BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF046M09

Length=805
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KDO46793.1|  hypothetical protein CISIN_1g012238mg                   288   7e-92   Citrus sinensis [apfelsine]
ref|XP_009789886.1|  PREDICTED: aspartate aminotransferase, chlor...    291   7e-92   Nicotiana sylvestris
ref|XP_006450331.1|  hypothetical protein CICLE_v10008224mg             288   6e-91   Citrus clementina [clementine]
gb|KDO46791.1|  hypothetical protein CISIN_1g012238mg                   288   7e-91   Citrus sinensis [apfelsine]
ref|XP_009619135.1|  PREDICTED: aspartate aminotransferase, chlor...    286   4e-90   Nicotiana tomentosiformis
gb|AFP86894.1|  aspartate aminotransferase                              279   2e-88   Ilex paraguariensis [Brazilian-tea]
ref|XP_011036642.1|  PREDICTED: aspartate aminotransferase, chlor...    281   6e-88   Populus euphratica
ref|XP_002309659.2|  aspartate aminotransferase 2 family protein        280   1e-87   
ref|XP_006345635.1|  PREDICTED: aspartate aminotransferase, chlor...    280   2e-87   Solanum tuberosum [potatoes]
ref|XP_002324896.1|  aspartate aminotransferase 2 family protein        278   1e-86   Populus trichocarpa [western balsam poplar]
ref|NP_001274906.1|  aspartate aminotransferase, chloroplastic-like     277   2e-86   Solanum tuberosum [potatoes]
ref|XP_011039608.1|  PREDICTED: aspartate aminotransferase, chlor...    275   1e-85   Populus euphratica
ref|XP_004244943.1|  PREDICTED: aspartate aminotransferase, chlor...    273   5e-85   Solanum lycopersicum
ref|XP_007223036.1|  hypothetical protein PRUPE_ppa005369mg             271   5e-84   Prunus persica
gb|KDO46792.1|  hypothetical protein CISIN_1g012238mg                   269   5e-84   Citrus sinensis [apfelsine]
ref|XP_008220703.1|  PREDICTED: aspartate aminotransferase, chlor...    269   2e-83   Prunus mume [ume]
gb|KDP33541.1|  hypothetical protein JCGZ_07112                         269   3e-83   Jatropha curcas
ref|XP_002285385.1|  PREDICTED: aspartate aminotransferase, chlor...    268   4e-83   Vitis vinifera
emb|CAN76227.1|  hypothetical protein VITISV_000267                     268   5e-83   Vitis vinifera
ref|XP_010245533.1|  PREDICTED: aspartate aminotransferase, chlor...    268   6e-83   Nelumbo nucifera [Indian lotus]
ref|XP_010048915.1|  PREDICTED: aspartate aminotransferase, chlor...    268   8e-83   Eucalyptus grandis [rose gum]
ref|XP_007011759.1|  Aspartate aminotransferase                         267   1e-82   
ref|XP_008377672.1|  PREDICTED: aspartate aminotransferase, chlor...    267   1e-82   Malus domestica [apple tree]
gb|KHG09550.1|  Aspartate aminotransferase, chloroplastic -like p...    263   2e-82   Gossypium arboreum [tree cotton]
gb|KJB55010.1|  hypothetical protein B456_009G060500                    262   2e-82   Gossypium raimondii
ref|XP_010089944.1|  Aspartate aminotransferase                         266   3e-82   
gb|KHG15177.1|  Aspartate aminotransferase, chloroplastic -like p...    266   4e-82   Gossypium arboreum [tree cotton]
ref|XP_011459596.1|  PREDICTED: aspartate aminotransferase, chlor...    265   4e-82   Fragaria vesca subsp. vesca
ref|XP_002515455.1|  aspartate aminotransferase, putative               266   4e-82   Ricinus communis
ref|XP_004138711.1|  PREDICTED: aspartate aminotransferase, chlor...    264   3e-81   Cucumis sativus [cucumbers]
ref|XP_008445249.1|  PREDICTED: aspartate aminotransferase, chlor...    263   5e-81   Cucumis melo [Oriental melon]
gb|KJB55006.1|  hypothetical protein B456_009G060500                    263   6e-81   Gossypium raimondii
ref|XP_010665799.1|  PREDICTED: aspartate aminotransferase, chlor...    261   1e-80   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010527116.1|  PREDICTED: aspartate aminotransferase, chlor...    260   2e-80   Tarenaya hassleriana [spider flower]
ref|XP_004498776.1|  PREDICTED: aspartate aminotransferase P2, mi...    261   3e-80   Cicer arietinum [garbanzo]
gb|KJB65890.1|  hypothetical protein B456_010G117400                    261   4e-80   Gossypium raimondii
gb|KJB55007.1|  hypothetical protein B456_009G060500                    259   1e-79   Gossypium raimondii
gb|AAB46611.1|  aspartate aminotransferase                              259   1e-79   Medicago sativa [alfalfa]
emb|CAA04697.1|  aspartate aminotransferase 2                           259   2e-79   Canavalia lineata
ref|XP_011082202.1|  PREDICTED: aspartate aminotransferase, chlor...    258   2e-79   
prf||1908424A  Asp aminotransferase                                     259   2e-79
ref|XP_008445250.1|  PREDICTED: aspartate aminotransferase, chlor...    257   2e-79   Cucumis melo [Oriental melon]
gb|KEH39860.1|  aspartate aminotransferase                              258   3e-79   Medicago truncatula
gb|KJB65891.1|  hypothetical protein B456_010G117400                    258   4e-79   Gossypium raimondii
gb|EPS60991.1|  aspartate aminotransferase                              249   5e-79   Genlisea aurea
sp|P26563.1|AATM_LUPAN  RecName: Full=Aspartate aminotransferase ...    256   1e-78   Lupinus angustifolius
emb|CDP18792.1|  unnamed protein product                                259   1e-78   Coffea canephora [robusta coffee]
gb|AAB68396.1|  aspartate aminotransferase 2 precursor                  256   1e-78   Canavalia lineata
gb|KJB55009.1|  hypothetical protein B456_009G060500                    257   2e-78   Gossypium raimondii
ref|XP_002867266.1|  hypothetical protein ARALYDRAFT_491537             256   2e-78   
ref|XP_010437971.1|  PREDICTED: aspartate aminotransferase, chlor...    256   2e-78   Camelina sativa [gold-of-pleasure]
ref|XP_009407084.1|  PREDICTED: aspartate aminotransferase, chlor...    255   2e-78   
ref|XP_006848765.1|  hypothetical protein AMTR_s00026p00065580          256   4e-78   Amborella trichopoda
emb|CDY13467.1|  BnaA03g51850D                                          255   4e-78   Brassica napus [oilseed rape]
ref|XP_009138057.1|  PREDICTED: aspartate aminotransferase, chlor...    255   4e-78   Brassica rapa
ref|XP_010447459.1|  PREDICTED: aspartate aminotransferase, chlor...    255   4e-78   Camelina sativa [gold-of-pleasure]
emb|CDX72339.1|  BnaC07g43610D                                          255   5e-78   
ref|XP_010432788.1|  PREDICTED: aspartate aminotransferase, chlor...    256   5e-78   Camelina sativa [gold-of-pleasure]
ref|XP_006283713.1|  hypothetical protein CARUB_v10004783mg             254   6e-78   Capsella rubella
ref|XP_010432789.1|  PREDICTED: aspartate aminotransferase, chlor...    254   8e-78   Camelina sativa [gold-of-pleasure]
ref|XP_009126483.1|  PREDICTED: aspartate aminotransferase, chlor...    254   1e-77   Brassica rapa
emb|CDX75211.1|  BnaA01g04910D                                          254   1e-77   
ref|XP_008784801.1|  PREDICTED: aspartate aminotransferase, chlor...    253   2e-77   Phoenix dactylifera
ref|XP_010942149.1|  PREDICTED: aspartate aminotransferase, chlor...    253   2e-77   Elaeis guineensis
ref|XP_006412529.1|  hypothetical protein EUTSA_v10025142mg             253   2e-77   
emb|CAA56932.1|  aspartate aminotransferase                             253   2e-77   Arabidopsis thaliana [mouse-ear cress]
gb|AAM67272.1|  aspartate aminotransferase                              253   2e-77   Arabidopsis thaliana [mouse-ear cress]
ref|NP_194927.1|  aspartate aminotransferase                            253   3e-77   Arabidopsis thaliana [mouse-ear cress]
prf||2009357A  Asp aminotransferase                                     253   3e-77
ref|XP_006412530.1|  hypothetical protein EUTSA_v10025142mg             253   4e-77   
ref|NP_001031767.1|  aspartate aminotransferase                         253   5e-77   Arabidopsis thaliana [mouse-ear cress]
gb|AAC12674.1|  aspartate aminotransferase                              251   1e-76   Lotus corniculatus
gb|AAB26677.2|  aspartate aminotransferase isozyme 5                    251   2e-76   Glycine max [soybeans]
emb|CDJ26231.1|  putative aspartate aminotransferase                    251   2e-76   Brassica oleracea
gb|ACU24502.1|  unknown                                                 251   2e-76   Glycine max [soybeans]
ref|NP_001237987.1|  aspartate aminotransferase                         251   2e-76   
gb|KHN22516.1|  Aspartate aminotransferase P2, mitochondrial            251   2e-76   Glycine soja [wild soybean]
ref|XP_006600243.1|  PREDICTED: aspartate aminotransferase isofor...    251   3e-76   Glycine max [soybeans]
emb|CDX68807.1|  BnaC01g06460D                                          251   5e-76   
gb|AAN76499.1|AF315376_1  aspartate aminotransferase                    250   6e-76   Phaseolus vulgaris [French bean]
ref|NP_001048397.1|  Os02g0797500                                       247   5e-75   
ref|XP_003544600.1|  PREDICTED: aspartate aminotransferase P2, mi...    247   6e-75   Glycine max [soybeans]
ref|NP_001190885.1|  aspartate aminotransferase                         246   1e-74   Arabidopsis thaliana [mouse-ear cress]
gb|AAO23563.1|  aspartate aminotransferase                              244   2e-74   Oryza sativa [red rice]
ref|XP_006648055.1|  PREDICTED: aspartate aminotransferase, chlor...    244   3e-74   
gb|ACN40845.1|  unknown                                                 245   3e-74   Picea sitchensis
gb|ABK24563.1|  unknown                                                 245   3e-74   Picea sitchensis
gb|ACR34530.1|  unknown                                                 244   5e-74   Zea mays [maize]
gb|EYU20220.1|  hypothetical protein MIMGU_mgv1a005965mg                244   6e-74   Erythranthe guttata [common monkey flower]
ref|NP_001149005.1|  aspartate aminotransferase                         244   7e-74   
dbj|BAA08106.1|  plastidic aspartate aminotransferase                   244   7e-74   Panicum miliaceum [broom millet]
gb|ABR16448.1|  unknown                                                 242   2e-73   Picea sitchensis
gb|EYU20219.1|  hypothetical protein MIMGU_mgv1a005965mg                243   3e-73   Erythranthe guttata [common monkey flower]
ref|XP_003570308.1|  PREDICTED: aspartate aminotransferase P2, mi...    242   5e-73   Brachypodium distachyon [annual false brome]
dbj|BAJ92741.1|  predicted protein                                      240   3e-72   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ96638.1|  predicted protein                                      240   3e-72   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004954233.1|  PREDICTED: aspartate aminotransferase, chlor...    240   3e-72   Setaria italica
ref|XP_002993397.1|  hypothetical protein SELMODRAFT_236735             238   5e-72   
ref|XP_002972976.1|  hypothetical protein SELMODRAFT_173087             238   6e-72   
gb|EMS51671.1|  Aspartate aminotransferase, chloroplastic               236   2e-70   Triticum urartu
gb|EMT29046.1|  Aspartate aminotransferase, chloroplastic               236   2e-70   
emb|CAN64661.1|  hypothetical protein VITISV_034785                     234   3e-70   Vitis vinifera
gb|KJB55008.1|  hypothetical protein B456_009G060500                    227   7e-68   Gossypium raimondii
ref|XP_001785888.1|  predicted protein                                  222   3e-65   
ref|XP_006495466.1|  PREDICTED: aspartate aminotransferase, chlor...    197   4e-60   Citrus sinensis [apfelsine]
ref|XP_011084852.1|  PREDICTED: aspartate aminotransferase, chlor...    203   1e-58   
gb|KCW81335.1|  hypothetical protein EUGRSUZ_C02721                     193   3e-54   Eucalyptus grandis [rose gum]
ref|XP_005642879.1|  aspartate aminotransferase                         192   8e-54   Coccomyxa subellipsoidea C-169
ref|XP_010942150.1|  PREDICTED: aspartate aminotransferase, chlor...    187   4e-52   
ref|XP_008784799.1|  PREDICTED: aspartate aminotransferase, chlor...    186   9e-52   Phoenix dactylifera
gb|ABN48559.1|  chloroplast aspartate aminotransferase                  177   1e-51   Brassica juncea [brown mustard]
ref|XP_005851216.1|  hypothetical protein CHLNCDRAFT_137913             186   1e-51   Chlorella variabilis
ref|XP_008784798.1|  PREDICTED: aspartate aminotransferase, chlor...    186   2e-51   
gb|ACG59771.1|  chloroplast aspartate aminotransferase                  180   3e-50   Triticum aestivum [Canadian hard winter wheat]
ref|XP_001700039.1|  aspartate aminotransferase                         176   3e-48   Chlamydomonas reinhardtii
ref|XP_003064597.1|  aspartate amino transferase                        170   6e-46   Micromonas pusilla CCMP1545
ref|XP_002950644.1|  aspartate aminotransferase                         169   2e-45   Volvox carteri f. nagariensis
ref|XP_011399285.1|  Aspartate aminotransferase P2, mitochondrial       162   2e-43   Auxenochlorella protothecoides
ref|XP_002501168.1|  aspartate aminotransferase                         161   1e-42   Micromonas commoda
ref|XP_006833326.1|  hypothetical protein AMTR_s00109p00068640          158   3e-41   Amborella trichopoda
ref|XP_002284313.1|  PREDICTED: aspartate aminotransferase, cytop...    156   6e-41   Vitis vinifera
emb|CAN70394.1|  hypothetical protein VITISV_020521                     155   1e-40   Vitis vinifera
tpg|DAA57531.1|  TPA: hypothetical protein ZEAMMB73_000065              150   9e-40   
ref|XP_005152326.1|  PREDICTED: aspartate aminotransferase, mitoc...    153   1e-39   Melopsittacus undulatus
ref|XP_006780104.1|  PREDICTED: aspartate aminotransferase, mitoc...    153   1e-39   Neolamprologus brichardi [lyretail cichlid]
ref|XP_004543093.1|  PREDICTED: aspartate aminotransferase, mitoc...    153   1e-39   Maylandia zebra
ref|XP_003442303.1|  PREDICTED: aspartate aminotransferase, mitoc...    153   1e-39   Oreochromis niloticus
gb|EMT25743.1|  Aspartate aminotransferase, cytoplasmic                 152   2e-39   
ref|XP_010250350.1|  PREDICTED: aspartate aminotransferase, cytop...    153   2e-39   
ref|XP_001176672.2|  PREDICTED: aspartate aminotransferase, mitoc...    152   4e-39   
gb|EMS51413.1|  Aspartate aminotransferase, cytoplasmic                 152   4e-39   Triticum urartu
ref|XP_008175935.1|  PREDICTED: aspartate aminotransferase, mitoc...    152   4e-39   Chrysemys picta bellii
gb|KIJ68385.1|  hypothetical protein HYDPIDRAFT_173129                  152   4e-39   Hydnomerulius pinastri MD-312
ref|XP_003970037.1|  PREDICTED: aspartate aminotransferase, mitoc...    152   5e-39   Takifugu rubripes [tiger puffer]
emb|CDM84293.1|  unnamed protein product                                152   5e-39   Triticum aestivum [Canadian hard winter wheat]
gb|KFO71408.1|  hypothetical protein N303_10396                         151   6e-39   Cuculus canorus
gb|KFP38914.1|  hypothetical protein N324_09434                         150   7e-39   Chlamydotis macqueenii
sp|P37833.1|AATC_ORYSJ  RecName: Full=Aspartate aminotransferase,...    150   7e-39   Oryza sativa Japonica Group [Japonica rice]
gb|KFP90495.1|  hypothetical protein N311_04899                         150   8e-39   Apaloderma vittatum
gb|KIM66148.1|  hypothetical protein SCLCIDRAFT_1211371                 151   8e-39   Scleroderma citrinum Foug A
emb|CBI20886.3|  unnamed protein product                                151   9e-39   Vitis vinifera
gb|KFV95661.1|  hypothetical protein N327_00168                         148   9e-39   Fulmarus glacialis
ref|XP_003227907.1|  PREDICTED: aspartate aminotransferase, mitoc...    150   9e-39   Anolis carolinensis [Carolina anole]
gb|KIJ21699.1|  aspartate transaminase                                  150   1e-38   Paxillus involutus ATCC 200175
dbj|BAJ97930.1|  predicted protein                                      149   1e-38   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002284136.1|  PREDICTED: aspartate aminotransferase, cytop...    151   1e-38   Vitis vinifera
ref|NP_001044317.1|  Os01g0760600                                       151   1e-38   
gb|KDP34208.1|  hypothetical protein JCGZ_07779                         151   1e-38   Jatropha curcas
gb|KIK94907.1|  hypothetical protein PAXRUDRAFT_827518                  150   1e-38   Paxillus rubicundulus Ve08.2h10
ref|XP_001731601.1|  hypothetical protein MGL_0869                      150   1e-38   Malassezia globosa CBS 7966
emb|CAA45023.1|  aspartate aminotransferase                             150   2e-38   Panicum miliaceum [broom millet]
gb|KIP12008.1|  hypothetical protein PHLGIDRAFT_27620                   150   2e-38   Phlebiopsis gigantea 11061_1 CR5-6
ref|XP_008033064.1|  hypothetical protein TRAVEDRAFT_109115             150   2e-38   Trametes versicolor FP-101664 SS1
ref|XP_006109334.1|  PREDICTED: aspartate aminotransferase, mitoc...    144   2e-38   
ref|XP_010582297.1|  PREDICTED: aspartate aminotransferase, mitoc...    150   2e-38   Haliaeetus leucocephalus
ref|XP_010878037.1|  PREDICTED: aspartate aminotransferase, mitoc...    150   2e-38   Esox lucius
ref|XP_004245266.1|  PREDICTED: aspartate aminotransferase, cytop...    150   2e-38   Solanum lycopersicum
gb|KDQ63696.1|  hypothetical protein JAAARDRAFT_29716                   150   2e-38   Jaapia argillacea MUCL 33604
ref|XP_006644742.1|  PREDICTED: aspartate aminotransferase, cytop...    150   2e-38   Oryza brachyantha
gb|KFP19653.1|  hypothetical protein Z169_06078                         149   2e-38   Egretta garzetta
ref|XP_003758636.1|  PREDICTED: aspartate aminotransferase, mitoc...    149   2e-38   
gb|KDO79734.1|  hypothetical protein CISIN_1g0188201mg                  147   2e-38   Citrus sinensis [apfelsine]
gb|KFQ16652.1|  hypothetical protein N330_09915                         149   2e-38   Leptosomus discolor
ref|XP_005814426.1|  PREDICTED: aspartate aminotransferase, mitoc...    150   2e-38   Xiphophorus maculatus
ref|XP_007762781.1|  hypothetical protein CONPUDRAFT_78940              149   3e-38   Coniophora puteana RWD-64-598 SS2
gb|KFZ50221.1|  hypothetical protein N321_06413                         149   3e-38   Antrostomus carolinensis
ref|XP_007012061.1|  Aspartate aminotransferase 3                       150   3e-38   
gb|KFP71016.1|  hypothetical protein N310_05849                         149   3e-38   Acanthisitta chloris
ref|XP_009569498.1|  PREDICTED: aspartate aminotransferase, mitoc...    149   3e-38   Cuculus canorus
ref|XP_006450637.1|  hypothetical protein CICLE_v10008274mg             148   3e-38   
ref|XP_006110233.1|  PREDICTED: aspartate aminotransferase, mitoc...    149   3e-38   
ref|XP_008292179.1|  PREDICTED: aspartate aminotransferase, mitoc...    149   3e-38   Stegastes partitus
emb|CCO28282.1|  aspartate aminotransferase                             143   3e-38   Rhizoctonia solani AG-1 IB
gb|EMP28841.1|  Aspartate aminotransferase                              149   3e-38   Chelonia mydas [green seaturtle]
gb|KFP55374.1|  hypothetical protein N322_09365                         149   3e-38   Cariama cristata
gb|KDP33689.1|  hypothetical protein JCGZ_07260                         149   3e-38   Jatropha curcas
gb|KFO97280.1|  hypothetical protein N300_07039                         149   3e-38   Calypte anna
sp|P28734.1|AATC_DAUCA  RecName: Full=Aspartate aminotransferase,...    149   3e-38   Daucus carota [carrots]
gb|KFV01058.1|  hypothetical protein N339_06116                         149   3e-38   Pterocles gutturalis
gb|KGL91867.1|  hypothetical protein N301_16701                         149   4e-38   Charadrius vociferus
ref|XP_009870982.1|  PREDICTED: LOW QUALITY PROTEIN: aspartate am...    149   4e-38   Apaloderma vittatum
gb|KFR02997.1|  hypothetical protein Y956_09274                         149   4e-38   Nipponia nippon
dbj|BAC56407.1|  similar to aspartate aminotransferase                  143   4e-38   Bos taurus [bovine]
ref|XP_010127976.1|  PREDICTED: aspartate aminotransferase, mitoc...    149   4e-38   Chlamydotis macqueenii
ref|XP_006020296.1|  PREDICTED: aspartate aminotransferase, mitoc...    149   4e-38   
gb|KFV00678.1|  hypothetical protein N340_11396                         149   4e-38   Tauraco erythrolophus
ref|XP_009583475.1|  PREDICTED: aspartate aminotransferase, mitoc...    146   4e-38   Fulmarus glacialis
gb|KFQ68668.1|  hypothetical protein N335_07592                         149   4e-38   Phaethon lepturus
gb|KFV53116.1|  hypothetical protein N328_06671                         149   4e-38   Gavia stellata
gb|KFW71608.1|  hypothetical protein AS28_11098                         149   4e-38   Pygoscelis adeliae
gb|KFQ42654.1|  hypothetical protein N333_09691                         149   4e-38   Nestor notabilis
gb|KFP56730.1|  hypothetical protein N323_06988                         149   4e-38   Cathartes aura
gb|EFB22248.1|  hypothetical protein PANDA_000063                       149   4e-38   Ailuropoda melanoleuca
ref|NP_001141224.1|  uncharacterized protein LOC100273311               149   5e-38   Zea mays [maize]
gb|KFQ73258.1|  hypothetical protein N337_00339                         149   5e-38   Phoenicopterus ruber ruber
ref|XP_011078312.1|  PREDICTED: aspartate aminotransferase, cytop...    149   5e-38   Sesamum indicum [beniseed]
ref|XP_006450635.1|  hypothetical protein CICLE_v10008274mg             148   5e-38   
ref|XP_009595013.1|  PREDICTED: aspartate aminotransferase, cytop...    149   5e-38   Nicotiana tomentosiformis
ref|XP_002324997.1|  aspartate aminotransferase family protein          148   6e-38   Populus trichocarpa [western balsam poplar]
ref|XP_011048396.1|  PREDICTED: aspartate aminotransferase, cytop...    148   6e-38   Populus euphratica
ref|XP_009782665.1|  PREDICTED: aspartate aminotransferase, cytop...    149   6e-38   Nicotiana sylvestris
ref|XP_008308463.1|  PREDICTED: aspartate aminotransferase, mitoc...    149   6e-38   Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_011043495.1|  PREDICTED: aspartate aminotransferase, cytop...    148   6e-38   Populus euphratica
gb|KIM24154.1|  hypothetical protein M408DRAFT_76285                    149   6e-38   Serendipita vermifera MAFF 305830
ref|XP_007549969.1|  PREDICTED: aspartate aminotransferase, mitoc...    148   7e-38   Poecilia formosa
gb|EOA96948.1|  Aspartate aminotransferase, mitochondrial               148   7e-38   Anas platyrhynchos [duck]
gb|KJB07521.1|  hypothetical protein B456_001G028100                    149   7e-38   Gossypium raimondii
ref|XP_006366212.1|  PREDICTED: aspartate aminotransferase, chlor...    149   8e-38   Solanum tuberosum [potatoes]
gb|AEX09183.1|  putative aspartate aminotransferase 2                   149   8e-38   Gossypium hirsutum [American cotton]
gb|KFV92257.1|  hypothetical protein N326_05957                         148   8e-38   Eurypyga helias
gb|KFQ63469.1|  hypothetical protein N334_09493                         148   8e-38   Pelecanus crispus
gb|EZP39195.1|  Aspartate aminotransferase AspC                         148   9e-38   Janthinobacterium lividum
gb|KFO63074.1|  hypothetical protein N302_07001                         148   9e-38   Corvus brachyrhynchos
gb|KFQ35253.1|  hypothetical protein N331_07571                         147   9e-38   Merops nubicus
gb|KFV54532.1|  hypothetical protein N341_00606                         147   9e-38   Tyto alba [Schleiereule]
gb|KIM48153.1|  hypothetical protein M413DRAFT_439876                   148   1e-37   Hebeloma cylindrosporum h7
ref|XP_009395718.1|  PREDICTED: aspartate aminotransferase, cytop...    148   1e-37   Musa acuminata subsp. malaccensis [pisang utan]
gb|KFO04448.1|  hypothetical protein N312_06091                         147   1e-37   Balearica regulorum gibbericeps
ref|XP_005490808.1|  PREDICTED: aspartate aminotransferase, mitoc...    148   1e-37   
ref|XP_005229254.1|  PREDICTED: aspartate aminotransferase, mitoc...    147   1e-37   
gb|KFW90670.1|  hypothetical protein N336_10326                         147   1e-37   Phalacrocorax carbo [common cormorant]
gb|EYU29270.1|  hypothetical protein MIMGU_mgv1a006139mg                148   1e-37   Erythranthe guttata [common monkey flower]
ref|XP_010254083.1|  PREDICTED: aspartate aminotransferase, cytop...    148   1e-37   Nelumbo nucifera [Indian lotus]
ref|XP_007438961.1|  PREDICTED: aspartate aminotransferase, mitoc...    148   1e-37   Python bivittatus
pdb|7AAT|A  Chain A, X-Ray Structure Refinement And Comparison Of...    147   1e-37   Gallus gallus [bantam]
gb|KHG23914.1|  Aspartate aminotransferase, chloroplastic -like p...    148   1e-37   Gossypium arboreum [tree cotton]
ref|XP_009958443.1|  PREDICTED: aspartate aminotransferase, mitoc...    147   1e-37   Leptosomus discolor
gb|KFM02723.1|  hypothetical protein AS27_01862                         147   1e-37   Aptenodytes forsteri
sp|P28011.2|AAT1_MEDSA  RecName: Full=Aspartate aminotransferase ...    147   1e-37   Medicago sativa [alfalfa]
ref|XP_009641563.1|  PREDICTED: aspartate aminotransferase, mitoc...    147   1e-37   Egretta garzetta
pdb|1AKA|A  Chain A, Structural Basis For The Catalytic Activity ...    147   1e-37   Gallus gallus [bantam]
ref|XP_007067232.1|  PREDICTED: aspartate aminotransferase, mitoc...    147   1e-37   
gb|KFV73576.1|  hypothetical protein N308_13552                         147   1e-37   Struthio camelus australis
gb|KEH36022.1|  aspartate aminotransferase                              147   1e-37   Medicago truncatula
ref|XP_004395809.1|  PREDICTED: aspartate aminotransferase, mitoc...    148   1e-37   Odobenus rosmarus divergens
ref|XP_004317705.1|  PREDICTED: aspartate aminotransferase, mitoc...    148   1e-37   
ref|XP_010164289.1|  PREDICTED: aspartate aminotransferase, mitoc...    147   1e-37   Antrostomus carolinensis
ref|XP_009078129.1|  PREDICTED: aspartate aminotransferase, mitoc...    147   1e-37   Acanthisitta chloris
ref|XP_006450636.1|  hypothetical protein CICLE_v10008274mg             148   1e-37   Citrus clementina [clementine]
ref|XP_002912325.1|  PREDICTED: aspartate aminotransferase, mitoc...    148   1e-37   Ailuropoda melanoleuca
ref|XP_004970037.1|  PREDICTED: aspartate aminotransferase, cytop...    148   1e-37   Setaria italica
ref|XP_003569862.1|  PREDICTED: aspartate aminotransferase, cytop...    148   1e-37   Brachypodium distachyon [annual false brome]
ref|XP_009126373.1|  PREDICTED: aspartate aminotransferase, cytop...    147   1e-37   Brassica rapa
gb|AFK40370.1|  unknown                                                 147   1e-37   Medicago truncatula
emb|CAA43779.1|  aspartate aminotransferase                             147   2e-37   Medicago sativa [alfalfa]
ref|XP_009697580.1|  PREDICTED: aspartate aminotransferase, mitoc...    147   2e-37   Cariama cristata
gb|KFU92658.1|  hypothetical protein M959_01402                         147   2e-37   Chaetura pelagica
ref|XP_004501184.1|  PREDICTED: aspartate aminotransferase 1-like       148   2e-37   Cicer arietinum [garbanzo]
ref|XP_008175936.1|  PREDICTED: aspartate aminotransferase, mitoc...    147   2e-37   Chrysemys picta bellii
ref|XP_008503619.1|  PREDICTED: aspartate aminotransferase, mitoc...    147   2e-37   Calypte anna
ref|XP_010080711.1|  PREDICTED: aspartate aminotransferase, mitoc...    147   2e-37   Pterocles gutturalis
ref|XP_009881551.1|  PREDICTED: aspartate aminotransferase, mitoc...    147   2e-37   Charadrius vociferus
ref|XP_009809693.1|  PREDICTED: aspartate aminotransferase, mitoc...    147   2e-37   Gavia stellata
ref|XP_009328640.1|  PREDICTED: aspartate aminotransferase, mitoc...    147   2e-37   Pygoscelis adeliae
ref|XP_004350746.1|  aspartate aminotransferase                         147   2e-37   Cavenderia fasciculata
ref|XP_010292847.1|  PREDICTED: aspartate aminotransferase, mitoc...    147   2e-37   Phaethon lepturus
ref|XP_009468749.1|  PREDICTED: aspartate aminotransferase, mitoc...    147   2e-37   Nipponia nippon
ref|XP_006863643.1|  PREDICTED: aspartate aminotransferase, mitoc...    147   2e-37   Chrysochloris asiatica
ref|XP_009980094.1|  PREDICTED: aspartate aminotransferase, mitoc...    147   2e-37   Tauraco erythrolophus
ref|XP_009120876.1|  PREDICTED: aspartate aminotransferase, cytop...    147   2e-37   Brassica rapa
gb|KIK71059.1|  hypothetical protein GYMLUDRAFT_33186                   147   2e-37   Gymnopus luxurians FD-317 M1
emb|CDX92520.1|  BnaA10g15590D                                          147   2e-37   
ref|XP_009924468.1|  PREDICTED: aspartate aminotransferase, mitoc...    146   2e-37   Haliaeetus albicilla
ref|XP_006476088.1|  PREDICTED: aspartate aminotransferase 3, chl...    147   2e-37   Citrus sinensis [apfelsine]
ref|XP_008700791.1|  PREDICTED: aspartate aminotransferase, mitoc...    147   2e-37   Ursus maritimus [white bear]
ref|XP_010013669.1|  PREDICTED: aspartate aminotransferase, mitoc...    146   2e-37   Nestor notabilis
gb|KEH36020.1|  aspartate aminotransferase                              147   2e-37   Medicago truncatula
gb|KEH36021.1|  aspartate aminotransferase                              147   3e-37   Medicago truncatula
ref|XP_006476087.1|  PREDICTED: aspartate aminotransferase 3, chl...    147   3e-37   Citrus sinensis [apfelsine]
ref|XP_001771002.1|  predicted protein                                  147   3e-37   
ref|XP_005025720.1|  PREDICTED: aspartate aminotransferase, mitoc...    147   3e-37   
ref|XP_009088934.1|  PREDICTED: aspartate aminotransferase, mitoc...    147   3e-37   Serinus canaria [canary]
gb|KFO92044.1|  hypothetical protein N320_04667                         146   3e-37   Buceros rhinoceros silvestris
ref|XP_010860133.1|  PREDICTED: aspartate aminotransferase, mitoc...    147   3e-37   Bison bison bison
ref|XP_003282681.2|  PREDICTED: aspartate aminotransferase, mitoc...    144   3e-37   
ref|XP_003209725.2|  PREDICTED: aspartate aminotransferase, mitoc...    146   3e-37   
ref|XP_005899976.1|  PREDICTED: aspartate aminotransferase, mitoc...    147   3e-37   Bos mutus
ref|XP_002126101.1|  PREDICTED: aspartate aminotransferase, mitoc...    147   3e-37   Ciona intestinalis [sea vase]
ref|NP_777231.1|  aspartate aminotransferase, mitochondrial             147   3e-37   Bos taurus [bovine]
emb|CDY44925.1|  BnaA02g04300D                                          146   3e-37   
emb|CDP03316.1|  unnamed protein product                                146   3e-37   
emb|CDY42276.1|  BnaC02g08820D                                          146   3e-37   
ref|XP_004340638.1|  aspartate aminotransferase, cytoplasmic, put...    147   3e-37   
ref|XP_010493028.1|  PREDICTED: aspartate aminotransferase, cytop...    146   4e-37   
emb|CDO75262.1|  hypothetical protein BN946_scf184967.g15               146   4e-37   
gb|KDQ20317.1|  hypothetical protein BOTBODRAFT_27738                   146   4e-37   
ref|XP_005526350.1|  PREDICTED: aspartate aminotransferase, mitoc...    146   4e-37   
ref|XP_010147321.1|  PREDICTED: aspartate aminotransferase, mitoc...    146   4e-37   
ref|XP_008401656.1|  PREDICTED: aspartate aminotransferase, mitoc...    146   4e-37   
ref|XP_009485645.1|  PREDICTED: aspartate aminotransferase, mitoc...    146   4e-37   
ref|XP_007004780.1|  hypothetical protein TREMEDRAFT_68635              146   4e-37   
ref|XP_010394985.1|  PREDICTED: aspartate aminotransferase, mitoc...    146   4e-37   
ref|XP_008636972.1|  PREDICTED: aspartate aminotransferase, mitoc...    145   4e-37   
ref|XP_009967572.1|  PREDICTED: aspartate aminotransferase, mitoc...    145   4e-37   
ref|XP_007860389.1|  hypothetical protein GLOTRDRAFT_53242              146   5e-37   
ref|XP_005981403.1|  PREDICTED: aspartate aminotransferase, mitoc...    146   5e-37   
ref|XP_002871893.1|  hypothetical protein ARALYDRAFT_909992             146   5e-37   
ref|XP_002516566.1|  aspartate aminotransferase, putative               146   5e-37   
ref|XP_005692154.1|  PREDICTED: aspartate aminotransferase, mitoc...    146   5e-37   
ref|XP_005422803.1|  PREDICTED: aspartate aminotransferase, mitoc...    145   5e-37   
ref|XP_008944416.1|  PREDICTED: aspartate aminotransferase, mitoc...    145   5e-37   
ref|XP_007339747.1|  hypothetical protein AURDEDRAFT_111475             146   5e-37   
ref|XP_010298153.1|  PREDICTED: aspartate aminotransferase, mitoc...    145   5e-37   
gb|KIM85250.1|  hypothetical protein PILCRDRAFT_5589                    146   5e-37   
gb|ABR16105.1|  unknown                                                 146   6e-37   
ref|XP_006052520.1|  PREDICTED: aspartate aminotransferase, mitoc...    146   6e-37   
ref|XP_009502368.1|  PREDICTED: aspartate aminotransferase, mitoc...    145   6e-37   
ref|XP_005842469.1|  hypothetical protein GUITHDRAFT_83779              145   6e-37   
ref|XP_009762342.1|  PREDICTED: aspartate aminotransferase, cytop...    145   6e-37   
ref|XP_004744353.1|  PREDICTED: aspartate aminotransferase, mitoc...    146   6e-37   
ref|XP_009999988.1|  PREDICTED: aspartate aminotransferase, mitoc...    145   6e-37   
ref|XP_009289063.1|  PREDICTED: aspartate aminotransferase, mitoc...    145   6e-37   
ref|XP_005052542.1|  PREDICTED: aspartate aminotransferase, mitoc...    145   6e-37   
gb|AAB91426.1|  aspartate aminotransferase precursor                    146   7e-37   
prf||0308236A  aminotransferase,Asp                                     145   7e-37
pdb|3PD6|A  Chain A, Crystal Structure Of Mouse Mitochondrial Asp...    145   7e-37   
ref|XP_009677969.1|  PREDICTED: aspartate aminotransferase, mitoc...    145   7e-37   
ref|XP_006732870.1|  PREDICTED: aspartate aminotransferase, mitoc...    146   7e-37   
emb|CDY65959.1|  BnaC09g54080D                                          145   7e-37   
gb|KIO08228.1|  hypothetical protein M404DRAFT_997154                   145   7e-37   
gb|EJT48226.1|  aspartate transaminase                                  145   7e-37   
ref|XP_004067248.1|  PREDICTED: aspartate aminotransferase, mitoc...    145   7e-37   
pdb|3HLM|A  Chain A, Crystal Structure Of Mouse Mitochondrial Asp...    145   8e-37   
gb|EFA75395.1|  aspartate aminotransferase                              148   8e-37   
ref|XP_007090444.1|  PREDICTED: aspartate aminotransferase, mitoc...    146   8e-37   
gb|KFC68496.1|  Aspartate aminotransferase AspC                         145   8e-37   
dbj|GAM22566.1|  hypothetical protein SAMD00019534_057410               145   8e-37   
ref|NP_001273953.1|  aspartate aminotransferase, mitochondrial          145   8e-37   
emb|CDG84060.1|  aminotransferase class I and II family protein         145   8e-37   
ref|XP_008789337.1|  PREDICTED: aspartate aminotransferase, cytop...    146   8e-37   
ref|XP_003998142.1|  PREDICTED: aspartate aminotransferase, mitoc...    145   9e-37   
ref|XP_004265006.1|  PREDICTED: aspartate aminotransferase, mitoc...    145   9e-37   
ref|WP_036212399.1|  aromatic amino acid aminotransferase               145   1e-36   
ref|XP_004037558.1|  hypothetical protein IMG5_049480                   145   1e-36   
gb|ACN40894.1|  unknown                                                 146   1e-36   
gb|KDQ30745.1|  hypothetical protein PLEOSDRAFT_1088517                 145   1e-36   
ref|XP_009617506.1|  PREDICTED: aspartate aminotransferase, cytop...    145   1e-36   
ref|XP_011090162.1|  PREDICTED: aspartate aminotransferase, cytop...    145   1e-36   
ref|XP_004015091.1|  PREDICTED: aspartate aminotransferase, mitoc...    145   1e-36   
ref|XP_006451184.1|  hypothetical protein CICLE_v10008489mg             145   1e-36   
ref|WP_036168796.1|  aromatic amino acid aminotransferase               145   1e-36   
ref|WP_019140639.1|  aspartate aminotransferase                         145   1e-36   
ref|XP_011019648.1|  PREDICTED: aspartate aminotransferase, cytop...    145   1e-36   
ref|XP_002680594.1|  aspartate aminotransferase                         145   1e-36   
ref|WP_036249231.1|  aromatic amino acid aminotransferase               145   1e-36   
emb|CDP16161.1|  unnamed protein product                                145   1e-36   
ref|XP_010739613.1|  PREDICTED: aspartate aminotransferase, mitoc...    145   1e-36   
ref|XP_003197284.1|  aspartate aminotransferase, mitochondrial pr...    145   1e-36   
ref|XP_008067406.1|  PREDICTED: aspartate aminotransferase, mitoc...    145   1e-36   
ref|XP_009410920.1|  PREDICTED: aspartate aminotransferase, cytop...    145   1e-36   
gb|EGF32845.1|  Aromatic-amino-acid aminotransferase                    143   1e-36   
gb|KIY47045.1|  hypothetical protein FISHEDRAFT_46081                   145   1e-36   
ref|XP_007637330.1|  PREDICTED: aspartate aminotransferase, mitoc...    145   1e-36   
gb|KGB78963.1|  aspartate aminotransferase                              145   1e-36   
ref|XP_010138136.1|  PREDICTED: aspartate aminotransferase, mitoc...    144   1e-36   
ref|XP_007468385.1|  PREDICTED: aspartate aminotransferase, mitoc...    145   1e-36   
gb|KIR35408.1|  aspartate aminotransferase, mitochondrial               145   1e-36   
ref|XP_003509628.1|  PREDICTED: aspartate aminotransferase, mitoc...    145   1e-36   
gb|KIR78862.1|  aspartate aminotransferase, mitochondrial               145   1e-36   
ref|XP_010693429.1|  PREDICTED: aspartate aminotransferase, cytop...    145   1e-36   
ref|XP_004690563.1|  PREDICTED: aspartate aminotransferase, mitoc...    145   1e-36   
gb|KIR59017.1|  aspartate aminotransferase, mitochondrial               145   1e-36   
ref|XP_002308618.1|  aspartate transaminase family protein              145   2e-36   
ref|XP_006099282.1|  PREDICTED: aspartate aminotransferase, mitoc...    144   2e-36   
ref|XP_005873554.1|  PREDICTED: aspartate aminotransferase, mitoc...    144   2e-36   
gb|EJT99836.1|  aspartate aminotransferase                              145   2e-36   
ref|XP_007112903.1|  PREDICTED: aspartate aminotransferase, mitoc...    144   2e-36   
gb|KIR45953.1|  aspartate aminotransferase, mitochondrial               145   2e-36   
ref|XP_010920378.1|  PREDICTED: aspartate aminotransferase, cytop...    145   2e-36   
ref|XP_007945851.1|  PREDICTED: aspartate aminotransferase, mitoc...    145   2e-36   
emb|CCM01943.1|  predicted protein                                      144   2e-36   
ref|XP_002514283.1|  aspartate aminotransferase, putative               144   2e-36   
ref|WP_028104419.1|  aromatic amino acid aminotransferase               144   2e-36   
ref|XP_005318543.1|  PREDICTED: aspartate aminotransferase, mitoc...    142   2e-36   
ref|XP_008138091.1|  PREDICTED: aspartate aminotransferase, mitoc...    144   2e-36   
ref|WP_038500080.1|  aromatic amino acid aminotransferase               144   2e-36   
gb|EMS22273.1|  L-aspartate:2-oxoglutarate aminotransferase             144   2e-36   
ref|NP_034455.1|  aspartate aminotransferase, mitochondrial             144   2e-36   
gb|KCW81535.1|  hypothetical protein EUGRSUZ_C02894                     145   2e-36   
ref|XP_007477592.1|  PREDICTED: aspartate aminotransferase, mitoc...    144   2e-36   
dbj|GAA98712.1|  hypothetical protein E5Q_05400                         144   2e-36   
ref|WP_005666272.1|  hypothetical protein                               144   2e-36   
ref|WP_035827865.1|  aromatic amino acid aminotransferase               144   2e-36   
emb|CAA63894.1|  aspartate aminotransferase                             144   2e-36   
ref|XP_007318932.1|  hypothetical protein SERLADRAFT_449644             144   2e-36   
gb|EPQ12242.1|  Aspartate aminotransferase, mitochondrial               144   2e-36   
ref|WP_034752132.1|  aromatic amino acid aminotransferase               144   2e-36   
ref|XP_005078702.1|  PREDICTED: aspartate aminotransferase, mitoc...    144   2e-36   
ref|XP_005345603.1|  PREDICTED: aspartate aminotransferase, mitoc...    144   2e-36   
ref|XP_004663500.1|  PREDICTED: aspartate aminotransferase, mitoc...    144   3e-36   
ref|WP_034789162.1|  aromatic amino acid aminotransferase               144   3e-36   
gb|KIK28496.1|  hypothetical protein PISMIDRAFT_673506                  144   3e-36   
ref|XP_003743821.1|  PREDICTED: aspartate aminotransferase, mitoc...    144   3e-36   
ref|XP_010420761.1|  PREDICTED: aspartate aminotransferase, cytop...    144   3e-36   
ref|XP_007013138.1|  Aspartate aminotransferase, cytoplasmic            144   3e-36   
ref|WP_029496550.1|  aromatic amino acid aminotransferase               144   3e-36   
ref|WP_025511365.1|  aromatic amino acid aminotransferase               144   3e-36   
gb|KGF78543.1|  aromatic amino acid aminotransferase                    144   3e-36   
gb|KJB64946.1|  hypothetical protein B456_010G072900                    142   3e-36   
ref|NP_999093.1|  aspartate aminotransferase, mitochondrial precu...    144   3e-36   
ref|NP_002071.2|  aspartate aminotransferase, mitochondrial isofo...    144   3e-36   
gb|AFR98315.2|  aspartate aminotransferase, mitchondrial                144   3e-36   
dbj|BAD96991.1|  aspartate aminotransferase 2 precursor variant         144   3e-36   
ref|XP_004583963.1|  PREDICTED: aspartate aminotransferase, mitoc...    144   3e-36   
ref|XP_004881984.1|  PREDICTED: aspartate aminotransferase, mitoc...    144   3e-36   
prf||0410468A  aminotransferase,Asp                                     143   3e-36
gb|AAH00525.1|  Glutamic-oxaloacetic transaminase 2, mitochondria...    144   3e-36   
ref|XP_523381.2|  PREDICTED: aspartate aminotransferase, mitochon...    144   3e-36   
ref|XP_003823746.1|  PREDICTED: aspartate aminotransferase, mitoc...    144   3e-36   
gb|KIR52756.1|  aspartate aminotransferase, mitochondrial               144   3e-36   
ref|XP_004057786.1|  PREDICTED: aspartate aminotransferase, mitoc...    144   4e-36   
gb|AEI84595.1|  mitochondrial aspartate transaminase                    143   4e-36   
ref|XP_008220042.1|  PREDICTED: aspartate aminotransferase, cytop...    144   4e-36   
ref|WP_027867125.1|  aromatic amino acid aminotransferase               143   4e-36   
ref|XP_007112902.1|  PREDICTED: aspartate aminotransferase, mitoc...    144   4e-36   
ref|XP_010049084.1|  PREDICTED: aspartate aminotransferase, cytop...    145   4e-36   
ref|XP_004339901.1|  aspartate aminotransferase, putative               144   4e-36   
gb|AEE61384.1|  unknown                                                 144   4e-36   
ref|XP_008361035.1|  PREDICTED: aspartate aminotransferase, cytop...    144   4e-36   
ref|XP_002711597.1|  PREDICTED: aspartate aminotransferase, mitoc...    144   4e-36   
ref|XP_007222958.1|  hypothetical protein PRUPE_ppa005315mg             144   4e-36   
gb|KIR84694.1|  aspartate aminotransferase, mitochondrial               144   4e-36   
ref|XP_008352022.1|  PREDICTED: aspartate aminotransferase, cytop...    144   5e-36   
ref|XP_007198093.1|  PREDICTED: aspartate aminotransferase, mitoc...    144   5e-36   
ref|XP_003792641.1|  PREDICTED: aspartate aminotransferase, mitoc...    144   5e-36   
gb|KJB64944.1|  hypothetical protein B456_010G072900                    143   5e-36   
ref|XP_008378104.1|  PREDICTED: aspartate aminotransferase, cytop...    143   5e-36   
ref|XP_004600685.1|  PREDICTED: aspartate aminotransferase, mitoc...    143   5e-36   
ref|XP_006271773.1|  PREDICTED: aspartate aminotransferase, mitoc...    143   5e-36   
ref|XP_006352160.1|  PREDICTED: aspartate aminotransferase, cytop...    143   6e-36   
gb|AAA33408.1|  aspartate aminotransferase P1                           143   6e-36   
ref|XP_007852807.1|  aspartate aminotransferase                         143   6e-36   
ref|XP_006148520.1|  PREDICTED: aspartate aminotransferase, mitoc...    143   6e-36   
gb|ELK38479.1|  Aspartate aminotransferase, mitochondrial               142   6e-36   
ref|XP_007670159.1|  PREDICTED: aspartate aminotransferase, mitoc...    143   6e-36   
gb|AAA50160.1|  aspartate aminotransferase P1                           143   6e-36   
ref|NP_990854.1|  aspartate aminotransferase, mitochondrial precu...    143   6e-36   
gb|KJB64945.1|  hypothetical protein B456_010G072900                    143   6e-36   
gb|EYU32934.1|  hypothetical protein MIMGU_mgv1a0079831mg               141   6e-36   
gb|AEI84593.1|  mitochondrial aspartate transaminase                    142   6e-36   
ref|XP_005643912.1|  aspartate aminotransferase                         143   6e-36   
ref|XP_007390433.1|  hypothetical protein PHACADRAFT_134034             143   7e-36   
ref|WP_026334277.1|  aromatic amino acid aminotransferase               142   7e-36   
gb|AEI84591.1|  mitochondrial aspartate transaminase                    142   7e-36   
ref|XP_006400515.1|  hypothetical protein EUTSA_v10013703mg             142   7e-36   
ref|WP_036240109.1|  aromatic amino acid aminotransferase               142   7e-36   
ref|XP_003472097.1|  PREDICTED: aspartate aminotransferase, mitoc...    143   7e-36   
emb|CEL53865.1|  aspartate aminotransferase                             143   7e-36   
ref|XP_004483033.1|  PREDICTED: aspartate aminotransferase, mitoc...    143   8e-36   
gb|AEI84600.1|  mitochondrial aspartate transaminase                    142   8e-36   
ref|XP_010454237.1|  PREDICTED: aspartate aminotransferase, cytop...    142   8e-36   
gb|AEI84602.1|  mitochondrial aspartate transaminase                    142   8e-36   
ref|NP_956283.1|  aspartate aminotransferase 2                          143   8e-36   
ref|XP_004371581.1|  PREDICTED: aspartate aminotransferase, mitoc...    143   8e-36   
ref|XP_568414.1|  aspartate aminotransferase mitochondrial precursor    143   8e-36   
gb|KIR44346.1|  aspartate aminotransferase                              142   8e-36   
gb|AEI84598.1|  mitochondrial aspartate transaminase                    142   8e-36   
ref|XP_009541187.1|  hypothetical protein HETIRDRAFT_437828             143   8e-36   
gb|KGL84885.1|  hypothetical protein N309_05764                         142   8e-36   
ref|WP_040723285.1|  aromatic amino acid aminotransferase               140   8e-36   
ref|XP_006641457.1|  PREDICTED: aspartate aminotransferase, mitoc...    143   9e-36   
ref|XP_005504845.1|  PREDICTED: aspartate aminotransferase, mitoc...    142   9e-36   
gb|KDN53315.1|  hypothetical protein K437DRAFT_292488                   143   9e-36   
ref|XP_006878782.1|  PREDICTED: aspartate aminotransferase, mitoc...    143   9e-36   
gb|KCW80241.1|  hypothetical protein EUGRSUZ_C01585                     140   9e-36   
ref|XP_001103601.1|  PREDICTED: aspartate aminotransferase, mitoc...    142   9e-36   
ref|XP_006977858.1|  PREDICTED: aspartate aminotransferase, mitoc...    142   9e-36   
ref|XP_002954714.1|  aspartate aminotransferase                         142   1e-35   
emb|CAH92240.1|  hypothetical protein                                   142   1e-35   
ref|NP_001124888.1|  aspartate aminotransferase, mitochondrial          142   1e-35   
ref|NP_001270119.1|  aspartate aminotransferase, mitochondrial          142   1e-35   
gb|AEB54629.1|  aspartate aminotransferase                              139   1e-35   
ref|XP_009367910.1|  PREDICTED: aspartate aminotransferase, cytop...    143   1e-35   
gb|KHG24168.1|  Aspartate aminotransferase, cytoplasmic                 142   1e-35   
gb|ELX09852.1|  aspartate aminotransferase AspC                         142   1e-35   
ref|XP_007359882.1|  PLP-dependent transferase                          142   1e-35   
ref|XP_009249048.1|  PREDICTED: aspartate aminotransferase, mitoc...    142   1e-35   
gb|EPT04274.1|  hypothetical protein FOMPIDRAFT_1021952                 142   1e-35   
ref|XP_010110107.1|  Aspartate aminotransferase                         142   1e-35   
ref|XP_001458635.1|  hypothetical protein                               142   1e-35   
gb|ACI34022.1|  Aspartate aminotransferase, mitochondrial precursor     142   1e-35   
ref|XP_002761002.1|  PREDICTED: aspartate aminotransferase, mitoc...    142   1e-35   
gb|KIR82897.1|  aspartate aminotransferase                              142   1e-35   
emb|CBQ68007.1|  probable aspartate aminotransferase, mitochondri...    142   1e-35   
ref|XP_007298245.1|  hypothetical protein STEHIDRAFT_88821              142   1e-35   
gb|KGB78925.1|  aspartate transaminase                                  142   1e-35   
gb|KIR97164.1|  aspartate aminotransferase                              142   1e-35   
ref|XP_005824554.1|  hypothetical protein GUITHDRAFT_158574             142   1e-35   
gb|AAC50015.1|  aspartate aminotransferase cytosolic isozyme AAT2       142   1e-35   
gb|KIR50768.1|  aspartate aminotransferase                              142   2e-35   
ref|XP_003197192.1|  aspartate transaminase                             142   2e-35   
ref|XP_007137184.1|  hypothetical protein PHAVU_009G106800g             142   2e-35   
ref|XP_006863642.1|  PREDICTED: aspartate aminotransferase, mitoc...    142   2e-35   
gb|KIR78943.1|  aspartate aminotransferase                              142   2e-35   
gb|KIL70778.1|  hypothetical protein M378DRAFT_183367                   142   2e-35   
ref|NP_037309.1|  aspartate aminotransferase, mitochondrial             142   2e-35   
gb|KIO33848.1|  hypothetical protein M407DRAFT_178303                   142   2e-35   
ref|XP_006817148.1|  PREDICTED: aspartate aminotransferase, mitoc...    142   2e-35   
gb|KHN10226.1|  Aspartate aminotransferase 1                            142   2e-35   
ref|XP_011354974.1|  PREDICTED: aspartate aminotransferase, mitoc...    142   2e-35   



>gb|KDO46793.1| hypothetical protein CISIN_1g012238mg [Citrus sinensis]
Length=363

 Score =   288 bits (736),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 153/190 (81%), Positives = 168/190 (88%), Gaps = 0/190 (0%)
 Frame = +2

Query  164  MASTVFTlasaspsvslslQDKLKAKPKLREYGQCTLFGNATKSHGRMRMVATVNVSRFE  343
            MAST+ ++ASA+PS SLS+ +KLK K KL      T     TKS GR+ MVA VNVSRFE
Sbjct  1    MASTMLSIASATPSASLSMHEKLKGKVKLGSTTNSTAGFIKTKSFGRVSMVAAVNVSRFE  60

Query  344  GISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENK  523
            G++MAPPDPILGVSEAFKADTDE KLNLGVGAYRTEELQPYVLDVVKKAENLML+RGENK
Sbjct  61   GVTMAPPDPILGVSEAFKADTDEKKLNLGVGAYRTEELQPYVLDVVKKAENLMLERGENK  120

Query  524  EYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFPGSKV  703
            EYLPIEGLAAFNKVTAELLFGADN V++++RVATVQGLSGTGSLRLAAALIERYFPG+KV
Sbjct  121  EYLPIEGLAAFNKVTAELLFGADNSVLKEQRVATVQGLSGTGSLRLAAALIERYFPGAKV  180

Query  704  LISSPTWGLH  733
            LISSPTWG H
Sbjct  181  LISSPTWGNH  190



>ref|XP_009789886.1| PREDICTED: aspartate aminotransferase, chloroplastic [Nicotiana 
sylvestris]
 ref|XP_009789887.1| PREDICTED: aspartate aminotransferase, chloroplastic [Nicotiana 
sylvestris]
 ref|XP_009789888.1| PREDICTED: aspartate aminotransferase, chloroplastic [Nicotiana 
sylvestris]
Length=462

 Score =   291 bits (744),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 154/193 (80%), Positives = 168/193 (87%), Gaps = 3/193 (2%)
 Frame = +2

Query  164  MASTVFTlasaspsvslslQDKLKAKPKLREYGQCTLFGN---ATKSHGRMRMVATVNVS  334
            M ST+F+LASA+PS S SLQD LK+K KL    Q   FG      KS+GR  M   VNVS
Sbjct  1    MVSTMFSLASATPSASFSLQDNLKSKLKLGTTSQSAFFGKDFVKAKSNGRTTMTVAVNVS  60

Query  335  RFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRG  514
            RFEGI+MAPPDPILGVSEAFKADT+E+KLNLGVGAYRTEELQPYVL+VVKKAENLML+RG
Sbjct  61   RFEGITMAPPDPILGVSEAFKADTNELKLNLGVGAYRTEELQPYVLNVVKKAENLMLERG  120

Query  515  ENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFPG  694
            +NKEYLPIEGLAAFNKVTAELLFGADN VIQQ+RVAT+QGLSGTGSLR+AAALIERYFPG
Sbjct  121  DNKEYLPIEGLAAFNKVTAELLFGADNPVIQQQRVATIQGLSGTGSLRIAAALIERYFPG  180

Query  695  SKVLISSPTWGLH  733
            SKVLISSPTWG H
Sbjct  181  SKVLISSPTWGNH  193



>ref|XP_006450331.1| hypothetical protein CICLE_v10008224mg [Citrus clementina]
 ref|XP_006450332.1| hypothetical protein CICLE_v10008224mg [Citrus clementina]
 ref|XP_006483438.1| PREDICTED: aspartate aminotransferase, chloroplastic-like isoform 
X1 [Citrus sinensis]
 ref|XP_006483439.1| PREDICTED: aspartate aminotransferase, chloroplastic-like isoform 
X2 [Citrus sinensis]
 gb|ESR63571.1| hypothetical protein CICLE_v10008224mg [Citrus clementina]
 gb|ESR63572.1| hypothetical protein CICLE_v10008224mg [Citrus clementina]
 gb|KDO46788.1| hypothetical protein CISIN_1g012238mg [Citrus sinensis]
 gb|KDO46789.1| hypothetical protein CISIN_1g012238mg [Citrus sinensis]
 gb|KDO46790.1| hypothetical protein CISIN_1g012238mg [Citrus sinensis]
Length=459

 Score =   288 bits (738),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 153/190 (81%), Positives = 168/190 (88%), Gaps = 0/190 (0%)
 Frame = +2

Query  164  MASTVFTlasaspsvslslQDKLKAKPKLREYGQCTLFGNATKSHGRMRMVATVNVSRFE  343
            MAST+ ++ASA+PS SLS+ +KLK K KL      T     TKS GR+ MVA VNVSRFE
Sbjct  1    MASTMLSIASATPSASLSMHEKLKGKVKLGSTTNSTAGFIKTKSFGRVSMVAAVNVSRFE  60

Query  344  GISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENK  523
            G++MAPPDPILGVSEAFKADTDE KLNLGVGAYRTEELQPYVLDVVKKAENLML+RGENK
Sbjct  61   GVTMAPPDPILGVSEAFKADTDEKKLNLGVGAYRTEELQPYVLDVVKKAENLMLERGENK  120

Query  524  EYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFPGSKV  703
            EYLPIEGLAAFNKVTAELLFGADN V++++RVATVQGLSGTGSLRLAAALIERYFPG+KV
Sbjct  121  EYLPIEGLAAFNKVTAELLFGADNSVLKEQRVATVQGLSGTGSLRLAAALIERYFPGAKV  180

Query  704  LISSPTWGLH  733
            LISSPTWG H
Sbjct  181  LISSPTWGNH  190



>gb|KDO46791.1| hypothetical protein CISIN_1g012238mg [Citrus sinensis]
Length=467

 Score =   288 bits (738),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 153/190 (81%), Positives = 168/190 (88%), Gaps = 0/190 (0%)
 Frame = +2

Query  164  MASTVFTlasaspsvslslQDKLKAKPKLREYGQCTLFGNATKSHGRMRMVATVNVSRFE  343
            MAST+ ++ASA+PS SLS+ +KLK K KL      T     TKS GR+ MVA VNVSRFE
Sbjct  1    MASTMLSIASATPSASLSMHEKLKGKVKLGSTTNSTAGFIKTKSFGRVSMVAAVNVSRFE  60

Query  344  GISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENK  523
            G++MAPPDPILGVSEAFKADTDE KLNLGVGAYRTEELQPYVLDVVKKAENLML+RGENK
Sbjct  61   GVTMAPPDPILGVSEAFKADTDEKKLNLGVGAYRTEELQPYVLDVVKKAENLMLERGENK  120

Query  524  EYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFPGSKV  703
            EYLPIEGLAAFNKVTAELLFGADN V++++RVATVQGLSGTGSLRLAAALIERYFPG+KV
Sbjct  121  EYLPIEGLAAFNKVTAELLFGADNSVLKEQRVATVQGLSGTGSLRLAAALIERYFPGAKV  180

Query  704  LISSPTWGLH  733
            LISSPTWG H
Sbjct  181  LISSPTWGNH  190



>ref|XP_009619135.1| PREDICTED: aspartate aminotransferase, chloroplastic [Nicotiana 
tomentosiformis]
 ref|XP_009619136.1| PREDICTED: aspartate aminotransferase, chloroplastic [Nicotiana 
tomentosiformis]
 ref|XP_009619137.1| PREDICTED: aspartate aminotransferase, chloroplastic [Nicotiana 
tomentosiformis]
 ref|XP_009619138.1| PREDICTED: aspartate aminotransferase, chloroplastic [Nicotiana 
tomentosiformis]
Length=437

 Score =   286 bits (731),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 154/195 (79%), Positives = 171/195 (88%), Gaps = 3/195 (2%)
 Frame = +2

Query  164  MASTVFTlasaspsvslslQDKLKAKPKLREYGQCTLFGN---ATKSHGRMRMVATVNVS  334
            MAST+F+LASA+PS S SLQD LK+K KL    Q   FG      KS+GR  M  +VNVS
Sbjct  1    MASTMFSLASAAPSASFSLQDNLKSKLKLGTTSQSAFFGKDFAKAKSNGRTTMAVSVNVS  60

Query  335  RFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRG  514
            RFEGI+MAPPDPILGVSEAFKADT+E+KLNLGVGAYRTE+LQPYVL+VVKKAENLML+RG
Sbjct  61   RFEGITMAPPDPILGVSEAFKADTNELKLNLGVGAYRTEDLQPYVLNVVKKAENLMLERG  120

Query  515  ENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFPG  694
            +NKEYLPIEGLAAFNKVTAELLFGADN VIQQ+RVAT+QGLSGTGSLR+AAALIERYFPG
Sbjct  121  DNKEYLPIEGLAAFNKVTAELLFGADNPVIQQQRVATIQGLSGTGSLRIAAALIERYFPG  180

Query  695  SKVLISSPTWGLHHS  739
            SKVLISSPTWG H +
Sbjct  181  SKVLISSPTWGNHKN  195



>gb|AFP86894.1| aspartate aminotransferase, partial [Ilex paraguariensis]
Length=368

 Score =   279 bits (713),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 139/178 (78%), Positives = 149/178 (84%), Gaps = 7/178 (4%)
 Frame = +2

Query  221  QDKLKAKPKLREYGQCTLFGNA-------TKSHGRMRMVATVNVSRFEGISMAPPDPILG  379
            QD LK K KL      +  G         TK+ GR+ M   V VSRFE I+MAPPDPILG
Sbjct  21   QDTLKTKLKLTSSNHTSFLGKGKSVPFTNTKTFGRITMAVAVKVSRFESITMAPPDPILG  80

Query  380  VSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENKEYLPIEGLAAFN  559
            VSEAF+ADT+EMKLNLGVGAYRTEELQPYVL+VVKKAENLML+RGENKEYLPIEGLAAFN
Sbjct  81   VSEAFRADTNEMKLNLGVGAYRTEELQPYVLNVVKKAENLMLERGENKEYLPIEGLAAFN  140

Query  560  KVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFPGSKVLISSPTWGLH  733
            KVTAELLFGADN VIQQ+RVATVQGLSGTGSLRLAAALIERYFPG+KVLISSPTWG H
Sbjct  141  KVTAELLFGADNPVIQQQRVATVQGLSGTGSLRLAAALIERYFPGAKVLISSPTWGNH  198



>ref|XP_011036642.1| PREDICTED: aspartate aminotransferase, chloroplastic [Populus 
euphratica]
 ref|XP_011036645.1| PREDICTED: aspartate aminotransferase, chloroplastic [Populus 
euphratica]
Length=466

 Score =   281 bits (718),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 152/197 (77%), Positives = 166/197 (84%), Gaps = 7/197 (4%)
 Frame = +2

Query  164  MASTVFTlasaspsvslslQDKLKAKPKLREYGQCTLFG-------NATKSHGRMRMVAT  322
            MAST+ +LASA+PS SLS+Q+ LK K +L      TLF        N  KS GR+ M   
Sbjct  1    MASTMISLASATPSASLSVQETLKGKTRLGSGSVSTLFNKEKGNPSNKKKSFGRISMTVA  60

Query  323  VNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLM  502
            VNVSRFEGI+MAPPDPILGVSEAF+AD D  KLNLGVGAYRTEELQPYVLDVVKKAENLM
Sbjct  61   VNVSRFEGIAMAPPDPILGVSEAFRADIDVKKLNLGVGAYRTEELQPYVLDVVKKAENLM  120

Query  503  LQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIER  682
            L+RGENKEYLPIEGLAAFNKVTAELLFGADN VI+Q+RVATVQGLSGTGSLRLAAALIER
Sbjct  121  LERGENKEYLPIEGLAAFNKVTAELLFGADNPVIEQQRVATVQGLSGTGSLRLAAALIER  180

Query  683  YFPGSKVLISSPTWGLH  733
            YFPG++VLISSPTWG H
Sbjct  181  YFPGAQVLISSPTWGNH  197



>ref|XP_002309659.2| aspartate aminotransferase 2 family protein [Populus trichocarpa]
 gb|EEE93182.2| aspartate aminotransferase 2 family protein [Populus trichocarpa]
Length=466

 Score =   280 bits (716),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 153/197 (78%), Positives = 167/197 (85%), Gaps = 7/197 (4%)
 Frame = +2

Query  164  MASTVFTlasaspsvslslQDKLKAKPKLREYGQCTLF----GN---ATKSHGRMRMVAT  322
            MAST+ +LAS +PS SLS+Q+ LK K +L      TLF    GN     KS GR+ M   
Sbjct  1    MASTMLSLASTTPSASLSMQEILKGKARLGSGSVSTLFNKEKGNPFIKAKSFGRISMTVA  60

Query  323  VNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLM  502
            VNVSRFEGI+MAPPDPILGVSEAF+ADTD  KLNLGVGAYRTEELQPYVLDVVKKAENLM
Sbjct  61   VNVSRFEGIAMAPPDPILGVSEAFRADTDVKKLNLGVGAYRTEELQPYVLDVVKKAENLM  120

Query  503  LQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIER  682
            L+RGENKEYLPIEGLAAFNKVTAELLFGADN VI+Q+RVATVQGLSGTGSLRLAAALIER
Sbjct  121  LERGENKEYLPIEGLAAFNKVTAELLFGADNPVIKQQRVATVQGLSGTGSLRLAAALIER  180

Query  683  YFPGSKVLISSPTWGLH  733
            YFPG++VLISSPTWG H
Sbjct  181  YFPGAQVLISSPTWGNH  197



>ref|XP_006345635.1| PREDICTED: aspartate aminotransferase, chloroplastic-like isoform 
X1 [Solanum tuberosum]
Length=469

 Score =   280 bits (715),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 151/198 (76%), Positives = 168/198 (85%), Gaps = 5/198 (3%)
 Frame = +2

Query  152  SPITMASTVFTlasaspsvslslQDKLKAKPKLREYGQCTL----FGNATKSHGRMRMVA  319
            S   MAST+F+LAS +PS S+SLQD LK K KL    Q       F  A KS+GR  M  
Sbjct  4    SSFAMASTMFSLASVTPSASISLQDNLKPKLKLGTSSQRAFPRKDFMKA-KSNGRTTMAV  62

Query  320  TVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENL  499
             VNVSRFEGI+MAPPDPILGVSEAFKADT+E+KLNLGVGAYRTE+LQPYVL+VVKKAENL
Sbjct  63   AVNVSRFEGITMAPPDPILGVSEAFKADTNELKLNLGVGAYRTEDLQPYVLNVVKKAENL  122

Query  500  MLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIE  679
            +L+RGENKEYLPIEGLAAFNKVTAELLFG DN V+QQ+RVAT+QGLSGTGSLR+AAALIE
Sbjct  123  ILERGENKEYLPIEGLAAFNKVTAELLFGKDNPVLQQQRVATIQGLSGTGSLRIAAALIE  182

Query  680  RYFPGSKVLISSPTWGLH  733
            RYFPGSK+LISSPTWG H
Sbjct  183  RYFPGSKILISSPTWGNH  200



>ref|XP_002324896.1| aspartate aminotransferase 2 family protein [Populus trichocarpa]
 gb|EEF03461.1| aspartate aminotransferase 2 family protein [Populus trichocarpa]
Length=466

 Score =   278 bits (710),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 152/197 (77%), Positives = 168/197 (85%), Gaps = 7/197 (4%)
 Frame = +2

Query  164  MASTVFTlasaspsvslslQDKLKAKPKLREYGQCTLF----GNAT---KSHGRMRMVAT  322
            MAST+ +LASA+PS SLS+Q+ LK K +L      TLF    GN +   KS GR+ M   
Sbjct  1    MASTMISLASATPSASLSVQETLKGKMRLGSSSVSTLFNKEKGNPSIKKKSFGRISMTVA  60

Query  323  VNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLM  502
            VNVSRFEGI+MAPPDPILGVSEAF+AD D  KLNLGVGAYRTEELQPYVLDVVKKAENLM
Sbjct  61   VNVSRFEGIAMAPPDPILGVSEAFRADIDVKKLNLGVGAYRTEELQPYVLDVVKKAENLM  120

Query  503  LQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIER  682
            L+RGENKEYL IEGLAAFNKVTAELLFGADN+VI+Q+RVATVQGLSGTGSLRLAAALIER
Sbjct  121  LERGENKEYLAIEGLAAFNKVTAELLFGADNQVIEQQRVATVQGLSGTGSLRLAAALIER  180

Query  683  YFPGSKVLISSPTWGLH  733
            YFPG++VLISSPTWG H
Sbjct  181  YFPGAQVLISSPTWGNH  197



>ref|NP_001274906.1| aspartate aminotransferase, chloroplastic-like [Solanum tuberosum]
 gb|ABB55364.1| aspartate aminotransferase-like [Solanum tuberosum]
Length=462

 Score =   277 bits (708),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 149/194 (77%), Positives = 167/194 (86%), Gaps = 5/194 (3%)
 Frame = +2

Query  164  MASTVFTlasaspsvslslQDKLKAKPKLREYGQCTL----FGNATKSHGRMRMVATVNV  331
            MAST+F+LAS +PS S+SLQD LK K KL    Q       F  A KS+G+  M   VNV
Sbjct  1    MASTMFSLASVTPSASISLQDNLKPKLKLGTSSQRAFPRKDFMKA-KSNGQTTMAVAVNV  59

Query  332  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  511
            SRFEGI+MAPPDPILGVSEAFKADT+E+KLNLGVGAYRTE+LQPYVL+VVKKAENL+L+R
Sbjct  60   SRFEGITMAPPDPILGVSEAFKADTNELKLNLGVGAYRTEDLQPYVLNVVKKAENLILER  119

Query  512  GENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFP  691
            GENKEYLPIEGLAAFNKVTAELLFG DN V+QQ+RVAT+QGLSGTGSLR+AAALIERYFP
Sbjct  120  GENKEYLPIEGLAAFNKVTAELLFGKDNPVLQQQRVATIQGLSGTGSLRIAAALIERYFP  179

Query  692  GSKVLISSPTWGLH  733
            GSK+LISSPTWG H
Sbjct  180  GSKILISSPTWGNH  193



>ref|XP_011039608.1| PREDICTED: aspartate aminotransferase, chloroplastic-like [Populus 
euphratica]
 ref|XP_011039610.1| PREDICTED: aspartate aminotransferase, chloroplastic-like [Populus 
euphratica]
Length=466

 Score =   275 bits (703),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 152/197 (77%), Positives = 166/197 (84%), Gaps = 7/197 (4%)
 Frame = +2

Query  164  MASTVFTlasaspsvslslQDKLKAKPKLREYGQCTLF----GN---ATKSHGRMRMVAT  322
            MAST+ +LASA+PS SLS+Q+ LK K +       TLF    GN     KS GR+ M   
Sbjct  1    MASTMLSLASATPSASLSMQEILKGKARPGSGSVSTLFNKEKGNPFIKAKSFGRISMTVA  60

Query  323  VNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLM  502
            VNVSRFEGI+MAPPDPILGVSEAF+AD D  KLNLGVGAYRTEELQPYVLDVVKKAENLM
Sbjct  61   VNVSRFEGIAMAPPDPILGVSEAFRADIDVKKLNLGVGAYRTEELQPYVLDVVKKAENLM  120

Query  503  LQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIER  682
            L+RGENKEYLPIEGLAAFNKVTAELLFGADN VI+Q+RVATVQGLSGTGSLRLAAALIER
Sbjct  121  LERGENKEYLPIEGLAAFNKVTAELLFGADNPVIKQQRVATVQGLSGTGSLRLAAALIER  180

Query  683  YFPGSKVLISSPTWGLH  733
            YFPG++VLISSPTWG H
Sbjct  181  YFPGAQVLISSPTWGNH  197



>ref|XP_004244943.1| PREDICTED: aspartate aminotransferase, chloroplastic [Solanum 
lycopersicum]
 ref|XP_010324870.1| PREDICTED: aspartate aminotransferase, chloroplastic [Solanum 
lycopersicum]
Length=462

 Score =   273 bits (699),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 146/193 (76%), Positives = 164/193 (85%), Gaps = 3/193 (2%)
 Frame = +2

Query  164  MASTVFTlasaspsvslslQDKLKAKPKLREYGQCTLFGN---ATKSHGRMRMVATVNVS  334
            MAST+F+LAS +PS S+SLQD LK K K+    Q    G      KS+GR  M   VNVS
Sbjct  1    MASTMFSLASVTPSASISLQDNLKPKLKIGTSSQRAFPGKDFMKAKSNGRTTMAVAVNVS  60

Query  335  RFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRG  514
            RFEGI+MAP DPILGVSEAFKADT+E+KLNLGVGAYRTE+LQPYVL+VVKKAENL+L+RG
Sbjct  61   RFEGITMAPADPILGVSEAFKADTNELKLNLGVGAYRTEDLQPYVLNVVKKAENLILERG  120

Query  515  ENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFPG  694
            ENKEYLPIEGLAAFNKVTAELLFG DN V+QQ+RVAT+QGLSGTGSLR+AAALIERYFP 
Sbjct  121  ENKEYLPIEGLAAFNKVTAELLFGKDNPVLQQQRVATIQGLSGTGSLRIAAALIERYFPY  180

Query  695  SKVLISSPTWGLH  733
            SK+LISSPTWG H
Sbjct  181  SKILISSPTWGNH  193



>ref|XP_007223036.1| hypothetical protein PRUPE_ppa005369mg [Prunus persica]
 gb|EMJ24235.1| hypothetical protein PRUPE_ppa005369mg [Prunus persica]
Length=464

 Score =   271 bits (692),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 149/196 (76%), Positives = 167/196 (85%), Gaps = 7/196 (4%)
 Frame = +2

Query  164  MASTVFTlasaspsvslslQDKLKAKPKL-REY-----GQCTLFGNATKSHGRMRMVATV  325
            MAST+ +LAS SPS SLS  +  K K KL R +      +  LF   T+S GR+ MVA V
Sbjct  1    MASTMLSLASVSPSASLSTHETPKGKVKLGRSFLSLNKERNNLFAK-TESFGRISMVAAV  59

Query  326  NVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLML  505
            NVS+FEG++MAPPDPILGVSEAFKA T++ KLNLGVGAYRTEELQPYVLDVVKKAENLM+
Sbjct  60   NVSKFEGVTMAPPDPILGVSEAFKASTNQSKLNLGVGAYRTEELQPYVLDVVKKAENLMI  119

Query  506  QRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERY  685
            +RGENKEYLPIEGLAAFNKVTAELLFGADN VI+Q++VATVQGLSGTGSLRLAAALIERY
Sbjct  120  ERGENKEYLPIEGLAAFNKVTAELLFGADNPVIKQQKVATVQGLSGTGSLRLAAALIERY  179

Query  686  FPGSKVLISSPTWGLH  733
            FPG+KVLISSPTWG H
Sbjct  180  FPGAKVLISSPTWGNH  195



>gb|KDO46792.1| hypothetical protein CISIN_1g012238mg [Citrus sinensis]
Length=410

 Score =   269 bits (687),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 129/141 (91%), Positives = 137/141 (97%), Gaps = 0/141 (0%)
 Frame = +2

Query  311  MVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKA  490
            MVA VNVSRFEG++MAPPDPILGVSEAFKADTDE KLNLGVGAYRTEELQPYVLDVVKKA
Sbjct  1    MVAAVNVSRFEGVTMAPPDPILGVSEAFKADTDEKKLNLGVGAYRTEELQPYVLDVVKKA  60

Query  491  ENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAA  670
            ENLML+RGENKEYLPIEGLAAFNKVTAELLFGADN V++++RVATVQGLSGTGSLRLAAA
Sbjct  61   ENLMLERGENKEYLPIEGLAAFNKVTAELLFGADNSVLKEQRVATVQGLSGTGSLRLAAA  120

Query  671  LIERYFPGSKVLISSPTWGLH  733
            LIERYFPG+KVLISSPTWG H
Sbjct  121  LIERYFPGAKVLISSPTWGNH  141



>ref|XP_008220703.1| PREDICTED: aspartate aminotransferase, chloroplastic [Prunus 
mume]
 ref|XP_008220704.1| PREDICTED: aspartate aminotransferase, chloroplastic [Prunus 
mume]
 ref|XP_008220705.1| PREDICTED: aspartate aminotransferase, chloroplastic [Prunus 
mume]
Length=464

 Score =   269 bits (687),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 128/149 (86%), Positives = 142/149 (95%), Gaps = 0/149 (0%)
 Frame = +2

Query  287  TKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPY  466
            T+S GR+ MVA VNVS+FEG+++APPDPILGVSEAFKA T++ KLNLGVGAYRTEELQPY
Sbjct  47   TESFGRISMVAAVNVSKFEGVTLAPPDPILGVSEAFKASTNQSKLNLGVGAYRTEELQPY  106

Query  467  VLDVVKKAENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGT  646
            VLDVVKKAENLM++RGENKEYLPIEGLAAFNKVTAELLFGADN VI+Q++VATVQGLSGT
Sbjct  107  VLDVVKKAENLMIERGENKEYLPIEGLAAFNKVTAELLFGADNPVIKQQKVATVQGLSGT  166

Query  647  GSLRLAAALIERYFPGSKVLISSPTWGLH  733
            GSLRLAAALIERYFPG+KVLISSPTWG H
Sbjct  167  GSLRLAAALIERYFPGAKVLISSPTWGNH  195



>gb|KDP33541.1| hypothetical protein JCGZ_07112 [Jatropha curcas]
Length=466

 Score =   269 bits (687),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 146/197 (74%), Positives = 163/197 (83%), Gaps = 7/197 (4%)
 Frame = +2

Query  164  MASTVFTlasaspsvslslQDKLKAKPKLREYGQCTLFGNA-------TKSHGRMRMVAT  322
            MAS++ +LAS SPS SLS+ + LK K +       T F          TKS GR+ M   
Sbjct  1    MASSMLSLASTSPSASLSVHETLKGKVRHGTGSLTTWFNKEKANRFRNTKSPGRISMAIA  60

Query  323  VNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLM  502
            VNVSRFEGI+MAPPDPILGVSEAF+ADT+++KLNLGVGAYRTEEL PYVL+VVKKAENLM
Sbjct  61   VNVSRFEGITMAPPDPILGVSEAFRADTNDLKLNLGVGAYRTEELHPYVLNVVKKAENLM  120

Query  503  LQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIER  682
            L+RGE KEYLPIEGLAAFNKVTAELLFGADN VI+Q+RVATVQGLSGTGSLRLAAALIER
Sbjct  121  LERGEYKEYLPIEGLAAFNKVTAELLFGADNPVIEQQRVATVQGLSGTGSLRLAAALIER  180

Query  683  YFPGSKVLISSPTWGLH  733
            YFPG+KVLISSPTWG H
Sbjct  181  YFPGAKVLISSPTWGNH  197



>ref|XP_002285385.1| PREDICTED: aspartate aminotransferase, chloroplastic [Vitis vinifera]
 emb|CBI21095.3| unnamed protein product [Vitis vinifera]
Length=462

 Score =   268 bits (686),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 129/149 (87%), Positives = 138/149 (93%), Gaps = 0/149 (0%)
 Frame = +2

Query  287  TKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPY  466
            TKS GR+ M   VN SRFEG++MAPPDPILGVSEAF+AD  EMKLNLGVGAYRTEELQPY
Sbjct  45   TKSFGRINMAIAVNTSRFEGVTMAPPDPILGVSEAFRADNSEMKLNLGVGAYRTEELQPY  104

Query  467  VLDVVKKAENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGT  646
            VL+VVKKAENLML+RGENKEYLPIEGLAAFNKVTAELLFGA N VI+Q+RVATVQGLSGT
Sbjct  105  VLNVVKKAENLMLERGENKEYLPIEGLAAFNKVTAELLFGAGNPVIEQQRVATVQGLSGT  164

Query  647  GSLRLAAALIERYFPGSKVLISSPTWGLH  733
            GSLRLAAALIERYFPG+KVLISSPTWG H
Sbjct  165  GSLRLAAALIERYFPGAKVLISSPTWGNH  193



>emb|CAN76227.1| hypothetical protein VITISV_000267 [Vitis vinifera]
Length=462

 Score =   268 bits (685),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 129/149 (87%), Positives = 138/149 (93%), Gaps = 0/149 (0%)
 Frame = +2

Query  287  TKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPY  466
            TKS GR+ M   VN SRFEG++MAPPDPILGVSEAF+AD  EMKLNLGVGAYRTEELQPY
Sbjct  45   TKSFGRINMAIAVNTSRFEGVTMAPPDPILGVSEAFRADNSEMKLNLGVGAYRTEELQPY  104

Query  467  VLDVVKKAENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGT  646
            VL+VVKKAENLML+RGENKEYLPIEGLAAFNKVTAELLFGA N VI+Q+RVATVQGLSGT
Sbjct  105  VLNVVKKAENLMLKRGENKEYLPIEGLAAFNKVTAELLFGAGNPVIEQQRVATVQGLSGT  164

Query  647  GSLRLAAALIERYFPGSKVLISSPTWGLH  733
            GSLRLAAALIERYFPG+KVLISSPTWG H
Sbjct  165  GSLRLAAALIERYFPGAKVLISSPTWGNH  193



>ref|XP_010245533.1| PREDICTED: aspartate aminotransferase, chloroplastic [Nelumbo 
nucifera]
Length=470

 Score =   268 bits (685),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 128/149 (86%), Positives = 140/149 (94%), Gaps = 0/149 (0%)
 Frame = +2

Query  287  TKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPY  466
            ++S GR+ M   VNVSRFEG++MAPPDPILGVSEAF+ADT++ KLNLGVGAYRTEELQPY
Sbjct  53   SQSFGRISMTVAVNVSRFEGVTMAPPDPILGVSEAFRADTNDAKLNLGVGAYRTEELQPY  112

Query  467  VLDVVKKAENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGT  646
            VL+VVKKAENLML+RGENKEYLPIEGLAAFNKVTAELLFGADN VI++ RVATVQGLSGT
Sbjct  113  VLNVVKKAENLMLERGENKEYLPIEGLAAFNKVTAELLFGADNPVIREGRVATVQGLSGT  172

Query  647  GSLRLAAALIERYFPGSKVLISSPTWGLH  733
            GSLRLAAALIERYFPGSKVLISSPTWG H
Sbjct  173  GSLRLAAALIERYFPGSKVLISSPTWGNH  201



>ref|XP_010048915.1| PREDICTED: aspartate aminotransferase, chloroplastic-like [Eucalyptus 
grandis]
 gb|KCW81333.1| hypothetical protein EUGRSUZ_C02720 [Eucalyptus grandis]
 gb|KCW81334.1| hypothetical protein EUGRSUZ_C02720 [Eucalyptus grandis]
Length=462

 Score =   268 bits (684),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 130/149 (87%), Positives = 136/149 (91%), Gaps = 0/149 (0%)
 Frame = +2

Query  287  TKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPY  466
            TK  GR+ M   VNVSRFEGI+MAPPDPILGVSEAFKADTDE KLNLGVGAYRTEELQPY
Sbjct  45   TKHFGRVSMSVAVNVSRFEGITMAPPDPILGVSEAFKADTDERKLNLGVGAYRTEELQPY  104

Query  467  VLDVVKKAENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGT  646
            VL VVK AENLML+RGENKEYLPIEGLA FNK TAELLFGADN VI+Q+RVATVQGLSGT
Sbjct  105  VLKVVKTAENLMLERGENKEYLPIEGLATFNKATAELLFGADNPVIKQQRVATVQGLSGT  164

Query  647  GSLRLAAALIERYFPGSKVLISSPTWGLH  733
            GSLRLAAALIERYFPG+KVLISSPTWG H
Sbjct  165  GSLRLAAALIERYFPGAKVLISSPTWGNH  193



>ref|XP_007011759.1| Aspartate aminotransferase [Theobroma cacao]
 gb|EOY29378.1| Aspartate aminotransferase [Theobroma cacao]
Length=464

 Score =   267 bits (683),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 129/149 (87%), Positives = 140/149 (94%), Gaps = 0/149 (0%)
 Frame = +2

Query  287  TKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPY  466
            TKS GR+ MV T NVSRFEGI+MAPPDPILGVSEAFKAD  E+KLNLGVGAYRTEELQPY
Sbjct  47   TKSFGRISMVITSNVSRFEGITMAPPDPILGVSEAFKADNHELKLNLGVGAYRTEELQPY  106

Query  467  VLDVVKKAENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGT  646
            VL+VVKKA+ L+L+RGEN+EYLPIEGLAAFNKVTAELLFGADN VI+Q+RVATVQGLSGT
Sbjct  107  VLNVVKKADKLLLERGENREYLPIEGLAAFNKVTAELLFGADNPVIKQQRVATVQGLSGT  166

Query  647  GSLRLAAALIERYFPGSKVLISSPTWGLH  733
            GSLRLAAALIERYFPG+KVLISSPTWG H
Sbjct  167  GSLRLAAALIERYFPGAKVLISSPTWGNH  195



>ref|XP_008377672.1| PREDICTED: aspartate aminotransferase, chloroplastic-like [Malus 
domestica]
Length=464

 Score =   267 bits (683),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 127/149 (85%), Positives = 140/149 (94%), Gaps = 0/149 (0%)
 Frame = +2

Query  287  TKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPY  466
            T+S GR+ MVA VNVS+FEG++MAPPDPILGVSEAFKA T+E KLNLGVGAYRTE+LQPY
Sbjct  47   TESFGRVSMVAAVNVSKFEGVTMAPPDPILGVSEAFKASTNESKLNLGVGAYRTEDLQPY  106

Query  467  VLDVVKKAENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGT  646
            VLDVVKKAENLM++RGENKEYLPIEGLAAFNKVTAELLFGADN VI+Q+R+ATVQGLSGT
Sbjct  107  VLDVVKKAENLMIERGENKEYLPIEGLAAFNKVTAELLFGADNPVIKQQRLATVQGLSGT  166

Query  647  GSLRLAAALIERYFPGSKVLISSPTWGLH  733
            GSLRLA A IERYFPG+KVLISSPTWG H
Sbjct  167  GSLRLAGAFIERYFPGAKVLISSPTWGNH  195



>gb|KHG09550.1| Aspartate aminotransferase, chloroplastic -like protein [Gossypium 
arboreum]
Length=332

 Score =   263 bits (671),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 126/148 (85%), Positives = 137/148 (93%), Gaps = 0/148 (0%)
 Frame = +2

Query  290  KSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYV  469
            KS GR+ MV   NVSRFEGI+MAPPDPILGVSEAFKAD  E+KLNLGVGAYRTEELQPYV
Sbjct  44   KSFGRVSMVVASNVSRFEGITMAPPDPILGVSEAFKADNHELKLNLGVGAYRTEELQPYV  103

Query  470  LDVVKKAENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTG  649
            LDVVKKA+ L+L++GEN+EYLPIEGLAAFNKVTAELLFG DN VI+Q+RVATVQGLSGTG
Sbjct  104  LDVVKKADKLLLEKGENREYLPIEGLAAFNKVTAELLFGVDNPVIRQQRVATVQGLSGTG  163

Query  650  SLRLAAALIERYFPGSKVLISSPTWGLH  733
            SLRLAAALIERYFPG+KVLISSPTWG H
Sbjct  164  SLRLAAALIERYFPGAKVLISSPTWGNH  191



>gb|KJB55010.1| hypothetical protein B456_009G060500 [Gossypium raimondii]
Length=339

 Score =   262 bits (670),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 145/197 (74%), Positives = 160/197 (81%), Gaps = 9/197 (5%)
 Frame = +2

Query  164  MASTVFTlasaspsvslslQDKLKAKPKLREYGQCTLFGN-------ATKSHGRMRMVAT  322
            MAS+VF+LASA+PS SLS  D  K K  LR    C  F          TKS GR+ MV  
Sbjct  1    MASSVFSLASATPSASLSSHDIEKGKLNLRNTSLC--FKKEKNNPFMKTKSFGRISMVVA  58

Query  323  VNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLM  502
             NVSRFEGI+MAP DPILGVSEAFKAD  E+KLNLGVGAYRTEELQPYVLDVVKKA+ L+
Sbjct  59   SNVSRFEGITMAPSDPILGVSEAFKADNHELKLNLGVGAYRTEELQPYVLDVVKKADKLL  118

Query  503  LQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIER  682
            L++GEN+EYLPIEGLAAFNKVTA+LLFGADN VI+Q+RVATVQGLSGTGSLRLAAALIER
Sbjct  119  LEKGENREYLPIEGLAAFNKVTADLLFGADNPVIKQQRVATVQGLSGTGSLRLAAALIER  178

Query  683  YFPGSKVLISSPTWGLH  733
            YFP  +VLISSPTWG H
Sbjct  179  YFPRGEVLISSPTWGNH  195



>ref|XP_010089944.1| Aspartate aminotransferase [Morus notabilis]
 gb|EXB38640.1| Aspartate aminotransferase [Morus notabilis]
Length=482

 Score =   266 bits (681),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 140/193 (73%), Positives = 153/193 (79%), Gaps = 23/193 (12%)
 Frame = +2

Query  221  QDKLKAKPKLREYG------QCTLFGNATKSHGRMRMVATVNVSRFEGISMAPPDPILGV  382
            Q+ LK K KLR  G      +   F N  KS GR+ MVA VN SRF+GI+MAPPDPILGV
Sbjct  22   QESLKGKLKLRSSGLSFTKEKINPFANG-KSFGRVSMVAAVNASRFDGIAMAPPDPILGV  80

Query  383  SEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENKE------------  526
            SEAFKADT+ +KLNLGVGAYRTEELQPYVLDVVKKAENLML+RGENKE            
Sbjct  81   SEAFKADTNALKLNLGVGAYRTEELQPYVLDVVKKAENLMLERGENKEVIHVFERVDDLK  140

Query  527  ----YLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFPG  694
                YLPIEGLAAFNKVTAELLFGADN VI++++VATVQGLSGTGSLRLAAALIERYFPG
Sbjct  141  LFLNYLPIEGLAAFNKVTAELLFGADNPVIKEQKVATVQGLSGTGSLRLAAALIERYFPG  200

Query  695  SKVLISSPTWGLH  733
            +KVLISSPTWG H
Sbjct  201  AKVLISSPTWGNH  213



>gb|KHG15177.1| Aspartate aminotransferase, chloroplastic -like protein [Gossypium 
arboreum]
Length=464

 Score =   266 bits (679),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 145/197 (74%), Positives = 161/197 (82%), Gaps = 9/197 (5%)
 Frame = +2

Query  164  MASTVFTlasaspsvslslQDKLKAKPKLREYGQCTLFGN-------ATKSHGRMRMVAT  322
            MAS+VF+LASA+PS SLS  D  K K  LR    C  F           KS GR+ MV  
Sbjct  1    MASSVFSLASATPSASLSSHDIEKGKLNLRNTSLC--FKKEKNNPFMKIKSFGRISMVVA  58

Query  323  VNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLM  502
             NVSRFEGI+MAPPDPILGVSEAFKAD  E+KLNLGVGAYRTEEL+PYVLDVVKKA+ L+
Sbjct  59   SNVSRFEGITMAPPDPILGVSEAFKADNHELKLNLGVGAYRTEELEPYVLDVVKKADKLL  118

Query  503  LQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIER  682
            L++GEN+EYLPIEGLAAFNKVTA+LLFGADN VI+Q+RVATVQGLSGTGSLRLAAALIER
Sbjct  119  LEKGENREYLPIEGLAAFNKVTADLLFGADNPVIKQQRVATVQGLSGTGSLRLAAALIER  178

Query  683  YFPGSKVLISSPTWGLH  733
            YFPG +VLISSPTWG H
Sbjct  179  YFPGGEVLISSPTWGNH  195



>ref|XP_011459596.1| PREDICTED: aspartate aminotransferase, chloroplastic [Fragaria 
vesca subsp. vesca]
Length=453

 Score =   265 bits (678),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 132/171 (77%), Positives = 146/171 (85%), Gaps = 1/171 (1%)
 Frame = +2

Query  221  QDKLKAKPKLREYGQCTLFGNATKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKA  400
             D  K K KL    +  LF N T+S GR+ MVA V  SRF+G++MAPPDPILGVSEAFKA
Sbjct  15   HDTHKGKIKLGSLERSNLFLN-TQSAGRVSMVAAVKTSRFDGVTMAPPDPILGVSEAFKA  73

Query  401  DTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENKEYLPIEGLAAFNKVTAELL  580
             T+ MKLNLGVGAYRTEELQPYVL+VVKKAENLML+RGENKEYLPIEGLAAFNK TAELL
Sbjct  74   STNLMKLNLGVGAYRTEELQPYVLNVVKKAENLMLERGENKEYLPIEGLAAFNKATAELL  133

Query  581  FGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFPGSKVLISSPTWGLH  733
            FGADN VI++++VATVQGLSGTGSLRLAAA IERYFPG+K LISSPTWG H
Sbjct  134  FGADNPVIKEQKVATVQGLSGTGSLRLAAAFIERYFPGAKALISSPTWGNH  184



>ref|XP_002515455.1| aspartate aminotransferase, putative [Ricinus communis]
 gb|EEF46904.1| aspartate aminotransferase, putative [Ricinus communis]
Length=464

 Score =   266 bits (679),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 146/197 (74%), Positives = 158/197 (80%), Gaps = 9/197 (5%)
 Frame = +2

Query  164  MASTVFTlasaspsvslslQDKLKAKPKLREYGQCTLFGN-------ATKSHGRMRMVAT  322
            MAS++F+LA AS S S+   D LK K +L      T F          TKS GR+ M A 
Sbjct  1    MASSMFSLAGASLSPSM--HDTLKEKVRLGSGSIGTWFTKDKVHSFMKTKSSGRISMTAA  58

Query  323  VNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLM  502
            VN+SRFEGI+MA PDPILGVSEAF+AD D  KLNLGVGAYRTEEL PYVLDVVKKAENLM
Sbjct  59   VNISRFEGITMALPDPILGVSEAFRADNDAKKLNLGVGAYRTEELHPYVLDVVKKAENLM  118

Query  503  LQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIER  682
            L+RGENKEYLPIEGLAAFNKVTAELLFGADN VI Q+RVATVQGLSGTGSLRLAAALIER
Sbjct  119  LERGENKEYLPIEGLAAFNKVTAELLFGADNPVINQQRVATVQGLSGTGSLRLAAALIER  178

Query  683  YFPGSKVLISSPTWGLH  733
            YF G+KVLISSPTWG H
Sbjct  179  YFLGAKVLISSPTWGNH  195



>ref|XP_004138711.1| PREDICTED: aspartate aminotransferase, chloroplastic-like [Cucumis 
sativus]
 ref|XP_004160763.1| PREDICTED: aspartate aminotransferase, chloroplastic-like [Cucumis 
sativus]
 gb|KGN62979.1| hypothetical protein Csa_2G382520 [Cucumis sativus]
Length=464

 Score =   264 bits (674),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 128/148 (86%), Positives = 137/148 (93%), Gaps = 0/148 (0%)
 Frame = +2

Query  290  KSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYV  469
            KS  R+ MVA+VNVSRFEGI+MAPPDPILGVSEAFKADT   KLNLGVGAYRTEELQPYV
Sbjct  48   KSFSRISMVASVNVSRFEGITMAPPDPILGVSEAFKADTHGNKLNLGVGAYRTEELQPYV  107

Query  470  LDVVKKAENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTG  649
            LDVVKK E LML+RG+NKEYLPIEGLAAFNK TAELLFGADN VI+Q+RVAT+QGLSGTG
Sbjct  108  LDVVKKVEALMLERGDNKEYLPIEGLAAFNKATAELLFGADNPVIKQQRVATIQGLSGTG  167

Query  650  SLRLAAALIERYFPGSKVLISSPTWGLH  733
            SLRLAAALIERYFPG+KVLISSPTWG H
Sbjct  168  SLRLAAALIERYFPGAKVLISSPTWGNH  195



>ref|XP_008445249.1| PREDICTED: aspartate aminotransferase, chloroplastic isoform 
X1 [Cucumis melo]
Length=465

 Score =   263 bits (672),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 127/148 (86%), Positives = 138/148 (93%), Gaps = 0/148 (0%)
 Frame = +2

Query  290  KSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYV  469
            KS  R+ MVA+VNVSRFEGI+MAPPDPILGVSEAFKADT   KLNLGVGAYRTEELQPYV
Sbjct  49   KSFSRISMVASVNVSRFEGITMAPPDPILGVSEAFKADTHGNKLNLGVGAYRTEELQPYV  108

Query  470  LDVVKKAENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTG  649
            LDVVKK E+LML+RG+NKEYLPIEGLAAFNK TAELLFGA+N VI+Q+RVAT+QGLSGTG
Sbjct  109  LDVVKKVESLMLERGDNKEYLPIEGLAAFNKATAELLFGANNPVIKQQRVATIQGLSGTG  168

Query  650  SLRLAAALIERYFPGSKVLISSPTWGLH  733
            SLRLAAALIERYFPG+KVLISSPTWG H
Sbjct  169  SLRLAAALIERYFPGAKVLISSPTWGNH  196



>gb|KJB55006.1| hypothetical protein B456_009G060500 [Gossypium raimondii]
Length=464

 Score =   263 bits (671),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 145/197 (74%), Positives = 160/197 (81%), Gaps = 9/197 (5%)
 Frame = +2

Query  164  MASTVFTlasaspsvslslQDKLKAKPKLREYGQCTLFGN-------ATKSHGRMRMVAT  322
            MAS+VF+LASA+PS SLS  D  K K  LR    C  F          TKS GR+ MV  
Sbjct  1    MASSVFSLASATPSASLSSHDIEKGKLNLRNTSLC--FKKEKNNPFMKTKSFGRISMVVA  58

Query  323  VNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLM  502
             NVSRFEGI+MAP DPILGVSEAFKAD  E+KLNLGVGAYRTEELQPYVLDVVKKA+ L+
Sbjct  59   SNVSRFEGITMAPSDPILGVSEAFKADNHELKLNLGVGAYRTEELQPYVLDVVKKADKLL  118

Query  503  LQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIER  682
            L++GEN+EYLPIEGLAAFNKVTA+LLFGADN VI+Q+RVATVQGLSGTGSLRLAAALIER
Sbjct  119  LEKGENREYLPIEGLAAFNKVTADLLFGADNPVIKQQRVATVQGLSGTGSLRLAAALIER  178

Query  683  YFPGSKVLISSPTWGLH  733
            YFP  +VLISSPTWG H
Sbjct  179  YFPRGEVLISSPTWGNH  195



>ref|XP_010665799.1| PREDICTED: aspartate aminotransferase, chloroplastic [Beta vulgaris 
subsp. vulgaris]
Length=459

 Score =   261 bits (668),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 125/148 (84%), Positives = 137/148 (93%), Gaps = 0/148 (0%)
 Frame = +2

Query  290  KSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYV  469
            +S  R+ MVATVN SRF+G+SMAP DPILGVSEAFKADTDE KLNLGVGAYRTEELQPYV
Sbjct  43   QSFSRVSMVATVNASRFDGVSMAPADPILGVSEAFKADTDEKKLNLGVGAYRTEELQPYV  102

Query  470  LDVVKKAENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTG  649
            L+VVKKAENLML+RGENKEYLPIEGLAAFNKVTAELLFGADN V++++RVATVQ LSGTG
Sbjct  103  LNVVKKAENLMLERGENKEYLPIEGLAAFNKVTAELLFGADNPVLKEQRVATVQSLSGTG  162

Query  650  SLRLAAALIERYFPGSKVLISSPTWGLH  733
            SLRLA A IERYFPG+KVLISSP+WG H
Sbjct  163  SLRLAGAFIERYFPGAKVLISSPSWGNH  190



>ref|XP_010527116.1| PREDICTED: aspartate aminotransferase, chloroplastic, partial 
[Tarenaya hassleriana]
Length=431

 Score =   260 bits (665),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 140/190 (74%), Positives = 152/190 (80%), Gaps = 6/190 (3%)
 Frame = +2

Query  164  MASTVFTlasaspsvslslQDKLKAKPKLREYGQCTLFGNATKSHGRMRMVATVNVSRFE  343
            MAST F+L SAS        DK     KL   G    F   TKS GR+ M   V  SRF+
Sbjct  1    MASTTFSLVSASVFPREISVDK----QKLGNSGSNAFF--KTKSFGRVTMSIAVKTSRFD  54

Query  344  GISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENK  523
            GI+MAP DPILGVSEAFKADT+E+KLNLGVGAYRTEEL PYVL VVKKAENLML+RGENK
Sbjct  55   GITMAPADPILGVSEAFKADTNELKLNLGVGAYRTEELHPYVLSVVKKAENLMLERGENK  114

Query  524  EYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFPGSKV  703
            EYLPIEGLAAFNKVTAELLFGA++ VI ++RVATVQGLSGTGSLRLAAALIERYFPG+KV
Sbjct  115  EYLPIEGLAAFNKVTAELLFGANSAVINEQRVATVQGLSGTGSLRLAAALIERYFPGAKV  174

Query  704  LISSPTWGLH  733
            LISSPTWG H
Sbjct  175  LISSPTWGNH  184



>ref|XP_004498776.1| PREDICTED: aspartate aminotransferase P2, mitochondrial-like 
[Cicer arietinum]
Length=467

 Score =   261 bits (667),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 127/153 (83%), Positives = 137/153 (90%), Gaps = 1/153 (1%)
 Frame = +2

Query  275  FGNATKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEE  454
            F N ++S GR+ M   VNVSRFEGI MAPPDPILGVSEAFKADT  +KLNLGVGAYRTEE
Sbjct  47   FSN-SRSSGRISMAVAVNVSRFEGIPMAPPDPILGVSEAFKADTSNVKLNLGVGAYRTEE  105

Query  455  LQPYVLDVVKKAENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQG  634
            LQPYVL+VVKKAENLML+RGENKEYLPIEGLAAFNK TAELL GADN  I+Q+RVATVQG
Sbjct  106  LQPYVLNVVKKAENLMLERGENKEYLPIEGLAAFNKATAELLLGADNPAIKQQRVATVQG  165

Query  635  LSGTGSLRLAAALIERYFPGSKVLISSPTWGLH  733
            LSGTGSLRL AALIERYFPG+KVLIS+PTWG H
Sbjct  166  LSGTGSLRLGAALIERYFPGAKVLISNPTWGNH  198



>gb|KJB65890.1| hypothetical protein B456_010G117400 [Gossypium raimondii]
Length=460

 Score =   261 bits (666),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 126/148 (85%), Positives = 136/148 (92%), Gaps = 0/148 (0%)
 Frame = +2

Query  290  KSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYV  469
            KS GR+ MV   NVS FEGI+MAPPDPILGVSEAFKAD  E+KLNLGVGAYRTEELQPYV
Sbjct  44   KSFGRVSMVVASNVSHFEGITMAPPDPILGVSEAFKADDHELKLNLGVGAYRTEELQPYV  103

Query  470  LDVVKKAENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTG  649
            LDVVKKA+ L+L++GEN EYLPIEGLAAFNKVTAELLFGADN VI+Q+RVATVQGLSGTG
Sbjct  104  LDVVKKADKLLLEKGENLEYLPIEGLAAFNKVTAELLFGADNPVIKQQRVATVQGLSGTG  163

Query  650  SLRLAAALIERYFPGSKVLISSPTWGLH  733
            SLRLAAALIERYFPG+KVLISSPTWG H
Sbjct  164  SLRLAAALIERYFPGAKVLISSPTWGNH  191



>gb|KJB55007.1| hypothetical protein B456_009G060500 [Gossypium raimondii]
Length=468

 Score =   259 bits (662),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 143/199 (72%), Positives = 161/199 (81%), Gaps = 9/199 (5%)
 Frame = +2

Query  164  MASTVFTlasaspsvslslQD--KLKAKPKLREYGQCTLFGN-------ATKSHGRMRMV  316
            MAS+VF+LASA+PS SLS  D  K+ ++ KL        F          TKS GR+ MV
Sbjct  1    MASSVFSLASATPSASLSSHDIEKISSQGKLNLRNTSLCFKKEKNNPFMKTKSFGRISMV  60

Query  317  ATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAEN  496
               NVSRFEGI+MAP DPILGVSEAFKAD  E+KLNLGVGAYRTEELQPYVLDVVKKA+ 
Sbjct  61   VASNVSRFEGITMAPSDPILGVSEAFKADNHELKLNLGVGAYRTEELQPYVLDVVKKADK  120

Query  497  LMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALI  676
            L+L++GEN+EYLPIEGLAAFNKVTA+LLFGADN VI+Q+RVATVQGLSGTGSLRLAAALI
Sbjct  121  LLLEKGENREYLPIEGLAAFNKVTADLLFGADNPVIKQQRVATVQGLSGTGSLRLAAALI  180

Query  677  ERYFPGSKVLISSPTWGLH  733
            ERYFP  +VLISSPTWG H
Sbjct  181  ERYFPRGEVLISSPTWGNH  199



>gb|AAB46611.1| aspartate aminotransferase [Medicago sativa]
Length=455

 Score =   259 bits (661),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 124/148 (84%), Positives = 135/148 (91%), Gaps = 0/148 (0%)
 Frame = +2

Query  290  KSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYV  469
            +S GR+ M    NVSRFEGI MAPPDPILGVSEAFKADT+++KLNLGVGAYRTEELQPYV
Sbjct  39   RSSGRICMAVATNVSRFEGIPMAPPDPILGVSEAFKADTNDVKLNLGVGAYRTEELQPYV  98

Query  470  LDVVKKAENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTG  649
            L+VVKKAENLML+RGENKEYLPIEGLAAFNK TAELL GADN  I+Q+RVATVQGLSGTG
Sbjct  99   LNVVKKAENLMLERGENKEYLPIEGLAAFNKATAELLLGADNPAIKQQRVATVQGLSGTG  158

Query  650  SLRLAAALIERYFPGSKVLISSPTWGLH  733
            SLRL AALIERYFPG+KVLIS+PTWG H
Sbjct  159  SLRLGAALIERYFPGAKVLISNPTWGNH  186



>emb|CAA04697.1| aspartate aminotransferase 2 [Canavalia lineata]
Length=465

 Score =   259 bits (662),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 135/197 (69%), Positives = 155/197 (79%), Gaps = 8/197 (4%)
 Frame = +2

Query  164  MASTVFTlasaspsvslslQDKLKAKPKLREYGQCTLFGN-------ATKSHGRMRMVAT  322
            MAS+V + A+ S   S  L   LK KP+L +       GN       +++S GR+ M   
Sbjct  1    MASSVLSGANQSSPSSTVLNTHLKGKPRLGD-NALRFSGNKGGSNAFSSRSRGRISMAVA  59

Query  323  VNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLM  502
             NVSRFEGI MAPPDPILGVSEAF+AD  ++KLNLGVGAYRTEELQPYVL+VVKKAENLM
Sbjct  60   DNVSRFEGIPMAPPDPILGVSEAFRADNSDVKLNLGVGAYRTEELQPYVLNVVKKAENLM  119

Query  503  LQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIER  682
            L+RG+NKEY+PIEGLAAFNK TAELL GADN  I+Q+RVATVQGLSGTGSLRL AA+IER
Sbjct  120  LERGQNKEYVPIEGLAAFNKATAELLLGADNPAIKQQRVATVQGLSGTGSLRLGAAVIER  179

Query  683  YFPGSKVLISSPTWGLH  733
            YFPG+KVLISSPTWG H
Sbjct  180  YFPGAKVLISSPTWGNH  196



>ref|XP_011082202.1| PREDICTED: aspartate aminotransferase, chloroplastic [Sesamum 
indicum]
Length=451

 Score =   258 bits (660),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 130/160 (81%), Positives = 139/160 (87%), Gaps = 3/160 (2%)
 Frame = +2

Query  263  QCTLFGNA---TKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGV  433
            Q TLFG      KS  R  + + V VSRF  I+MAPPDPILGVSEAF+ADT EMKLNLGV
Sbjct  23   QSTLFGKDYIRAKSFTRKSVTSAVEVSRFGDITMAPPDPILGVSEAFRADTHEMKLNLGV  82

Query  434  GAYRTEELQPYVLDVVKKAENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQK  613
            GAYRTE+LQPYVL+VVKKAENLML+RGENKEYLPIEGLAAFNKVTAELL GA N+VIQQ+
Sbjct  83   GAYRTEDLQPYVLNVVKKAENLMLERGENKEYLPIEGLAAFNKVTAELLLGAQNDVIQQQ  142

Query  614  RVATVQGLSGTGSLRLAAALIERYFPGSKVLISSPTWGLH  733
            RVATVQGLSGTGSLRLAAALIERYF GSKVLISSPTWG H
Sbjct  143  RVATVQGLSGTGSLRLAAALIERYFSGSKVLISSPTWGNH  182



>prf||1908424A Asp aminotransferase
Length=465

 Score =   259 bits (661),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 124/150 (83%), Positives = 135/150 (90%), Gaps = 0/150 (0%)
 Frame = +2

Query  290  KSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYV  469
            +S GR+ M    NVSRFEGI MAPPDPILGVSEAFKADT ++KLNLGVGAYRTEELQPYV
Sbjct  49   RSSGRICMAVATNVSRFEGIPMAPPDPILGVSEAFKADTSDVKLNLGVGAYRTEELQPYV  108

Query  470  LDVVKKAENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTG  649
            L+VVKKAENLML+RGENKEYLPIEGLAAFNK TAELL GADN  I+Q+RVATVQGLSGTG
Sbjct  109  LNVVKKAENLMLERGENKEYLPIEGLAAFNKATAELLLGADNPAIKQQRVATVQGLSGTG  168

Query  650  SLRLAAALIERYFPGSKVLISSPTWGLHHS  739
            SLRL AALIERYFPG+KVLIS+PTWG H +
Sbjct  169  SLRLGAALIERYFPGAKVLISNPTWGNHRN  198



>ref|XP_008445250.1| PREDICTED: aspartate aminotransferase, chloroplastic isoform 
X2 [Cucumis melo]
Length=410

 Score =   257 bits (656),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 124/141 (88%), Positives = 134/141 (95%), Gaps = 0/141 (0%)
 Frame = +2

Query  311  MVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKA  490
            MVA+VNVSRFEGI+MAPPDPILGVSEAFKADT   KLNLGVGAYRTEELQPYVLDVVKK 
Sbjct  1    MVASVNVSRFEGITMAPPDPILGVSEAFKADTHGNKLNLGVGAYRTEELQPYVLDVVKKV  60

Query  491  ENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAA  670
            E+LML+RG+NKEYLPIEGLAAFNK TAELLFGA+N VI+Q+RVAT+QGLSGTGSLRLAAA
Sbjct  61   ESLMLERGDNKEYLPIEGLAAFNKATAELLFGANNPVIKQQRVATIQGLSGTGSLRLAAA  120

Query  671  LIERYFPGSKVLISSPTWGLH  733
            LIERYFPG+KVLISSPTWG H
Sbjct  121  LIERYFPGAKVLISSPTWGNH  141



>gb|KEH39860.1| aspartate aminotransferase [Medicago truncatula]
Length=465

 Score =   258 bits (660),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 124/148 (84%), Positives = 134/148 (91%), Gaps = 0/148 (0%)
 Frame = +2

Query  290  KSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYV  469
            +S GR+ M    NVSRFEGI MAPPDPILGVSEAFKADT ++KLNLGVGAYRTEELQPYV
Sbjct  49   RSSGRICMAVATNVSRFEGIPMAPPDPILGVSEAFKADTSDVKLNLGVGAYRTEELQPYV  108

Query  470  LDVVKKAENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTG  649
            L+VVKKAENLML+RGENKEYLPIEGLAAFNK TAELL GADN  I+Q+RVATVQGLSGTG
Sbjct  109  LNVVKKAENLMLERGENKEYLPIEGLAAFNKATAELLLGADNPAIKQQRVATVQGLSGTG  168

Query  650  SLRLAAALIERYFPGSKVLISSPTWGLH  733
            SLRL AALIERYFPG+KVLIS+PTWG H
Sbjct  169  SLRLGAALIERYFPGAKVLISNPTWGNH  196



>gb|KJB65891.1| hypothetical protein B456_010G117400 [Gossypium raimondii]
Length=460

 Score =   258 bits (659),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 125/148 (84%), Positives = 134/148 (91%), Gaps = 0/148 (0%)
 Frame = +2

Query  290  KSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYV  469
            KS GR+ MV   NVS FEGI+MAPPDPILGVSEAFKAD  E+KLNLGVGAYRTEELQPYV
Sbjct  44   KSFGRVSMVVASNVSHFEGITMAPPDPILGVSEAFKADDHELKLNLGVGAYRTEELQPYV  103

Query  470  LDVVKKAENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTG  649
            LDVVKK   L+L++GEN EYLPIEGLAAFNKVTAELLFGADN VI+Q+RVATVQGLSGTG
Sbjct  104  LDVVKKVNKLLLEKGENLEYLPIEGLAAFNKVTAELLFGADNPVIKQQRVATVQGLSGTG  163

Query  650  SLRLAAALIERYFPGSKVLISSPTWGLH  733
            SLRLAAALIERYFPG+KVLISSPTWG H
Sbjct  164  SLRLAAALIERYFPGAKVLISSPTWGNH  191



>gb|EPS60991.1| aspartate aminotransferase, partial [Genlisea aurea]
Length=200

 Score =   249 bits (636),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 119/150 (79%), Positives = 132/150 (88%), Gaps = 0/150 (0%)
 Frame = +2

Query  290  KSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYV  469
            +S  R  MV    VSRF  +S+APPDPILGVSEAFKADT ++KLNLGVGAYRTE+LQPYV
Sbjct  19   RSFNRASMVIASGVSRFNEVSLAPPDPILGVSEAFKADTSDLKLNLGVGAYRTEDLQPYV  78

Query  470  LDVVKKAENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTG  649
            L+VVKKAENLML+RGENKEYLPIEGLAAFNK TAELLFGADN+VIQQ+RVATVQGLSGTG
Sbjct  79   LNVVKKAENLMLERGENKEYLPIEGLAAFNKATAELLFGADNDVIQQQRVATVQGLSGTG  138

Query  650  SLRLAAALIERYFPGSKVLISSPTWGLHHS  739
            SLRL A  I+RYFPGS VL+SSPTWG H +
Sbjct  139  SLRLGAVFIQRYFPGSTVLLSSPTWGNHKN  168



>sp|P26563.1|AATM_LUPAN RecName: Full=Aspartate aminotransferase P2, mitochondrial; AltName: 
Full=Transaminase A; Flags: Precursor, partial [Lupinus 
angustifolius]
 emb|CAA42430.1| aspartate aminotransferase [Lupinus angustifolius]
Length=454

 Score =   256 bits (655),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 127/157 (81%), Positives = 136/157 (87%), Gaps = 1/157 (1%)
 Frame = +2

Query  263  QCTLFGNATKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAY  442
            Q   F NA KS  R+ MVA VNVSRFEGI MAPPDPILGVSEAF+ADT + KLNLGVGAY
Sbjct  30   QSNTFSNA-KSSCRISMVAAVNVSRFEGIPMAPPDPILGVSEAFRADTSDAKLNLGVGAY  88

Query  443  RTEELQPYVLDVVKKAENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVA  622
            RTEELQPYVL VV KAENLML+RG+NKEYL IEGLAAFNK TAELL GADN  I+Q+RVA
Sbjct  89   RTEELQPYVLKVVNKAENLMLERGQNKEYLAIEGLAAFNKATAELLLGADNPAIKQQRVA  148

Query  623  TVQGLSGTGSLRLAAALIERYFPGSKVLISSPTWGLH  733
            TVQGLSGTGSLRL AALIERYFPG+KVLIS+PTWG H
Sbjct  149  TVQGLSGTGSLRLGAALIERYFPGAKVLISAPTWGNH  185



>emb|CDP18792.1| unnamed protein product [Coffea canephora]
Length=549

 Score =   259 bits (662),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 130/168 (77%), Positives = 145/168 (86%), Gaps = 5/168 (3%)
 Frame = +2

Query  239  KPKLREYGQCTLFGN---ATKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTD  409
            KPKL    Q ++FG     T+S  R  M   +NVSRFE I+MAPPDPILGVSEAF+ADT+
Sbjct  115  KPKL--LNQASVFGKRFVNTESFTRTTMAVALNVSRFESITMAPPDPILGVSEAFRADTN  172

Query  410  EMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENKEYLPIEGLAAFNKVTAELLFGA  589
            EMKLNLGVGAYRTE+LQPYVL+VVKKAE LML+RGENKEYLPIEGLA+FNKVTAELL GA
Sbjct  173  EMKLNLGVGAYRTEDLQPYVLNVVKKAEKLMLERGENKEYLPIEGLASFNKVTAELLLGA  232

Query  590  DNEVIQQKRVATVQGLSGTGSLRLAAALIERYFPGSKVLISSPTWGLH  733
            DN +I Q+RVATVQGLSGTGSLRLAAALIERYFPG+KVLISSP+WG H
Sbjct  233  DNPLILQQRVATVQGLSGTGSLRLAAALIERYFPGAKVLISSPSWGNH  280



>gb|AAB68396.1| aspartate aminotransferase 2 precursor [Canavalia lineata]
Length=465

 Score =   256 bits (655),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 136/197 (69%), Positives = 153/197 (78%), Gaps = 8/197 (4%)
 Frame = +2

Query  164  MASTVFTlasaspsvslslQDKLKAKPKLREYGQCTLFGN-------ATKSHGRMRMVAT  322
            MAS+V + A+ S   S  L   LK KP+L +       GN       +++S GR+ M   
Sbjct  1    MASSVLSGANQSSPSSTVLNTHLKGKPRLGD-NALRFSGNKGGSNAFSSRSRGRISMAVA  59

Query  323  VNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLM  502
             NVSRFEGI MAPPDPILGVSEAFKAD  ++KLNLGVGAYRTEELQPYVL+VVKKAENLM
Sbjct  60   DNVSRFEGIPMAPPDPILGVSEAFKADNSDVKLNLGVGAYRTEELQPYVLNVVKKAENLM  119

Query  503  LQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIER  682
            L+RG+NKEYLPIEGLAAFNK TAELL GADN  I+Q+RVATVQGLSG  SLRL AALIER
Sbjct  120  LERGQNKEYLPIEGLAAFNKATAELLLGADNPAIKQQRVATVQGLSGLVSLRLGAALIER  179

Query  683  YFPGSKVLISSPTWGLH  733
            YFPG+KVLISSPTWG H
Sbjct  180  YFPGAKVLISSPTWGNH  196



>gb|KJB55009.1| hypothetical protein B456_009G060500 [Gossypium raimondii]
Length=496

 Score =   257 bits (657),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 124/149 (83%), Positives = 136/149 (91%), Gaps = 0/149 (0%)
 Frame = +2

Query  287  TKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPY  466
            TKS GR+ MV   NVSRFEGI+MAP DPILGVSEAFKAD  E+KLNLGVGAYRTEELQPY
Sbjct  79   TKSFGRISMVVASNVSRFEGITMAPSDPILGVSEAFKADNHELKLNLGVGAYRTEELQPY  138

Query  467  VLDVVKKAENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGT  646
            VLDVVKKA+ L+L++GEN+EYLPIEGLAAFNKVTA+LLFGADN VI+Q+RVATVQGLSGT
Sbjct  139  VLDVVKKADKLLLEKGENREYLPIEGLAAFNKVTADLLFGADNPVIKQQRVATVQGLSGT  198

Query  647  GSLRLAAALIERYFPGSKVLISSPTWGLH  733
            GSLRLAAALIERYFP  +VLISSPTWG H
Sbjct  199  GSLRLAAALIERYFPRGEVLISSPTWGNH  227



>ref|XP_002867266.1| hypothetical protein ARALYDRAFT_491537 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43525.1| hypothetical protein ARALYDRAFT_491537 [Arabidopsis lyrata subsp. 
lyrata]
Length=453

 Score =   256 bits (654),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 123/148 (83%), Positives = 136/148 (92%), Gaps = 0/148 (0%)
 Frame = +2

Query  290  KSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYV  469
            KS  R+ M   V  SRFEGI+MAPPDPILGVSEAFKADT+EMKLNLGVGAYRTEELQPYV
Sbjct  37   KSFSRVTMTVAVKPSRFEGITMAPPDPILGVSEAFKADTNEMKLNLGVGAYRTEELQPYV  96

Query  470  LDVVKKAENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTG  649
            L+VVKKAENLML+RG+NKEYLPIEGLAAFNK TAELLFGA + VI+++RVAT+QGLSGTG
Sbjct  97   LNVVKKAENLMLERGDNKEYLPIEGLAAFNKATAELLFGAGHPVIKEQRVATIQGLSGTG  156

Query  650  SLRLAAALIERYFPGSKVLISSPTWGLH  733
            SLRLAAALIERYFPG+KV+ISSPTWG H
Sbjct  157  SLRLAAALIERYFPGAKVVISSPTWGNH  184



>ref|XP_010437971.1| PREDICTED: aspartate aminotransferase, chloroplastic [Camelina 
sativa]
 ref|XP_010437972.1| PREDICTED: aspartate aminotransferase, chloroplastic [Camelina 
sativa]
Length=453

 Score =   256 bits (653),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 123/148 (83%), Positives = 136/148 (92%), Gaps = 0/148 (0%)
 Frame = +2

Query  290  KSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYV  469
            KS  R+ M   V  SRFEGI+MAPPDPILGVSEAFKADT+EMKLNLGVGAYRTEELQPYV
Sbjct  37   KSFSRVTMTVAVKPSRFEGITMAPPDPILGVSEAFKADTNEMKLNLGVGAYRTEELQPYV  96

Query  470  LDVVKKAENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTG  649
            L+VVKKAENLML+RG+NKEYLPIEGLAAFNK TAELLFGA + VI+++RVAT+QGLSGTG
Sbjct  97   LNVVKKAENLMLERGDNKEYLPIEGLAAFNKATAELLFGAGHPVIKEQRVATIQGLSGTG  156

Query  650  SLRLAAALIERYFPGSKVLISSPTWGLH  733
            SLRLAAALIERYFPG+KV+ISSPTWG H
Sbjct  157  SLRLAAALIERYFPGAKVVISSPTWGNH  184



>ref|XP_009407084.1| PREDICTED: aspartate aminotransferase, chloroplastic [Musa acuminata 
subsp. malaccensis]
Length=425

 Score =   255 bits (651),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 120/144 (83%), Positives = 134/144 (93%), Gaps = 0/144 (0%)
 Frame = +2

Query  302  RMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVV  481
            R+ M  +VNVSRFEG++MAPPDPILGVSEAF+ADT+++KLNLGVGAYRTEELQPYVL+VV
Sbjct  13   RVSMTVSVNVSRFEGVTMAPPDPILGVSEAFRADTNDLKLNLGVGAYRTEELQPYVLNVV  72

Query  482  KKAENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRL  661
            KKAE LML+RGENKEYLPIEGLAAFNKVTAELLFGADN VIQ+ RVAT+QGLSGTGSLRL
Sbjct  73   KKAEKLMLERGENKEYLPIEGLAAFNKVTAELLFGADNSVIQEGRVATIQGLSGTGSLRL  132

Query  662  AAALIERYFPGSKVLISSPTWGLH  733
            AAA I+RYFP +K LISSPTWG H
Sbjct  133  AAAFIQRYFPDAKALISSPTWGNH  156



>ref|XP_006848765.1| hypothetical protein AMTR_s00026p00065580 [Amborella trichopoda]
 gb|ERN10346.1| hypothetical protein AMTR_s00026p00065580 [Amborella trichopoda]
Length=469

 Score =   256 bits (653),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 121/148 (82%), Positives = 135/148 (91%), Gaps = 0/148 (0%)
 Frame = +2

Query  290  KSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYV  469
            ++ G + M   VNVSRFEG++MAPPDPILGVSEAFKADT+ MKLNLGVGAYRTEELQPYV
Sbjct  53   QNSGGVTMTVAVNVSRFEGVTMAPPDPILGVSEAFKADTNSMKLNLGVGAYRTEELQPYV  112

Query  470  LDVVKKAENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTG  649
            L+VVKKAENLML+RG+NKEYLPIEGLAAFN+ TAELL GADN VI+Q+RVATVQGLSGTG
Sbjct  113  LNVVKKAENLMLERGDNKEYLPIEGLAAFNRATAELLLGADNPVIKQERVATVQGLSGTG  172

Query  650  SLRLAAALIERYFPGSKVLISSPTWGLH  733
            SLRLAAA I+RYFP +KVLISSPTWG H
Sbjct  173  SLRLAAAFIQRYFPDAKVLISSPTWGNH  200



>emb|CDY13467.1| BnaA03g51850D [Brassica napus]
Length=454

 Score =   255 bits (652),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 134/190 (71%), Positives = 154/190 (81%), Gaps = 6/190 (3%)
 Frame = +2

Query  164  MASTVFTlasaspsvslslQDKLKAKPKLREYGQCTLFGNATKSHGRMRMVATVNVSRFE  343
            MAS++ +L S S       +DKLK  P     G        TKS  R+ M  +V  SRFE
Sbjct  1    MASSMLSLGSTSLLPREINKDKLKLGPS----GSNPFL--RTKSLSRVTMSVSVKPSRFE  54

Query  344  GISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENK  523
            GI+MAPPDPILGVSEAFKADT+E+KLNLGVGAYRTEELQPYVL+VVKKAENLML+RG+NK
Sbjct  55   GITMAPPDPILGVSEAFKADTNELKLNLGVGAYRTEELQPYVLNVVKKAENLMLERGDNK  114

Query  524  EYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFPGSKV  703
            EYLPIEGLAAFNK TAELLFGA + VI++++VAT+QGLSGTGSLRLAAALIERYFPG+KV
Sbjct  115  EYLPIEGLAAFNKATAELLFGAGHPVIKEQKVATIQGLSGTGSLRLAAALIERYFPGAKV  174

Query  704  LISSPTWGLH  733
            LIS+PTWG H
Sbjct  175  LISAPTWGNH  184



>ref|XP_009138057.1| PREDICTED: aspartate aminotransferase, chloroplastic-like [Brassica 
rapa]
Length=453

 Score =   255 bits (651),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 133/190 (70%), Positives = 153/190 (81%), Gaps = 6/190 (3%)
 Frame = +2

Query  164  MASTVFTlasaspsvslslQDKLKAKPKLREYGQCTLFGNATKSHGRMRMVATVNVSRFE  343
            MAS++ +L   S       +DKLK  P     G        TKS  R+ M  +V  SRFE
Sbjct  1    MASSMLSLGWTSLLPREINKDKLKLGPS----GSNPFL--RTKSLSRVTMSVSVKPSRFE  54

Query  344  GISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENK  523
            GI+MAPPDPILGVSEAFKADT+E+KLNLGVGAYRTEELQPYVL+VVKKAENLML+RG+NK
Sbjct  55   GITMAPPDPILGVSEAFKADTNELKLNLGVGAYRTEELQPYVLNVVKKAENLMLERGDNK  114

Query  524  EYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFPGSKV  703
            EYLPIEGLAAFNK TAELLFGA + VI++++VAT+QGLSGTGSLRLAAALIERYFPG+KV
Sbjct  115  EYLPIEGLAAFNKATAELLFGAGHPVIKEQKVATIQGLSGTGSLRLAAALIERYFPGAKV  174

Query  704  LISSPTWGLH  733
            LIS+PTWG H
Sbjct  175  LISAPTWGNH  184



>ref|XP_010447459.1| PREDICTED: aspartate aminotransferase, chloroplastic-like [Camelina 
sativa]
Length=453

 Score =   255 bits (651),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 123/148 (83%), Positives = 136/148 (92%), Gaps = 0/148 (0%)
 Frame = +2

Query  290  KSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYV  469
            KS  R+ M   V  SRFEGI+MAPPDPILGVSEAFKADT+EMKLNLGVGAYRTEELQPYV
Sbjct  37   KSISRVTMTVAVKPSRFEGITMAPPDPILGVSEAFKADTNEMKLNLGVGAYRTEELQPYV  96

Query  470  LDVVKKAENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTG  649
            L+VVKKAENLML+RG+NKEYLPIEGLAAFNK TAELLFGA + VI+++RVAT+QGLSGTG
Sbjct  97   LNVVKKAENLMLERGDNKEYLPIEGLAAFNKATAELLFGAGHPVIKEQRVATIQGLSGTG  156

Query  650  SLRLAAALIERYFPGSKVLISSPTWGLH  733
            SLRLAAALIERYFPG+KV+ISSPTWG H
Sbjct  157  SLRLAAALIERYFPGAKVVISSPTWGNH  184



>emb|CDX72339.1| BnaC07g43610D [Brassica napus]
Length=461

 Score =   255 bits (652),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 134/190 (71%), Positives = 154/190 (81%), Gaps = 6/190 (3%)
 Frame = +2

Query  164  MASTVFTlasaspsvslslQDKLKAKPKLREYGQCTLFGNATKSHGRMRMVATVNVSRFE  343
            MAS++ +L S S       +DKLK  P     G        TKS  R+ M  +V  SRFE
Sbjct  1    MASSMLSLGSTSLLPREINKDKLKLGPS----GSNPFL--RTKSLSRVTMSVSVKPSRFE  54

Query  344  GISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENK  523
            GI+MAPPDPILGVSEAFKADT+E+KLNLGVGAYRTEELQPYVL+VVKKAENLML+RG+NK
Sbjct  55   GITMAPPDPILGVSEAFKADTNELKLNLGVGAYRTEELQPYVLNVVKKAENLMLERGDNK  114

Query  524  EYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFPGSKV  703
            EYLPIEGLAAFNK TAELLFGA + VI++++VAT+QGLSGTGSLRLAAALIERYFPG+KV
Sbjct  115  EYLPIEGLAAFNKATAELLFGAGHPVIKEQKVATIQGLSGTGSLRLAAALIERYFPGAKV  174

Query  704  LISSPTWGLH  733
            LIS+PTWG H
Sbjct  175  LISAPTWGNH  184



>ref|XP_010432788.1| PREDICTED: aspartate aminotransferase, chloroplastic-like isoform 
X1 [Camelina sativa]
Length=495

 Score =   256 bits (654),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 141/222 (64%), Positives = 165/222 (74%), Gaps = 22/222 (10%)
 Frame = +2

Query  101  CIAETSPSV-----FLFLQNSPSP-ITMASTVFTlasaspsvslslQDKLK-----AKPK  247
            C A   PS+     F   +  P+P ++MAS++ +L S S       +DKLK     + P 
Sbjct  16   CPALRDPSICRSDRFETARFLPNPALSMASSMLSLGSTSLLPREISKDKLKLGTSGSNPF  75

Query  248  LREYGQCTLFGNATKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNL  427
            L+            KS  R+ M   V  SRFEGI+MAPPDPILGVSEAFKADT+EMKLNL
Sbjct  76   LK-----------AKSFSRVTMTVAVKPSRFEGITMAPPDPILGVSEAFKADTNEMKLNL  124

Query  428  GVGAYRTEELQPYVLDVVKKAENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQ  607
            GVGAYRTEELQPYVL+VVKKAENLML+RG+NKEYLPIEGL AFNK TAELLFGA + VI+
Sbjct  125  GVGAYRTEELQPYVLNVVKKAENLMLERGDNKEYLPIEGLTAFNKATAELLFGAGHPVIK  184

Query  608  QKRVATVQGLSGTGSLRLAAALIERYFPGSKVLISSPTWGLH  733
            ++RVAT+QGLSGTGSLRLAAALIERYFPG+KV+ISSPTWG H
Sbjct  185  EQRVATIQGLSGTGSLRLAAALIERYFPGAKVVISSPTWGNH  226



>ref|XP_006283713.1| hypothetical protein CARUB_v10004783mg [Capsella rubella]
 gb|EOA16611.1| hypothetical protein CARUB_v10004783mg [Capsella rubella]
Length=453

 Score =   254 bits (650),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 122/148 (82%), Positives = 136/148 (92%), Gaps = 0/148 (0%)
 Frame = +2

Query  290  KSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYV  469
            KS  R+ M   V  SRFEGI+MAPPDPILGVSEAFKADT+EMKLNLGVGAYRTEELQPYV
Sbjct  37   KSFSRVTMAVAVTPSRFEGITMAPPDPILGVSEAFKADTNEMKLNLGVGAYRTEELQPYV  96

Query  470  LDVVKKAENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTG  649
            L+VVKKAENLML+RG+NKEYLPIEGLAAFNK TAELLFGA + VI+++RVAT+QGLSGTG
Sbjct  97   LNVVKKAENLMLERGDNKEYLPIEGLAAFNKATAELLFGAGHPVIKEQRVATIQGLSGTG  156

Query  650  SLRLAAALIERYFPGSKVLISSPTWGLH  733
            SLR+AAALIERYFPG+KV+ISSPTWG H
Sbjct  157  SLRVAAALIERYFPGAKVVISSPTWGNH  184



>ref|XP_010432789.1| PREDICTED: aspartate aminotransferase, chloroplastic-like isoform 
X2 [Camelina sativa]
Length=453

 Score =   254 bits (649),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 122/148 (82%), Positives = 135/148 (91%), Gaps = 0/148 (0%)
 Frame = +2

Query  290  KSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYV  469
            KS  R+ M   V  SRFEGI+MAPPDPILGVSEAFKADT+EMKLNLGVGAYRTEELQPYV
Sbjct  37   KSFSRVTMTVAVKPSRFEGITMAPPDPILGVSEAFKADTNEMKLNLGVGAYRTEELQPYV  96

Query  470  LDVVKKAENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTG  649
            L+VVKKAENLML+RG+NKEYLPIEGL AFNK TAELLFGA + VI+++RVAT+QGLSGTG
Sbjct  97   LNVVKKAENLMLERGDNKEYLPIEGLTAFNKATAELLFGAGHPVIKEQRVATIQGLSGTG  156

Query  650  SLRLAAALIERYFPGSKVLISSPTWGLH  733
            SLRLAAALIERYFPG+KV+ISSPTWG H
Sbjct  157  SLRLAAALIERYFPGAKVVISSPTWGNH  184



>ref|XP_009126483.1| PREDICTED: aspartate aminotransferase, chloroplastic [Brassica 
rapa]
Length=462

 Score =   254 bits (649),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 122/148 (82%), Positives = 137/148 (93%), Gaps = 0/148 (0%)
 Frame = +2

Query  290  KSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYV  469
            KS  R+ M  TV  SRFEGI+MAPPDPILGVSEAFKADT+E+KLNLGVGAYRTEELQPYV
Sbjct  37   KSFSRVTMSVTVKPSRFEGITMAPPDPILGVSEAFKADTNELKLNLGVGAYRTEELQPYV  96

Query  470  LDVVKKAENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTG  649
            L+VVKKAENLML+RG+NKEYLPIEGLAAFNK TAELLFGA + VI++++VAT+QGLSGTG
Sbjct  97   LNVVKKAENLMLERGDNKEYLPIEGLAAFNKATAELLFGAGHPVIKEQKVATIQGLSGTG  156

Query  650  SLRLAAALIERYFPGSKVLISSPTWGLH  733
            SLRLAAALIERYFPG+KVLIS+PTWG H
Sbjct  157  SLRLAAALIERYFPGAKVLISAPTWGNH  184



>emb|CDX75211.1| BnaA01g04910D [Brassica napus]
Length=462

 Score =   254 bits (649),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 122/148 (82%), Positives = 137/148 (93%), Gaps = 0/148 (0%)
 Frame = +2

Query  290  KSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYV  469
            KS  R+ M  TV  SRFEGI+MAPPDPILGVSEAFKADT+E+KLNLGVGAYRTEELQPYV
Sbjct  37   KSFSRVTMSVTVKPSRFEGITMAPPDPILGVSEAFKADTNELKLNLGVGAYRTEELQPYV  96

Query  470  LDVVKKAENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTG  649
            L+VVKKAENLML+RG+NKEYLPIEGLAAFNK TAELLFGA + VI++++VAT+QGLSGTG
Sbjct  97   LNVVKKAENLMLERGDNKEYLPIEGLAAFNKATAELLFGAGHPVIKEQKVATIQGLSGTG  156

Query  650  SLRLAAALIERYFPGSKVLISSPTWGLH  733
            SLRLAAALIERYFPG+KVLIS+PTWG H
Sbjct  157  SLRLAAALIERYFPGAKVLISAPTWGNH  184



>ref|XP_008784801.1| PREDICTED: aspartate aminotransferase, chloroplastic-like [Phoenix 
dactylifera]
Length=454

 Score =   253 bits (647),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 121/148 (82%), Positives = 135/148 (91%), Gaps = 0/148 (0%)
 Frame = +2

Query  290  KSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYV  469
            K+ GR+ +   VNVSRFE ++MAPPDPILGVSEAFKADT ++KLNLGVGAYRTEELQPYV
Sbjct  38   KAFGRVSLAVAVNVSRFESVTMAPPDPILGVSEAFKADTSDVKLNLGVGAYRTEELQPYV  97

Query  470  LDVVKKAENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTG  649
            L+VV+KAENLML+RGENKEYLPIEGLAAFNKVTA+LLFGA+N VIQQ RVATVQ LSGTG
Sbjct  98   LNVVRKAENLMLERGENKEYLPIEGLAAFNKVTADLLFGANNPVIQQGRVATVQSLSGTG  157

Query  650  SLRLAAALIERYFPGSKVLISSPTWGLH  733
            SLRLAAA I+RYFP +KVLISSPTWG H
Sbjct  158  SLRLAAAFIQRYFPDAKVLISSPTWGNH  185



>ref|XP_010942149.1| PREDICTED: aspartate aminotransferase, chloroplastic isoform 
X1 [Elaeis guineensis]
Length=454

 Score =   253 bits (647),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 120/148 (81%), Positives = 136/148 (92%), Gaps = 0/148 (0%)
 Frame = +2

Query  290  KSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYV  469
            K+ GR+RM   VNVSRFE ++MAPPDPILGVSEAFKADT ++KLNLGVGAYRTEELQPYV
Sbjct  38   KAFGRVRMAVAVNVSRFESVTMAPPDPILGVSEAFKADTSDVKLNLGVGAYRTEELQPYV  97

Query  470  LDVVKKAENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTG  649
            L+VV+KAENLML+RGENKEYLPIEGLAAFNKVTA+LLFGA+N V+Q+ +VATVQ LSGTG
Sbjct  98   LNVVRKAENLMLERGENKEYLPIEGLAAFNKVTADLLFGANNIVVQEGKVATVQSLSGTG  157

Query  650  SLRLAAALIERYFPGSKVLISSPTWGLH  733
            SLRLAAA I+RYFP +KVLISSPTWG H
Sbjct  158  SLRLAAAFIQRYFPDAKVLISSPTWGNH  185



>ref|XP_006412529.1| hypothetical protein EUTSA_v10025142mg [Eutrema salsugineum]
 ref|XP_006412531.1| hypothetical protein EUTSA_v10025142mg [Eutrema salsugineum]
 ref|XP_006412532.1| hypothetical protein EUTSA_v10025142mg [Eutrema salsugineum]
 gb|ESQ53982.1| hypothetical protein EUTSA_v10025142mg [Eutrema salsugineum]
 gb|ESQ53984.1| hypothetical protein EUTSA_v10025142mg [Eutrema salsugineum]
 gb|ESQ53985.1| hypothetical protein EUTSA_v10025142mg [Eutrema salsugineum]
Length=453

 Score =   253 bits (647),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 121/148 (82%), Positives = 136/148 (92%), Gaps = 0/148 (0%)
 Frame = +2

Query  290  KSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYV  469
            KS  R+ M   V  SRFEGI+MAPPDPILGVSEAFKADT+E+KLNLGVGAYRTEELQPYV
Sbjct  37   KSFSRVTMTVAVKPSRFEGITMAPPDPILGVSEAFKADTNELKLNLGVGAYRTEELQPYV  96

Query  470  LDVVKKAENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTG  649
            L+VVKKAENLML+RG+NKEYLPIEGLAAFNK TAELLFGA + VI++++VAT+QGLSGTG
Sbjct  97   LNVVKKAENLMLERGDNKEYLPIEGLAAFNKATAELLFGAGHPVIKEQKVATIQGLSGTG  156

Query  650  SLRLAAALIERYFPGSKVLISSPTWGLH  733
            SLRLAAALIERYFPG+KVLIS+PTWG H
Sbjct  157  SLRLAAALIERYFPGAKVLISAPTWGNH  184



>emb|CAA56932.1| aspartate aminotransferase [Arabidopsis thaliana]
 emb|CAA62972.1| aspartate aminotransferase [Arabidopsis thaliana]
Length=453

 Score =   253 bits (646),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 122/148 (82%), Positives = 135/148 (91%), Gaps = 0/148 (0%)
 Frame = +2

Query  290  KSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYV  469
            KS  R+ M   V  SRFEGI+MAPPDPILGVSEAFKADT+ MKLNLGVGAYRTEELQPYV
Sbjct  37   KSFSRVTMTVAVKPSRFEGITMAPPDPILGVSEAFKADTNGMKLNLGVGAYRTEELQPYV  96

Query  470  LDVVKKAENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTG  649
            L+VVKKAENLML+RG+NKEYLPIEGLAAFNK TAELLFGA + VI+++RVAT+QGLSGTG
Sbjct  97   LNVVKKAENLMLERGDNKEYLPIEGLAAFNKATAELLFGAGHPVIKEQRVATIQGLSGTG  156

Query  650  SLRLAAALIERYFPGSKVLISSPTWGLH  733
            SLRLAAALIERYFPG+KV+ISSPTWG H
Sbjct  157  SLRLAAALIERYFPGAKVVISSPTWGNH  184



>gb|AAM67272.1| aspartate aminotransferase [Arabidopsis thaliana]
Length=453

 Score =   253 bits (646),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 122/148 (82%), Positives = 135/148 (91%), Gaps = 0/148 (0%)
 Frame = +2

Query  290  KSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYV  469
            KS  R+ M   V  SRFEGI+MAPPDPILGVSEAFKADT+ MKLNLGVGAYRTEELQPYV
Sbjct  37   KSFSRVTMTVAVKPSRFEGITMAPPDPILGVSEAFKADTNGMKLNLGVGAYRTEELQPYV  96

Query  470  LDVVKKAENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTG  649
            L+VVKKAENLML+RG+NKEYLPIEGLAAFNK TAELLFGA + VI+++RVAT+QGLSGTG
Sbjct  97   LNVVKKAENLMLERGDNKEYLPIEGLAAFNKATAELLFGAGHPVIKEQRVATIQGLSGTG  156

Query  650  SLRLAAALIERYFPGSKVLISSPTWGLH  733
            SLRLAAALIERYFPG+KV+ISSPTWG H
Sbjct  157  SLRLAAALIERYFPGAKVVISSPTWGNH  184



>ref|NP_194927.1| aspartate aminotransferase [Arabidopsis thaliana]
 ref|NP_849483.1| aspartate aminotransferase [Arabidopsis thaliana]
 sp|P46248.2|AAT5_ARATH RecName: Full=Aspartate aminotransferase, chloroplastic; AltName: 
Full=Transaminase A; Flags: Precursor [Arabidopsis thaliana]
 emb|CAA16590.1| aspartate aminotransferase [Arabidopsis thaliana]
 emb|CAB79917.1| aspartate aminotransferase [Arabidopsis thaliana]
 gb|AAK96851.1| aspartate aminotransferase [Arabidopsis thaliana]
 gb|AAM10068.1| aspartate aminotransferase [Arabidopsis thaliana]
 dbj|BAH19775.1| AT4G31990 [Arabidopsis thaliana]
 gb|AEE85987.1| aspartate aminotransferase [Arabidopsis thaliana]
 gb|AEE85988.1| aspartate aminotransferase [Arabidopsis thaliana]
Length=453

 Score =   253 bits (646),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 122/148 (82%), Positives = 135/148 (91%), Gaps = 0/148 (0%)
 Frame = +2

Query  290  KSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYV  469
            KS  R+ M   V  SRFEGI+MAPPDPILGVSEAFKADT+ MKLNLGVGAYRTEELQPYV
Sbjct  37   KSFSRVTMTVAVKPSRFEGITMAPPDPILGVSEAFKADTNGMKLNLGVGAYRTEELQPYV  96

Query  470  LDVVKKAENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTG  649
            L+VVKKAENLML+RG+NKEYLPIEGLAAFNK TAELLFGA + VI+++RVAT+QGLSGTG
Sbjct  97   LNVVKKAENLMLERGDNKEYLPIEGLAAFNKATAELLFGAGHPVIKEQRVATIQGLSGTG  156

Query  650  SLRLAAALIERYFPGSKVLISSPTWGLH  733
            SLRLAAALIERYFPG+KV+ISSPTWG H
Sbjct  157  SLRLAAALIERYFPGAKVVISSPTWGNH  184



>prf||2009357A Asp aminotransferase
Length=463

 Score =   253 bits (646),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 123/150 (82%), Positives = 133/150 (89%), Gaps = 0/150 (0%)
 Frame = +2

Query  290  KSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYV  469
            +S GR+ M    NVSRFEGI MAPPDPILGVSEAFKADT ++KLNLGVGAYRTEELQPYV
Sbjct  49   RSSGRICMAVATNVSRFEGIPMAPPDPILGVSEAFKADTSDVKLNLGVGAYRTEELQPYV  108

Query  470  LDVVKKAENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTG  649
            L+VVKKAENLML+RGENKEYL IEGLAAFNK TAELL GADN  I+Q RVATVQGLSGTG
Sbjct  109  LNVVKKAENLMLERGENKEYLFIEGLAAFNKATAELLLGADNPAIKQGRVATVQGLSGTG  168

Query  650  SLRLAAALIERYFPGSKVLISSPTWGLHHS  739
            SLRL AALIERYFPG+KVLIS+PTWG H +
Sbjct  169  SLRLGAALIERYFPGAKVLISNPTWGNHRN  198



>ref|XP_006412530.1| hypothetical protein EUTSA_v10025142mg [Eutrema salsugineum]
 gb|ESQ53983.1| hypothetical protein EUTSA_v10025142mg [Eutrema salsugineum]
Length=462

 Score =   253 bits (645),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 121/148 (82%), Positives = 136/148 (92%), Gaps = 0/148 (0%)
 Frame = +2

Query  290  KSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYV  469
            KS  R+ M   V  SRFEGI+MAPPDPILGVSEAFKADT+E+KLNLGVGAYRTEELQPYV
Sbjct  37   KSFSRVTMTVAVKPSRFEGITMAPPDPILGVSEAFKADTNELKLNLGVGAYRTEELQPYV  96

Query  470  LDVVKKAENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTG  649
            L+VVKKAENLML+RG+NKEYLPIEGLAAFNK TAELLFGA + VI++++VAT+QGLSGTG
Sbjct  97   LNVVKKAENLMLERGDNKEYLPIEGLAAFNKATAELLFGAGHPVIKEQKVATIQGLSGTG  156

Query  650  SLRLAAALIERYFPGSKVLISSPTWGLH  733
            SLRLAAALIERYFPG+KVLIS+PTWG H
Sbjct  157  SLRLAAALIERYFPGAKVLISAPTWGNH  184



>ref|NP_001031767.1| aspartate aminotransferase [Arabidopsis thaliana]
 dbj|BAH19688.1| AT4G31990 [Arabidopsis thaliana]
 gb|AEE85989.1| aspartate aminotransferase [Arabidopsis thaliana]
Length=462

 Score =   253 bits (645),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 122/148 (82%), Positives = 135/148 (91%), Gaps = 0/148 (0%)
 Frame = +2

Query  290  KSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYV  469
            KS  R+ M   V  SRFEGI+MAPPDPILGVSEAFKADT+ MKLNLGVGAYRTEELQPYV
Sbjct  37   KSFSRVTMTVAVKPSRFEGITMAPPDPILGVSEAFKADTNGMKLNLGVGAYRTEELQPYV  96

Query  470  LDVVKKAENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTG  649
            L+VVKKAENLML+RG+NKEYLPIEGLAAFNK TAELLFGA + VI+++RVAT+QGLSGTG
Sbjct  97   LNVVKKAENLMLERGDNKEYLPIEGLAAFNKATAELLFGAGHPVIKEQRVATIQGLSGTG  156

Query  650  SLRLAAALIERYFPGSKVLISSPTWGLH  733
            SLRLAAALIERYFPG+KV+ISSPTWG H
Sbjct  157  SLRLAAALIERYFPGAKVVISSPTWGNH  184



>gb|AAC12674.1| aspartate aminotransferase [Lotus corniculatus]
Length=457

 Score =   251 bits (642),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 121/145 (83%), Positives = 129/145 (89%), Gaps = 0/145 (0%)
 Frame = +2

Query  299  GRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDV  478
            GR+ M   VN SRFEGI MAPPDPILGVSEAFKAD  ++KLNLGVGAYRTEELQPYVL+V
Sbjct  44   GRISMAVAVNASRFEGIPMAPPDPILGVSEAFKADKCDLKLNLGVGAYRTEELQPYVLNV  103

Query  479  VKKAENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLR  658
            VKKAENLML RGENKEYLPIEG AAFNK TAELL GADN  I+++RVATVQGLSGTGSLR
Sbjct  104  VKKAENLMLNRGENKEYLPIEGWAAFNKATAELLLGADNPAIKEQRVATVQGLSGTGSLR  163

Query  659  LAAALIERYFPGSKVLISSPTWGLH  733
             AAALIERYFPG+KVLISSPTWG H
Sbjct  164  HAAALIERYFPGAKVLISSPTWGNH  188



>gb|AAB26677.2| aspartate aminotransferase isozyme 5 (chloroplast) [Glycine max]
Length=463

 Score =   251 bits (641),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 120/141 (85%), Positives = 129/141 (91%), Gaps = 0/141 (0%)
 Frame = +2

Query  311  MVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKA  490
            M   VNVSRFEGI MAPPDPILGVSEAFKAD  ++KLNLGVGAYRTEELQPYVL+VVKKA
Sbjct  54   MAVAVNVSRFEGIPMAPPDPILGVSEAFKADNSDVKLNLGVGAYRTEELQPYVLNVVKKA  113

Query  491  ENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAA  670
            ENLML+RG+NKEYLPIEGLAAFNK TAELL GADN  I+Q+RVATVQGLSGTGSLRL AA
Sbjct  114  ENLMLERGDNKEYLPIEGLAAFNKATAELLLGADNPAIKQQRVATVQGLSGTGSLRLGAA  173

Query  671  LIERYFPGSKVLISSPTWGLH  733
            LIERYFPG+KVLIS+PTWG H
Sbjct  174  LIERYFPGAKVLISAPTWGNH  194



>emb|CDJ26231.1| putative aspartate aminotransferase [Brassica oleracea]
Length=453

 Score =   251 bits (640),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 120/148 (81%), Positives = 135/148 (91%), Gaps = 0/148 (0%)
 Frame = +2

Query  290  KSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYV  469
            K   R+ M   V  SRFEGI+MAPPDPILGVSEAFKADT+E+KLNLGVGAYRTEELQPYV
Sbjct  37   KCFSRVTMSVAVKPSRFEGITMAPPDPILGVSEAFKADTNELKLNLGVGAYRTEELQPYV  96

Query  470  LDVVKKAENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTG  649
            L+VVKKAENLML+RG+NKEYLPIEGLAAFNK TAELLFGA + VI++++VAT+QGLSGTG
Sbjct  97   LNVVKKAENLMLERGDNKEYLPIEGLAAFNKATAELLFGAGHPVIKEQKVATIQGLSGTG  156

Query  650  SLRLAAALIERYFPGSKVLISSPTWGLH  733
            SLRLAAALIERYFPG+KVLIS+PTWG H
Sbjct  157  SLRLAAALIERYFPGAKVLISAPTWGNH  184



>gb|ACU24502.1| unknown [Glycine max]
Length=463

 Score =   251 bits (640),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 120/141 (85%), Positives = 129/141 (91%), Gaps = 0/141 (0%)
 Frame = +2

Query  311  MVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKA  490
            M   VNVSRFEGI MAPPDPILGVSEAFKAD  ++KLNLGVGAYRTEELQPYVL+VVKKA
Sbjct  54   MAVAVNVSRFEGIPMAPPDPILGVSEAFKADNSDVKLNLGVGAYRTEELQPYVLNVVKKA  113

Query  491  ENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAA  670
            ENLML+RG+NKEYLPIEGLAAFNK TAELL GADN  I+Q+RVATVQGLSGTGSLRL AA
Sbjct  114  ENLMLERGDNKEYLPIEGLAAFNKATAELLLGADNPAIKQQRVATVQGLSGTGSLRLGAA  173

Query  671  LIERYFPGSKVLISSPTWGLH  733
            LIERYFPG+KVLIS+PTWG H
Sbjct  174  LIERYFPGAKVLISAPTWGNH  194



>ref|NP_001237987.1| aspartate aminotransferase [Glycine max]
 gb|AAA33942.1| aspartate aminotransferase [Glycine max]
Length=463

 Score =   251 bits (640),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 120/141 (85%), Positives = 129/141 (91%), Gaps = 0/141 (0%)
 Frame = +2

Query  311  MVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKA  490
            M   VNVSRFEGI MAPPDPILGVSEAFKAD  ++KLNLGVGAYRTEELQPYVL+VVKKA
Sbjct  54   MAVAVNVSRFEGIPMAPPDPILGVSEAFKADNSDVKLNLGVGAYRTEELQPYVLNVVKKA  113

Query  491  ENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAA  670
            ENLML+RG+NKEYLPIEGLAAFNK TAELL GADN  I+Q+RVATVQGLSGTGSLRL AA
Sbjct  114  ENLMLERGDNKEYLPIEGLAAFNKATAELLLGADNPAIKQQRVATVQGLSGTGSLRLGAA  173

Query  671  LIERYFPGSKVLISSPTWGLH  733
            LIERYFPG+KVLIS+PTWG H
Sbjct  174  LIERYFPGAKVLISAPTWGNH  194



>gb|KHN22516.1| Aspartate aminotransferase P2, mitochondrial [Glycine soja]
Length=463

 Score =   251 bits (640),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 120/141 (85%), Positives = 129/141 (91%), Gaps = 0/141 (0%)
 Frame = +2

Query  311  MVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKA  490
            M   VNVSRFEGI MAPPDPILGVSEAFKAD  ++KLNLGVGAYRTEELQPYVL+VVKKA
Sbjct  54   MAVAVNVSRFEGIPMAPPDPILGVSEAFKADNSDVKLNLGVGAYRTEELQPYVLNVVKKA  113

Query  491  ENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAA  670
            ENLML+RG+NKEYLPIEGLAAFNK TAELL GADN  I+Q+RVATVQGLSGTGSLRL AA
Sbjct  114  ENLMLERGDNKEYLPIEGLAAFNKATAELLLGADNPAIKQQRVATVQGLSGTGSLRLGAA  173

Query  671  LIERYFPGSKVLISSPTWGLH  733
            LIERYFPG+KVLIS+PTWG H
Sbjct  174  LIERYFPGAKVLISAPTWGNH  194



>ref|XP_006600243.1| PREDICTED: aspartate aminotransferase isoform X1 [Glycine max]
Length=463

 Score =   251 bits (640),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 120/141 (85%), Positives = 129/141 (91%), Gaps = 0/141 (0%)
 Frame = +2

Query  311  MVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKA  490
            M   VNVSRFEGI MAPPDPILGVSEAFKAD  ++KLNLGVGAYRTEELQPYVL+VVKKA
Sbjct  54   MAVAVNVSRFEGIPMAPPDPILGVSEAFKADNSDVKLNLGVGAYRTEELQPYVLNVVKKA  113

Query  491  ENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAA  670
            ENLML+RG+NKEYLPIEGLAAFNK TAELL GADN  I+Q+RVATVQGLSGTGSLRL AA
Sbjct  114  ENLMLERGDNKEYLPIEGLAAFNKATAELLLGADNPAIKQQRVATVQGLSGTGSLRLGAA  173

Query  671  LIERYFPGSKVLISSPTWGLH  733
            LIERYFPG+KVLIS+PTWG H
Sbjct  174  LIERYFPGAKVLISAPTWGNH  194



>emb|CDX68807.1| BnaC01g06460D [Brassica napus]
Length=513

 Score =   251 bits (642),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 132/196 (67%), Positives = 154/196 (79%), Gaps = 16/196 (8%)
 Frame = +2

Query  161  TMASTVFTlasaspsvslslQDKLK-----AKPKLREYGQCTLFGNATKSHGRMRMVATV  325
            +MAS++ +L S S       +DKLK     + P L+            K   R+ M   V
Sbjct  51   SMASSMLSLGSTSLLPREINKDKLKLGTSGSNPFLK-----------AKCFSRVTMSVAV  99

Query  326  NVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLML  505
              SRFEGI+MAPPDPILGVSEAFKADT+E+KLNLGVGAYRTEELQPYVL+VVKKAENLML
Sbjct  100  KPSRFEGITMAPPDPILGVSEAFKADTNELKLNLGVGAYRTEELQPYVLNVVKKAENLML  159

Query  506  QRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERY  685
            +RG+NKEYLPIEGLAAFNK TAELLFGA + VI++++VAT+QGLSGTGSLRLAAALIERY
Sbjct  160  ERGDNKEYLPIEGLAAFNKATAELLFGAGHPVIKEQKVATIQGLSGTGSLRLAAALIERY  219

Query  686  FPGSKVLISSPTWGLH  733
            FPG+KVLIS+PTWG H
Sbjct  220  FPGAKVLISAPTWGNH  235



>gb|AAN76499.1|AF315376_1 aspartate aminotransferase [Phaseolus vulgaris]
Length=461

 Score =   250 bits (638),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 130/170 (76%), Positives = 142/170 (84%), Gaps = 6/170 (4%)
 Frame = +2

Query  233  KAKPKLREYGQCTLFGNA---TKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKAD  403
            K KPK+   G    F  +    +S GR+  VA VN SRFEGI MAPPDPILGVSEAFKAD
Sbjct  26   KGKPKIG--GNALRFNKSFPNARSSGRVMAVA-VNGSRFEGIPMAPPDPILGVSEAFKAD  82

Query  404  TDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENKEYLPIEGLAAFNKVTAELLF  583
            T ++KLNLGVGAYRTEELQPYVL+VVKKAENLML+RG+NKEYL IEGLAAFNK TAELL 
Sbjct  83   TSDVKLNLGVGAYRTEELQPYVLNVVKKAENLMLERGDNKEYLSIEGLAAFNKATAELLL  142

Query  584  GADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFPGSKVLISSPTWGLH  733
            GADN  I+Q+RVATVQGLSGTGSLRLAAALIERYF G+KVLISSPTWG H
Sbjct  143  GADNPAIKQQRVATVQGLSGTGSLRLAAALIERYFAGAKVLISSPTWGNH  192



>ref|NP_001048397.1| Os02g0797500 [Oryza sativa Japonica Group]
 dbj|BAD19094.1| putative aspartate transaminase [Oryza sativa Japonica Group]
 dbj|BAF10311.1| Os02g0797500 [Oryza sativa Japonica Group]
 dbj|BAG97085.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC74177.1| hypothetical protein OsI_09291 [Oryza sativa Indica Group]
 gb|EEE57981.1| hypothetical protein OsJ_08730 [Oryza sativa Japonica Group]
Length=458

 Score =   247 bits (631),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 121/156 (78%), Positives = 136/156 (87%), Gaps = 1/156 (1%)
 Frame = +2

Query  266  CTLFGNATKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYR  445
            C L G   K+ GR+ M   V+VSRFEG+ MAPPDPILGVSEAFKAD +++KLNLGVGAYR
Sbjct  35   CRL-GITRKNFGRVMMALAVDVSRFEGVPMAPPDPILGVSEAFKADQNDLKLNLGVGAYR  93

Query  446  TEELQPYVLDVVKKAENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVAT  625
            TEELQPYVL+VVKKAE LML++GENKEYLPIEGLAAFNK TAELLFGADN V++Q RVAT
Sbjct  94   TEELQPYVLNVVKKAETLMLEKGENKEYLPIEGLAAFNKATAELLFGADNPVLKQGRVAT  153

Query  626  VQGLSGTGSLRLAAALIERYFPGSKVLISSPTWGLH  733
            +Q LSGTGSLRLAAA I+RYFP +KVLISSPTWG H
Sbjct  154  LQSLSGTGSLRLAAAFIQRYFPEAKVLISSPTWGNH  189



>ref|XP_003544600.1| PREDICTED: aspartate aminotransferase P2, mitochondrial-like 
isoform X1 [Glycine max]
 ref|XP_006596081.1| PREDICTED: aspartate aminotransferase P2, mitochondrial-like 
isoform X2 [Glycine max]
 gb|KHN04158.1| Aspartate aminotransferase P2, mitochondrial [Glycine soja]
Length=463

 Score =   247 bits (631),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 136/194 (70%), Positives = 156/194 (80%), Gaps = 4/194 (2%)
 Frame = +2

Query  164  MASTVFTlasaspsvslslQDKLKAKPKLRE----YGQCTLFGNATKSHGRMRMVATVNV  331
            MAS+V + AS S S S SL    K KP +R+    + +     ++++S GR+ M   VNV
Sbjct  1    MASSVLSAASHSVSPSCSLSTTHKGKPMIRDNTLGFHRGPNSFSSSRSRGRISMAVAVNV  60

Query  332  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  511
            SRFEGI MAPPDPILGVSEAFK D  ++KLNLGVGAYRTEELQPYVL+VVKKAENLML+R
Sbjct  61   SRFEGIPMAPPDPILGVSEAFKVDNSDVKLNLGVGAYRTEELQPYVLNVVKKAENLMLER  120

Query  512  GENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFP  691
            G+NKEYLPIEG AAFNK TAELL GADN  I+Q+RVATVQGLSGTGSLRL AALIERYFP
Sbjct  121  GDNKEYLPIEGSAAFNKATAELLLGADNPAIKQQRVATVQGLSGTGSLRLGAALIERYFP  180

Query  692  GSKVLISSPTWGLH  733
            G+KVLIS+PTWG H
Sbjct  181  GAKVLISAPTWGNH  194



>ref|NP_001190885.1| aspartate aminotransferase [Arabidopsis thaliana]
 gb|AEE85990.1| aspartate aminotransferase [Arabidopsis thaliana]
Length=448

 Score =   246 bits (627),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 117/134 (87%), Positives = 129/134 (96%), Gaps = 0/134 (0%)
 Frame = +2

Query  332  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  511
            SRFEGI+MAPPDPILGVSEAFKADT+ MKLNLGVGAYRTEELQPYVL+VVKKAENLML+R
Sbjct  46   SRFEGITMAPPDPILGVSEAFKADTNGMKLNLGVGAYRTEELQPYVLNVVKKAENLMLER  105

Query  512  GENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFP  691
            G+NKEYLPIEGLAAFNK TAELLFGA + VI+++RVAT+QGLSGTGSLRLAAALIERYFP
Sbjct  106  GDNKEYLPIEGLAAFNKATAELLFGAGHPVIKEQRVATIQGLSGTGSLRLAAALIERYFP  165

Query  692  GSKVLISSPTWGLH  733
            G+KV+ISSPTWG H
Sbjct  166  GAKVVISSPTWGNH  179



>gb|AAO23563.1| aspartate aminotransferase [Oryza sativa]
Length=414

 Score =   244 bits (624),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 117/145 (81%), Positives = 131/145 (90%), Gaps = 0/145 (0%)
 Frame = +2

Query  299  GRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDV  478
            GR+ M   V+VSRFEG+ MAPPDPILGVSEAFKAD +++KLNLGVGAYRTEELQPYVL+V
Sbjct  1    GRVMMALAVDVSRFEGVPMAPPDPILGVSEAFKADQNDLKLNLGVGAYRTEELQPYVLNV  60

Query  479  VKKAENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLR  658
            VKKAE LML++GENKEYLPIEGLAAFNK TAELLFGADN V++Q RVAT+Q LSGTGSLR
Sbjct  61   VKKAETLMLEKGENKEYLPIEGLAAFNKATAELLFGADNPVLKQGRVATLQSLSGTGSLR  120

Query  659  LAAALIERYFPGSKVLISSPTWGLH  733
            LAAA I+RYFP +KVLISSPTWG H
Sbjct  121  LAAAFIQRYFPEAKVLISSPTWGNH  145



>ref|XP_006648055.1| PREDICTED: aspartate aminotransferase, chloroplastic-like [Oryza 
brachyantha]
Length=422

 Score =   244 bits (623),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 119/152 (78%), Positives = 133/152 (88%), Gaps = 0/152 (0%)
 Frame = +2

Query  278  GNATKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEEL  457
            G   K+ GR+ M   V+VSRFE + MAPPDPILGVSEAFKADT ++KLNLGVGAYRTEEL
Sbjct  2    GITRKNFGRVMMALAVDVSRFEIVPMAPPDPILGVSEAFKADTSDLKLNLGVGAYRTEEL  61

Query  458  QPYVLDVVKKAENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGL  637
            QPYVL+VVKKAE LML++GENKEYLPIEGLAAFNK TAELLFGADN V++Q RVAT+Q L
Sbjct  62   QPYVLNVVKKAETLMLEKGENKEYLPIEGLAAFNKATAELLFGADNPVLKQGRVATLQSL  121

Query  638  SGTGSLRLAAALIERYFPGSKVLISSPTWGLH  733
            SGTGSLRLAAA I+RYFP +KVLISSPTWG H
Sbjct  122  SGTGSLRLAAAFIQRYFPEAKVLISSPTWGNH  153



>gb|ACN40845.1| unknown [Picea sitchensis]
Length=453

 Score =   245 bits (626),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 114/146 (78%), Positives = 131/146 (90%), Gaps = 0/146 (0%)
 Frame = +2

Query  302  RMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVV  481
            R+ M    +VSRFEG++MAPPDPILGVSEAFKADT+++KLNLGVGAYRTE+LQPYVL+VV
Sbjct  41   RINMALATDVSRFEGVTMAPPDPILGVSEAFKADTNDLKLNLGVGAYRTEDLQPYVLNVV  100

Query  482  KKAENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRL  661
            KKAEN+ML++GENKEYLPIEGLAAFNK T ELL GADN+  +Q RVATVQGLSGTGSLRL
Sbjct  101  KKAENMMLEKGENKEYLPIEGLAAFNKATVELLLGADNDATKQGRVATVQGLSGTGSLRL  160

Query  662  AAALIERYFPGSKVLISSPTWGLHHS  739
            AAA I+RYFPG +VLISSPTWG H +
Sbjct  161  AAAFIQRYFPGVQVLISSPTWGNHKN  186



>gb|ABK24563.1| unknown [Picea sitchensis]
Length=464

 Score =   245 bits (626),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 114/146 (78%), Positives = 131/146 (90%), Gaps = 0/146 (0%)
 Frame = +2

Query  302  RMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVV  481
            R+ M    +VSRFEG++MAPPDPILGVSEAFKADT+++KLNLGVGAYRTE+LQPYVL+VV
Sbjct  52   RINMALATDVSRFEGVTMAPPDPILGVSEAFKADTNDLKLNLGVGAYRTEDLQPYVLNVV  111

Query  482  KKAENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRL  661
            KKAEN+ML++GENKEYLPIEGLAAFNK T ELL GADN+  +Q RVATVQGLSGTGSLRL
Sbjct  112  KKAENMMLEKGENKEYLPIEGLAAFNKATVELLLGADNDATKQGRVATVQGLSGTGSLRL  171

Query  662  AAALIERYFPGSKVLISSPTWGLHHS  739
            AAA I+RYFPG +VLISSPTWG H +
Sbjct  172  AAAFIQRYFPGVQVLISSPTWGNHKN  197



>gb|ACR34530.1| unknown [Zea mays]
 gb|AFW73875.1| glutamate-oxaloacetate transaminase2 [Zea mays]
Length=459

 Score =   244 bits (624),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 120/154 (78%), Positives = 132/154 (86%), Gaps = 0/154 (0%)
 Frame = +2

Query  278  GNATKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEEL  457
            G   K+ GR+ M   V+VSRFEG+ MAPPDPILGVSEAFKAD  E+KLNLGVGAYRTEEL
Sbjct  39   GITRKNFGRVMMALAVDVSRFEGVPMAPPDPILGVSEAFKADKSELKLNLGVGAYRTEEL  98

Query  458  QPYVLDVVKKAENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGL  637
            QPYVL+VVKKAENLML++GENKEYLPIEGLAAFNK TAELL GADN VI Q  VAT+Q L
Sbjct  99   QPYVLNVVKKAENLMLEKGENKEYLPIEGLAAFNKATAELLLGADNPVINQGLVATLQSL  158

Query  638  SGTGSLRLAAALIERYFPGSKVLISSPTWGLHHS  739
            SGTGSLRLAAA I+RYFP +KVLISSPTWG H +
Sbjct  159  SGTGSLRLAAAFIQRYFPEAKVLISSPTWGNHKN  192



>gb|EYU20220.1| hypothetical protein MIMGU_mgv1a005965mg [Erythranthe guttata]
Length=462

 Score =   244 bits (624),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 123/160 (77%), Positives = 133/160 (83%), Gaps = 3/160 (2%)
 Frame = +2

Query  263  QCTLFGN---ATKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGV  433
            Q T  GN    +KS  R  M   V  S+F  I+MAPPDPILGVSEAF+ADT+EMKLNLGV
Sbjct  34   QMTFLGNDHINSKSFFRTSMSVAVENSKFTDITMAPPDPILGVSEAFRADTNEMKLNLGV  93

Query  434  GAYRTEELQPYVLDVVKKAENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQK  613
            GAYRTE+LQPYVL+VVKKAE LML+  ENKEYLPIEGLAAFNK TAELLFG +N VI Q+
Sbjct  94   GAYRTEDLQPYVLNVVKKAETLMLEWAENKEYLPIEGLAAFNKATAELLFGTENPVILQQ  153

Query  614  RVATVQGLSGTGSLRLAAALIERYFPGSKVLISSPTWGLH  733
            RVATVQGLSGTGSLRLAAALIERYFP SKVLISSPTWG H
Sbjct  154  RVATVQGLSGTGSLRLAAALIERYFPSSKVLISSPTWGNH  193



>ref|NP_001149005.1| aspartate aminotransferase [Zea mays]
 gb|ACG33777.1| aspartate aminotransferase [Zea mays]
Length=459

 Score =   244 bits (624),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 120/154 (78%), Positives = 132/154 (86%), Gaps = 0/154 (0%)
 Frame = +2

Query  278  GNATKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEEL  457
            G   K+ GR+ M   V+VSRFEG+ MAPPDPILGVSEAFKAD  E+KLNLGVGAYRTEEL
Sbjct  39   GITRKNFGRVMMALAVDVSRFEGVPMAPPDPILGVSEAFKADKSELKLNLGVGAYRTEEL  98

Query  458  QPYVLDVVKKAENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGL  637
            QPYVL+VVKKAENLML++GENKEYLPIEGLAAFNK TAELL GADN VI Q  VAT+Q L
Sbjct  99   QPYVLNVVKKAENLMLEKGENKEYLPIEGLAAFNKATAELLLGADNPVINQGLVATLQSL  158

Query  638  SGTGSLRLAAALIERYFPGSKVLISSPTWGLHHS  739
            SGTGSLRLAAA I+RYFP +KVLISSPTWG H +
Sbjct  159  SGTGSLRLAAAFIQRYFPEAKVLISSPTWGNHKN  192



>dbj|BAA08106.1| plastidic aspartate aminotransferase [Panicum miliaceum]
Length=457

 Score =   244 bits (623),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 119/154 (77%), Positives = 134/154 (87%), Gaps = 0/154 (0%)
 Frame = +2

Query  278  GNATKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEEL  457
            G   K+ GR+ M   V+VSRFEG+ MAPPDPILGVSEAFKAD +++KLNLGVGAYRTEEL
Sbjct  37   GITRKNFGRVLMALAVDVSRFEGVPMAPPDPILGVSEAFKADKNDLKLNLGVGAYRTEEL  96

Query  458  QPYVLDVVKKAENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGL  637
            QPYVL+VVKKAENLML++GENKEYLPIEGLAAFNK TAELL GADN VI+Q  VAT+Q L
Sbjct  97   QPYVLNVVKKAENLMLEKGENKEYLPIEGLAAFNKATAELLLGADNPVIKQGLVATLQSL  156

Query  638  SGTGSLRLAAALIERYFPGSKVLISSPTWGLHHS  739
            SGTGSLRLAAA I+RYFP +KVLISSPTWG H +
Sbjct  157  SGTGSLRLAAAFIQRYFPEAKVLISSPTWGNHKN  190



>gb|ABR16448.1| unknown [Picea sitchensis]
Length=410

 Score =   242 bits (617),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 113/141 (80%), Positives = 127/141 (90%), Gaps = 0/141 (0%)
 Frame = +2

Query  311  MVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKA  490
            M    NVSRFEG+ MAPPDPILGVSEAFKADTD++KLNLGVGAYRTE+L+PYVL+VVKKA
Sbjct  1    MAVATNVSRFEGVKMAPPDPILGVSEAFKADTDDLKLNLGVGAYRTEDLRPYVLNVVKKA  60

Query  491  ENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAA  670
            EN+ML++GENKEYLPIEGLAAF K T ELL GADN+V +Q RVATVQGLSGTGSLRL AA
Sbjct  61   ENMMLEKGENKEYLPIEGLAAFIKATVELLLGADNDVTKQGRVATVQGLSGTGSLRLGAA  120

Query  671  LIERYFPGSKVLISSPTWGLH  733
             I+RYFPG++VLISSPTWG H
Sbjct  121  FIQRYFPGTQVLISSPTWGNH  141



>gb|EYU20219.1| hypothetical protein MIMGU_mgv1a005965mg [Erythranthe guttata]
Length=463

 Score =   243 bits (620),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 122/161 (76%), Positives = 133/161 (83%), Gaps = 4/161 (2%)
 Frame = +2

Query  263  QCTLFGN----ATKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLG  430
            Q T  GN    + +S  R  M   V  S+F  I+MAPPDPILGVSEAF+ADT+EMKLNLG
Sbjct  34   QMTFLGNDHINSKQSFFRTSMSVAVENSKFTDITMAPPDPILGVSEAFRADTNEMKLNLG  93

Query  431  VGAYRTEELQPYVLDVVKKAENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQ  610
            VGAYRTE+LQPYVL+VVKKAE LML+  ENKEYLPIEGLAAFNK TAELLFG +N VI Q
Sbjct  94   VGAYRTEDLQPYVLNVVKKAETLMLEWAENKEYLPIEGLAAFNKATAELLFGTENPVILQ  153

Query  611  KRVATVQGLSGTGSLRLAAALIERYFPGSKVLISSPTWGLH  733
            +RVATVQGLSGTGSLRLAAALIERYFP SKVLISSPTWG H
Sbjct  154  QRVATVQGLSGTGSLRLAAALIERYFPSSKVLISSPTWGNH  194



>ref|XP_003570308.1| PREDICTED: aspartate aminotransferase P2, mitochondrial [Brachypodium 
distachyon]
Length=455

 Score =   242 bits (617),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 117/154 (76%), Positives = 135/154 (88%), Gaps = 0/154 (0%)
 Frame = +2

Query  278  GNATKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEEL  457
            G A K+ GR+ M   V+ SRFEG+ MAPPDPILGVSEAF+ADT+++KLNLGVGAYRTEEL
Sbjct  35   GIARKNFGRVVMALAVDTSRFEGVPMAPPDPILGVSEAFRADTNDLKLNLGVGAYRTEEL  94

Query  458  QPYVLDVVKKAENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGL  637
            QP VL+VVKKAENLML++GENKEYLPIEGLAAFNK TA+LL GADN VI+Q +VAT+Q L
Sbjct  95   QPSVLNVVKKAENLMLEKGENKEYLPIEGLAAFNKATADLLLGADNPVIKQGQVATLQSL  154

Query  638  SGTGSLRLAAALIERYFPGSKVLISSPTWGLHHS  739
            SGTGSLRLAAA I+RYFP +KVLISSPTWG H +
Sbjct  155  SGTGSLRLAAAFIQRYFPDAKVLISSPTWGNHKN  188



>dbj|BAJ92741.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=457

 Score =   240 bits (612),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 117/152 (77%), Positives = 131/152 (86%), Gaps = 0/152 (0%)
 Frame = +2

Query  278  GNATKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEEL  457
            G A K+ G + M  TV+ SRFEG+ MAPPDPILGVSEAFKADT ++KLNLGVGAYRTEEL
Sbjct  37   GIARKNTGHIAMALTVHASRFEGVPMAPPDPILGVSEAFKADTSDLKLNLGVGAYRTEEL  96

Query  458  QPYVLDVVKKAENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGL  637
            QP VL+VVKKAE LML++GENKEYLPIEG AAFNK TA+LL GADN VI+Q RVAT+Q L
Sbjct  97   QPAVLNVVKKAEKLMLEKGENKEYLPIEGFAAFNKATADLLLGADNPVIKQGRVATLQSL  156

Query  638  SGTGSLRLAAALIERYFPGSKVLISSPTWGLH  733
            SGTGSLRLAAA I+RYFP +KVLISSPTWG H
Sbjct  157  SGTGSLRLAAAFIQRYFPDAKVLISSPTWGNH  188



>dbj|BAJ96638.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=457

 Score =   240 bits (612),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 117/152 (77%), Positives = 131/152 (86%), Gaps = 0/152 (0%)
 Frame = +2

Query  278  GNATKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEEL  457
            G A K+ G + M  TV+ SRFEG+ MAPPDPILGVSEAFKADT ++KLNLGVGAYRTEEL
Sbjct  37   GIARKNTGHIAMALTVHASRFEGVPMAPPDPILGVSEAFKADTSDLKLNLGVGAYRTEEL  96

Query  458  QPYVLDVVKKAENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGL  637
            QP VL+VVKKAE LML++GENKEYLPIEG AAFNK TA+LL GADN VI+Q RVAT+Q L
Sbjct  97   QPAVLNVVKKAEKLMLEKGENKEYLPIEGFAAFNKATADLLLGADNPVIKQGRVATLQSL  156

Query  638  SGTGSLRLAAALIERYFPGSKVLISSPTWGLH  733
            SGTGSLRLAAA I+RYFP +KVLISSPTWG H
Sbjct  157  SGTGSLRLAAAFIQRYFPDAKVLISSPTWGNH  188



>ref|XP_004954233.1| PREDICTED: aspartate aminotransferase, chloroplastic-like [Setaria 
italica]
Length=458

 Score =   240 bits (612),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 118/152 (78%), Positives = 131/152 (86%), Gaps = 0/152 (0%)
 Frame = +2

Query  278  GNATKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEEL  457
            G   K+ GR+ M   V+VSRFEG+ MAPPDPILGVSEAFKAD  ++KLNLGVGAYRTEEL
Sbjct  38   GITRKNFGRVMMALAVDVSRFEGVPMAPPDPILGVSEAFKADKSDLKLNLGVGAYRTEEL  97

Query  458  QPYVLDVVKKAENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGL  637
            QPYVL+VVKKAENLML++GE KEYLPIEGLAAFNK TAELL GADN VI+Q  VAT+Q L
Sbjct  98   QPYVLNVVKKAENLMLEKGEYKEYLPIEGLAAFNKATAELLLGADNPVIKQGLVATLQSL  157

Query  638  SGTGSLRLAAALIERYFPGSKVLISSPTWGLH  733
            SGTGSLRLAAA I+RYFP +KVLISSPTWG H
Sbjct  158  SGTGSLRLAAAFIQRYFPEAKVLISSPTWGNH  189



>ref|XP_002993397.1| hypothetical protein SELMODRAFT_236735 [Selaginella moellendorffii]
 gb|EFJ05582.1| hypothetical protein SELMODRAFT_236735 [Selaginella moellendorffii]
Length=410

 Score =   238 bits (607),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 116/150 (77%), Positives = 126/150 (84%), Gaps = 0/150 (0%)
 Frame = +2

Query  311  MVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKA  490
            M   V+VSRFE +SMAPPDPILGVSEAFKADTD  KLNLGVGAYRTE+LQPYVL VV KA
Sbjct  1    MAVAVDVSRFENVSMAPPDPILGVSEAFKADTDATKLNLGVGAYRTEDLQPYVLKVVNKA  60

Query  491  ENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAA  670
            E LML+RGENKEYLPIEGLAAFNK TAELL GADN VI+  ++ATVQGLSGTGSLRL AA
Sbjct  61   EQLMLERGENKEYLPIEGLAAFNKATAELLLGADNPVIKNGQIATVQGLSGTGSLRLGAA  120

Query  671  LIERYFPGSKVLISSPTWGLHHSSVVIYGI  760
             I RYFPG KVLISSPTWG H + +   G+
Sbjct  121  FIARYFPGVKVLISSPTWGNHKNILSDVGV  150



>ref|XP_002972976.1| hypothetical protein SELMODRAFT_173087 [Selaginella moellendorffii]
 gb|EFJ26197.1| hypothetical protein SELMODRAFT_173087 [Selaginella moellendorffii]
Length=410

 Score =   238 bits (607),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 116/150 (77%), Positives = 126/150 (84%), Gaps = 0/150 (0%)
 Frame = +2

Query  311  MVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKA  490
            M   V+VSRFE +SMAPPDPILGVSEAFKADTD  KLNLGVGAYRTE+LQPYVL VV KA
Sbjct  1    MAVAVDVSRFENVSMAPPDPILGVSEAFKADTDATKLNLGVGAYRTEDLQPYVLKVVNKA  60

Query  491  ENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAA  670
            E LML+RGENKEYLPIEGLAAFNK TAELL GADN VI+  ++ATVQGLSGTGSLRL AA
Sbjct  61   EQLMLERGENKEYLPIEGLAAFNKATAELLLGADNPVIKNGQIATVQGLSGTGSLRLGAA  120

Query  671  LIERYFPGSKVLISSPTWGLHHSSVVIYGI  760
             I RYFPG KVLISSPTWG H + +   G+
Sbjct  121  FIARYFPGVKVLISSPTWGNHKNILSDAGV  150



>gb|EMS51671.1| Aspartate aminotransferase, chloroplastic [Triticum urartu]
Length=468

 Score =   236 bits (601),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 119/176 (68%), Positives = 137/176 (78%), Gaps = 8/176 (5%)
 Frame = +2

Query  227  KLKAKPKLREYGQCTLFGNATKSHGRMR-------MVATVNVSRFEGISMAPPDPILGVS  385
            +L+  P +R +   ++F     S  R R       M   V+ SRFEG+ MAPPDPILGVS
Sbjct  25   RLRMTP-IRTFPSNSIFQRPFSSASRDRVNTSHITMAVAVDASRFEGVPMAPPDPILGVS  83

Query  386  EAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENKEYLPIEGLAAFNKV  565
            EAFKADT ++KLNLGVGAYRTEELQP VL+VVKKAE LML++GENKEYLPIEG AAFNK 
Sbjct  84   EAFKADTSDLKLNLGVGAYRTEELQPAVLNVVKKAEKLMLEKGENKEYLPIEGFAAFNKA  143

Query  566  TAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFPGSKVLISSPTWGLH  733
            TA+LL GADN VI+Q RVAT+Q LSGTGSLRLAAA I+RYFP +KVLISSPTWG H
Sbjct  144  TADLLLGADNPVIKQGRVATLQSLSGTGSLRLAAAFIQRYFPDAKVLISSPTWGNH  199



>gb|EMT29046.1| Aspartate aminotransferase, chloroplastic [Aegilops tauschii]
Length=483

 Score =   236 bits (602),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 113/145 (78%), Positives = 126/145 (87%), Gaps = 0/145 (0%)
 Frame = +2

Query  299  GRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDV  478
            G + M   V+ SRFEG+ MAPPDPILGVSEAFKADT ++KLNLGVGAYRTEELQP VL+V
Sbjct  70   GHITMALAVDASRFEGVPMAPPDPILGVSEAFKADTSDLKLNLGVGAYRTEELQPAVLNV  129

Query  479  VKKAENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLR  658
            VKKAE LML++GENKEYLPIEG AAFNK TA+LL GADN VI+Q RVAT+Q LSGTGSLR
Sbjct  130  VKKAEKLMLEKGENKEYLPIEGFAAFNKATADLLLGADNPVIKQGRVATLQSLSGTGSLR  189

Query  659  LAAALIERYFPGSKVLISSPTWGLH  733
            LAAA I+RYFP +KVLISSPTWG H
Sbjct  190  LAAAFIQRYFPDAKVLISSPTWGNH  214



>emb|CAN64661.1| hypothetical protein VITISV_034785 [Vitis vinifera]
Length=420

 Score =   234 bits (597),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 117/149 (79%), Positives = 125/149 (84%), Gaps = 13/149 (9%)
 Frame = +2

Query  287  TKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPY  466
            TKS GR+ M   VN SRFEG++MAPPDPILGVSEAF+AD  EMKLNLGVGAYRTEELQPY
Sbjct  23   TKSFGRINMAIAVNTSRFEGVTMAPPDPILGVSEAFRADNSEMKLNLGVGAYRTEELQPY  82

Query  467  VLDVVKKAENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGT  646
            VL+VVKK             YLPIEGLAAFNKVTAELLFGA N VI+Q+RVATVQGLSGT
Sbjct  83   VLNVVKK-------------YLPIEGLAAFNKVTAELLFGAGNPVIEQQRVATVQGLSGT  129

Query  647  GSLRLAAALIERYFPGSKVLISSPTWGLH  733
            GSLRLAAALIERYFPG+KVLISSPTWG H
Sbjct  130  GSLRLAAALIERYFPGAKVLISSPTWGNH  158



>gb|KJB55008.1| hypothetical protein B456_009G060500 [Gossypium raimondii]
Length=396

 Score =   227 bits (578),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 109/127 (86%), Positives = 119/127 (94%), Gaps = 0/127 (0%)
 Frame = +2

Query  353  MAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENKEYL  532
            MAP DPILGVSEAFKAD  E+KLNLGVGAYRTEELQPYVLDVVKKA+ L+L++GEN+EYL
Sbjct  1    MAPSDPILGVSEAFKADNHELKLNLGVGAYRTEELQPYVLDVVKKADKLLLEKGENREYL  60

Query  533  PIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFPGSKVLIS  712
            PIEGLAAFNKVTA+LLFGADN VI+Q+RVATVQGLSGTGSLRLAAALIERYFP  +VLIS
Sbjct  61   PIEGLAAFNKVTADLLFGADNPVIKQQRVATVQGLSGTGSLRLAAALIERYFPRGEVLIS  120

Query  713  SPTWGLH  733
            SPTWG H
Sbjct  121  SPTWGNH  127



>ref|XP_001785888.1| predicted protein [Physcomitrella patens]
 gb|EDQ49297.1| predicted protein [Physcomitrella patens]
Length=461

 Score =   222 bits (565),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 107/143 (75%), Positives = 118/143 (83%), Gaps = 0/143 (0%)
 Frame = +2

Query  311  MVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKA  490
            M    +VSRFE ++MAP DPILGVSEAFK D  E KLNLGVGAYRTE+LQPYVL+VVKKA
Sbjct  52   MSVATDVSRFESVTMAPADPILGVSEAFKKDNSEKKLNLGVGAYRTEDLQPYVLEVVKKA  111

Query  491  ENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAA  670
            E  ML+ G+NKEYLPIEGLAAFNK TAELL GADN  I++ RVATVQGLSGTGSLRL AA
Sbjct  112  EKKMLEGGDNKEYLPIEGLAAFNKATAELLLGADNAAIKENRVATVQGLSGTGSLRLGAA  171

Query  671  LIERYFPGSKVLISSPTWGLHHS  739
             I+RYFPG  V ISSPTWG H +
Sbjct  172  FIQRYFPGITVYISSPTWGNHKN  194



>ref|XP_006495466.1| PREDICTED: aspartate aminotransferase, chloroplastic-like [Citrus 
sinensis]
Length=113

 Score =   197 bits (502),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 94/108 (87%), Positives = 103/108 (95%), Gaps = 0/108 (0%)
 Frame = +2

Query  311  MVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKA  490
            MVA VNVSRFEG++MAPPDPILGVSEAFKADTDE KLNLGVGAYRTEELQPYVLDVVKKA
Sbjct  1    MVAAVNVSRFEGVTMAPPDPILGVSEAFKADTDEKKLNLGVGAYRTEELQPYVLDVVKKA  60

Query  491  ENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQG  634
            ENLML+RGENKEYLPIEGLAAFNKVTAELLFGADN V++++RV++  G
Sbjct  61   ENLMLERGENKEYLPIEGLAAFNKVTAELLFGADNSVLKEQRVSSDSG  108



>ref|XP_011084852.1| PREDICTED: aspartate aminotransferase, chloroplastic-like [Sesamum 
indicum]
Length=406

 Score =   203 bits (517),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 99/129 (77%), Positives = 113/129 (88%), Gaps = 0/129 (0%)
 Frame = +2

Query  347  ISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENKE  526
            I M   +P + +S+AF AD  EMKL+LG+GAYRTE+LQPYVL+VVKKAE LML+R ENKE
Sbjct  9    IGMGAEEPSVELSKAFGADRYEMKLDLGLGAYRTEDLQPYVLNVVKKAEKLMLERCENKE  68

Query  527  YLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFPGSKVL  706
            YLPIEGLAAFNK TAELLFGAD+ VIQQ+RVATVQG+SGTGSLRLAAALI R+FP SK+L
Sbjct  69   YLPIEGLAAFNKATAELLFGADSPVIQQQRVATVQGISGTGSLRLAAALIHRHFPASKIL  128

Query  707  ISSPTWGLH  733
            ISSPTWG H
Sbjct  129  ISSPTWGNH  137



>gb|KCW81335.1| hypothetical protein EUGRSUZ_C02721 [Eucalyptus grandis]
Length=461

 Score =   193 bits (490),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 92/109 (84%), Positives = 99/109 (91%), Gaps = 0/109 (0%)
 Frame = +2

Query  290  KSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYV  469
            K  GR+ M   VNVSRFEGI++APPDPILGVSEAFKADTDE KLNLGVGAYRTEELQPYV
Sbjct  104  KHFGRVSMTVAVNVSRFEGITIAPPDPILGVSEAFKADTDEKKLNLGVGAYRTEELQPYV  163

Query  470  LDVVKKAENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKR  616
            L VV+KAENLML+RGENKEYLPIEGLAAFNK TAELLFGADN VI+Q+R
Sbjct  164  LKVVEKAENLMLERGENKEYLPIEGLAAFNKATAELLFGADNPVIKQQR  212



>ref|XP_005642879.1| aspartate aminotransferase [Coccomyxa subellipsoidea C-169]
 gb|EIE18335.1| aspartate aminotransferase [Coccomyxa subellipsoidea C-169]
Length=453

 Score =   192 bits (487),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 91/149 (61%), Positives = 114/149 (77%), Gaps = 0/149 (0%)
 Frame = +2

Query  314  VATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAE  493
            V T   SR   + + PPDPILGVSEAFK DT+++KLNLGVGAYRTEEL+PYVL+VVKKAE
Sbjct  47   VDTKKQSRLAFVDLQPPDPILGVSEAFKRDTNDLKLNLGVGAYRTEELKPYVLNVVKKAE  106

Query  494  NLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAAL  673
             +ML+  ENKEYLPI+GL AFNK TAELL G D+  I++ R+AT+Q LSGTGSLR+AA  
Sbjct  107  KIMLESEENKEYLPIQGLEAFNKATAELLLGQDHPAIKEGRIATLQSLSGTGSLRVAADF  166

Query  674  IERYFPGSKVLISSPTWGLHHSSVVIYGI  760
            I ++ PG+   +S+PTWG H +     G+
Sbjct  167  IAKFLPGTTAYLSNPTWGNHKNIFADAGV  195



>ref|XP_010942150.1| PREDICTED: aspartate aminotransferase, chloroplastic isoform 
X2 [Elaeis guineensis]
Length=438

 Score =   187 bits (474),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 87/109 (80%), Positives = 101/109 (93%), Gaps = 0/109 (0%)
 Frame = +2

Query  290  KSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYV  469
            K+ GR+RM   VNVSRFE ++MAPPDPILGVSEAFKADT ++KLNLGVGAYRTEELQPYV
Sbjct  38   KAFGRVRMAVAVNVSRFESVTMAPPDPILGVSEAFKADTSDVKLNLGVGAYRTEELQPYV  97

Query  470  LDVVKKAENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKR  616
            L+VV+KAENLML+RGENKEYLPIEGLAAFNKVTA+LLFGA+N V+Q+ +
Sbjct  98   LNVVRKAENLMLERGENKEYLPIEGLAAFNKVTADLLFGANNIVVQEGK  146



>ref|XP_008784799.1| PREDICTED: aspartate aminotransferase, chloroplastic-like isoform 
X2 [Phoenix dactylifera]
Length=453

 Score =   186 bits (473),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 98/169 (58%), Positives = 120/169 (71%), Gaps = 8/169 (5%)
 Frame = +2

Query  248  LREYGQCTLFGNAT-------KSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADT  406
            +RE+ +    G  T       K+ G    V   N SRFEG++  PPDP   + EAF+ADT
Sbjct  17   IREHPKSIRVGKRTGSLLFKAKAFGPNSTVVASNGSRFEGVTAGPPDPYYELLEAFEADT  76

Query  407  DEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENKEYLPIEGLAAFNKVTAELLFG  586
             + K+NL V AYR E LQP+VL+VVKKAE LML++GE+KEYLP++GLA FNKVTAELLFG
Sbjct  77   SDTKVNLWVRAYRVE-LQPFVLNVVKKAEKLMLEKGEDKEYLPMDGLAEFNKVTAELLFG  135

Query  587  ADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFPGSKVLISSPTWGLH  733
            A+N V+Q+ RVATVQ LSGTG+L LAAA I   FP +K LISSPTW  H
Sbjct  136  ANNPVVQEGRVATVQTLSGTGALHLAAAFIHGNFPSAKALISSPTWSNH  184



>gb|ABN48559.1| chloroplast aspartate aminotransferase [Brassica juncea]
Length=135

 Score =   177 bits (448),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 95/141 (67%), Positives = 107/141 (76%), Gaps = 6/141 (4%)
 Frame = +2

Query  164  MASTVFTlasaspsvslslQDKLKAKPKLREYGQCTLFGNATKSHGRMRMVATVNVSRFE  343
            MAS++ +L   S       +DKLK  P     G        TKS  R+ M  +V  SRFE
Sbjct  1    MASSMLSLGWTSLLPREINKDKLKLGPS----GSNPFL--RTKSLSRVTMSVSVKPSRFE  54

Query  344  GISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENK  523
            GI+MAPPDPILGVSEAFKADT+E+KLNLGVGAYRTEELQPYVL+VVKKAENLML+RG+NK
Sbjct  55   GITMAPPDPILGVSEAFKADTNELKLNLGVGAYRTEELQPYVLNVVKKAENLMLERGDNK  114

Query  524  EYLPIEGLAAFNKVTAELLFG  586
            EYLPIEGLAAFNK TAELLFG
Sbjct  115  EYLPIEGLAAFNKATAELLFG  135



>ref|XP_005851216.1| hypothetical protein CHLNCDRAFT_137913 [Chlorella variabilis]
 gb|EFN59114.1| hypothetical protein CHLNCDRAFT_137913 [Chlorella variabilis]
Length=441

 Score =   186 bits (471),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 90/143 (63%), Positives = 105/143 (73%), Gaps = 0/143 (0%)
 Frame = +2

Query  332  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  511
            SR + +  APPDPILGVSEAFK DT   KLNLGVGAYRTEELQPYVL VV+KAE  ML +
Sbjct  41   SRLDAVEQAPPDPILGVSEAFKKDTSPDKLNLGVGAYRTEELQPYVLKVVRKAEERMLAK  100

Query  512  GENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFP  691
             ENKEYLPIEGLA+F + T ELL GAD+  IQ+ RVA +Q LSGTGSLR+ A  I ++ P
Sbjct  101  DENKEYLPIEGLASFRQATVELLLGADSPAIQEGRVAVLQSLSGTGSLRVGAEFIAKFMP  160

Query  692  GSKVLISSPTWGLHHSSVVIYGI  760
            G+   IS PTWG H +     G+
Sbjct  161  GTVAYISRPTWGNHKNIFADAGV  183



>ref|XP_008784798.1| PREDICTED: aspartate aminotransferase, chloroplastic-like isoform 
X1 [Phoenix dactylifera]
Length=492

 Score =   186 bits (473),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 98/169 (58%), Positives = 120/169 (71%), Gaps = 8/169 (5%)
 Frame = +2

Query  248  LREYGQCTLFGNAT-------KSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADT  406
            +RE+ +    G  T       K+ G    V   N SRFEG++  PPDP   + EAF+ADT
Sbjct  17   IREHPKSIRVGKRTGSLLFKAKAFGPNSTVVASNGSRFEGVTAGPPDPYYELLEAFEADT  76

Query  407  DEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENKEYLPIEGLAAFNKVTAELLFG  586
             + K+NL V AYR E LQP+VL+VVKKAE LML++GE+KEYLP++GLA FNKVTAELLFG
Sbjct  77   SDTKVNLWVRAYRVE-LQPFVLNVVKKAEKLMLEKGEDKEYLPMDGLAEFNKVTAELLFG  135

Query  587  ADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFPGSKVLISSPTWGLH  733
            A+N V+Q+ RVATVQ LSGTG+L LAAA I   FP +K LISSPTW  H
Sbjct  136  ANNPVVQEGRVATVQTLSGTGALHLAAAFIHGNFPSAKALISSPTWSNH  184



>gb|ACG59771.1| chloroplast aspartate aminotransferase [Triticum aestivum]
Length=368

 Score =   180 bits (457),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 88/106 (83%), Positives = 95/106 (90%), Gaps = 0/106 (0%)
 Frame = +2

Query  416  KLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADN  595
            KLNLGVGAYRTEELQP VL+VVKKAE LML++GENKEYLPIEG AAFNK TA+LL GADN
Sbjct  1    KLNLGVGAYRTEELQPAVLNVVKKAEKLMLEKGENKEYLPIEGFAAFNKATADLLLGADN  60

Query  596  EVIQQKRVATVQGLSGTGSLRLAAALIERYFPGSKVLISSPTWGLH  733
             VI+Q RVAT+Q LSGTGSLRLAAA I+RYFP SKVLISSPTWG H
Sbjct  61   PVIKQGRVATLQSLSGTGSLRLAAAFIQRYFPDSKVLISSPTWGNH  106



>ref|XP_001700039.1| aspartate aminotransferase [Chlamydomonas reinhardtii]
 gb|EDP07735.1| aspartate aminotransferase [Chlamydomonas reinhardtii]
Length=428

 Score =   176 bits (447),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 91/155 (59%), Positives = 109/155 (70%), Gaps = 5/155 (3%)
 Frame = +2

Query  332  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  511
            SRF  ++ APPDPILGVSEAFKA TD  KLNLGVGAYR E+L+P VL VVKKAE+ +  R
Sbjct  28   SRFADVAQAPPDPILGVSEAFKASTDPNKLNLGVGAYRDEQLKPVVLSVVKKAESKIFSR  87

Query  512  GENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFP  691
             ENKEYL IEGL AF K T +LL G D+  I++ RVA VQ LSGTGSLR+ AA I R+  
Sbjct  88   NENKEYLTIEGLDAFRKATVDLLLGGDHPAIKEGRVAVVQSLSGTGSLRVGAAFIARFMK  147

Query  692  GSKVLISSPTWGLHHSSVVIYGIFKS*L*CSYYHY  796
            G+ V +S+PTWG H +   I+G     +   YY Y
Sbjct  148  GATVYLSNPTWGNHRN---IFG--DEGVEWKYYRY  177



>ref|XP_003064597.1| aspartate amino transferase [Micromonas pusilla CCMP1545]
 gb|EEH51502.1| aspartate amino transferase [Micromonas pusilla CCMP1545]
Length=413

 Score =   170 bits (430),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 82/139 (59%), Positives = 102/139 (73%), Gaps = 0/139 (0%)
 Frame = +2

Query  344  GISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENK  523
            G+  +PPDPILGVS AF+A  D  KLNLGVGAYRTEELQPYVL+VV++AE  M+  G +K
Sbjct  14   GVEPSPPDPILGVSVAFRACDDPNKLNLGVGAYRTEELQPYVLEVVREAERRMIAAGHDK  73

Query  524  EYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFPGSKV  703
            EYLP++GLA F   TAELL G  +  I +KRVAT+Q LSGTGSLR+ AA I ++ PG  V
Sbjct  74   EYLPMQGLAEFCGATAELLLGKGHPAIAEKRVATIQSLSGTGSLRVGAAFIAKFLPGKAV  133

Query  704  LISSPTWGLHHSSVVIYGI  760
             + SPTWG H + +   G+
Sbjct  134  YLPSPTWGNHKNILADSGV  152



>ref|XP_002950644.1| aspartate aminotransferase [Volvox carteri f. nagariensis]
 gb|EFJ48390.1| aspartate aminotransferase [Volvox carteri f. nagariensis]
Length=438

 Score =   169 bits (428),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 87/153 (57%), Positives = 106/153 (69%), Gaps = 4/153 (3%)
 Frame = +2

Query  302  RMRMVATVN-VSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDV  478
            R R+   V  +SRF  ++ APPDPILGVSEAF+A T   KLNLGVGAYR E+L+P VL V
Sbjct  27   RSRLALQVRCMSRFADVAQAPPDPILGVSEAFRASTSPSKLNLGVGAYRDEDLKPVVLSV  86

Query  479  VKKAENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLR  658
            VKKAE  +  R ENKEYL IEG   F K T +LL GA +  I++ RVA +Q LSGTGSLR
Sbjct  87   VKKAEAKIFSRNENKEYLSIEGFEPFRKATVDLLLGAGHPAIKEGRVAVIQSLSGTGSLR  146

Query  659  LAAALIERYFPGSKVLISSPTWGLHHSSVVIYG  757
            + AA I R+  G+ V IS+PTWG H +   I+G
Sbjct  147  VGAAFIARFLKGATVYISNPTWGNHRN---IFG  176



>ref|XP_011399285.1| Aspartate aminotransferase P2, mitochondrial [Auxenochlorella 
protothecoides]
 gb|KFM26389.1| Aspartate aminotransferase P2, mitochondrial [Auxenochlorella 
protothecoides]
Length=386

 Score =   162 bits (411),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 80/121 (66%), Positives = 93/121 (77%), Gaps = 0/121 (0%)
 Frame = +2

Query  371  ILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENKEYLPIEGLA  550
            ILGVSEAFK +T   KLNLGVGAYRTEELQPYVL VV KAE  ML+RG+NKEYL IEGL 
Sbjct  23   ILGVSEAFKRETSTDKLNLGVGAYRTEELQPYVLRVVGKAEKRMLERGDNKEYLSIEGLP  82

Query  551  AFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFPGSKVLISSPTWGL  730
             F   T ELL GAD+  +++ RVAT+Q LSGTGSLR+AAA + ++ PG  V +S PTWG 
Sbjct  83   EFRAATVELLLGADSAAVKEGRVATLQSLSGTGSLRVAAAFLAKFLPGVTVYLSRPTWGN  142

Query  731  H  733
            H
Sbjct  143  H  143



>ref|XP_002501168.1| aspartate aminotransferase [Micromonas sp. RCC299]
 gb|ACO62426.1| aspartate aminotransferase [Micromonas sp. RCC299]
Length=410

 Score =   161 bits (407),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 79/152 (52%), Positives = 104/152 (68%), Gaps = 0/152 (0%)
 Frame = +2

Query  305  MRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVK  484
            M   A    S   G+  AP DPILGVS AF+  T+  KLNLGVGAYRTE+L+PYVLDVV+
Sbjct  1    MSTRAAAGPSFLSGVEQAPADPILGVSVAFRESTNPNKLNLGVGAYRTEDLKPYVLDVVR  60

Query  485  KAENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLA  664
            +AE  M++   +KEYLP++GLA FN+ T +LL G  +  + + RVATVQ LSGTGSLR+ 
Sbjct  61   QAEKRMIEADYDKEYLPMQGLAEFNEATRKLLLGEGSAAVAESRVATVQSLSGTGSLRVG  120

Query  665  AALIERYFPGSKVLISSPTWGLHHSSVVIYGI  760
            AA I ++ PG+ V + +PTWG H +     G+
Sbjct  121  AAFIGKFMPGAVVYLPNPTWGNHKNIFADAGV  152



>ref|XP_006833326.1| hypothetical protein AMTR_s00109p00068640 [Amborella trichopoda]
 gb|ERM98604.1| hypothetical protein AMTR_s00109p00068640 [Amborella trichopoda]
Length=452

 Score =   158 bits (399),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 81/144 (56%), Positives = 101/144 (70%), Gaps = 1/144 (1%)
 Frame = +2

Query  332  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  511
            S FE I+ AP DPILGV+ A+  D   +KLNLGVGAYRTEE +P VL+VVK+AE L++  
Sbjct  50   SVFESINQAPEDPILGVTVAYNKDPSPVKLNLGVGAYRTEEGKPLVLNVVKQAEQLLIND  109

Query  512  GEN-KEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYF  688
            G   KEYLPI GLA FNK++A L+ GAD+  I +KRVATVQGLSGTGSLR+ A  + R++
Sbjct  110  GSRVKEYLPITGLADFNKLSATLILGADSPAILEKRVATVQGLSGTGSLRVGAEFLTRHY  169

Query  689  PGSKVLISSPTWGLHHSSVVIYGI  760
                + I  PTWG H     I G+
Sbjct  170  YNRTIYIPLPTWGNHPKVFTIAGL  193



>ref|XP_002284313.1| PREDICTED: aspartate aminotransferase, cytoplasmic [Vitis vinifera]
 emb|CBI28052.3| unnamed protein product [Vitis vinifera]
Length=411

 Score =   156 bits (395),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 80/144 (56%), Positives = 101/144 (70%), Gaps = 1/144 (1%)
 Frame = +2

Query  332  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  511
            S F  I  AP DPILGV+ A+  DT  +KLNLGVGAYRTEE +P VL+VV++AE L++  
Sbjct  9    SVFSNIVRAPEDPILGVTVAYNKDTSPIKLNLGVGAYRTEEGKPLVLNVVRRAEQLLVND  68

Query  512  GEN-KEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYF  688
                KEYLPI GLA FNK++A+L+FGAD+  IQ+ RVATVQGLSGTGSLR+ A  + R++
Sbjct  69   PSRVKEYLPIVGLAEFNKLSAKLIFGADSPAIQENRVATVQGLSGTGSLRIGAEFLARHY  128

Query  689  PGSKVLISSPTWGLHHSSVVIYGI  760
                + I  PTWG H     I G+
Sbjct  129  YQHTIYIPVPTWGNHPKIFTIAGL  152



>emb|CAN70394.1| hypothetical protein VITISV_020521 [Vitis vinifera]
Length=411

 Score =   155 bits (393),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 80/144 (56%), Positives = 100/144 (69%), Gaps = 1/144 (1%)
 Frame = +2

Query  332  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  511
            S F  I  AP DPILGV+ A+  DT  +KLNLGVGAYRTEE +P VL VV++AE L++  
Sbjct  9    SVFSNIVRAPEDPILGVTVAYNKDTSPIKLNLGVGAYRTEEGKPLVLKVVRRAEQLLVND  68

Query  512  GEN-KEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYF  688
                KEYLPI GLA FNK++A+L+FGAD+  IQ+ RVATVQGLSGTGSLR+ A  + R++
Sbjct  69   PSRVKEYLPIVGLAEFNKLSAKLIFGADSPAIQENRVATVQGLSGTGSLRIGAEFLARHY  128

Query  689  PGSKVLISSPTWGLHHSSVVIYGI  760
                + I  PTWG H     I G+
Sbjct  129  YQHTIYIPVPTWGNHPKIFTIAGL  152



>tpg|DAA57531.1| TPA: hypothetical protein ZEAMMB73_000065 [Zea mays]
Length=281

 Score =   150 bits (379),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 76/161 (47%), Positives = 105/161 (65%), Gaps = 1/161 (1%)
 Frame = +2

Query  281  NATKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQ  460
            +AT +      +A+   S F  +  AP DPILGV+ A+  D   +K+NLGVGAYRTEE +
Sbjct  40   SATSTLESFPTMASQGSSVFAALEQAPEDPILGVTVAYNKDPSPVKVNLGVGAYRTEEGK  99

Query  461  PYVLDVVKKAENLMLQRGEN-KEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGL  637
            P VL+VV++AE +++      KEYLPI GLA FNK++A+L+FGAD+  IQ+ RVATVQ L
Sbjct  100  PLVLNVVRRAEQMLINNPSRVKEYLPITGLAEFNKLSAKLIFGADSPAIQENRVATVQCL  159

Query  638  SGTGSLRLAAALIERYFPGSKVLISSPTWGLHHSSVVIYGI  760
            SGTGSLR+    + R++    + I  PTWG H     + G+
Sbjct  160  SGTGSLRVGGEFLARHYHERTIYIPQPTWGNHPKVFTLSGL  200



>ref|XP_005152326.1| PREDICTED: aspartate aminotransferase, mitochondrial [Melopsittacus 
undulatus]
Length=423

 Score =   153 bits (387),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 73/145 (50%), Positives = 101/145 (70%), Gaps = 1/145 (1%)
 Frame = +2

Query  302  RMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVV  481
            R+   AT   S +  + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V
Sbjct  14   RLVAAATRASSWWSHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDSGKPYVLNCV  73

Query  482  KKAENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRL  661
            +KAE ++  +  +KEYLPI GLA F + +AEL  G ++EV++  R  TVQG+SGTGSLR+
Sbjct  74   RKAEAMIASKKMDKEYLPIGGLADFTRASAELALGENSEVLKSGRYVTVQGISGTGSLRI  133

Query  662  AAALIERYFPGSK-VLISSPTWGLH  733
             A  ++R+F  S+ V +  P+WG H
Sbjct  134  GANFLQRFFKSSREVYLPKPSWGNH  158



>ref|XP_006780104.1| PREDICTED: aspartate aminotransferase, mitochondrial-like [Neolamprologus 
brichardi]
Length=428

 Score =   153 bits (387),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 76/155 (49%), Positives = 105/155 (68%), Gaps = 4/155 (3%)
 Frame = +2

Query  272  LFGNATKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTE  451
              GN + S G   +++T N S + G+ M PPDPILGV+EAFK DT+  K+NLGVGAYR +
Sbjct  12   CLGNISPSLG---VLSTRNSSWWGGVQMGPPDPILGVTEAFKKDTNPKKMNLGVGAYRDD  68

Query  452  ELQPYVLDVVKKAENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQ  631
            + +P+VL  V+KAE ++  +  +KEYLPI GLA F+K  A+L  G +NEV++  R  TVQ
Sbjct  69   QGKPFVLSCVRKAEAIIAAKQLDKEYLPIGGLAEFSKACAQLALGPENEVLKSSRSVTVQ  128

Query  632  GLSGTGSLRLAAALIERYFPG-SKVLISSPTWGLH  733
             +SGTGSLR+ A  + R+ PG   V +  P+WG H
Sbjct  129  TISGTGSLRIGANFLARFHPGPHDVYLPKPSWGNH  163



>ref|XP_004543093.1| PREDICTED: aspartate aminotransferase, mitochondrial-like [Maylandia 
zebra]
 ref|XP_005741732.1| PREDICTED: aspartate aminotransferase, mitochondrial-like [Pundamilia 
nyererei]
 ref|XP_005915269.1| PREDICTED: aspartate aminotransferase, mitochondrial-like [Haplochromis 
burtoni]
Length=428

 Score =   153 bits (387),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 76/155 (49%), Positives = 105/155 (68%), Gaps = 4/155 (3%)
 Frame = +2

Query  272  LFGNATKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTE  451
              GN + S G   +++T N S + G+ M PPDPILGV+EAFK DT+  K+NLGVGAYR +
Sbjct  12   CLGNISPSLG---VLSTRNSSWWGGVQMGPPDPILGVTEAFKKDTNPKKMNLGVGAYRDD  68

Query  452  ELQPYVLDVVKKAENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQ  631
            + +P+VL  V+KAE ++  +  +KEYLPI GLA F+K  A+L  G +NEV++  R  TVQ
Sbjct  69   QGKPFVLSCVRKAEAIIAAKQLDKEYLPIGGLAEFSKACAQLALGPENEVLKSSRSVTVQ  128

Query  632  GLSGTGSLRLAAALIERYFPG-SKVLISSPTWGLH  733
             +SGTGSLR+ A  + R+ PG   V +  P+WG H
Sbjct  129  TISGTGSLRIGANFLARFHPGPHDVYLPKPSWGNH  163



>ref|XP_003442303.1| PREDICTED: aspartate aminotransferase, mitochondrial-like [Oreochromis 
niloticus]
Length=428

 Score =   153 bits (387),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 76/155 (49%), Positives = 105/155 (68%), Gaps = 4/155 (3%)
 Frame = +2

Query  272  LFGNATKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTE  451
              GN + S G   +++T N S + G+ M PPDPILGV+EAFK DT+  K+NLGVGAYR +
Sbjct  12   CLGNISPSLG---VLSTRNSSWWGGVQMGPPDPILGVTEAFKKDTNPKKMNLGVGAYRDD  68

Query  452  ELQPYVLDVVKKAENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQ  631
            + +P+VL  V+KAE ++  +  +KEYLPI GLA F+K  A+L  G +NEV++  R  TVQ
Sbjct  69   QGKPFVLSCVRKAEAIIAAKQLDKEYLPIGGLAEFSKACAQLALGPENEVLKSSRSVTVQ  128

Query  632  GLSGTGSLRLAAALIERYFPG-SKVLISSPTWGLH  733
             +SGTGSLR+ A  + R+ PG   V +  P+WG H
Sbjct  129  TISGTGSLRIGANFLARFHPGPHDVYLPKPSWGNH  163



>gb|EMT25743.1| Aspartate aminotransferase, cytoplasmic [Aegilops tauschii]
Length=407

 Score =   152 bits (384),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 75/144 (52%), Positives = 100/144 (69%), Gaps = 1/144 (1%)
 Frame = +2

Query  332  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  511
            S F GI+  P DPILGV+ A+  D   +K+NLGVGAYRTEE +P VL+VV++AE +++Q 
Sbjct  5    SVFAGIAQGPEDPILGVTVAYNKDPSPVKVNLGVGAYRTEEGKPMVLNVVRRAEQMLIQN  64

Query  512  GEN-KEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYF  688
                KEYLPI GLA FNK++A+L+FGAD+  IQ+ RVATVQ LSGTGSLR+    + R++
Sbjct  65   ESRVKEYLPITGLADFNKLSAKLIFGADSPAIQENRVATVQCLSGTGSLRVGGEFLARHY  124

Query  689  PGSKVLISSPTWGLHHSSVVIYGI  760
                + I  PTWG H     + G+
Sbjct  125  HERTIYIPQPTWGNHPKVFTLAGL  148



>ref|XP_010250350.1| PREDICTED: aspartate aminotransferase, cytoplasmic, partial [Nelumbo 
nucifera]
Length=458

 Score =   153 bits (386),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 79/156 (51%), Positives = 105/156 (67%), Gaps = 6/156 (4%)
 Frame = +2

Query  332  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  511
            S F  I+ AP DPILGV+ A+  D+  +KLNLGVGAYRTEE +P VL+VV++AE L++  
Sbjct  56   SVFANIAKAPEDPILGVTVAYNKDSSPIKLNLGVGAYRTEEGKPLVLNVVRRAEQLLVND  115

Query  512  GEN-KEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYF  688
                KEYLPI GLA FNK++A+L+FGAD+  IQ+ RVATVQ LSGTGSLR+ A  + +++
Sbjct  116  PSRVKEYLPITGLADFNKLSAKLIFGADSPAIQENRVATVQCLSGTGSLRVGAEFLAKHY  175

Query  689  PGSKVLISSPTWGLHHSSVVIYGIFKS*L*CSYYHY  796
              + + I  PTWG H     + G+        YY Y
Sbjct  176  HQNSIYIPQPTWGNHPKVFTMAGLSP-----KYYRY  206



>ref|XP_001176672.2| PREDICTED: aspartate aminotransferase, mitochondrial-like isoform 
2 [Strongylocentrotus purpuratus]
Length=431

 Score =   152 bits (384),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 73/140 (52%), Positives = 100/140 (71%), Gaps = 1/140 (1%)
 Frame = +2

Query  317  ATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAEN  496
            A+   S ++G+ M PPDPILGVSEAFK DT+  K+NLGVGAYR +E +P+VL  VK+ E+
Sbjct  27   ASAKSSLWDGVEMGPPDPILGVSEAFKRDTNTNKINLGVGAYRDDEGKPFVLQSVKQVED  86

Query  497  LMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALI  676
             +     +KEYLPI GLA F K  A+L FG D+   Q+ R  TVQ +SGTGSLR+  + +
Sbjct  87   KVRNMSLDKEYLPITGLADFAKGAAKLAFGQDSHTSQEGRNVTVQTISGTGSLRVGGSFL  146

Query  677  ERYFPGSKVL-ISSPTWGLH  733
            +++FPG+KV+ + SP+WG H
Sbjct  147  QKFFPGNKVVYLPSPSWGNH  166



>gb|EMS51413.1| Aspartate aminotransferase, cytoplasmic [Triticum urartu]
Length=439

 Score =   152 bits (384),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 75/144 (52%), Positives = 100/144 (69%), Gaps = 1/144 (1%)
 Frame = +2

Query  332  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  511
            S F GI+  P DPILGV+ A+  D   +K+NLGVGAYRTEE +P VL+VV++AE +++Q 
Sbjct  5    SVFAGIAQGPEDPILGVTVAYNKDPSPVKVNLGVGAYRTEEGKPLVLNVVRRAEQMLIQN  64

Query  512  GEN-KEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYF  688
                KEYLPI GLA FNK++A+L+FGAD+  IQ+ RVATVQ LSGTGSLR+    + R++
Sbjct  65   ESRVKEYLPITGLADFNKLSAKLIFGADSPAIQENRVATVQCLSGTGSLRVGGEFLARHY  124

Query  689  PGSKVLISSPTWGLHHSSVVIYGI  760
                + I  PTWG H     + G+
Sbjct  125  HERTIYIPQPTWGNHPKVFTLAGL  148



>ref|XP_008175935.1| PREDICTED: aspartate aminotransferase, mitochondrial isoform 
X1 [Chrysemys picta bellii]
Length=429

 Score =   152 bits (383),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 77/155 (50%), Positives = 103/155 (66%), Gaps = 1/155 (1%)
 Frame = +2

Query  272  LFGNATKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTE  451
            L   A + H  +  VA    S +  + M PPDPILGV+EAFK DT+  K+NLGVGAYR +
Sbjct  10   LLSAAAQRHLCLAPVAARASSWWSHVEMGPPDPILGVTEAFKRDTNAKKMNLGVGAYRDD  69

Query  452  ELQPYVLDVVKKAENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQ  631
              +P+VL+ V+KAE  +  +  +KEYLPI GLA FNK +AEL  G  NEVI+  R  TVQ
Sbjct  70   NGKPFVLNSVRKAEAQIAAKKMDKEYLPIAGLAEFNKASAELALGDTNEVIKSGRYVTVQ  129

Query  632  GLSGTGSLRLAAALIERYFPGSK-VLISSPTWGLH  733
             +SGTGSLR+ A+ ++R+F  S+ V +  P+WG H
Sbjct  130  TISGTGSLRVGASFLQRFFKYSRDVYLPKPSWGNH  164



>gb|KIJ68385.1| hypothetical protein HYDPIDRAFT_173129 [Hydnomerulius pinastri 
MD-312]
Length=424

 Score =   152 bits (383),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 71/136 (52%), Positives = 98/136 (72%), Gaps = 1/136 (1%)
 Frame = +2

Query  329  VSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQ  508
            +S +  +   PPDPILG+SEAFKAD D  K+NLGVGAYR E  +PYVL+ VKKAE  M  
Sbjct  20   LSTWSAVPAGPPDPILGISEAFKADKDPRKINLGVGAYRDENGKPYVLNAVKKAEAKMAL  79

Query  509  RGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYF  688
               +KEYLPI GLA+F +  A+L +GAD+E ++Q  +A  Q +SGTG+LR+  A + R++
Sbjct  80   AKLDKEYLPITGLASFAQNAAKLAYGADSEPLKQNAIAVTQSISGTGALRIGGAFMARHY  139

Query  689  PGSKVL-ISSPTWGLH  733
            PG+K++ + +PTWG H
Sbjct  140  PGAKIIYLPTPTWGNH  155



>ref|XP_003970037.1| PREDICTED: aspartate aminotransferase, mitochondrial-like [Takifugu 
rubripes]
Length=428

 Score =   152 bits (383),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 77/155 (50%), Positives = 103/155 (66%), Gaps = 4/155 (3%)
 Frame = +2

Query  272  LFGNATKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTE  451
              GN + S G   + AT N S + G+ M PPDPILGV+EAFK D++  K+NLGVGAYR +
Sbjct  12   CLGNISPSMG---VFATRNSSWWGGVQMGPPDPILGVTEAFKRDSNPKKMNLGVGAYRDD  68

Query  452  ELQPYVLDVVKKAENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQ  631
            + +P+VL  V+KAE L+  +  +KEYLPI GL  F+K  A L  GADNEV++  R  TVQ
Sbjct  69   QGKPFVLSCVRKAEALIAAKQLDKEYLPIGGLGEFSKACATLALGADNEVLKSGRSITVQ  128

Query  632  GLSGTGSLRLAAALIERYFPGSK-VLISSPTWGLH  733
             +SGTGSLR+ A  + R+   S+ V +  P+WG H
Sbjct  129  TISGTGSLRIGANFLSRFHGASRDVFLPKPSWGNH  163



>emb|CDM84293.1| unnamed protein product [Triticum aestivum]
Length=454

 Score =   152 bits (384),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 75/144 (52%), Positives = 99/144 (69%), Gaps = 1/144 (1%)
 Frame = +2

Query  332  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  511
            S F GI+  P DPILGV+ A+  D   +K+NLGVGAYRTEE +P VL+VVK+AE +++  
Sbjct  52   SVFAGIAQGPEDPILGVTVAYNKDPSPVKVNLGVGAYRTEEGKPLVLNVVKRAEQMLIHN  111

Query  512  GEN-KEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYF  688
                KEYLPI GLA FNK++A+L+FGAD+  IQ+ RVATVQ LSGTGSLR+    + R++
Sbjct  112  ESRVKEYLPITGLADFNKLSAKLIFGADSPAIQENRVATVQCLSGTGSLRVGGEFLARHY  171

Query  689  PGSKVLISSPTWGLHHSSVVIYGI  760
                + I  PTWG H     + G+
Sbjct  172  HERTIYIPQPTWGNHPKVFTLAGL  195



>gb|KFO71408.1| hypothetical protein N303_10396, partial [Cuculus canorus]
Length=401

 Score =   151 bits (381),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 70/135 (52%), Positives = 95/135 (70%), Gaps = 1/135 (1%)
 Frame = +2

Query  332  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  511
            S +  + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE +M  +
Sbjct  2    SWWSHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMMASK  61

Query  512  GENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFP  691
              +KEYLPI GLA F + +AEL  G ++E  +  R  TVQG+SGTGSLR+ A  ++R+F 
Sbjct  62   KMDKEYLPIAGLADFTRASAELALGENSEAFKSGRYVTVQGISGTGSLRIGANFLQRFFK  121

Query  692  GSK-VLISSPTWGLH  733
             S+ V +  P+WG H
Sbjct  122  SSRDVYLPKPSWGNH  136



>gb|KFP38914.1| hypothetical protein N324_09434, partial [Chlamydotis macqueenii]
Length=401

 Score =   150 bits (380),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 70/135 (52%), Positives = 94/135 (70%), Gaps = 1/135 (1%)
 Frame = +2

Query  332  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  511
            S +  + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL  V+KAE ++  +
Sbjct  2    SWWSHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLSCVRKAEAMIASK  61

Query  512  GENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFP  691
              +KEYLPI GLA F + +AEL  G +NE  +  R  TVQG+SGTGSLR+ A  ++R+F 
Sbjct  62   KMDKEYLPIAGLADFTRASAELALGENNEAFKSGRYVTVQGISGTGSLRIGANFLQRFFK  121

Query  692  GSK-VLISSPTWGLH  733
             S+ V +  P+WG H
Sbjct  122  SSRDVYLPKPSWGNH  136



>sp|P37833.1|AATC_ORYSJ RecName: Full=Aspartate aminotransferase, cytoplasmic; AltName: 
Full=Transaminase A [Oryza sativa Japonica Group]
 dbj|BAA03504.1| aspartate aminotransferase [Oryza sativa Japonica Group]
 dbj|BAB61211.1| aspartate aminotransferase [Oryza sativa Japonica Group]
 dbj|BAC78585.1| aspartate aminotransferase [Oryza sativa Japonica Group]
 gb|ABL74572.1| aspartate aminotransferase [Oryza sativa Japonica Group]
 gb|EAY75902.1| hypothetical protein OsI_03821 [Oryza sativa Indica Group]
 gb|EAZ13614.1| hypothetical protein OsJ_03530 [Oryza sativa Japonica Group]
Length=407

 Score =   150 bits (380),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 74/144 (51%), Positives = 100/144 (69%), Gaps = 1/144 (1%)
 Frame = +2

Query  332  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  511
            S F G++ AP DPILGV+ A+  D   +K+NLGVGAYRTEE +P VL+VV++AE +++  
Sbjct  5    SVFAGLAQAPEDPILGVTVAYNKDPSPVKVNLGVGAYRTEEGKPLVLNVVRRAEQMLINN  64

Query  512  GEN-KEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYF  688
                KEYLPI GLA FNK++A+L+FGAD+  IQ+ RVATVQ LSGTGSLR+    + R++
Sbjct  65   PSRVKEYLPITGLADFNKLSAKLIFGADSPAIQENRVATVQCLSGTGSLRVGGEFLARHY  124

Query  689  PGSKVLISSPTWGLHHSSVVIYGI  760
                + I  PTWG H     + G+
Sbjct  125  HERTIYIPQPTWGNHPKVFTLAGL  148



>gb|KFP90495.1| hypothetical protein N311_04899, partial [Apaloderma vittatum]
Length=405

 Score =   150 bits (380),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 70/135 (52%), Positives = 95/135 (70%), Gaps = 1/135 (1%)
 Frame = +2

Query  332  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  511
            S +  + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE +M  +
Sbjct  2    SWWSHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAIMASK  61

Query  512  GENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFP  691
              +KEYLPI GLA F + +AEL  G ++E  +  R  TVQG+SGTGSLR+ A  ++R+F 
Sbjct  62   KMDKEYLPIGGLADFTRASAELALGENSEAFKSGRYVTVQGISGTGSLRIGANFLQRFFK  121

Query  692  GSK-VLISSPTWGLH  733
             S+ V +  P+WG H
Sbjct  122  ASRDVYLPKPSWGNH  136



>gb|KIM66148.1| hypothetical protein SCLCIDRAFT_1211371 [Scleroderma citrinum 
Foug A]
Length=424

 Score =   151 bits (381),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 76/153 (50%), Positives = 104/153 (68%), Gaps = 3/153 (2%)
 Frame = +2

Query  278  GNATKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEEL  457
            G A +S    R VA+V  S +  +   PPDPILG++EAFKAD D  K+NLGVGAYR E  
Sbjct  5    GAARRSPALFRNVASV--STWSAVPAGPPDPILGITEAFKADKDPRKINLGVGAYRDENG  62

Query  458  QPYVLDVVKKAENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGL  637
            +PYVL+ VKKAE  M     +KEYL I GLA+F +  A+L +G D+E+++Q  +A  Q +
Sbjct  63   KPYVLNAVKKAEEKMAAAQLDKEYLGITGLASFTQNAAKLAYGVDSELLKQNAIAVTQSI  122

Query  638  SGTGSLRLAAALIERYFPGSKVL-ISSPTWGLH  733
            SGTG+LR+  A I R++P +KV+ + +PTWG H
Sbjct  123  SGTGALRIGGAFIARHYPHAKVIYLPTPTWGNH  155



>emb|CBI20886.3| unnamed protein product [Vitis vinifera]
Length=422

 Score =   151 bits (381),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 77/144 (53%), Positives = 99/144 (69%), Gaps = 1/144 (1%)
 Frame = +2

Query  332  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQ-  508
            S F+ +  AP DPILGV+ A+  D   +KLNLGVGAYRTEE +P VL+VV++AE L++  
Sbjct  20   SVFDHVVQAPEDPILGVTVAYNKDPSPVKLNLGVGAYRTEEGKPLVLNVVRRAEQLLVND  79

Query  509  RGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYF  688
            R   KEYLPI GLA FNK++A+L+FGAD+  IQ KRV TVQ LSGTGSLR+ A  + R+ 
Sbjct  80   RSRVKEYLPIVGLAEFNKLSAKLMFGADSPAIQVKRVTTVQCLSGTGSLRVGAEFLARHH  139

Query  689  PGSKVLISSPTWGLHHSSVVIYGI  760
                + I  PTWG H     + G+
Sbjct  140  HQRTIYIPQPTWGNHGKIFTLAGL  163



>gb|KFV95661.1| hypothetical protein N327_00168, partial [Fulmarus glacialis]
Length=310

 Score =   148 bits (374),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 69/135 (51%), Positives = 95/135 (70%), Gaps = 1/135 (1%)
 Frame = +2

Query  332  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  511
            S +  + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE ++  +
Sbjct  2    SWWSHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMIASK  61

Query  512  GENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFP  691
              +KEYLPI GLA F + +AEL  G ++E  +  R  TVQG+SGTGSLR+ A  ++R+F 
Sbjct  62   KMDKEYLPIGGLADFTRASAELALGENSEAFKSGRYVTVQGISGTGSLRIGANFLQRFFK  121

Query  692  GSK-VLISSPTWGLH  733
             S+ V +  P+WG H
Sbjct  122  SSRDVYLPKPSWGNH  136



>ref|XP_003227907.1| PREDICTED: aspartate aminotransferase, mitochondrial [Anolis 
carolinensis]
Length=424

 Score =   150 bits (380),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 75/145 (52%), Positives = 96/145 (66%), Gaps = 1/145 (1%)
 Frame = +2

Query  302  RMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVV  481
            R+   A    S +  + M PPDPILGV+EAFK DT   K+NLGVGAYR +  +PYVL+ V
Sbjct  15   RLASCAARASSWWAQVEMGPPDPILGVTEAFKRDTSAKKMNLGVGAYRDDNGKPYVLNCV  74

Query  482  KKAENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRL  661
            +KAE  +  +  +KEYLPI GLA F K +AEL  G  NEVIQ  R  TVQ +SGTGSLR+
Sbjct  75   RKAEAQIAAKKMDKEYLPIAGLAEFTKASAELALGESNEVIQSGRYVTVQTISGTGSLRV  134

Query  662  AAALIERYFPGSK-VLISSPTWGLH  733
             A  ++R+F  S+ V +  P+WG H
Sbjct  135  GANFLQRFFKSSRDVYLPKPSWGNH  159



>gb|KIJ21699.1| aspartate transaminase [Paxillus involutus ATCC 200175]
Length=424

 Score =   150 bits (380),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 70/136 (51%), Positives = 96/136 (71%), Gaps = 1/136 (1%)
 Frame = +2

Query  329  VSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQ  508
            +S +  +   PPDPILG++EAFKAD D  K+NLGVGAYR E  +PYVL+ VKKAE  M  
Sbjct  20   LSTWSAVPAGPPDPILGITEAFKADKDPRKINLGVGAYRDESGKPYVLNAVKKAEEKMAS  79

Query  509  RGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYF  688
               +KEYLPI GLA+F +  A+L +GAD+  + Q  +A  Q +SGTG+LR+  A + R++
Sbjct  80   AKLDKEYLPITGLASFTQNAAKLAYGADSAPLNQHAIAVTQTISGTGALRIGGAFVARHY  139

Query  689  PGSKVL-ISSPTWGLH  733
            PGSK++ + +PTWG H
Sbjct  140  PGSKIIYLPNPTWGNH  155



>dbj|BAJ97930.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=331

 Score =   149 bits (375),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 73/144 (51%), Positives = 99/144 (69%), Gaps = 1/144 (1%)
 Frame = +2

Query  332  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  511
            S F GI+  P DPILGV+ A+  D   +K+NLGVGA+RTEE +P VL+VV++AE +++  
Sbjct  57   SVFAGIAQGPEDPILGVTVAYNKDPSPVKVNLGVGAHRTEEGKPLVLNVVRRAEQMLIHN  116

Query  512  GEN-KEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYF  688
                KEYLPI GLA FNK++A+L+FGAD+  IQ+ RVATVQ LSGTGSLR+    + R++
Sbjct  117  ESRVKEYLPITGLADFNKLSAKLIFGADSPAIQENRVATVQCLSGTGSLRVGGEFLARHY  176

Query  689  PGSKVLISSPTWGLHHSSVVIYGI  760
                + I  PTWG H     + G+
Sbjct  177  HERTIYIPQPTWGNHPKVFTLAGL  200



>ref|XP_002284136.1| PREDICTED: aspartate aminotransferase, cytoplasmic [Vitis vinifera]
Length=450

 Score =   151 bits (381),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 77/144 (53%), Positives = 99/144 (69%), Gaps = 1/144 (1%)
 Frame = +2

Query  332  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQ-  508
            S F+ +  AP DPILGV+ A+  D   +KLNLGVGAYRTEE +P VL+VV++AE L++  
Sbjct  48   SVFDHVVQAPEDPILGVTVAYNKDPSPVKLNLGVGAYRTEEGKPLVLNVVRRAEQLLVND  107

Query  509  RGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYF  688
            R   KEYLPI GLA FNK++A+L+FGAD+  IQ KRV TVQ LSGTGSLR+ A  + R+ 
Sbjct  108  RSRVKEYLPIVGLAEFNKLSAKLMFGADSPAIQVKRVTTVQCLSGTGSLRVGAEFLARHH  167

Query  689  PGSKVLISSPTWGLHHSSVVIYGI  760
                + I  PTWG H     + G+
Sbjct  168  HQRTIYIPQPTWGNHGKIFTLAGL  191



>ref|NP_001044317.1| Os01g0760600 [Oryza sativa Japonica Group]
 dbj|BAD87343.1| putative aspartate aminotransferase [Oryza sativa Japonica Group]
 dbj|BAF06231.1| Os01g0760600 [Oryza sativa Japonica Group]
 dbj|BAG96155.1| unnamed protein product [Oryza sativa Japonica Group]
Length=460

 Score =   151 bits (381),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 74/144 (51%), Positives = 100/144 (69%), Gaps = 1/144 (1%)
 Frame = +2

Query  332  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  511
            S F G++ AP DPILGV+ A+  D   +K+NLGVGAYRTEE +P VL+VV++AE +++  
Sbjct  58   SVFAGLAQAPEDPILGVTVAYNKDPSPVKVNLGVGAYRTEEGKPLVLNVVRRAEQMLINN  117

Query  512  GEN-KEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYF  688
                KEYLPI GLA FNK++A+L+FGAD+  IQ+ RVATVQ LSGTGSLR+    + R++
Sbjct  118  PSRVKEYLPITGLADFNKLSAKLIFGADSPAIQENRVATVQCLSGTGSLRVGGEFLARHY  177

Query  689  PGSKVLISSPTWGLHHSSVVIYGI  760
                + I  PTWG H     + G+
Sbjct  178  HERTIYIPQPTWGNHPKVFTLAGL  201



>gb|KDP34208.1| hypothetical protein JCGZ_07779 [Jatropha curcas]
Length=454

 Score =   151 bits (381),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 77/144 (53%), Positives = 98/144 (68%), Gaps = 1/144 (1%)
 Frame = +2

Query  332  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAEN-LMLQ  508
            S F  +  AP DPILGV+ A+  D   +KLNLGVGAYRTEE +P VL+VV+KAE  L+  
Sbjct  52   SVFSHVDRAPEDPILGVTVAYNKDPSPVKLNLGVGAYRTEEGKPLVLNVVRKAEQQLVND  111

Query  509  RGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYF  688
            R   KEYLPI GLA FNK++A+L+FGAD+  IQ+ RV TVQ LSGTGSLR+ A  + R++
Sbjct  112  RSRVKEYLPITGLADFNKLSAKLIFGADSNAIQENRVTTVQCLSGTGSLRVGAEFLARHY  171

Query  689  PGSKVLISSPTWGLHHSSVVIYGI  760
                + I  PTWG H     + G+
Sbjct  172  HQRIIYIPQPTWGNHPKVFTLAGL  195



>gb|KIK94907.1| hypothetical protein PAXRUDRAFT_827518 [Paxillus rubicundulus 
Ve08.2h10]
Length=424

 Score =   150 bits (380),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 69/136 (51%), Positives = 95/136 (70%), Gaps = 1/136 (1%)
 Frame = +2

Query  329  VSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQ  508
            +S +  +   PPDPILG++EAFKAD D  K+NLGVGAYR E  +PYVL+ VKKAE  M  
Sbjct  20   LSTWSAVPAGPPDPILGITEAFKADKDSRKINLGVGAYRDENGKPYVLNAVKKAEEKMAS  79

Query  509  RGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYF  688
               +KEYLPI GL +F +  A+L +GAD+  + Q  +A  Q +SGTG+LR+  A + R++
Sbjct  80   AKLDKEYLPITGLGSFTQNAAKLAYGADSAPLNQHAIAVTQSISGTGALRIGGAFVARHY  139

Query  689  PGSKVL-ISSPTWGLH  733
            PGSK++ + +PTWG H
Sbjct  140  PGSKIIYLPNPTWGNH  155



>ref|XP_001731601.1| hypothetical protein MGL_0869 [Malassezia globosa CBS 7966]
 gb|EDP44387.1| hypothetical protein MGL_0869 [Malassezia globosa CBS 7966]
Length=427

 Score =   150 bits (379),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 73/152 (48%), Positives = 99/152 (65%), Gaps = 5/152 (3%)
 Frame = +2

Query  293  SHGRMRMVATVNVSRFE----GISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQ  460
            S   + M   VN  R++    G+   PPDPILGV+EAFK D D  K+NLGVGAYR E  +
Sbjct  9    SRSTLAMKPVVNSVRYQSVWAGVPAGPPDPILGVTEAFKHDKDPRKINLGVGAYRDEHGK  68

Query  461  PYVLDVVKKAENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLS  640
            PYVL  V+KA++ + +   NKEYLPI GL  FNK  A L +G D +V+   R+AT Q +S
Sbjct  69   PYVLPSVRKADHHIAKSNLNKEYLPITGLPGFNKYAARLAYGPDCKVLNSHRIATTQTIS  128

Query  641  GTGSLRLAAALIERYFPGSK-VLISSPTWGLH  733
            GTG+LR+A   + R++P SK + + +P+WG H
Sbjct  129  GTGALRIAGEFLARHYPHSKEIYLPTPSWGNH  160



>emb|CAA45023.1| aspartate aminotransferase [Panicum miliaceum]
 dbj|BAA04992.1| aspartate aminotransferase [Panicum miliaceum]
Length=409

 Score =   150 bits (378),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 75/150 (50%), Positives = 103/150 (69%), Gaps = 1/150 (1%)
 Frame = +2

Query  314  VATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAE  493
            +A+   S F GI+ AP DPILGV+ AF  D   +K+NLGVGAYRTEE +P VL+VV++AE
Sbjct  1    MASQVASVFAGIAQAPEDPILGVTVAFNKDPSPVKINLGVGAYRTEEGKPLVLNVVRRAE  60

Query  494  NLMLQRGEN-KEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAA  670
             +++      KEYLPI GLA +NK++A+L+FGAD+  IQ+ RVATVQ LSGTGSLR+   
Sbjct  61   QMLINDPSRVKEYLPITGLAEYNKLSAKLIFGADSPAIQENRVATVQCLSGTGSLRVGGE  120

Query  671  LIERYFPGSKVLISSPTWGLHHSSVVIYGI  760
             + +++    + I  PTWG H     + G+
Sbjct  121  FLAKHYHERTIYIPVPTWGNHPKVFTLAGL  150



>gb|KIP12008.1| hypothetical protein PHLGIDRAFT_27620 [Phlebiopsis gigantea 11061_1 
CR5-6]
Length=425

 Score =   150 bits (379),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 70/136 (51%), Positives = 93/136 (68%), Gaps = 1/136 (1%)
 Frame = +2

Query  329  VSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQ  508
            +S +  +   PPDPILGVSEAFKAD D  K+NLGVGAYR E  +PYVL+ VKKAEN++  
Sbjct  22   LSTWSAVPAGPPDPILGVSEAFKADKDPRKINLGVGAYRDEHGKPYVLNSVKKAENIIAS  81

Query  509  RGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYF  688
               +KEYLPI GLA F K   +L +G D+  +Q   VA  Q +SGTG+LR+  A + R++
Sbjct  82   SNPDKEYLPITGLADFTKAAVKLAYGTDSAPLQANSVAVTQSISGTGALRIGGAFLGRFY  141

Query  689  PGSK-VLISSPTWGLH  733
            P SK + + +P+WG H
Sbjct  142  PHSKTIYLPTPSWGNH  157



>ref|XP_008033064.1| hypothetical protein TRAVEDRAFT_109115 [Trametes versicolor FP-101664 
SS1]
 gb|EIW64721.1| hypothetical protein TRAVEDRAFT_109115 [Trametes versicolor FP-101664 
SS1]
Length=425

 Score =   150 bits (378),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 70/139 (50%), Positives = 98/139 (71%), Gaps = 1/139 (1%)
 Frame = +2

Query  320  TVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENL  499
            T ++S +  +   PPDPILGV+EAFKAD D  K+NLGVGAYR E  +PYVL+ VKKAE +
Sbjct  19   TGSLSAWSAVPAGPPDPILGVTEAFKADKDPRKINLGVGAYRDENGKPYVLNAVKKAEEI  78

Query  500  MLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIE  679
            ++Q+  +KEYLPI GL  F +  A+L +GAD+  +  K VA  Q +SGTG+LR+  A + 
Sbjct  79   LVQQNPDKEYLPITGLPEFTQAAAKLAYGADSAPLLAKSVAATQSISGTGALRIGGAFLG  138

Query  680  RYFPGSK-VLISSPTWGLH  733
            R++P SK + + +P+WG H
Sbjct  139  RFYPHSKTIYLPNPSWGNH  157



>ref|XP_006109334.1| PREDICTED: aspartate aminotransferase, mitochondrial-like, partial 
[Myotis lucifugus]
Length=177

 Score =   144 bits (362),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 69/135 (51%), Positives = 95/135 (70%), Gaps = 1/135 (1%)
 Frame = +2

Query  332  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  511
            S +  + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL  ++KAE  +  +
Sbjct  9    SWWAHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLPSIRKAEAQIAAK  68

Query  512  GENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFP  691
              +KEYLPI GLA F K +AEL  G ++EV++  R  TVQ +SGTG+LR+ A+ ++R+F 
Sbjct  69   NLDKEYLPIGGLAEFCKASAELALGENSEVLKSGRYVTVQTISGTGALRIGASFLQRFFK  128

Query  692  GSK-VLISSPTWGLH  733
             S+ V +  PTWG H
Sbjct  129  FSRDVFLPKPTWGNH  143



>ref|XP_010582297.1| PREDICTED: aspartate aminotransferase, mitochondrial [Haliaeetus 
leucocephalus]
Length=421

 Score =   150 bits (378),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 71/143 (50%), Positives = 97/143 (68%), Gaps = 1/143 (1%)
 Frame = +2

Query  308  RMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKK  487
            R  A    S +  + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+K
Sbjct  14   RFAAARASSWWSHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRK  73

Query  488  AENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAA  667
            AE ++  +  +KEYLPI GLA F + +AEL  G ++E  +  R  TVQG+SGTGSLR+ A
Sbjct  74   AEAMIASKKMDKEYLPIGGLADFTRASAELALGENSEAFKSGRYVTVQGISGTGSLRIGA  133

Query  668  ALIERYFPGSK-VLISSPTWGLH  733
              ++R+F  S+ V +  P+WG H
Sbjct  134  NFLQRFFKSSRDVYLPKPSWGNH  156



>ref|XP_010878037.1| PREDICTED: aspartate aminotransferase, mitochondrial [Esox lucius]
Length=428

 Score =   150 bits (378),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 73/141 (52%), Positives = 99/141 (70%), Gaps = 1/141 (1%)
 Frame = +2

Query  314  VATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAE  493
            V+T N S + G+ M PPDPILGV+EAFK DT+  K+NLGVGAYR ++ +P+VLD V+KAE
Sbjct  23   VSTRNSSWWAGVQMGPPDPILGVTEAFKRDTNPKKMNLGVGAYRDDQGKPFVLDCVRKAE  82

Query  494  NLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAAL  673
             L+  +  +KEYL I GL  F K  A+L  GAD+EV++  R  TVQ +SGTGSLR+ A  
Sbjct  83   ALISSKQLDKEYLAIGGLGDFTKSCAQLALGADSEVLKSGRNITVQTISGTGSLRIGANF  142

Query  674  IERYFPGSK-VLISSPTWGLH  733
            + R+   S+ V + +P+WG H
Sbjct  143  LSRFHSASRDVYLPTPSWGNH  163



>ref|XP_004245266.1| PREDICTED: aspartate aminotransferase, cytoplasmic [Solanum lycopersicum]
Length=452

 Score =   150 bits (379),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 76/144 (53%), Positives = 98/144 (68%), Gaps = 1/144 (1%)
 Frame = +2

Query  332  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQ-  508
            S F  I  AP DPILGV+ A+  DT  MKLNLGVGAYRTEE +P VL+VV++AE L++  
Sbjct  50   SVFSHIVRAPEDPILGVTVAYNKDTSPMKLNLGVGAYRTEEGKPLVLNVVRQAEQLLVND  109

Query  509  RGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYF  688
            R   KEYLPI GLA FNK++A+L+ GAD+  IQ+ RV TVQ LSGTGSLR+    + +++
Sbjct  110  RSRIKEYLPITGLADFNKLSAKLILGADSPAIQENRVTTVQCLSGTGSLRVGGEFLAQHY  169

Query  689  PGSKVLISSPTWGLHHSSVVIYGI  760
                + I  PTWG H     + G+
Sbjct  170  HQRTIYIPQPTWGNHTKIFALAGL  193



>gb|KDQ63696.1| hypothetical protein JAAARDRAFT_29716 [Jaapia argillacea MUCL 
33604]
Length=429

 Score =   150 bits (378),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 74/147 (50%), Positives = 98/147 (67%), Gaps = 2/147 (1%)
 Frame = +2

Query  305  MRMVATVN-VSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVV  481
            +RM AT   VS +  +   PPDPILGVSEAFKAD D  K+NLGVGAYR ++ +PYVL  V
Sbjct  16   LRMSATAAPVSTWSAVPAGPPDPILGVSEAFKADKDSKKINLGVGAYRDDKGKPYVLSSV  75

Query  482  KKAENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRL  661
            KKAE L+     +KEYLPI GL  F K  A+L +GA++       +A  Q +SGTG+LR+
Sbjct  76   KKAEELLASSHPDKEYLPITGLPEFTKNAAKLAYGAESAPFASNSIAVTQSISGTGALRI  135

Query  662  AAALIERYFPGSKVL-ISSPTWGLHHS  739
              A + +++P +KV+ +  PTWG HHS
Sbjct  136  GGAFLAKFYPHAKVIYLPVPTWGNHHS  162



>ref|XP_006644742.1| PREDICTED: aspartate aminotransferase, cytoplasmic-like [Oryza 
brachyantha]
Length=458

 Score =   150 bits (379),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 74/144 (51%), Positives = 99/144 (69%), Gaps = 1/144 (1%)
 Frame = +2

Query  332  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  511
            S F G++ AP DPILGV+ A+  D   +K+NLGVGAYRTEE +P VL+VV+ AE +++  
Sbjct  56   SVFAGLTQAPEDPILGVTVAYNKDPSPVKVNLGVGAYRTEEGKPLVLNVVRHAEQMLINN  115

Query  512  GEN-KEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYF  688
                KEYLPI GLA FNK++A+L+FGAD+  IQ+ RVATVQ LSGTGSLR+    + R++
Sbjct  116  PSRVKEYLPITGLAEFNKLSAKLIFGADSPAIQESRVATVQCLSGTGSLRVGGEFLARHY  175

Query  689  PGSKVLISSPTWGLHHSSVVIYGI  760
                + I  PTWG H     + G+
Sbjct  176  HERTIYIPQPTWGNHPKVFTLAGL  199



>gb|KFP19653.1| hypothetical protein Z169_06078, partial [Egretta garzetta]
Length=401

 Score =   149 bits (377),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 69/135 (51%), Positives = 95/135 (70%), Gaps = 1/135 (1%)
 Frame = +2

Query  332  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  511
            S +  + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE ++  +
Sbjct  2    SWWSHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMIASK  61

Query  512  GENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFP  691
              +KEYLPI GLA F + +AEL  G ++E  +  R  TVQG+SGTGSLR+ A  ++R+F 
Sbjct  62   KMDKEYLPIAGLADFTRASAELALGENSEAFKSGRYVTVQGISGTGSLRIGANFLQRFFK  121

Query  692  GSK-VLISSPTWGLH  733
             S+ V +  P+WG H
Sbjct  122  SSRDVYLPKPSWGNH  136



>ref|XP_003758636.1| PREDICTED: aspartate aminotransferase, mitochondrial [Sarcophilus 
harrisii]
Length=402

 Score =   149 bits (377),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 72/135 (53%), Positives = 96/135 (71%), Gaps = 1/135 (1%)
 Frame = +2

Query  332  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  511
            S +  + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL  V+KAE  +  +
Sbjct  3    SWWTHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLPSVRKAEAQIAGK  62

Query  512  GENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFP  691
              +KEYLPI GLA F K +AEL  G DNEV++ KR  TVQ +SGTG+LR+ A+ ++R+F 
Sbjct  63   NMDKEYLPIGGLAEFCKASAELALGEDNEVLKNKRYVTVQTISGTGALRVGASFLQRFFK  122

Query  692  GSK-VLISSPTWGLH  733
             S+ V +  P+WG H
Sbjct  123  FSRDVYLPKPSWGNH  137



>gb|KDO79734.1| hypothetical protein CISIN_1g0188201mg, partial [Citrus sinensis]
Length=309

 Score =   147 bits (371),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 77/149 (52%), Positives = 99/149 (66%), Gaps = 1/149 (1%)
 Frame = +2

Query  317  ATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAEN  496
            A  N S F  +  AP DPILGV+ A+  D   +KLNLGVGAYRTEE +P VL+VV+KAE 
Sbjct  42   ANQNDSVFSHVVRAPEDPILGVTVAYNKDPSPVKLNLGVGAYRTEEGKPLVLNVVRKAEQ  101

Query  497  -LMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAAL  673
             L+  R   KEYLPI GLA FNK++A+L+ GAD+  I++ RV TVQ LSGTGSLR+ A  
Sbjct  102  QLVNDRSRVKEYLPIVGLAEFNKLSAKLILGADSPAIRENRVTTVQCLSGTGSLRVGAEF  161

Query  674  IERYFPGSKVLISSPTWGLHHSSVVIYGI  760
            + R++    + I  PTWG H     + G+
Sbjct  162  LARHYHQRTIYIPQPTWGNHPKVFTLAGL  190



>gb|KFQ16652.1| hypothetical protein N330_09915, partial [Leptosomus discolor]
Length=401

 Score =   149 bits (377),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 69/135 (51%), Positives = 95/135 (70%), Gaps = 1/135 (1%)
 Frame = +2

Query  332  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  511
            S +  + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE ++  +
Sbjct  2    SWWSHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMIASK  61

Query  512  GENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFP  691
              +KEYLPI GLA F + +AEL  G ++E  +  R  TVQG+SGTGSLR+ A  ++R+F 
Sbjct  62   KMDKEYLPIAGLADFTRASAELALGENSEAFKSGRYVTVQGISGTGSLRIGANFLQRFFK  121

Query  692  GSK-VLISSPTWGLH  733
             S+ V +  P+WG H
Sbjct  122  SSRDVYLPKPSWGNH  136



>ref|XP_005814426.1| PREDICTED: aspartate aminotransferase, mitochondrial-like [Xiphophorus 
maculatus]
Length=428

 Score =   150 bits (378),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 72/141 (51%), Positives = 96/141 (68%), Gaps = 1/141 (1%)
 Frame = +2

Query  314  VATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAE  493
            +++ N S + G+ M PPDPILGV+EAFK DT+  K+NLGVGAYR ++ +P+VL  V+KAE
Sbjct  23   LSSRNSSWWAGVQMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDQGKPFVLSCVRKAE  82

Query  494  NLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAAL  673
             LM  +  +KEYLPI GL  F K  A+L  GADNEV++  R  TVQ +SGTGSLR+    
Sbjct  83   ALMASKQLDKEYLPIGGLGEFTKACAQLALGADNEVLKSGRSITVQTISGTGSLRIGGNY  142

Query  674  IERYFPG-SKVLISSPTWGLH  733
            + R+  G   V +  P+WG H
Sbjct  143  LARFHTGPHDVYLPKPSWGNH  163



>ref|XP_007762781.1| hypothetical protein CONPUDRAFT_78940 [Coniophora puteana RWD-64-598 
SS2]
 gb|EIW86661.1| hypothetical protein CONPUDRAFT_78940 [Coniophora puteana RWD-64-598 
SS2]
Length=410

 Score =   149 bits (377),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 69/136 (51%), Positives = 97/136 (71%), Gaps = 1/136 (1%)
 Frame = +2

Query  329  VSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQ  508
            +S +  +   PPDPILG++EAFKADTD  K+NLGVGAYR E  +PYVL+ VKKAE ++  
Sbjct  6    LSTWSAVPAGPPDPILGITEAFKADTDSRKINLGVGAYRDENGKPYVLNAVKKAEEIITA  65

Query  509  RGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYF  688
               +KEYLPI GLA+F K  A+L +GA++  + Q  VA  Q +SGTG+LR+  A + R++
Sbjct  66   AKLDKEYLPITGLASFTKNAAKLAYGAESVPLNQNAVAVTQAISGTGALRIGGAFLARHY  125

Query  689  PGSK-VLISSPTWGLH  733
            PG+K + + +P+WG H
Sbjct  126  PGAKAIYLPTPSWGNH  141



>gb|KFZ50221.1| hypothetical protein N321_06413, partial [Caprimulgus carolinensis]
Length=401

 Score =   149 bits (376),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 69/135 (51%), Positives = 95/135 (70%), Gaps = 1/135 (1%)
 Frame = +2

Query  332  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  511
            S +  + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE ++  +
Sbjct  2    SWWSHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMIASK  61

Query  512  GENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFP  691
              +KEYLPI GLA F + +AEL  G ++E  +  R  TVQG+SGTGSLR+ A  ++R+F 
Sbjct  62   KMDKEYLPIAGLADFTRASAELALGENSEAFKSGRYVTVQGISGTGSLRIGANFLQRFFK  121

Query  692  GSK-VLISSPTWGLH  733
             S+ V +  P+WG H
Sbjct  122  SSRDVYLPKPSWGNH  136



>ref|XP_007012061.1| Aspartate aminotransferase 3 [Theobroma cacao]
 gb|EOY29680.1| Aspartate aminotransferase 3 [Theobroma cacao]
Length=450

 Score =   150 bits (378),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 75/144 (52%), Positives = 99/144 (69%), Gaps = 1/144 (1%)
 Frame = +2

Query  332  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQ-  508
            S F  +  AP DPILGV+ A+  D   +KLNLGVGAYRTEE +P VL+VV+KAE +++  
Sbjct  49   SVFSHVVRAPEDPILGVTVAYNKDPSPVKLNLGVGAYRTEEGKPLVLNVVRKAEQMLVND  108

Query  509  RGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYF  688
            R   KEYLPI GLA FNK++A+L+FGAD+  I++ RV TVQ LSGTGSLR+ A  + R++
Sbjct  109  RSRVKEYLPIVGLAEFNKLSAKLIFGADSPAIRENRVTTVQCLSGTGSLRVGAEFLARHY  168

Query  689  PGSKVLISSPTWGLHHSSVVIYGI  760
                + I  PTWG H     + G+
Sbjct  169  HQRTIYIPQPTWGNHPKIFTLSGL  192



>gb|KFP71016.1| hypothetical protein N310_05849, partial [Acanthisitta chloris]
Length=401

 Score =   149 bits (376),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 69/135 (51%), Positives = 95/135 (70%), Gaps = 1/135 (1%)
 Frame = +2

Query  332  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  511
            S +  + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE ++  +
Sbjct  2    SWWSHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMIASK  61

Query  512  GENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFP  691
              +KEYLPI GLA F + +AEL  G ++E  +  R  TVQG+SGTGSLR+ A  ++R+F 
Sbjct  62   KMDKEYLPIGGLADFTRASAELALGENSEAFKSGRYVTVQGISGTGSLRIGANFLQRFFK  121

Query  692  GSK-VLISSPTWGLH  733
             S+ V +  P+WG H
Sbjct  122  ASRDVYLPKPSWGNH  136



>ref|XP_009569498.1| PREDICTED: aspartate aminotransferase, mitochondrial [Cuculus 
canorus]
Length=393

 Score =   149 bits (376),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 69/128 (54%), Positives = 92/128 (72%), Gaps = 1/128 (1%)
 Frame = +2

Query  353  MAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENKEYL  532
            M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE +M  +  +KEYL
Sbjct  1    MGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMMASKKMDKEYL  60

Query  533  PIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFPGSK-VLI  709
            PI GLA F + +AEL  G ++E  +  R  TVQG+SGTGSLR+ A  ++R+F  S+ V +
Sbjct  61   PIAGLADFTRASAELALGENSEAFKSGRYVTVQGISGTGSLRIGANFLQRFFKSSRDVYL  120

Query  710  SSPTWGLH  733
              P+WG H
Sbjct  121  PKPSWGNH  128



>ref|XP_006450637.1| hypothetical protein CICLE_v10008274mg [Citrus clementina]
 gb|ESR63877.1| hypothetical protein CICLE_v10008274mg [Citrus clementina]
Length=350

 Score =   148 bits (373),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 77/149 (52%), Positives = 99/149 (66%), Gaps = 1/149 (1%)
 Frame = +2

Query  317  ATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAEN  496
            A  N S F  +  AP DPILGV+ A+  D   +KLNLGVGAYRTEE +P VL+VV+KAE 
Sbjct  42   ANQNDSVFSHVVRAPEDPILGVTVAYNKDPSPLKLNLGVGAYRTEEGKPLVLNVVRKAEQ  101

Query  497  -LMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAAL  673
             L+  R   KEYLPI GLA FNK++A+L+ GAD+  I++ RV TVQ LSGTGSLR+ A  
Sbjct  102  QLVNDRSRVKEYLPIVGLAEFNKLSAKLILGADSPAIRENRVTTVQCLSGTGSLRVGAEF  161

Query  674  IERYFPGSKVLISSPTWGLHHSSVVIYGI  760
            + R++    + I  PTWG H     + G+
Sbjct  162  LARHYHQRTIYIPQPTWGNHPKVFTLAGL  190



>ref|XP_006110233.1| PREDICTED: aspartate aminotransferase, mitochondrial-like [Pelodiscus 
sinensis]
Length=423

 Score =   149 bits (377),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 72/130 (55%), Positives = 94/130 (72%), Gaps = 1/130 (1%)
 Frame = +2

Query  347  ISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENKE  526
            + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE  +  +  +KE
Sbjct  29   VEMGPPDPILGVTEAFKRDTNAKKMNLGVGAYRDDNGKPYVLNSVRKAEAQIAAKKMDKE  88

Query  527  YLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFPGSK-V  703
            YLPI GLA FNK +AEL  G  NEVI+  R  TVQ +SGTGSLR+ A+ ++R+F  S+ V
Sbjct  89   YLPIAGLAEFNKASAELALGDTNEVIKNGRYVTVQTISGTGSLRVGASFLQRFFKYSRDV  148

Query  704  LISSPTWGLH  733
             +  P+WG H
Sbjct  149  YLPKPSWGNH  158



>ref|XP_008292179.1| PREDICTED: aspartate aminotransferase, mitochondrial [Stegastes 
partitus]
Length=428

 Score =   149 bits (377),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 76/155 (49%), Positives = 103/155 (66%), Gaps = 4/155 (3%)
 Frame = +2

Query  272  LFGNATKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTE  451
              GN + S G   +++T N S + G+ M PPDPILGV+EAFK DT+  K+NLGVGAYR +
Sbjct  12   CLGNISPSLG---VLSTRNSSWWGGVQMGPPDPILGVTEAFKRDTNPKKMNLGVGAYRDD  68

Query  452  ELQPYVLDVVKKAENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQ  631
            + +P+VL  V+KAE L+  +  +KEYLPI GL  F K  A+L  G DNEV++  R  TVQ
Sbjct  69   QGKPFVLSCVRKAEALIAAKQLDKEYLPIGGLGDFTKACAQLALGNDNEVLKSGRNITVQ  128

Query  632  GLSGTGSLRLAAALIERYFPGSK-VLISSPTWGLH  733
             +SGTGSLR+ A  + R+  G + V +  P+WG H
Sbjct  129  TISGTGSLRIGANFLSRFHGGPRDVYLPKPSWGNH  163



>emb|CCO28282.1| aspartate aminotransferase [Rhizoctonia solani AG-1 IB]
Length=179

 Score =   143 bits (361),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 66/143 (46%), Positives = 95/143 (66%), Gaps = 1/143 (1%)
 Frame = +2

Query  308  RMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKK  487
            R+     VS +  +   PPDPILGVSEAFKAD D  K+NLGVGAYR +  +PY+L  V+ 
Sbjct  16   RLSLRAGVSTWANVPAGPPDPILGVSEAFKADKDSRKINLGVGAYRDDSGKPYILPSVQA  75

Query  488  AENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAA  667
            AE+ +     +KEYLPI GLA F K+ A+L +G+D+    + R+A  Q +SGTG+LR+  
Sbjct  76   AEDKIAASKADKEYLPITGLADFTKLAAKLAYGSDSAPFSEGRIAVTQSISGTGALRIGG  135

Query  668  ALIERYFPGSK-VLISSPTWGLH  733
            A + R++P +K + + +P+WG H
Sbjct  136  AFLARHYPHAKTIYLPTPSWGNH  158



>gb|EMP28841.1| Aspartate aminotransferase [Chelonia mydas]
Length=388

 Score =   149 bits (375),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 72/135 (53%), Positives = 95/135 (70%), Gaps = 1/135 (1%)
 Frame = +2

Query  332  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  511
            S +  + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE  +  +
Sbjct  13   SWWSHVEMGPPDPILGVTEAFKRDTNAKKMNLGVGAYRDDNGKPYVLNSVRKAEAQIAAK  72

Query  512  GENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFP  691
              +KEYLPI GLA FNK +AEL  G  NEVI+  R  TVQ +SGTGSLR+  + ++R+F 
Sbjct  73   KMDKEYLPIAGLAEFNKASAELALGDTNEVIKNGRYVTVQTISGTGSLRVGGSFLQRFFK  132

Query  692  GSK-VLISSPTWGLH  733
             S+ V +  P+WG H
Sbjct  133  YSRDVYLPKPSWGNH  147



>gb|KFP55374.1| hypothetical protein N322_09365, partial [Cariama cristata]
Length=401

 Score =   149 bits (376),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 69/135 (51%), Positives = 95/135 (70%), Gaps = 1/135 (1%)
 Frame = +2

Query  332  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  511
            S +  + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE ++  +
Sbjct  2    SWWSHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMIASK  61

Query  512  GENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFP  691
              +KEYLPI GLA F + +AEL  G ++E  +  R  TVQG+SGTGSLR+ A  ++R+F 
Sbjct  62   KMDKEYLPIAGLADFTRASAELALGENSEAFKSGRYVTVQGISGTGSLRVGANFLQRFFK  121

Query  692  GSK-VLISSPTWGLH  733
             S+ V +  P+WG H
Sbjct  122  SSRDVYLPKPSWGNH  136



>gb|KDP33689.1| hypothetical protein JCGZ_07260 [Jatropha curcas]
Length=407

 Score =   149 bits (376),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 75/144 (52%), Positives = 98/144 (68%), Gaps = 1/144 (1%)
 Frame = +2

Query  332  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQ-  508
            S F  I  AP DPILGV+ A+  DT   KLNLGVGAYRTEE +P VL+VV+KAE +++  
Sbjct  5    SVFSNIVRAPEDPILGVTVAYNKDTSPNKLNLGVGAYRTEEGKPLVLNVVRKAEQILVND  64

Query  509  RGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYF  688
            +   KEYLPI GLA FNK++A+L+ GAD+  IQ+ R+ TVQGLSGTGSLR+    + R++
Sbjct  65   QSRVKEYLPIVGLADFNKLSAKLILGADSPAIQENRITTVQGLSGTGSLRVGGEFLARHY  124

Query  689  PGSKVLISSPTWGLHHSSVVIYGI  760
                + I  PTWG H     + G+
Sbjct  125  HQLTIYIPQPTWGNHTKVFTLAGL  148



>gb|KFO97280.1| hypothetical protein N300_07039, partial [Calypte anna]
Length=401

 Score =   149 bits (376),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 69/135 (51%), Positives = 95/135 (70%), Gaps = 1/135 (1%)
 Frame = +2

Query  332  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  511
            S +  + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE ++  +
Sbjct  2    SWWSHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMIASK  61

Query  512  GENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFP  691
              +KEYLPI GLA F + +AEL  G ++E  +  R  TVQG+SGTGSLR+ A  ++R+F 
Sbjct  62   KMDKEYLPIGGLADFTRASAELALGENSEAFKNGRYVTVQGISGTGSLRIGANFLQRFFK  121

Query  692  GSK-VLISSPTWGLH  733
             S+ V +  P+WG H
Sbjct  122  SSRDVYLPKPSWGNH  136



>sp|P28734.1|AATC_DAUCA RecName: Full=Aspartate aminotransferase, cytoplasmic; AltName: 
Full=Transaminase A [Daucus carota]
 gb|AAA33134.1| aspartate aminotransferase [Daucus carota]
 prf||1909339A Asp aminotransferase
Length=405

 Score =   149 bits (376),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 77/144 (53%), Positives = 98/144 (68%), Gaps = 1/144 (1%)
 Frame = +2

Query  332  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQ-  508
            S F  +  AP DPILGV+ A+  D    KLNLGVGAYRTEE +P VL+VVKKAE +++  
Sbjct  3    SVFANVVRAPEDPILGVTVAYHKDQSPNKLNLGVGAYRTEEGKPLVLNVVKKAEQMLVND  62

Query  509  RGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYF  688
            +   KEYLPI GLA FNK++A+L+FGAD+  IQ+ RVATVQ LSGTGSLR+    + R++
Sbjct  63   QSRVKEYLPIVGLADFNKLSAKLIFGADSPAIQENRVATVQCLSGTGSLRVGGEFLARHY  122

Query  689  PGSKVLISSPTWGLHHSSVVIYGI  760
                V I  PTWG H     + G+
Sbjct  123  HEHTVYIPQPTWGNHPKIFTLAGL  146



>gb|KFV01058.1| hypothetical protein N339_06116, partial [Pterocles gutturalis]
Length=401

 Score =   149 bits (375),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 70/135 (52%), Positives = 94/135 (70%), Gaps = 1/135 (1%)
 Frame = +2

Query  332  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  511
            S +  + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE  +  +
Sbjct  2    SWWSHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEATIASK  61

Query  512  GENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFP  691
              +KEYLPI GLA F + +AEL  G ++E  +  R  TVQG+SGTGSLR+ A  ++R+F 
Sbjct  62   KMDKEYLPIGGLADFTRASAELALGENSEAFKSGRYVTVQGISGTGSLRIGANFLQRFFK  121

Query  692  GSK-VLISSPTWGLH  733
             S+ V +  PTWG H
Sbjct  122  ASRDVYLPKPTWGNH  136



>gb|KGL91867.1| hypothetical protein N301_16701, partial [Charadrius vociferus]
Length=401

 Score =   149 bits (375),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 69/135 (51%), Positives = 95/135 (70%), Gaps = 1/135 (1%)
 Frame = +2

Query  332  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  511
            S +  + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE ++  +
Sbjct  2    SWWSHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMIASK  61

Query  512  GENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFP  691
              +KEYLPI GLA F + +AEL  G ++E  +  R  TVQG+SGTGSLR+ A  ++R+F 
Sbjct  62   KMDKEYLPIGGLADFTRASAELALGENSEAFKSGRYVTVQGISGTGSLRIGANFLQRFFK  121

Query  692  GSK-VLISSPTWGLH  733
             S+ V +  P+WG H
Sbjct  122  SSRDVYLPKPSWGNH  136



>ref|XP_009870982.1| PREDICTED: LOW QUALITY PROTEIN: aspartate aminotransferase, mitochondrial 
[Apaloderma vittatum]
Length=390

 Score =   149 bits (375),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 69/128 (54%), Positives = 92/128 (72%), Gaps = 1/128 (1%)
 Frame = +2

Query  353  MAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENKEYL  532
            M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE +M  +  +KEYL
Sbjct  1    MGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAIMASKKMDKEYL  60

Query  533  PIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFPGSK-VLI  709
            PI GLA F + +AEL  G ++E  +  R  TVQG+SGTGSLR+ A  ++R+F  S+ V +
Sbjct  61   PIGGLADFTRASAELALGENSEAFKSGRYVTVQGISGTGSLRIGANFLQRFFKASRDVYL  120

Query  710  SSPTWGLH  733
              P+WG H
Sbjct  121  PKPSWGNH  128



>gb|KFR02997.1| hypothetical protein Y956_09274, partial [Nipponia nippon]
Length=401

 Score =   149 bits (375),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 69/135 (51%), Positives = 95/135 (70%), Gaps = 1/135 (1%)
 Frame = +2

Query  332  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  511
            S +  + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE ++  +
Sbjct  2    SWWSHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMIASK  61

Query  512  GENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFP  691
              +KEYLPI GLA F + +AEL  G ++E  +  R  TVQG+SGTGSLR+ A  ++R+F 
Sbjct  62   KMDKEYLPIGGLADFTRASAELALGENSEAFKSGRYVTVQGISGTGSLRIGANFLQRFFK  121

Query  692  GSK-VLISSPTWGLH  733
             S+ V +  P+WG H
Sbjct  122  ASRDVYLPKPSWGNH  136



>dbj|BAC56407.1| similar to aspartate aminotransferase [Bos taurus]
Length=173

 Score =   143 bits (360),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 69/130 (53%), Positives = 92/130 (71%), Gaps = 1/130 (1%)
 Frame = +2

Query  347  ISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENKE  526
            + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL  V+KAE  +  +  +KE
Sbjct  36   VEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLPSVRKAEAQIAAKNLDKE  95

Query  527  YLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFPGSK-V  703
            YLPI GLA F K +AEL  G +NEV++  R  TVQ +SGTG+LR+ A+ ++R+F  S+ V
Sbjct  96   YLPIAGLAEFCKASAELALGENNEVLKSGRYVTVQTISGTGALRIGASFLQRFFKFSRDV  155

Query  704  LISSPTWGLH  733
             +   TWG H
Sbjct  156  FLPKTTWGNH  165



>ref|XP_010127976.1| PREDICTED: aspartate aminotransferase, mitochondrial [Chlamydotis 
macqueenii]
Length=393

 Score =   149 bits (375),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 69/128 (54%), Positives = 91/128 (71%), Gaps = 1/128 (1%)
 Frame = +2

Query  353  MAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENKEYL  532
            M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL  V+KAE ++  +  +KEYL
Sbjct  1    MGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLSCVRKAEAMIASKKMDKEYL  60

Query  533  PIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFPGSK-VLI  709
            PI GLA F + +AEL  G +NE  +  R  TVQG+SGTGSLR+ A  ++R+F  S+ V +
Sbjct  61   PIAGLADFTRASAELALGENNEAFKSGRYVTVQGISGTGSLRIGANFLQRFFKSSRDVYL  120

Query  710  SSPTWGLH  733
              P+WG H
Sbjct  121  PKPSWGNH  128



>ref|XP_006020296.1| PREDICTED: aspartate aminotransferase, mitochondrial, partial 
[Alligator sinensis]
Length=418

 Score =   149 bits (376),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 71/130 (55%), Positives = 93/130 (72%), Gaps = 1/130 (1%)
 Frame = +2

Query  347  ISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENKE  526
            + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE  +  +  +KE
Sbjct  24   VEMGPPDPILGVTEAFKRDTNAKKMNLGVGAYRDDNGKPYVLNCVRKAEAQIAAKKMDKE  83

Query  527  YLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFPGSK-V  703
            YLPI GLA FNK +AEL  G  +EVI+  R  TVQ +SGTGSLR+ A  ++R+F  S+ V
Sbjct  84   YLPIAGLAEFNKASAELALGETSEVIKNGRYVTVQSISGTGSLRIGANFLQRFFKSSRDV  143

Query  704  LISSPTWGLH  733
             +  P+WG H
Sbjct  144  YLPKPSWGNH  153



>gb|KFV00678.1| hypothetical protein N340_11396, partial [Tauraco erythrolophus]
Length=401

 Score =   149 bits (375),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 69/135 (51%), Positives = 95/135 (70%), Gaps = 1/135 (1%)
 Frame = +2

Query  332  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  511
            S +  + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE ++  +
Sbjct  2    SWWSHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMIASK  61

Query  512  GENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFP  691
              +KEYLPI GLA F + +AEL  G ++E  +  R  TVQG+SGTGSLR+ A  ++R+F 
Sbjct  62   KMDKEYLPIGGLADFTRASAELALGENSEAFKSGRYVTVQGISGTGSLRIGANFLQRFFK  121

Query  692  GSK-VLISSPTWGLH  733
             S+ V +  P+WG H
Sbjct  122  SSRDVYLPKPSWGNH  136



>ref|XP_009583475.1| PREDICTED: aspartate aminotransferase, mitochondrial, partial 
[Fulmarus glacialis]
Length=301

 Score =   146 bits (369),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 68/128 (53%), Positives = 92/128 (72%), Gaps = 1/128 (1%)
 Frame = +2

Query  353  MAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENKEYL  532
            M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE ++  +  +KEYL
Sbjct  1    MGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMIASKKMDKEYL  60

Query  533  PIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFPGSK-VLI  709
            PI GLA F + +AEL  G ++E  +  R  TVQG+SGTGSLR+ A  ++R+F  S+ V +
Sbjct  61   PIGGLADFTRASAELALGENSEAFKSGRYVTVQGISGTGSLRIGANFLQRFFKSSRDVYL  120

Query  710  SSPTWGLH  733
              P+WG H
Sbjct  121  PKPSWGNH  128



>gb|KFQ68668.1| hypothetical protein N335_07592, partial [Phaethon lepturus]
Length=401

 Score =   149 bits (375),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 69/135 (51%), Positives = 95/135 (70%), Gaps = 1/135 (1%)
 Frame = +2

Query  332  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  511
            S +  + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE ++  +
Sbjct  2    SWWSHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMIASK  61

Query  512  GENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFP  691
              +KEYLPI GLA F + +AEL  G ++E  +  R  TVQG+SGTGSLR+ A  ++R+F 
Sbjct  62   KMDKEYLPIGGLADFTRASAELALGENSEAFKSGRYVTVQGISGTGSLRIGANFLQRFFK  121

Query  692  GSK-VLISSPTWGLH  733
             S+ V +  P+WG H
Sbjct  122  SSRDVYLPKPSWGNH  136



>gb|KFV53116.1| hypothetical protein N328_06671, partial [Gavia stellata]
Length=401

 Score =   149 bits (375),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 69/135 (51%), Positives = 95/135 (70%), Gaps = 1/135 (1%)
 Frame = +2

Query  332  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  511
            S +  + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE ++  +
Sbjct  2    SWWSHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMIASK  61

Query  512  GENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFP  691
              +KEYLPI GLA F + +AEL  G ++E  +  R  TVQG+SGTGSLR+ A  ++R+F 
Sbjct  62   KMDKEYLPIGGLADFTRASAELALGENSEAFKSGRYVTVQGISGTGSLRIGANFLQRFFK  121

Query  692  GSK-VLISSPTWGLH  733
             S+ V +  P+WG H
Sbjct  122  SSRDVYLPKPSWGNH  136



>gb|KFW71608.1| hypothetical protein AS28_11098, partial [Pygoscelis adeliae]
Length=401

 Score =   149 bits (375),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 69/135 (51%), Positives = 95/135 (70%), Gaps = 1/135 (1%)
 Frame = +2

Query  332  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  511
            S +  + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE ++  +
Sbjct  2    SWWSHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMIASK  61

Query  512  GENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFP  691
              +KEYLPI GLA F + +AEL  G ++E  +  R  TVQG+SGTGSLR+ A  ++R+F 
Sbjct  62   KMDKEYLPIGGLADFTRASAELALGENSEAFKSGRYVTVQGISGTGSLRIGANFLQRFFK  121

Query  692  GSK-VLISSPTWGLH  733
             S+ V +  P+WG H
Sbjct  122  SSRDVYLPKPSWGNH  136



>gb|KFQ42654.1| hypothetical protein N333_09691, partial [Nestor notabilis]
Length=401

 Score =   149 bits (375),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 69/135 (51%), Positives = 95/135 (70%), Gaps = 1/135 (1%)
 Frame = +2

Query  332  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  511
            S +  + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE ++  +
Sbjct  2    SWWSHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDSGKPYVLNCVRKAEAMIASK  61

Query  512  GENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFP  691
              +KEYLPI GLA F + +AEL  G ++E  +  R  TVQG+SGTGSLR+ A  ++R+F 
Sbjct  62   KMDKEYLPIVGLADFTRASAELALGENSEAFKSGRYVTVQGISGTGSLRIGANFLQRFFK  121

Query  692  GSK-VLISSPTWGLH  733
             S+ V +  P+WG H
Sbjct  122  SSRDVYLPKPSWGNH  136



>gb|KFP56730.1| hypothetical protein N323_06988, partial [Cathartes aura]
Length=401

 Score =   149 bits (375),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 69/135 (51%), Positives = 94/135 (70%), Gaps = 1/135 (1%)
 Frame = +2

Query  332  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  511
            S +  + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL  V+KAE ++  +
Sbjct  2    SWWSHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLSCVRKAEAMIASK  61

Query  512  GENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFP  691
              +KEYLPI GLA F + +AEL  G ++E  +  R  TVQG+SGTGSLR+ A  ++R+F 
Sbjct  62   KMDKEYLPIAGLADFTRASAELALGENSEAFKSGRYVTVQGISGTGSLRIGANFLQRFFK  121

Query  692  GSK-VLISSPTWGLH  733
             S+ V +  P+WG H
Sbjct  122  SSRDVYLPKPSWGNH  136



>gb|EFB22248.1| hypothetical protein PANDA_000063 [Ailuropoda melanoleuca]
Length=401

 Score =   149 bits (375),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 71/135 (53%), Positives = 96/135 (71%), Gaps = 1/135 (1%)
 Frame = +2

Query  332  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  511
            S +  + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL  V+KAE  +  +
Sbjct  2    SWWTHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLPSVRKAEAQIAAK  61

Query  512  GENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFP  691
              +KEYLPI GLA F K +AEL  G +NEV++  R ATVQ +SGTG+LR+ A+ ++R+F 
Sbjct  62   NLDKEYLPIAGLAEFCKASAELALGENNEVLKSSRYATVQTISGTGALRIGASFLQRFFK  121

Query  692  GSK-VLISSPTWGLH  733
             S+ V +  P+WG H
Sbjct  122  FSRDVFLPKPSWGNH  136



>ref|NP_001141224.1| uncharacterized protein LOC100273311 [Zea mays]
 gb|ACF85765.1| unknown [Zea mays]
 tpg|DAA57530.1| TPA: aspartate aminotransferase [Zea mays]
Length=459

 Score =   149 bits (377),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 76/161 (47%), Positives = 105/161 (65%), Gaps = 1/161 (1%)
 Frame = +2

Query  281  NATKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQ  460
            +AT +      +A+   S F  +  AP DPILGV+ A+  D   +K+NLGVGAYRTEE +
Sbjct  40   SATSTLESFPTMASQGSSVFAALEQAPEDPILGVTVAYNKDPSPVKVNLGVGAYRTEEGK  99

Query  461  PYVLDVVKKAENLMLQRGEN-KEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGL  637
            P VL+VV++AE +++      KEYLPI GLA FNK++A+L+FGAD+  IQ+ RVATVQ L
Sbjct  100  PLVLNVVRRAEQMLINNPSRVKEYLPITGLAEFNKLSAKLIFGADSPAIQENRVATVQCL  159

Query  638  SGTGSLRLAAALIERYFPGSKVLISSPTWGLHHSSVVIYGI  760
            SGTGSLR+    + R++    + I  PTWG H     + G+
Sbjct  160  SGTGSLRVGGEFLARHYHERTIYIPQPTWGNHPKVFTLSGL  200



>gb|KFQ73258.1| hypothetical protein N337_00339, partial [Phoenicopterus ruber 
ruber]
Length=401

 Score =   149 bits (375),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 69/135 (51%), Positives = 95/135 (70%), Gaps = 1/135 (1%)
 Frame = +2

Query  332  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  511
            S +  + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE ++  +
Sbjct  2    SWWSHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMIASK  61

Query  512  GENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFP  691
              +KEYLPI GLA F + +AEL  G ++E  +  R  TVQG+SGTGSLR+ A  ++R+F 
Sbjct  62   KMDKEYLPIVGLADFTRASAELALGENSEAFKSGRYVTVQGISGTGSLRIGANFLQRFFK  121

Query  692  GSK-VLISSPTWGLH  733
             S+ V +  P+WG H
Sbjct  122  SSRDVYLPKPSWGNH  136



>ref|XP_011078312.1| PREDICTED: aspartate aminotransferase, cytoplasmic [Sesamum indicum]
Length=406

 Score =   149 bits (375),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 74/144 (51%), Positives = 99/144 (69%), Gaps = 1/144 (1%)
 Frame = +2

Query  332  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQ-  508
            S F  +  AP DPILGV+ A+  D   +KLNLGVGAYRTEE +P VL+VV+KAE +++  
Sbjct  4    SVFASVVQAPEDPILGVTVAYNKDQSPVKLNLGVGAYRTEEGKPLVLNVVRKAEQMLVND  63

Query  509  RGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYF  688
            +   KEYLPI GLA FNK++A+L+FGA++  IQ+ RV TVQ LSGTGSLR+ A  + R++
Sbjct  64   QSRVKEYLPITGLADFNKLSAKLIFGANSPAIQENRVTTVQCLSGTGSLRVGAEFLARHY  123

Query  689  PGSKVLISSPTWGLHHSSVVIYGI  760
                + I  PTWG H     + G+
Sbjct  124  HEKTIYIPQPTWGNHPKVFTLAGL  147



>ref|XP_006450635.1| hypothetical protein CICLE_v10008274mg [Citrus clementina]
 gb|ESR63875.1| hypothetical protein CICLE_v10008274mg [Citrus clementina]
Length=386

 Score =   148 bits (373),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 77/149 (52%), Positives = 99/149 (66%), Gaps = 1/149 (1%)
 Frame = +2

Query  317  ATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAEN  496
            A  N S F  +  AP DPILGV+ A+  D   +KLNLGVGAYRTEE +P VL+VV+KAE 
Sbjct  42   ANQNDSVFSHVVRAPEDPILGVTVAYNKDPSPLKLNLGVGAYRTEEGKPLVLNVVRKAEQ  101

Query  497  -LMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAAL  673
             L+  R   KEYLPI GLA FNK++A+L+ GAD+  I++ RV TVQ LSGTGSLR+ A  
Sbjct  102  QLVNDRSRVKEYLPIVGLAEFNKLSAKLILGADSPAIRENRVTTVQCLSGTGSLRVGAEF  161

Query  674  IERYFPGSKVLISSPTWGLHHSSVVIYGI  760
            + R++    + I  PTWG H     + G+
Sbjct  162  LARHYHQRTIYIPQPTWGNHPKVFTLAGL  190



>ref|XP_009595013.1| PREDICTED: aspartate aminotransferase, cytoplasmic [Nicotiana 
tomentosiformis]
Length=448

 Score =   149 bits (376),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 76/144 (53%), Positives = 98/144 (68%), Gaps = 1/144 (1%)
 Frame = +2

Query  332  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQ-  508
            S F  I  AP DPILGV+ A+  D+  MKLNLGVGAYRTEE +P VL+VV++AE L++  
Sbjct  46   SVFSHIVRAPEDPILGVTIAYNKDSSPMKLNLGVGAYRTEEGKPLVLNVVRQAEQLLVND  105

Query  509  RGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYF  688
            R   KEYL I GLA FNK++A+L+ GAD+  IQ+ RV TVQ LSGTGSLR+ A  + R++
Sbjct  106  RSRVKEYLSITGLADFNKLSAKLILGADSPAIQENRVTTVQCLSGTGSLRVGAEFLARHY  165

Query  689  PGSKVLISSPTWGLHHSSVVIYGI  760
                + I  PTWG H     + G+
Sbjct  166  HQRTIYIPQPTWGNHPKVFTLAGL  189



>ref|XP_002324997.1| aspartate aminotransferase family protein [Populus trichocarpa]
 gb|ABK95824.1| unknown [Populus trichocarpa]
 gb|EEF03562.1| aspartate aminotransferase family protein [Populus trichocarpa]
Length=407

 Score =   148 bits (374),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 74/135 (55%), Positives = 96/135 (71%), Gaps = 1/135 (1%)
 Frame = +2

Query  332  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  511
            S F  I  AP DPILGV+ A+  D+   KLNLGVGAYRTEE +P VL+VV++AE +++  
Sbjct  5    SVFANIVRAPEDPILGVTVAYNKDSSPHKLNLGVGAYRTEEGKPLVLNVVRRAEQMLVND  64

Query  512  GEN-KEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYF  688
                KEYLPI GLA FNK++A+L+FGAD+  IQ+ RV TVQ LSGTGSLR+ A  + R++
Sbjct  65   SSRVKEYLPIVGLADFNKLSAKLIFGADSPAIQENRVTTVQCLSGTGSLRVGAEFLARHY  124

Query  689  PGSKVLISSPTWGLH  733
                + I +PTWG H
Sbjct  125  HQLVIYIPNPTWGNH  139



>ref|XP_011048396.1| PREDICTED: aspartate aminotransferase, cytoplasmic-like [Populus 
euphratica]
Length=407

 Score =   148 bits (374),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 74/135 (55%), Positives = 96/135 (71%), Gaps = 1/135 (1%)
 Frame = +2

Query  332  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  511
            S F  I  AP DPILGV+ A+  D+   KLNLGVGAYRTEE +P VL+VV++AE +++  
Sbjct  5    SVFANIVRAPEDPILGVTVAYNKDSSPHKLNLGVGAYRTEEGKPLVLNVVRRAEQMLVND  64

Query  512  GEN-KEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYF  688
                KEYLPI GLA FNK++A+L+FGAD+  IQ+ RV TVQ LSGTGSLR+ A  + R++
Sbjct  65   SSRVKEYLPIVGLADFNKLSAKLIFGADSPAIQENRVTTVQCLSGTGSLRVGAEFLARHY  124

Query  689  PGSKVLISSPTWGLH  733
                + I +PTWG H
Sbjct  125  HQLVIYIPNPTWGNH  139



>ref|XP_009782665.1| PREDICTED: aspartate aminotransferase, cytoplasmic [Nicotiana 
sylvestris]
Length=450

 Score =   149 bits (376),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 76/144 (53%), Positives = 98/144 (68%), Gaps = 1/144 (1%)
 Frame = +2

Query  332  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQ-  508
            S F  I  AP DPILGV+ A+  D+  MKLNLGVGAYRTEE +P VL+VV++AE L++  
Sbjct  48   SVFSHIVRAPEDPILGVTIAYNKDSSPMKLNLGVGAYRTEEGKPLVLNVVRQAEQLLVND  107

Query  509  RGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYF  688
            R   KEYL I GLA FNK++A+L+ GAD+  IQ+ RV TVQ LSGTGSLR+ A  + R++
Sbjct  108  RSRVKEYLSITGLADFNKLSAKLILGADSPAIQENRVTTVQCLSGTGSLRVGAEFLARHY  167

Query  689  PGSKVLISSPTWGLHHSSVVIYGI  760
                + I  PTWG H     + G+
Sbjct  168  HQRTIYIPQPTWGNHPKVFTLAGL  191



>ref|XP_008308463.1| PREDICTED: aspartate aminotransferase, mitochondrial [Cynoglossus 
semilaevis]
Length=428

 Score =   149 bits (375),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 75/158 (47%), Positives = 108/158 (68%), Gaps = 6/158 (4%)
 Frame = +2

Query  263  QCTLFGNATKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAY  442
            QC   GN + + G   ++++ + S + G+ M PPDPILGV+EAFK D++  K+NLGVGAY
Sbjct  11   QC--LGNISPALG---VLSSRHSSWWGGVQMGPPDPILGVTEAFKRDSNPKKMNLGVGAY  65

Query  443  RTEELQPYVLDVVKKAENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVA  622
            R ++ +P+VL  V+KAE L+  +  +KEYLPI GL  FNK  A+L  GA+NEV++  R  
Sbjct  66   RDDQGKPFVLSCVRKAEALIAAKQLDKEYLPIGGLGEFNKACAQLALGAENEVLKSGRNI  125

Query  623  TVQGLSGTGSLRLAAALIERYFPGSK-VLISSPTWGLH  733
            TVQ +SGTGSLR+ A  + R+  G++ V +  P+WG H
Sbjct  126  TVQTISGTGSLRIGANFLSRFHGGARDVYLPKPSWGNH  163



>ref|XP_011043495.1| PREDICTED: aspartate aminotransferase, cytoplasmic [Populus euphratica]
 ref|XP_011014875.1| PREDICTED: aspartate aminotransferase, cytoplasmic [Populus euphratica]
Length=407

 Score =   148 bits (374),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 74/135 (55%), Positives = 96/135 (71%), Gaps = 1/135 (1%)
 Frame = +2

Query  332  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  511
            S F  I  AP DPILGV+ A+  D+   KLNLGVGAYRTEE +P VL+VV++AE +++  
Sbjct  5    SVFANIVRAPEDPILGVTVAYNKDSSPHKLNLGVGAYRTEEGKPLVLNVVRRAEQMLVND  64

Query  512  GEN-KEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYF  688
                KEYLPI GLA FNK++A+L+FGAD+  IQ+ RV TVQ LSGTGSLR+ A  + R++
Sbjct  65   SSRVKEYLPIVGLADFNKLSAKLIFGADSPAIQENRVTTVQCLSGTGSLRVGAEFLARHY  124

Query  689  PGSKVLISSPTWGLH  733
                + I +PTWG H
Sbjct  125  HQLVIYIPNPTWGNH  139



>gb|KIM24154.1| hypothetical protein M408DRAFT_76285 [Serendipita vermifera MAFF 
305830]
Length=424

 Score =   149 bits (375),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 73/153 (48%), Positives = 102/153 (67%), Gaps = 10/153 (7%)
 Frame = +2

Query  302  RMRMVATVNVSR--------FEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEEL  457
            R R  +   V+R        + G+   PPDPILGV+EAFKA+T   K+NLGVGAYR E  
Sbjct  3    RARFASKFTVARVPRALASTWAGVPAGPPDPILGVTEAFKANTSPKKINLGVGAYRDEAG  62

Query  458  QPYVLDVVKKAENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGL  637
            +PY+L  VKKAE L+  +  +KEYLPI GL+ F  + A+L +GAD+ +++  R+A  Q +
Sbjct  63   KPYILPSVKKAEELLAGK-NDKEYLPITGLSDFTSLAAKLAYGADSALLKDGRIAVTQSI  121

Query  638  SGTGSLRLAAALIERYFPGSKVL-ISSPTWGLH  733
            SGTG+LR+  A  ER++PG KV+ + +PTWG H
Sbjct  122  SGTGALRIGGAFFERHYPGPKVIYLPTPTWGNH  154



>ref|XP_007549969.1| PREDICTED: aspartate aminotransferase, mitochondrial [Poecilia 
formosa]
Length=428

 Score =   148 bits (374),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 71/141 (50%), Positives = 95/141 (67%), Gaps = 1/141 (1%)
 Frame = +2

Query  314  VATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAE  493
            +++ N S + G+ M PPDPILGV+EAFK DT+  K+NLGVGAYR ++ +P+VL  V+KAE
Sbjct  23   LSSRNSSWWAGVQMGPPDPILGVTEAFKRDTNPKKMNLGVGAYRDDQGKPFVLSCVRKAE  82

Query  494  NLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAAL  673
             LM  +  +KEYLPI G   F K  A+L  GADNEV++  R  TVQ +SGTGSLR+    
Sbjct  83   ALMASKQLDKEYLPIGGFGEFTKACAQLALGADNEVLKSGRSVTVQTISGTGSLRIGGNY  142

Query  674  IERYFPG-SKVLISSPTWGLH  733
            + R+  G   V +  P+WG H
Sbjct  143  LARFHTGPHDVYLPKPSWGNH  163



>gb|EOA96948.1| Aspartate aminotransferase, mitochondrial, partial [Anas platyrhynchos]
Length=402

 Score =   148 bits (373),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 69/135 (51%), Positives = 94/135 (70%), Gaps = 1/135 (1%)
 Frame = +2

Query  332  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  511
            S +  + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL  V+KAE ++  +
Sbjct  3    SWWSHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLSCVRKAEAMIASK  62

Query  512  GENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFP  691
              +KEYLPI GLA F + +AEL  G ++E  +  R  TVQG+SGTGSLR+ A  ++R+F 
Sbjct  63   KMDKEYLPIGGLADFTRASAELALGENSEAFKSGRYVTVQGISGTGSLRIGANFLQRFFK  122

Query  692  GSK-VLISSPTWGLH  733
             S+ V +  P+WG H
Sbjct  123  SSRDVYLPKPSWGNH  137



>gb|KJB07521.1| hypothetical protein B456_001G028100 [Gossypium raimondii]
Length=452

 Score =   149 bits (375),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 74/144 (51%), Positives = 99/144 (69%), Gaps = 1/144 (1%)
 Frame = +2

Query  332  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQ-  508
            S F  +  AP DPILGV+ A+  D   +KLNLGVGAYRTEE +P VL+VV+KAE ++L  
Sbjct  50   SVFSHVVRAPEDPILGVTVAYNKDPSPVKLNLGVGAYRTEEGKPLVLNVVRKAEQMLLND  109

Query  509  RGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYF  688
            +   KEYLPI G+A FNK++A+L+FGAD+  I++ RV TVQ LSGTGSLR+ A  + R++
Sbjct  110  KSRVKEYLPIVGIAEFNKLSAKLIFGADSPAIRENRVTTVQCLSGTGSLRVGAEFLARHY  169

Query  689  PGSKVLISSPTWGLHHSSVVIYGI  760
                + I  PTWG H     + G+
Sbjct  170  HQKTIYIPQPTWGNHPKVFTLAGL  193



>ref|XP_006366212.1| PREDICTED: aspartate aminotransferase, chloroplastic-like [Solanum 
tuberosum]
Length=453

 Score =   149 bits (375),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 75/135 (56%), Positives = 95/135 (70%), Gaps = 1/135 (1%)
 Frame = +2

Query  332  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQ-  508
            S F  I  AP DPILGV+ A+  DT  +KLNLGVGAYRTEE +P VL+VV+KAE L++  
Sbjct  51   SVFSHIVRAPEDPILGVTVAYNKDTSPVKLNLGVGAYRTEEGKPLVLNVVRKAEQLLVND  110

Query  509  RGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYF  688
            R   KEYLPI GLA FNK++A+L+ GAD+  IQ+ RV TVQ LSGTGSLR+    + +++
Sbjct  111  RSRIKEYLPIVGLADFNKLSAKLILGADSPAIQENRVTTVQCLSGTGSLRVGGEFLAQHY  170

Query  689  PGSKVLISSPTWGLH  733
                + I  PTWG H
Sbjct  171  HQRTIYIPQPTWGNH  185



>gb|AEX09183.1| putative aspartate aminotransferase 2 [Gossypium hirsutum]
Length=452

 Score =   149 bits (375),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 74/144 (51%), Positives = 99/144 (69%), Gaps = 1/144 (1%)
 Frame = +2

Query  332  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQ-  508
            S F  +  AP DPILGV+ A+  D   +KLNLGVGAYRTEE +P VL+VV+KAE ++L  
Sbjct  50   SVFSHVVRAPEDPILGVTVAYNKDPSPVKLNLGVGAYRTEEGKPLVLNVVRKAEQMLLND  109

Query  509  RGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYF  688
            +   KEYLPI G+A FNK++A+L+FGAD+  I++ RV TVQ LSGTGSLR+ A  + R++
Sbjct  110  KSRVKEYLPIVGIAEFNKLSAKLIFGADSPAIRENRVTTVQCLSGTGSLRVGAEFLARHY  169

Query  689  PGSKVLISSPTWGLHHSSVVIYGI  760
                + I  PTWG H     + G+
Sbjct  170  HQKTIYIPQPTWGNHPKVFTLAGL  193



>gb|KFV92257.1| hypothetical protein N326_05957, partial [Eurypyga helias]
Length=401

 Score =   148 bits (373),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 69/135 (51%), Positives = 94/135 (70%), Gaps = 1/135 (1%)
 Frame = +2

Query  332  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  511
            S +  + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL  V+KAE ++  +
Sbjct  2    SWWSHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLSCVRKAEAMIASK  61

Query  512  GENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFP  691
              +KEYLPI GLA F + +AEL  G ++E  +  R  TVQG+SGTGSLR+ A  ++R+F 
Sbjct  62   KMDKEYLPIGGLADFTRASAELALGENSEAFKSGRYVTVQGISGTGSLRIGANFLQRFFK  121

Query  692  GSK-VLISSPTWGLH  733
             S+ V +  P+WG H
Sbjct  122  SSRDVYLPKPSWGNH  136



>gb|KFQ63469.1| hypothetical protein N334_09493, partial [Pelecanus crispus]
Length=401

 Score =   148 bits (373),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 69/135 (51%), Positives = 94/135 (70%), Gaps = 1/135 (1%)
 Frame = +2

Query  332  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  511
            S +  + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE ++  +
Sbjct  2    SWWSHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAVIASK  61

Query  512  GENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFP  691
              +KEYLPI GLA F + +AEL  G ++E  +  R  TVQG+SGTGSLR+ A  ++R+F 
Sbjct  62   KMDKEYLPIAGLADFTRASAELALGENSEAFKSGRYVTVQGISGTGSLRIGANFLQRFFK  121

Query  692  GSK-VLISSPTWGLH  733
             S  V +  P+WG H
Sbjct  122  SSHDVYLPKPSWGNH  136



>gb|EZP39195.1| Aspartate aminotransferase AspC [Janthinobacterium lividum]
Length=404

 Score =   148 bits (373),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 67/140 (48%), Positives = 99/140 (71%), Gaps = 0/140 (0%)
 Frame = +2

Query  320  TVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENL  499
            TV+ S F  I MAP DPILG++EAF AD +  K+NLGVG Y  +  +  +L  V+KAE +
Sbjct  5    TVSASLFSAIEMAPRDPILGITEAFNADQNPAKINLGVGVYYDDNGKVPLLACVRKAEAI  64

Query  500  MLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIE  679
            ++++   + YLPIEGLAA++K   EL+FGAD+ VIQ++R  TVQ + GTG+L++ A  ++
Sbjct  65   LIEQAAPRTYLPIEGLAAYDKAVQELVFGADSAVIQERRAVTVQAIGGTGALKIGADFLQ  124

Query  680  RYFPGSKVLISSPTWGLHHS  739
            R+ PG++V IS P+W  H +
Sbjct  125  RFAPGAQVYISDPSWENHRA  144



>gb|KFO63074.1| hypothetical protein N302_07001, partial [Corvus brachyrhynchos]
Length=401

 Score =   148 bits (373),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 68/135 (50%), Positives = 95/135 (70%), Gaps = 1/135 (1%)
 Frame = +2

Query  332  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  511
            S +  + M PPDPILGV+EA+K DT+  K+NLGVGAYR +  +PYVL+ V+KAE ++  +
Sbjct  2    SWWSHVEMGPPDPILGVTEAYKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMIASK  61

Query  512  GENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFP  691
              +KEYLPI GLA F + +AEL  G ++E  +  R  TVQG+SGTGSLR+ A  ++R+F 
Sbjct  62   KMDKEYLPIGGLADFTRASAELALGENSEAFKSGRYVTVQGISGTGSLRIGANFLQRFFK  121

Query  692  GSK-VLISSPTWGLH  733
             S+ V +  P+WG H
Sbjct  122  ASRDVYLPKPSWGNH  136



>gb|KFQ35253.1| hypothetical protein N331_07571, partial [Merops nubicus]
Length=401

 Score =   147 bits (372),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 70/135 (52%), Positives = 93/135 (69%), Gaps = 1/135 (1%)
 Frame = +2

Query  332  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  511
            S +  + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL  V+KAE L+  +
Sbjct  2    SWWSHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLSCVRKAEALIASK  61

Query  512  GENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFP  691
              +KEYLPI GLA F +  AEL  G ++E  +  R  TVQG+SGTGSLR+ A  ++R+F 
Sbjct  62   KMDKEYLPIAGLADFTRAAAELALGENSEPFKSGRYVTVQGISGTGSLRIGANFLQRFFK  121

Query  692  GSK-VLISSPTWGLH  733
             S+ V +  P+WG H
Sbjct  122  SSRDVYLPKPSWGNH  136



>gb|KFV54532.1| hypothetical protein N341_00606, partial [Tyto alba]
Length=401

 Score =   147 bits (372),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 68/135 (50%), Positives = 95/135 (70%), Gaps = 1/135 (1%)
 Frame = +2

Query  332  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  511
            S +  + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +P+VL+ V+KAE ++  +
Sbjct  2    SWWSHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPFVLNCVRKAEAMIASK  61

Query  512  GENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFP  691
              +KEYLPI GLA F + +AEL  G ++E  +  R  TVQG+SGTGSLR+ A  ++R+F 
Sbjct  62   KMDKEYLPIAGLADFTRASAELALGENSEAFKSGRYVTVQGISGTGSLRIGANFLQRFFK  121

Query  692  GSK-VLISSPTWGLH  733
             S+ V +  P+WG H
Sbjct  122  SSRDVYLPKPSWGNH  136



>gb|KIM48153.1| hypothetical protein M413DRAFT_439876 [Hebeloma cylindrosporum 
h7]
Length=426

 Score =   148 bits (373),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 71/136 (52%), Positives = 95/136 (70%), Gaps = 1/136 (1%)
 Frame = +2

Query  329  VSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQ  508
            VS +  +   PPDPILGV+EAFKAD D  K+NLGVGAYR E  +PY+L  VKKAE ++  
Sbjct  22   VSTWSNVPAGPPDPILGVTEAFKADKDPRKINLGVGAYRDENGKPYILPSVKKAEEIVQS  81

Query  509  RGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYF  688
               +KEYLPI GL  F K +A L +GA+++VI+Q  VA  Q +SGTG+LR+  A + R++
Sbjct  82   SKPDKEYLPITGLPEFTKNSALLAYGAESDVIKQGTVAITQSISGTGALRIGGAFLARHY  141

Query  689  PGSK-VLISSPTWGLH  733
            P SK + + +PTWG H
Sbjct  142  PHSKAIYLPAPTWGNH  157



>ref|XP_009395718.1| PREDICTED: aspartate aminotransferase, cytoplasmic [Musa acuminata 
subsp. malaccensis]
Length=421

 Score =   148 bits (373),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 74/144 (51%), Positives = 98/144 (68%), Gaps = 1/144 (1%)
 Frame = +2

Query  332  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  511
            S F  +  AP DPILGV+ A+  D   +K+NLGVGAYRTEE +P VL+VV++AE L++  
Sbjct  19   SVFANVVQAPEDPILGVTVAYNKDPSPVKVNLGVGAYRTEEGKPLVLNVVRRAEQLLVND  78

Query  512  GEN-KEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYF  688
                KEYLPI GLA FNK++A+L+FGAD+  IQ+ RVATVQ LSGTGSLR+    + R++
Sbjct  79   PSRVKEYLPITGLADFNKLSAKLIFGADSPAIQENRVATVQCLSGTGSLRVGGEFLARHY  138

Query  689  PGSKVLISSPTWGLHHSSVVIYGI  760
                + I  PTWG H     + G+
Sbjct  139  HERTIYIPQPTWGNHPKVFTLAGL  162



>gb|KFO04448.1| hypothetical protein N312_06091, partial [Balearica regulorum 
gibbericeps]
Length=401

 Score =   147 bits (372),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 68/135 (50%), Positives = 95/135 (70%), Gaps = 1/135 (1%)
 Frame = +2

Query  332  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  511
            S +  + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE ++  +
Sbjct  2    SWWSHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMIASK  61

Query  512  GENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFP  691
              +KEYLPI GLA F + +AEL  G ++E  +  R  T+QG+SGTGSLR+ A  ++R+F 
Sbjct  62   KMDKEYLPIGGLADFTRASAELALGENSEAFKSGRYVTMQGISGTGSLRIGANFLQRFFK  121

Query  692  GSK-VLISSPTWGLH  733
             S+ V +  P+WG H
Sbjct  122  SSRDVYLPKPSWGNH  136



>ref|XP_005490808.1| PREDICTED: aspartate aminotransferase, mitochondrial [Zonotrichia 
albicollis]
Length=422

 Score =   148 bits (373),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 68/135 (50%), Positives = 95/135 (70%), Gaps = 1/135 (1%)
 Frame = +2

Query  332  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  511
            S +  + M PPDPILGV+EA+K DT+  K+NLGVGAYR +  +PYVL+ V+KAE ++  +
Sbjct  23   SWWSHVEMGPPDPILGVTEAYKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMIASK  82

Query  512  GENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFP  691
              +KEYLPI GLA F + +AEL  G ++E  +  R  TVQG+SGTGSLR+ A  ++R+F 
Sbjct  83   KMDKEYLPIGGLADFTRASAELALGENSEAFKSGRYVTVQGISGTGSLRIGANFLQRFFK  142

Query  692  GSK-VLISSPTWGLH  733
             S+ V +  P+WG H
Sbjct  143  ASRDVYLPKPSWGNH  157



>ref|XP_005229254.1| PREDICTED: aspartate aminotransferase, mitochondrial [Falco peregrinus]
 ref|XP_005440356.1| PREDICTED: aspartate aminotransferase, mitochondrial [Falco cherrug]
Length=393

 Score =   147 bits (372),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 68/128 (53%), Positives = 92/128 (72%), Gaps = 1/128 (1%)
 Frame = +2

Query  353  MAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENKEYL  532
            M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE ++  +  +KEYL
Sbjct  1    MGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMIASKKMDKEYL  60

Query  533  PIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFPGSK-VLI  709
            PI GLA F + +AEL  G ++E  +  R  TVQG+SGTGSLR+ A  ++R+F  S+ V +
Sbjct  61   PIAGLADFTRASAELALGENSEAFKSGRYVTVQGISGTGSLRIGANFLQRFFKSSRDVYL  120

Query  710  SSPTWGLH  733
              P+WG H
Sbjct  121  PKPSWGNH  128



>gb|KFW90670.1| hypothetical protein N336_10326, partial [Phalacrocorax carbo]
Length=401

 Score =   147 bits (372),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 68/135 (50%), Positives = 93/135 (69%), Gaps = 1/135 (1%)
 Frame = +2

Query  332  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  511
            S +  + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL  V+KAE ++  +
Sbjct  2    SWWSHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLSCVRKAEAMIASK  61

Query  512  GENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFP  691
              +KEYLPI GL  F + +AEL  G ++E  +  R  TVQG+SGTGSLR+ A  ++R+F 
Sbjct  62   KMDKEYLPIAGLVDFTRASAELALGENSEAFKSSRYVTVQGISGTGSLRIGANFLQRFFK  121

Query  692  GSK-VLISSPTWGLH  733
             S+ V +  P+WG H
Sbjct  122  SSRDVYLPKPSWGNH  136



>gb|EYU29270.1| hypothetical protein MIMGU_mgv1a006139mg [Erythranthe guttata]
Length=455

 Score =   148 bits (374),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 71/135 (53%), Positives = 96/135 (71%), Gaps = 1/135 (1%)
 Frame = +2

Query  332  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  511
            S F+ + M P DPILGV+ A+  D   +K+NLGVGAYRTEE +P VL+VV++AE +++  
Sbjct  53   SVFDHVVMGPEDPILGVTVAYNKDPSPVKMNLGVGAYRTEEGKPLVLNVVRRAEQMLVND  112

Query  512  GEN-KEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYF  688
                KEYLPI GLA FNK++A+L+ GAD+  +Q+ RV TVQ LSGTGSLR+ A  + R++
Sbjct  113  SSRVKEYLPIVGLADFNKLSAKLILGADSPAVQENRVTTVQCLSGTGSLRVGAEFLARHY  172

Query  689  PGSKVLISSPTWGLH  733
                +LI  PTWG H
Sbjct  173  HQHTILIPQPTWGNH  187



>ref|XP_010254083.1| PREDICTED: aspartate aminotransferase, cytoplasmic-like [Nelumbo 
nucifera]
Length=461

 Score =   148 bits (374),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 73/144 (51%), Positives = 99/144 (69%), Gaps = 1/144 (1%)
 Frame = +2

Query  332  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQ-  508
            S F  I  AP DPILGV+ A+  D   +KLNLGVGAYRTEE +P VL+VV++AE L++  
Sbjct  59   SVFANIVQAPEDPILGVTVAYNKDPSPVKLNLGVGAYRTEEGKPLVLNVVRRAEQLIIND  118

Query  509  RGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYF  688
            +   KEYLPI G+A FNK++A+L+FG D+  IQ+ R+ATVQ LSGTGSLR+ A  + +++
Sbjct  119  QSRVKEYLPITGMADFNKLSAKLIFGTDSPAIQENRIATVQCLSGTGSLRVGAEFLVKHY  178

Query  689  PGSKVLISSPTWGLHHSSVVIYGI  760
                + I  PTWG H     + G+
Sbjct  179  HNRTIYIPQPTWGNHPKVFTMAGL  202



>ref|XP_007438961.1| PREDICTED: aspartate aminotransferase, mitochondrial [Python 
bivittatus]
Length=424

 Score =   148 bits (373),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 74/145 (51%), Positives = 96/145 (66%), Gaps = 1/145 (1%)
 Frame = +2

Query  302  RMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVV  481
            R+  +A    S +  + M  PDPILGV+EAFK DT   K+NLGVGAYR +  +PYVL+ V
Sbjct  15   RVAALAVRASSWWTHVEMGLPDPILGVTEAFKRDTSAKKMNLGVGAYRDDNGKPYVLNCV  74

Query  482  KKAENLMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRL  661
            ++AE  +  +  +KEYLPI GLA FNK +AEL  G  NEVIQ  R  TVQ +SGTGSLR+
Sbjct  75   RRAEAQIASKKMDKEYLPIAGLADFNKASAELALGETNEVIQSGRYVTVQTISGTGSLRV  134

Query  662  AAALIERYFPGSK-VLISSPTWGLH  733
             A  ++R+F  S  V +  P+WG H
Sbjct  135  GANFLQRFFTASHDVFLPKPSWGNH  159



>pdb|7AAT|A Chain A, X-Ray Structure Refinement And Comparison Of Three Forms 
Of Mitochondrial Aspartate Aminotransferase
 pdb|7AAT|B Chain B, X-Ray Structure Refinement And Comparison Of Three Forms 
Of Mitochondrial Aspartate Aminotransferase
 pdb|8AAT|A Chain A, X-ray Structure Refinement And Comparison Of Three Forms 
Of Mitochondrial Aspartate Aminotransferase
 pdb|8AAT|B Chain B, X-ray Structure Refinement And Comparison Of Three Forms 
Of Mitochondrial Aspartate Aminotransferase
 pdb|9AAT|A Chain A, X-Ray Structure Refinement And Comparison Of Three Forms 
Of Mitochondrial Aspartate Aminotransferase
 pdb|9AAT|B Chain B, X-Ray Structure Refinement And Comparison Of Three Forms 
Of Mitochondrial Aspartate Aminotransferase
 pdb|1TAR|A Chain A, Crystalline Mitochondrial Aspartate Aminotransferase 
Exists In Only Two Conformations
 pdb|1TAR|B Chain B, Crystalline Mitochondrial Aspartate Aminotransferase 
Exists In Only Two Conformations
 pdb|1TAS|A Chain A, Crystalline Mitochondrial Aspartate Aminotransferase 
Exists In Only Two Conformations
 pdb|1TAS|B Chain B, Crystalline Mitochondrial Aspartate Aminotransferase 
Exists In Only Two Conformations
 pdb|1TAT|A Chain A, Crystalline Mitochondrial Aspartate Aminotransferase 
Exists In Only Two Conformations
 pdb|1TAT|B Chain B, Crystalline Mitochondrial Aspartate Aminotransferase 
Exists In Only Two Conformations
 pdb|1OXO|A Chain A, Aspartate Aminotransferase, H-Asp Complex, Open Conformation
 pdb|1OXO|B Chain B, Aspartate Aminotransferase, H-Asp Complex, Open Conformation
 pdb|1IVR|A Chain A, Structure Of Aspartate Aminotransferase
 pdb|1AMA|A Chain A, Domain Closure In Mitochondrial Aspartate Aminotransferase
 pdb|1MAP|A Chain A, Crystal Structures Of True Enzymatic Reaction Intermediates: 
Aspartate And Glutamate Ketimines In Aspartate Aminotransferase
 pdb|1MAQ|A Chain A, Crystal Structures Of True Enzymatic Reaction Intermediates: 
Aspartate And Glutamate Ketimines In Aspartate Aminotransferase
 pdb|1OXP|A Chain A, Aspartate Aminotransferase, H-Asp Complex, Closed Conformation
Length=401

 Score =   147 bits (372),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 69/135 (51%), Positives = 95/135 (70%), Gaps = 1/135 (1%)
 Frame = +2

Query  332  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  511
            S +  + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE ++  +
Sbjct  2    SWWSHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMIAAK  61

Query  512  GENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFP  691
              +KEYLPI GLA F + +AEL  G ++E  +  R  TVQG+SGTGSLR+ A  ++R+F 
Sbjct  62   KMDKEYLPIAGLADFTRASAELALGENSEAFKSGRYVTVQGISGTGSLRVGANFLQRFFK  121

Query  692  GSK-VLISSPTWGLH  733
             S+ V +  P+WG H
Sbjct  122  FSRDVYLPKPSWGNH  136



>gb|KHG23914.1| Aspartate aminotransferase, chloroplastic -like protein [Gossypium 
arboreum]
Length=452

 Score =   148 bits (374),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 74/144 (51%), Positives = 98/144 (68%), Gaps = 1/144 (1%)
 Frame = +2

Query  332  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQ-  508
            S F  +  AP DPILGV+ A+  D   +KLNLGVGAYRTEE +P VL+VV+KAE ++L  
Sbjct  50   SVFSHVVRAPEDPILGVTVAYNKDPSPVKLNLGVGAYRTEEGKPLVLNVVRKAEQMLLND  109

Query  509  RGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYF  688
            +   KEYLPI G+A FNK++A+L+FGAD+  I + RV TVQ LSGTGSLR+ A  + R++
Sbjct  110  KSRVKEYLPIVGIAEFNKLSAQLIFGADSPAIGENRVTTVQCLSGTGSLRVGAEFLARHY  169

Query  689  PGSKVLISSPTWGLHHSSVVIYGI  760
                + I  PTWG H     + G+
Sbjct  170  HQKTIYIPQPTWGNHPKVFTLAGL  193



>ref|XP_009958443.1| PREDICTED: aspartate aminotransferase, mitochondrial [Leptosomus 
discolor]
Length=393

 Score =   147 bits (371),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 68/128 (53%), Positives = 92/128 (72%), Gaps = 1/128 (1%)
 Frame = +2

Query  353  MAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENKEYL  532
            M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE ++  +  +KEYL
Sbjct  1    MGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMIASKKMDKEYL  60

Query  533  PIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFPGSK-VLI  709
            PI GLA F + +AEL  G ++E  +  R  TVQG+SGTGSLR+ A  ++R+F  S+ V +
Sbjct  61   PIAGLADFTRASAELALGENSEAFKSGRYVTVQGISGTGSLRIGANFLQRFFKSSRDVYL  120

Query  710  SSPTWGLH  733
              P+WG H
Sbjct  121  PKPSWGNH  128



>gb|KFM02723.1| hypothetical protein AS27_01862, partial [Aptenodytes forsteri]
Length=401

 Score =   147 bits (372),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 69/135 (51%), Positives = 94/135 (70%), Gaps = 1/135 (1%)
 Frame = +2

Query  332  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  511
            S +  + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE ++  +
Sbjct  2    SWWSHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMIASK  61

Query  512  GENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFP  691
              +KEYLPI GLA F + +AEL  G ++E  +  R  TVQG+SGTGSLR+ A  ++R+F 
Sbjct  62   KMDKEYLPIGGLADFTQASAELALGENSEAFKSGRYVTVQGISGTGSLRIGANFLQRFFK  121

Query  692  GSK-VLISSPTWGLH  733
             S  V +  P+WG H
Sbjct  122  SSHDVYLPKPSWGNH  136



>sp|P28011.2|AAT1_MEDSA RecName: Full=Aspartate aminotransferase 1; AltName: Full=Transaminase 
A [Medicago sativa]
 gb|AAB46610.1| aspartate aminotransferase [Medicago sativa]
Length=418

 Score =   147 bits (372),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 72/135 (53%), Positives = 95/135 (70%), Gaps = 1/135 (1%)
 Frame = +2

Query  332  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  511
            S F  +  AP DPILGV+ A+  D   +KLNLGVGAYRTEE +P VLDVV++ E  +L  
Sbjct  16   SVFAHLVRAPEDPILGVTVAYNKDPSPIKLNLGVGAYRTEEGKPLVLDVVRRVERQLLND  75

Query  512  -GENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYF  688
               NKEY+PI GLA FNK++A+L+FGAD+  IQ+ RV TVQGLSGTGSLR+    + +++
Sbjct  76   MSRNKEYIPIVGLADFNKLSAKLIFGADSPAIQENRVTTVQGLSGTGSLRVGGEFLAKHY  135

Query  689  PGSKVLISSPTWGLH  733
                + + +PTWG H
Sbjct  136  HQRIIYLPTPTWGNH  150



>ref|XP_009641563.1| PREDICTED: aspartate aminotransferase, mitochondrial [Egretta 
garzetta]
Length=393

 Score =   147 bits (371),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 68/128 (53%), Positives = 92/128 (72%), Gaps = 1/128 (1%)
 Frame = +2

Query  353  MAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENKEYL  532
            M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE ++  +  +KEYL
Sbjct  1    MGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMIASKKMDKEYL  60

Query  533  PIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFPGSK-VLI  709
            PI GLA F + +AEL  G ++E  +  R  TVQG+SGTGSLR+ A  ++R+F  S+ V +
Sbjct  61   PIAGLADFTRASAELALGENSEAFKSGRYVTVQGISGTGSLRIGANFLQRFFKSSRDVYL  120

Query  710  SSPTWGLH  733
              P+WG H
Sbjct  121  PKPSWGNH  128



>pdb|1AKA|A Chain A, Structural Basis For The Catalytic Activity Of Aspartate 
Aminotransferase K258h Lacking Its Pyridoxal-5'-Phosphate-Binding 
Lysine Residue
 pdb|1AKA|B Chain B, Structural Basis For The Catalytic Activity Of Aspartate 
Aminotransferase K258h Lacking Its Pyridoxal-5'-Phosphate-Binding 
Lysine Residue
 pdb|1AKB|A Chain A, Structural Basis For The Catalytic Activity Of Aspartate 
Aminotransferase K258h Lacking Its Pyridoxal-5'-Phosphate-Binding 
Lysine Residue
 pdb|1AKC|A Chain A, Structural Basis For The Catalytic Activity Of Aspartate 
Aminotransferase K258h Lacking Its Pyridoxal-5'-Phosphate- 
Binding Lysine Residue
Length=401

 Score =   147 bits (372),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 69/135 (51%), Positives = 95/135 (70%), Gaps = 1/135 (1%)
 Frame = +2

Query  332  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  511
            S +  + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE ++  +
Sbjct  2    SWWSHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMIAAK  61

Query  512  GENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFP  691
              +KEYLPI GLA F + +AEL  G ++E  +  R  TVQG+SGTGSLR+ A  ++R+F 
Sbjct  62   KMDKEYLPIAGLADFTRASAELALGENSEAFKSGRYVTVQGISGTGSLRVGANFLQRFFK  121

Query  692  GSK-VLISSPTWGLH  733
             S+ V +  P+WG H
Sbjct  122  FSRDVYLPKPSWGNH  136



>ref|XP_007067232.1| PREDICTED: aspartate aminotransferase, mitochondrial-like [Chelonia 
mydas]
Length=393

 Score =   147 bits (371),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 71/128 (55%), Positives = 92/128 (72%), Gaps = 1/128 (1%)
 Frame = +2

Query  353  MAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENKEYL  532
            M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE  +  +  +KEYL
Sbjct  1    MGPPDPILGVTEAFKRDTNAKKMNLGVGAYRDDNGKPYVLNSVRKAEAQIAAKKMDKEYL  60

Query  533  PIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFPGSK-VLI  709
            PI GLA FNK +AEL  G  NEVI+  R  TVQ +SGTGSLR+  + ++R+F  S+ V +
Sbjct  61   PIAGLAEFNKASAELALGDTNEVIKNGRYVTVQTISGTGSLRVGGSFLQRFFKYSRDVYL  120

Query  710  SSPTWGLH  733
              P+WG H
Sbjct  121  PKPSWGNH  128



>gb|KFV73576.1| hypothetical protein N308_13552, partial [Struthio camelus australis]
Length=401

 Score =   147 bits (371),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 69/135 (51%), Positives = 94/135 (70%), Gaps = 1/135 (1%)
 Frame = +2

Query  332  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  511
            S +  + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE  +  +
Sbjct  2    SWWSHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAQIASK  61

Query  512  GENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFP  691
              +KEYLPI GLA F + +AEL  G ++E  +  R  TVQG+SGTGSLR+ A  ++R+F 
Sbjct  62   KMDKEYLPIAGLADFTRASAELALGENSEAFKSGRYVTVQGISGTGSLRVGANFLQRFFK  121

Query  692  GSK-VLISSPTWGLH  733
             S+ V +  P+WG H
Sbjct  122  SSRDVYLPKPSWGNH  136



>gb|KEH36022.1| aspartate aminotransferase [Medicago truncatula]
Length=418

 Score =   147 bits (372),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 72/135 (53%), Positives = 95/135 (70%), Gaps = 1/135 (1%)
 Frame = +2

Query  332  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  511
            S F  +  AP DPILGV+ A+  D   +KLNLGVGAYRTEE +P VLDVV++ E  +L  
Sbjct  16   SVFAHLVRAPEDPILGVTVAYNKDPSPIKLNLGVGAYRTEEGKPLVLDVVRRVERQLLND  75

Query  512  -GENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYF  688
               NKEY+PI GLA FNK++A+L+FGAD+  IQ+ RV TVQGLSGTGSLR+    + +++
Sbjct  76   MSRNKEYIPIVGLADFNKLSAKLIFGADSPAIQENRVTTVQGLSGTGSLRVGGEFLAKHY  135

Query  689  PGSKVLISSPTWGLH  733
                + + +PTWG H
Sbjct  136  HQRIIYLPTPTWGNH  150



>ref|XP_004395809.1| PREDICTED: aspartate aminotransferase, mitochondrial isoform 
1 [Odobenus rosmarus divergens]
Length=430

 Score =   148 bits (373),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 70/130 (54%), Positives = 93/130 (72%), Gaps = 1/130 (1%)
 Frame = +2

Query  347  ISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENKE  526
            + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL  V+KAE  +  +  +KE
Sbjct  36   VEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLPSVRKAEAQIAAKNLDKE  95

Query  527  YLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFPGSK-V  703
            YLPI GLA F K +AEL  G DNEV++  R  TVQ +SGTG+LR+ A+ ++R+F  S+ V
Sbjct  96   YLPIAGLADFCKASAELALGEDNEVLKSSRYVTVQTISGTGALRIGASFLQRFFKFSRDV  155

Query  704  LISSPTWGLH  733
             +  P+WG H
Sbjct  156  FLPKPSWGNH  165



>ref|XP_004317705.1| PREDICTED: aspartate aminotransferase, mitochondrial [Tursiops 
truncatus]
Length=430

 Score =   148 bits (373),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 72/130 (55%), Positives = 92/130 (71%), Gaps = 1/130 (1%)
 Frame = +2

Query  347  ISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENKE  526
            + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL VV+KAE  +  R  +KE
Sbjct  36   VEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLPVVRKAEAQIAARNLDKE  95

Query  527  YLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFPGSK-V  703
            YLPI GLA F K +AEL  G  NEV++  R  TVQ +SGTG+LR+ A  ++R+F  S+ V
Sbjct  96   YLPIGGLAEFCKASAELALGESNEVLKSGRYITVQTISGTGALRIGANFLQRFFKFSRDV  155

Query  704  LISSPTWGLH  733
             +  PTWG H
Sbjct  156  FLPKPTWGNH  165



>ref|XP_010164289.1| PREDICTED: aspartate aminotransferase, mitochondrial [Caprimulgus 
carolinensis]
Length=393

 Score =   147 bits (371),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 68/128 (53%), Positives = 92/128 (72%), Gaps = 1/128 (1%)
 Frame = +2

Query  353  MAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENKEYL  532
            M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE ++  +  +KEYL
Sbjct  1    MGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMIASKKMDKEYL  60

Query  533  PIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFPGSK-VLI  709
            PI GLA F + +AEL  G ++E  +  R  TVQG+SGTGSLR+ A  ++R+F  S+ V +
Sbjct  61   PIAGLADFTRASAELALGENSEAFKSGRYVTVQGISGTGSLRIGANFLQRFFKSSRDVYL  120

Query  710  SSPTWGLH  733
              P+WG H
Sbjct  121  PKPSWGNH  128



>ref|XP_009078129.1| PREDICTED: aspartate aminotransferase, mitochondrial [Acanthisitta 
chloris]
Length=393

 Score =   147 bits (371),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 68/128 (53%), Positives = 92/128 (72%), Gaps = 1/128 (1%)
 Frame = +2

Query  353  MAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENKEYL  532
            M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE ++  +  +KEYL
Sbjct  1    MGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMIASKKMDKEYL  60

Query  533  PIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFPGSK-VLI  709
            PI GLA F + +AEL  G ++E  +  R  TVQG+SGTGSLR+ A  ++R+F  S+ V +
Sbjct  61   PIGGLADFTRASAELALGENSEAFKSGRYVTVQGISGTGSLRIGANFLQRFFKASRDVYL  120

Query  710  SSPTWGLH  733
              P+WG H
Sbjct  121  PKPSWGNH  128



>ref|XP_006450636.1| hypothetical protein CICLE_v10008274mg [Citrus clementina]
 gb|ESR63876.1| hypothetical protein CICLE_v10008274mg [Citrus clementina]
Length=449

 Score =   148 bits (373),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 77/149 (52%), Positives = 99/149 (66%), Gaps = 1/149 (1%)
 Frame = +2

Query  317  ATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAEN  496
            A  N S F  +  AP DPILGV+ A+  D   +KLNLGVGAYRTEE +P VL+VV+KAE 
Sbjct  42   ANQNDSVFSHVVRAPEDPILGVTVAYNKDPSPLKLNLGVGAYRTEEGKPLVLNVVRKAEQ  101

Query  497  -LMLQRGENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAAL  673
             L+  R   KEYLPI GLA FNK++A+L+ GAD+  I++ RV TVQ LSGTGSLR+ A  
Sbjct  102  QLVNDRSRVKEYLPIVGLAEFNKLSAKLILGADSPAIRENRVTTVQCLSGTGSLRVGAEF  161

Query  674  IERYFPGSKVLISSPTWGLHHSSVVIYGI  760
            + R++    + I  PTWG H     + G+
Sbjct  162  LARHYHQRTIYIPQPTWGNHPKVFTLAGL  190



>ref|XP_002912325.1| PREDICTED: aspartate aminotransferase, mitochondrial [Ailuropoda 
melanoleuca]
Length=430

 Score =   148 bits (373),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 70/130 (54%), Positives = 94/130 (72%), Gaps = 1/130 (1%)
 Frame = +2

Query  347  ISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENKE  526
            + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL  V+KAE  +  +  +KE
Sbjct  36   VEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLPSVRKAEAQIAAKNLDKE  95

Query  527  YLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFPGSK-V  703
            YLPI GLA F K +AEL  G +NEV++  R ATVQ +SGTG+LR+ A+ ++R+F  S+ V
Sbjct  96   YLPIAGLAEFCKASAELALGENNEVLKSSRYATVQTISGTGALRIGASFLQRFFKFSRDV  155

Query  704  LISSPTWGLH  733
             +  P+WG H
Sbjct  156  FLPKPSWGNH  165



>ref|XP_004970037.1| PREDICTED: aspartate aminotransferase, cytoplasmic-like [Setaria 
italica]
Length=460

 Score =   148 bits (374),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 73/150 (49%), Positives = 101/150 (67%), Gaps = 1/150 (1%)
 Frame = +2

Query  314  VATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAE  493
            +A+   S F  ++ AP DPILGV+ A+  D   +K+NLGVGAYRTEE +P VL+VV++AE
Sbjct  52   MASQGSSVFAALAQAPEDPILGVTVAYNKDPSPVKVNLGVGAYRTEEGKPLVLNVVRRAE  111

Query  494  NLMLQRGEN-KEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAA  670
             +++      KEYLPI GLA FNK++A+L+FGAD+  IQ+ RV TVQ LSGTGSLR+   
Sbjct  112  QMLINNPSRVKEYLPITGLAEFNKLSAKLIFGADSPAIQENRVTTVQCLSGTGSLRVGGE  171

Query  671  LIERYFPGSKVLISSPTWGLHHSSVVIYGI  760
             + R++    + I  PTWG H     + G+
Sbjct  172  FLARHYHERTIYIPQPTWGNHPKVFTLSGL  201



>ref|XP_003569862.1| PREDICTED: aspartate aminotransferase, cytoplasmic [Brachypodium 
distachyon]
Length=464

 Score =   148 bits (374),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 75/144 (52%), Positives = 97/144 (67%), Gaps = 1/144 (1%)
 Frame = +2

Query  332  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  511
            S F G+   P DPILGV+ AF  D   +K+NLGVGAYRTEE +P VL+VVK+AE  M++ 
Sbjct  62   SVFAGVPQGPEDPILGVTVAFNKDPSPVKVNLGVGAYRTEEGKPLVLNVVKRAELQMIKN  121

Query  512  GE-NKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYF  688
                KEYLPI GLA FNK++A+L+FGAD+  IQ+ RV TVQ LSGTGSLR+    + R++
Sbjct  122  PSLGKEYLPITGLADFNKLSAKLIFGADSPAIQENRVVTVQCLSGTGSLRVGGEFLARHY  181

Query  689  PGSKVLISSPTWGLHHSSVVIYGI  760
                + I  PTWG H     + G+
Sbjct  182  HERTIYIPQPTWGNHPKVFTLAGL  205



>ref|XP_009126373.1| PREDICTED: aspartate aminotransferase, cytoplasmic isozyme 1 
[Brassica rapa]
Length=405

 Score =   147 bits (371),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 78/156 (50%), Positives = 101/156 (65%), Gaps = 6/156 (4%)
 Frame = +2

Query  332  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  511
            S F  +  AP DPILGV+ A+  D    KLNLGVGAYRTEE +P VLDVV+KAE  ++  
Sbjct  3    SVFSNVVRAPEDPILGVTVAYNNDPSPAKLNLGVGAYRTEEGKPLVLDVVRKAEQQLVND  62

Query  512  GEN-KEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYF  688
                KEY+PI GLA FNK++A+L+ GAD+  IQ+ RVAT+Q LSGTGSLR+ A  +++++
Sbjct  63   PSRVKEYIPIAGLADFNKLSAKLILGADSPAIQESRVATIQCLSGTGSLRVGAEFLKKHY  122

Query  689  PGSKVLISSPTWGLHHSSVVIYGIFKS*L*CSYYHY  796
              S + I  PTWG H     + G     L   YY Y
Sbjct  123  HQSVIFIPKPTWGNHPKVFNLAG-----LSVEYYRY  153



>gb|AFK40370.1| unknown [Medicago truncatula]
Length=418

 Score =   147 bits (372),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 72/135 (53%), Positives = 95/135 (70%), Gaps = 1/135 (1%)
 Frame = +2

Query  332  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  511
            S F  +  AP DPILGV+ A+  D   +KLNLGVGAYRTEE +P VLDVV++ E  +L  
Sbjct  16   SVFAHLVRAPEDPILGVTVAYNKDPSPIKLNLGVGAYRTEEGKPLVLDVVRRVERQLLND  75

Query  512  -GENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYF  688
               NKEY+PI GLA FNK++A+L+FGAD+  IQ+ RV TVQGLSGTGSLR+    + +++
Sbjct  76   MSRNKEYIPIVGLADFNKLSAKLIFGADSPAIQENRVTTVQGLSGTGSLRVGGEFLAKHY  135

Query  689  PGSKVLISSPTWGLH  733
                + + +PTWG H
Sbjct  136  HQRIIYLPTPTWGNH  150



>emb|CAA43779.1| aspartate aminotransferase [Medicago sativa]
Length=417

 Score =   147 bits (372),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 72/135 (53%), Positives = 95/135 (70%), Gaps = 1/135 (1%)
 Frame = +2

Query  332  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  511
            S F  +  AP DPILGV+ A+  D   +KLNLGVGAYRTEE +P VLDVV++ E  +L  
Sbjct  15   SVFAHLVRAPEDPILGVTVAYNKDPSPIKLNLGVGAYRTEEGKPLVLDVVRRVERQLLND  74

Query  512  -GENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYF  688
               NKEY+PI GLA FNK++A+L+FGAD+  IQ+ RV TVQGLSGTGSLR+    + +++
Sbjct  75   MSRNKEYIPIVGLADFNKLSAKLIFGADSPAIQENRVTTVQGLSGTGSLRVGGEFLAKHY  134

Query  689  PGSKVLISSPTWGLH  733
                + + +PTWG H
Sbjct  135  HQRIIYLPTPTWGNH  149



>ref|XP_009697580.1| PREDICTED: aspartate aminotransferase, mitochondrial [Cariama 
cristata]
Length=393

 Score =   147 bits (370),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 68/128 (53%), Positives = 92/128 (72%), Gaps = 1/128 (1%)
 Frame = +2

Query  353  MAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENKEYL  532
            M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE ++  +  +KEYL
Sbjct  1    MGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMIASKKMDKEYL  60

Query  533  PIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFPGSK-VLI  709
            PI GLA F + +AEL  G ++E  +  R  TVQG+SGTGSLR+ A  ++R+F  S+ V +
Sbjct  61   PIAGLADFTRASAELALGENSEAFKSGRYVTVQGISGTGSLRVGANFLQRFFKSSRDVYL  120

Query  710  SSPTWGLH  733
              P+WG H
Sbjct  121  PKPSWGNH  128



>gb|KFU92658.1| hypothetical protein M959_01402, partial [Chaetura pelagica]
Length=401

 Score =   147 bits (371),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 69/135 (51%), Positives = 93/135 (69%), Gaps = 1/135 (1%)
 Frame = +2

Query  332  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  511
            S +  + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL  V+KAE ++   
Sbjct  2    SWWSHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLSCVRKAEAMIASN  61

Query  512  GENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFP  691
              +KEYLPI GLA F + +AEL  G ++E  +  R  TVQG+SGTGSLR+ A  ++R+F 
Sbjct  62   KMDKEYLPIGGLADFTRASAELALGENSEAFKSGRYVTVQGISGTGSLRIGANFLQRFFK  121

Query  692  GSK-VLISSPTWGLH  733
             S+ V +  P+WG H
Sbjct  122  ASRDVYLPKPSWGNH  136



>ref|XP_004501184.1| PREDICTED: aspartate aminotransferase 1-like [Cicer arietinum]
Length=458

 Score =   148 bits (373),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 73/135 (54%), Positives = 95/135 (70%), Gaps = 1/135 (1%)
 Frame = +2

Query  332  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  511
            S F  I  AP D ILGV+ A+  DT  +KLNLGVGAYRTEE +P VLDVV++ E+ +   
Sbjct  56   SVFAQIVRAPEDAILGVTVAYNKDTSPIKLNLGVGAYRTEEGKPLVLDVVRRVEHQLFTD  115

Query  512  G-ENKEYLPIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYF  688
            G  NKEY+PI GLA FNK++A+L+FGAD+  IQ+ RV TVQGLSGTGSLR+    + +++
Sbjct  116  GSRNKEYIPIVGLADFNKLSAKLIFGADSPAIQENRVTTVQGLSGTGSLRVGGEFLAKHY  175

Query  689  PGSKVLISSPTWGLH  733
                + +  PTWG H
Sbjct  176  HERVIYLPQPTWGNH  190



>ref|XP_008175936.1| PREDICTED: aspartate aminotransferase, mitochondrial isoform 
X2 [Chrysemys picta bellii]
Length=393

 Score =   147 bits (370),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 71/128 (55%), Positives = 93/128 (73%), Gaps = 1/128 (1%)
 Frame = +2

Query  353  MAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENKEYL  532
            M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +P+VL+ V+KAE  +  +  +KEYL
Sbjct  1    MGPPDPILGVTEAFKRDTNAKKMNLGVGAYRDDNGKPFVLNSVRKAEAQIAAKKMDKEYL  60

Query  533  PIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFPGSK-VLI  709
            PI GLA FNK +AEL  G  NEVI+  R  TVQ +SGTGSLR+ A+ ++R+F  S+ V +
Sbjct  61   PIAGLAEFNKASAELALGDTNEVIKSGRYVTVQTISGTGSLRVGASFLQRFFKYSRDVYL  120

Query  710  SSPTWGLH  733
              P+WG H
Sbjct  121  PKPSWGNH  128



>ref|XP_008503619.1| PREDICTED: aspartate aminotransferase, mitochondrial [Calypte 
anna]
Length=393

 Score =   147 bits (370),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 68/128 (53%), Positives = 92/128 (72%), Gaps = 1/128 (1%)
 Frame = +2

Query  353  MAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENKEYL  532
            M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE ++  +  +KEYL
Sbjct  1    MGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMIASKKMDKEYL  60

Query  533  PIEGLAAFNKVTAELLFGADNEVIQQKRVATVQGLSGTGSLRLAAALIERYFPGSK-VLI  709
            PI GLA F + +AEL  G ++E  +  R  TVQG+SGTGSLR+ A  ++R+F  S+ V +
Sbjct  61   PIGGLADFTRASAELALGENSEAFKNGRYVTVQGISGTGSLRIGANFLQRFFKSSRDVYL  120

Query  710  SSPTWGLH  733
              P+WG H
Sbjct  121  PKPSWGNH  128



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1606838546005