BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF046M08

Length=775
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|ACN40426.1|  unknown                                                 411   3e-141   Picea sitchensis
ref|XP_002263822.2|  PREDICTED: tubulin alpha chain                     410   8e-141   
emb|CBI29424.3|  unnamed protein product                                409   9e-141   Vitis vinifera
gb|AAN33000.1|  alpha-tubulin 4                                         410   9e-141   Gossypium hirsutum [American cotton]
ref|XP_008236253.1|  PREDICTED: tubulin alpha chain isoform X2          414   2e-140   
emb|CBI19330.3|  unnamed protein product                                411   4e-140   Vitis vinifera
ref|XP_008440460.1|  PREDICTED: tubulin alpha chain-like isoform X2     413   5e-140   
emb|CBI25125.3|  unnamed protein product                                410   7e-140   Vitis vinifera
gb|KDO78780.1|  hypothetical protein CISIN_1g037616mg                   410   7e-140   Citrus sinensis [apfelsine]
ref|XP_006486879.1|  PREDICTED: tubulin alpha chain-like isoform X2     412   8e-140   
emb|CBI22190.3|  unnamed protein product                                410   1e-139   Vitis vinifera
ref|XP_006466395.1|  PREDICTED: tubulin alpha-3 chain-like isofor...    412   1e-139   
gb|AHJ80818.1|  Tua1                                                    406   1e-139   Eragrostis tef [tef]
ref|XP_010531322.1|  PREDICTED: tubulin alpha-4 chain isoform X2        412   2e-139   Tarenaya hassleriana [spider flower]
ref|XP_006422747.1|  hypothetical protein CICLE_v10028426mg             412   2e-139   Citrus clementina [clementine]
ref|XP_010466127.1|  PREDICTED: tubulin alpha-2 chain-like isofor...    410   3e-139   
gb|KDP44552.1|  hypothetical protein JCGZ_16385                         411   3e-139   Jatropha curcas
gb|ACJ60905.1|  alpha tubulin                                           411   3e-139   Betula pendula [white birch]
ref|XP_002522104.1|  tubulin alpha chain, putative                      411   3e-139   Ricinus communis
ref|XP_002510010.1|  tubulin alpha chain, putative                      411   4e-139   Ricinus communis
gb|ABX57816.1|  alpha tubulin                                           411   4e-139   Picea wilsonii
gb|AAV92352.1|  alpha tubulin 1                                         411   4e-139   Pseudotsuga menziesii var. menziesii
ref|XP_007018369.1|  Tubulin alpha-2 chain                              411   4e-139   Theobroma cacao [chocolate]
ref|XP_010531321.1|  PREDICTED: tubulin alpha chain isoform X1          411   4e-139   Tarenaya hassleriana [spider flower]
ref|XP_009335355.1|  PREDICTED: tubulin alpha chain-like                411   4e-139   Pyrus x bretschneideri [bai li]
ref|XP_006578253.1|  PREDICTED: tubulin alpha-4 chain isoform X2        410   4e-139   
ref|XP_010526692.1|  PREDICTED: tubulin alpha chain-like                411   4e-139   Tarenaya hassleriana [spider flower]
ref|XP_010555432.1|  PREDICTED: tubulin alpha chain-like                411   4e-139   Tarenaya hassleriana [spider flower]
gb|AID52921.1|  tubulin alpha chain                                     411   4e-139   Carthamus tinctorius
ref|XP_004288297.1|  PREDICTED: tubulin alpha-3 chain                   411   4e-139   Fragaria vesca subsp. vesca
ref|XP_007199840.1|  hypothetical protein PRUPE_ppa005633mg             411   4e-139   Prunus persica
ref|XP_010065856.1|  PREDICTED: tubulin alpha chain                     411   5e-139   Eucalyptus grandis [rose gum]
ref|XP_008236966.1|  PREDICTED: tubulin alpha chain-like isoform X2     410   5e-139   
ref|XP_009407690.1|  PREDICTED: tubulin alpha chain-like                411   5e-139   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011457777.1|  PREDICTED: tubulin alpha chain                     411   5e-139   Fragaria vesca subsp. vesca
ref|XP_009335354.1|  PREDICTED: tubulin alpha chain                     411   5e-139   Pyrus x bretschneideri [bai li]
ref|XP_007042689.1|  Tubulin alpha-2 chain                              410   5e-139   Theobroma cacao [chocolate]
gb|KHG18997.1|  Tubulin alpha chain                                     410   6e-139   Gossypium arboreum [tree cotton]
gb|ABO47736.1|  alpha-tubulin                                           410   6e-139   Gossypium hirsutum [American cotton]
ref|XP_010943272.1|  PREDICTED: tubulin alpha chain-like                410   6e-139   Elaeis guineensis
ref|XP_009107245.1|  PREDICTED: tubulin alpha-2 chain isoform X2        411   6e-139   Brassica rapa
ref|XP_008372962.1|  PREDICTED: tubulin alpha chain isoform X2          410   6e-139   
emb|CDY25017.1|  BnaC02g39910D                                          409   6e-139   Brassica napus [oilseed rape]
ref|XP_002313194.1|  hypothetical protein POPTR_0009s08850g             410   7e-139   Populus trichocarpa [western balsam poplar]
gb|KJB58757.1|  hypothetical protein B456_009G224800                    409   7e-139   Gossypium raimondii
dbj|BAP59012.1|  alpha tubulin                                          410   7e-139   Taxus cuspidata [ichii]
ref|XP_006466394.1|  PREDICTED: tubulin alpha-3 chain-like isofor...    410   7e-139   Citrus sinensis [apfelsine]
ref|XP_006426173.1|  hypothetical protein CICLE_v10025588mg             410   7e-139   Citrus clementina [clementine]
gb|AGG37283.1|  alpha-tubulin 1                                         410   8e-139   Salix arbutifolia
ref|NP_849388.1|  tubulin alpha-6 chain                                 409   8e-139   Arabidopsis thaliana [mouse-ear cress]
gb|ABO47740.1|  alpha-tubulin                                           410   9e-139   Gossypium hirsutum [American cotton]
ref|WP_039310890.1|  hypothetical protein                               410   9e-139   
ref|XP_008440459.1|  PREDICTED: tubulin alpha chain-like isoform X1     410   9e-139   Cucumis melo [Oriental melon]
ref|XP_004143417.1|  PREDICTED: tubulin alpha chain-like                410   9e-139   Cucumis sativus [cucumbers]
gb|AGG37285.1|  alpha-tubulin 3                                         410   1e-138   Salix arbutifolia
gb|ABK92552.1|  unknown                                                 410   1e-138   Populus trichocarpa [western balsam poplar]
gb|KDP32140.1|  hypothetical protein JCGZ_12601                         410   1e-138   Jatropha curcas
gb|AGG37287.1|  alpha-tubulin 5                                         410   1e-138   Salix arbutifolia
ref|XP_010664458.1|  PREDICTED: tubulin alpha-4 chain                   410   1e-138   Vitis vinifera
emb|CDY66630.1|  BnaCnng51680D                                          409   1e-138   Brassica napus [oilseed rape]
ref|XP_006404742.1|  hypothetical protein EUTSA_v10000161mg             410   1e-138   Eutrema salsugineum [saltwater cress]
ref|XP_011030289.1|  PREDICTED: tubulin alpha-4 chain                   410   1e-138   Populus euphratica
gb|AIX10966.1|  tubulin                                                 410   1e-138   Ornithogalum longebracteatum [sea-onion]
ref|XP_010104543.1|  Tubulin alpha chain                                409   1e-138   
emb|CAD13176.1|  alpha-tubulin                                          409   1e-138   Nicotiana tabacum [American tobacco]
gb|AAO23139.1|  alpha tubulin                                           409   2e-138   Populus tremuloides
sp|Q6VAF9.1|TBA4_GOSHI  RecName: Full=Tubulin alpha-4 chain; AltN...    409   2e-138   Gossypium hirsutum [American cotton]
ref|XP_003522731.1|  PREDICTED: tubulin alpha-4 chain isoform X1        409   2e-138   Glycine max [soybeans]
ref|XP_006581474.1|  PREDICTED: tubulin alpha-4 chain-like isofor...    409   2e-138   
ref|XP_010266793.1|  PREDICTED: tubulin alpha chain                     409   2e-138   Nelumbo nucifera [Indian lotus]
ref|XP_009402887.1|  PREDICTED: tubulin alpha chain                     409   2e-138   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAO73546.1|  alpha-tubulin                                           409   2e-138   Ceratopteris richardii
ref|XP_009790136.1|  PREDICTED: tubulin alpha chain                     409   2e-138   Nicotiana sylvestris
ref|XP_007047652.1|  Tubulin alpha-2 chain                              411   2e-138   
ref|XP_006307493.1|  hypothetical protein CARUB_v10009117mg             409   2e-138   Capsella rubella
ref|NP_171974.1|  tubulin alpha-4 chain                                 409   2e-138   Arabidopsis thaliana [mouse-ear cress]
sp|Q6VAG0.1|TBA2_GOSHI  RecName: Full=Tubulin alpha-2 chain; AltN...    409   2e-138   Gossypium hirsutum [American cotton]
gb|ABO47739.1|  alpha-tubulin                                           409   2e-138   Gossypium hirsutum [American cotton]
dbj|BAE99023.1|  tubulin alpha-2/alpha-4 chain                          409   2e-138   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010557535.1|  PREDICTED: tubulin alpha-2 chain-like isofor...    409   2e-138   Tarenaya hassleriana [spider flower]
ref|XP_010557536.1|  PREDICTED: tubulin alpha-4 chain-like isofor...    409   2e-138   
ref|XP_006581475.1|  PREDICTED: tubulin alpha-4 chain-like isofor...    410   2e-138   
ref|XP_010245599.1|  PREDICTED: tubulin alpha chain-like                409   2e-138   Nelumbo nucifera [Indian lotus]
ref|XP_011002356.1|  PREDICTED: tubulin alpha chain-like                409   2e-138   Populus euphratica
ref|XP_004238046.1|  PREDICTED: tubulin alpha chain                     409   2e-138   
ref|XP_009620798.1|  PREDICTED: tubulin alpha chain                     409   2e-138   Nicotiana tomentosiformis
sp|P33629.1|TBA_PRUDU  RecName: Full=Tubulin alpha chain                409   3e-138   Prunus dulcis [sweet almond]
ref|XP_001764722.1|  predicted protein                                  409   3e-138   
ref|XP_010093625.1|  Tubulin alpha chain                                409   3e-138   Morus notabilis
gb|KFK32793.1|  hypothetical protein AALP_AA6G289100                    409   3e-138   Arabis alpina [alpine rockcress]
ref|XP_006606007.1|  PREDICTED: tubulin alpha-4 chain-like isofor...    408   3e-138   
dbj|BAC24800.1|  alpha tubulin                                          409   3e-138   Physcomitrella patens
ref|XP_006601463.1|  PREDICTED: tubulin alpha-3 chain-like              408   3e-138   
ref|XP_008787237.1|  PREDICTED: tubulin alpha chain                     409   3e-138   Phoenix dactylifera
sp|Q9ZRR5.1|TBA3_HORVU  RecName: Full=Tubulin alpha-3 chain             409   3e-138   Hordeum vulgare [barley]
ref|XP_011088040.1|  PREDICTED: tubulin alpha chain                     409   3e-138   Sesamum indicum [beniseed]
ref|XP_002981542.1|  hypothetical protein SELMODRAFT_178975             409   3e-138   Selaginella moellendorffii
ref|XP_006356798.1|  PREDICTED: tubulin alpha chain-like                409   3e-138   Solanum tuberosum [potatoes]
ref|XP_006573681.1|  PREDICTED: tubulin alpha-2 chain-like isofor...    408   3e-138   
ref|XP_002301128.1|  hypothetical protein POPTR_0002s11250g             409   4e-138   Populus trichocarpa [western balsam poplar]
ref|XP_008787760.1|  PREDICTED: tubulin alpha chain-like                409   4e-138   Phoenix dactylifera
ref|XP_009614122.1|  PREDICTED: tubulin alpha-3 chain                   409   4e-138   Nicotiana tomentosiformis
ref|XP_002275973.1|  PREDICTED: tubulin alpha chain                     409   4e-138   Vitis vinifera
ref|XP_010096739.1|  Tubulin alpha chain                                408   4e-138   
ref|XP_010507910.1|  PREDICTED: tubulin alpha-2 chain-like              409   4e-138   Camelina sativa [gold-of-pleasure]
ref|XP_006589612.1|  PREDICTED: tubulin alpha chain-like isoform X2     408   4e-138   
ref|XP_009124557.1|  PREDICTED: tubulin alpha-6 chain-like isofor...    407   4e-138   Brassica rapa
emb|CAB66336.1|  alpha-tubulin                                          408   5e-138   Betula pendula [white birch]
ref|XP_007205183.1|  hypothetical protein PRUPE_ppa005613mg             408   5e-138   Prunus persica
gb|KDP41548.1|  hypothetical protein JCGZ_15955                         408   5e-138   Jatropha curcas
ref|XP_006662856.1|  PREDICTED: tubulin alpha-3 chain-like              408   5e-138   Oryza brachyantha
ref|XP_002298794.2|  TUBULIN ALPHA CHAIN family protein                 408   6e-138   Populus trichocarpa [western balsam poplar]
gb|ACN40181.1|  unknown                                                 408   6e-138   Picea sitchensis
ref|XP_002283198.1|  PREDICTED: tubulin alpha chain                     408   6e-138   Vitis vinifera
ref|XP_002964078.1|  hypothetical protein SELMODRAFT_405729             408   6e-138   Selaginella moellendorffii
ref|XP_004304311.1|  PREDICTED: tubulin alpha-2 chain-like              408   6e-138   Fragaria vesca subsp. vesca
ref|XP_010936237.1|  PREDICTED: tubulin alpha chain-like                408   6e-138   Elaeis guineensis
gb|KHN01709.1|  Tubulin alpha chain                                     408   6e-138   Glycine soja [wild soybean]
ref|XP_003524707.1|  PREDICTED: tubulin alpha-3 chain-like isofor...    408   7e-138   Glycine max [soybeans]
ref|XP_006362511.1|  PREDICTED: tubulin alpha-1 chain-like              408   7e-138   
ref|XP_007215369.1|  hypothetical protein PRUPE_ppa005626mg             408   7e-138   Prunus persica
gb|ABK92520.1|  unknown                                                 408   7e-138   Populus trichocarpa [western balsam poplar]
ref|XP_010500556.1|  PREDICTED: tubulin alpha-2 chain isoform X2        408   7e-138   
ref|XP_004244533.1|  PREDICTED: tubulin alpha-3 chain-like              408   7e-138   Solanum lycopersicum
ref|XP_009605705.1|  PREDICTED: tubulin alpha-2 chain-like              408   7e-138   Nicotiana tomentosiformis
ref|XP_008372961.1|  PREDICTED: tubulin alpha chain isoform X1          408   8e-138   Malus domestica [apple tree]
ref|XP_004136930.1|  PREDICTED: tubulin alpha-4 chain-like              408   8e-138   Cucumis sativus [cucumbers]
ref|XP_004501073.1|  PREDICTED: tubulin alpha chain-like                407   8e-138   Cicer arietinum [garbanzo]
ref|XP_003603670.1|  Tubulin alpha-7 chain                              407   8e-138   Medicago truncatula
ref|XP_003635553.2|  PREDICTED: tubulin alpha chain-like                407   9e-138   Vitis vinifera
gb|ABQ59633.1|  alpha-tubulin 3                                         407   9e-138   Populus tremuloides
ref|XP_010939312.1|  PREDICTED: tubulin alpha chain-like                407   9e-138   Elaeis guineensis
ref|XP_003556001.1|  PREDICTED: tubulin alpha-4 chain-like isofor...    407   9e-138   Glycine max [soybeans]
ref|XP_011014531.1|  PREDICTED: tubulin alpha-4 chain-like              407   9e-138   Populus euphratica
gb|KHG20487.1|  Tubulin alpha chain                                     407   1e-137   Gossypium arboreum [tree cotton]
gb|ABO47737.1|  alpha-tubulin                                           407   1e-137   Gossypium hirsutum [American cotton]
ref|XP_010500555.1|  PREDICTED: tubulin alpha-6 chain isoform X1        407   1e-137   Camelina sativa [gold-of-pleasure]
gb|ACU19580.1|  unknown                                                 407   1e-137   Glycine max [soybeans]
ref|XP_010461854.1|  PREDICTED: tubulin alpha-6 chain-like              407   1e-137   Camelina sativa [gold-of-pleasure]
ref|XP_003536570.1|  PREDICTED: tubulin alpha chain-like isoform X1     407   1e-137   Glycine max [soybeans]
ref|XP_009388502.1|  PREDICTED: tubulin alpha-2 chain isoform X1        407   1e-137   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB29387.1|  hypothetical protein B456_005G097800                    407   1e-137   Gossypium raimondii
gb|ABB02631.1|  unknown                                                 407   1e-137   Solanum tuberosum [potatoes]
ref|XP_008455056.1|  PREDICTED: tubulin alpha-4 chain isoform X2        405   1e-137   
ref|XP_009147859.1|  PREDICTED: tubulin alpha-6 chain                   407   1e-137   Brassica rapa
ref|XP_006472373.1|  PREDICTED: tubulin alpha chain isoform X2          407   1e-137   
sp|P46259.1|TBA1_PEA  RecName: Full=Tubulin alpha-1 chain               407   1e-137   Pisum sativum [garden pea]
gb|ADW66593.1|  alpha tubulin                                           404   1e-137   Hirschfeldia incana [buchanweed]
ref|XP_003608582.1|  Tubulin alpha-5 chain                              407   1e-137   Medicago truncatula
ref|NP_193232.1|  tubulin alpha-6 chain                                 407   1e-137   Arabidopsis thaliana [mouse-ear cress]
gb|AHJ80816.1|  Tua1                                                    407   1e-137   Eragrostis tef [tef]
ref|XP_004496862.1|  PREDICTED: tubulin alpha chain-like                407   1e-137   Cicer arietinum [garbanzo]
ref|XP_006579968.1|  PREDICTED: tubulin alpha-3 chain-like isofor...    407   2e-137   
ref|XP_004299843.1|  PREDICTED: tubulin alpha chain-like                407   2e-137   Fragaria vesca subsp. vesca
ref|XP_008341563.1|  PREDICTED: tubulin alpha-2 chain-like              407   2e-137   
gb|KDO81347.1|  hypothetical protein CISIN_1g013037mg                   407   2e-137   Citrus sinensis [apfelsine]
ref|XP_006472372.1|  PREDICTED: tubulin alpha chain isoform X1          407   2e-137   Citrus sinensis [apfelsine]
ref|NP_001067613.1|  Os11g0247300                                       406   3e-137   
ref|XP_008379344.1|  PREDICTED: tubulin alpha-2 chain                   406   3e-137   Malus domestica [apple tree]
ref|XP_008804464.1|  PREDICTED: tubulin alpha chain-like                406   3e-137   Phoenix dactylifera
dbj|BAB19779.1|  alpha tubulin                                          406   3e-137   Nicotiana tabacum [American tobacco]
gb|AHZ58482.1|  alpha-tubulin                                           399   3e-137   Syntrichia caninervis
ref|XP_010680774.1|  PREDICTED: tubulin alpha-2 chain                   406   3e-137   Beta vulgaris subsp. vulgaris [field beet]
gb|AGE09583.1|  TUA1-like protein                                       405   4e-137   Eucalyptus cladocalyx
gb|KEH43997.1|  tubulin beta-1 chain                                    406   4e-137   Medicago truncatula
ref|NP_001289660.1|  tubulin alpha chain-like                           406   4e-137   Eucalyptus grandis [rose gum]
ref|XP_009388503.1|  PREDICTED: tubulin alpha chain isoform X2          406   4e-137   
ref|XP_002962630.1|  hypothetical protein SELMODRAFT_230143             406   4e-137   
dbj|BAJ06362.1|  alpha-tubulin                                          406   4e-137   Alopecurus aequalis
ref|XP_003560377.1|  PREDICTED: tubulin alpha-1 chain                   406   4e-137   Brachypodium distachyon [annual false brome]
ref|XP_004981922.1|  PREDICTED: tubulin alpha-1 chain-like              406   4e-137   Setaria italica
ref|XP_008219157.1|  PREDICTED: tubulin alpha chain-like isoform X2     405   5e-137   
ref|XP_003517369.1|  PREDICTED: tubulin alpha-2 chain-like isofor...    405   5e-137   Glycine max [soybeans]
ref|XP_007156677.1|  hypothetical protein PHAVU_002G007900g             405   5e-137   Phaseolus vulgaris [French bean]
ref|XP_007137281.1|  hypothetical protein PHAVU_009G114100g             405   6e-137   Phaseolus vulgaris [French bean]
ref|XP_007155784.1|  hypothetical protein PHAVU_003G231500g             405   6e-137   Phaseolus vulgaris [French bean]
gb|AFV46219.1|  hypothetical protein                                    405   6e-137   Scutellaria baicalensis [Baikal skullcap]
gb|AHJ80822.1|  Tua1                                                    405   7e-137   Eragrostis tef [tef]
gb|AHJ80817.1|  Tua1                                                    405   7e-137   Eragrostis tef [tef]
ref|XP_010060142.1|  PREDICTED: tubulin alpha chain-like                405   7e-137   Eucalyptus grandis [rose gum]
ref|XP_008455054.1|  PREDICTED: tubulin alpha-4 chain isoform X1        405   7e-137   Cucumis melo [Oriental melon]
ref|XP_003539228.1|  PREDICTED: tubulin alpha-2 chain-like              405   7e-137   Glycine max [soybeans]
emb|CAA06619.1|  alpha-tubulin 1                                        405   7e-137   Eleusine indica [crabgrass]
gb|AHJ80815.1|  Tua1                                                    405   7e-137   Eragrostis tef [tef]
ref|NP_001167663.1|  tubulin alpha-3 chain                              405   7e-137   Zea mays [maize]
sp|O22347.1|TBA1_ELEIN  RecName: Full=Tubulin alpha-1 chain; AltN...    405   7e-137   Eleusine indica [crabgrass]
gb|AFC88832.1|  putative tubulin alpha-3 chain                          405   7e-137   Miscanthus sinensis
gb|AAL16174.1|AF428406_1  AT4g14960/dl3520c                             405   8e-137   Arabidopsis thaliana [mouse-ear cress]
sp|Q9FT36.1|TBA_DAUCA  RecName: Full=Tubulin alpha chain                405   8e-137   Daucus carota [carrots]
ref|XP_009124556.1|  PREDICTED: tubulin alpha-2 chain-like isofor...    405   9e-137   Brassica rapa
ref|XP_004150268.1|  PREDICTED: tubulin alpha chain-like                405   9e-137   Cucumis sativus [cucumbers]
gb|ABQ59634.1|  alpha-tubulin 5                                         405   9e-137   Populus tremuloides
ref|XP_006650518.1|  PREDICTED: tubulin alpha-1 chain-like              405   9e-137   Oryza brachyantha
gb|AIX10773.1|  alpha tubulin                                           405   1e-136   Panax notoginseng [san-qi]
ref|XP_008665337.1|  PREDICTED: tubulin alpha-1 chain-like              405   1e-136   
ref|XP_008665339.1|  PREDICTED: tubulin alpha-2 chain                   405   1e-136   Zea mays [maize]
ref|XP_009357231.1|  PREDICTED: tubulin alpha chain-like isoform X2     405   1e-136   
ref|XP_002976230.1|  hypothetical protein SELMODRAFT_105136             405   1e-136   Selaginella moellendorffii
ref|XP_008352751.1|  PREDICTED: tubulin alpha chain isoform X2          405   1e-136   
gb|ACH68563.1|  alpha-tubulin                                           405   1e-136   Solanum tuberosum [potatoes]
ref|XP_007143142.1|  hypothetical protein PHAVU_007G047300g             405   1e-136   Phaseolus vulgaris [French bean]
ref|XP_002989731.1|  hypothetical protein SELMODRAFT_130285             404   1e-136   Selaginella moellendorffii
sp|Q6VAG1.1|TBA1_GOSHI  RecName: Full=Tubulin alpha-1 chain; AltN...    404   1e-136   Gossypium hirsutum [American cotton]
emb|CDP02221.1|  unnamed protein product                                404   2e-136   Coffea canephora [robusta coffee]
emb|CAA62917.1|  alfa-tubulin                                           404   2e-136   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009618479.1|  PREDICTED: tubulin alpha-3 chain-like              404   2e-136   Nicotiana tomentosiformis
ref|XP_002989721.1|  hypothetical protein SELMODRAFT_235864             404   2e-136   
gb|KHN42598.1|  Tubulin alpha-2 chain                                   404   2e-136   Glycine soja [wild soybean]
sp|Q96460.1|TBA2_HORVU  RecName: Full=Tubulin alpha-2 chain             404   3e-136   Hordeum vulgare [barley]
gb|ABD92930.1|  alpha tubulin-2A                                        404   3e-136   Triticum aestivum [Canadian hard winter wheat]
gb|ABO47742.1|  alpha-tubulin                                           404   3e-136   Gossypium hirsutum [American cotton]
ref|XP_002517492.1|  tubulin alpha chain, putative                      404   3e-136   Ricinus communis
ref|XP_002972670.1|  hypothetical protein SELMODRAFT_231979             404   3e-136   Selaginella moellendorffii
ref|NP_001291325.1|  tubulin alpha chain-like                           404   3e-136   Sesamum indicum [beniseed]
gb|ABF98643.1|  Tubulin alpha-1 chain, putative, expressed              403   3e-136   Oryza sativa Japonica Group [Japonica rice]
gb|ABG78593.1|  alpha-tubulin                                           404   3e-136   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009779180.1|  PREDICTED: tubulin alpha-3 chain-like              404   3e-136   Nicotiana sylvestris
ref|XP_007223365.1|  hypothetical protein PRUPE_ppa005617mg             404   4e-136   Prunus persica
gb|ABV55999.1|  alpha-tubulin 7                                         403   4e-136   Populus tremuloides
ref|NP_001051132.1|  Os03g0726100                                       403   4e-136   
ref|XP_006482577.1|  PREDICTED: tubulin alpha-2 chain-like isofor...    402   4e-136   Citrus sinensis [apfelsine]
gb|ABP65320.1|  alpha tubulin                                           403   5e-136   Capsicum annuum
ref|XP_007032501.1|  Tubulin alpha-2 chain                              403   5e-136   
ref|XP_008347837.1|  PREDICTED: tubulin alpha-4 chain isoform X2        403   6e-136   
ref|XP_002508010.1|  alpha tubulin 2                                    403   6e-136   Micromonas commoda
gb|AGG37289.1|  alpha-tubulin 7                                         403   7e-136   Salix arbutifolia
sp|Q9ZRB7.1|TBA_WHEAT  RecName: Full=Tubulin alpha chain                403   7e-136   Triticum aestivum [Canadian hard winter wheat]
gb|AAB84298.1|  tubulin                                                 403   7e-136   Oryza sativa Indica Group [Indian rice]
ref|XP_011008936.1|  PREDICTED: tubulin alpha chain                     403   7e-136   Populus euphratica
ref|XP_010256937.1|  PREDICTED: tubulin alpha chain-like                402   8e-136   Nelumbo nucifera [Indian lotus]
ref|XP_006650524.1|  PREDICTED: tubulin alpha-1 chain-like              403   8e-136   Oryza brachyantha
ref|XP_011098608.1|  PREDICTED: tubulin alpha chain                     402   9e-136   Sesamum indicum [beniseed]
sp|P33623.1|TBA1_ANEPH  RecName: Full=Tubulin alpha-1 chain             402   1e-135   Anemia phyllitidis
gb|AAQ81585.1|  putative tubulin alpha-2/alpha-4 chain                  402   1e-135   Brassica napus [oilseed rape]
ref|XP_002962209.1|  hypothetical protein SELMODRAFT_230058             402   2e-135   Selaginella moellendorffii
dbj|BAJ98211.1|  predicted protein                                      402   2e-135   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_005651460.1|  tubulin alpha chain                                402   2e-135   Coccomyxa subellipsoidea C-169
ref|XP_005851144.1|  alpha-tubulin                                      402   2e-135   Chlorella variabilis
emb|CDO97305.1|  unnamed protein product                                402   2e-135   Coffea canephora [robusta coffee]
ref|XP_001777081.1|  predicted protein                                  402   2e-135   
ref|XP_002963092.1|  hypothetical protein SELMODRAFT_78469              402   2e-135   Selaginella moellendorffii
ref|XP_001782790.1|  predicted protein                                  402   2e-135   
ref|XP_010242419.1|  PREDICTED: tubulin alpha-1 chain                   402   2e-135   Nelumbo nucifera [Indian lotus]
ref|XP_006338461.1|  PREDICTED: tubulin alpha-3 chain-like isofor...    401   2e-135   
ref|XP_006431130.1|  hypothetical protein CICLE_v10011709mg             401   3e-135   Citrus clementina [clementine]
ref|XP_004231960.1|  PREDICTED: tubulin alpha-3 chain-like              401   4e-135   Solanum lycopersicum
ref|XP_002973792.1|  hypothetical protein SELMODRAFT_100162             401   4e-135   Selaginella moellendorffii
ref|XP_006357741.1|  PREDICTED: tubulin alpha-3 chain-like              400   6e-135   Solanum tuberosum [potatoes]
gb|AHJ80823.1|  Tua1                                                    400   6e-135   Eragrostis tef [tef]
ref|XP_005643073.1|  tubulin alpha chain                                400   7e-135   Coccomyxa subellipsoidea C-169
emb|CAA62916.1|  alpha-tubulin                                          400   8e-135   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002963093.1|  hypothetical protein SELMODRAFT_404672             400   9e-135   Selaginella moellendorffii
ref|XP_003058621.1|  alpha tubulin                                      400   9e-135   Micromonas pusilla CCMP1545
ref|XP_010099392.1|  Tubulin alpha chain                                400   1e-134   
ref|XP_002980239.1|  hypothetical protein SELMODRAFT_233509             400   1e-134   Selaginella moellendorffii
ref|XP_009409992.1|  PREDICTED: tubulin alpha chain-like                399   1e-134   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004232226.1|  PREDICTED: tubulin alpha chain-like                399   1e-134   Solanum lycopersicum
sp|P10872.1|TBA_TETPY  RecName: Full=Tubulin alpha chain                399   2e-134   Tetrahymena pyriformis
ref|XP_009626810.1|  PREDICTED: tubulin alpha chain-like                399   2e-134   Nicotiana tomentosiformis
gb|AIA82433.1|  alpha-tubulin-like protein 01                           399   2e-134   Stentor coeruleus
gb|ACY05960.1|  alpha-tubulin                                           396   3e-134   Haematococcus lacustris
ref|XP_001022424.1|  Tubulin/FtsZ family, GTPase domain containin...    399   3e-134   Tetrahymena thermophila SB210
gb|ACK76232.1|  alpha-tubulin                                           399   3e-134   Dimocarpus longan [longan]
sp|P09205.1|TBA2_CHLRE  RecName: Full=Tubulin alpha-2 chain             398   6e-134   Chlamydomonas reinhardtii
gb|KIZ03400.1|  Tubulin alpha chain                                     398   6e-134   Monoraphidium neglectum
gb|AIA82437.1|  alpha-tubulin-like protein 06                           394   6e-134   Stentor coeruleus
gb|KIZ01406.1|  Tubulin alpha-1 chain                                   398   6e-134   Monoraphidium neglectum
emb|CDP00974.1|  unnamed protein product                                398   7e-134   Coffea canephora [robusta coffee]
ref|XP_002951007.1|  alpha tubulin                                      397   7e-134   Volvox carteri f. nagariensis
ref|XP_001691876.1|  alpha tubulin 1                                    397   7e-134   Chlamydomonas reinhardtii
gb|AAX63396.1|  alpha-tubulin                                           397   1e-133   Haematococcus lacustris
gb|AEW46684.1|  beta-tubulin                                            397   1e-133   Ulva linza
gb|ACH70610.1|  alpha tubulin                                           397   2e-133   Ulva fasciata
gb|AAB86649.1|  alpha-tubulin                                           396   2e-133   Chloromonas sp. ANT1
ref|XP_004034900.1|  hypothetical protein IMG5_110300                   396   3e-133   Ichthyophthirius multifiliis
emb|CBI16534.3|  unnamed protein product                                395   3e-133   Vitis vinifera
emb|CDW82295.1|  alpha tubulin                                          395   6e-133   Stylonychia lemnae
dbj|BAJ06364.1|  alpha-tubulin                                          395   7e-133   Alopecurus aequalis
ref|XP_003558668.1|  PREDICTED: tubulin alpha-2 chain-like              395   7e-133   Brachypodium distachyon [annual false brome]
gb|AIA82435.1|  alpha-tubulin-like protein 03                           395   8e-133   
gb|EJY81124.1|  Alpha tubulin,putative                                  395   1e-132   
gb|ABC59068.2|  alpha tubulin 1                                         395   1e-132   
gb|KJB83376.1|  hypothetical protein B456_013G244600                    388   1e-132   
gb|ABD92937.1|  alpha tubulin-4A                                        394   1e-132   
gb|ABD92936.1|  alpha tubulin-4D                                        394   1e-132   
ref|XP_008606530.1|  tubulin alpha                                      389   1e-132   
dbj|BAJ97454.1|  predicted protein                                      391   1e-132   
gb|EYU34660.1|  hypothetical protein MIMGU_mgv1a006269mg                394   2e-132   
emb|CAA67848.1|  alpha-tubulin                                          394   2e-132   
ref|XP_008351479.1|  PREDICTED: tubulin alpha-3 chain                   394   2e-132   
ref|XP_001454509.1|  hypothetical protein                               394   2e-132   
emb|CAI38956.1|  alpha_tubulin,putative                                 394   3e-132   
ref|XP_002285721.1|  PREDICTED: tubulin alpha-3 chain                   394   3e-132   
gb|KJB83377.1|  hypothetical protein B456_013G244600                    390   3e-132   
ref|XP_001460309.1|  hypothetical protein                               393   4e-132   
gb|AAB86648.1|  alpha-tubulin                                           393   4e-132   
ref|XP_011461685.1|  PREDICTED: tubulin alpha-3 chain isoform X2        392   4e-132   
gb|AAB08791.1|  alpha tubulin                                           393   4e-132   
gb|AFC88824.1|  putative tubulin alpha-3 chain                          393   5e-132   
ref|XP_002466376.1|  hypothetical protein SORBIDRAFT_01g006650          393   5e-132   
ref|XP_001770881.1|  predicted protein                                  393   6e-132   
gb|AEF79970.1|  alpha-tubulin protein                                   393   6e-132   
ref|XP_008223650.1|  PREDICTED: tubulin alpha-3 chain-like              392   7e-132   
ref|XP_002904194.1|  alpha-tubulin                                      392   9e-132   
ref|XP_009126389.1|  PREDICTED: tubulin alpha-3 chain-like              392   9e-132   
ref|NP_001105440.1|  tubulin alpha-3 chain                              392   1e-131   
gb|ETL99793.1|  tubulin alpha chain                                     389   1e-131   
ref|NP_197478.1|  tubulin alpha-3                                       392   1e-131   
gb|AAW57312.1|  alpha-tubulin                                           387   1e-131   
ref|XP_009126388.1|  PREDICTED: tubulin alpha-3 chain-like              392   1e-131   
ref|XP_009120857.1|  PREDICTED: tubulin alpha-3 chain                   392   1e-131   
ref|XP_008349406.1|  PREDICTED: tubulin alpha-3 chain                   392   1e-131   
emb|CDY42294.1|  BnaC02g09000D                                          392   1e-131   
ref|XP_009126391.1|  PREDICTED: tubulin alpha-3 chain-like              392   1e-131   
ref|XP_006650667.1|  PREDICTED: tubulin alpha-2 chain-like              392   1e-131   
emb|CDY44941.1|  BnaA02g04460D                                          392   1e-131   
emb|CDP12358.1|  unnamed protein product                                392   2e-131   
ref|XP_010454260.1|  PREDICTED: tubulin alpha-3 chain-like              392   2e-131   
gb|KDO81348.1|  hypothetical protein CISIN_1g013037mg                   391   2e-131   
emb|CDX88875.1|  BnaA03g07740D                                          392   2e-131   
gb|AAT09064.1|  alpha tubulin 2                                         392   2e-131   
ref|XP_001455356.1|  hypothetical protein                               391   2e-131   
ref|XP_008240534.1|  PREDICTED: tubulin alpha-3 chain isoform X2        390   2e-131   
sp|P28287.1|TBA_OXYGR  RecName: Full=Tubulin alpha chain                391   2e-131   
ref|XP_007205189.1|  hypothetical protein PRUPE_ppa005642mg             391   2e-131   
sp|P07304.2|TBA1_STYLE  RecName: Full=Tubulin alpha-1 chain             391   2e-131   
gb|ACN40824.1|  unknown                                                 391   2e-131   
ref|XP_009131752.1|  PREDICTED: tubulin alpha-3 chain-like              391   2e-131   
ref|XP_009375870.1|  PREDICTED: tubulin alpha-3 chain                   391   2e-131   
gb|AAT09063.1|  alpha tubulin 1                                         391   2e-131   
gb|AIA82436.1|  alpha-tubulin-like protein 04                           392   3e-131   
ref|XP_006286664.1|  hypothetical protein CARUB_v10002583mg             390   4e-131   
ref|XP_010531152.1|  PREDICTED: tubulin alpha-3 chain                   390   4e-131   
ref|XP_006286795.1|  hypothetical protein CARUB_v10003470mg             390   5e-131   
ref|XP_010535935.1|  PREDICTED: tubulin alpha-3 chain-like isofor...    390   5e-131   
gb|EYU23006.1|  hypothetical protein MIMGU_mgv1a006283mg                390   5e-131   
ref|XP_004295008.1|  PREDICTED: tubulin alpha-3 chain isoform X1        390   6e-131   
gb|AEG74028.1|  alpha-tubulin                                           390   6e-131   
gb|KDD76276.1|  tubulin/FtsZ GTPase                                     390   7e-131   
emb|CAB77671.1|  alpha-tubulin                                          390   7e-131   
ref|XP_010673470.1|  PREDICTED: tubulin alpha-3 chain                   390   8e-131   
ref|XP_009408459.1|  PREDICTED: tubulin alpha-3 chain-like              390   9e-131   
ref|XP_002532068.1|  tubulin alpha chain, putative                      389   1e-130   
dbj|BAM28754.1|  tubulin                                                387   1e-130   
ref|NP_001060075.1|  Os07g0574800                                       389   1e-130   
gb|ABE66388.1|  alpha-tubulin                                           380   1e-130   
gb|ETM30643.1|  tubulin alpha chain                                     389   2e-130   
emb|CEG01594.1|  Tubulin/FtsZ, 2-layer sandwich domain                  389   2e-130   
ref|XP_010535933.1|  PREDICTED: tubulin alpha-3 chain-like isofor...    389   2e-130   
ref|XP_009400845.1|  PREDICTED: tubulin alpha-3 chain                   389   2e-130   
emb|CCI41153.1|  unnamed protein product                                389   3e-130   
ref|XP_008900864.1|  tubulin alpha chain                                389   3e-130   
ref|XP_002904195.1|  alpha-tubulin, putative                            389   3e-130   
ref|XP_008872990.1|  tubulin alpha chain                                389   3e-130   
emb|CAL80740.1|  alpha-tubulin                                          389   3e-130   
gb|ETM52951.1|  tubulin alpha chain                                     388   3e-130   
ref|XP_006657877.1|  PREDICTED: tubulin alpha-3 chain-like              389   3e-130   
ref|XP_001419217.1|  predicted protein                                  389   3e-130   
gb|ETO82054.1|  tubulin alpha chain                                     389   3e-130   
ref|XP_004504311.1|  PREDICTED: tubulin alpha-3 chain-like              388   3e-130   
ref|XP_003629736.1|  Alpha-tubulin                                      388   3e-130   
ref|XP_009842456.1|  tubulin alpha chain                                388   3e-130   
gb|KHG06160.1|  Tubulin alpha-3/alpha-5 chain -like protein             388   4e-130   
gb|KJB83375.1|  hypothetical protein B456_013G244600                    388   4e-130   
ref|XP_006858944.1|  hypothetical protein AMTR_s00068p00090790          388   4e-130   
gb|KJB80786.1|  hypothetical protein B456_013G115100                    388   4e-130   
ref|XP_004981594.1|  PREDICTED: tubulin alpha-3 chain-like              388   4e-130   
gb|KHG19627.1|  Tubulin alpha-3/alpha-5 chain -like protein             388   4e-130   
ref|XP_009413318.1|  PREDICTED: tubulin alpha-3 chain-like              388   4e-130   
ref|XP_008240533.1|  PREDICTED: tubulin alpha-3 chain isoform X1        388   4e-130   
ref|XP_010923361.1|  PREDICTED: tubulin alpha-3 chain                   388   4e-130   
ref|XP_007204346.1|  hypothetical protein PRUPE_ppa005649mg             388   5e-130   
gb|EPS70933.1|  tubulin alpha-6 chain                                   381   5e-130   
gb|ABD92943.1|  alpha tubulin-1B                                        388   5e-130   
emb|CAE52514.1|  alpha tubulin                                          388   5e-130   
emb|CAD26886.1|  alpha-tubulin                                          387   6e-130   
ref|XP_003562846.1|  PREDICTED: tubulin alpha-1 chain                   387   7e-130   
ref|NP_001105588.1|  tubulin alpha-6 chain                              387   8e-130   
gb|ABD92942.1|  alpha tubulin-1D                                        387   8e-130   
ref|XP_002675196.1|  alpha-tubulin                                      387   9e-130   
ref|XP_006584595.1|  PREDICTED: uncharacterized protein LOC100806...    386   9e-130   
ref|XP_009366459.1|  PREDICTED: tubulin alpha-3 chain                   387   9e-130   
emb|CAD26893.1|  alpha-tubulin                                          387   1e-129   
sp|O22349.1|TBA3_ELEIN  RecName: Full=Tubulin alpha-3 chain; AltN...    387   1e-129   
ref|NP_001237301.1|  tubulin A                                          387   1e-129   
emb|CAD26887.1|  alpha-tubulin                                          387   1e-129   
ref|XP_006579487.1|  PREDICTED: tubulin A isoform X1                    387   1e-129   
ref|XP_011025144.1|  PREDICTED: tubulin alpha-3 chain                   387   1e-129   
emb|CAD24767.1|  alpha-tubulin                                          387   1e-129   
ref|XP_006488931.1|  PREDICTED: tubulin alpha-1 chain-like isofor...    386   1e-129   
ref|XP_009406530.1|  PREDICTED: tubulin alpha-3 chain-like              387   2e-129   
gb|AIC33057.1|  tubulin alpha-1 chain                                   387   2e-129   
ref|XP_673091.1|  hypothetical protein                                  379   2e-129   
ref|XP_009389058.1|  PREDICTED: tubulin alpha-3 chain-like              386   2e-129   
ref|XP_011089722.1|  PREDICTED: tubulin alpha-3 chain                   386   2e-129   
dbj|BAJ06363.1|  alpha-tubulin                                          386   3e-129   
sp|Q08114.1|TBA_EUPOC  RecName: Full=Tubulin alpha chain                386   3e-129   
ref|XP_009833024.1|  tubulin alpha chain                                386   4e-129   
ref|XP_008449886.1|  PREDICTED: tubulin alpha-3 chain isoform X2        385   4e-129   
sp|P09243.1|TBA2_STYLE  RecName: Full=Tubulin alpha-2 chain             385   4e-129   
ref|XP_009353129.1|  PREDICTED: tubulin alpha-3 chain-like              385   4e-129   
gb|AGG37290.1|  alpha-tubulin 8                                         385   4e-129   
ref|NP_001275086.1|  uncharacterized LOC102577521                       385   4e-129   
ref|XP_010112637.1|  Tubulin alpha-3 chain                              385   5e-129   
ref|XP_004170946.1|  PREDICTED: LOW QUALITY PROTEIN: tubulin alph...    385   5e-129   
ref|XP_008464962.1|  PREDICTED: tubulin alpha-3 chain-like              385   5e-129   
ref|XP_004141134.1|  PREDICTED: tubulin alpha-3 chain-like              385   5e-129   
emb|CAD24765.1|  alpha-tubulin                                          385   5e-129   
ref|XP_010934670.1|  PREDICTED: tubulin alpha-3 chain-like              385   5e-129   
emb|CAD26891.1|  alpha-tubulin                                          385   6e-129   
sp|Q43473.1|TBA1_HORVU  RecName: Full=Tubulin alpha-1 chain             385   6e-129   
gb|AGD80034.1|  alpha-tubulin 1                                         385   6e-129   
sp|Q25563.1|TBA13_NAEGR  RecName: Full=Tubulin alpha-13 chain           385   7e-129   
gb|EYU31677.1|  hypothetical protein MIMGU_mgv1a006281mg                385   7e-129   
emb|CAD26889.1|  alpha-tubulin                                          384   8e-129   
gb|KDP39691.1|  hypothetical protein JCGZ_02711                         385   8e-129   
ref|XP_011078787.1|  PREDICTED: tubulin alpha-1 chain-like              385   8e-129   
emb|CAB77672.1|  alpha-tubulin                                          385   8e-129   
ref|XP_008813089.1|  PREDICTED: tubulin alpha-3 chain                   385   9e-129   
ref|NP_001275271.1|  alpha-tubulin-like protein                         385   9e-129   
gb|AEN19681.1|  alpha-tubulin                                           383   1e-128   
ref|XP_010257632.1|  PREDICTED: tubulin alpha-3 chain                   384   1e-128   
ref|XP_004149645.1|  PREDICTED: tubulin alpha-3 chain-like              384   1e-128   
ref|XP_010044940.1|  PREDICTED: tubulin alpha-3 chain                   384   1e-128   
gb|AGG37286.1|  alpha-tubulin 4                                         384   1e-128   
emb|CAD24766.1|  alpha-tubulin                                          384   1e-128   
gb|AEN19682.1|  alpha-tubulin                                           382   1e-128   
ref|XP_008616224.1|  tubulin alpha chain                                384   1e-128   
ref|XP_008449885.1|  PREDICTED: tubulin alpha-3 chain isoform X1        384   1e-128   
emb|CAD26890.1|  alpha-tubulin                                          384   1e-128   
ref|XP_004958110.1|  PREDICTED: tubulin alpha-3 chain-like              384   1e-128   
gb|KDO30581.1|  tubulin alpha chain                                     384   1e-128   
gb|AAL73386.1|AF408404_1  alpha-tubulin                                 384   2e-128   
ref|XP_002324047.2|  hypothetical protein POPTR_0017s11740g             384   2e-128   
gb|ACU18775.1|  unknown                                                 375   2e-128   
ref|XP_007159433.1|  hypothetical protein PHAVU_002G237400g             384   2e-128   
ref|XP_008804327.1|  PREDICTED: tubulin alpha-1 chain-like              384   2e-128   
ref|NP_001105324.1|  tubulin alpha-5 chain                              384   2e-128   
ref|XP_006445597.1|  hypothetical protein CICLE_v10015224mg             384   2e-128   
gb|KDO55010.1|  hypothetical protein CISIN_1g0157541mg                  380   2e-128   
emb|CDP17586.1|  unnamed protein product                                384   3e-128   
sp|Q38771.1|TBA_AVESA  RecName: Full=Tubulin alpha chain                383   3e-128   
gb|AGG37284.1|  alpha-tubulin 2                                         384   3e-128   
ref|XP_002303998.1|  alpha-tubulin 2 family protein                     383   3e-128   
gb|AEQ75493.1|  alpha-tubulin                                           383   3e-128   
ref|XP_008386829.1|  PREDICTED: tubulin alpha-3 chain-like              383   4e-128   
gb|AAK37831.1|AF182309_1  alpha-tubulin                                 383   4e-128   
emb|CCC46467.1|  putative alpha tubulin, fragment                       376   5e-128   
sp|P33625.1|TBA_EUGGR  RecName: Full=Tubulin alpha chain                382   6e-128   
gb|AAX21196.1|  putative alpha-tubulin                                  373   6e-128   
ref|NP_001242878.1|  uncharacterized protein LOC100806907               382   7e-128   
ref|XP_007014666.1|  Tubulin alpha-5                                    382   7e-128   
gb|ABV55994.1|  alpha-tubulin 6                                         382   7e-128   
ref|XP_002325422.1|  Tubulin alpha-1 chain family protein               382   7e-128   
ref|XP_002364807.1|  tubulin alpha chain                                382   8e-128   
ref|XP_010276368.1|  PREDICTED: tubulin alpha-3 chain-like              382   8e-128   
gb|AGY80453.1|  tubulin                                                 382   9e-128   
gb|AAO63773.2|  alpha-tubulin 2                                         382   1e-127   
ref|XP_002297631.1|  alpha-tubulin 2 family protein                     382   1e-127   
emb|CAD26888.1|  alpha-tubulin                                          382   1e-127   
gb|ABO47735.1|  alpha-tubulin                                           382   1e-127   
ref|XP_004599399.1|  PREDICTED: tubulin alpha-1B chain                  373   2e-127   
gb|KJB44614.1|  hypothetical protein B456_007G261000                    381   2e-127   
gb|KHG26159.1|  Tubulin alpha-6 chain                                   381   2e-127   
dbj|BAE01779.1|  unnamed protein product                                374   2e-127   
ref|XP_006443441.1|  hypothetical protein CICLE_v10020128mg             381   2e-127   
gb|ABO47741.1|  alpha-tubulin                                           381   2e-127   
gb|KDP42087.1|  hypothetical protein JCGZ_01875                         381   2e-127   
ref|XP_005801996.1|  PREDICTED: tubulin alpha-1B chain-like             374   2e-127   
ref|XP_006895063.1|  PREDICTED: tubulin alpha-1B chain-like             374   2e-127   
ref|XP_011048194.1|  PREDICTED: tubulin alpha-6 chain-like              381   2e-127   
ref|XP_011075054.1|  PREDICTED: tubulin alpha-3 chain-like              381   2e-127   
ref|XP_011034391.1|  PREDICTED: tubulin alpha-3 chain                   381   2e-127   
emb|CAD26892.1|  alpha-tubulin                                          381   3e-127   
ref|XP_011366648.1|  PREDICTED: tubulin alpha-1C chain-like             375   3e-127   
ref|XP_002781275.1|  Tubulin alpha chain, putative                      373   3e-127   
ref|XP_003080933.1|  TBA_CHLVU Tubulin alpha chain (ISS)                382   3e-127   
gb|AGG37288.1|  alpha-tubulin 6                                         380   3e-127   
gb|ABO47738.1|  alpha-tubulin                                           380   3e-127   
gb|ABP65323.1|  alpha tubulin                                           380   4e-127   
ref|XP_002525416.1|  tubulin alpha chain, putative                      380   4e-127   
emb|CAD24768.1|  alpha-tubulin                                          380   4e-127   
ref|XP_005932717.1|  PREDICTED: tubulin alpha-1B chain-like             372   5e-127   
tpg|DAA51110.1|  TPA: alpha-tubulin                                     372   5e-127   
gb|EKG00415.1|  epsilon tubulin, putative                               378   5e-127   
gb|ESL08706.1|  alpha tubulin                                           375   5e-127   
ref|XP_008172101.1|  PREDICTED: tubulin alpha-1B chain                  374   5e-127   
gb|EDL87015.1|  rCG50513, isoform CRA_a                                 375   5e-127   
ref|XP_005801995.1|  PREDICTED: tubulin alpha-1A chain-like             373   5e-127   
ref|XP_008616225.1|  tubulin alpha chain                                380   5e-127   
emb|CCC46464.1|  putative alpha tubulin                                 375   5e-127   
gb|AAG49533.3|  alpha tubulin                                           374   6e-127   
emb|CAA77816.1|  alpha-Tubulin                                          380   6e-127   
ref|XP_009622332.1|  PREDICTED: tubulin alpha-3 chain                   380   6e-127   
ref|XP_002767974.1|  Tubulin alpha chain, putative                      374   7e-127   
sp|P28268.1|TBA_EUPVA  RecName: Full=Tubulin alpha chain                380   7e-127   
ref|XP_002779347.1|  Tubulin alpha chain, putative                      376   7e-127   
ref|XP_002319688.1|  Tubulin alpha-1 chain family protein               380   7e-127   
gb|EPY40566.1|  tubulin alpha                                           376   8e-127   
gb|KGL81705.1|  Tubulin alpha-1C chain                                  372   8e-127   



>gb|ACN40426.1| unknown [Picea sitchensis]
Length=319

 Score =   411 bits (1057),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 214/216 (99%), Positives = 215/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRS  216



>ref|XP_002263822.2| PREDICTED: tubulin alpha chain, partial [Vitis vinifera]
Length=322

 Score =   410 bits (1055),  Expect = 8e-141, Method: Compositional matrix adjust.
 Identities = 213/216 (99%), Positives = 215/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRS  216



>emb|CBI29424.3| unnamed protein product [Vitis vinifera]
Length=287

 Score =   409 bits (1051),  Expect = 9e-141, Method: Compositional matrix adjust.
 Identities = 213/216 (99%), Positives = 215/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRS  216



>gb|AAN33000.1| alpha-tubulin 4, partial [Gossypium hirsutum]
Length=311

 Score =   410 bits (1054),  Expect = 9e-141, Method: Compositional matrix adjust.
 Identities = 212/216 (98%), Positives = 214/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECIS+HIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRS  216



>ref|XP_008236253.1| PREDICTED: tubulin alpha chain isoform X2 [Prunus mume]
Length=427

 Score =   414 bits (1063),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 214/216 (99%), Positives = 215/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRS  216



>emb|CBI19330.3| unnamed protein product [Vitis vinifera]
Length=395

 Score =   411 bits (1057),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 213/216 (99%), Positives = 214/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRS  216



>ref|XP_008440460.1| PREDICTED: tubulin alpha chain-like isoform X2 [Cucumis melo]
Length=437

 Score =   413 bits (1061),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 213/216 (99%), Positives = 215/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECIS+HIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRS  216



>emb|CBI25125.3| unnamed protein product [Vitis vinifera]
Length=375

 Score =   410 bits (1054),  Expect = 7e-140, Method: Compositional matrix adjust.
 Identities = 213/216 (99%), Positives = 214/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKT GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTPGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRS  216



>gb|KDO78780.1| hypothetical protein CISIN_1g037616mg, partial [Citrus sinensis]
Length=383

 Score =   410 bits (1055),  Expect = 7e-140, Method: Compositional matrix adjust.
 Identities = 213/216 (99%), Positives = 215/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECIS+HIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRS  216



>ref|XP_006486879.1| PREDICTED: tubulin alpha chain-like isoform X2 [Citrus sinensis]
Length=433

 Score =   412 bits (1059),  Expect = 8e-140, Method: Compositional matrix adjust.
 Identities = 214/216 (99%), Positives = 215/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRS  216



>emb|CBI22190.3| unnamed protein product [Vitis vinifera]
Length=393

 Score =   410 bits (1055),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 212/216 (98%), Positives = 215/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVF+DLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFHAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRS  216



>ref|XP_006466395.1| PREDICTED: tubulin alpha-3 chain-like isoform X2 [Citrus sinensis]
Length=447

 Score =   412 bits (1059),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 213/216 (99%), Positives = 215/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECIS+HIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRS  216



>gb|AHJ80818.1| Tua1, partial [Eragrostis tef]
Length=291

 Score =   406 bits (1044),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 211/216 (98%), Positives = 213/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQ DGQMP DKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPGDKTIGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRS  216



>ref|XP_010531322.1| PREDICTED: tubulin alpha-4 chain isoform X2 [Tarenaya hassleriana]
Length=454

 Score =   412 bits (1059),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 214/216 (99%), Positives = 215/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRS  216



>ref|XP_006422747.1| hypothetical protein CICLE_v10028426mg [Citrus clementina]
 ref|XP_006486878.1| PREDICTED: tubulin alpha chain-like isoform X1 [Citrus sinensis]
 gb|ESR35987.1| hypothetical protein CICLE_v10028426mg [Citrus clementina]
 gb|KDO49534.1| hypothetical protein CISIN_1g013062mg [Citrus sinensis]
Length=450

 Score =   412 bits (1058),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 214/216 (99%), Positives = 215/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRS  216



>ref|XP_010466127.1| PREDICTED: tubulin alpha-2 chain-like isoform X2 [Camelina sativa]
Length=423

 Score =   410 bits (1055),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 211/216 (98%), Positives = 215/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DV++LLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVSILLDNEAIYDICRRS  216



>gb|KDP44552.1| hypothetical protein JCGZ_16385 [Jatropha curcas]
Length=450

 Score =   411 bits (1057),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 214/216 (99%), Positives = 215/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRS  216



>gb|ACJ60905.1| alpha tubulin [Betula pendula]
Length=450

 Score =   411 bits (1057),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 214/216 (99%), Positives = 215/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRS  216



>ref|XP_002522104.1| tubulin alpha chain, putative [Ricinus communis]
 gb|EEF40304.1| tubulin alpha chain, putative [Ricinus communis]
Length=450

 Score =   411 bits (1057),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 214/216 (99%), Positives = 215/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRS  216



>ref|XP_002510010.1| tubulin alpha chain, putative [Ricinus communis]
 ref|XP_006852746.1| hypothetical protein AMTR_s00033p00112490 [Amborella trichopoda]
 gb|EEF52197.1| tubulin alpha chain, putative [Ricinus communis]
 gb|ERN14213.1| hypothetical protein AMTR_s00033p00112490 [Amborella trichopoda]
Length=451

 Score =   411 bits (1057),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 214/216 (99%), Positives = 215/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRS  216



>gb|ABX57816.1| alpha tubulin [Picea wilsonii]
Length=451

 Score =   411 bits (1057),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 214/216 (99%), Positives = 215/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRS  216



>gb|AAV92352.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92353.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92354.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92355.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92356.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92357.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92358.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92359.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92360.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92361.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92362.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92363.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92364.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92365.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92366.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92367.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92368.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92369.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92370.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92371.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92372.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92373.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92374.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92375.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92376.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92377.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92378.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92379.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|ACN40661.1| unknown [Picea sitchensis]
 gb|ACN40854.1| unknown [Picea sitchensis]
 gb|ACN40972.1| unknown [Picea sitchensis]
 gb|ACN41102.1| unknown [Picea sitchensis]
 gb|AIZ74331.1| alpha-tubulin [Pinus massoniana]
Length=451

 Score =   411 bits (1057),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 214/216 (99%), Positives = 215/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRS  216



>ref|XP_007018369.1| Tubulin alpha-2 chain [Theobroma cacao]
 gb|EOY15594.1| Tubulin alpha-2 chain [Theobroma cacao]
Length=451

 Score =   411 bits (1057),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 214/216 (99%), Positives = 215/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRS  216



>ref|XP_010531321.1| PREDICTED: tubulin alpha chain isoform X1 [Tarenaya hassleriana]
Length=450

 Score =   411 bits (1056),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 214/216 (99%), Positives = 215/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRS  216



>ref|XP_009335355.1| PREDICTED: tubulin alpha chain-like [Pyrus x bretschneideri]
Length=450

 Score =   411 bits (1056),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 214/216 (99%), Positives = 215/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRS  216



>ref|XP_006578253.1| PREDICTED: tubulin alpha-4 chain isoform X2 [Glycine max]
Length=432

 Score =   410 bits (1055),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 213/216 (99%), Positives = 214/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRS  216



>ref|XP_010526692.1| PREDICTED: tubulin alpha chain-like [Tarenaya hassleriana]
Length=450

 Score =   411 bits (1056),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 213/216 (99%), Positives = 215/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVA+LLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAILLDNEAIYDICRRS  216



>ref|XP_010555432.1| PREDICTED: tubulin alpha chain-like [Tarenaya hassleriana]
Length=450

 Score =   411 bits (1056),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 213/216 (99%), Positives = 215/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVA+LLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAILLDNEAIYDICRRS  216



>gb|AID52921.1| tubulin alpha chain [Carthamus tinctorius]
Length=450

 Score =   411 bits (1056),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 213/216 (99%), Positives = 215/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVA+LLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAILLDNEAIYDICRRS  216



>ref|XP_004288297.1| PREDICTED: tubulin alpha-3 chain [Fragaria vesca subsp. vesca]
Length=451

 Score =   411 bits (1056),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 214/216 (99%), Positives = 215/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRS  216



>ref|XP_007199840.1| hypothetical protein PRUPE_ppa005633mg [Prunus persica]
 ref|XP_008236252.1| PREDICTED: tubulin alpha chain isoform X1 [Prunus mume]
 gb|EMJ01039.1| hypothetical protein PRUPE_ppa005633mg [Prunus persica]
Length=450

 Score =   411 bits (1056),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 214/216 (99%), Positives = 215/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRS  216



>ref|XP_010065856.1| PREDICTED: tubulin alpha chain [Eucalyptus grandis]
 gb|KCW63554.1| hypothetical protein EUGRSUZ_G01186 [Eucalyptus grandis]
Length=450

 Score =   411 bits (1056),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 214/216 (99%), Positives = 215/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRS  216



>ref|XP_008236966.1| PREDICTED: tubulin alpha chain-like isoform X2 [Prunus mume]
Length=427

 Score =   410 bits (1054),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 212/216 (98%), Positives = 214/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGI PDGQMPSDKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIHPDGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRS  216



>ref|XP_009407690.1| PREDICTED: tubulin alpha chain-like [Musa acuminata subsp. malaccensis]
Length=452

 Score =   411 bits (1056),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 213/216 (99%), Positives = 215/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRS  216



>ref|XP_011457777.1| PREDICTED: tubulin alpha chain [Fragaria vesca subsp. vesca]
Length=450

 Score =   411 bits (1056),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 213/216 (99%), Positives = 215/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRS  216



>ref|XP_009335354.1| PREDICTED: tubulin alpha chain [Pyrus x bretschneideri]
Length=450

 Score =   411 bits (1056),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 213/216 (99%), Positives = 215/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRS  216



>ref|XP_007042689.1| Tubulin alpha-2 chain [Theobroma cacao]
 gb|EOX98520.1| Tubulin alpha-2 chain [Theobroma cacao]
Length=450

 Score =   410 bits (1055),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 214/216 (99%), Positives = 215/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRS  216



>gb|KHG18997.1| Tubulin alpha chain [Gossypium arboreum]
 gb|KJB32210.1| hypothetical protein B456_005G229600 [Gossypium raimondii]
Length=450

 Score =   410 bits (1055),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 213/216 (99%), Positives = 215/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECIS+HIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRS  216



>gb|ABO47736.1| alpha-tubulin [Gossypium hirsutum]
 gb|ACM89778.1| alpha-tubulin 6 [Gossypium hirsutum]
Length=450

 Score =   410 bits (1055),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 213/216 (99%), Positives = 215/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECIS+HIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRS  216



>ref|XP_010943272.1| PREDICTED: tubulin alpha chain-like [Elaeis guineensis]
Length=451

 Score =   410 bits (1055),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 213/216 (99%), Positives = 215/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRS  216



>ref|XP_009107245.1| PREDICTED: tubulin alpha-2 chain isoform X2 [Brassica rapa]
Length=459

 Score =   411 bits (1056),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 212/216 (98%), Positives = 215/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DV++LLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVSILLDNEAIYDICRRS  216



>ref|XP_008372962.1| PREDICTED: tubulin alpha chain isoform X2 [Malus domestica]
Length=438

 Score =   410 bits (1054),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 211/216 (98%), Positives = 214/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECIS+HIGQAGIQVGNACWELYCLEHG+QPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGLQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRS  216



>emb|CDY25017.1| BnaC02g39910D [Brassica napus]
Length=410

 Score =   409 bits (1051),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 212/216 (98%), Positives = 215/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DV++LLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVSILLDNEAIYDICRRS  216



>ref|XP_002313194.1| hypothetical protein POPTR_0009s08850g [Populus trichocarpa]
 gb|EEE87149.1| hypothetical protein POPTR_0009s08850g [Populus trichocarpa]
Length=451

 Score =   410 bits (1055),  Expect = 7e-139, Method: Compositional matrix adjust.
 Identities = 213/216 (99%), Positives = 215/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDIC+RS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICKRS  216



>gb|KJB58757.1| hypothetical protein B456_009G224800 [Gossypium raimondii]
Length=403

 Score =   409 bits (1050),  Expect = 7e-139, Method: Compositional matrix adjust.
 Identities = 212/216 (98%), Positives = 215/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECIS+HIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRS  216



>dbj|BAP59012.1| alpha tubulin [Taxus cuspidata]
Length=451

 Score =   410 bits (1055),  Expect = 7e-139, Method: Compositional matrix adjust.
 Identities = 213/216 (99%), Positives = 215/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVD+CLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDICLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRS  216



>ref|XP_006466394.1| PREDICTED: tubulin alpha-3 chain-like isoform X1 [Citrus sinensis]
Length=451

 Score =   410 bits (1055),  Expect = 7e-139, Method: Compositional matrix adjust.
 Identities = 213/216 (99%), Positives = 215/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECIS+HIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRS  216



>ref|XP_006426173.1| hypothetical protein CICLE_v10025588mg [Citrus clementina]
 gb|ESR39413.1| hypothetical protein CICLE_v10025588mg [Citrus clementina]
Length=451

 Score =   410 bits (1055),  Expect = 7e-139, Method: Compositional matrix adjust.
 Identities = 213/216 (99%), Positives = 215/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECIS+HIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRS  216



>gb|AGG37283.1| alpha-tubulin 1 [Salix arbutifolia]
Length=451

 Score =   410 bits (1054),  Expect = 8e-139, Method: Compositional matrix adjust.
 Identities = 213/216 (99%), Positives = 215/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRS  216



>ref|NP_849388.1| tubulin alpha-6 chain [Arabidopsis thaliana]
 dbj|BAH19475.1| AT4G14960 [Arabidopsis thaliana]
 gb|AEE83529.1| tubulin alpha-6 chain [Arabidopsis thaliana]
Length=427

 Score =   409 bits (1052),  Expect = 8e-139, Method: Compositional matrix adjust.
 Identities = 211/216 (98%), Positives = 214/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DV++LLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVSILLDNEAIYDICRRS  216



>gb|ABO47740.1| alpha-tubulin [Gossypium hirsutum]
 gb|ACM89777.1| alpha-tubulin 10 [Gossypium hirsutum]
 gb|KHG24734.1| Tubulin alpha chain [Gossypium arboreum]
 gb|KJB58758.1| hypothetical protein B456_009G224800 [Gossypium raimondii]
Length=450

 Score =   410 bits (1054),  Expect = 9e-139, Method: Compositional matrix adjust.
 Identities = 212/216 (98%), Positives = 215/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECIS+HIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRS  216



>ref|WP_039310890.1| hypothetical protein, partial [Paenibacillus sp. IHB B 3415]
 gb|KHL91192.1| hypothetical protein QW71_36085, partial [Paenibacillus sp. IHB 
B 3415]
Length=453

 Score =   410 bits (1054),  Expect = 9e-139, Method: Compositional matrix adjust.
 Identities = 213/218 (98%), Positives = 217/218 (99%), Gaps = 0/218 (0%)
 Frame = +2

Query  119  AKMRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGA  298
            +KMRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGA
Sbjct  3    SKMRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGA  62

Query  299  GKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLC  478
            GKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLC
Sbjct  63   GKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLC  122

Query  479  LDRIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVS  658
            LDRIRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQ+S
Sbjct  123  LDRIRKLADNCTGLQGFLVFHAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQIS  182

Query  659  TSVVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            TSVVEPYNSVLSTHSLLEH DVAVLLDNEAIYDICRRS
Sbjct  183  TSVVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRS  220



>ref|XP_008440459.1| PREDICTED: tubulin alpha chain-like isoform X1 [Cucumis melo]
Length=450

 Score =   410 bits (1054),  Expect = 9e-139, Method: Compositional matrix adjust.
 Identities = 213/216 (99%), Positives = 215/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECIS+HIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRS  216



>ref|XP_004143417.1| PREDICTED: tubulin alpha chain-like [Cucumis sativus]
 ref|XP_004160931.1| PREDICTED: tubulin alpha chain-like [Cucumis sativus]
Length=450

 Score =   410 bits (1054),  Expect = 9e-139, Method: Compositional matrix adjust.
 Identities = 213/216 (99%), Positives = 215/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECIS+HIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRS  216



>gb|AGG37285.1| alpha-tubulin 3 [Salix arbutifolia]
Length=451

 Score =   410 bits (1054),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 213/216 (99%), Positives = 215/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDIC+RS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICKRS  216



>gb|ABK92552.1| unknown [Populus trichocarpa]
Length=451

 Score =   410 bits (1054),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 213/216 (99%), Positives = 215/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDIC+RS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICKRS  216



>gb|KDP32140.1| hypothetical protein JCGZ_12601 [Jatropha curcas]
Length=450

 Score =   410 bits (1053),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 213/216 (99%), Positives = 215/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDK+VGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKSVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRS  216



>gb|AGG37287.1| alpha-tubulin 5 [Salix arbutifolia]
Length=451

 Score =   410 bits (1053),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 213/216 (99%), Positives = 215/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDIC+RS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICKRS  216



>ref|XP_010664458.1| PREDICTED: tubulin alpha-4 chain [Vitis vinifera]
 emb|CAN77412.1| hypothetical protein VITISV_000470 [Vitis vinifera]
Length=451

 Score =   410 bits (1053),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 213/216 (99%), Positives = 214/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRS  216



>emb|CDY66630.1| BnaCnng51680D [Brassica napus]
Length=435

 Score =   409 bits (1052),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 212/216 (98%), Positives = 215/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DV++LLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVSILLDNEAIYDICRRS  216



>ref|XP_006404742.1| hypothetical protein EUTSA_v10000161mg [Eutrema salsugineum]
 gb|ESQ46195.1| hypothetical protein EUTSA_v10000161mg [Eutrema salsugineum]
Length=451

 Score =   410 bits (1053),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 213/216 (99%), Positives = 215/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DV+VLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVSVLLDNEAIYDICRRS  216



>ref|XP_011030289.1| PREDICTED: tubulin alpha-4 chain [Populus euphratica]
Length=451

 Score =   410 bits (1053),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 213/216 (99%), Positives = 215/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDIC+RS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICKRS  216



>gb|AIX10966.1| tubulin [Ornithogalum saundersiae]
Length=451

 Score =   410 bits (1053),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 213/216 (99%), Positives = 215/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGI+PDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIKPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRS  216



>ref|XP_010104543.1| Tubulin alpha chain [Morus notabilis]
 gb|EXC01144.1| Tubulin alpha chain [Morus notabilis]
Length=448

 Score =   409 bits (1052),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 213/216 (99%), Positives = 214/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRS  216



>emb|CAD13176.1| alpha-tubulin [Nicotiana tabacum]
Length=450

 Score =   409 bits (1052),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 214/216 (99%), Positives = 214/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRS  216



>gb|AAO23139.1| alpha tubulin [Populus tremuloides]
Length=451

 Score =   409 bits (1052),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 212/216 (98%), Positives = 214/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRA+FVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRS  216



>sp|Q6VAF9.1|TBA4_GOSHI RecName: Full=Tubulin alpha-4 chain; AltName: Full=Alpha-4-tubulin 
[Gossypium hirsutum]
 gb|AAQ92663.1| alpha-tubulin 4 [Gossypium hirsutum]
Length=450

 Score =   409 bits (1052),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 213/216 (99%), Positives = 214/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRS  216



>ref|XP_003522731.1| PREDICTED: tubulin alpha-4 chain isoform X1 [Glycine max]
Length=452

 Score =   409 bits (1052),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 213/216 (99%), Positives = 214/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRS  216



>ref|XP_006581474.1| PREDICTED: tubulin alpha-4 chain-like isoform X1 [Glycine max]
Length=452

 Score =   409 bits (1052),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 213/216 (99%), Positives = 214/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRS  216



>ref|XP_010266793.1| PREDICTED: tubulin alpha chain [Nelumbo nucifera]
Length=451

 Score =   409 bits (1052),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 213/216 (99%), Positives = 214/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRS  216



>ref|XP_009402887.1| PREDICTED: tubulin alpha chain [Musa acuminata subsp. malaccensis]
Length=451

 Score =   409 bits (1052),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 213/216 (99%), Positives = 214/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRS  216



>gb|AAO73546.1| alpha-tubulin [Ceratopteris richardii]
 gb|AAW57307.1| alpha-tubulin [Ceratopteris richardii]
Length=450

 Score =   409 bits (1052),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 213/216 (99%), Positives = 215/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRS  216



>ref|XP_009790136.1| PREDICTED: tubulin alpha chain [Nicotiana sylvestris]
Length=450

 Score =   409 bits (1052),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 214/216 (99%), Positives = 214/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRS  216



>ref|XP_007047652.1| Tubulin alpha-2 chain [Theobroma cacao]
 gb|EOX91809.1| Tubulin alpha-2 chain [Theobroma cacao]
Length=501

 Score =   411 bits (1056),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 214/224 (96%), Positives = 218/224 (97%), Gaps = 0/224 (0%)
 Frame = +2

Query  101  SSNSSFAKMRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTF  280
            +  S+  KMRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSD TVGGGDDAFNTF
Sbjct  43   AGQSNHEKMRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDTTVGGGDDAFNTF  102

Query  281  FSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  460
            FSETG+GKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK
Sbjct  103  FSETGSGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGK  162

Query  461  EIVDLCLDRIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIY  640
            EIVDLCLDRIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+Y
Sbjct  163  EIVDLCLDRIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVY  222

Query  641  PSPQVSTSVVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            PSPQVSTSVVEPYNSVLSTHSLLEH DVAVLLDNEAIYDICRRS
Sbjct  223  PSPQVSTSVVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRS  266



>ref|XP_006307493.1| hypothetical protein CARUB_v10009117mg [Capsella rubella]
 ref|XP_010418156.1| PREDICTED: tubulin alpha-2 chain [Camelina sativa]
 ref|XP_010430201.1| PREDICTED: tubulin alpha-2 chain isoform X1 [Camelina sativa]
 ref|XP_010430202.1| PREDICTED: tubulin alpha-2 chain isoform X2 [Camelina sativa]
 ref|XP_010473400.1| PREDICTED: tubulin alpha-2 chain [Camelina sativa]
 gb|EOA40391.1| hypothetical protein CARUB_v10009117mg [Capsella rubella]
Length=450

 Score =   409 bits (1052),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 212/216 (98%), Positives = 215/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DV++LLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVSILLDNEAIYDICRRS  216



>ref|NP_171974.1| tubulin alpha-4 chain [Arabidopsis thaliana]
 ref|NP_175423.1| tubulin alpha-2 chain [Arabidopsis thaliana]
 ref|XP_002863595.1| tubulin alpha-2/alpha-4 chain [Arabidopsis lyrata subsp. lyrata]
 ref|XP_002891551.1| tubulin alpha-2/alpha-4 chain [Arabidopsis lyrata subsp. lyrata]
 ref|XP_006279139.1| hypothetical protein CARUB_v10008014mg [Capsella rubella]
 ref|XP_006393188.1| hypothetical protein EUTSA_v10011471mg [Eutrema salsugineum]
 ref|XP_006406473.1| hypothetical protein EUTSA_v10020718mg [Eutrema salsugineum]
 ref|XP_009107244.1| PREDICTED: tubulin alpha-2 chain isoform X1 [Brassica rapa]
 sp|B9DGT7.2|TBA2_ARATH RecName: Full=Tubulin alpha-2 chain [Arabidopsis thaliana]
 sp|Q0WV25.2|TBA4_ARATH RecName: Full=Tubulin alpha-4 chain [Arabidopsis thaliana]
 gb|AAF40454.1|AC004809_12 Identical to the alpha-4 tubulin (TUA4) gene from A. thaliana 
gb|M84697. ESTs gb|T46564. gb|T04381, gb|T76028, gb|T21602, 
gb|H37154 gb|H37663 and gb|T21719 come from this gene [Arabidopsis 
thaliana]
 gb|AAF76449.1|AC015445_16 Identical to Tubulin Alpha-6 Chain from Arabidopsis thaliana 
gi|267070 and contains a Tubulin PF|00091 domain. ESTs gb|N37387, 
gb|N37805, gb|R90497, gb|T44684, gb|H36144, gb|N38686, 
gb|AI994844, gb|R90689, gb|T04725, gb|H36928, gb|N96479, gb|H36922, 
gb|R90670, gb|Z17980, gb|T4428, gb|H36248, gb|N65408, 
gb|T46222 come from this gene [Arabidopsis thaliana]
 gb|AAK95316.1|AF410330_1 At1g50010/F2J10_12 [Arabidopsis thaliana]
 gb|AAA32889.1| apha-2 tubulin [Arabidopsis thaliana]
 gb|AAA32890.1| alpha-4 tubulin [Arabidopsis thaliana]
 gb|AAL25612.1| At1g04820/F13M7_26 [Arabidopsis thaliana]
 gb|AAL38293.1| Tubulin Alpha-6 Chain [Arabidopsis thaliana]
 gb|AAM98269.1| At1g04820/F13M7_26 [Arabidopsis thaliana]
 gb|AAN31076.1| At1g50010/F2J10_12 [Arabidopsis thaliana]
 gb|ABQ01730.1| TUA2 [Eutrema halophilum]
 gb|ABQ01731.1| TUA2-2 [Eutrema halophilum]
 gb|EFH39854.1| tubulin alpha-2/alpha-4 chain [Arabidopsis lyrata subsp. lyrata]
 gb|EFH67810.1| tubulin alpha-2/alpha-4 chain [Arabidopsis lyrata subsp. lyrata]
 gb|AEE27747.1| tubulin alpha-4 chain [Arabidopsis thaliana]
 gb|AEE32507.1| tubulin alpha-2 chain [Arabidopsis thaliana]
 gb|EOA12037.1| hypothetical protein CARUB_v10008014mg [Capsella rubella]
 gb|ESQ30474.1| hypothetical protein EUTSA_v10011471mg [Eutrema salsugineum]
 gb|ESQ47926.1| hypothetical protein EUTSA_v10020718mg [Eutrema salsugineum]
 gb|KFK35954.1| hypothetical protein AALP_AA4G059800 [Arabis alpina]
 gb|KFK39296.1| alpha tubulin 1 [Arabis alpina]
 emb|CDY45043.1| BnaA08g02320D [Brassica napus]
 emb|CDY03583.1| BnaC03g68420D [Brassica napus]
Length=450

 Score =   409 bits (1052),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 212/216 (98%), Positives = 215/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DV++LLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVSILLDNEAIYDICRRS  216



>sp|Q6VAG0.1|TBA2_GOSHI RecName: Full=Tubulin alpha-2 chain; AltName: Full=Alpha-2-tubulin 
[Gossypium hirsutum]
 gb|AAQ92662.1| alpha-tubulin 2 [Gossypium hirsutum]
 gb|ACM89776.1| alpha-tubulin 2 [Gossypium hirsutum]
 gb|KJB77616.1| hypothetical protein B456_012G147000 [Gossypium raimondii]
 gb|KJB77617.1| hypothetical protein B456_012G147000 [Gossypium raimondii]
Length=450

 Score =   409 bits (1052),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 213/216 (99%), Positives = 214/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRS  216



>gb|ABO47739.1| alpha-tubulin [Gossypium hirsutum]
 gb|KHG18532.1| Tubulin alpha-2 chain [Gossypium arboreum]
Length=450

 Score =   409 bits (1052),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 213/216 (99%), Positives = 214/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRS  216



>dbj|BAE99023.1| tubulin alpha-2/alpha-4 chain [Arabidopsis thaliana]
Length=450

 Score =   409 bits (1051),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 212/216 (98%), Positives = 215/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DV++LLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVSILLDNEAIYDICRRS  216



>ref|XP_010557535.1| PREDICTED: tubulin alpha-2 chain-like isoform X1 [Tarenaya hassleriana]
Length=450

 Score =   409 bits (1051),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 213/216 (99%), Positives = 215/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFHAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRS  216



>ref|XP_010557536.1| PREDICTED: tubulin alpha-4 chain-like isoform X2 [Tarenaya hassleriana]
Length=455

 Score =   409 bits (1052),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 213/216 (99%), Positives = 215/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFHAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRS  216



>ref|XP_006581475.1| PREDICTED: tubulin alpha-4 chain-like isoform X2 [Glycine max]
Length=466

 Score =   410 bits (1053),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 213/216 (99%), Positives = 214/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRS  216



>ref|XP_010245599.1| PREDICTED: tubulin alpha chain-like [Nelumbo nucifera]
Length=451

 Score =   409 bits (1051),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 213/216 (99%), Positives = 214/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGQYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRS  216



>ref|XP_011002356.1| PREDICTED: tubulin alpha chain-like [Populus euphratica]
Length=451

 Score =   409 bits (1051),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 212/216 (98%), Positives = 215/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP+DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPNDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDIC+RS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICKRS  216



>ref|XP_004238046.1| PREDICTED: tubulin alpha chain [Solanum lycopersicum]
Length=450

 Score =   409 bits (1051),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 213/216 (99%), Positives = 214/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVA+LLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAILLDNEAIYDICRRS  216



>ref|XP_009620798.1| PREDICTED: tubulin alpha chain [Nicotiana tomentosiformis]
Length=450

 Score =   409 bits (1051),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 214/216 (99%), Positives = 214/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRS  216



>sp|P33629.1|TBA_PRUDU RecName: Full=Tubulin alpha chain [Prunus dulcis]
 emb|CAA47635.1| alpha-tubulin [Prunus dulcis]
Length=450

 Score =   409 bits (1051),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 213/216 (99%), Positives = 214/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRS  216



>ref|XP_001764722.1| predicted protein [Physcomitrella patens]
 gb|EDQ70421.1| predicted protein [Physcomitrella patens]
Length=451

 Score =   409 bits (1051),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 212/216 (98%), Positives = 215/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP+DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPADKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVF+DLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRS  216



>ref|XP_010093625.1| Tubulin alpha chain [Morus notabilis]
 gb|EXB54386.1| Tubulin alpha chain [Morus notabilis]
Length=451

 Score =   409 bits (1051),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 211/216 (98%), Positives = 214/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGL SLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLASLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DV+VLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVSVLLDNEAIYDICRRS  216



>gb|KFK32793.1| hypothetical protein AALP_AA6G289100 [Arabis alpina]
Length=450

 Score =   409 bits (1051),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 212/216 (98%), Positives = 215/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGN+CWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNSCWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDE+RTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEIRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRS  216



>ref|XP_006606007.1| PREDICTED: tubulin alpha-4 chain-like isoform X2 [Glycine max]
Length=437

 Score =   408 bits (1049),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 213/216 (99%), Positives = 214/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGI PDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIGPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRS  216



>dbj|BAC24800.1| alpha tubulin [Physcomitrella patens]
Length=451

 Score =   409 bits (1050),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 212/216 (98%), Positives = 215/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDK+VGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKSVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVF+DLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRS  216



>ref|XP_006601463.1| PREDICTED: tubulin alpha-3 chain-like [Glycine max]
Length=432

 Score =   408 bits (1049),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 212/216 (98%), Positives = 215/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIV+LCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVELCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRS  216



>ref|XP_008787237.1| PREDICTED: tubulin alpha chain [Phoenix dactylifera]
 ref|XP_010941981.1| PREDICTED: tubulin alpha chain [Elaeis guineensis]
Length=451

 Score =   409 bits (1050),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 212/216 (98%), Positives = 214/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTIGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRS  216



>sp|Q9ZRR5.1|TBA3_HORVU RecName: Full=Tubulin alpha-3 chain [Hordeum vulgare]
 emb|CAA10663.1| alpha-tubulin 3 [Hordeum vulgare subsp. vulgare]
 gb|ABD92933.1| alpha tubulin-3B [Triticum aestivum]
 gb|ABD92934.1| alpha tubulin-3A [Triticum aestivum]
 gb|ABD92935.1| alpha tubulin-3D [Triticum aestivum]
 dbj|BAJ87680.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gb|EMS48260.1| Tubulin alpha-3 chain [Triticum urartu]
 gb|EMT18537.1| Tubulin alpha-3 chain [Aegilops tauschii]
Length=451

 Score =   409 bits (1050),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 213/216 (99%), Positives = 214/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRS  216



>ref|XP_011088040.1| PREDICTED: tubulin alpha chain [Sesamum indicum]
Length=450

 Score =   409 bits (1050),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 211/216 (98%), Positives = 215/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECIS+HIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETG+GK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGSGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVA+LLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAILLDNEAIYDICRRS  216



>ref|XP_002981542.1| hypothetical protein SELMODRAFT_178975 [Selaginella moellendorffii]
 gb|EFJ17357.1| hypothetical protein SELMODRAFT_178975 [Selaginella moellendorffii]
Length=449

 Score =   409 bits (1050),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 213/216 (99%), Positives = 215/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFHAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRS  216



>ref|XP_006356798.1| PREDICTED: tubulin alpha chain-like [Solanum tuberosum]
Length=450

 Score =   409 bits (1050),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 213/216 (99%), Positives = 214/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVA+LLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAILLDNEAIYDICRRS  216



>ref|XP_006573681.1| PREDICTED: tubulin alpha-2 chain-like isoform X2 [Glycine max]
Length=424

 Score =   408 bits (1048),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 211/216 (98%), Positives = 213/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEH IQ DGQMPSDKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHAIQADGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRS  216



>ref|XP_002301128.1| hypothetical protein POPTR_0002s11250g [Populus trichocarpa]
 ref|XP_011017025.1| PREDICTED: tubulin alpha chain-like isoform X1 [Populus euphratica]
 ref|XP_011017026.1| PREDICTED: tubulin alpha chain-like isoform X1 [Populus euphratica]
 ref|XP_011017027.1| PREDICTED: tubulin alpha chain-like isoform X2 [Populus euphratica]
 gb|AAO63781.1| alpha-tubulin 1 [Populus tremuloides]
 gb|ABK96001.1| unknown [Populus trichocarpa]
 gb|EEE80401.1| hypothetical protein POPTR_0002s11250g [Populus trichocarpa]
Length=451

 Score =   409 bits (1050),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 212/216 (98%), Positives = 214/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRA+FVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRS  216



>ref|XP_008787760.1| PREDICTED: tubulin alpha chain-like [Phoenix dactylifera]
Length=451

 Score =   409 bits (1050),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 212/216 (98%), Positives = 214/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTIGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRS  216



>ref|XP_009614122.1| PREDICTED: tubulin alpha-3 chain [Nicotiana tomentosiformis]
 ref|XP_009787472.1| PREDICTED: tubulin alpha-3 chain [Nicotiana sylvestris]
 emb|CAD13177.1| alpha-tubulin [Nicotiana tabacum]
Length=451

 Score =   409 bits (1050),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 212/216 (98%), Positives = 214/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTIGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVA+LLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAILLDNEAIYDICRRS  216



>ref|XP_002275973.1| PREDICTED: tubulin alpha chain [Vitis vinifera]
Length=450

 Score =   409 bits (1050),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 213/216 (99%), Positives = 214/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKT GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTPGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRS  216



>ref|XP_010096739.1| Tubulin alpha chain [Morus notabilis]
 gb|EXB65591.1| Tubulin alpha chain [Morus notabilis]
Length=449

 Score =   408 bits (1049),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 212/216 (98%), Positives = 214/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRS  216



>ref|XP_010507910.1| PREDICTED: tubulin alpha-2 chain-like [Camelina sativa]
 ref|XP_010466126.1| PREDICTED: tubulin alpha-2 chain-like isoform X1 [Camelina sativa]
 ref|XP_010487911.1| PREDICTED: tubulin alpha-2 chain-like [Camelina sativa]
Length=451

 Score =   409 bits (1050),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 211/216 (98%), Positives = 215/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DV++LLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVSILLDNEAIYDICRRS  216



>ref|XP_006589612.1| PREDICTED: tubulin alpha chain-like isoform X2 [Glycine max]
Length=449

 Score =   408 bits (1049),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 213/216 (99%), Positives = 214/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGI PDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIGPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRS  216



>ref|XP_009124557.1| PREDICTED: tubulin alpha-6 chain-like isoform X2 [Brassica rapa]
Length=431

 Score =   407 bits (1047),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 210/216 (97%), Positives = 213/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYN VLS HSLLEH DV++LLDNEAIYDICRRS
Sbjct  181  VVEPYNRVLSPHSLLEHTDVSILLDNEAIYDICRRS  216



>emb|CAB66336.1| alpha-tubulin [Betula pendula]
 gb|AJA29683.1| tubulin alpha chain [Betula luminifera]
Length=451

 Score =   408 bits (1049),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 212/216 (98%), Positives = 214/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGI+PDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIKPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRS  216



>ref|XP_007205183.1| hypothetical protein PRUPE_ppa005613mg [Prunus persica]
 ref|XP_008236958.1| PREDICTED: tubulin alpha chain-like isoform X1 [Prunus mume]
 gb|EMJ06382.1| hypothetical protein PRUPE_ppa005613mg [Prunus persica]
Length=451

 Score =   408 bits (1049),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 212/216 (98%), Positives = 214/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGI PDGQMPSDKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIHPDGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRS  216



>gb|KDP41548.1| hypothetical protein JCGZ_15955 [Jatropha curcas]
Length=451

 Score =   408 bits (1049),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 212/216 (98%), Positives = 214/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGPYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRS  216



>ref|XP_006662856.1| PREDICTED: tubulin alpha-3 chain-like [Oryza brachyantha]
Length=451

 Score =   408 bits (1049),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 212/216 (98%), Positives = 214/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVA+LLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAILLDNEAIYDICRRS  216



>ref|XP_002298794.2| TUBULIN ALPHA CHAIN family protein [Populus trichocarpa]
 gb|EEE83599.2| TUBULIN ALPHA CHAIN family protein [Populus trichocarpa]
Length=451

 Score =   408 bits (1049),  Expect = 6e-138, Method: Compositional matrix adjust.
 Identities = 212/216 (98%), Positives = 214/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDIC+RS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICKRS  216



>gb|ACN40181.1| unknown [Picea sitchensis]
 gb|ACN40840.1| unknown [Picea sitchensis]
Length=450

 Score =   408 bits (1048),  Expect = 6e-138, Method: Compositional matrix adjust.
 Identities = 212/216 (98%), Positives = 215/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVF+DLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFHAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRS  216



>ref|XP_002283198.1| PREDICTED: tubulin alpha chain [Vitis vinifera]
 ref|XP_006827169.1| hypothetical protein AMTR_s00010p00254750 [Amborella trichopoda]
 ref|XP_010939541.1| PREDICTED: tubulin alpha chain-like [Elaeis guineensis]
 gb|ERM94406.1| hypothetical protein AMTR_s00010p00254750 [Amborella trichopoda]
Length=450

 Score =   408 bits (1048),  Expect = 6e-138, Method: Compositional matrix adjust.
 Identities = 212/216 (98%), Positives = 215/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVF+DLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFHAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRS  216



>ref|XP_002964078.1| hypothetical protein SELMODRAFT_405729 [Selaginella moellendorffii]
 ref|XP_002975442.1| hypothetical protein SELMODRAFT_232506 [Selaginella moellendorffii]
 gb|EFJ23643.1| hypothetical protein SELMODRAFT_232506 [Selaginella moellendorffii]
 gb|EFJ34411.1| hypothetical protein SELMODRAFT_405729 [Selaginella moellendorffii]
Length=451

 Score =   408 bits (1048),  Expect = 6e-138, Method: Compositional matrix adjust.
 Identities = 212/216 (98%), Positives = 215/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVF+DLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFHAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRS  216



>ref|XP_004304311.1| PREDICTED: tubulin alpha-2 chain-like [Fragaria vesca subsp. 
vesca]
Length=450

 Score =   408 bits (1048),  Expect = 6e-138, Method: Compositional matrix adjust.
 Identities = 212/216 (98%), Positives = 215/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVF+DLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFHAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRS  216



>ref|XP_010936237.1| PREDICTED: tubulin alpha chain-like [Elaeis guineensis]
Length=451

 Score =   408 bits (1048),  Expect = 6e-138, Method: Compositional matrix adjust.
 Identities = 212/216 (98%), Positives = 215/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGT+RQLFHPEQLI+GKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTFRQLFHPEQLINGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRS  216



>gb|KHN01709.1| Tubulin alpha chain [Glycine soja]
Length=450

 Score =   408 bits (1048),  Expect = 6e-138, Method: Compositional matrix adjust.
 Identities = 212/216 (98%), Positives = 215/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIV+LCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVELCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRS  216



>ref|XP_003524707.1| PREDICTED: tubulin alpha-3 chain-like isoform X1 [Glycine max]
 gb|KHN47565.1| Tubulin alpha chain [Glycine soja]
Length=450

 Score =   408 bits (1048),  Expect = 7e-138, Method: Compositional matrix adjust.
 Identities = 212/216 (98%), Positives = 215/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIV+LCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVELCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRS  216



>ref|XP_006362511.1| PREDICTED: tubulin alpha-1 chain-like [Solanum tuberosum]
Length=450

 Score =   408 bits (1048),  Expect = 7e-138, Method: Compositional matrix adjust.
 Identities = 212/216 (98%), Positives = 214/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DV++LLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVSILLDNEAIYDICRRS  216



>ref|XP_007215369.1| hypothetical protein PRUPE_ppa005626mg [Prunus persica]
 ref|XP_008230754.1| PREDICTED: tubulin alpha chain-like [Prunus mume]
 gb|EMJ16568.1| hypothetical protein PRUPE_ppa005626mg [Prunus persica]
Length=450

 Score =   408 bits (1048),  Expect = 7e-138, Method: Compositional matrix adjust.
 Identities = 212/216 (98%), Positives = 215/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVF+DLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFHAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRS  216



>gb|ABK92520.1| unknown [Populus trichocarpa]
Length=451

 Score =   408 bits (1048),  Expect = 7e-138, Method: Compositional matrix adjust.
 Identities = 212/216 (98%), Positives = 214/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDIC+RS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICKRS  216



>ref|XP_010500556.1| PREDICTED: tubulin alpha-2 chain isoform X2 [Camelina sativa]
Length=462

 Score =   408 bits (1049),  Expect = 7e-138, Method: Compositional matrix adjust.
 Identities = 211/216 (98%), Positives = 214/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DV++LLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVSILLDNEAIYDICRRS  216



>ref|XP_004244533.1| PREDICTED: tubulin alpha-3 chain-like [Solanum lycopersicum]
Length=451

 Score =   408 bits (1048),  Expect = 7e-138, Method: Compositional matrix adjust.
 Identities = 212/216 (98%), Positives = 214/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DV++LLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVSILLDNEAIYDICRRS  216



>ref|XP_009605705.1| PREDICTED: tubulin alpha-2 chain-like [Nicotiana tomentosiformis]
 ref|XP_009761158.1| PREDICTED: tubulin alpha-2 chain-like [Nicotiana sylvestris]
 emb|CAD13178.1| alpha-tubulin [Nicotiana tabacum]
Length=451

 Score =   408 bits (1048),  Expect = 7e-138, Method: Compositional matrix adjust.
 Identities = 212/216 (98%), Positives = 214/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DV++LLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVSILLDNEAIYDICRRS  216



>ref|XP_008372961.1| PREDICTED: tubulin alpha chain isoform X1 [Malus domestica]
Length=450

 Score =   408 bits (1048),  Expect = 8e-138, Method: Compositional matrix adjust.
 Identities = 211/216 (98%), Positives = 214/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECIS+HIGQAGIQVGNACWELYCLEHG+QPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGLQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRS  216



>ref|XP_004136930.1| PREDICTED: tubulin alpha-4 chain-like [Cucumis sativus]
 ref|XP_004155416.1| PREDICTED: tubulin alpha-4 chain-like [Cucumis sativus]
 gb|KGN43837.1| Tubulin alpha chain [Cucumis sativus]
Length=450

 Score =   408 bits (1048),  Expect = 8e-138, Method: Compositional matrix adjust.
 Identities = 212/216 (98%), Positives = 214/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGMYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DV+VLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVSVLLDNEAIYDICRRS  216



>ref|XP_004501073.1| PREDICTED: tubulin alpha chain-like [Cicer arietinum]
Length=451

 Score =   407 bits (1047),  Expect = 8e-138, Method: Compositional matrix adjust.
 Identities = 212/216 (98%), Positives = 213/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRS  216



>ref|XP_003603670.1| Tubulin alpha-7 chain [Medicago truncatula]
 gb|AES73921.1| tubulin beta-1 chain [Medicago truncatula]
Length=451

 Score =   407 bits (1047),  Expect = 8e-138, Method: Compositional matrix adjust.
 Identities = 212/216 (98%), Positives = 213/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRS  216



>ref|XP_003635553.2| PREDICTED: tubulin alpha chain-like [Vitis vinifera]
Length=451

 Score =   407 bits (1047),  Expect = 9e-138, Method: Compositional matrix adjust.
 Identities = 212/216 (98%), Positives = 214/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFL FNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLGFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRS  216



>gb|ABQ59633.1| alpha-tubulin 3 [Populus tremuloides]
Length=451

 Score =   407 bits (1047),  Expect = 9e-138, Method: Compositional matrix adjust.
 Identities = 212/216 (98%), Positives = 215/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            +VPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   YVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDIC+RS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICKRS  216



>ref|XP_010939312.1| PREDICTED: tubulin alpha chain-like [Elaeis guineensis]
Length=451

 Score =   407 bits (1047),  Expect = 9e-138, Method: Compositional matrix adjust.
 Identities = 212/216 (98%), Positives = 214/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTG+YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGSYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRS  216



>ref|XP_003556001.1| PREDICTED: tubulin alpha-4 chain-like isoform X1 [Glycine max]
 gb|KHN01573.1| Tubulin alpha-4 chain [Glycine soja]
Length=449

 Score =   407 bits (1047),  Expect = 9e-138, Method: Compositional matrix adjust.
 Identities = 213/216 (99%), Positives = 214/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGI PDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIGPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRS  216



>ref|XP_011014531.1| PREDICTED: tubulin alpha-4 chain-like [Populus euphratica]
Length=451

 Score =   407 bits (1047),  Expect = 9e-138, Method: Compositional matrix adjust.
 Identities = 212/216 (98%), Positives = 214/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVR GTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRPGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDIC+RS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICKRS  216



>gb|KHG20487.1| Tubulin alpha chain [Gossypium arboreum]
Length=451

 Score =   407 bits (1047),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 211/216 (98%), Positives = 215/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFSAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DV+VLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVSVLLDNEAIYDICRRS  216



>gb|ABO47737.1| alpha-tubulin [Gossypium hirsutum]
Length=451

 Score =   407 bits (1047),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 211/216 (98%), Positives = 215/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFSAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DV+VLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVSVLLDNEAIYDICRRS  216



>ref|XP_010500555.1| PREDICTED: tubulin alpha-6 chain isoform X1 [Camelina sativa]
 ref|XP_010479400.1| PREDICTED: tubulin alpha-6 chain [Camelina sativa]
Length=450

 Score =   407 bits (1047),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 211/216 (98%), Positives = 214/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DV++LLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVSILLDNEAIYDICRRS  216



>gb|ACU19580.1| unknown [Glycine max]
Length=449

 Score =   407 bits (1047),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 213/216 (99%), Positives = 214/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGI PDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIGPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRS  216



>ref|XP_010461854.1| PREDICTED: tubulin alpha-6 chain-like [Camelina sativa]
Length=450

 Score =   407 bits (1047),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 211/216 (98%), Positives = 214/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DV++LLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVSILLDNEAIYDICRRS  216



>ref|XP_003536570.1| PREDICTED: tubulin alpha chain-like isoform X1 [Glycine max]
 gb|KHN23177.1| Tubulin alpha chain [Glycine soja]
Length=449

 Score =   407 bits (1047),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 213/216 (99%), Positives = 214/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGI PDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIGPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRS  216



>ref|XP_009388502.1| PREDICTED: tubulin alpha-2 chain isoform X1 [Musa acuminata subsp. 
malaccensis]
Length=451

 Score =   407 bits (1047),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 212/216 (98%), Positives = 213/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRS  216



>gb|KJB29387.1| hypothetical protein B456_005G097800 [Gossypium raimondii]
Length=451

 Score =   407 bits (1047),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 211/216 (98%), Positives = 215/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFSAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DV+VLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVSVLLDNEAIYDICRRS  216



>gb|ABB02631.1| unknown [Solanum tuberosum]
Length=450

 Score =   407 bits (1047),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 212/216 (98%), Positives = 214/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DV++LLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVSILLDNEAIYDICRRS  216



>ref|XP_008455056.1| PREDICTED: tubulin alpha-4 chain isoform X2 [Cucumis melo]
Length=406

 Score =   405 bits (1042),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 210/216 (97%), Positives = 213/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSD TVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDTTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRA+FVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGMYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DV+VLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVSVLLDNEAIYDICRRS  216



>ref|XP_009147859.1| PREDICTED: tubulin alpha-6 chain [Brassica rapa]
Length=450

 Score =   407 bits (1047),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 211/216 (98%), Positives = 214/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DV++LLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVSILLDNEAIYDICRRS  216



>ref|XP_006472373.1| PREDICTED: tubulin alpha chain isoform X2 [Citrus sinensis]
Length=460

 Score =   407 bits (1047),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 211/216 (98%), Positives = 213/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECIS+HIGQAGIQVGNACWELYCLEHGIQPDGQMP D TVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDTTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRS  216



>sp|P46259.1|TBA1_PEA RecName: Full=Tubulin alpha-1 chain [Pisum sativum]
 gb|AAA79910.1| alpha-tubulin [Pisum sativum]
Length=452

 Score =   407 bits (1046),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 212/216 (98%), Positives = 213/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRS  216



>gb|ADW66593.1| alpha tubulin [Hirschfeldia incana]
Length=355

 Score =   404 bits (1037),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 210/214 (98%), Positives = 213/214 (99%), Gaps = 0/214 (0%)
 Frame = +2

Query  131  ECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGKHV  310
            ECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGKHV
Sbjct  1    ECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGKHV  60

Query  311  PRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRI  490
            PRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRI
Sbjct  61   PRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDRI  120

Query  491  RKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSVV  670
            RKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTSVV
Sbjct  121  RKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTSVV  180

Query  671  EPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            EPYNSVLSTHSLLEH DV++LLDNEAIYDICRRS
Sbjct  181  EPYNSVLSTHSLLEHTDVSILLDNEAIYDICRRS  214



>ref|XP_003608582.1| Tubulin alpha-5 chain [Medicago truncatula]
 gb|AES90779.1| tubulin beta-1 chain [Medicago truncatula]
Length=451

 Score =   407 bits (1046),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 212/216 (98%), Positives = 214/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQ DGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVD+CLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDVCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRS  216



>ref|NP_193232.1| tubulin alpha-6 chain [Arabidopsis thaliana]
 sp|P29511.1|TBA6_ARATH RecName: Full=Tubulin alpha-6 chain [Arabidopsis thaliana]
 gb|AAA32892.1| TUA6 [Arabidopsis thaliana]
 emb|CAB10275.1| tubulin alpha-6 chain (TUA6) [Arabidopsis thaliana]
 emb|CAB78538.1| tubulin alpha-6 chain (TUA6) [Arabidopsis thaliana]
 gb|AAL24246.1| AT4g14960/dl3520c [Arabidopsis thaliana]
 gb|AAL38788.1| putative tubulin alpha-6 chain TUA6 [Arabidopsis thaliana]
 gb|AAL79586.1| AT4g14960/dl3520c [Arabidopsis thaliana]
 gb|AAM51249.1| putative tubulin alpha-6 chain TUA6 [Arabidopsis thaliana]
 gb|ABD75335.1| tubulin alpha-1 chain [Brassica rapa subsp. oleifera]
 gb|AEE83530.1| tubulin alpha-6 chain [Arabidopsis thaliana]
 emb|CDY50974.1| BnaA06g37700D [Brassica napus]
 emb|CDY28123.1| BnaC06g03040D [Brassica napus]
Length=450

 Score =   407 bits (1046),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 211/216 (98%), Positives = 214/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DV++LLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVSILLDNEAIYDICRRS  216



>gb|AHJ80816.1| Tua1 [Eragrostis tef]
Length=451

 Score =   407 bits (1046),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 212/216 (98%), Positives = 214/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQ DGQMP DKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPGDKTIGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  216



>ref|XP_004496862.1| PREDICTED: tubulin alpha chain-like [Cicer arietinum]
Length=450

 Score =   407 bits (1046),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 213/216 (99%), Positives = 214/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGI PDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIGPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRS  216



>ref|XP_006579968.1| PREDICTED: tubulin alpha-3 chain-like isoform X2 [Glycine max]
Length=462

 Score =   407 bits (1047),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 212/216 (98%), Positives = 215/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIV+LCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVELCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRS  216



>ref|XP_004299843.1| PREDICTED: tubulin alpha chain-like [Fragaria vesca subsp. vesca]
 gb|AAK81858.1|AF394915_1 alpha tubulin subunit [Rosa hybrid cultivar]
Length=451

 Score =   407 bits (1045),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 211/216 (98%), Positives = 214/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVG GDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGRGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DV+VLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVSVLLDNEAIYDICRRS  216



>ref|XP_008341563.1| PREDICTED: tubulin alpha-2 chain-like [Malus domestica]
Length=450

 Score =   407 bits (1045),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 211/216 (98%), Positives = 215/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVF+DLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFHAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DV+VLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVSVLLDNEAIYDICRRS  216



>gb|KDO81347.1| hypothetical protein CISIN_1g013037mg [Citrus sinensis]
Length=451

 Score =   407 bits (1045),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 211/216 (98%), Positives = 213/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECIS+HIGQAGIQVGNACWELYCLEHGIQPDGQMP D TVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDTTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRS  216



>ref|XP_006472372.1| PREDICTED: tubulin alpha chain isoform X1 [Citrus sinensis]
Length=451

 Score =   407 bits (1045),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 211/216 (98%), Positives = 213/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECIS+HIGQAGIQVGNACWELYCLEHGIQPDGQMP D TVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDTTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRS  216



>ref|NP_001067613.1| Os11g0247300 [Oryza sativa Japonica Group]
 sp|Q53M52.1|TBA2_ORYSJ RecName: Full=Tubulin alpha-2 chain [Oryza sativa Japonica Group]
 gb|AAX96762.1| Tubulin/FtsZ family, GTPase domain, putative [Oryza sativa Japonica 
Group]
 gb|AAX96764.1| Tubulin/FtsZ family, GTPase domain, putative [Oryza sativa Japonica 
Group]
 gb|ABA92352.1| Tubulin alpha-3 chain, putative, expressed [Oryza sativa Japonica 
Group]
 gb|ABA92353.1| Tubulin alpha-3 chain, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF27976.1| Os11g0247300 [Oryza sativa Japonica Group]
 gb|EAY80511.1| hypothetical protein OsI_35689 [Oryza sativa Indica Group]
 gb|EAZ17981.1| hypothetical protein OsJ_33527 [Oryza sativa Japonica Group]
 dbj|BAG95614.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH85357.1| alpha-tubulin [Oryza sativa Japonica Group]
 gb|ADM86870.1| alpha-tubulin [Oryza sativa Japonica Group]
 gb|AFI71279.1| alpha-tubulin [Oryza sativa Japonica Group]
Length=451

 Score =   406 bits (1044),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 212/216 (98%), Positives = 213/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGDYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRS  216



>ref|XP_008379344.1| PREDICTED: tubulin alpha-2 chain [Malus domestica]
Length=450

 Score =   406 bits (1044),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 211/216 (98%), Positives = 215/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVF+DLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFHAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DV+VLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVSVLLDNEAIYDICRRS  216



>ref|XP_008804464.1| PREDICTED: tubulin alpha chain-like [Phoenix dactylifera]
Length=450

 Score =   406 bits (1044),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 211/216 (98%), Positives = 214/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVF+DLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFHAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRS  216



>dbj|BAB19779.1| alpha tubulin [Nicotiana tabacum]
Length=450

 Score =   406 bits (1044),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 213/216 (99%), Positives = 213/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLF PEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFRPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRS  216



>gb|AHZ58482.1| alpha-tubulin, partial [Syntrichia caninervis]
Length=261

 Score =   399 bits (1025),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 207/216 (96%), Positives = 212/216 (98%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRE ISIHIGQAGIQVGNACWELYCLEHGIQPDG+MPSD + GGGDDAFNTFFSETGAGK
Sbjct  1    MREIISIHIGQAGIQVGNACWELYCLEHGIQPDGRMPSDASTGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            R+RKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVST+
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRS  216



>ref|XP_010680774.1| PREDICTED: tubulin alpha-2 chain [Beta vulgaris subsp. vulgaris]
Length=451

 Score =   406 bits (1044),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 212/216 (98%), Positives = 213/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQ DGQMPSD TVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPSDTTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQ+STS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQISTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRS  216



>gb|AGE09583.1| TUA1-like protein [Eucalyptus cladocalyx]
 gb|KCW68570.1| hypothetical protein EUGRSUZ_F02183 [Eucalyptus grandis]
Length=420

 Score =   405 bits (1040),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 211/216 (98%), Positives = 213/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFN+VGGGTGSGLGSLLLERLSVDYGKKSKL FT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNSVGGGTGSGLGSLLLERLSVDYGKKSKLSFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRS  216



>gb|KEH43997.1| tubulin beta-1 chain [Medicago truncatula]
Length=450

 Score =   406 bits (1043),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 211/216 (98%), Positives = 214/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECIS+HIGQAGIQVGNACWELYCLEHGI PDGQMPSDKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIGPDGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRS  216



>ref|NP_001289660.1| tubulin alpha chain-like [Eucalyptus grandis]
 gb|ABS50670.1| alpha-tubulin [Eucalyptus grandis]
Length=451

 Score =   406 bits (1043),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 211/216 (98%), Positives = 213/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFN+VGGGTGSGLGSLLLERLSVDYGKKSKL FT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNSVGGGTGSGLGSLLLERLSVDYGKKSKLSFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRS  216



>ref|XP_009388503.1| PREDICTED: tubulin alpha chain isoform X2 [Musa acuminata subsp. 
malaccensis]
Length=465

 Score =   406 bits (1044),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 212/216 (98%), Positives = 213/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRS  216



>ref|XP_002962630.1| hypothetical protein SELMODRAFT_230143 [Selaginella moellendorffii]
 ref|XP_002980460.1| hypothetical protein SELMODRAFT_233518 [Selaginella moellendorffii]
 gb|EFJ18720.1| hypothetical protein SELMODRAFT_233518 [Selaginella moellendorffii]
 gb|EFJ36093.1| hypothetical protein SELMODRAFT_230143 [Selaginella moellendorffii]
Length=452

 Score =   406 bits (1043),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 211/216 (98%), Positives = 214/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDG MPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGTMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVF+DLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFHAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRS  216



>dbj|BAJ06362.1| alpha-tubulin [Alopecurus aequalis]
Length=451

 Score =   406 bits (1043),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 212/216 (98%), Positives = 213/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQ DGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRS  216



>ref|XP_003560377.1| PREDICTED: tubulin alpha-1 chain [Brachypodium distachyon]
Length=451

 Score =   406 bits (1043),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 212/216 (98%), Positives = 213/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQ DGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRS  216



>ref|XP_004981922.1| PREDICTED: tubulin alpha-1 chain-like [Setaria italica]
 emb|CAE52515.1| alpha tubulin [Setaria viridis]
Length=451

 Score =   406 bits (1043),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 212/216 (98%), Positives = 213/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQ DGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRS  216



>ref|XP_008219157.1| PREDICTED: tubulin alpha chain-like isoform X2 [Prunus mume]
Length=442

 Score =   405 bits (1042),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 210/216 (97%), Positives = 213/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGI PDGQMPSDKTVG GDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIGPDGQMPSDKTVGRGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DV+VLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVSVLLDNEAIYDICRRS  216



>ref|XP_003517369.1| PREDICTED: tubulin alpha-2 chain-like isoform X1 [Glycine max]
Length=451

 Score =   405 bits (1042),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 211/216 (98%), Positives = 213/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEH IQ DGQMPSDKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHAIQADGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRS  216



>ref|XP_007156677.1| hypothetical protein PHAVU_002G007900g [Phaseolus vulgaris]
 gb|ESW28671.1| hypothetical protein PHAVU_002G007900g [Phaseolus vulgaris]
Length=451

 Score =   405 bits (1042),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 211/216 (98%), Positives = 213/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQ DGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            R+RKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRS  216



>ref|XP_007137281.1| hypothetical protein PHAVU_009G114100g [Phaseolus vulgaris]
 gb|ESW09275.1| hypothetical protein PHAVU_009G114100g [Phaseolus vulgaris]
Length=451

 Score =   405 bits (1042),  Expect = 6e-137, Method: Compositional matrix adjust.
 Identities = 210/216 (97%), Positives = 214/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRA+FVDLEPTVIDEVR+G YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRSGPYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDIC+RS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICKRS  216



>ref|XP_007155784.1| hypothetical protein PHAVU_003G231500g [Phaseolus vulgaris]
 gb|ESW27778.1| hypothetical protein PHAVU_003G231500g [Phaseolus vulgaris]
Length=450

 Score =   405 bits (1042),  Expect = 6e-137, Method: Compositional matrix adjust.
 Identities = 211/216 (98%), Positives = 214/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRA+FVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIV+LCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGPYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVELCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRS  216



>gb|AFV46219.1| hypothetical protein, partial [Scutellaria baicalensis]
Length=440

 Score =   405 bits (1041),  Expect = 6e-137, Method: Compositional matrix adjust.
 Identities = 211/218 (97%), Positives = 215/218 (99%), Gaps = 0/218 (0%)
 Frame = +2

Query  119  AKMRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGA  298
            AKMRECISIHIG+AGIQVGNACWELYCLEHGIQPDGQMP D TVGGGDDAFNTFFSETGA
Sbjct  36   AKMRECISIHIGRAGIQVGNACWELYCLEHGIQPDGQMPGDHTVGGGDDAFNTFFSETGA  95

Query  299  GKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLC  478
            GKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLC
Sbjct  96   GKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLC  155

Query  479  LDRIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVS  658
            LDRIRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVS
Sbjct  156  LDRIRKLADNCTGLQGFLVFHAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVS  215

Query  659  TSVVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            T+VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDICR+S
Sbjct  216  TAVVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRKS  253



>gb|AHJ80822.1| Tua1 [Eragrostis tef]
Length=451

 Score =   405 bits (1042),  Expect = 7e-137, Method: Compositional matrix adjust.
 Identities = 211/216 (98%), Positives = 213/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQ DGQMP DKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPGDKTIGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRS  216



>gb|AHJ80817.1| Tua1 [Eragrostis tef]
Length=451

 Score =   405 bits (1042),  Expect = 7e-137, Method: Compositional matrix adjust.
 Identities = 211/216 (98%), Positives = 213/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQ DGQMP DKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPGDKTIGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRS  216



>ref|XP_010060142.1| PREDICTED: tubulin alpha chain-like [Eucalyptus grandis]
 gb|KCW66706.1| hypothetical protein EUGRSUZ_F00470 [Eucalyptus grandis]
Length=451

 Score =   405 bits (1042),  Expect = 7e-137, Method: Compositional matrix adjust.
 Identities = 210/216 (97%), Positives = 214/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGN+CWELYC+EHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNSCWELYCVEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFN+VGGGTGSGLGSLLLERLSVDYGKKSKL FT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNSVGGGTGSGLGSLLLERLSVDYGKKSKLSFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRS  216



>ref|XP_008455054.1| PREDICTED: tubulin alpha-4 chain isoform X1 [Cucumis melo]
Length=451

 Score =   405 bits (1041),  Expect = 7e-137, Method: Compositional matrix adjust.
 Identities = 210/216 (97%), Positives = 213/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSD TVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDTTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRA+FVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGMYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DV+VLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVSVLLDNEAIYDICRRS  216



>ref|XP_003539228.1| PREDICTED: tubulin alpha-2 chain-like [Glycine max]
 gb|KHN13032.1| Tubulin alpha-2 chain [Glycine soja]
Length=451

 Score =   405 bits (1041),  Expect = 7e-137, Method: Compositional matrix adjust.
 Identities = 210/216 (97%), Positives = 213/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEH IQ DGQMPSDKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHAIQADGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDE+RTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEIRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRS  216



>emb|CAA06619.1| alpha-tubulin 1 [Eleusine indica]
Length=451

 Score =   405 bits (1041),  Expect = 7e-137, Method: Compositional matrix adjust.
 Identities = 211/216 (98%), Positives = 213/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQ DGQMP DKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPGDKTIGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRS  216



>gb|AHJ80815.1| Tua1 [Eragrostis tef]
Length=451

 Score =   405 bits (1041),  Expect = 7e-137, Method: Compositional matrix adjust.
 Identities = 211/216 (98%), Positives = 213/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQ DGQMP DKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPGDKTIGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRS  216



>ref|NP_001167663.1| tubulin alpha-3 chain [Zea mays]
 gb|ACG26907.1| tubulin alpha-3 chain [Zea mays]
 gb|AFW67746.1| alpha tubulin4 isoform 1 [Zea mays]
 gb|AFW67747.1| alpha tubulin4 isoform 2 [Zea mays]
Length=451

 Score =   405 bits (1041),  Expect = 7e-137, Method: Compositional matrix adjust.
 Identities = 211/216 (98%), Positives = 213/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQ DGQMP DKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPGDKTIGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRS  216



>sp|O22347.1|TBA1_ELEIN RecName: Full=Tubulin alpha-1 chain; AltName: Full=Alpha-1-tubulin 
[Eleusine indica]
 gb|AAC05717.1| alpha tubulin 1 [Eleusine indica]
 emb|CAA06618.1| alpha-tubulin 1 [Eleusine indica]
 gb|AFC88823.1| putative tubulin alpha-1 chain [Miscanthus sinensis]
 gb|AFC88833.1| tubulin alpha-1 chain [Miscanthus sinensis]
Length=451

 Score =   405 bits (1041),  Expect = 7e-137, Method: Compositional matrix adjust.
 Identities = 211/216 (98%), Positives = 213/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQ DGQMP DKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPGDKTIGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRS  216



>gb|AFC88832.1| putative tubulin alpha-3 chain [Miscanthus sinensis]
Length=451

 Score =   405 bits (1041),  Expect = 7e-137, Method: Compositional matrix adjust.
 Identities = 211/216 (98%), Positives = 213/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQ DGQMP DKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPGDKTIGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRS  216



>gb|AAL16174.1|AF428406_1 AT4g14960/dl3520c [Arabidopsis thaliana]
Length=450

 Score =   405 bits (1041),  Expect = 8e-137, Method: Compositional matrix adjust.
 Identities = 210/216 (97%), Positives = 213/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DK VGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKIVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DV++LLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVSILLDNEAIYDICRRS  216



>sp|Q9FT36.1|TBA_DAUCA RecName: Full=Tubulin alpha chain [Daucus carota]
 gb|AAG02564.1| alpha-tubulin [Daucus carota]
Length=451

 Score =   405 bits (1041),  Expect = 8e-137, Method: Compositional matrix adjust.
 Identities = 207/216 (96%), Positives = 215/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECIS+HIGQAGIQ+GNACWELYCLEHGIQP+GQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQIGNACWELYCLEHGIQPNGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQ+STS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQISTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DV+VLLDNEAIYDIC+RS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVSVLLDNEAIYDICKRS  216



>ref|XP_009124556.1| PREDICTED: tubulin alpha-2 chain-like isoform X1 [Brassica rapa]
Length=450

 Score =   405 bits (1041),  Expect = 9e-137, Method: Compositional matrix adjust.
 Identities = 210/216 (97%), Positives = 213/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYN VLS HSLLEH DV++LLDNEAIYDICRRS
Sbjct  181  VVEPYNRVLSPHSLLEHTDVSILLDNEAIYDICRRS  216



>ref|XP_004150268.1| PREDICTED: tubulin alpha chain-like [Cucumis sativus]
 ref|XP_004156870.1| PREDICTED: tubulin alpha chain-like [Cucumis sativus]
 ref|XP_008454421.1| PREDICTED: tubulin alpha chain [Cucumis melo]
 gb|ADN33817.1| tubulin alpha chain [Cucumis melo subsp. melo]
 gb|KGN52737.1| Tubulin alpha chain [Cucumis sativus]
Length=450

 Score =   405 bits (1041),  Expect = 9e-137, Method: Compositional matrix adjust.
 Identities = 210/216 (97%), Positives = 213/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP D T+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDTTLGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRS  216



>gb|ABQ59634.1| alpha-tubulin 5 [Populus tremuloides]
Length=451

 Score =   405 bits (1041),  Expect = 9e-137, Method: Compositional matrix adjust.
 Identities = 210/216 (97%), Positives = 213/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVF DLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFADLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSL+EH  VAVLLDNEAIYDIC+RS
Sbjct  181  VVEPYNSVLSTHSLVEHTTVAVLLDNEAIYDICKRS  216



>ref|XP_006650518.1| PREDICTED: tubulin alpha-1 chain-like [Oryza brachyantha]
Length=451

 Score =   405 bits (1041),  Expect = 9e-137, Method: Compositional matrix adjust.
 Identities = 212/216 (98%), Positives = 213/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQ DGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGGYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRS  216



>gb|AIX10773.1| alpha tubulin [Panax notoginseng]
Length=451

 Score =   405 bits (1040),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 210/216 (97%), Positives = 213/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVR+G YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRSGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVA+LLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAILLDNEAIYDICRRS  216



>ref|XP_008665337.1| PREDICTED: tubulin alpha-1 chain-like [Zea mays]
 sp|P14640.1|TBA1_MAIZE RecName: Full=Tubulin alpha-1 chain; AltName: Full=Alpha-1-tubulin 
[Zea mays]
 emb|CAA33734.1| alpha1-tubulin [Zea mays]
 tpg|DAA51112.1| TPA: tubulin alpha-1 chain [Zea mays]
 tpg|DAA51113.1| TPA: tubulin alpha-1 chain [Zea mays]
 tpg|DAA51114.1| TPA: tubulin alpha-1 chain [Zea mays]
 tpg|DAA51117.1| TPA: tubulin alpha-1 chain [Zea mays]
Length=451

 Score =   405 bits (1040),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 210/216 (97%), Positives = 213/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQ DGQMP DKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPGDKTIGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVA+LLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAILLDNEAIYDICRRS  216



>ref|XP_008665339.1| PREDICTED: tubulin alpha-2 chain [Zea mays]
 sp|P14641.1|TBA2_MAIZE RecName: Full=Tubulin alpha-2 chain; AltName: Full=Alpha-2-tubulin 
[Zea mays]
 emb|CAA33733.1| alpha2-tubulin [Zea mays]
 tpg|DAA51111.1| TPA: tubulin alpha-2 chain [Zea mays]
Length=451

 Score =   405 bits (1040),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 210/216 (97%), Positives = 213/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQ DGQMP DKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPGDKTIGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVA+LLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAILLDNEAIYDICRRS  216



>ref|XP_009357231.1| PREDICTED: tubulin alpha chain-like isoform X2 [Pyrus x bretschneideri]
Length=446

 Score =   405 bits (1040),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 210/216 (97%), Positives = 213/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGI PDGQMPSDKTVG GDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIGPDGQMPSDKTVGRGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DV+VLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVSVLLDNEAIYDICRRS  216



>ref|XP_002976230.1| hypothetical protein SELMODRAFT_105136 [Selaginella moellendorffii]
 ref|XP_002987138.1| hypothetical protein SELMODRAFT_125554 [Selaginella moellendorffii]
 gb|EFJ11714.1| hypothetical protein SELMODRAFT_125554 [Selaginella moellendorffii]
 gb|EFJ22490.1| hypothetical protein SELMODRAFT_105136 [Selaginella moellendorffii]
Length=451

 Score =   405 bits (1040),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 207/216 (96%), Positives = 215/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAG+QVGNACWELYCLEHGIQPDGQMP+DKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGVQVGNACWELYCLEHGIQPDGQMPTDKTIGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPR+VF+DLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRSVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFL+FNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVST+
Sbjct  121  RIRKLADNCTGLQGFLIFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTA  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRS  216



>ref|XP_008352751.1| PREDICTED: tubulin alpha chain isoform X2 [Malus domestica]
Length=449

 Score =   405 bits (1040),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 210/216 (97%), Positives = 213/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGI PDGQMPSDKTVG GDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIGPDGQMPSDKTVGRGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DV+VLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVSVLLDNEAIYDICRRS  216



>gb|ACH68563.1| alpha-tubulin [Solanum tuberosum]
Length=449

 Score =   405 bits (1040),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 211/215 (98%), Positives = 213/215 (99%), Gaps = 0/215 (0%)
 Frame = +2

Query  128  RECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGKH  307
            RECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGKH
Sbjct  1    RECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGKH  60

Query  308  VPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDR  487
            VPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDR
Sbjct  61   VPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLDR  120

Query  488  IRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTSV  667
            IRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTSV
Sbjct  121  IRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTSV  180

Query  668  VEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VEPYNSVLSTHSLLEH DV++LLDNEAIYDICRRS
Sbjct  181  VEPYNSVLSTHSLLEHTDVSILLDNEAIYDICRRS  215



>ref|XP_007143142.1| hypothetical protein PHAVU_007G047300g [Phaseolus vulgaris]
 gb|ESW15136.1| hypothetical protein PHAVU_007G047300g [Phaseolus vulgaris]
Length=449

 Score =   405 bits (1040),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 211/216 (98%), Positives = 213/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGI PDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIGPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRA+FVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGPYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRS  216



>ref|XP_002989731.1| hypothetical protein SELMODRAFT_130285 [Selaginella moellendorffii]
 ref|XP_002991763.1| hypothetical protein SELMODRAFT_236391 [Selaginella moellendorffii]
 gb|EFJ07167.1| hypothetical protein SELMODRAFT_236391 [Selaginella moellendorffii]
 gb|EFJ09208.1| hypothetical protein SELMODRAFT_130285 [Selaginella moellendorffii]
Length=451

 Score =   404 bits (1039),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 208/216 (96%), Positives = 214/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPR+VF+DLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRSVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            R+RKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVST+
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTA  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVA +LDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAAILDNEAIYDICRRS  216



>sp|Q6VAG1.1|TBA1_GOSHI RecName: Full=Tubulin alpha-1 chain; AltName: Full=Alpha-1-tubulin 
[Gossypium hirsutum]
 gb|AAQ92661.1| alpha-tubulin 1 [Gossypium hirsutum]
Length=451

 Score =   404 bits (1039),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 210/216 (97%), Positives = 214/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAF TFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFYTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFSAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DV+VLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVSVLLDNEAIYDICRRS  216



>emb|CDP02221.1| unnamed protein product [Coffea canephora]
Length=449

 Score =   404 bits (1039),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 211/216 (98%), Positives = 214/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSD TVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDHTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVST+
Sbjct  121  RIRKLADNCTGLQGFLVFHAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDICR+S
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRKS  216



>emb|CAA62917.1| alfa-tubulin [Oryza sativa Japonica Group]
Length=451

 Score =   404 bits (1039),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 210/216 (97%), Positives = 213/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPT+IDEVRTG YRQLFHPEQ+ISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTMIDEVRTGDYRQLFHPEQVISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRS  216



>ref|XP_009618479.1| PREDICTED: tubulin alpha-3 chain-like [Nicotiana tomentosiformis]
Length=451

 Score =   404 bits (1039),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 209/216 (97%), Positives = 213/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSET +GK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETSSGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIG+EIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGREIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DV+VLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVSVLLDNEAIYDICRRS  216



>ref|XP_002989721.1| hypothetical protein SELMODRAFT_235864 [Selaginella moellendorffii]
 ref|XP_002993678.1| hypothetical protein SELMODRAFT_236787 [Selaginella moellendorffii]
 gb|EFJ05267.1| hypothetical protein SELMODRAFT_236787 [Selaginella moellendorffii]
 gb|EFJ09198.1| hypothetical protein SELMODRAFT_235864 [Selaginella moellendorffii]
Length=451

 Score =   404 bits (1038),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 208/216 (96%), Positives = 214/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPR+VF+DLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRSVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            R+RKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKL FT+YPSPQVST+
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLAFTVYPSPQVSTA  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAV+LDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVILDNEAIYDICRRS  216



>gb|KHN42598.1| Tubulin alpha-2 chain [Glycine soja]
Length=451

 Score =   404 bits (1038),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 210/216 (97%), Positives = 213/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEH IQ DGQMPSDKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHAIQADGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIV+LCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVNLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRS  216



>sp|Q96460.1|TBA2_HORVU RecName: Full=Tubulin alpha-2 chain [Hordeum vulgare]
 emb|CAA69724.1| alpha-tubulin 2 [Hordeum vulgare subsp. vulgare]
Length=451

 Score =   404 bits (1037),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 209/216 (97%), Positives = 213/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKL+DNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLSDNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DV++LLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVSILLDNEAIYDICRRS  216



>gb|ABD92930.1| alpha tubulin-2A [Triticum aestivum]
 gb|ABD92931.1| alpha tubulin-2D [Triticum aestivum]
 gb|ABD92932.1| alpha tubulin-2B [Triticum aestivum]
 gb|EMS59370.1| Tubulin alpha chain [Triticum urartu]
 gb|EMT25007.1| Tubulin alpha chain [Aegilops tauschii]
Length=451

 Score =   404 bits (1037),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 209/216 (97%), Positives = 213/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKL+DNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLSDNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DV++LLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVSILLDNEAIYDICRRS  216



>gb|ABO47742.1| alpha-tubulin [Gossypium hirsutum]
 gb|KHG08879.1| Tubulin alpha-1 chain [Gossypium arboreum]
 gb|KJB11380.1| hypothetical protein B456_001G255600 [Gossypium raimondii]
Length=450

 Score =   404 bits (1037),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 209/216 (97%), Positives = 213/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECIS+HIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVF+DLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFHAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRS  216



>ref|XP_002517492.1| tubulin alpha chain, putative [Ricinus communis]
 gb|EEF45034.1| tubulin alpha chain, putative [Ricinus communis]
Length=450

 Score =   404 bits (1037),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 209/216 (97%), Positives = 214/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVF+DLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFHAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DV++LLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVSILLDNEAIYDICRRS  216



>ref|XP_002972670.1| hypothetical protein SELMODRAFT_231979 [Selaginella moellendorffii]
 ref|XP_002988134.1| hypothetical protein SELMODRAFT_235448 [Selaginella moellendorffii]
 gb|EFJ10926.1| hypothetical protein SELMODRAFT_235448 [Selaginella moellendorffii]
 gb|EFJ25891.1| hypothetical protein SELMODRAFT_231979 [Selaginella moellendorffii]
Length=450

 Score =   404 bits (1037),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 208/216 (96%), Positives = 214/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPR VF+DLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEIVDLCLD
Sbjct  61   HVPRCVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYG+KSKLGFTIYPSPQVST+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGRKSKLGFTIYPSPQVSTA  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYD+CRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDLCRRS  216



>ref|NP_001291325.1| tubulin alpha chain-like [Sesamum indicum]
 gb|AFJ42573.1| alpha-tubulin [Sesamum indicum]
Length=450

 Score =   404 bits (1037),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 210/216 (97%), Positives = 214/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP D+TVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDQTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVST+
Sbjct  121  RIRKLADNCTGLQGFLVFHAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDICR+S
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRKS  216



>gb|ABF98643.1| Tubulin alpha-1 chain, putative, expressed [Oryza sativa Japonica 
Group]
Length=433

 Score =   403 bits (1035),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 210/216 (97%), Positives = 213/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQ DGQMPSD+TVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPSDRTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLI+GKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGCYRQLFHPEQLINGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRS  216



>gb|ABG78593.1| alpha-tubulin [Oryza sativa Japonica Group]
Length=451

 Score =   404 bits (1037),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 210/216 (97%), Positives = 213/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQP+GQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPEGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHY+IGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGDYRQLFHPEQLISGKEDAANNFARGHYSIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRS  216



>ref|XP_009779180.1| PREDICTED: tubulin alpha-3 chain-like [Nicotiana sylvestris]
Length=451

 Score =   404 bits (1037),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 208/216 (96%), Positives = 214/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSET +GK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETSSGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIG+EIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGREIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLAD+CTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADSCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DV++LLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVSILLDNEAIYDICRRS  216



>ref|XP_007223365.1| hypothetical protein PRUPE_ppa005617mg [Prunus persica]
 ref|XP_008219156.1| PREDICTED: tubulin alpha chain-like isoform X1 [Prunus mume]
 ref|XP_008347836.1| PREDICTED: tubulin alpha chain isoform X1 [Malus domestica]
 ref|XP_008352750.1| PREDICTED: tubulin alpha chain isoform X1 [Malus domestica]
 ref|XP_009357230.1| PREDICTED: tubulin alpha chain-like isoform X1 [Pyrus x bretschneideri]
 ref|XP_009335481.1| PREDICTED: tubulin alpha chain-like [Pyrus x bretschneideri]
 gb|EMJ24564.1| hypothetical protein PRUPE_ppa005617mg [Prunus persica]
Length=451

 Score =   404 bits (1037),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 210/216 (97%), Positives = 213/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGI PDGQMPSDKTVG GDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIGPDGQMPSDKTVGRGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DV+VLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVSVLLDNEAIYDICRRS  216



>gb|ABV55999.1| alpha-tubulin 7 [Populus tremuloides]
Length=451

 Score =   403 bits (1036),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 209/216 (97%), Positives = 214/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVF+DLEPTVIDEVRTG YRQLFHPEQLISGKE+AANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGAYRQLFHPEQLISGKENAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFHAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DV+VLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVSVLLDNEAIYDICRRS  216



>ref|NP_001051132.1| Os03g0726100 [Oryza sativa Japonica Group]
 gb|AAG16905.1|AF182523_1 alpha-tubulin [Oryza sativa]
 gb|AAS07163.1| alpha tubulin [Oryza sativa Japonica Group]
 gb|AAT77077.1| alpha tubulin [Oryza sativa Japonica Group]
 gb|ABF98642.1| Tubulin alpha-1 chain, putative, expressed [Oryza sativa Japonica 
Group]
 gb|ABG78592.1| alpha-tubulin [Oryza sativa Japonica Group]
 dbj|BAF13046.1| Os03g0726100 [Oryza sativa Japonica Group]
 gb|EAY91719.1| hypothetical protein OsI_13361 [Oryza sativa Indica Group]
 gb|EAZ28437.1| hypothetical protein OsJ_12419 [Oryza sativa Japonica Group]
 gb|AFI71265.1| alpha tubulin [Oryza sativa Japonica Group]
Length=451

 Score =   403 bits (1036),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 210/216 (97%), Positives = 213/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQ DGQMPSD+TVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPSDRTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLI+GKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGCYRQLFHPEQLINGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRS  216



>ref|XP_006482577.1| PREDICTED: tubulin alpha-2 chain-like isoform X2 [Citrus sinensis]
Length=425

 Score =   402 bits (1034),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 209/216 (97%), Positives = 213/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQM SDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMLSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVF+DLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFHAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DV+VLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVSVLLDNEAIYDICRRS  216



>gb|ABP65320.1| alpha tubulin [Capsicum annuum]
Length=450

 Score =   403 bits (1036),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 211/216 (98%), Positives = 212/216 (98%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFL FNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLDFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            V EPYNSVLSTHSLLEH DVA+LLDNEAIYDICRRS
Sbjct  181  VDEPYNSVLSTHSLLEHTDVAILLDNEAIYDICRRS  216



>ref|XP_007032501.1| Tubulin alpha-2 chain [Theobroma cacao]
 gb|EOY03427.1| Tubulin alpha-2 chain [Theobroma cacao]
Length=450

 Score =   403 bits (1036),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 210/216 (97%), Positives = 213/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGG DAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGADAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVF+DLEPTVIDEVRTGTYRQLFHPE LISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGTYRQLFHPEHLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFHAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRS  216



>ref|XP_008347837.1| PREDICTED: tubulin alpha-4 chain isoform X2 [Malus domestica]
Length=459

 Score =   403 bits (1036),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 210/216 (97%), Positives = 213/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGI PDGQMPSDKTVG GDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIGPDGQMPSDKTVGRGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRA+FVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DV+VLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVSVLLDNEAIYDICRRS  216



>ref|XP_002508010.1| alpha tubulin 2 [Micromonas sp. RCC299]
 ref|XP_002506067.1| alpha tubulin 1 [Micromonas sp. RCC299]
 gb|ACO67325.1| alpha tubulin 1 [Micromonas sp. RCC299]
 gb|ACO69268.1| alpha tubulin 2 [Micromonas sp. RCC299]
Length=449

 Score =   403 bits (1035),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 208/216 (96%), Positives = 213/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRE ISIHIGQAGIQ GNACWELYCLEHGIQPDGQMPSDKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MREVISIHIGQAGIQTGNACWELYCLEHGIQPDGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVF+DLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGF+VFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVST+
Sbjct  121  RIRKLADNCTGLQGFMVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAV+LDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVMLDNEAIYDICRRS  216



>gb|AGG37289.1| alpha-tubulin 7 [Salix arbutifolia]
Length=450

 Score =   403 bits (1035),  Expect = 7e-136, Method: Compositional matrix adjust.
 Identities = 209/216 (97%), Positives = 213/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVF+DLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFHAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DV+VLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVSVLLDNEAIYDICRRS  216



>sp|Q9ZRB7.1|TBA_WHEAT RecName: Full=Tubulin alpha chain [Triticum aestivum]
 gb|AAD10486.1| alpha-tubulin [Triticum aestivum]
Length=451

 Score =   403 bits (1035),  Expect = 7e-136, Method: Compositional matrix adjust.
 Identities = 208/216 (96%), Positives = 213/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKL+DNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYG+KSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLSDNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGRKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DV++LLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVSILLDNEAIYDICRRS  216



>gb|AAB84298.1| tubulin [Oryza sativa Indica Group]
Length=451

 Score =   403 bits (1035),  Expect = 7e-136, Method: Compositional matrix adjust.
 Identities = 209/216 (97%), Positives = 212/216 (98%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQ DGQMPSD+TVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPSDRTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTG YRQ FHPEQLI+GKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGLYRQFFHPEQLINGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRS  216



>ref|XP_011008936.1| PREDICTED: tubulin alpha chain [Populus euphratica]
Length=451

 Score =   403 bits (1035),  Expect = 7e-136, Method: Compositional matrix adjust.
 Identities = 209/216 (97%), Positives = 213/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVF+DLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFHAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DV+VLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVSVLLDNEAIYDICRRS  216



>ref|XP_010256937.1| PREDICTED: tubulin alpha chain-like [Nelumbo nucifera]
Length=450

 Score =   402 bits (1034),  Expect = 8e-136, Method: Compositional matrix adjust.
 Identities = 208/216 (96%), Positives = 213/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECIS+HIGQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVF+DLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGNYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFHAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVA+LLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAILLDNEAIYDICRRS  216



>ref|XP_006650524.1| PREDICTED: tubulin alpha-1 chain-like [Oryza brachyantha]
Length=451

 Score =   403 bits (1035),  Expect = 8e-136, Method: Compositional matrix adjust.
 Identities = 211/216 (98%), Positives = 212/216 (98%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQ GIQVGNACWELYCLEHGIQ DGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQPGIQVGNACWELYCLEHGIQADGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGGYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRS  216



>ref|XP_011098608.1| PREDICTED: tubulin alpha chain [Sesamum indicum]
Length=450

 Score =   402 bits (1034),  Expect = 9e-136, Method: Compositional matrix adjust.
 Identities = 210/216 (97%), Positives = 213/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMP D TVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDHTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVST+
Sbjct  121  RIRKLADNCTGLQGFLVFHAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDICR+S
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRKS  216



>sp|P33623.1|TBA1_ANEPH RecName: Full=Tubulin alpha-1 chain [Anemia phyllitidis]
 emb|CAA48927.1| alpha tubulin [Anemia phyllitidis]
Length=451

 Score =   402 bits (1033),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 209/216 (97%), Positives = 213/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNA WELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNARWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVF+DLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVF+AVGG TGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFHAVGGXTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DV+VLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVSVLLDNEAIYDICRRS  216



>gb|AAQ81585.1| putative tubulin alpha-2/alpha-4 chain [Brassica napus]
Length=450

 Score =   402 bits (1033),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 209/216 (97%), Positives = 213/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            M ECISIH+GQAGIQVGNACWELYCLEHGIQPDGQMP DKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MGECISIHMGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DV++LLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVSILLDNEAIYDICRRS  216



>ref|XP_002962209.1| hypothetical protein SELMODRAFT_230058 [Selaginella moellendorffii]
 ref|XP_002965123.1| hypothetical protein SELMODRAFT_230496 [Selaginella moellendorffii]
 gb|EFJ33961.1| hypothetical protein SELMODRAFT_230496 [Selaginella moellendorffii]
 gb|EFJ37469.1| hypothetical protein SELMODRAFT_230058 [Selaginella moellendorffii]
Length=451

 Score =   402 bits (1032),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 205/216 (95%), Positives = 214/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQ+GNACWEL+CLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQIGNACWELFCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPR+VF+DLEPTV+DEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRSVFLDLEPTVVDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGF+VFNAVGGGTGSGLGSLLLERLSVDYGKKSKL FT+YPSPQVST+
Sbjct  121  RIRKLADNCTGLQGFMVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLAFTVYPSPQVSTA  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAV+LDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVMLDNEAIYDICRRS  216



>dbj|BAJ98211.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=449

 Score =   402 bits (1032),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 205/215 (95%), Positives = 213/215 (99%), Gaps = 0/215 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRE ISIH+GQAGIQ+GNACWELYCLEHGIQPDGQMPSDKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MREVISIHVGQAGIQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVF+DLEPTV+DEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFLDLEPTVVDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVST+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTA  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRR  769
            VVEPYNSVLSTHSLLEH DVAV+LDNEAIYDICRR
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVMLDNEAIYDICRR  215



>ref|XP_005651460.1| tubulin alpha chain [Coccomyxa subellipsoidea C-169]
 gb|EIE26916.1| tubulin alpha chain [Coccomyxa subellipsoidea C-169]
Length=451

 Score =   402 bits (1032),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 207/216 (96%), Positives = 213/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRE ISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MREVISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPR VF+DLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRCVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVST+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTA  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAV+LDNEA+YDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVMLDNEAVYDICRRS  216



>ref|XP_005851144.1| alpha-tubulin [Chlorella variabilis]
 gb|EFN59042.1| alpha-tubulin [Chlorella variabilis]
Length=450

 Score =   402 bits (1032),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 207/216 (96%), Positives = 213/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRE ISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MREVISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPR VFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRCVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVST+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTA  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DV+V+LDNEA+YDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVSVMLDNEAVYDICRRS  216



>emb|CDO97305.1| unnamed protein product [Coffea canephora]
Length=450

 Score =   402 bits (1032),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 208/216 (96%), Positives = 214/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECIS+HIGQAGIQVGNACWELYCLEHGIQPDG+MPSDKTVGGG+DAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGRMPSDKTVGGGNDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHP+QLISG EDAANNFARGHYTIG+EIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPDQLISGNEDAANNFARGHYTIGREIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRS  216



>ref|XP_001777081.1| predicted protein [Physcomitrella patens]
 gb|EDQ58074.1| predicted protein [Physcomitrella patens]
Length=449

 Score =   402 bits (1032),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 209/216 (97%), Positives = 213/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRE ISIHIGQAGIQVGNACWELYCLEHGIQPDG+MPSD TVGGGDDAFNTFFSETGAGK
Sbjct  1    MREIISIHIGQAGIQVGNACWELYCLEHGIQPDGRMPSDTTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            R+RKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVST+
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRS  216



>ref|XP_002963092.1| hypothetical protein SELMODRAFT_78469 [Selaginella moellendorffii]
 ref|XP_002980241.1| hypothetical protein SELMODRAFT_112368 [Selaginella moellendorffii]
 gb|EFJ18501.1| hypothetical protein SELMODRAFT_112368 [Selaginella moellendorffii]
 gb|EFJ36555.1| hypothetical protein SELMODRAFT_78469 [Selaginella moellendorffii]
Length=451

 Score =   402 bits (1032),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 205/216 (95%), Positives = 214/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQ+GNACWEL+CLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQIGNACWELFCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPR+VF+DLEPTV+DEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRSVFLDLEPTVVDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGF+VFNAVGGGTGSGLGSLLLERLSVDYGKKSKL FT+YPSPQVST+
Sbjct  121  RIRKLADNCTGLQGFMVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLAFTVYPSPQVSTA  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAV+LDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVMLDNEAIYDICRRS  216



>ref|XP_001782790.1| predicted protein [Physcomitrella patens]
 ref|XP_001782813.1| predicted protein [Physcomitrella patens]
 dbj|BAC24799.1| alpha tubulin [Physcomitrella patens]
 gb|EDQ52367.1| predicted protein [Physcomitrella patens]
 gb|EDQ52390.1| predicted protein [Physcomitrella patens]
Length=449

 Score =   402 bits (1032),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 209/216 (97%), Positives = 213/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRE ISIHIGQAGIQVGNACWELYCLEHGIQPDG+MPSD TVGGGDDAFNTFFSETGAGK
Sbjct  1    MREIISIHIGQAGIQVGNACWELYCLEHGIQPDGRMPSDTTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYT+GKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            R+RKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVST+
Sbjct  121  RVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRS  216



>ref|XP_010242419.1| PREDICTED: tubulin alpha-1 chain [Nelumbo nucifera]
Length=451

 Score =   402 bits (1032),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 208/216 (96%), Positives = 213/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECIS+HIGQAGIQVGNACWELYCLEHGIQPDGQMPS KTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPSGKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVF+DLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFHAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DV+VLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVSVLLDNEAIYDICRRS  216



>ref|XP_006338461.1| PREDICTED: tubulin alpha-3 chain-like isoform X2 [Solanum tuberosum]
Length=434

 Score =   401 bits (1030),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 208/216 (96%), Positives = 213/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGI+PDGQMP D TVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIKPDGQMPGDVTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVST+
Sbjct  121  RIRKLADNCTGLQGFLVFHAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVA+LLDNEAIYDICR+S
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAILLDNEAIYDICRKS  216



>ref|XP_006431130.1| hypothetical protein CICLE_v10011709mg [Citrus clementina]
 ref|XP_006482576.1| PREDICTED: tubulin alpha-2 chain-like isoform X1 [Citrus sinensis]
 gb|ESR44370.1| hypothetical protein CICLE_v10011709mg [Citrus clementina]
 gb|KDO72550.1| hypothetical protein CISIN_1g013066mg [Citrus sinensis]
Length=450

 Score =   401 bits (1031),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 209/216 (97%), Positives = 213/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQM SDKTVGGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMLSDKTVGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVF+DLEPTVIDEVRTG YRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVFLDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFHAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DV+VLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVSVLLDNEAIYDICRRS  216



>ref|XP_004231960.1| PREDICTED: tubulin alpha-3 chain-like [Solanum lycopersicum]
Length=451

 Score =   401 bits (1030),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 207/216 (96%), Positives = 212/216 (98%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECIS+HIGQAGIQVGNACWELYCLEHGIQPDGQMP DKT+GGGDDAFNTFFSETG+GK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTLGGGDDAFNTFFSETGSGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAVFVDLEPTVIDEVR G YRQLFHPEQLISGKEDAANNFARGHYTIG+EIVDLCLD
Sbjct  61   HVPRAVFVDLEPTVIDEVRAGPYRQLFHPEQLISGKEDAANNFARGHYTIGREIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRS  216



>ref|XP_002973792.1| hypothetical protein SELMODRAFT_100162 [Selaginella moellendorffii]
 ref|XP_002983604.1| hypothetical protein SELMODRAFT_234301 [Selaginella moellendorffii]
 gb|EFJ15505.1| hypothetical protein SELMODRAFT_234301 [Selaginella moellendorffii]
 gb|EFJ24747.1| hypothetical protein SELMODRAFT_100162 [Selaginella moellendorffii]
Length=451

 Score =   401 bits (1030),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 205/216 (95%), Positives = 214/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQ+GNACWEL+CLEHGIQPDGQMPSDKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQIGNACWELFCLEHGIQPDGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPR VF+DLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRCVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            R+RKLADNCTGLQGFLVF+AVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVST+
Sbjct  121  RVRKLADNCTGLQGFLVFHAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTA  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAV+LDNEAIYD+CRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVMLDNEAIYDLCRRS  216



>ref|XP_006357741.1| PREDICTED: tubulin alpha-3 chain-like [Solanum tuberosum]
Length=451

 Score =   400 bits (1029),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 206/216 (95%), Positives = 212/216 (98%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECIS+HIGQAGIQVGNACWELYCLEHGIQPDGQMP DKT+GGGDDAFNTFFSETG+GK
Sbjct  1    MRECISVHIGQAGIQVGNACWELYCLEHGIQPDGQMPGDKTLGGGDDAFNTFFSETGSGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRA+FVDLEPTVIDEVR G YRQLFHPEQLISGKEDAANNFARGHYTIG+EIVDLCLD
Sbjct  61   HVPRAIFVDLEPTVIDEVRAGPYRQLFHPEQLISGKEDAANNFARGHYTIGREIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRS  216



>gb|AHJ80823.1| Tua1 [Eragrostis tef]
Length=451

 Score =   400 bits (1028),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 209/216 (97%), Positives = 212/216 (98%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRECISIHIGQAGIQVGNACWELYCLEHGIQ DGQMP DKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MRECISIHIGQAGIQVGNACWELYCLEHGIQADGQMPGDKTIGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPRAV VDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRAVSVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGK+SKLGFT+YPSPQVSTS
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKESKLGFTVYPSPQVSTS  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DVAVLLDNEAIYDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRS  216



>ref|XP_005643073.1| tubulin alpha chain [Coccomyxa subellipsoidea C-169]
 sp|Q9ZRJ4.1|TBA_CHLVU RecName: Full=Tubulin alpha chain [Chlorella vulgaris]
 dbj|BAA03955.1| alpha-tubulin [Chlorella vulgaris]
 gb|EIE18529.1| tubulin alpha chain [Coccomyxa subellipsoidea C-169]
Length=451

 Score =   400 bits (1028),  Expect = 7e-135, Method: Compositional matrix adjust.
 Identities = 206/216 (95%), Positives = 213/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  125  MRECISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTVGGGDDAFNTFFSETGAGK  304
            MRE ISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKT+GGGDDAFNTFFSETGAGK
Sbjct  1    MREVISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDKTIGGGDDAFNTFFSETGAGK  60

Query  305  HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  484
            HVPR VF+DLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD
Sbjct  61   HVPRCVFLDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLCLD  120

Query  485  RIRKLADNCTGLQGFLVFNAVgggtgsglgslllerlsVDYGKKSKLGFTIYPSPQVSTS  664
            RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFT+YPSPQVST+
Sbjct  121  RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTVYPSPQVSTA  180

Query  665  VVEPYNSVLSTHSLLEHIDVAVLLDNEAIYDICRRS  772
            VVEPYNSVLSTHSLLEH DV+V+LDNEA+YDICRRS
Sbjct  181  VVEPYNSVLSTHSLLEHTDVSVMLDNEAVYDICRRS  216



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1494411655520