  CL+YDY+  DD+ DLLGE DLD
Sbjct  122  SSVSDLLNLLYFGSLFDVKS-QSDFTATMLTRTHERGCCLTYDYV-TDDATDLLGEKDLD  179

Query  619  llsllsgllisRSANSSLPHKNALQKCI  702
            L+S+LSGLLISR  +SS  HK+AL +CI
Sbjct  180  LISMLSGLLISRPIDSSWSHKSALHRCI  207



>emb|CAN72059.1| hypothetical protein VITISV_039073 [Vitis vinifera]
Length=415

 Score =   169 bits (427),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 126/209 (60%), Positives = 160/209 (77%), Gaps = 7/209 (3%)
 Frame = +1

Query  79   SMAATEVSDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAV  258
            +MAA   SDV+DGPVLS+INKR+R L+KK NRI+QME+++++GK +NKEQE+ LR+KPAV
Sbjct  92   TMAA---SDVTDGPVLSLINKRLRGLRKKYNRITQMEEAIAQGKPINKEQEDVLRSKPAV  148

Query  259  LAGIDELEKIRQPLSAALEEEISLSVQR-HQVSALETPAPSEESGKEPEGDVENKGESDG  435
               IDELE++RQPLSAA+EEE+SL++Q+ H +     P PS    K+   D E K ESD 
Sbjct  149  TVLIDELERLRQPLSAAVEEELSLALQQAHHLPPSPPPQPSSIINKDGADDGEEKPESD-  207

Query  436  GVVIEDLLNLLYFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidllgesdl  615
             + +E+LLNLLYFG +FDVK  Q  FT  ML+R HER  CL+YDY+  DD+ DLLGE DL
Sbjct  208  HLNVENLLNLLYFGYLFDVKP-QTDFTSTMLTRTHERGCCLTYDYV-TDDATDLLGERDL  265

Query  616  dllsllsgllisRSANSSLPHKNALQKCI  702
            DL+S LSGLLISR  +SSL HKNALQ+CI
Sbjct  266  DLISQLSGLLISRPVDSSLSHKNALQRCI  294



>ref|XP_009110060.1| PREDICTED: uncharacterized protein LOC103835629 [Brassica rapa]
Length=407

 Score =   168 bits (426),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 105/204 (51%), Positives = 149/204 (73%), Gaps = 17/204 (8%)
 Frame = +1

Query  91   TEVSDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVLAGI  270
            T  SD  +GPV+++INKR+RAL+KKLNRI+QME+S+S+GKTLN EQ+E LR+KP+V+  I
Sbjct  5    TATSDAGEGPVMALINKRLRALRKKLNRITQMEESISQGKTLNTEQQEVLRSKPSVVVLI  64

Query  271  DELEKIRQPLSAALEEEISLSVQRHQVSALETPAPSEESGKEPEGDVENKGESDGGVVIE  450
            +EL+K+R PLSAA+ EEI+L+   H  S+ +T A + E  KE +              +E
Sbjct  65   EELDKLRAPLSAAVSEEIALAT--HHTSSDQTTAVAPEEEKEVQK-------------LE  109

Query  451  DLLNLLYFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidllgesdldllsl  630
            DL+NLLYFGS+F+VK+ Q+    +M++R HER  CL YD +  D+S DLL + DLDL+S 
Sbjct  110  DLVNLLYFGSLFEVKS-QSELASIMMTRTHERGCCLVYDTV-TDESTDLLCDKDLDLISR  167

Query  631  lsgllisRSANSSLPHKNALQKCI  702
            L G+++SR A+SSL HKNAL++C+
Sbjct  168  LWGMMVSRPADSSLSHKNALERCV  191



>ref|XP_002269144.1| PREDICTED: uncharacterized protein LOC100248339 [Vitis vinifera]
Length=444

 Score =   168 bits (425),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 125/207 (60%), Positives = 158/207 (76%), Gaps = 6/207 (3%)
 Frame = +1

Query  82   MAATEVSDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVL  261
            MAA   SDV+DGPVLS+INKR+R L+KK NRI+QME+++++GK +NKEQE+ LR+KPAV 
Sbjct  1    MAA---SDVTDGPVLSLINKRLRGLRKKYNRITQMEEAIAQGKPINKEQEDVLRSKPAVT  57

Query  262  AGIDELEKIRQPLSAALEEEISLSVQRHQVSALETPAPSEESGKEPEGDVENKGESDGGV  441
              IDELE++RQPLSAA+EEE+SL++Q + +     P PS    K+   D E K ESD  +
Sbjct  58   VLIDELERLRQPLSAAVEEELSLALQSNHLPPSPPPQPSSIINKDGADDGEEKPESD-HL  116

Query  442  VIEDLLNLLYFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidllgesdldl  621
             +E+LLNLLYFG +FDVK  Q  FT  ML+R HER  CL+YDY+  DD+ DLLGE DLDL
Sbjct  117  NVENLLNLLYFGYLFDVKP-QTDFTSTMLTRTHERGCCLTYDYV-TDDATDLLGERDLDL  174

Query  622  lsllsgllisRSANSSLPHKNALQKCI  702
            +S LSGLLISR  +SSL HKNALQ+CI
Sbjct  175  ISQLSGLLISRPVDSSLSHKNALQRCI  201



>ref|XP_010043853.1| PREDICTED: uncharacterized protein LOC104432951 [Eucalyptus grandis]
 gb|KCW85854.1| hypothetical protein EUGRSUZ_B02587 [Eucalyptus grandis]
Length=442

 Score =   167 bits (422),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 110/202 (54%), Positives = 149/202 (74%), Gaps = 5/202 (2%)
 Frame = +1

Query  100  SDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVLAGIDEL  279
            S+ +DGPV+S+INKR+RAL+KKLNRI QME+S+++GK +NKEQE+ LR+KP+VLA IDEL
Sbjct  8    SEATDGPVVSLINKRLRALRKKLNRIHQMEESMAQGKPINKEQEDVLRSKPSVLASIDEL  67

Query  280  EKIRQPLSAALEEEISLSVQRHQVSALETPAPSEESGKEPEGDVENKGESDGG-VVIEDL  456
            EK+R  LS A++EE+SL+ +R         A      +  + + +  G  DGG  V++D+
Sbjct  68   EKLRPQLSFAVQEELSLAARRLPRDDDAAAAADAAEKQPQQQEEQEAG--DGGDAVVKDV  125

Query  457  LNLLYFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidllgesdldllslls  636
            L LLYFGSMF V + Q+ +T  ML+R HER  CL+YDY+  D++ DLL E DLDL++ LS
Sbjct  126  LKLLYFGSMFAVSS-QSDYTSTMLTRTHERGCCLTYDYV-TDEATDLLKERDLDLIATLS  183

Query  637  gllisRSANSSLPHKNALQKCI  702
             LLISR A+SSL HKNALQKC+
Sbjct  184  SLLISRPADSSLSHKNALQKCL  205



>gb|KDO82715.1| hypothetical protein CISIN_1g013233mg [Citrus sinensis]
Length=447

 Score =   166 bits (421),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 122/208 (59%), Positives = 149/208 (72%), Gaps = 5/208 (2%)
 Frame = +1

Query  79   SMAATEVSDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAV  258
            +  A   SD+SDGPVLSVINKR+RAL+KK NRI QME+S+S+GKTLNKEQEE LR+KP V
Sbjct  5    TATAAPASDMSDGPVLSVINKRLRALRKKYNRIVQMEESVSQGKTLNKEQEEVLRSKPIV  64

Query  259  LAGIDELEKIRQPLSAALEEEISLSVQRHQVSALETPAPSEESGKEPEGDVENKGESDGG  438
             A IDEL+K+R PL +AL EE+SL  QR   SA  TP            D  +  + D  
Sbjct  65   TALIDELDKLRSPLCSALSEELSLH-QRQ--SAPPTPDNQPNHVANSTKDDNDDNDDDDS  121

Query  439  VVIEDLLNLLYFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidllgesdld  618
              + DLLNLLYFGS+FDVK+ Q+ FT  ML+R HER  CL+YDY+  DD+ DLLGE DLD
Sbjct  122  SSVSDLLNLLYFGSLFDVKS-QSDFTATMLTRTHERGCCLTYDYV-TDDATDLLGEKDLD  179

Query  619  llsllsgllisRSANSSLPHKNALQKCI  702
            L+S+LSGLLISR  +SS  HK+AL +CI
Sbjct  180  LISMLSGLLISRPIDSSWSHKSALHRCI  207



>ref|XP_006438557.1| hypothetical protein CICLE_v10031519mg [Citrus clementina]
 ref|XP_006483261.1| PREDICTED: uncharacterized protein LOC102619416 isoform X2 [Citrus 
sinensis]
 gb|ESR51797.1| hypothetical protein CICLE_v10031519mg [Citrus clementina]
Length=445

 Score =   165 bits (418),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 121/208 (58%), Positives = 148/208 (71%), Gaps = 5/208 (2%)
 Frame = +1

Query  79   SMAATEVSDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAV  258
            +  A   SD+SDGPVLSVINKR+RAL+KK NRI QME+S+S+GKTLNKEQEE  R+KP V
Sbjct  5    TATAAPASDMSDGPVLSVINKRLRALRKKYNRIVQMEESVSQGKTLNKEQEEVFRSKPIV  64

Query  259  LAGIDELEKIRQPLSAALEEEISLSVQRHQVSALETPAPSEESGKEPEGDVENKGESDGG  438
             A IDEL+K+R PL +AL EE+SL  QR   SA  TP            D  +  + D  
Sbjct  65   TALIDELDKLRSPLCSALSEELSLH-QRQ--SAPPTPDNQPNHVANSTKDDNDDNDDDDS  121

Query  439  VVIEDLLNLLYFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidllgesdld  618
              + DLLNLLYFGS+FDVK+ Q+ FT  ML+R HER  CL+YDY+  DD+ DLLGE DLD
Sbjct  122  SSVSDLLNLLYFGSLFDVKS-QSDFTATMLTRTHERGCCLTYDYV-TDDATDLLGEKDLD  179

Query  619  llsllsgllisRSANSSLPHKNALQKCI  702
            L+S+LSGLLISR  +SS  HK+AL +CI
Sbjct  180  LISMLSGLLISRPIDSSWSHKSALHRCI  207



>ref|XP_006438558.1| hypothetical protein CICLE_v10031519mg [Citrus clementina]
 ref|XP_006483260.1| PREDICTED: uncharacterized protein LOC102619416 isoform X1 [Citrus 
sinensis]
 gb|ESR51798.1| hypothetical protein CICLE_v10031519mg [Citrus clementina]
Length=450

 Score =   165 bits (418),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 121/208 (58%), Positives = 148/208 (71%), Gaps = 5/208 (2%)
 Frame = +1

Query  79   SMAATEVSDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAV  258
            +  A   SD+SDGPVLSVINKR+RAL+KK NRI QME+S+S+GKTLNKEQEE  R+KP V
Sbjct  5    TATAAPASDMSDGPVLSVINKRLRALRKKYNRIVQMEESVSQGKTLNKEQEEVFRSKPIV  64

Query  259  LAGIDELEKIRQPLSAALEEEISLSVQRHQVSALETPAPSEESGKEPEGDVENKGESDGG  438
             A IDEL+K+R PL +AL EE+SL  QR   SA  TP            D  +  + D  
Sbjct  65   TALIDELDKLRSPLCSALSEELSLH-QRQ--SAPPTPDNQPNHVANSTKDDNDDNDDDDS  121

Query  439  VVIEDLLNLLYFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidllgesdld  618
              + DLLNLLYFGS+FDVK+ Q+ FT  ML+R HER  CL+YDY+  DD+ DLLGE DLD
Sbjct  122  SSVSDLLNLLYFGSLFDVKS-QSDFTATMLTRTHERGCCLTYDYV-TDDATDLLGEKDLD  179

Query  619  llsllsgllisRSANSSLPHKNALQKCI  702
            L+S+LSGLLISR  +SS  HK+AL +CI
Sbjct  180  LISMLSGLLISRPIDSSWSHKSALHRCI  207



>emb|CDY14707.1| BnaC05g19640D [Brassica napus]
Length=417

 Score =   164 bits (416),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 104/197 (53%), Positives = 141/197 (72%), Gaps = 10/197 (5%)
 Frame = +1

Query  112  DGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVLAGIDELEKIR  291
            +GPV+ +INKR+RAL+KKLNRI+QME+S+S+GKTLNKEQ+E LR+KP+VL  I+EL+K+R
Sbjct  19   EGPVMGLINKRLRALRKKLNRITQMEESISQGKTLNKEQQEVLRSKPSVLVLIEELDKLR  78

Query  292  QPLSAALEEEISLSVQRHQVSALETPAPSEESGKEPEGDVENKGESDGGVVIEDLLNLLY  471
             PLSAA+ EEI+L+   H     + P    E    PE +   K        +EDL+NLLY
Sbjct  79   APLSAAVSEEITLATTHHLHHHNQAPPDQNEVADAPEEEEAKK--------LEDLVNLLY  130

Query  472  FGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidllgesdldllsllsgllis  651
            FGS+FDVK+ QN    +ML+R HER  CL YD +  D+S DLL + DLDL+S L  +++S
Sbjct  131  FGSLFDVKS-QNELASIMLTRTHERGCCLVYDTV-TDESTDLLCDKDLDLISELWTMMVS  188

Query  652  RSANSSLPHKNALQKCI  702
            R A+S L HKNAL++C+
Sbjct  189  RPADSFLSHKNALERCV  205



>ref|XP_006838798.1| hypothetical protein AMTR_s00002p00260390 [Amborella trichopoda]
 gb|ERN01367.1| hypothetical protein AMTR_s00002p00260390 [Amborella trichopoda]
Length=463

 Score =   160 bits (406),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 109/208 (52%), Positives = 142/208 (68%), Gaps = 2/208 (1%)
 Frame = +1

Query  79   SMAATEVSDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAV  258
            +  AT +    DGPVLS+++KR+RALKKK NRI Q+E+S S+GK++ KEQEE LR+KP V
Sbjct  7    AATATSIETCKDGPVLSMMSKRLRALKKKYNRILQIEESRSQGKSIIKEQEEVLRSKPGV  66

Query  259  LAGIDELEKIRQPLSAALEEEISLSVQRHQVSALETPAPSEESGKEPEGDVENKGESDGG  438
            LA I+E EK+R PLS AL+EE+S             P  +  S K+ +G  +     D  
Sbjct  67   LALIEEYEKLRVPLSNALKEELSSLQPPTPSPPPPLPQDNGTSDKKEKGYHKKGLNHDLD  126

Query  439  VVIEDLLNLLYFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidllgesdld  618
             VIEDLL LLYFGS+FDVK+ QN FT +ML+R HERSSCL+YDY+  DD+ DLL E DLD
Sbjct  127  EVIEDLLKLLYFGSLFDVKS-QNEFTSIMLTRVHERSSCLTYDYV-TDDATDLLVERDLD  184

Query  619  llsllsgllisRSANSSLPHKNALQKCI  702
             LS+   L+ +R  NS+L HK AL+ C+
Sbjct  185  FLSVCGSLMTARPPNSTLSHKEALRICV  212



>ref|XP_010923301.1| PREDICTED: uncharacterized protein LOC105046420 [Elaeis guineensis]
Length=451

 Score =   157 bits (396),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 108/207 (52%), Positives = 139/207 (67%), Gaps = 11/207 (5%)
 Frame = +1

Query  82   MAATEVSDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVL  261
            + A   ++V+DGPVLS+I+KR+RAL+KK NRI Q E+SL++GK LNKEQEE LR+KPAV 
Sbjct  5    LVAAGAAEVADGPVLSLISKRLRALRKKHNRILQTEESLAQGKPLNKEQEELLRSKPAVT  64

Query  262  AGIDELEKIRQPLSAALEEEISLSVQRHQVSALETPAPSEESGKEPEGDVENKGESDGGV  441
            A IDELEK+R PL+AAL EE+S            TP P        E +         G 
Sbjct  65   ALIDELEKLRSPLAAALHEELSRCPSPPPQDPSPTPPPPPPLAVAAESN---------GK  115

Query  442  VIEDLLNLLYFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidllgesdldl  621
             IEDLL LLYFG +FD++  Q+ FT +ML+R HER  CL+YDY+  DD+ DLLGE DLD 
Sbjct  116  AIEDLLALLYFGCLFDIRP-QSEFTGMMLTRTHERDCCLTYDYV-TDDATDLLGERDLDA  173

Query  622  lsllsgllisRSANSSLPHKNALQKCI  702
            +S+L  L+ SR   S + HKNALQ+C+
Sbjct  174  ISVLGSLVTSRPTYSGVSHKNALQECV  200



>ref|XP_008807869.1| PREDICTED: uncharacterized protein LOC103720099 isoform X4 [Phoenix 
dactylifera]
Length=336

 Score =   154 bits (389),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 105/197 (53%), Positives = 133/197 (68%), Gaps = 19/197 (10%)
 Frame = +1

Query  115  GPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVLAGIDELEKIRQ  294
            GPVL +I+KR+RAL+KK NRI Q E+SL++GK+LNKEQEE LR+KPAV A IDELEK+R 
Sbjct  19   GPVLGLISKRLRALRKKNNRILQTEESLAQGKSLNKEQEELLRSKPAVTALIDELEKLRS  78

Query  295  PLSAALEEEI-SLSVQRHQVSALETPAPSEESGKEPEGDVENKGESDGGVVIEDLLNLLY  471
            PL+AAL++E         Q  +   P  +E   K                 IEDLL+LLY
Sbjct  79   PLAAALQDEFSRRPSPPPQQPSPSAPVAAEPDDK----------------AIEDLLSLLY  122

Query  472  FGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidllgesdldllsllsgllis  651
            FG +FDV+  QN FT +ML+R HER  CL+YDY+  DD+ DLLGE DLD +S L  L+IS
Sbjct  123  FGCLFDVRP-QNEFTAMMLTRTHERDCCLTYDYV-TDDATDLLGERDLDTISALGSLVIS  180

Query  652  RSANSSLPHKNALQKCI  702
            R A S + HKNALQ+C+
Sbjct  181  RPAYSGVSHKNALQECV  197



>ref|XP_008807868.1| PREDICTED: uncharacterized protein LOC103720099 isoform X3 [Phoenix 
dactylifera]
Length=337

 Score =   154 bits (389),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 105/197 (53%), Positives = 133/197 (68%), Gaps = 19/197 (10%)
 Frame = +1

Query  115  GPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVLAGIDELEKIRQ  294
            GPVL +I+KR+RAL+KK NRI Q E+SL++GK+LNKEQEE LR+KPAV A IDELEK+R 
Sbjct  19   GPVLGLISKRLRALRKKNNRILQTEESLAQGKSLNKEQEELLRSKPAVTALIDELEKLRS  78

Query  295  PLSAALEEEI-SLSVQRHQVSALETPAPSEESGKEPEGDVENKGESDGGVVIEDLLNLLY  471
            PL+AAL++E         Q  +   P  +E   K                 IEDLL+LLY
Sbjct  79   PLAAALQDEFSRRPSPPPQQPSPSAPVAAEPDDK----------------AIEDLLSLLY  122

Query  472  FGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidllgesdldllsllsgllis  651
            FG +FDV+  QN FT +ML+R HER  CL+YDY+  DD+ DLLGE DLD +S L  L+IS
Sbjct  123  FGCLFDVRP-QNEFTAMMLTRTHERDCCLTYDYV-TDDATDLLGERDLDTISALGSLVIS  180

Query  652  RSANSSLPHKNALQKCI  702
            R A S + HKNALQ+C+
Sbjct  181  RPAYSGVSHKNALQECV  197



>ref|XP_009396953.1| PREDICTED: uncharacterized protein LOC103981916 [Musa acuminata 
subsp. malaccensis]
Length=419

 Score =   154 bits (389),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 103/215 (48%), Positives = 139/215 (65%), Gaps = 18/215 (8%)
 Frame = +1

Query  76   LSMAATEVSDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPA  255
            ++ +  EV    DGPVLS+++KR+RAL+KK NRI QME+SL++GK LNKEQEE LR+KPA
Sbjct  2    MASSGAEVVAAGDGPVLSLMSKRLRALRKKYNRILQMEESLAQGKPLNKEQEEVLRSKPA  61

Query  256  VLAGIDELEKIRQPLSAALEEEISLSVQRHQVSAL------ETPAPSEESGKEPEGDVEN  417
            +   IDE EK+RQPL+ AL+EE++ +      S        ET  P+  S  + E D   
Sbjct  62   IAVLIDEYEKLRQPLAVALQEELARTAASPPPSFPPPAVQEETHVPAAASAVKEEPD---  118

Query  418  KGESDGGVVIEDLLNLLYFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidl  597
                   + + D+L LLYFG +FDVK  Q+ F   ML+R HER  CL+YDY+  DD+I+L
Sbjct  119  -------LAVRDILTLLYFGCLFDVKP-QSEFAATMLTRTHERGCCLTYDYV-TDDAIEL  169

Query  598  lgesdldllsllsgllisRSANSSLPHKNALQKCI  702
            LGE DLD +S L  L+ SR   S + HKNAL+ C+
Sbjct  170  LGERDLDAISALGSLVTSRPVYSGVSHKNALEACL  204



>ref|XP_009398398.1| PREDICTED: uncharacterized protein LOC103983002 [Musa acuminata 
subsp. malaccensis]
Length=443

 Score =   154 bits (388),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 102/212 (48%), Positives = 137/212 (65%), Gaps = 18/212 (8%)
 Frame = +1

Query  82   MAATEVSDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVL  261
            MA++ +    DGPV ++++KR+RAL+KK NRI QME+SL++GK LNKEQEE LR+KPA+ 
Sbjct  1    MASSGMEAAVDGPVQNLMSKRLRALRKKYNRILQMEESLAQGKPLNKEQEEVLRSKPAIT  60

Query  262  AGIDELEKIRQPLSAALEEEISLSVQRHQVSALE-----TPAPSEESGKEPEGDVENKGE  426
              IDE EK+RQPL+ A++EE++ +               T APS +  KE          
Sbjct  61   VLIDEYEKLRQPLAVAVQEELARAAAASPPPPPAPQEEPTAAPSADDDKE----------  110

Query  427  SDGGVVIEDLLNLLYFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidllge  606
             + G  +EDLL LLYFG +FDVK  Q+ F   ML+R HER  CL+YDY+  DD+ DLLGE
Sbjct  111  -ELGPAVEDLLTLLYFGCLFDVKP-QSEFAATMLTRTHERGCCLTYDYV-TDDATDLLGE  167

Query  607  sdldllsllsgllisRSANSSLPHKNALQKCI  702
             DLD +S +  L+ SR   S + HKNALQ C+
Sbjct  168  QDLDAISAIGSLVTSRPVYSGISHKNALQVCL  199



>ref|XP_008807865.1| PREDICTED: uncharacterized protein LOC103720099 isoform X1 [Phoenix 
dactylifera]
Length=448

 Score =   153 bits (386),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 105/197 (53%), Positives = 133/197 (68%), Gaps = 19/197 (10%)
 Frame = +1

Query  115  GPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVLAGIDELEKIRQ  294
            GPVL +I+KR+RAL+KK NRI Q E+SL++GK+LNKEQEE LR+KPAV A IDELEK+R 
Sbjct  19   GPVLGLISKRLRALRKKNNRILQTEESLAQGKSLNKEQEELLRSKPAVTALIDELEKLRS  78

Query  295  PLSAALEEEI-SLSVQRHQVSALETPAPSEESGKEPEGDVENKGESDGGVVIEDLLNLLY  471
            PL+AAL++E         Q  +   P  +E   K                 IEDLL+LLY
Sbjct  79   PLAAALQDEFSRRPSPPPQQPSPSAPVAAEPDDK----------------AIEDLLSLLY  122

Query  472  FGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidllgesdldllsllsgllis  651
            FG +FDV+  QN FT +ML+R HER  CL+YDY+  DD+ DLLGE DLD +S L  L+IS
Sbjct  123  FGCLFDVRP-QNEFTAMMLTRTHERDCCLTYDYV-TDDATDLLGERDLDTISALGSLVIS  180

Query  652  RSANSSLPHKNALQKCI  702
            R A S + HKNALQ+C+
Sbjct  181  RPAYSGVSHKNALQECV  197



>ref|XP_008807866.1| PREDICTED: uncharacterized protein LOC103720099 isoform X2 [Phoenix 
dactylifera]
Length=447

 Score =   153 bits (386),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 105/197 (53%), Positives = 133/197 (68%), Gaps = 19/197 (10%)
 Frame = +1

Query  115  GPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVLAGIDELEKIRQ  294
            GPVL +I+KR+RAL+KK NRI Q E+SL++GK+LNKEQEE LR+KPAV A IDELEK+R 
Sbjct  19   GPVLGLISKRLRALRKKNNRILQTEESLAQGKSLNKEQEELLRSKPAVTALIDELEKLRS  78

Query  295  PLSAALEEEI-SLSVQRHQVSALETPAPSEESGKEPEGDVENKGESDGGVVIEDLLNLLY  471
            PL+AAL++E         Q  +   P  +E   K                 IEDLL+LLY
Sbjct  79   PLAAALQDEFSRRPSPPPQQPSPSAPVAAEPDDK----------------AIEDLLSLLY  122

Query  472  FGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidllgesdldllsllsgllis  651
            FG +FDV+  QN FT +ML+R HER  CL+YDY+  DD+ DLLGE DLD +S L  L+IS
Sbjct  123  FGCLFDVRP-QNEFTAMMLTRTHERDCCLTYDYV-TDDATDLLGERDLDTISALGSLVIS  180

Query  652  RSANSSLPHKNALQKCI  702
            R A S + HKNALQ+C+
Sbjct  181  RPAYSGVSHKNALQECV  197



>ref|XP_003561154.1| PREDICTED: uncharacterized protein LOC100834871 [Brachypodium 
distachyon]
Length=472

 Score =   152 bits (385),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 90/197 (46%), Positives = 122/197 (62%), Gaps = 17/197 (9%)
 Frame = +1

Query  109  SDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVLAGIDELEKI  288
            +DGPVLSV+ KR+RAL+KK NRISQME+S++ GKTLN+EQ+E LR+KP V A I+ELE+I
Sbjct  24   NDGPVLSVVTKRLRALRKKQNRISQMEESVAAGKTLNQEQKEVLRSKPIVAAVIEELERI  83

Query  289  RQPLSAALEEEISLSVQRHQVSALETPAPSEESGKEPEGDVENKGESDGGVVIEDLLNLL  468
            R PLS+AL EE+S             PAPS      P  D  +         I+DLL L+
Sbjct  84   RAPLSSALAEELST-----------IPAPS----AAPATDAGSSSSG-SDSSIQDLLALV  127

Query  469  YFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidllgesdldllsllsglli  648
            YFGS+FDVK  Q+ F   M++R HERS C++YDY+ DD +  L       + ++ +    
Sbjct  128  YFGSLFDVKP-QSEFVTTMVARTHERSCCITYDYVTDDAAELLAESDLDAVATVAALAAA  186

Query  649  sRSANSSLPHKNALQKC  699
              S    + H++ALQ C
Sbjct  187  RPSKAVGVTHRDALQAC  203



>ref|XP_010933750.1| PREDICTED: uncharacterized protein LOC105054054 [Elaeis guineensis]
Length=445

 Score =   147 bits (372),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 106/198 (54%), Positives = 135/198 (68%), Gaps = 16/198 (8%)
 Frame = +1

Query  109  SDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVLAGIDELEKI  288
            ++GPVLS+I+KR+RAL+KK NRI Q E+SL +GK+LNKEQEE LR+KPAV A IDELEK+
Sbjct  14   TEGPVLSLISKRLRALRKKHNRILQTEESLIQGKSLNKEQEELLRSKPAVTALIDELEKL  73

Query  289  RQPLSAALEEEISLSVQRHQVSALETPAPSEESGKEPEGDVENKGESDGGVVIEDLLNLL  468
            R PL+AAL +E S    R      +  +P   +      D            IEDL+ LL
Sbjct  74   RSPLAAALHDEFS----RLSSPPPQQSSPPPAAAATQPDD----------KAIEDLVVLL  119

Query  469  YFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidllgesdldllsllsglli  648
            YFG++FDVK  QN FT +ML+R HER  CL+YDY+  DD+ DLLGE DLD +S L  L+I
Sbjct  120  YFGNLFDVKP-QNEFTAMMLTRTHERDCCLTYDYV-TDDATDLLGERDLDTISALGSLVI  177

Query  649  sRSANSSLPHKNALQKCI  702
            SR A S + HKNALQ+C+
Sbjct  178  SRPAYSGVSHKNALQECL  195



>ref|NP_001168517.1| hypothetical protein [Zea mays]
 gb|ACN28496.1| unknown [Zea mays]
 gb|AFW67958.1| hypothetical protein ZEAMMB73_254492 [Zea mays]
Length=457

 Score =   147 bits (371),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 87/203 (43%), Positives = 124/203 (61%), Gaps = 21/203 (10%)
 Frame = +1

Query  91   TEVSDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVLAGI  270
            T  ++ +DGPVLSV++KR+RAL+KK NRI+QME+SL+ GK+LN+EQEE LR+KP V A I
Sbjct  21   TMAAEAADGPVLSVVSKRLRALRKKYNRITQMEESLAAGKSLNREQEEVLRSKPVVAALI  80

Query  271  DELEKIRQPLSAALEEEISLSVQRHQVSALETPAPSEESGKEPEGDVENKGESDGGVVIE  450
            DELE++R PL++AL EE+                    S +           SD    ++
Sbjct  81   DELERLRPPLASALAEEL--------------------SSRSAPAPAATASSSDSDSSVQ  120

Query  451  DLLNLLYFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidllgesdldllsl  630
            DLL L+YFGS+FDVK  Q+ F  ++ +RE ERSSCL+YDY+ DD    L+      + +L
Sbjct  121  DLLALVYFGSLFDVKQ-QSDFVSLVYTRELERSSCLTYDYVGDDPEDSLVETDLNAVSAL  179

Query  631  lsgllisRSANSSLPHKNALQKC  699
             +       A + + H++ALQ C
Sbjct  180  ATLAASRPPAAAGVSHRDALQAC  202



>ref|NP_001168582.1| uncharacterized protein LOC100382366 [Zea mays]
 gb|ACN28756.1| unknown [Zea mays]
 tpg|DAA50732.1| TPA: hypothetical protein ZEAMMB73_804328 [Zea mays]
Length=452

 Score =   141 bits (355),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 88/196 (45%), Positives = 122/196 (62%), Gaps = 22/196 (11%)
 Frame = +1

Query  112  DGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVLAGIDELEKIR  291
            DGPVLSV++KR+RAL+KK NRI+QME+SL+ GKTLN+EQEE LR+KP V A IDELE++R
Sbjct  29   DGPVLSVVSKRLRALRKKYNRITQMEESLAAGKTLNREQEEVLRSKPVVAALIDELERLR  88

Query  292  QPLSAALEEEISLSVQRHQVSALETPAPSEESGKEPEGDVENKGESDGGVVIEDLLNLLY  471
             PL++AL EE+S        +A  + + S                      ++DLL L+Y
Sbjct  89   PPLASALAEELSSRPAPAPSAASSSDSDSS---------------------VQDLLALVY  127

Query  472  FGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidllgesdldllsllsgllis  651
            FGS+FDVK  Q+ F  ++ +RE ERSSCL+YDY+ DD    L       + +L S   + 
Sbjct  128  FGSLFDVKQ-QSDFVSLVYTRELERSSCLTYDYVGDDPEDSLAETDLNAVSALASLAALR  186

Query  652  RSANSSLPHKNALQKC  699
              A + + H++ALQ C
Sbjct  187  PPAAAGVSHRDALQAC  202



>ref|XP_002466649.1| hypothetical protein SORBIDRAFT_01g011640 [Sorghum bicolor]
 gb|EER93647.1| hypothetical protein SORBIDRAFT_01g011640 [Sorghum bicolor]
Length=465

 Score =   140 bits (352),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 86/196 (44%), Positives = 118/196 (60%), Gaps = 17/196 (9%)
 Frame = +1

Query  112  DGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVLAGIDELEKIR  291
            DGPVLSV++KR+RAL+KK NRI+QME+SL+ GKTLN+EQEE LR+KP V A IDELE++R
Sbjct  29   DGPVLSVVSKRLRALRKKYNRITQMEESLAAGKTLNREQEEVLRSKPVVAALIDELERLR  88

Query  292  QPLSAALEEEISLSVQRHQVSALETPAPSEESGKEPEGDVENKGESDGGVVIEDLLNLLY  471
             PL++A+ EE+S         A                       SD    ++DLL L+Y
Sbjct  89   PPLASAVAEELSSRPAPAPAPAPAA----------------AASSSDSDSSVQDLLALIY  132

Query  472  FGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidllgesdldllsllsgllis  651
            FGS+FDVK  Q+ F  ++ + E ERSSC++YDY+ DD    L       + +L S     
Sbjct  133  FGSLFDVKQ-QSDFVSLVYASELERSSCITYDYVGDDPEDSLAETDLNAVSALASLAASR  191

Query  652  RSANSSLPHKNALQKC  699
              A + + H++ALQ C
Sbjct  192  PPAAAGVSHRDALQAC  207



>ref|XP_008796647.1| PREDICTED: uncharacterized protein LOC103712049 [Phoenix dactylifera]
Length=441

 Score =   139 bits (350),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 99/195 (51%), Positives = 126/195 (65%), Gaps = 15/195 (8%)
 Frame = +1

Query  118  PVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVLAGIDELEKIRQP  297
            PVLS+I+KR+RAL+KK NRI QME+S ++GK LNKEQEE LR+KPAV A IDELEK+R P
Sbjct  14   PVLSLISKRLRALRKKHNRIIQMEESQAQGKPLNKEQEELLRSKPAVTALIDELEKLRSP  73

Query  298  LSAALEEEISLSVQRHQVSALETPAPSEESGKEPEGDVENKGESDGGVVIEDLLNLLYFG  477
            L AAL +E+S             P  +     EP               +ED+L LLYFG
Sbjct  74   LVAALHDELSRCPSPPPQDPPTPPPLA--VAAEPNDK-----------AVEDILALLYFG  120

Query  478  SMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidllgesdldllsllsgllisRS  657
             +FD++  Q+ FT +ML+R HER  CL+YDY+  DD+ DLLGE DLD +S L  L+ SR 
Sbjct  121  CLFDIRP-QSEFTSMMLTRTHERDCCLTYDYV-TDDATDLLGERDLDAISALGSLVTSRQ  178

Query  658  ANSSLPHKNALQKCI  702
            A S + HKNAL  C+
Sbjct  179  AYSGVSHKNALLGCV  193



>gb|ABR16221.1| unknown [Picea sitchensis]
Length=546

 Score =   134 bits (336),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 96/220 (44%), Positives = 131/220 (60%), Gaps = 23/220 (10%)
 Frame = +1

Query  106  VSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVLAGIDELEK  285
            V DGPVL ++NKR+RALKKK NRI Q+E+S ++GK +NKEQ++ LR+K +V   I+E EK
Sbjct  24   VKDGPVLCLMNKRLRALKKKYNRILQIEESKAQGKVINKEQDDVLRSKASVAVLIEEYEK  83

Query  286  IRQPLSAALEEEISLSVQRHQVSALETPAPSEESG---------------------KEPE  402
            +RQPL+ A++EEI+   +        +  P+ E G                      + E
Sbjct  84   LRQPLAVAVKEEIAEKEKELLEENAASKEPTAEDGVVTEETQDTQDSDEVKTSEATPQAE  143

Query  403  GDVENKGESDGGVVIEDLLNLLYFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdd  582
            GD    G       I +LL +LYF  +FDV T QN F  +M ++ HERSSCLSYDY+  D
Sbjct  144  GDDAKDGVGLSDEAIAELLKILYFAHLFDV-TSQNDFASMMWTKMHERSSCLSYDYV-TD  201

Query  583  dsidllgesdldllsllsgllisRSANSSLPHKNALQKCI  702
            D+   L E DLD LSL   L+ SR  N++L HK+ALQ C+
Sbjct  202  DATKPLAEEDLDALSLFGSLMTSRPPNATLSHKSALQSCV  241



>ref|XP_004982143.1| PREDICTED: glycine, alanine and asparagine-rich protein-like 
[Setaria italica]
Length=460

 Score =   133 bits (334),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 82/197 (42%), Positives = 118/197 (60%), Gaps = 15/197 (8%)
 Frame = +1

Query  109  SDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVLAGIDELEKI  288
            +DGPVLSV++KR+RAL+KK NRI+QME+SL+ GK LN EQEE LR+K  V+A I+ELE++
Sbjct  21   TDGPVLSVVSKRLRALRKKYNRITQMEESLAAGKKLNPEQEEVLRSKTVVVAQIEELERL  80

Query  289  RQPLSAALEEEISLSVQRHQVSALETPAPSEESGKEPEGDVENKGESDGGVVIEDLLNLL  468
            R PL++AL EE+S         A    A +  S  +                + D L L+
Sbjct  81   RAPLASALAEELSSRPAPAPAPAPAAAAAASSSDSD--------------SSVLDFLPLV  126

Query  469  YFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidllgesdldllsllsglli  648
            YFGS+FDVK  Q  F   M++R HER+ C++YDY+ DD +  L       + +L S    
Sbjct  127  YFGSLFDVKQ-QGDFVATMVARTHERNCCITYDYVTDDAADLLAETDLDAVSALASLAAS  185

Query  649  sRSANSSLPHKNALQKC  699
              ++ + + H++ALQ C
Sbjct  186  RPASAAGVSHRDALQAC  202



>emb|CDM83736.1| unnamed protein product [Triticum aestivum]
Length=664

 Score =   133 bits (334),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 70/161 (43%), Positives = 106/161 (66%), Gaps = 27/161 (17%)
 Frame = +1

Query  97   VSDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVLAGIDE  276
            +S++ +GPVLSV++KR+R L+KK NRI+QME+S++ GK LN+EQ+E + +KP + A IDE
Sbjct  411  ISEIKEGPVLSVVSKRLRVLRKKQNRIAQMEESVAAGKMLNQEQKELMHSKPVIAALIDE  470

Query  277  LEKIRQPLSAALEEEISLSVQRHQVSALETPAPSEESGKEPEGDVENKGESDGG--VVIE  450
            LE++R PLS +L +E+S             PAP+              G S  G  + ++
Sbjct  471  LERLRVPLSTSLTKELS-----------TVPAPA-------------AGSSSFGSDLSVQ  506

Query  451  DLLNLLYFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYM  573
            DLL L+YFGS+F VK+  N F   M++R+HERSSC+++ Y+
Sbjct  507  DLLALIYFGSLFYVKS-PNEFIATMVARKHERSSCITHGYV  546



>ref|XP_001771935.1| predicted protein [Physcomitrella patens]
 gb|EDQ63196.1| predicted protein [Physcomitrella patens]
Length=422

 Score =   129 bits (324),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 99/216 (46%), Positives = 137/216 (63%), Gaps = 23/216 (11%)
 Frame = +1

Query  112  DGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVLAGIDELEKIR  291
            DGPVL++++KR+RALKKK NRI Q+E++  +GKT+NKEQE+ L+TK A+ A IDE EK+R
Sbjct  20   DGPVLTMMSKRLRALKKKYNRILQIEENKRQGKTVNKEQEDVLKTKIAIAALIDEYEKLR  79

Query  292  QPLSAALEEEISLSVQRHQVSALETPAPSE------ESGKEPEGDVENKG----------  423
            QPL +A++EE++   +    + LE     E      +S KE   +VE +           
Sbjct  80   QPLISAVKEEVAEREKELLAATLERKQEEESSQDVTDSEKEKLTEVEKESFVRVSESVVP  139

Query  424  ---ESDGGVVIEDLLNLLYFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsid  594
                S+G V   DLL LLYF  +FDV++ Q     +M +R HERSSCLSYD++  DDS  
Sbjct  140  ENVFSEGDV--SDLLKLLYFSHLFDVRS-QGEAPSLMWTRVHERSSCLSYDFV-TDDSTT  195

Query  595  llgesdldllsllsgllisRSANSSLPHKNALQKCI  702
             L E+DLD LSL   +L SR  N +L H++ALQ+CI
Sbjct  196  PLIEADLDALSLFGSMLTSRPPNETLSHRDALQRCI  231



>gb|EMS56397.1| hypothetical protein TRIUR3_34734 [Triticum urartu]
Length=591

 Score =   128 bits (322),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 77/203 (38%), Positives = 120/203 (59%), Gaps = 27/203 (13%)
 Frame = +1

Query  97   VSDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVLAGIDE  276
            +S+  +G  LSV++KR+RAL+KK +RI+QME+S++ GK LN++Q+E + +KP + A IDE
Sbjct  341  ISETKEGLALSVVSKRLRALRKKQDRIAQMEESVAAGKVLNQDQKEVMHSKPTIAALIDE  400

Query  277  LEKIRQPLSAALEEEISLSVQRHQVSALETPAPSEESGKEPEGDVENKGESDGG--VVIE  450
            LE++R PLS AL +E+S             PAP+              G S  G  + I+
Sbjct  401  LERLRVPLSTALTKELS-----------TVPAPA-------------AGSSSFGSDLSIQ  436

Query  451  DLLNLLYFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidllgesdldllsl  630
            DLL L+YFGS+F VK+  + F   M++R+HERSSC++Y Y+ DD    L       + ++
Sbjct  437  DLLALVYFGSLFYVKS-PDEFITTMVARKHERSSCITYGYVWDDTVDLLTENDLDAVSAV  495

Query  631  lsgllisRSANSSLPHKNALQKC  699
             +      ++   + H +ALQ C
Sbjct  496  AALATARPASAVGVSHHDALQAC  518



>gb|EMT18822.1| hypothetical protein F775_06861 [Aegilops tauschii]
Length=869

 Score =   129 bits (324),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 76/203 (37%), Positives = 121/203 (60%), Gaps = 27/203 (13%)
 Frame = +1

Query  97   VSDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVLAGIDE  276
            +S+  +GP LSV++KR+RAL+KK +RI++ME+S++ GK LN++Q+E + +KP + A I+E
Sbjct  396  ISETKEGPALSVVSKRLRALRKKQDRIARMEESVAAGKVLNQDQKEVMHSKPTIAALINE  455

Query  277  LEKIRQPLSAALEEEISLSVQRHQVSALETPAPSEESGKEPEGDVENKGESDGG--VVIE  450
            LE++R PLS AL +E+S             PAP+              G S  G  + I+
Sbjct  456  LERLRVPLSTALTKELS-----------TVPAPA-------------AGSSSFGSDLSIQ  491

Query  451  DLLNLLYFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidllgesdldllsl  630
            DLL L+YFGS+F VK+  + F   M++R+HERSSC++Y Y+ DD    L       + ++
Sbjct  492  DLLALVYFGSLFYVKS-PDEFITTMVARKHERSSCITYGYVWDDTVDLLTENDLDAVSAV  550

Query  631  lsgllisRSANSSLPHKNALQKC  699
             +      ++   + H +ALQ C
Sbjct  551  AALATARPASAVGVSHHDALQAC  573



>gb|EMS62622.1| hypothetical protein TRIUR3_18305 [Triticum urartu]
Length=572

 Score =   125 bits (313),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 69/161 (43%), Positives = 103/161 (64%), Gaps = 27/161 (17%)
 Frame = +1

Query  97   VSDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVLAGIDE  276
            +S+  +G  LSV +KR+RAL+KK +RI+QME+S++ GK LN++Q+E + +KP + A IDE
Sbjct  388  ISETKEGLALSVASKRLRALRKKQDRIAQMEESVASGKVLNQDQKEVMHSKPTIAALIDE  447

Query  277  LEKIRQPLSAALEEEISLSVQRHQVSALETPAPSEESGKEPEGDVENKGESDGG--VVIE  450
            LE++R PLS AL +E+S             PAP+              G S  G  + I+
Sbjct  448  LERLRVPLSTALTKELS-----------TVPAPA-------------AGSSSFGSDLSIQ  483

Query  451  DLLNLLYFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYM  573
            DLL L+YFGS+F VK+  + F   M++R+HERSSC++Y Y+
Sbjct  484  DLLALVYFGSLFYVKS-PDEFITTMVARKHERSSCITYGYV  523



>ref|XP_002988977.1| hypothetical protein SELMODRAFT_129003 [Selaginella moellendorffii]
 gb|EFJ10006.1| hypothetical protein SELMODRAFT_129003 [Selaginella moellendorffii]
Length=431

 Score =   122 bits (306),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 91/222 (41%), Positives = 133/222 (60%), Gaps = 28/222 (13%)
 Frame = +1

Query  82   MAATEVSDV------SDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLR  243
            MAA +VS V       DGPVL+++NKR+RALKKK NRI Q+E++  KGK +NKEQE+ L+
Sbjct  1    MAALDVSGVEDSSCGKDGPVLTMMNKRLRALKKKYNRIVQLEEAKEKGKAINKEQEDVLK  60

Query  244  TKPAVLAGIDELEKIRQPLSAALEEEIS------LSVQRHQVSA---LETPAPSEESGKE  396
            +K  VL  ++E +++RQPL  A+ EEI+      ++ +  QVS    +E P  S      
Sbjct  61   SKVQVLTLMEEYDRLRQPLLVAVREEIAEKEKEWIATKEEQVSGNEKIEVPVDS------  114

Query  397  PEGDVENKGESDGGVVIEDLLNLLYFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMK  576
              G V    E     ++ +L+ LLYF  +FDV++     + +   + HER SCLSYD + 
Sbjct  115  --GSVAGLDEH----LMLELIQLLYFALLFDVQSQGEAHSFMRTVKYHERVSCLSYD-LV  167

Query  577  dddsidllgesdldllsllsgllisRSANSSLPHKNALQKCI  702
             DDS   L ++DLD L+    L+ SR  N++L H++ALQ CI
Sbjct  168  TDDSTSHLTDADLDALAAFGSLMTSRPPNTTLSHRDALQACI  209



>gb|KHN01223.1| Abietadienol/abietadienal oxidase [Glycine soja]
Length=293

 Score =   120 bits (300),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 88/189 (47%), Positives = 118/189 (62%), Gaps = 7/189 (4%)
 Frame = +1

Query  136  NKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVLAGIDELEKIRQPLSAALE  315
            N  + AL+K +  +  ++ S      +NKEQEE LR+KP++LA IDEL+K+RQPL+ AL 
Sbjct  37   NISLDALRKII--MDAIQGSPKASLNVNKEQEEVLRSKPSILALIDELDKLRQPLATALS  94

Query  316  EEISLSVQRHQVSALETPAPSEESGKEPEGDVENKGESDGGVVIEDLLNLLYFGSMFDVK  495
            EE+ ++    Q    ET     E+  E  G +E    S   VV+EDLLN LYFGS+FDVK
Sbjct  95   EELQINGTSSQNPHHETET-ENETLAESSGSIEPNSNSRNDVVVEDLLNFLYFGSLFDVK  153

Query  496  TLQNHFTEVMLSREHERSSCLSYDYMKdddsidllgesdldllsllsgllisRSANSSLP  675
            +    F   ML+R HER  CL+YDY+  DD+ DLLGE DLD +S L GLL+    +SS  
Sbjct  154  S---DFVSTMLTRTHERGCCLTYDYVT-DDATDLLGEKDLDSISALRGLLVLWPVDSSFS  209

Query  676  HKNALQKCI  702
            HKN L +C+
Sbjct  210  HKNVLHRCV  218



>emb|CBI32031.3| unnamed protein product [Vitis vinifera]
Length=399

 Score =   121 bits (304),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 105/207 (51%), Positives = 129/207 (62%), Gaps = 50/207 (24%)
 Frame = +1

Query  82   MAATEVSDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVL  261
            MAA   SDV+DGPVLS+INKR+R L+KK NRI+QME+++++GK +NKEQE+ LR+KPAV 
Sbjct  1    MAA---SDVTDGPVLSLINKRLRGLRKKYNRITQMEEAIAQGKPINKEQEDVLRSKPAVT  57

Query  262  AGIDELEKIRQPLSAALEEEISLSVQRHQVSALETPAPSEESGKEPEGDVENKGESDGGV  441
             G D                                            D E K ESD  +
Sbjct  58   DGAD--------------------------------------------DGEEKPESD-HL  72

Query  442  VIEDLLNLLYFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidllgesdldl  621
             +E+LLNLLYFG +FDVK  Q  FT  ML+R HER  CL+YDY+  DD+ DLLGE DLDL
Sbjct  73   NVENLLNLLYFGYLFDVKP-QTDFTSTMLTRTHERGCCLTYDYV-TDDATDLLGERDLDL  130

Query  622  lsllsgllisRSANSSLPHKNALQKCI  702
            +S LSGLLISR  +SSL HKNALQ+CI
Sbjct  131  ISQLSGLLISRPVDSSLSHKNALQRCI  157



>ref|XP_006573960.1| PREDICTED: uncharacterized protein LOC100816385 [Glycine max]
Length=370

 Score =   120 bits (300),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 90/189 (48%), Positives = 120/189 (63%), Gaps = 7/189 (4%)
 Frame = +1

Query  136  NKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVLAGIDELEKIRQPLSAALE  315
            N  + AL+K +  +  ++ S      +NKEQEE LR+KP++LA IDEL+K+RQPL+ AL 
Sbjct  37   NISLDALRKTI--MDAIQGSPKASLNVNKEQEEVLRSKPSILALIDELDKLRQPLATALS  94

Query  316  EEISLSVQRHQVSALETPAPSEESGKEPEGDVENKGESDGGVVIEDLLNLLYFGSMFDVK  495
            EE+ ++    Q    ET     E+  E  G +E    S   VV+EDLLN LYFGS+FDVK
Sbjct  95   EELQINDTSSQNPHHETEI-ENETLAESSGSIEPNSNSRNDVVVEDLLNFLYFGSLFDVK  153

Query  496  TLQNHFTEVMLSREHERSSCLSYDYMKdddsidllgesdldllsllsgllisRSANSSLP  675
            +    F   ML+R HER  CL+YDY+  DD+ DLLGE DLD +S L GLL+SR A+SS  
Sbjct  154  S---DFVSTMLTRTHERGCCLTYDYV-IDDATDLLGEKDLDSISALRGLLVSRPADSSFS  209

Query  676  HKNALQKCI  702
            HK+ L  C+
Sbjct  210  HKSVLHCCV  218



>gb|EEC75970.1| hypothetical protein OsI_13079 [Oryza sativa Indica Group]
Length=466

 Score =   120 bits (300),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 86/197 (44%), Positives = 121/197 (61%), Gaps = 13/197 (7%)
 Frame = +1

Query  109  SDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVLAGIDELEKI  288
            +DGP LSV++KR+RAL+KK NRI QME+SL+ G+ LNKEQEE LR+KPAV+A IDELE++
Sbjct  24   TDGPTLSVVSKRLRALRKKHNRILQMEESLAGGRKLNKEQEEVLRSKPAVVALIDELERM  83

Query  289  RQPLSAALEEEISLSVQRHQVSALETPAPSEESGKEPEGDVENKGESDGGVVIEDLLNLL  468
            R PL+AAL EE+S        +A   PA S  +G                 V+EDLL L+
Sbjct  84   RAPLAAALAEELSSRPAPSSSAAPPPPASSSAAGAA------------DSSVVEDLLALI  131

Query  469  YFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidllgesdldllsllsglli  648
            YFG++FD+K  Q  F   M++R  ER  C++YDY+ +D +  L       + +L +    
Sbjct  132  YFGTLFDLKP-QTEFVATMVARAQERDCCITYDYVTEDAADLLHQSDLDKVSALAALAAS  190

Query  649  sRSANSSLPHKNALQKC  699
              +A   + H++ALQ C
Sbjct  191  RPAAAVGVSHRDALQSC  207



>ref|XP_001761769.1| predicted protein [Physcomitrella patens]
 gb|EDQ73525.1| predicted protein, partial [Physcomitrella patens]
Length=437

 Score =   118 bits (295),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 88/205 (43%), Positives = 127/205 (62%), Gaps = 20/205 (10%)
 Frame = +1

Query  115  GPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVLAGIDELEKIRQ  294
            GPVL++++KR+RALKKK +RI Q+E++  +GK +NKEQE+ L+ K  + A IDE EK+RQ
Sbjct  25   GPVLTMMSKRLRALKKKYSRILQIEENKRQGKAVNKEQEDVLKAKIGIAALIDEYEKLRQ  84

Query  295  PLSAALEEEISLSVQRHQVSALETPAPSEESGKEPEGDVENKGESDGGVV---------I  447
            PL  A++EE++   +    + LE         +  E + E+    + GVV         +
Sbjct  85   PLMIAVKEEVAEREKELLAATLE---------RNQEEESESIVRKNTGVVREDVFSERDV  135

Query  448  EDLLNLLYFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidllgesdldlls  627
             DLL LLYF  +FDV++       ++ +R HERSSCLSYD++  DDS   L ESDLD LS
Sbjct  136  ADLLKLLYFAHLFDVRS-PGEAPSLVWTRVHERSSCLSYDFV-TDDSTTPLIESDLDALS  193

Query  628  llsgllisRSANSSLPHKNALQKCI  702
                +L SR  N +L H++ALQ+CI
Sbjct  194  FFGSMLTSRPPNETLSHRDALQRCI  218



>ref|NP_001050943.1| Os03g0688200 [Oryza sativa Japonica Group]
 gb|AAT81716.1| putative glycine rich protein [Oryza sativa Japonica Group]
 gb|AAT85066.1| hypothetical protein [Oryza sativa Japonica Group]
 gb|ABF98269.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF12857.1| Os03g0688200 [Oryza sativa Japonica Group]
Length=466

 Score =   117 bits (293),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 85/197 (43%), Positives = 120/197 (61%), Gaps = 13/197 (7%)
 Frame = +1

Query  109  SDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVLAGIDELEKI  288
            +DGP LSV++KR+RAL+KK NRI QME+SL+ G+ LNKEQE  LR+KPAV+A IDELE++
Sbjct  24   TDGPTLSVVSKRLRALRKKHNRILQMEESLAGGRKLNKEQEGVLRSKPAVVALIDELERM  83

Query  289  RQPLSAALEEEISLSVQRHQVSALETPAPSEESGKEPEGDVENKGESDGGVVIEDLLNLL  468
            R PL+AAL EE+S        +A   PA S  +G                 V+EDLL L+
Sbjct  84   RAPLAAALAEELSSRPAPSSSAAPPPPASSSAAGAA------------DSSVVEDLLALI  131

Query  469  YFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidllgesdldllsllsglli  648
            YFG++FD+K  Q  F   M++R  ER  C++YDY+ +D +  L       + +L +    
Sbjct  132  YFGTLFDLKP-QTEFVATMVARAQERDCCITYDYVTEDAADLLHQSDLDKVSALAALAAS  190

Query  649  sRSANSSLPHKNALQKC  699
              +A   + H++ALQ C
Sbjct  191  RPAAAVGVSHRDALQSC  207



>gb|EAZ28187.1| hypothetical protein OsJ_12160 [Oryza sativa Japonica Group]
Length=468

 Score =   117 bits (293),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 85/197 (43%), Positives = 120/197 (61%), Gaps = 13/197 (7%)
 Frame = +1

Query  109  SDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVLAGIDELEKI  288
            +DGP LSV++KR+RAL+KK NRI QME+SL+ G+ LNKEQE  LR+KPAV+A IDELE++
Sbjct  24   TDGPTLSVVSKRLRALRKKHNRILQMEESLAGGRKLNKEQEGVLRSKPAVVALIDELERM  83

Query  289  RQPLSAALEEEISLSVQRHQVSALETPAPSEESGKEPEGDVENKGESDGGVVIEDLLNLL  468
            R PL+AAL EE+S        +A   PA S  +G                 V+EDLL L+
Sbjct  84   RAPLAAALAEELSSRPAPSSSAAPPPPASSSAAGAA------------DSSVVEDLLALI  131

Query  469  YFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidllgesdldllsllsglli  648
            YFG++FD+K  Q  F   M++R  ER  C++YDY+ +D +  L       + +L +    
Sbjct  132  YFGTLFDLKP-QTEFVATMVARAQERDCCITYDYVTEDAADLLHQSDLDKVSALAALAAS  190

Query  649  sRSANSSLPHKNALQKC  699
              +A   + H++ALQ C
Sbjct  191  RPAAAVGVSHRDALQSC  207



>ref|XP_002975088.1| hypothetical protein SELMODRAFT_442638 [Selaginella moellendorffii]
 gb|EFJ23873.1| hypothetical protein SELMODRAFT_442638 [Selaginella moellendorffii]
Length=500

 Score =   115 bits (289),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 96/265 (36%), Positives = 139/265 (52%), Gaps = 59/265 (22%)
 Frame = +1

Query  82   MAATEVSDV------SDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLR  243
            MAA +VS V       DGPVL+++NKR+RALKKK NRI Q+E++  KGK +NKEQE+ L+
Sbjct  1    MAALDVSGVEDSSCGKDGPVLTMMNKRLRALKKKYNRIVQLEEAKEKGKAINKEQEDVLK  60

Query  244  TKPAVLAGIDELEKIRQPLSAALEEEIS------LSVQRHQVSALETPAPSEESGKEPE-  402
            +K  VL  ++E +++RQPL  A+ EEI+      ++ +  QVS + +    EE+  E E 
Sbjct  61   SKVQVLTLMEEYDRLRQPLLVAVREEIAEKEKEWIAAKEEQVSGVASSENLEEARTESEE  120

Query  403  -----------GDVENKGES----------------------------DGGVVIED----  453
                       G+ +N G                              D G V  D    
Sbjct  121  ASNENLENAGSGEADNVGGGGGDPAFAAAATATPAAATEENEKIEVPVDSGSVAVDEHLM  180

Query  454  --LLNLLYFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidllgesdldlls  627
              L+ LLYF  +FDV++     + +   + HER SCLSYD +  DDS   L ++DLD L+
Sbjct  181  LELIQLLYFALLFDVQSQGEAHSFMRTVKYHERVSCLSYD-LVTDDSTSHLTDADLDALA  239

Query  628  llsgllisRSANSSLPHKNALQKCI  702
                L+ SR  N++L H++ALQ CI
Sbjct  240  AFGSLMTSRPPNTTLSHRDALQACI  264



>gb|ABR16471.1| unknown [Picea sitchensis]
Length=539

 Score =   106 bits (264),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 90/238 (38%), Positives = 127/238 (53%), Gaps = 43/238 (18%)
 Frame = +1

Query  112  DGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVLAGIDELEKIR  291
            + PVL ++NKRIRAL+KK NRI Q+E++ S+GK +NKEQEE L +K  +   IDE EK++
Sbjct  23   ESPVLCLLNKRIRALRKKYNRILQIEENKSQGKVINKEQEEVLCSKNGIAVLIDEFEKLK  82

Query  292  QPLSAALEEEISLSVQRHQVSALETPAPSEESGKEPE----GDVENKGESDGGVVIE---  450
            QPLS AL EE++   +    S L+ P   + S  + E     D E     DGG+  E   
Sbjct  83   QPLSNALREELAEREREFMDSVLKRPDEDDGSTNDKEYSSANDKEQSFADDGGLNNEDSD  142

Query  451  ----------------------------------DLLNLLYFGSMFDVKTLQNHFTEVML  528
                                              DLL +LYF  +F+V +  N    +M 
Sbjct  143  EKGIMANGYSEETRKECEESSAMDKEAPDLNAASDLLKILYFAKLFNVCS-PNRLASIMW  201

Query  529  SREHERSSCLSYDYMKdddsidllgesdldllsllsgllisRSANSSLPHKNALQKCI  702
            ++ HER SCLSYDY+  +DS D L E DLD LS++   + SR  N+++ H +ALQ C+
Sbjct  202  TKTHERISCLSYDYV-TEDSTDHLREEDLDALSMVGSFMTSRPPNATISHNDALQICV  258



>gb|EMT18821.1| hypothetical protein F775_02142 [Aegilops tauschii]
Length=871

 Score =   102 bits (254),  Expect = 6e-21, Method: Composition-based stats.
 Identities = 77/201 (38%), Positives = 121/201 (60%), Gaps = 23/201 (11%)
 Frame = +1

Query  97   VSDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVLAGIDE  276
            V ++ +GPVLSV+++R+R L++K NRI+QME+S++ GK L +EQ+E + +KP + A IDE
Sbjct  426  VFEIKEGPVLSVVSRRLRVLRRKQNRIAQMEESVAAGKMLYQEQKELMHSKPVIAALIDE  485

Query  277  LEKIRQPLSAALEEEISLSVQRHQVSALETPAPSEESGKEPEGDVENKGESDGGVVIEDL  456
            LE++R PLS AL +E++       VSA   PA    S                 + I+DL
Sbjct  486  LERLRVPLSTALTKELT------TVSA---PAAGSSS-------------FGSDLSIQDL  523

Query  457  LNLLYFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidllgesdldllslls  636
            L L+YFGS+F VK+  N F   M++R+HERSSC+++ Y+ DD    L+  +   + ++ +
Sbjct  524  LALIYFGSLFHVKS-PNEFIATMVARKHERSSCITHGYVWDDTVDLLVENALDAVSAVAA  582

Query  637  gllisRSANSSLPHKNALQKC  699
                  S+   + H +ALQ C
Sbjct  583  LAAACPSSADGVSHHDALQAC  603



>ref|XP_002883544.1| hypothetical protein ARALYDRAFT_479980 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59803.1| hypothetical protein ARALYDRAFT_479980 [Arabidopsis lyrata subsp. 
lyrata]
Length=156

 Score = 87.0 bits (214),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 48/83 (58%), Positives = 63/83 (76%), Gaps = 7/83 (8%)
 Frame = +1

Query  82   MAATEVSDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVL  261
            MAA E      GP+L++I+KR+R L+KK NRI+ ME+S+S+GKTLNKEQEETLR+KP V 
Sbjct  1    MAAVE------GPILALISKRLRTLRKKYNRITDMEESISQGKTLNKEQEETLRSKPIVT  54

Query  262  AGIDELEKIRQPLSAALEEEISL  330
            A IDEL  +R P   ++ EEI+L
Sbjct  55   ALIDELINLRIP-PPSVAEEINL  76



>ref|NP_189112.1| uncharacterized protein [Arabidopsis thaliana]
 dbj|BAB01218.1| unnamed protein product [Arabidopsis thaliana]
 gb|AEE76936.1| uncharacterized protein AT3G24690 [Arabidopsis thaliana]
Length=158

 Score = 84.0 bits (206),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 48/83 (58%), Positives = 62/83 (75%), Gaps = 7/83 (8%)
 Frame = +1

Query  82   MAATEVSDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVL  261
            MAA E      G + ++I+KR+R L+KK NRI+ ME+S+S+GKTLNKEQE+TLR+KP V 
Sbjct  1    MAAVE------GQISALISKRLRTLRKKYNRITDMEESISQGKTLNKEQEDTLRSKPIVS  54

Query  262  AGIDELEKIR-QPLSAALEEEIS  327
            A IDEL K+R  P SAA+ EE S
Sbjct  55   ALIDELVKLRIPPPSAAISEETS  77



>ref|XP_010513678.1| PREDICTED: uncharacterized protein LOC104789722 [Camelina sativa]
Length=152

 Score = 78.2 bits (191),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 45/85 (53%), Positives = 60/85 (71%), Gaps = 7/85 (8%)
 Frame = +1

Query  82   MAATEVSDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVL  261
            MAATE      GPV ++I+KR+RA +KK N+I  +E+S+S+GKTLNK+Q E LR+KP V 
Sbjct  1    MAATE------GPVFALISKRLRAHRKKYNKIVGLEESISQGKTLNKDQVEILRSKPIVT  54

Query  262  AGIDELEKIR-QPLSAALEEEISLS  333
            A IDEL K+R  P S    EE ++S
Sbjct  55   ALIDELLKLRIPPPSGVAPEETTVS  79



>ref|XP_010488577.1| PREDICTED: uncharacterized protein LOC104766398 [Camelina sativa]
Length=152

 Score = 77.8 bits (190),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 45/84 (54%), Positives = 61/84 (73%), Gaps = 7/84 (8%)
 Frame = +1

Query  82   MAATEVSDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVL  261
            MAATE      GPV+++I+KR+RA +KK N+I  +E+S+S+GKTLNK+Q E LR+KP V 
Sbjct  1    MAATE------GPVVALISKRLRAHRKKYNKIVGLEESISQGKTLNKDQVEILRSKPIVT  54

Query  262  AGIDELEKIR-QPLSAALEEEISL  330
            A IDEL K+R  P S  + EE S+
Sbjct  55   ALIDELLKLRIPPPSDVVPEETSV  78



>ref|XP_010466896.1| PREDICTED: uncharacterized protein LOC104747029 [Camelina sativa]
Length=156

 Score = 77.8 bits (190),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 45/84 (54%), Positives = 61/84 (73%), Gaps = 7/84 (8%)
 Frame = +1

Query  82   MAATEVSDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVL  261
            MAATE      GPV+++I+KR+RA +KK N+I  +E+S+S+GKTLNK+Q E LR+KP V 
Sbjct  1    MAATE------GPVVALISKRLRAHRKKYNKIVGLEESISQGKTLNKDQVEILRSKPIVT  54

Query  262  AGIDELEKIR-QPLSAALEEEISL  330
            A IDEL K+R  P S  + EE S+
Sbjct  55   ALIDELLKLRIPPPSDVVPEETSV  78



>ref|XP_005652064.1| hypothetical protein COCSUDRAFT_64270 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE27520.1| hypothetical protein COCSUDRAFT_64270 [Coccomyxa subellipsoidea 
C-169]
Length=535

 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 80/234 (34%), Positives = 116/234 (50%), Gaps = 40/234 (17%)
 Frame = +1

Query  91   TEVSDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVLAGI  270
            +E     +GPVL+VI KR+RA  KKL R+ ++E + + GKTLN +QEE LR K  VL  I
Sbjct  26   SEAPKDGEGPVLTVITKRLRAANKKLKRVEEIESARAAGKTLNADQEEVLRGKAKVLGTI  85

Query  271  DELEKIRQPLSAALEEEISLSVQRHQVSALETPAPS---EESGKEPEGDVENK-------  420
            +ELE++   L  AL+EE S S++    SA E  A +   +E+  + +   E K       
Sbjct  86   EELERLTPLLKEALQEERS-SLEAAAQSAAEKFARAVAEQEAASKIDALEEAKAATERSA  144

Query  421  -------------------GESDGGV--VIEDLLNLLYFGSMFDVKTLQNHFTEVMLSRE  537
                                 S  GV   +  LL L+YF  +F       H        +
Sbjct  145  AAAQAEAAEAKQQLAELQAAPSGEGVDSAVTRLLQLIYFAMLFLDDGSHQH--------Q  196

Query  538  HERSSCLSYDYMKdddsidllgesdldllsllsgllisRSANSSLPHKNALQKC  699
             ERS+C SYDY  + +   +L  +DL L+S L  L+I RS N +L H+++L  C
Sbjct  197  SERSACRSYDYDDEGNPDAVLSSNDLTLISQLGQLIIQRSPNQTLCHQDSLAHC  250



>ref|XP_006396698.1| hypothetical protein EUTSA_v10029189mg [Eutrema salsugineum]
 gb|ESQ38151.1| hypothetical protein EUTSA_v10029189mg [Eutrema salsugineum]
Length=166

 Score = 74.7 bits (182),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 45/78 (58%), Positives = 61/78 (78%), Gaps = 3/78 (4%)
 Frame = +1

Query  121  VLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVLAGIDELEKIR---  291
            VL++I+KR+RAL+KK  RI++ME+S+S+GK LNK+QEE LR+KP V A I+ELEK+R   
Sbjct  9    VLALISKRLRALRKKNKRIAEMEESISQGKILNKDQEEILRSKPIVTALIEELEKLRLPS  68

Query  292  QPLSAALEEEISLSVQRH  345
             P S A+ EEISL  Q+ 
Sbjct  69   PPPSVAVPEEISLPSQKK  86



>emb|CDX94550.1| BnaC09g22860D [Brassica napus]
Length=165

 Score = 74.3 bits (181),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 34/57 (60%), Positives = 51/57 (89%), Gaps = 0/57 (0%)
 Frame = +1

Query  121  VLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVLAGIDELEKIR  291
            V+++I+KR+RA +K+ NRI++ME+++S+GKTLNKEQEE +R+KP V A I+ELEK+R
Sbjct  9    VMALISKRLRAHRKRYNRITEMEEAVSQGKTLNKEQEEAIRSKPIVTALIEELEKLR  65



>ref|XP_003613551.1| hypothetical protein MTR_5g037970 [Medicago truncatula]
 gb|AES96509.1| hypothetical protein MTR_5g037970 [Medicago truncatula]
Length=132

 Score = 73.2 bits (178),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 47/108 (44%), Positives = 64/108 (59%), Gaps = 10/108 (9%)
 Frame = +1

Query  238  LRTKPAVLAGIDELEKIRQPLSAALEEEISLSVQRHQVSALETPAPSEESGKEPEGDVEN  417
            L +  +VLA IDEL K+ + +S+AL EE+ L+ Q    S  E+   +E S   P G+  N
Sbjct  13   LYSNSSVLALIDELGKLHKSISSALVEELELATQTKNESR-ESETLAENSEPRPSGENSN  71

Query  418  KGESDGGVVIEDLLNLLYFGSMFDVKTLQNHFTEVMLSREHERSSCLS  561
                    V+ED+LNLLYFGS+F+VKT QN FT  ML+   ER   +S
Sbjct  72   --------VVEDILNLLYFGSLFEVKT-QNDFTSTMLTMTRERGLLIS  110



>gb|KFK44624.1| hypothetical protein AALP_AA1G282900 [Arabis alpina]
Length=331

 Score = 75.9 bits (185),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 53/95 (56%), Positives = 71/95 (75%), Gaps = 4/95 (4%)
 Frame = +1

Query  418  KGESDGGVVIEDLLNLLYFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidl  597
            K   DG   +EDL+NLLYFGS+FDVK+ QN FT VM++R HER  CL+YDY+  DDS + 
Sbjct  25   KASDDGH--LEDLVNLLYFGSLFDVKS-QNDFTSVMVTRTHERGCCLTYDYV-TDDSTEF  80

Query  598  lgesdldllsllsgllisRSANSSLPHKNALQKCI  702
            LG+ DLD +S L  L++SR  +S+L H+NAL++CI
Sbjct  81   LGDRDLDSISQLWSLMVSRPMDSNLSHRNALERCI  115



>ref|XP_009114578.1| PREDICTED: uncharacterized protein LOC103839843 [Brassica rapa]
 emb|CDY16672.1| BnaA09g20500D [Brassica napus]
Length=161

 Score = 73.2 bits (178),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 51/57 (89%), Gaps = 0/57 (0%)
 Frame = +1

Query  121  VLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVLAGIDELEKIR  291
            V+++I+KR+RA +K+ NRI++ME+++S+GKTLNKEQ+E +R+KP V A I+ELEK+R
Sbjct  9    VMALISKRLRAHRKRYNRITEMEEAVSQGKTLNKEQQEAIRSKPIVTALIEELEKLR  65



>gb|ABA92081.1| hypothetical protein LOC_Os11g11180 [Oryza sativa Japonica Group]
Length=267

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 51/138 (37%), Positives = 68/138 (49%), Gaps = 33/138 (24%)
 Frame = +1

Query  160  KKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVLAGIDELEKIRQPLSAALEEEISLSVQ  339
            KK N+I QME+SL+ G+ LNKEQE              EL+++  PL+ AL EE+S    
Sbjct  113  KKHNKILQMEESLTDGRKLNKEQE--------------ELKRMCAPLATALAEELSSRPA  158

Query  340  RHQVSALETPAPSEESGKEPEGDVENKGESDGGVVIEDLLNLLYFGSMFDVKTLQNHFTE  519
            R   +                    +   S   + IEDLL L+YFGS+FDVK  Q  F  
Sbjct  159  RSPSTV------------------ASSSSSSVDLSIEDLLALIYFGSLFDVKP-QTEFVA  199

Query  520  VMLSREHERSSCLSYDYM  573
             ML R  ER  C ++DY+
Sbjct  200  TMLVRAKERDCCSTFDYV  217


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/53 (53%), Positives = 39/53 (74%), Gaps = 2/53 (4%)
 Frame = +1

Query  82   MAATEVSDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETL  240
            MAA   ++ +DGP LSV++K + AL+KK N+I QME+ L+ G+ LNKEQ E L
Sbjct  1    MAA--AAEPTDGPTLSVVSKWLHALRKKHNKIIQMEEPLADGRKLNKEQGEDL  51



>gb|KFK37826.1| hypothetical protein AALP_AA3G034300 [Arabis alpina]
Length=151

 Score = 71.2 bits (173),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 38/65 (58%), Positives = 51/65 (78%), Gaps = 6/65 (9%)
 Frame = +1

Query  82   MAATEVSDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVL  261
            MAATE      G VL++I+KR+R  +KK NRI++ME+SLS+GKTLNK+QEE LR+KP + 
Sbjct  1    MAATE------GSVLALISKRLRTHRKKQNRIAEMEESLSQGKTLNKDQEEILRSKPIIN  54

Query  262  AGIDE  276
            A I+E
Sbjct  55   ALIEE  59



>gb|EEE59723.1| hypothetical protein OsJ_12161 [Oryza sativa Japonica Group]
Length=258

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +1

Query  109  SDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQE  231
            +DGP LSV++KR+RAL+KK NRI QME+SL+ G+ LNKEQE
Sbjct  24   TDGPTLSVVSKRLRALRKKHNRILQMEESLAGGRKLNKEQE  64


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/87 (33%), Positives = 46/87 (53%), Gaps = 1/87 (1%)
 Frame = +1

Query  439  VVIEDLLNLLYFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidllgesdld  618
            VV ED     YFG++FD K  Q  F   M++R  ER  C++YDY+ +D +  L       
Sbjct  70   VVFEDFSRSFYFGTLFDFKP-QTEFVATMVARAQERDCCITYDYVTEDAADLLHQSDLDK  128

Query  619  llsllsgllisRSANSSLPHKNALQKC  699
            + +L +   +  +A   + H++ALQ C
Sbjct  129  VSALAALAALGPAAAVGVSHRDALQSC  155



>ref|XP_009626346.1| PREDICTED: uncharacterized protein LOC104117072 [Nicotiana tomentosiformis]
Length=134

 Score = 58.9 bits (141),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 54/94 (57%), Gaps = 11/94 (12%)
 Frame = +1

Query  88   ATEVSDVSDGP-----------VLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEE  234
              E+++V DGP           V+ V NKR+R L+KKL RI    +  +K +TLNK+QEE
Sbjct  13   GNELNEVEDGPMASNDKEEFKPVMKVTNKRLRILRKKLKRILHSVEFATKRQTLNKDQEE  72

Query  235  TLRTKPAVLAGIDELEKIRQPLSAALEEEISLSV  336
             L+   ++   I+EL  I + L  A+ EEI L++
Sbjct  73   ALQQIKSIEYAIEELSSIEKDLPGAISEEIQLAM  106



>emb|CCI41035.1| unnamed protein product [Albugo candida]
Length=377

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 43/147 (29%), Positives = 78/147 (53%), Gaps = 15/147 (10%)
 Frame = +1

Query  118  PVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVLAGIDELEKIRQP  297
            P L  I KR R+ KKKL++I+ +E + + GK LN++Q+E +  KP +   + EL+ +R  
Sbjct  34   PYLDFIQKRKRSYKKKLDKITILEAARADGKVLNEQQKELVSGKPMLERLLLELDMVR--  91

Query  298  LSAALEEEISLSVQRHQVSALETPAPSEESGKEPEGDVENKGESDGG---VVIEDLLNLL  468
                 ++ I L   +H +  LE+P   ++   +P     +    D G     IEDLL +L
Sbjct  92   -----DQFIELETDKHPICDLESPRILDKDPIDPPIQTADSTVGDNGDEHHAIEDLLEVL  146

Query  469  -----YFGSMFDVKTLQNHFTEVMLSR  534
                 Y G   ++ T+ +++++V+L +
Sbjct  147  HIVDSYRGLQQNIPTVLDYYSQVLLGK  173



>emb|CCI41034.1| unnamed protein product [Albugo candida]
Length=405

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 43/147 (29%), Positives = 78/147 (53%), Gaps = 15/147 (10%)
 Frame = +1

Query  118  PVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVLAGIDELEKIRQP  297
            P L  I KR R+ KKKL++I+ +E + + GK LN++Q+E +  KP +   + EL+ +R  
Sbjct  62   PYLDFIQKRKRSYKKKLDKITILEAARADGKVLNEQQKELVSGKPMLERLLLELDMVR--  119

Query  298  LSAALEEEISLSVQRHQVSALETPAPSEESGKEPEGDVENKGESDGG---VVIEDLLNLL  468
                 ++ I L   +H +  LE+P   ++   +P     +    D G     IEDLL +L
Sbjct  120  -----DQFIELETDKHPICDLESPRILDKDPIDPPIQTADSTVGDNGDEHHAIEDLLEVL  174

Query  469  -----YFGSMFDVKTLQNHFTEVMLSR  534
                 Y G   ++ T+ +++++V+L +
Sbjct  175  HIVDSYRGLQQNIPTVLDYYSQVLLGK  201



>gb|KHN23080.1| hypothetical protein glysoja_040901 [Glycine soja]
Length=77

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 44/61 (72%), Gaps = 0/61 (0%)
 Frame = +1

Query  184  MEDSLSKGKTLNKEQEETLRTKPAVLAGIDELEKIRQPLSAALEEEISLSVQRHQVSALE  363
            ME+ +++GK LNKE EE L +KP++LA IDEL+K++QPL+ AL E++ ++    Q    E
Sbjct  1    MEEVVTQGKPLNKEHEEVLCSKPSILALIDELDKLQQPLAIALFEDLQINDTSSQNPCHE  60

Query  364  T  366
            T
Sbjct  61   T  61



>ref|XP_006651701.1| PREDICTED: heterogeneous nuclear ribonucleoprotein A1, A2/B1 
homolog, partial [Oryza brachyantha]
Length=360

 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 32/85 (38%), Positives = 51/85 (60%), Gaps = 1/85 (1%)
 Frame = +1

Query  445  IEDLLNLLYFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYMKdddsidllgesdldll  624
            +EDLL L+YFG++FDVK   + F   M++R HER  CL+YDY+ D+ +  L+      + 
Sbjct  14   VEDLLRLVYFGTLFDVKP-HDEFVATMVARTHERQGCLTYDYVTDEAADILVEPDLDMVS  72

Query  625  sllsgllisRSANSSLPHKNALQKC  699
            +L +      +A   + H++ALQ C
Sbjct  73   ALAALAASRPAAAVGVSHRDALQAC  97



>gb|EEE51859.1| hypothetical protein OsJ_33386 [Oryza sativa Japonica Group]
Length=113

 Score = 54.3 bits (129),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 28/53 (53%), Positives = 39/53 (74%), Gaps = 2/53 (4%)
 Frame = +1

Query  82   MAATEVSDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETL  240
            MAA   ++ +DGP LSV++K + AL+KK N+I QME+ L+ G+ LNKEQ E L
Sbjct  1    MAA--AAEPTDGPTLSVVSKWLHALRKKHNKIIQMEEPLADGRKLNKEQGEDL  51



>emb|CCA21941.1| conserved hypothetical protein [Albugo laibachii Nc14]
Length=335

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 42/163 (26%), Positives = 85/163 (52%), Gaps = 19/163 (12%)
 Frame = +1

Query  73   PLSMAATEVSDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKP  252
            P+   AT+ +     P L+ I KR R+ KKKL+++  +E + + GK LN++Q+E +  KP
Sbjct  50   PIGSIATDTT-FQQHPYLNFIQKRKRSYKKKLDKVIALESACADGKVLNEQQQELVSGKP  108

Query  253  AVLAGIDELEKIRQPLSAALEEEISLSV----QRHQVSALETPAPSEESGKEPEGDVENK  420
             +   + EL+ IR     ++E++ S+S+    +  Q  A+E+P  + +S    +G++   
Sbjct  109  MLERLLLELDMIRDQFIESMEDKASMSLPDSERVLQEEAMESPKEAPDSAIPTDGELHAT  168

Query  421  GESDGGVVIEDLLNLLYFGSMF-----DVKTLQNHFTEVMLSR  534
             E         LL +L+    +     ++  + ++ ++V+L R
Sbjct  169  TE---------LLKVLHIVDAYRNLDQEIPAVLDYCSQVLLGR  202



>emb|CCA24791.1| conserved hypothetical protein [Albugo laibachii Nc14]
Length=443

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 42/163 (26%), Positives = 84/163 (52%), Gaps = 19/163 (12%)
 Frame = +1

Query  73   PLSMAATEVSDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKP  252
            P+   AT+ +     P L+ I KR R+ KKKL+++  +E + + GK LN++Q+E +  KP
Sbjct  50   PIGSIATDTT-FQQHPYLNFIQKRKRSYKKKLDKVIALESACADGKVLNEQQQELVSGKP  108

Query  253  AVLAGIDELEKIRQPLSAALEEEISLSVQRH----QVSALETPAPSEESGKEPEGDVENK  420
             +   + EL+ IR     ++E++ S+S+       Q  A+E+P  + +S    +G++   
Sbjct  109  MLERLLLELDMIRDQFIESMEDKASMSLPDSERVLQEEAMESPKEAPDSAIPTDGELHAT  168

Query  421  GESDGGVVIEDLLNLLYFGSMF-----DVKTLQNHFTEVMLSR  534
             E         LL +L+    +     ++  + ++ ++V+L R
Sbjct  169  TE---------LLKVLHIVDAYRNLDQEIPAVLDYCSQVLLGR  202



>gb|AFW67957.1| hypothetical protein ZEAMMB73_254492, partial [Zea mays]
Length=67

 Score = 50.1 bits (118),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 23/39 (59%), Positives = 31/39 (79%), Gaps = 1/39 (3%)
 Frame = +1

Query  457  LNLLYFGSMFDVKTLQNHFTEVMLSREHERSSCLSYDYM  573
            L L+YFGS+FDVK  Q+ F  ++ +RE ERSSCL+YDY+
Sbjct  1    LALVYFGSLFDVKQ-QSDFVSLVYTRELERSSCLTYDYV  38



>gb|EEC67891.1| hypothetical protein OsI_35559 [Oryza sativa Indica Group]
Length=289

 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 27/53 (51%), Positives = 39/53 (74%), Gaps = 2/53 (4%)
 Frame = +1

Query  82   MAATEVSDVSDGPVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETL  240
            MAA   ++ +DGP LSV++K + AL+KK N+I Q+E+ L+ G+ LNKEQ E L
Sbjct  1    MAAA--AEPTDGPTLSVVSKWLHALRKKHNKIIQIEEPLADGRKLNKEQGEDL  51



>ref|XP_011397224.1| hypothetical protein F751_3054 [Auxenochlorella protothecoides]
 gb|KFM24336.1| hypothetical protein F751_3054 [Auxenochlorella protothecoides]
Length=412

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 46/186 (25%), Positives = 82/186 (44%), Gaps = 43/186 (23%)
 Frame = +1

Query  118  PVLSVINKRIRALKKKLNRISQMEDSLSKGKTLNKEQEETLRTKPAVLAGIDELEKIRQP  297
            PVL  + KR+R  +KKL  I +++     GK LN +QE  L +K +++A ++ELE++ + 
Sbjct  23   PVLLALAKRLRNQRKKLRGIDEIQAKADVGKALNADQEAALASKASIVAAVEELERLTKL  82

Query  298  LSAALEEEISLSVQRHQVSALETPAPS------------EESGKEPEGDVENK-------  420
            L   L EE++ + Q  + +A     PS            E++  +  G +  +       
Sbjct  83   LKEPLAEEVAAARQEGEAAAAARAPPSPTKSDAEWLAEREDAVAKAVGPLRQQLSEAKTN  142

Query  421  ------------------GESDGGVVIEDLLNLLYFGSMFDVKTLQNHFTEVMLSREHER  546
                               + +G  ++  L+ LLYF ++ D   LQ+  +       +ER
Sbjct  143  AAADAKAAKLAAAAREAAAKKEGEALVGRLVELLYFATVLDPFALQHDVS------HYER  196

Query  547  SSCLSY  564
              CL Y
Sbjct  197  HVCLMY  202



Lambda      K        H        a         alpha
   0.315    0.131    0.360    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1193157586335