BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF046L16

Length=721
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|ABM88789.1|  cytochrome P450 reductase                               227   1e-65   Artemisia annua [sweet Annie]
gb|ABL09938.1|  cytochrome P450 reductase                               226   2e-65   Artemisia annua [sweet Annie]
gb|ABC47946.1|  cytochrome P450 reductase                               226   3e-65   Artemisia annua [sweet Annie]
gb|ABI98819.1|  cytochrome P450 reductase                               226   3e-65   Artemisia annua [sweet Annie]
gb|AFO64618.1|  cytochrome P450 reductase                               225   5e-65   Artemisia annua [sweet Annie]
ref|XP_009795589.1|  PREDICTED: NADPH--cytochrome P450 reductase        223   6e-64   Nicotiana sylvestris
ref|XP_009607226.1|  PREDICTED: NADPH--cytochrome P450 reductase        222   9e-64   Nicotiana tomentosiformis
gb|AGX85599.1|  NADPH:cytochrome P450 reductase                         219   9e-63   Scoparia dulcis [escobilla]
ref|XP_011079296.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    219   1e-62   Sesamum indicum [beniseed]
gb|ADC94831.1|  cytochrome P450 reductase                               215   3e-61   Perilla frutescens [beefsteak-mint]
ref|XP_011069915.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    215   4e-61   Sesamum indicum [beniseed]
ref|XP_004242931.1|  PREDICTED: NADPH--cytochrome P450 reductase        214   8e-61   Solanum lycopersicum
gb|AHM95445.1|  cytochrome P450 reductase                               213   1e-60   Matricaria chamomilla var. recutita [German chamomile]
gb|AAZ39649.1|  cytochrome P450 NADPH-reductase                         212   5e-60   Petunia x hybrida [garden petunia]
gb|EYU42400.1|  hypothetical protein MIMGU_mgv1a002170mg                211   8e-60   Erythranthe guttata [common monkey flower]
gb|ADG29353.1|  cytochrome P450 reductase                               211   1e-59   Withania somnifera [ashwagandha]
gb|EPS73891.1|  hypothetical protein M569_00858                         211   1e-59   Genlisea aurea
gb|AGL46979.1|  cytochrome P450 reductase                               209   5e-59   Salvia miltiorrhiza [Chinese salvia]
gb|AGO03795.1|  cytochrome P450-like protein                            204   1e-58   Tanacetum cinerariifolium [pyrethrum]
ref|XP_004168990.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    195   3e-58   
ref|XP_010548619.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    206   8e-58   Tarenaya hassleriana [spider flower]
ref|XP_002534464.1|  cytochrome P450, putative                          203   7e-57   
emb|CAN77401.1|  hypothetical protein VITISV_027794                     202   1e-56   Vitis vinifera
gb|AIG15452.1|  NADPH-cytochrome P450 reductase 2                       202   1e-56   Azadirachta indica [Indian-lilac]
gb|AGC92176.1|  cytochrome P450 oxidoreductase                          202   2e-56   Ocimum basilicum [basil]
ref|XP_002270732.2|  PREDICTED: NADPH--cytochrome P450 reductase        202   2e-56   Vitis vinifera
ref|XP_008223694.1|  PREDICTED: NADPH--cytochrome P450 reductase 2      200   1e-55   Prunus mume [ume]
ref|XP_007227446.1|  hypothetical protein PRUPE_ppa002142mg             199   2e-55   Prunus persica
sp|Q05001.1|NCPR_CATRO  RecName: Full=NADPH--cytochrome P450 redu...    199   2e-55   Catharanthus roseus [chatas]
ref|XP_008453604.1|  PREDICTED: NADPH--cytochrome P450 reductase 2      199   2e-55   Cucumis melo [Oriental melon]
ref|XP_007014268.1|  P450 reductase 2                                   198   4e-55   
ref|XP_010259920.1|  PREDICTED: NADPH--cytochrome P450 reductase        198   6e-55   Nelumbo nucifera [Indian lotus]
ref|XP_010093854.1|  NADPH--cytochrome P450 reductase                   197   7e-55   Morus notabilis
gb|KJB53796.1|  hypothetical protein B456_009G005600                    196   9e-55   Gossypium raimondii
ref|XP_006412733.1|  hypothetical protein EUTSA_v10024546mg             197   1e-54   Eutrema salsugineum [saltwater cress]
dbj|BAJ33878.1|  unnamed protein product                                197   1e-54   Eutrema halophilum
gb|KDO43873.1|  hypothetical protein CISIN_1g005072mg                   195   2e-54   Citrus sinensis [apfelsine]
gb|KJB53795.1|  hypothetical protein B456_009G005600                    196   2e-54   Gossypium raimondii
gb|KJB53797.1|  hypothetical protein B456_009G005600                    196   2e-54   Gossypium raimondii
gb|KJB53794.1|  hypothetical protein B456_009G005600                    196   2e-54   Gossypium raimondii
gb|KDO43872.1|  hypothetical protein CISIN_1g005072mg                   195   2e-54   Citrus sinensis [apfelsine]
gb|ACN54324.1|  NADPH:cytochrome P450 reductase                         196   3e-54   Gossypium hirsutum [American cotton]
ref|XP_010688489.1|  PREDICTED: NADPH--cytochrome P450 reductase        196   3e-54   Beta vulgaris subsp. vulgaris [field beet]
gb|KHG09184.1|  NADPH--cytochrome P450 reductase                        196   3e-54   Gossypium arboreum [tree cotton]
gb|KJB22135.1|  hypothetical protein B456_004G0316001                   188   3e-54   Gossypium raimondii
gb|KDO43869.1|  hypothetical protein CISIN_1g005072mg                   196   3e-54   Citrus sinensis [apfelsine]
gb|KDO43870.1|  hypothetical protein CISIN_1g005072mg                   196   4e-54   Citrus sinensis [apfelsine]
gb|KDO43868.1|  hypothetical protein CISIN_1g005072mg                   196   4e-54   Citrus sinensis [apfelsine]
ref|XP_004146317.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    195   4e-54   Cucumis sativus [cucumbers]
ref|XP_006474185.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    195   5e-54   Citrus sinensis [apfelsine]
ref|XP_006453370.1|  hypothetical protein CICLE_v10007535mg             195   6e-54   
ref|XP_009108997.1|  PREDICTED: NADPH--cytochrome P450 reductase 2      194   8e-54   Brassica rapa
emb|CDY03543.1|  BnaC03g68020D                                          194   2e-53   
gb|ACF35280.1|  cytochrome P450 reductase-like protein                  194   2e-53   Nothapodytes nimmoniana
ref|NP_849472.2|  NADPH--cytochrome P450 reductase 2                    193   3e-53   Arabidopsis thaliana [mouse-ear cress]
ref|NP_194750.1|  NADPH--cytochrome P450 reductase 2                    193   3e-53   Arabidopsis thaliana [mouse-ear cress]
emb|CAA46815.1|  NADPH-ferrihemoprotein reductase                       193   3e-53   Arabidopsis thaliana [mouse-ear cress]
gb|KDO43871.1|  hypothetical protein CISIN_1g005072mg                   191   1e-52   Citrus sinensis [apfelsine]
ref|XP_002869386.1|  hypothetical protein ARALYDRAFT_913457             191   1e-52   Arabidopsis lyrata subsp. lyrata
ref|XP_006453369.1|  hypothetical protein CICLE_v10007535mg             191   1e-52   
ref|XP_006474186.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    191   1e-52   Citrus sinensis [apfelsine]
emb|CDY51656.1|  BnaAnng10960D                                          190   5e-52   Brassica napus [oilseed rape]
dbj|BAG68945.1|  cytochrome P450 reductase                              189   8e-52   Lotus japonicus
gb|ACF35282.1|  cytochrome P450 reductase-like protein                  188   2e-51   Nothapodytes nimmoniana
ref|XP_008789667.1|  PREDICTED: NADPH--cytochrome P450 reductase        187   3e-51   Phoenix dactylifera
gb|AIC73829.1|  cytochrome P450 reductase                               187   3e-51   Panax ginseng [Asiatic ginseng]
ref|XP_006283224.1|  hypothetical protein CARUB_v10004254mg             187   6e-51   Capsella rubella
gb|AEW43314.1|  NADPH cytochrome P450 reductase                         186   7e-51   Picrorhiza kurrooa
emb|CDX72222.1|  BnaC07g42440D                                          186   8e-51   
ref|XP_010928663.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    186   1e-50   Elaeis guineensis
gb|ABB88839.2|  NADPH cytochrome P450 reductase                         185   2e-50   Stevia rebaudiana
gb|KHG21257.1|  NADPH--cytochrome P450 reductase                        185   2e-50   Gossypium arboreum [tree cotton]
gb|AHA50098.1|  CYP450 reductase                                        184   4e-50   Panax ginseng [Asiatic ginseng]
emb|CDX68634.1|  BnaC01g08190D                                          184   4e-50   
ref|XP_010433014.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    184   4e-50   Camelina sativa [gold-of-pleasure]
emb|CDY14183.1|  BnaA08g13140D                                          184   4e-50   Brassica napus [oilseed rape]
ref|XP_010438203.1|  PREDICTED: NADPH--cytochrome P450 reductase 2      184   5e-50   Camelina sativa [gold-of-pleasure]
gb|AIO11759.1|  cytochrome p450 reductase                               182   3e-49   Croton stellatopilosus
gb|KDP36395.1|  hypothetical protein JCGZ_08664                         182   3e-49   Jatropha curcas
ref|XP_010447751.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    181   4e-49   Camelina sativa [gold-of-pleasure]
ref|XP_010265447.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    181   6e-49   Nelumbo nucifera [Indian lotus]
ref|XP_004296434.1|  PREDICTED: NADPH--cytochrome P450 reductase 2      181   7e-49   Fragaria vesca subsp. vesca
ref|XP_010525727.1|  PREDICTED: NADPH--cytochrome P450 reductase 2      181   8e-49   Tarenaya hassleriana [spider flower]
emb|CDP02981.1|  unnamed protein product                                180   1e-48   Coffea canephora [robusta coffee]
gb|KFK29577.1|  nadph-ferrihemoprotein reductase                        180   1e-48   Arabis alpina [alpine rockcress]
ref|XP_009385909.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    179   2e-48   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008391625.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    178   5e-48   Malus domestica [apple tree]
ref|XP_008451695.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    178   5e-48   
ref|XP_011010331.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    178   5e-48   Populus euphratica
gb|AHB33950.1|  cytochrome P450 reductase                               178   6e-48   Santalum album
emb|CDY28169.1|  BnaA01g06800D                                          178   6e-48   Brassica napus [oilseed rape]
ref|XP_004168364.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    178   7e-48   
ref|XP_004148333.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    178   7e-48   Cucumis sativus [cucumbers]
gb|KCW80968.1|  hypothetical protein EUGRSUZ_C02330                     177   9e-48   Eucalyptus grandis [rose gum]
ref|XP_010048643.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    177   9e-48   Eucalyptus grandis [rose gum]
ref|XP_007154761.1|  hypothetical protein PHAVU_003G145400g             177   9e-48   Phaseolus vulgaris [French bean]
emb|CAQ37789.1|  NADPH:cytochrome P450 reductase                        177   1e-47   Plectranthus scutellarioides
gb|AGO03799.1|  cytochrome P450-like protein                            176   2e-47   Tanacetum cinerariifolium [pyrethrum]
gb|EYU20907.1|  hypothetical protein MIMGU_mgv1a002097mg                174   1e-46   Erythranthe guttata [common monkey flower]
ref|XP_008776011.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    172   1e-46   
ref|XP_006372087.1|  hypothetical protein POPTR_0018s09980g             171   2e-46   
ref|XP_009408053.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    174   2e-46   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003549436.1|  PREDICTED: NADPH--cytochrome P450 reductase        173   3e-46   Glycine max [soybeans]
ref|XP_011043963.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    173   4e-46   Populus euphratica
ref|XP_006372088.1|  hypothetical protein POPTR_0018s09980g             171   5e-46   
gb|AAC05022.1|  NADPH:ferrihemoprotein oxidoreductase                   172   1e-45   Eschscholzia californica
ref|XP_010913661.1|  PREDICTED: LOW QUALITY PROTEIN: NADPH--cytoc...    171   1e-45   Elaeis guineensis
gb|AAK15261.1|AF302498_1  NADPH-cytochrome P450 oxydoreductase is...    171   2e-45   Populus trichocarpa x Populus deltoides
ref|XP_002324469.1|  putative NADPH-cytochrome P450 reductase fam...    171   2e-45   Populus trichocarpa [western balsam poplar]
ref|XP_008383106.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    169   7e-45   Malus domestica [apple tree]
ref|XP_008383105.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    169   7e-45   Malus domestica [apple tree]
gb|AAB97736.1|  NADPH cytochrome P450 reductase                         169   1e-44   Petroselinum crispum
gb|AAS90127.1|  NADPH cytochrome P450 reductase                         169   1e-44   Ammi majus [ameo mayor]
ref|XP_008781895.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    169   1e-44   Phoenix dactylifera
gb|AIL29328.1|  cytochrome P450 reductase                               167   4e-44   Pinus contorta
ref|XP_009414761.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    167   4e-44   Musa acuminata subsp. malaccensis [pisang utan]
gb|EPS67504.1|  hypothetical protein M569_07270                         167   6e-44   Genlisea aurea
ref|XP_004507857.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    166   1e-43   
ref|XP_004507858.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    166   2e-43   Cicer arietinum [garbanzo]
ref|XP_010929254.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    165   2e-43   Elaeis guineensis
ref|XP_010526342.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    165   3e-43   Tarenaya hassleriana [spider flower]
gb|AAC09468.2|  putative NADPH-cytochrome P450 reductase                165   3e-43   Pisum sativum [garden pea]
ref|XP_009382841.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    163   9e-43   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAB97737.1|  NADPH cytochrome P450 reductase                         163   1e-42   Petroselinum crispum
emb|CBX24555.1|  NADPH:cytochrome P450 reductase                        161   4e-42   Salvia miltiorrhiza [Chinese salvia]
emb|CCO62220.1|  putative cytochrome P450 reductase                     161   7e-42   Actaea racemosa
gb|EPS66345.1|  hypothetical protein M569_08425                         160   1e-41   Genlisea aurea
ref|XP_003610109.1|  NADPH cytochrome P450 reductase                    160   1e-41   Medicago truncatula
ref|XP_003541616.1|  PREDICTED: NADPH--cytochrome P450 reductase        159   2e-41   Glycine max [soybeans]
ref|XP_006381796.1|  putative NADPH-cytochrome P450 reductase fam...    158   6e-41   Populus trichocarpa [western balsam poplar]
emb|CBI17838.3|  unnamed protein product                                157   2e-40   Vitis vinifera
emb|CAA89837.3|  NADPH-cytochrome P450 reductase                        156   3e-40   Pseudotsuga menziesii
gb|EAZ10065.1|  hypothetical protein OsI_32371                          155   1e-39   Oryza sativa Indica Group [Indian rice]
ref|XP_009384791.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    154   2e-39   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001063914.1|  Os09g0558900                                       154   4e-39   
ref|XP_010914150.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    153   4e-39   Elaeis guineensis
gb|KCW78708.1|  hypothetical protein EUGRSUZ_C00154                     152   6e-39   Eucalyptus grandis [rose gum]
gb|KCW78707.1|  hypothetical protein EUGRSUZ_C00154                     152   6e-39   Eucalyptus grandis [rose gum]
gb|EEE70211.1|  hypothetical protein OsJ_30318                          153   8e-39   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010046982.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    152   8e-39   Eucalyptus grandis [rose gum]
dbj|BAJ41269.1|  NADPH-P450 reductase 2                                 147   4e-37   Zingiber officinale [ginger]
gb|KDO81197.1|  hypothetical protein CISIN_1g005496mg                   146   8e-37   Citrus sinensis [apfelsine]
gb|KDO81198.1|  hypothetical protein CISIN_1g005496mg                   146   8e-37   Citrus sinensis [apfelsine]
gb|KDO81196.1|  hypothetical protein CISIN_1g005496mg                   146   9e-37   Citrus sinensis [apfelsine]
ref|XP_006472452.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    146   1e-36   Citrus sinensis [apfelsine]
gb|KDO81193.1|  hypothetical protein CISIN_1g005496mg                   146   1e-36   Citrus sinensis [apfelsine]
ref|XP_008338958.1|  PREDICTED: NADPH--cytochrome P450 reductase        146   1e-36   Malus domestica [apple tree]
ref|XP_008219252.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    146   1e-36   Prunus mume [ume]
ref|XP_007226979.1|  hypothetical protein PRUPE_ppa002280mg             146   1e-36   Prunus persica
ref|XP_009376208.1|  PREDICTED: NADPH--cytochrome P450 reductase        146   2e-36   Pyrus x bretschneideri [bai li]
ref|XP_008219251.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    145   3e-36   
ref|XP_006433816.1|  hypothetical protein CICLE_v10000469mg             145   3e-36   Citrus clementina [clementine]
ref|XP_010277516.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    140   9e-35   
gb|KHN17598.1|  NADPH--cytochrome P450 reductase                        141   9e-35   Glycine soja [wild soybean]
ref|XP_010277515.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    140   1e-34   Nelumbo nucifera [Indian lotus]
ref|XP_004299743.1|  PREDICTED: NADPH--cytochrome P450 reductase        140   2e-34   Fragaria vesca subsp. vesca
gb|KHN39959.1|  NADPH--cytochrome P450 reductase                        140   2e-34   Glycine soja [wild soybean]
ref|NP_001236742.1|  NADPH:P450 reductase                               140   3e-34   
gb|KHN22700.1|  NADPH--cytochrome P450 reductase                        140   3e-34   Glycine soja [wild soybean]
ref|XP_006845640.1|  hypothetical protein AMTR_s00019p00222550          140   3e-34   
ref|XP_003578634.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    139   4e-34   Brachypodium distachyon [annual false brome]
gb|AAS00459.1|  NADPH:cytochrome P450-reductase                         139   5e-34   Hypericum androsaemum
gb|AAT76449.1|  NADPH:cytochrome P450 reductase                         139   5e-34   Taxus cuspidata [ichii]
ref|XP_002514049.1|  cytochrome P450, putative                          139   6e-34   Ricinus communis
ref|XP_002265859.2|  PREDICTED: NADPH--cytochrome P450 reductase        138   9e-34   Vitis vinifera
gb|KJB58864.1|  hypothetical protein B456_009G229300                    137   1e-33   Gossypium raimondii
gb|KJB58865.1|  hypothetical protein B456_009G229300                    138   1e-33   Gossypium raimondii
pir||A47298  NADPH-ferrihemoprotein reductase (EC 1.6.2.4) - mung...    138   1e-33
emb|CDP11509.1|  unnamed protein product                                138   2e-33   Coffea canephora [robusta coffee]
gb|KJB58863.1|  hypothetical protein B456_009G229300                    138   2e-33   Gossypium raimondii
ref|XP_010530279.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    137   2e-33   Tarenaya hassleriana [spider flower]
gb|AAX59902.1|  cytochrome P450 reductase                               138   2e-33   Taxus wallichiana var. chinensis [Chinese yew]
ref|XP_007018237.1|  NADPH--cytochrome P450 reductase isoform 4         136   2e-33   
ref|XP_010520739.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    137   2e-33   Tarenaya hassleriana [spider flower]
gb|AAS92623.1|  NADPH:cytochrome P450-reductase                         137   2e-33   Centaurium erythraea
ref|XP_010692385.1|  PREDICTED: NADPH--cytochrome P450 reductase        137   3e-33   Beta vulgaris subsp. vulgaris [field beet]
gb|ACN54323.1|  NADPH:cytochrome P450 reductase                         137   4e-33   Gossypium hirsutum [American cotton]
ref|XP_007018234.1|  P450 reductase 1 isoform 1                         136   7e-33   
sp|P37116.1|NCPR_VIGRR  RecName: Full=NADPH--cytochrome P450 redu...    136   8e-33   Vigna radiata var. radiata [golden gram]
ref|XP_004501653.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    136   8e-33   
ref|XP_004501654.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    135   8e-33   Cicer arietinum [garbanzo]
ref|XP_010254555.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    135   8e-33   Nelumbo nucifera [Indian lotus]
ref|XP_007018236.1|  NADPH--cytochrome P450 reductase isoform 3         136   8e-33   
ref|XP_003602898.1|  NADPH cytochrome P450 reductase                    135   9e-33   Medicago truncatula
gb|ADI49691.1|  cytochrome P450 reductase                               135   9e-33   Withania somnifera [ashwagandha]
gb|KHG05124.1|  NADPH--cytochrome P450 reductase                        135   9e-33   Gossypium arboreum [tree cotton]
emb|CAA81211.1|  NADPH-ferrihemoprotein reductase                       135   1e-32   Vicia sativa [spring vetch]
ref|XP_007141274.1|  hypothetical protein PHAVU_008G182200g             135   2e-32   Phaseolus vulgaris [French bean]
ref|XP_007136327.1|  hypothetical protein PHAVU_009G036200g             135   2e-32   Phaseolus vulgaris [French bean]
ref|XP_004973052.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    135   2e-32   Setaria italica
ref|XP_003522768.1|  PREDICTED: NADPH--cytochrome P450 reductase        134   2e-32   Glycine max [soybeans]
ref|XP_010086660.1|  NADPH--cytochrome P450 reductase                   134   3e-32   Morus notabilis
gb|ACF17649.1|  putative cytochrome reductase                           134   3e-32   Capsicum annuum
ref|XP_004238001.1|  PREDICTED: NADPH--cytochrome P450 reductase        134   4e-32   Solanum lycopersicum
ref|XP_009786522.1|  PREDICTED: NADPH--cytochrome P450 reductase        134   5e-32   Nicotiana sylvestris
gb|AAZ39648.1|  cytochrome P450 NADPH-reductase                         133   8e-32   Petunia x hybrida [garden petunia]
ref|XP_006338052.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    132   1e-31   Solanum tuberosum [potatoes]
gb|AIG15451.1|  NADPH-cytochrome P450 reductase 1                       132   1e-31   Azadirachta indica [Indian-lilac]
gb|AHB33949.1|  cytochrome P450 reductase                               132   1e-31   Santalum album
ref|XP_003526551.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    132   2e-31   Glycine max [soybeans]
gb|KDP41487.1|  hypothetical protein JCGZ_15894                         131   3e-31   Jatropha curcas
ref|XP_009630023.1|  PREDICTED: NADPH--cytochrome P450 reductase        130   5e-31   Nicotiana tomentosiformis
gb|ACG27711.1|  NADPH--cytochrome P450 reductase                        131   5e-31   Zea mays [maize]
gb|ACF35281.1|  cytochrome P450 reductase-like protein                  130   5e-31   Nothapodytes nimmoniana
ref|NP_001146345.1|  uncharacterized protein LOC100279923               126   6e-31   
ref|XP_009138145.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    130   7e-31   Brassica rapa
dbj|BAC41516.1|  NADPH-cytochrome P-450 reductase                       130   7e-31   Ophiorrhiza pumila
emb|CDY34288.1|  BnaA01g13910D                                          130   7e-31   Brassica napus [oilseed rape]
emb|CDY03447.1|  BnaC01g16350D                                          129   1e-30   
gb|EYU36460.1|  hypothetical protein MIMGU_mgv1a002296mg                129   2e-30   Erythranthe guttata [common monkey flower]
ref|XP_008667834.1|  PREDICTED: uncharacterized protein LOC100279...    128   4e-30   
ref|XP_008667833.1|  PREDICTED: uncharacterized protein LOC100279...    128   4e-30   Zea mays [maize]
gb|KJB14708.1|  hypothetical protein B456_002G138900                    128   4e-30   Gossypium raimondii
ref|XP_003579401.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    128   5e-30   Brachypodium distachyon [annual false brome]
gb|KJB14707.1|  hypothetical protein B456_002G138900                    128   5e-30   Gossypium raimondii
ref|XP_006653834.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    127   7e-30   Oryza brachyantha
ref|XP_004960247.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    127   7e-30   Setaria italica
ref|XP_009130253.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    127   7e-30   Brassica rapa
ref|XP_004960246.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    127   9e-30   
ref|XP_008676669.1|  PREDICTED: uncharacterized protein LOC100216...    127   1e-29   
ref|XP_009138137.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    127   1e-29   Brassica rapa
ref|XP_009791726.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    126   2e-29   Nicotiana sylvestris
emb|CAE01547.2|  OSJNBb0022F16.2                                        126   2e-29   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006413419.1|  hypothetical protein EUTSA_v10024568mg             125   4e-29   Eutrema salsugineum [saltwater cress]
ref|XP_002307336.1|  NADPH-cytochrome P450 oxydoreductase isoform...    125   5e-29   
ref|XP_011016946.1|  PREDICTED: LOW QUALITY PROTEIN: NADPH--cytoc...    125   7e-29   Populus euphratica
emb|CDY34287.1|  BnaA01g13900D                                          124   9e-29   Brassica napus [oilseed rape]
ref|XP_002447240.1|  hypothetical protein SORBIDRAFT_06g031110          124   1e-28   Sorghum bicolor [broomcorn]
ref|XP_002867662.1|  hypothetical protein ARALYDRAFT_492391             124   1e-28   
ref|NP_001159331.1|  uncharacterized protein LOC100304425               124   2e-28   Zea mays [maize]
ref|XP_010448554.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    123   3e-28   Camelina sativa [gold-of-pleasure]
ref|XP_011015338.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    122   5e-28   Populus euphratica
ref|XP_006285937.1|  hypothetical protein CARUB_v10007449mg             122   6e-28   Capsella rubella
ref|XP_008653023.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    122   6e-28   Zea mays [maize]
ref|XP_010433757.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    122   7e-28   Camelina sativa [gold-of-pleasure]
ref|XP_004957625.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    122   8e-28   Setaria italica
ref|NP_194183.1|  NADPH--cytochrome P450 reductase 1                    122   8e-28   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009137450.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    121   9e-28   Brassica rapa
emb|CDY11017.1|  BnaA03g46760D                                          121   9e-28   Brassica napus [oilseed rape]
emb|CDY70343.1|  BnaCnng67910D                                          120   1e-27   Brassica napus [oilseed rape]
ref|XP_010439016.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    120   2e-27   Camelina sativa [gold-of-pleasure]
emb|CDX92639.1|  BnaC07g38970D                                          120   2e-27   
ref|XP_010234513.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    120   4e-27   Brachypodium distachyon [annual false brome]
ref|NP_001061346.1|  Os08g0243500                                       119   6e-27   
emb|CAA46814.1|  NADPH-ferrihemoprotein reductase                       118   1e-26   Arabidopsis thaliana [mouse-ear cress]
gb|AAC05021.1|  NADPH:ferrihemoprotein oxidoreductase                   117   4e-26   Papaver somniferum
dbj|BAJ41268.1|  NADPH-P450 reductase 1                                 116   7e-26   Zingiber officinale [ginger]
ref|XP_002960044.1|  hypothetical protein SELMODRAFT_401997             115   7e-26   
ref|NP_001190823.1|  NADPH--cytochrome P450 reductase 1                 116   7e-26   Arabidopsis thaliana [mouse-ear cress]
emb|CAC83301.1|  cytochrome P450 reductase                              112   1e-24   Triticum aestivum [Canadian hard winter wheat]
gb|ACG28940.1|  NADPH--cytochrome P450 reductase                        111   3e-24   Zea mays [maize]
ref|XP_002444097.1|  hypothetical protein SORBIDRAFT_07g007640          111   4e-24   Sorghum bicolor [broomcorn]
ref|XP_008661364.1|  PREDICTED: uncharacterized protein LOC100192...    110   5e-24   
gb|EMT14573.1|  NADPH--cytochrome P450 reductase                        110   6e-24   
ref|XP_002462826.1|  hypothetical protein SORBIDRAFT_02g032640          107   6e-23   Sorghum bicolor [broomcorn]
gb|EEE68301.1|  hypothetical protein OsJ_26563                          107   8e-23   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002984958.1|  hypothetical protein SELMODRAFT_181373             106   1e-22   
ref|XP_002986144.1|  hypothetical protein SELMODRAFT_157822             106   2e-22   
dbj|BAJ99370.1|  predicted protein                                      106   2e-22   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002978784.1|  hypothetical protein SELMODRAFT_152770             105   3e-22   
ref|XP_008337575.1|  PREDICTED: uncharacterized protein LOC103400688    104   3e-22   
ref|XP_001785882.1|  predicted protein                                  104   6e-22   
gb|AAG17471.1|AF123610_10  NADPH-cytochrome P450 reductase              104   7e-22   Triticum aestivum [Canadian hard winter wheat]
ref|XP_002984697.1|  hypothetical protein SELMODRAFT_234596             104   8e-22   
ref|XP_006661531.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    103   1e-21   
ref|XP_001779575.1|  predicted protein                                92.8    8e-18   
ref|XP_001758838.1|  predicted protein                                89.7    7e-17   
gb|EMS66177.1|  NADPH--cytochrome P450 reductase                      85.5    2e-15   Triticum urartu
gb|EEE61817.1|  hypothetical protein OsJ_16444                        85.1    2e-15   Oryza sativa Japonica Group [Japonica rice]
gb|EMT19472.1|  NADPH--cytochrome P450 reductase                      83.2    1e-14   
emb|CAA81209.1|  NADPH-ferrihemoprotein reductase                     82.8    1e-14   Helianthus tuberosus [Jerusalem artichoke]
gb|ADE76209.1|  unknown                                               75.5    1e-13   Picea sitchensis
ref|XP_001770150.1|  predicted protein                                79.7    2e-13   
ref|XP_009114362.1|  PREDICTED: uncharacterized protein LOC103839613  73.2    9e-13   Brassica rapa
ref|XP_005645698.1|  NADPH-cytochrome P450 reductase                  76.3    2e-12   Coccomyxa subellipsoidea C-169
gb|EMS53484.1|  NADPH--cytochrome P450 reductase                      72.0    4e-11   Triticum urartu
gb|KIZ02441.1|  NADPH-cytochrome P450 reductase                       71.6    6e-11   Monoraphidium neglectum
dbj|BAD05443.1|  putative cytochrome P450 reductase                   71.6    6e-11   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006659239.1|  PREDICTED: NADPH--cytochrome P450 reductase-...  71.6    6e-11   
emb|CDX85685.1|  BnaA02g01280D                                        70.9    1e-10   
gb|EAZ06154.1|  hypothetical protein OsI_28390                        68.6    3e-10   
ref|XP_009900576.1|  PREDICTED: LOW QUALITY PROTEIN: NADPH--cytoc...  69.3    4e-10   
gb|KIY99765.1|  hypothetical protein MNEG_8195                        67.8    1e-09   
gb|EWM29292.1|  nadph--cytochrome p450 reductase                      67.0    2e-09   
gb|ERE75946.1|  NADPH--cytochrome P450 reductase                      66.6    3e-09   
ref|XP_006386427.1|  hypothetical protein POPTR_0002s10680g           66.2    3e-09   
ref|XP_009493300.1|  hypothetical protein H696_01144                  66.2    4e-09   
ref|XP_009022160.1|  hypothetical protein HELRODRAFT_113572           66.2    4e-09   
emb|CCJ28834.1|  unnamed protein product                              66.2    4e-09   
ref|XP_011399053.1|  NADPH-cytochrome P450 reductase                  65.9    5e-09   
sp|Q9HDG2.1|NCPR_PHACH  RecName: Full=NADPH--cytochrome P450 redu...  65.9    5e-09   
ref|XP_011481096.1|  PREDICTED: NADPH--cytochrome P450 reductase ...  65.5    6e-09   
gb|KIJ59467.1|  hypothetical protein HYDPIDRAFT_118445                65.5    7e-09   
gb|EHK22188.1|  hypothetical protein TRIVIDRAFT_71556                 65.1    8e-09   
ref|XP_007564214.1|  PREDICTED: NADPH--cytochrome P450 reductase ...  65.1    8e-09   
ref|XP_008423675.1|  PREDICTED: NADPH--cytochrome P450 reductase ...  65.1    9e-09   
ref|XP_002953937.1|  hypothetical protein VOLCADRAFT_76078            65.1    1e-08   
ref|XP_005846436.1|  hypothetical protein CHLNCDRAFT_36035            64.7    1e-08   
ref|XP_007258471.1|  PREDICTED: NADPH--cytochrome P450 reductase-...  64.7    1e-08   
gb|KIL67916.1|  hypothetical protein M378DRAFT_177150                 64.7    1e-08   
ref|XP_005173404.1|  PREDICTED: zgc:63480 isoform X2                  64.3    2e-08   
ref|XP_005746975.1|  PREDICTED: NADPH--cytochrome P450 reductase-...  64.3    2e-08   
emb|CCD17239.1|  unnamed protein product                              63.5    2e-08   
gb|KDN51453.1|  hypothetical protein K437DRAFT_272947                 63.9    2e-08   
gb|KHN94212.1|  cytochrome P450 oxidoreductase                        63.9    2e-08   
ref|XP_005746976.1|  PREDICTED: NADPH--cytochrome P450 reductase-...  63.9    2e-08   
ref|XP_964443.1|  NADPH-cytochrome P450 reductase                     63.9    2e-08   
ref|XP_003449358.1|  PREDICTED: NADPH--cytochrome P450 reductase-...  63.9    2e-08   
emb|CCC11787.1|  unnamed protein product                              63.9    2e-08   
ref|XP_003346596.1|  hypothetical protein SMAC_04769                  63.9    2e-08   
ref|XP_009849280.1|  NADPH-cytochrome P450 reductase                  63.9    2e-08   
ref|XP_007564212.1|  PREDICTED: NADPH--cytochrome P450 reductase ...  63.9    2e-08   
emb|CEF96794.1|  Flavoprotein pyridine nucleotide cytochrome redu...  63.9    2e-08   
ref|XP_005933201.1|  PREDICTED: NADPH--cytochrome P450 reductase-...  63.5    3e-08   
gb|EKC98772.1|  NADPH--cytochrome reductase                           63.5    3e-08   
ref|XP_005454398.1|  PREDICTED: NADPH--cytochrome P450 reductase-...  63.5    3e-08   
ref|XP_007768671.1|  cytochrome P450 oxidoreductase                   63.5    3e-08   
gb|KEZ42169.1|  hypothetical protein SAPIO_CDS6229                    63.5    3e-08   
ref|XP_007807687.1|  cytochrome P450 oxidoreductase                   63.5    3e-08   
gb|EMT67929.1|  NADPH--cytochrome P450 reductase                      63.5    3e-08   
gb|EXL90686.1|  NADPH-ferrihemoprotein reductase                      63.5    3e-08   
gb|EXM20238.1|  NADPH-ferrihemoprotein reductase                      63.5    3e-08   
gb|EGU74887.1|  hypothetical protein FOXB_14597                       63.2    4e-08   
gb|EXK46194.1|  NADPH-ferrihemoprotein reductase                      63.2    4e-08   
ref|XP_001826472.1|  NADPH cytochrome P450                            63.2    4e-08   
gb|EXA32845.1|  NADPH-ferrihemoprotein reductase                      63.2    4e-08   
ref|NP_956120.2|  P450 (cytochrome) oxidoreductase b                  62.0    4e-08   
gb|EXK96612.1|  NADPH-ferrihemoprotein reductase                      63.2    4e-08   
emb|CBY19306.1|  unnamed protein product                              62.4    4e-08   
ref|XP_006693773.1|  NADPH-cytochrome P450 reductase-like protein     63.2    4e-08   
gb|EWZ93900.1|  NADPH-ferrihemoprotein reductase                      63.2    4e-08   
ref|XP_005465079.1|  PREDICTED: tRNA wybutosine-synthesizing prot...  63.2    5e-08   
gb|ENH85424.1|  nadph-cytochrome p450 reductase                       62.8    5e-08   
gb|EJT52232.1|  NADPH--cytochrome reductase                           62.8    5e-08   
ref|XP_005465078.1|  PREDICTED: tRNA wybutosine-synthesizing prot...  62.8    5e-08   
gb|EWZ48832.1|  NADPH-ferrihemoprotein reductase                      62.8    5e-08   
ref|XP_001910174.1|  hypothetical protein                             62.8    5e-08   
ref|XP_003715306.1|  NADPH-cytochrome P450 reductase, variant         62.8    5e-08   
ref|XP_007409251.1|  hypothetical protein MELLADRAFT_77606            62.8    6e-08   
ref|XP_008280827.1|  PREDICTED: NADPH--cytochrome P450 reductase ...  62.4    6e-08   
emb|CAA81550.1|  NADPH cytochrome P450 oxidoreductase                 62.4    7e-08   
ref|XP_008308056.1|  PREDICTED: NADPH--cytochrome P450 reductase ...  62.4    7e-08   
ref|XP_002923514.2|  PREDICTED: NADPH--cytochrome P450 reductase ...  62.4    7e-08   
ref|XP_010869620.1|  PREDICTED: NADPH--cytochrome P450 reductase ...  62.4    7e-08   
gb|EWZ02750.1|  NADPH-ferrihemoprotein reductase                      62.4    7e-08   
ref|XP_010869629.1|  PREDICTED: NADPH--cytochrome P450 reductase ...  62.4    7e-08   
ref|XP_008037880.1|  cytochrome P450 oxidoreductase                   62.4    7e-08   
ref|XP_001392901.1|  NADPH--cytochrome P450 reductase                 62.4    7e-08   
dbj|BAB83588.1|  Cytochrome P450 oxidoreductase                       62.4    7e-08   
gb|AAG31351.1|AF193062_1  NADPH-dependent cytochrome P450 oxidore...  62.4    7e-08   
ref|XP_005803425.1|  PREDICTED: NADPH--cytochrome P450 reductase-...  62.4    7e-08   
ref|XP_007791948.1|  putative nadph-cytochrome p450 reductase pro...  62.4    8e-08   
sp|Q00141.2|NCPR_ASPNG  RecName: Full=NADPH--cytochrome P450 redu...  62.4    8e-08   
gb|KIK78742.1|  hypothetical protein PAXRUDRAFT_834465                62.4    8e-08   
ref|XP_010891863.1|  PREDICTED: NADPH--cytochrome P450 reductase ...  62.0    8e-08   
gb|AAG23833.1|AF290425_1  NADPH cytochrome P450 oxidoreductase is...  62.0    8e-08   
emb|CDM31424.1|  NADPH--cytochrome P450 reductase                     62.0    8e-08   
gb|KHC68125.1|  NADPH-cytochrome P450 reductase                       62.0    8e-08   
gb|KFZ17258.1|  hypothetical protein V502_04653                       62.0    9e-08   
gb|EKV15852.1|  NADPH--cytochrome P450 reductase                      62.0    9e-08   
emb|CBQ72454.1|  probable NADPH-cytochrome P450 reductase             62.0    9e-08   
gb|AAF89958.1|AF195659_1  NADPH-dependent cytochrome P450 oxidore...  62.0    9e-08   
ref|XP_005173403.1|  PREDICTED: zgc:63480 isoform X1                  62.0    1e-07   
gb|ELR09795.1|  NADPH-ferrihemoprotein reductase                      62.0    1e-07   
gb|KFY87865.1|  hypothetical protein V500_06715                       62.0    1e-07   
gb|KIP05352.1|  hypothetical protein PHLGIDRAFT_128913                62.0    1e-07   
gb|KGO76390.1|  NADPH-cytochrome p450 reductase, FAD-binding, alp...  62.0    1e-07   
ref|XP_008980062.1|  PREDICTED: NADPH--cytochrome P450 reductase      62.0    1e-07   
gb|KFZ10954.1|  hypothetical protein V501_04969                       62.0    1e-07   
ref|XP_006962366.1|  NADPH cytochrome P450 oxidoreductase             61.6    1e-07   
ref|XP_011369842.1|  PREDICTED: NADPH--cytochrome P450 reductase      61.6    1e-07   
dbj|GAN10969.1|  NADPh-cytochrome p450 reductase protein              61.6    1e-07   
gb|KGO39386.1|  Oxidoreductase FAD/NAD(P)-binding                     61.6    1e-07   
gb|KFY70284.1|  hypothetical protein V499_09298                       61.6    1e-07   
ref|XP_002150062.1|  NADPH cytochrome P450 reductase (CprA), puta...  61.6    1e-07   
ref|XP_646400.1|  NADPH-cytochrome-P450 oxidoreductase                61.6    1e-07   
ref|XP_001690130.1|  NADPH-cytochrome P450 reductase                  61.6    1e-07   
ref|XP_007916278.1|  putative nadph-cytochrome p450 reductase pro...  61.6    1e-07   
ref|XP_006918626.1|  PREDICTED: NADPH--cytochrome P450 reductase      61.6    1e-07   
emb|CCM01900.1|  predicted protein                                    61.6    1e-07   
gb|KFY55382.1|  hypothetical protein V496_07019                       61.6    1e-07   
ref|XP_006799993.1|  PREDICTED: NADPH--cytochrome P450 reductase-...  61.6    1e-07   
gb|KIJ07743.1|  hypothetical protein PAXINDRAFT_89908                 61.6    1e-07   
gb|EXA44105.1|  hypothetical protein FOVG_05609                       61.6    1e-07   
gb|KFM58328.1|  NADPH--cytochrome P450 reductase                      61.2    1e-07   
ref|XP_010735715.1|  PREDICTED: NADPH--cytochrome P450 reductase      61.6    1e-07   
gb|KFY85961.1|  hypothetical protein V498_07622                       61.6    1e-07   
ref|XP_010764173.1|  PREDICTED: NADPH--cytochrome P450 reductase ...  61.6    1e-07   
gb|KFY19361.1|  hypothetical protein V493_07994                       61.6    1e-07   
gb|EGU73783.1|  hypothetical protein FOXB_15691                       61.6    1e-07   
ref|XP_008423671.1|  PREDICTED: NADPH--cytochrome P450 reductase ...  61.6    1e-07   
ref|XP_008423672.1|  PREDICTED: NADPH--cytochrome P450 reductase ...  61.6    1e-07   
ref|XP_008280826.1|  PREDICTED: NADPH--cytochrome P450 reductase ...  61.6    1e-07   
gb|KIM98461.1|  hypothetical protein OIDMADRAFT_128641                61.2    1e-07   
gb|EXL70772.1|  hypothetical protein FOPG_13457                       61.2    2e-07   
ref|XP_009252252.1|  hypothetical protein FPSE_00857                  61.2    2e-07   
gb|EPS33038.1|  hypothetical protein PDE_07999                        61.2    2e-07   
ref|XP_011327904.1|  NADPH-cytochrome P450 reductase                  61.2    2e-07   
gb|EPX70486.1|  NADPH-cytochrome p450 reductase                       61.2    2e-07   
ref|XP_003770264.1|  PREDICTED: NADPH--cytochrome P450 reductase      61.2    2e-07   
gb|EFX85471.1|  hypothetical protein DAPPUDRAFT_300447                61.2    2e-07   
emb|CCF32060.1|  NADPH-cytochrome P450 reductase                      61.2    2e-07   
ref|NP_001231204.1|  NADPH--cytochrome P450 reductase                 61.2    2e-07   
ref|XP_007074057.1|  PREDICTED: NADPH--cytochrome P450 reductase      61.2    2e-07   
gb|EGW01833.1|  NADPH--cytochrome P450 reductase                      61.2    2e-07   
gb|KFV05180.1|  NADPH--cytochrome P450 reductase                      61.2    2e-07   
gb|KEY74237.1|  hypothetical protein S7711_00395                      61.2    2e-07   
gb|KFY18485.1|  hypothetical protein V491_04772                       61.2    2e-07   
ref|XP_009984473.1|  PREDICTED: NADPH--cytochrome P450 reductase      61.2    2e-07   
ref|XP_003034351.1|  hypothetical protein SCHCODRAFT_75223            61.2    2e-07   
gb|KFA72831.1|  hypothetical protein S40288_08553                     61.2    2e-07   
gb|ENH65598.1|  NADPH--cytochrome P450 reductase                      61.2    2e-07   
gb|EGU84801.1|  hypothetical protein FOXB_04696                       61.2    2e-07   
gb|EIE89541.1|  hypothetical protein RO3G_14252                       61.2    2e-07   
gb|EWG45709.1|  NADPH-cytochrome P450 reductase                       61.2    2e-07   
gb|KIL92537.1|  nadph-cytochrome p450 reductase                       61.2    2e-07   
gb|KFA61935.1|  hypothetical protein S40285_02840                     61.2    2e-07   
ref|XP_008120878.1|  PREDICTED: NADPH--cytochrome P450 reductase      61.2    2e-07   
gb|EWG42643.1|  NADPH-ferrihemoprotein reductase                      61.2    2e-07   
emb|CAE09055.1|  cytochrome P450 oxidoreductase                       61.2    2e-07   
ref|XP_007399288.1|  hypothetical protein PHACADRAFT_127059           61.2    2e-07   
gb|KIV99574.1|  NADPH-cytochrome P450 reductase                       61.2    2e-07   
gb|KDN70201.1|  putative FAD binding domain-containing protein        61.2    2e-07   
dbj|BAM71038.1|  NADPH-cytochrome P450 reductase                      61.2    2e-07   
gb|EMT60357.1|  NADPH--cytochrome P450 reductase                      61.2    2e-07   
gb|ELT87080.1|  hypothetical protein CAPTEDRAFT_173459                61.2    2e-07   
gb|EXL95837.1|  NADPH-cytochrome P450 reductase                       60.8    2e-07   
ref|XP_007639857.1|  PREDICTED: LOW QUALITY PROTEIN: NADPH--cytoc...  60.8    2e-07   
emb|CDQ69252.1|  unnamed protein product                              60.8    2e-07   
ref|XP_004350080.1|  NADPH-cytochrome-P450 oxidoreductase             60.8    2e-07   
emb|CCT64101.1|  probable NCP1-NADPH-cytochrome P450 reductase        60.8    2e-07   
ref|XP_008088456.1|  Riboflavin synthase                              61.2    2e-07   
ref|XP_003653169.1|  hypothetical protein THITE_2115296               60.8    2e-07   
ref|XP_004385994.1|  PREDICTED: NADPH--cytochrome P450 reductase      60.8    2e-07   
gb|EXL87323.1|  NADPH-cytochrome P450 reductase                       60.8    2e-07   
gb|EWZ41852.1|  NADPH-cytochrome P450 reductase                       60.8    2e-07   
emb|CDQ74009.1|  unnamed protein product                              60.8    2e-07   
emb|CCT69332.1|  probable NCP1-NADPH-cytochrome P450 reductase        60.8    2e-07   
ref|XP_007622429.1|  PREDICTED: LOW QUALITY PROTEIN: NADPH--cytoc...  60.8    2e-07   
ref|XP_007781691.1|  hypothetical protein W97_05471                   60.8    2e-07   
gb|EXM25379.1|  NADPH-cytochrome P450 reductase                       60.8    2e-07   
gb|EXL87329.1|  NADPH-cytochrome P450 reductase                       60.8    2e-07   
gb|KIL89341.1|  cytochrome p450 oxidoreductase                        60.8    2e-07   
gb|EPB87224.1|  hypothetical protein HMPREF1544_05946                 60.8    2e-07   
gb|EWY96328.1|  NADPH-cytochrome P450 reductase                       60.8    2e-07   
gb|EST07036.1|  NADPH--cytochrome P450 reductase                      60.8    2e-07   
ref|XP_004075861.1|  PREDICTED: NADPH--cytochrome P450 reductase ...  60.8    2e-07   
emb|CEP08857.1|  hypothetical protein                                 60.8    2e-07   
gb|KFV61779.1|  NADPH--cytochrome P450 reductase                      60.8    2e-07   
gb|EMF09667.1|  NADPH cytochrome P450 oxidoreductase                  60.8    3e-07   
gb|KDO81194.1|  hypothetical protein CISIN_1g005496mg                 60.5    3e-07   
ref|XP_001951585.2|  PREDICTED: NADPH--cytochrome P450 reductase-...  58.5    3e-07   
ref|XP_002484207.1|  NADPH cytochrome P450 reductase (CprA), puta...  60.8    3e-07   
ref|XP_010617284.1|  PREDICTED: NADPH--cytochrome P450 reductase ...  60.5    3e-07   
ref|XP_001258221.1|  NADPH cytochrome P450 reductase (CprA), puta...  60.5    3e-07   
gb|EKC21191.1|  NADPH--cytochrome P450 reductase                      60.8    3e-07   
ref|XP_007874791.1|  hypothetical protein PNEG_02760                  60.5    3e-07   
gb|EMD39998.1|  cytochrome P450 oxidoreductase                        60.5    3e-07   
gb|EQB57087.1|  hypothetical protein CGLO_02825                       60.5    3e-07   
ref|XP_005988651.1|  PREDICTED: NADPH--cytochrome P450 reductase ...  60.5    3e-07   
emb|CCD52118.1|  hypothetical protein BofuT4_P082770.1                60.5    3e-07   
emb|CDO76091.1|  hypothetical protein BN946_scf184649.g17             60.5    3e-07   
ref|XP_008164419.1|  PREDICTED: NADPH--cytochrome P450 reductase ...  60.5    3e-07   
ref|XP_007590680.1|  NADPH-cytochrome P450 reductase                  60.5    3e-07   
gb|KEY75941.1|  NADPH cytochrome P450 reductase CprA                  60.5    3e-07   
ref|XP_007278117.1|  cytochrome p450 oxidoreductase                   60.5    3e-07   
gb|KFO35483.1|  NADPH--cytochrome P450 reductase                      60.5    3e-07   
ref|XP_007515695.1|  predicted protein                                60.5    3e-07   
ref|XP_750985.1|  NADPH cytochrome P450 reductase (CprA)              60.5    3e-07   
dbj|GAA86370.1|  NADPH-cytochrome P450 reductase                      60.5    3e-07   
ref|XP_010617285.1|  PREDICTED: NADPH--cytochrome P450 reductase ...  60.5    3e-07   
ref|XP_001558194.1|  hypothetical protein BC1G_03226                  60.5    3e-07   
emb|CEJ87026.1|  Putative NADPH--cytochrome P450 reductase            60.5    3e-07   
gb|ENH71776.1|  NADPH--cytochrome P450 reductase                      60.5    3e-07   
gb|EWZ36539.1|  hypothetical protein FOZG_10533                       60.5    3e-07   
gb|EFQ30590.1|  FAD binding domain-containing protein                 60.5    3e-07   
ref|XP_007874792.1|  hypothetical protein, variant                    60.5    3e-07   
gb|EHB08276.1|  NADPH--cytochrome P450 reductase                      60.5    3e-07   
gb|EHL01570.1|  putative NADPH--cytochrome reductase                  60.5    3e-07   
ref|XP_004892914.1|  PREDICTED: NADPH--cytochrome P450 reductase-...  60.5    4e-07   
ref|XP_005328569.1|  PREDICTED: NADPH--cytochrome P450 reductase ...  60.1    4e-07   
gb|ACN10454.1|  NADPH--cytochrome P450 reductase                      60.1    4e-07   
ref|XP_003046613.1|  predicted protein                                60.1    4e-07   
ref|XP_004630501.1|  PREDICTED: NADPH--cytochrome P450 reductase      60.1    4e-07   
dbj|GAC94958.1|  NADPH--cytochrome P450 reductase                     60.1    4e-07   
gb|KIM65748.1|  hypothetical protein SCLCIDRAFT_112091                60.1    4e-07   
ref|XP_001544042.1|  NADPH--cytochrome P450 reductase                 60.1    4e-07   
ref|XP_007938439.1|  PREDICTED: NADPH--cytochrome P450 reductase      60.1    4e-07   
ref|XP_007330029.1|  hypothetical protein AGABI1DRAFT_113910          60.1    4e-07   
ref|XP_001731494.1|  hypothetical protein MGL_1677                    60.1    4e-07   
ref|XP_001214242.1|  NADPH--cytochrome P450 reductase                 60.1    4e-07   
ref|XP_004892915.1|  PREDICTED: NADPH--cytochrome P450 reductase-...  60.1    4e-07   
gb|EER38563.1|  NADPH cytochrome P450 oxidoreductase                  60.1    4e-07   
ref|XP_003740943.1|  PREDICTED: NADPH--cytochrome P450 reductase-...  60.1    4e-07   
ref|XP_010342955.1|  PREDICTED: NADPH--cytochrome P450 reductase ...  60.1    4e-07   
ref|XP_004892916.1|  PREDICTED: NADPH--cytochrome P450 reductase-...  60.1    4e-07   
ref|XP_006462636.1|  hypothetical protein AGABI2DRAFT_193746          60.1    4e-07   
gb|EEH06895.1|  NADPH cytochrome P450 oxidoreductase                  60.1    4e-07   
ref|XP_010342959.1|  PREDICTED: NADPH--cytochrome P450 reductase ...  60.1    4e-07   
ref|XP_004399140.1|  PREDICTED: NADPH--cytochrome P450 reductase      60.1    4e-07   



>gb|ABM88789.1| cytochrome P450 reductase [Artemisia annua]
Length=704

 Score =   227 bits (579),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 135/188 (72%), Positives = 156/188 (83%), Gaps = 1/188 (1%)
 Frame = +2

Query  134  TSEKLSPFDFMAAIFKGGRIFDQSNASSESASPVAMLMDNKELMAMLTTSVAVLIGCVFV  313
            TS KLSPFD M A+  G   FD SN +S+S  P+A+ M+N+EL+ +LTTSVAVLIGCV V
Sbjct  5    TSVKLSPFDLMTALLNGKVSFDTSN-TSDSNIPLAVFMENRELLMILTTSVAVLIGCVVV  63

Query  314  LVWRRASSSAKKAVEPPNPEVPKAAEEETGEDGRKKITIFFGTQTGTAEGFAKALAEEAK  493
            LVWRR+SS+AKKA E P   VPK   E+  +DGRKK+T+FFGTQTGTAEGFAKAL EEAK
Sbjct  64   LVWRRSSSAAKKAAESPVIVVPKKVTEDEVDDGRKKVTVFFGTQTGTAEGFAKALVEEAK  123

Query  494  ARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFLATYGDGEPTDNAARFYKWFSEGK  673
            ARYEKA  KV+DLDDYA +DDEYEEKLKKESL FFFLATYGDGEPTDNAARFYKWF+EG+
Sbjct  124  ARYEKAVFKVIDLDDYAAEDDEYEEKLKKESLAFFFLATYGDGEPTDNAARFYKWFTEGE  183

Query  674  ERGVWLKR  697
            E+G WL +
Sbjct  184  EKGEWLDK  191



>gb|ABL09938.1| cytochrome P450 reductase [Artemisia annua]
Length=704

 Score =   226 bits (577),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 134/188 (71%), Positives = 157/188 (84%), Gaps = 1/188 (1%)
 Frame = +2

Query  134  TSEKLSPFDFMAAIFKGGRIFDQSNASSESASPVAMLMDNKELMAMLTTSVAVLIGCVFV  313
            TS KLSPFD M A+  G   FD SN +S++  P+A+ M+N+EL+ +LTTSVAVLIGCV V
Sbjct  5    TSVKLSPFDLMTALLNGKVSFDTSN-TSDTNIPLAVFMENRELLMILTTSVAVLIGCVVV  63

Query  314  LVWRRASSSAKKAVEPPNPEVPKAAEEETGEDGRKKITIFFGTQTGTAEGFAKALAEEAK  493
            LVWRR+SS+AKKA E P   VPK   E+  +DGRKK+T+FFGTQTGTAEGFAKAL EEAK
Sbjct  64   LVWRRSSSAAKKAAESPVIVVPKKVTEDEVDDGRKKVTVFFGTQTGTAEGFAKALVEEAK  123

Query  494  ARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFLATYGDGEPTDNAARFYKWFSEGK  673
            ARYEKA  KV+DLDDYA +DDEYEEKLKKESL FFFLATYGDGEPTDNAARFYKWF+EG+
Sbjct  124  ARYEKAVFKVIDLDDYAAEDDEYEEKLKKESLAFFFLATYGDGEPTDNAARFYKWFTEGE  183

Query  674  ERGVWLKR  697
            E+G WL++
Sbjct  184  EKGEWLEK  191



>gb|ABC47946.1| cytochrome P450 reductase [Artemisia annua]
 gb|AEQ63685.1| cytochrome P450 reductase [synthetic construct]
Length=704

 Score =   226 bits (576),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 134/188 (71%), Positives = 156/188 (83%), Gaps = 1/188 (1%)
 Frame = +2

Query  134  TSEKLSPFDFMAAIFKGGRIFDQSNASSESASPVAMLMDNKELMAMLTTSVAVLIGCVFV  313
            TS KLSPFD M A+  G   FD SN +S++  P+A+ M+N+EL+ +LTTSVAVLIGCV V
Sbjct  5    TSVKLSPFDLMTALLNGKVSFDTSN-TSDTNIPLAVFMENRELLMILTTSVAVLIGCVVV  63

Query  314  LVWRRASSSAKKAVEPPNPEVPKAAEEETGEDGRKKITIFFGTQTGTAEGFAKALAEEAK  493
            LVWRR+SS+AKKA E P   VPK   E+  +DGRKK+T+FFGTQTGTAEGFAKAL EEAK
Sbjct  64   LVWRRSSSAAKKAAESPVIVVPKKVTEDEVDDGRKKVTVFFGTQTGTAEGFAKALVEEAK  123

Query  494  ARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFLATYGDGEPTDNAARFYKWFSEGK  673
            ARYEKA  KV+DLDDYA +DDEYEEKLKKESL FFFLATYGDGEPTDNAARFYKWF+EG+
Sbjct  124  ARYEKAVFKVIDLDDYAAEDDEYEEKLKKESLAFFFLATYGDGEPTDNAARFYKWFTEGE  183

Query  674  ERGVWLKR  697
            E+G WL +
Sbjct  184  EKGEWLDK  191



>gb|ABI98819.1| cytochrome P450 reductase [Artemisia annua]
Length=704

 Score =   226 bits (575),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 134/188 (71%), Positives = 156/188 (83%), Gaps = 1/188 (1%)
 Frame = +2

Query  134  TSEKLSPFDFMAAIFKGGRIFDQSNASSESASPVAMLMDNKELMAMLTTSVAVLIGCVFV  313
            TS KLSPFD M A+  G   FD SN +S++  P+A+ M+N+EL+ +LTTSVAVLIGCV V
Sbjct  5    TSVKLSPFDLMTALLNGKVSFDTSN-TSDTNIPLAVFMENRELLMILTTSVAVLIGCVVV  63

Query  314  LVWRRASSSAKKAVEPPNPEVPKAAEEETGEDGRKKITIFFGTQTGTAEGFAKALAEEAK  493
            LVWRR+SS+AKKA E P   VPK   E+  +DGRKK+T+FFGTQTGTAEGFAKAL EEAK
Sbjct  64   LVWRRSSSAAKKAAESPVIVVPKKVTEDEVDDGRKKVTVFFGTQTGTAEGFAKALVEEAK  123

Query  494  ARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFLATYGDGEPTDNAARFYKWFSEGK  673
            ARYEKA  KV+DLDDYA +DDEYEEKLKKESL FFFLATYGDGEPTDNAARFYKWF+EG+
Sbjct  124  ARYEKAVFKVIDLDDYAAEDDEYEEKLKKESLAFFFLATYGDGEPTDNAARFYKWFTEGE  183

Query  674  ERGVWLKR  697
            E+G WL +
Sbjct  184  EKGEWLDK  191



>gb|AFO64618.1| cytochrome P450 reductase [Artemisia annua]
Length=704

 Score =   225 bits (574),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 133/188 (71%), Positives = 157/188 (84%), Gaps = 1/188 (1%)
 Frame = +2

Query  134  TSEKLSPFDFMAAIFKGGRIFDQSNASSESASPVAMLMDNKELMAMLTTSVAVLIGCVFV  313
            TS KLSPFD M A+  G   FD SN +S++  P+A+ M+N+EL+ +LTTSVAVLIGCV V
Sbjct  5    TSVKLSPFDLMTALLNGKVSFDTSN-TSDTNIPLAVFMENRELLMILTTSVAVLIGCVVV  63

Query  314  LVWRRASSSAKKAVEPPNPEVPKAAEEETGEDGRKKITIFFGTQTGTAEGFAKALAEEAK  493
            LVWRR+SS+AK+A E P   VPK   E+  +DGRKK+T+FFGTQTGTAEGFAKAL EEAK
Sbjct  64   LVWRRSSSAAKRAAESPVIVVPKKVTEDEVDDGRKKVTVFFGTQTGTAEGFAKALVEEAK  123

Query  494  ARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFLATYGDGEPTDNAARFYKWFSEGK  673
            ARYEKA  KV+DLDDYA +DDEYEEKLKKESL FFFLATYGDGEPTDNAARFYKWF+EG+
Sbjct  124  ARYEKAVFKVIDLDDYAAEDDEYEEKLKKESLAFFFLATYGDGEPTDNAARFYKWFTEGE  183

Query  674  ERGVWLKR  697
            E+G WL++
Sbjct  184  EKGEWLEK  191



>ref|XP_009795589.1| PREDICTED: NADPH--cytochrome P450 reductase [Nicotiana sylvestris]
Length=713

 Score =   223 bits (567),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 148/197 (75%), Positives = 168/197 (85%), Gaps = 7/197 (4%)
 Frame = +2

Query  125  MEPTSEKLSPFDFMAAIFKGGRIFDQSNASSES------ASPVAMLMDNKELMAMLTTSV  286
            M+ TSEKLSPFDFMAAIFKGG+IFDQ N+SS+S      AS  A+LM+NK+LM MLTTSV
Sbjct  1    MDSTSEKLSPFDFMAAIFKGGKIFDQLNSSSDSGDSSSPASLAALLMENKDLMMMLTTSV  60

Query  287  AVLIGCVFVLVWRRASSSAKKAVEPPNPEVPKAA-EEETGEDGRKKITIFFGTQTGTAEG  463
            AVLIGC  VL+WRR+S+SAKK VEPP   VPK+  E E  +DG+KK+TIFFGTQTGTAEG
Sbjct  61   AVLIGCAVVLMWRRSSTSAKKVVEPPKLVVPKSVIEPEEIDDGKKKVTIFFGTQTGTAEG  120

Query  464  FAKALAEEAKARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFLATYGDGEPTDNAA  643
            FAKALAEEAKARY+KA  KV+D+DDYA DDD+YEEKLKKE+L FFFLATYGDGEPTDNAA
Sbjct  121  FAKALAEEAKARYDKATFKVIDMDDYAADDDDYEEKLKKETLAFFFLATYGDGEPTDNAA  180

Query  644  RFYKWFSEGKERGVWLK  694
            RFYKWF EGKERG + K
Sbjct  181  RFYKWFVEGKERGDYFK  197



>ref|XP_009607226.1| PREDICTED: NADPH--cytochrome P450 reductase [Nicotiana tomentosiformis]
Length=713

 Score =   222 bits (566),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 148/197 (75%), Positives = 169/197 (86%), Gaps = 7/197 (4%)
 Frame = +2

Query  125  MEPTSEKLSPFDFMAAIFKGGRIFDQSNASSES------ASPVAMLMDNKELMAMLTTSV  286
            ME TSEKLSPFDFMAAIFKGG+IFDQ N+SS+S      AS  A+LM+NK+LM +LTTSV
Sbjct  1    MESTSEKLSPFDFMAAIFKGGKIFDQLNSSSDSGDSSSPASLAALLMENKDLMMILTTSV  60

Query  287  AVLIGCVFVLVWRRASSSAKKAVEPPNPEVPKAA-EEETGEDGRKKITIFFGTQTGTAEG  463
            AVLIGC  VL+WRR+S+SAKK VEPP   VPK+  E E  +DG+KK+TIFFGTQTGTAEG
Sbjct  61   AVLIGCAVVLMWRRSSTSAKKVVEPPKLVVPKSVIEPEEIDDGKKKVTIFFGTQTGTAEG  120

Query  464  FAKALAEEAKARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFLATYGDGEPTDNAA  643
            FAKALAEEAKARY+KA  KV+D+DDYAVDDD+YE+KLKKE+L FFFLATYGDGEPTDNAA
Sbjct  121  FAKALAEEAKARYDKATFKVIDMDDYAVDDDDYEDKLKKETLAFFFLATYGDGEPTDNAA  180

Query  644  RFYKWFSEGKERGVWLK  694
            RFYKWF EGKERG + K
Sbjct  181  RFYKWFVEGKERGDYFK  197



>gb|AGX85599.1| NADPH:cytochrome P450 reductase [Scoparia dulcis]
Length=713

 Score =   219 bits (559),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 146/195 (75%), Positives = 166/195 (85%), Gaps = 6/195 (3%)
 Frame = +2

Query  125  MEPTSEKLSPFDFMAAIFKGGRIFDQSNASSESASP---VAMLMDNKELMAMLTTSVAVL  295
            M+ TSEKLSPFDFMAAIF G +  D SN SSE+ +P   VAML++NK+LM +LTTSVAVL
Sbjct  1    MQSTSEKLSPFDFMAAIFSGAKT-DSSNGSSEATAPAQVVAMLLENKDLMMILTTSVAVL  59

Query  296  IGCVFVLVWRRASSSAKK-AVEPPNPEVPK-AAEEETGEDGRKKITIFFGTQTGTAEGFA  469
            IGCV VLVWR+ S SAKK AVEPP   VPK AA+ E  +DG+KK+TIFFGTQTGTAEGFA
Sbjct  60   IGCVVVLVWRKTSGSAKKKAVEPPKLVVPKPAAQPEEEDDGKKKVTIFFGTQTGTAEGFA  119

Query  470  KALAEEAKARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFLATYGDGEPTDNAARF  649
            KALAEEAKARY +A  KVVDLDDYA +D+EYEEK+KKE++ FFFLATYGDGEPTDNAARF
Sbjct  120  KALAEEAKARYSQAKFKVVDLDDYAAEDEEYEEKMKKENIAFFFLATYGDGEPTDNAARF  179

Query  650  YKWFSEGKERGVWLK  694
            YKWF+EGKERG WLK
Sbjct  180  YKWFTEGKERGEWLK  194



>ref|XP_011079296.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Sesamum indicum]
Length=705

 Score =   219 bits (557),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 135/191 (71%), Positives = 159/191 (83%), Gaps = 6/191 (3%)
 Frame = +2

Query  125  MEPTSEKLSPFDFMAAIFKGGRIFDQSNASSESASPVAMLMDNKELMAMLTTSVAVLIGC  304
            MEPTSEKLSPFD +AAI KG ++ D S+ S E    VA+LM+N++L+ +LTTSVAVLIGC
Sbjct  1    MEPTSEKLSPFDLVAAILKGVKL-DGSDGSPEV---VALLMENRDLVMVLTTSVAVLIGC  56

Query  305  VFVLVWRRASSSAKKAVEPPNPEVPKAA-EEETGEDGRKKITIFFGTQTGTAEGFAKALA  481
            V VL WRR S   KK VEPP   +PKAA E E  +DG+KK+++FFGTQTGTAEGFAKA +
Sbjct  57   VVVLAWRRGSGK-KKPVEPPKLVLPKAALEPEEVDDGKKKVSVFFGTQTGTAEGFAKAFS  115

Query  482  EEAKARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFLATYGDGEPTDNAARFYKWF  661
            EEAKARY++A  KV+DLDDYA DD+EYEEKLKKE+L FFFLA+YGDGEPTDNAARFYKWF
Sbjct  116  EEAKARYQQAKFKVIDLDDYAADDEEYEEKLKKETLAFFFLASYGDGEPTDNAARFYKWF  175

Query  662  SEGKERGVWLK  694
            +EGKERG WLK
Sbjct  176  TEGKERGDWLK  186



>gb|ADC94831.1| cytochrome P450 reductase [Perilla frutescens]
Length=709

 Score =   215 bits (548),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 144/193 (75%), Positives = 161/193 (83%), Gaps = 4/193 (2%)
 Frame = +2

Query  125  MEPTSEKLSPFDFMAAIFKGGRIFDQSNASSESASP--VAMLMDNKELMAMLTTSVAVLI  298
            ME TSEKLSPFDFMAAI KG ++ D SN S+ +A P  VAMLM+N++LM MLTTSVAVL+
Sbjct  1    MESTSEKLSPFDFMAAILKGVKL-DTSNGSAGAAQPAVVAMLMENRDLMMMLTTSVAVLL  59

Query  299  GCVFVLVWRRASSSAKKAVEPPNPEVPKA-AEEETGEDGRKKITIFFGTQTGTAEGFAKA  475
            GCV  L+WRR + SAKK VEPP   V KA AE E  +DG+KK+TIFFGTQTGTAEGFAKA
Sbjct  60   GCVVYLIWRRGTGSAKKVVEPPKLVVTKAPAETEEVDDGKKKVTIFFGTQTGTAEGFAKA  119

Query  476  LAEEAKARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFLATYGDGEPTDNAARFYK  655
            LAEEAKARY +AN KVVDLDDYA DD+EYEEK+KKES  FFFLATYGDGEPTDNAARFYK
Sbjct  120  LAEEAKARYPQANFKVVDLDDYAADDEEYEEKMKKESFAFFFLATYGDGEPTDNAARFYK  179

Query  656  WFSEGKERGVWLK  694
            WF+EGKERG   K
Sbjct  180  WFAEGKERGDMFK  192



>ref|XP_011069915.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Sesamum indicum]
Length=712

 Score =   215 bits (547),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 145/194 (75%), Positives = 166/194 (86%), Gaps = 5/194 (3%)
 Frame = +2

Query  125  MEPTSEKLSPFDFMAAIFKGGRIFDQSNASSESASP--VAMLMDNKELMAMLTTSVAVLI  298
            ME TSEKLSPFD MAAIFKG ++ D+ N SSE+A P  +AML++NK+LM +LTTS+AVLI
Sbjct  1    METTSEKLSPFDLMAAIFKGVKL-DKLNGSSEAAPPAVMAMLLENKDLMMILTTSLAVLI  59

Query  299  GCVFVLVWRRASSSAKK-AVEPPNPEVPKA-AEEETGEDGRKKITIFFGTQTGTAEGFAK  472
            GCV VL+WRRA+ SAKK  VEPP   V KA AE E  +DGRKK+TIFFGTQTGTAEGFAK
Sbjct  60   GCVVVLIWRRAAGSAKKKVVEPPKLVVAKAPAEPEEVDDGRKKVTIFFGTQTGTAEGFAK  119

Query  473  ALAEEAKARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFLATYGDGEPTDNAARFY  652
            ALAEEAKARY++A  KVVDLDDYA DD+EYEEK+KKE+L FFFLATYGDGEPTDNAARFY
Sbjct  120  ALAEEAKARYQQAKFKVVDLDDYAADDEEYEEKMKKETLAFFFLATYGDGEPTDNAARFY  179

Query  653  KWFSEGKERGVWLK  694
            KWF+E K+RG WLK
Sbjct  180  KWFTEEKDRGDWLK  193



>ref|XP_004242931.1| PREDICTED: NADPH--cytochrome P450 reductase [Solanum lycopersicum]
Length=715

 Score =   214 bits (545),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 144/197 (73%), Positives = 163/197 (83%), Gaps = 7/197 (4%)
 Frame = +2

Query  125  MEPTSEKLSPFDFMAAIFKGGRIFDQSNASSES------ASPVAMLMDNKELMAMLTTSV  286
            M+ TSEKLSPFDFMAAIFKGG+IFD+ N+S +S      AS  A+LM+NK+LM +LTTSV
Sbjct  1    MDSTSEKLSPFDFMAAIFKGGKIFDKLNSSLDSGDSTSPASLTALLMENKDLMMILTTSV  60

Query  287  AVLIGCVFVLVWRRASSSAKKAVEPPNPEVPKAA-EEETGEDGRKKITIFFGTQTGTAEG  463
            AVLIGC  VL+WRR+S+SA+K VE P   VPK+  E E  +DG+KKI IFFGTQTGTAEG
Sbjct  61   AVLIGCAVVLMWRRSSTSARKVVELPKLVVPKSVVEPEEIDDGKKKIAIFFGTQTGTAEG  120

Query  464  FAKALAEEAKARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFLATYGDGEPTDNAA  643
            FAKALAEEAKARYEKA  KV+D+DDYA DD+EYEEKLKKE L FFFLATYGDGEPTDNAA
Sbjct  121  FAKALAEEAKARYEKAIFKVIDMDDYAADDEEYEEKLKKEKLAFFFLATYGDGEPTDNAA  180

Query  644  RFYKWFSEGKERGVWLK  694
            RFYKWF EGKERG   K
Sbjct  181  RFYKWFEEGKERGDCFK  197



>gb|AHM95445.1| cytochrome P450 reductase [Matricaria chamomilla var. recutita]
Length=701

 Score =   213 bits (543),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 130/188 (69%), Positives = 153/188 (81%), Gaps = 4/188 (2%)
 Frame = +2

Query  134  TSEKLSPFDFMAAIFKGGRIFDQSNASSESASPVAMLMDNKELMAMLTTSVAVLIGCVFV  313
             S+KLS FD M A+   G++FD SN +SE+  P+A++M+N+EL+ +LTTSVAVLIGCV V
Sbjct  5    NSDKLSTFDLMTALL-NGKVFDTSN-TSEANIPLALIMENRELLMILTTSVAVLIGCVVV  62

Query  314  LVWRRASSSAKKAVEPPNPEVPKAAEEETGEDGRKKITIFFGTQTGTAEGFAKALAEEAK  493
            L WRR+SSS K   E P   VPK   EE  +DGRKK+T+FFGTQTGTAEGFAKAL EEAK
Sbjct  63   LAWRRSSSSKK--AEAPVIVVPKRVAEEEVDDGRKKVTVFFGTQTGTAEGFAKALVEEAK  120

Query  494  ARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFLATYGDGEPTDNAARFYKWFSEGK  673
             RYEKA  KV+DLDDYA +DDEYEEKLKKESL FFFLATYGDGEPTDNAARFYKWF+EG+
Sbjct  121  VRYEKAVFKVIDLDDYAAEDDEYEEKLKKESLAFFFLATYGDGEPTDNAARFYKWFTEGE  180

Query  674  ERGVWLKR  697
            E+G WL +
Sbjct  181  EKGEWLDK  188



>gb|AAZ39649.1| cytochrome P450 NADPH-reductase [Petunia x hybrida]
Length=715

 Score =   212 bits (539),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 142/197 (72%), Positives = 163/197 (83%), Gaps = 6/197 (3%)
 Frame = +2

Query  125  MEPTSEKLSPFDFMAAIF-KGGRIFDQSNASS-ESASP---VAMLMDNKELMAMLTTSVA  289
            M+ T+EKLS FDFM+AI  KGG+IFDQ N SS +S SP     +LMDNKELM +LTTSVA
Sbjct  1    MDSTAEKLSAFDFMSAILNKGGKIFDQLNTSSGDSTSPDSVATLLMDNKELMMILTTSVA  60

Query  290  VLIGCVFVLVWRRASSSAKKAVEPPNPEVPKAA-EEETGEDGRKKITIFFGTQTGTAEGF  466
            VLIGC  VL+ RR+S+SAKK V+PP   VPK+  E E  +DG+KK+TIFFGTQTGTAEGF
Sbjct  61   VLIGCAVVLIMRRSSTSAKKVVDPPKLVVPKSVMETEEIDDGKKKVTIFFGTQTGTAEGF  120

Query  467  AKALAEEAKARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFLATYGDGEPTDNAAR  646
            AKALAEEAKARY+KA  KV+D+DDYA DD+EYEEKLKKE+L FFFLATYGDGEPTDNAAR
Sbjct  121  AKALAEEAKARYDKAVFKVIDMDDYAADDEEYEEKLKKETLAFFFLATYGDGEPTDNAAR  180

Query  647  FYKWFSEGKERGVWLKR  697
            FYKWF EGKERG + K 
Sbjct  181  FYKWFVEGKERGDYFKN  197



>gb|EYU42400.1| hypothetical protein MIMGU_mgv1a002170mg [Erythranthe guttata]
Length=705

 Score =   211 bits (537),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 138/192 (72%), Positives = 163/192 (85%), Gaps = 4/192 (2%)
 Frame = +2

Query  125  MEPTSEKLSPFDFMAAIFKGGRIFDQSNASSESASP--VAMLMDNKELMAMLTTSVAVLI  298
            ME TSEK SPFD M+AI KG R+ D SN S+E+A P  VAML++NK+L+ +++TSVAVL+
Sbjct  1    MESTSEKFSPFDLMSAILKGVRL-DNSNGSAEAAPPALVAMLLENKDLVMLVSTSVAVLV  59

Query  299  GCVFVLVWRRASSSAKKAVEPPNPEVPKAAEEETGEDGRKKITIFFGTQTGTAEGFAKAL  478
            GC+  L+WRRA S+ KKAVE P   VPKA  EE  +DG+KK+TIF+GTQTGTAEGFAKAL
Sbjct  60   GCLVFLMWRRAGSAKKKAVELPKLVVPKAEPEEV-DDGKKKVTIFYGTQTGTAEGFAKAL  118

Query  479  AEEAKARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFLATYGDGEPTDNAARFYKW  658
            AEEAKARY++A  KV+DLDDYA DD+EYEEK+KKE+LVFFFLATYGDGEPTDNAARFYKW
Sbjct  119  AEEAKARYQQAKFKVIDLDDYAADDEEYEEKMKKENLVFFFLATYGDGEPTDNAARFYKW  178

Query  659  FSEGKERGVWLK  694
            F EGKERG WLK
Sbjct  179  FIEGKERGDWLK  190



>gb|ADG29353.1| cytochrome P450 reductase [Withania somnifera]
Length=713

 Score =   211 bits (537),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 141/197 (72%), Positives = 161/197 (82%), Gaps = 7/197 (4%)
 Frame = +2

Query  125  MEPTSEKLSPFDFMAAIFKGGRIFDQSNASSES------ASPVAMLMDNKELMAMLTTSV  286
            M+ TSEKLSPFD MAAIFKGG+IFD+ N+SS        AS  A+LMDNK+LM + T SV
Sbjct  1    MDSTSEKLSPFDLMAAIFKGGKIFDKLNSSSGFGGSSSPASLAALLMDNKDLMMIWTASV  60

Query  287  AVLIGCVFVLVWRRASSSAKKAVEPPNPEVPKAA-EEETGEDGRKKITIFFGTQTGTAEG  463
            AVLIGC  VL+WRR+S+SAKK +EPP   VPK+  E +  +DG+KKITIFFGTQTGTAEG
Sbjct  61   AVLIGCAVVLMWRRSSTSAKKVMEPPKLVVPKSVIEPQEIDDGKKKITIFFGTQTGTAEG  120

Query  464  FAKALAEEAKARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFLATYGDGEPTDNAA  643
            FAKALAEEAKARYEKA VKV+DLDDYA DD+EYE+K  KE+L FFF ATYGDGEPTDNAA
Sbjct  121  FAKALAEEAKARYEKATVKVIDLDDYAADDEEYEKKFAKETLAFFFSATYGDGEPTDNAA  180

Query  644  RFYKWFSEGKERGVWLK  694
            RFYKWF EGKERG + K
Sbjct  181  RFYKWFVEGKERGDYFK  197



>gb|EPS73891.1| hypothetical protein M569_00858 [Genlisea aurea]
Length=706

 Score =   211 bits (536),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 128/192 (67%), Positives = 158/192 (82%), Gaps = 4/192 (2%)
 Frame = +2

Query  125  MEPTSEKLSPFDFMAAIFKGGRIFDQSNASSESASP--VAMLMDNKELMAMLTTSVAVLI  298
            ME T+EK+SPF+FM+AI KG  + DQSN SSE+ +P  VAML++N++L+ + TTS+AVL+
Sbjct  1    MESTTEKVSPFNFMSAILKGVNL-DQSNGSSEATAPAVVAMLLENRDLLMIATTSLAVLL  59

Query  299  GCVFVLVWRRASSSAKKAVEPPNPEVPKA-AEEETGEDGRKKITIFFGTQTGTAEGFAKA  475
            G V  LVWR+ + SAKK  E      PK  A+EE  +DG KK+T+F+GTQTGTAEGFAKA
Sbjct  60   GFVLFLVWRKTAGSAKKPSEAAKIAAPKVKADEEEIDDGTKKVTVFYGTQTGTAEGFAKA  119

Query  476  LAEEAKARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFLATYGDGEPTDNAARFYK  655
            LAEEA+ARY++A  KVVDLDDYA +D+EYEEK+KKES+ FFFLATYGDGEPTDNAARFYK
Sbjct  120  LAEEARARYQQAKFKVVDLDDYAAEDEEYEEKMKKESVAFFFLATYGDGEPTDNAARFYK  179

Query  656  WFSEGKERGVWL  691
            WF+EGKERG WL
Sbjct  180  WFTEGKERGEWL  191



>gb|AGL46979.1| cytochrome P450 reductase [Salvia miltiorrhiza]
Length=712

 Score =   209 bits (532),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 138/189 (73%), Positives = 157/189 (83%), Gaps = 4/189 (2%)
 Frame = +2

Query  125  MEPTSEKLSPFDFMAAIFKGGRIFDQSNASSESASP--VAMLMDNKELMAMLTTSVAVLI  298
            ME TS KLSP D M AI KG ++ D SN S+E+A P  VAMLM+NK+LM MLTTSVAVL+
Sbjct  1    MESTSVKLSPLDLMTAILKGVKL-DNSNGSAEAAQPAVVAMLMENKDLMMMLTTSVAVLL  59

Query  299  GCVFVLVWRRASSSAKKAVEPPNPEVPKAAEE-ETGEDGRKKITIFFGTQTGTAEGFAKA  475
            GCV  L+WRR + SAKK VEPP   VPKA  E E  +DG+KK+TIFFGTQTGTAEGFAKA
Sbjct  60   GCVVYLIWRRGAGSAKKVVEPPKLVVPKAPSEVEEADDGKKKVTIFFGTQTGTAEGFAKA  119

Query  476  LAEEAKARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFLATYGDGEPTDNAARFYK  655
            LAEEAKARY +AN KVVDLDDYA DD+EYEEK+KKE+  FFFLATYGDGEPTDNAARFYK
Sbjct  120  LAEEAKARYPQANFKVVDLDDYAADDEEYEEKMKKENFAFFFLATYGDGEPTDNAARFYK  179

Query  656  WFSEGKERG  682
            WF+EG+E+G
Sbjct  180  WFAEGQEKG  188



>gb|AGO03795.1| cytochrome P450-like protein [Tanacetum cinerariifolium]
Length=483

 Score =   204 bits (519),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 127/178 (71%), Positives = 148/178 (83%), Gaps = 4/178 (2%)
 Frame = +2

Query  164  MAAIFKGGRIFDQSNASSESASPVAMLMDNKELMAMLTTSVAVLIGCVFVLVWRRASSSA  343
            M A+   G++FD SN +SE+  P+AM+M+N+EL+ +LTTSVAVLIGCV VLVWRR+SSS 
Sbjct  1    MTALL-NGKVFDSSN-TSETNIPLAMIMENRELLMILTTSVAVLIGCVVVLVWRRSSSSK  58

Query  344  KKAVEPPNPEVPKAAEEETGEDGRKKITIFFGTQTGTAEGFAKALAEEAKARYEKANvkv  523
            K  VE P   VPK   EE  +DGRKK+T+FFGTQTGTAEGFAKAL EEAKARYEKA  KV
Sbjct  59   K--VEAPVIVVPKRVTEEEVDDGRKKVTVFFGTQTGTAEGFAKALVEEAKARYEKAVFKV  116

Query  524  vdlddyavdddeyeeklkkeSLVFFFLATYGDGEPTDNAARFYKWFSEGKERGVWLKR  697
            +DLDDYA +DDEYEEKLKKESL FFFLAT G GEPTDNAARFYKWF+EG+ERG WL++
Sbjct  117  IDLDDYAAEDDEYEEKLKKESLAFFFLATXGXGEPTDNAARFYKWFTEGEERGEWLEK  174



>ref|XP_004168990.1| PREDICTED: NADPH--cytochrome P450 reductase 2-like, partial [Cucumis 
sativus]
Length=209

 Score =   195 bits (496),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 122/192 (64%), Positives = 151/192 (79%), Gaps = 4/192 (2%)
 Frame = +2

Query  122  EMEPTSEKLSPFDFMAAIFKGGRIFDQSNASSESASPVA-MLMDNKELMAMLTTSVAVLI  298
            + E +S K SPFDFM+AI KG    D SN+S +S    A ++ +N+EL+A+LTTS+AV+I
Sbjct  2    QSESSSMKASPFDFMSAIIKGR--MDPSNSSFQSTGEGASVIFENRELVAILTTSIAVMI  59

Query  299  GCVFVLVWRRASSSAKKAVEPPNPEVPKAAEEETGEDGRKKITIFFGTQTGTAEGFAKAL  478
            GC  VLVWRR+ +   K +E P P + K  E E  +DG+KK+TIFFGTQTGTAEGFAKAL
Sbjct  60   GCFVVLVWRRSGNRKVKTIELPKPLLGKEPEPEV-DDGKKKVTIFFGTQTGTAEGFAKAL  118

Query  479  AEEAKARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFLATYGDGEPTDNAARFYKW  658
            ++EAKARY+KA  +VVDLDDY  D+DEYE+KLKKES+  FFLATYGDGEPTDNAARFYKW
Sbjct  119  SDEAKARYDKAKFRVVDLDDYGADEDEYEQKLKKESVAVFFLATYGDGEPTDNAARFYKW  178

Query  659  FSEGKERGVWLK  694
            F+EGKERG  L+
Sbjct  179  FTEGKERGECLQ  190



>ref|XP_010548619.1| PREDICTED: NADPH--cytochrome P450 reductase 2-like [Tarenaya 
hassleriana]
Length=714

 Score =   206 bits (524),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 131/190 (69%), Positives = 150/190 (79%), Gaps = 5/190 (3%)
 Frame = +2

Query  137  SEKLSPFDFMAAIFKGGR-IFDQSNAS---SESASPVAMLMDNKELMAMLTTSVAVLIGC  304
            S K+SPFD M+AI KG   + D +NAS   S +A   A+L +NK+  A+LTTSVAVLIGC
Sbjct  9    SVKISPFDLMSAIIKGKSGVADSANASAYESFAAEFSAILFENKDFKALLTTSVAVLIGC  68

Query  305  VFVLVWRRASSSAKKAVEPPNPEVPKAAEEETGEDGRKKITIFFGTQTGTAEGFAKALAE  484
            V VLVWRR+  +  K VEPP P V K  EEE  +DGRKK+TIFFGTQTGTAEGFAKALAE
Sbjct  69   VIVLVWRRSGGNKPKLVEPPKPLVIKRREEEV-DDGRKKVTIFFGTQTGTAEGFAKALAE  127

Query  485  EAKARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFLATYGDGEPTDNAARFYKWFS  664
            EA+ARYEKA  K+VDL+DYA DDDEY EKLKKE L FFFLATYGDGEPTDNAARFYKWF+
Sbjct  128  EARARYEKARFKIVDLEDYAADDDEYAEKLKKEKLAFFFLATYGDGEPTDNAARFYKWFT  187

Query  665  EGKERGVWLK  694
            EG ++G  LK
Sbjct  188  EGDDKGELLK  197



>ref|XP_002534464.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF27920.1| cytochrome P450, putative, partial [Ricinus communis]
Length=694

 Score =   203 bits (516),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 131/200 (66%), Positives = 154/200 (77%), Gaps = 13/200 (7%)
 Frame = +2

Query  125  MEPTSE------KLSPFDFMAAIFKGGRIFDQSNASSESASP--VAMLMDNKELMAMLTT  280
            M+P+S       K+SPFD ++A+ KG    D SN SSES++     ML +N+E + +LTT
Sbjct  1    MQPSSSSAGSIMKVSPFDLISAVIKGN--LDPSNVSSESSAVEVATMLYENREFVMILTT  58

Query  281  SVAVLIGCVFVLVWRRASSSAKK--AVEPPNPEVPKAAEEETGEDGRKKITIFFGTQTGT  454
            S+AVLIGCV VLVWRR+ S   K  A+EP  P V K  E E  +DG+K++TIFFGTQTGT
Sbjct  59   SIAVLIGCVVVLVWRRSGSQKSKSVAIEPLKPLVVKEPEPEP-DDGQKRVTIFFGTQTGT  117

Query  455  AEGFAKALAEEAKARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFLATYGDGEPTD  634
            AEGFAKAL+EEAKARYEKA  KVVDLDDYA DDDEYE KLKKESL  FF+ATYGDGEPTD
Sbjct  118  AEGFAKALSEEAKARYEKATFKVVDLDDYAADDDEYETKLKKESLALFFVATYGDGEPTD  177

Query  635  NAARFYKWFSEGKERGVWLK  694
            NAARFYKWF+EGKERG WL+
Sbjct  178  NAARFYKWFTEGKERGEWLQ  197



>emb|CAN77401.1| hypothetical protein VITISV_027794 [Vitis vinifera]
Length=745

 Score =   202 bits (515),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 133/190 (70%), Positives = 154/190 (81%), Gaps = 3/190 (2%)
 Frame = +2

Query  125  MEPTSEKLSPFDFMAAIFKGGRIFDQSNASSESASPVAMLMDNKELMAMLTTSVAVLIGC  304
            M+ +S K+SPFD M+AI KG    DQSN SSES    AM+++N+E + +LTTS+AVLIGC
Sbjct  1    MQSSSVKVSPFDLMSAIIKGS--MDQSNVSSESGGAAAMVLENREFIMILTTSIAVLIGC  58

Query  305  VFVLVWRRASSSAKKAVEPPNPEVPKAAEEETGEDGRKKITIFFGTQTGTAEGFAKALAE  484
            V VL+WRR+     K  EPP P + K  E E  +DG++K+TIFFGTQTGTAEGFAKALAE
Sbjct  59   VVVLIWRRSGQKQSKTPEPPKPLIVKDLEVEV-DDGKQKVTIFFGTQTGTAEGFAKALAE  117

Query  485  EAKARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFLATYGDGEPTDNAARFYKWFS  664
            EAKARYEKA  KVVDLDDYA DDDEYEEKLKKE+L FFFLATYGDGEPTDNAARFYKWF+
Sbjct  118  EAKARYEKAIFKVVDLDDYAGDDDEYEEKLKKETLAFFFLATYGDGEPTDNAARFYKWFA  177

Query  665  EGKERGVWLK  694
            EGKERG WL+
Sbjct  178  EGKERGEWLQ  187



>gb|AIG15452.1| NADPH-cytochrome P450 reductase 2 [Azadirachta indica]
Length=715

 Score =   202 bits (515),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 127/186 (68%), Positives = 150/186 (81%), Gaps = 5/186 (3%)
 Frame = +2

Query  143  KLSPFDFMAAIFKGGRIFDQSNASSESAS--PVAMLMDNKELMAMLTTSVAVLIGCVFVL  316
            K+SPFD M+AI KG    D SN SS  +     +++++NKE + +LTTS+AVLIGCV VL
Sbjct  15   KVSPFDLMSAIIKGKT--DPSNVSSSGSGLEVASIVLENKEFVMILTTSIAVLIGCVVVL  72

Query  317  VWRRASSSAKKAVEPPNPEVPKAAEEETGEDGRKKITIFFGTQTGTAEGFAKALAEEAKA  496
            +WRR+SS   K +EP  P V K  E E  +DG++KITIFFGTQTGTAEGFAKALA+EAKA
Sbjct  73   IWRRSSSQKPKKIEPLKPLVVKEPEVEV-DDGKQKITIFFGTQTGTAEGFAKALADEAKA  131

Query  497  RYEKANvkvvdlddyavdddeyeeklkkeSLVFFFLATYGDGEPTDNAARFYKWFSEGKE  676
            RY+KA  KVVDLDDYA DD+EYEEKLKKES+ FFFLATYGDGEPTDNAARFYKWF+EGKE
Sbjct  132  RYDKAIFKVVDLDDYAADDEEYEEKLKKESIAFFFLATYGDGEPTDNAARFYKWFTEGKE  191

Query  677  RGVWLK  694
            RG WL+
Sbjct  192  RGEWLQ  197



>gb|AGC92176.1| cytochrome P450 oxidoreductase [Ocimum basilicum]
Length=707

 Score =   202 bits (514),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 137/192 (71%), Positives = 159/192 (83%), Gaps = 6/192 (3%)
 Frame = +2

Query  125  MEPTSEKLSPFDFMAAIFKGGRIFDQSNASSESASP-VAMLMDNKELMAMLTTSVAVLIG  301
            MEPTS+KLSP DF+AAI KG    D S+   E+ASP +AML++N++L+ +LTTSVAVLIG
Sbjct  1    MEPTSQKLSPLDFIAAILKG----DYSDGQLEAASPGMAMLLENRDLVMVLTTSVAVLIG  56

Query  302  CVFVLVWRRASSSA-KKAVEPPNPEVPKAAEEETGEDGRKKITIFFGTQTGTAEGFAKAL  478
            CV VL WRR + SA KK  EPP   VPKAAE E  +D + K++IFFGTQTGTAEGFAKA 
Sbjct  57   CVVVLAWRRTAGSATKKQFEPPKLVVPKAAELEEVDDDKPKVSIFFGTQTGTAEGFAKAF  116

Query  479  AEEAKARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFLATYGDGEPTDNAARFYKW  658
            AEEAKARY +AN KV+DLDDYA DDDEYEEKLKKE+L FFFLA+YGDGEPTDNAARFYKW
Sbjct  117  AEEAKARYPQANFKVIDLDDYAADDDEYEEKLKKETLAFFFLASYGDGEPTDNAARFYKW  176

Query  659  FSEGKERGVWLK  694
            F+EGK+RG WLK
Sbjct  177  FTEGKDRGDWLK  188



>ref|XP_002270732.2| PREDICTED: NADPH--cytochrome P450 reductase [Vitis vinifera]
Length=705

 Score =   202 bits (514),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 133/190 (70%), Positives = 154/190 (81%), Gaps = 3/190 (2%)
 Frame = +2

Query  125  MEPTSEKLSPFDFMAAIFKGGRIFDQSNASSESASPVAMLMDNKELMAMLTTSVAVLIGC  304
            M+ +S K+SPFD M+AI KG    DQSN SSES    AM+++N+E + +LTTS+AVLIGC
Sbjct  1    MQSSSVKVSPFDLMSAIIKGS--MDQSNVSSESGGAAAMVLENREFIMILTTSIAVLIGC  58

Query  305  VFVLVWRRASSSAKKAVEPPNPEVPKAAEEETGEDGRKKITIFFGTQTGTAEGFAKALAE  484
            V VL+WRR+     K  EPP P + K  E E  +DG++K+TIFFGTQTGTAEGFAKALAE
Sbjct  59   VVVLIWRRSGQKQSKTPEPPKPLIVKDLEVEV-DDGKQKVTIFFGTQTGTAEGFAKALAE  117

Query  485  EAKARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFLATYGDGEPTDNAARFYKWFS  664
            EAKARYEKA  KVVDLDDYA DDDEYEEKLKKE+L FFFLATYGDGEPTDNAARFYKWF+
Sbjct  118  EAKARYEKAIFKVVDLDDYAGDDDEYEEKLKKETLAFFFLATYGDGEPTDNAARFYKWFA  177

Query  665  EGKERGVWLK  694
            EGKERG WL+
Sbjct  178  EGKERGEWLQ  187



>ref|XP_008223694.1| PREDICTED: NADPH--cytochrome P450 reductase 2 [Prunus mume]
Length=710

 Score =   200 bits (508),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 122/188 (65%), Positives = 147/188 (78%), Gaps = 7/188 (4%)
 Frame = +2

Query  143  KLSPFDFMAAIFKGGRIFDQSNASSE--SASPVAMLMDNKELMAMLTTSVAVLIGCVFVL  316
            K+SP D MAAI KG    D SNAS++   A   +++++N+E + +LTTS+AVLIGCV VL
Sbjct  9    KISPLDLMAAIIKGK--MDPSNASADLSGAQVTSVMLENREFVMILTTSIAVLIGCVVVL  66

Query  317  VWRRASSSAK-KAVEPPNPEVPKAAEEETGEDGRKKITIFFGTQTGTAEGFAKALAEEAK  493
            +WRR+S+  K + ++PP P +     E   +DG KK+TIFFGTQTGTAEGFAKALAEE K
Sbjct  67   IWRRSSAPQKPRVIQPPAPVI--VTPEPEVDDGTKKVTIFFGTQTGTAEGFAKALAEEGK  124

Query  494  ARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFLATYGDGEPTDNAARFYKWFSEGK  673
            ARYEK   KVVDLDDYA DD+ YEEKLKKESL FFFLATYGDGEPTDNAARFYKWF+EG 
Sbjct  125  ARYEKVTFKVVDLDDYAADDEAYEEKLKKESLAFFFLATYGDGEPTDNAARFYKWFTEGN  184

Query  674  ERGVWLKR  697
            ERG WL++
Sbjct  185  ERGEWLQK  192



>ref|XP_007227446.1| hypothetical protein PRUPE_ppa002142mg [Prunus persica]
 gb|EMJ28645.1| hypothetical protein PRUPE_ppa002142mg [Prunus persica]
Length=710

 Score =   199 bits (506),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 122/187 (65%), Positives = 146/187 (78%), Gaps = 7/187 (4%)
 Frame = +2

Query  143  KLSPFDFMAAIFKGGRIFDQSNASSE--SASPVAMLMDNKELMAMLTTSVAVLIGCVFVL  316
            K+SP D MAAI KG    D SNAS++   A   +++++N+E + +LTTS+AVLIGCV VL
Sbjct  9    KISPLDLMAAIIKGK--MDPSNASADLSGAQVTSVMLENREFVMILTTSIAVLIGCVVVL  66

Query  317  VWRRASSSAK-KAVEPPNPEVPKAAEEETGEDGRKKITIFFGTQTGTAEGFAKALAEEAK  493
            +WRR+S+  K + ++PP P +     E   +DG KK+TIFFGTQTGTAEGFAKALAEE K
Sbjct  67   IWRRSSAPPKPRVIQPPAPVI--VTSEPEVDDGTKKVTIFFGTQTGTAEGFAKALAEEGK  124

Query  494  ARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFLATYGDGEPTDNAARFYKWFSEGK  673
            ARYEK   KVVDLDDYA DD+ YEEKLKKESL FFFLATYGDGEPTDNAARFYKWF+EG 
Sbjct  125  ARYEKVTFKVVDLDDYAADDEAYEEKLKKESLAFFFLATYGDGEPTDNAARFYKWFTEGN  184

Query  674  ERGVWLK  694
            ERG WL+
Sbjct  185  ERGEWLQ  191



>sp|Q05001.1|NCPR_CATRO RecName: Full=NADPH--cytochrome P450 reductase; Short=CPR; Short=P450R 
[Catharanthus roseus]
 emb|CAA49446.1| NADPH--ferrihemoprotein reductase [Catharanthus roseus]
Length=714

 Score =   199 bits (506),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 134/195 (69%), Positives = 160/195 (82%), Gaps = 6/195 (3%)
 Frame = +2

Query  125  MEPTSEKLSPFDFMAAIFKGGRIFDQSNASSE--SASP--VAMLMDNKELMAMLTTSVAV  292
            M+ +SEKLSPF+ M+AI KG ++ D SN+S    + SP  +AML++NKEL+ +LTTSVAV
Sbjct  1    MDSSSEKLSPFELMSAILKGAKL-DGSNSSDSGVAVSPAVMAMLLENKELVMILTTSVAV  59

Query  293  LIGCVFVLVWRRASSSAKKAVEPPNPEVPKA-AEEETGEDGRKKITIFFGTQTGTAEGFA  469
            LIGCV VL+WRR+S S KK VEPP   VPK+  E E  ++G+KK TIFFGTQTGTAEGFA
Sbjct  60   LIGCVVVLIWRRSSGSGKKVVEPPKLIVPKSVVEPEEIDEGKKKFTIFFGTQTGTAEGFA  119

Query  470  KALAEEAKARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFLATYGDGEPTDNAARF  649
            KALAEEAKARYEKA +KV+D+DDYA DD+EYEEK +KE+L FF LATYGDGEPTDNAARF
Sbjct  120  KALAEEAKARYEKAVIKVIDIDDYAADDEEYEEKFRKETLAFFILATYGDGEPTDNAARF  179

Query  650  YKWFSEGKERGVWLK  694
            YKWF EG +RG WLK
Sbjct  180  YKWFVEGNDRGDWLK  194



>ref|XP_008453604.1| PREDICTED: NADPH--cytochrome P450 reductase 2 [Cucumis melo]
Length=708

 Score =   199 bits (505),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 123/195 (63%), Positives = 152/195 (78%), Gaps = 4/195 (2%)
 Frame = +2

Query  122  EMEPTSEKLSPFDFMAAIFKGGRIFDQSNASSESASPVA-MLMDNKELMAMLTTSVAVLI  298
            + E +S K SP DFM+AI KG    D SN+S +S    A ++ +N+EL+A+LTTS+AV+I
Sbjct  2    QSESSSMKASPLDFMSAIIKGR--MDPSNSSFQSTGEGASVIFENRELVAILTTSIAVMI  59

Query  299  GCVFVLVWRRASSSAKKAVEPPNPEVPKAAEEETGEDGRKKITIFFGTQTGTAEGFAKAL  478
            GC  VLVWRR+ +   K +E P P + K  E E  +DG+KK+TIFFGTQTGTAEGFAKAL
Sbjct  60   GCFVVLVWRRSGNRKVKTIELPKPLLAKEPEPEV-DDGKKKVTIFFGTQTGTAEGFAKAL  118

Query  479  AEEAKARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFLATYGDGEPTDNAARFYKW  658
            ++EAKARY+KA  +VVDLDDY  DDDEYE++LKKES+  FFLATYGDGEPTDNAARFYKW
Sbjct  119  SDEAKARYDKAKFRVVDLDDYGGDDDEYEQQLKKESVAVFFLATYGDGEPTDNAARFYKW  178

Query  659  FSEGKERGVWLKRSS  703
            F+EGKERG WL+  S
Sbjct  179  FTEGKERGEWLQNLS  193



>ref|XP_007014268.1| P450 reductase 2 [Theobroma cacao]
 gb|EOY31887.1| P450 reductase 2 [Theobroma cacao]
Length=710

 Score =   198 bits (504),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 137/195 (70%), Positives = 158/195 (81%), Gaps = 8/195 (4%)
 Frame = +2

Query  125  MEPTSE----KLSPFDFMAAIFKGGRIFDQSNASSESASPVA-MLMDNKELMAMLTTSVA  289
            MEP+S     K+SP D M+AI KG    D SNAS +SA+ VA ML++N+E + +LTTS+A
Sbjct  1    MEPSSSSGSIKVSPLDLMSAIIKGK--MDPSNASYDSAAEVATMLLENREFVMILTTSIA  58

Query  290  VLIGCVFVLVWRRASSSAKKAVEPPNPEVPKAAEEETGEDGRKKITIFFGTQTGTAEGFA  469
            VLIGCV VLVWRR+ S   K +EPP P + K  E E  +DG+KK+TIFFGTQTGTAEGFA
Sbjct  59   VLIGCVVVLVWRRSGSQKPKQIEPPKPLIVKEPELEV-DDGKKKVTIFFGTQTGTAEGFA  117

Query  470  KALAEEAKARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFLATYGDGEPTDNAARF  649
            KALAEEAKARY+KA  KVVDLDDYAVDDDEYEEK+K ESL FFFLATYGDGEPTDNAARF
Sbjct  118  KALAEEAKARYDKATFKVVDLDDYAVDDDEYEEKMKTESLAFFFLATYGDGEPTDNAARF  177

Query  650  YKWFSEGKERGVWLK  694
            YKWF+EGKERG WL+
Sbjct  178  YKWFTEGKERGEWLQ  192



>ref|XP_010259920.1| PREDICTED: NADPH--cytochrome P450 reductase [Nelumbo nucifera]
Length=705

 Score =   198 bits (503),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 124/191 (65%), Positives = 148/191 (77%), Gaps = 6/191 (3%)
 Frame = +2

Query  125  MEPTSEKLSPFDFMAAIFKGGRIFDQSNASSESASPVAMLMDNKELMAMLTTSVAVLIGC  304
            M+  S K+SP D MAA  KG    D SN S+ S+   A+ ++NKE + +LTTS+AVLIGC
Sbjct  1    MDSESVKISPMDLMAAFLKGSS--DPSNMSATSSE--AVFIENKEFLMILTTSIAVLIGC  56

Query  305  VFVLVWRRASSS-AKKAVEPPNPEVPKAAEEETGEDGRKKITIFFGTQTGTAEGFAKALA  481
            V + VWRR++   A K VE P P + K  E E  +DG+KK+T+FFGTQTGTAEGFAKAL 
Sbjct  57   VVLFVWRRSTGQKASKVVEVPKPVIVKEPEPEF-DDGKKKVTVFFGTQTGTAEGFAKALV  115

Query  482  EEAKARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFLATYGDGEPTDNAARFYKWF  661
            EEAK RYEKA  KV+DLDDYA DDDEYEEK++KE+L FFFLATYGDGEPTDNAARFYKWF
Sbjct  116  EEAKVRYEKATFKVIDLDDYAADDDEYEEKMRKETLAFFFLATYGDGEPTDNAARFYKWF  175

Query  662  SEGKERGVWLK  694
            +EGKERG WL+
Sbjct  176  TEGKERGTWLE  186



>ref|XP_010093854.1| NADPH--cytochrome P450 reductase [Morus notabilis]
 gb|EXB54742.1| NADPH--cytochrome P450 reductase [Morus notabilis]
Length=715

 Score =   197 bits (502),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 133/189 (70%), Positives = 151/189 (80%), Gaps = 7/189 (4%)
 Frame = +2

Query  143  KLSPFDFMAAIFKGGRIFDQSNASSESASP-----VAMLMDNKELMAMLTTSVAVLIGCV  307
            KLSP D M AI KG ++ D SNAS+ESA        +++++N+EL+ +LTTS AVLIGC 
Sbjct  11   KLSPLDLMTAIIKGAKV-DPSNASAESAGGAAAEVASLILENRELVTILTTSFAVLIGCF  69

Query  308  FVLVWRRASSSAKKAVEPPNPEVPKAAEEETGEDGRKKITIFFGTQTGTAEGFAKALAEE  487
             VL+WRR+ S   KAVE   P V K  E E  +DG+KK+TIFFGTQTGTAEGFAKALA+E
Sbjct  70   VVLMWRRSGSQKPKAVELLKPLVVKEPEIEV-DDGKKKVTIFFGTQTGTAEGFAKALADE  128

Query  488  AKARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFLATYGDGEPTDNAARFYKWFSE  667
            AKARYEKA  KVVDLDDYA DDDEYEEKLKKESL FFFLATYGDGEPTDNAARFYKWFSE
Sbjct  129  AKARYEKAVFKVVDLDDYAADDDEYEEKLKKESLAFFFLATYGDGEPTDNAARFYKWFSE  188

Query  668  GKERGVWLK  694
            GKERG WL+
Sbjct  189  GKERGEWLQ  197



>gb|KJB53796.1| hypothetical protein B456_009G005600 [Gossypium raimondii]
Length=614

 Score =   196 bits (498),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 121/184 (66%), Positives = 145/184 (79%), Gaps = 5/184 (3%)
 Frame = +2

Query  149  SPFDFMAAIFKGGRIFDQSNASSESASPVA-MLMDNKELMAMLTTSVAVLIGCVFVLVWR  325
            SP D M+A+ K     D SNASS+SA+ V  +L  N+E + +LTTS+AVLIGCV +L+WR
Sbjct  13   SPLDLMSALIKAK--MDPSNASSDSAAQVTTVLFGNREFIMILTTSIAVLIGCVVILIWR  70

Query  326  RASSSAKKAVEPP-NPEVPKAAEEETGEDGRKKITIFFGTQTGTAEGFAKALAEEAKARY  502
            R+SS   K ++ P  P + K  E E  +DG+KK+TI FGTQTGT+EGFAKAL EEAKARY
Sbjct  71   RSSSQKPKEIQLPLKPSIIKEPELEV-DDGKKKVTILFGTQTGTSEGFAKALVEEAKARY  129

Query  503  EKANvkvvdlddyavdddeyeeklkkeSLVFFFLATYGDGEPTDNAARFYKWFSEGKERG  682
            EKA   +VDLDDYA DD+EYEEK+KKESL FFFLATYGDGEPTDNAARFYKWF+EGKERG
Sbjct  130  EKATFNIVDLDDYAADDEEYEEKMKKESLAFFFLATYGDGEPTDNAARFYKWFTEGKERG  189

Query  683  VWLK  694
             WL+
Sbjct  190  EWLQ  193



>ref|XP_006412733.1| hypothetical protein EUTSA_v10024546mg [Eutrema salsugineum]
 gb|ESQ54186.1| hypothetical protein EUTSA_v10024546mg [Eutrema salsugineum]
Length=711

 Score =   197 bits (500),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 122/189 (65%), Positives = 148/189 (78%), Gaps = 6/189 (3%)
 Frame = +2

Query  143  KLSPFDFMAAIFKGGRIF--DQSNAS---SESASPVAMLMDNKELMAMLTTSVAVLIGCV  307
            K+SPFD M+AI KG  +   D +NAS   S +A   +ML++N++   ++TTS+AVLIGC+
Sbjct  10   KVSPFDLMSAIIKGEPVVVSDPANASAYESVAAELSSMLIENRQFAMIVTTSIAVLIGCI  69

Query  308  FVLVWRRASSSAKKAVEPPNPEVPKAAEEETGEDGRKKITIFFGTQTGTAEGFAKALAEE  487
             +LVWRR+ +   K VEP  P V K  E++  +DGRKK+TIFFGTQTGTAEGFAKAL EE
Sbjct  70   VMLVWRRSGTGNSKRVEPLKPLVIKPREDDV-DDGRKKVTIFFGTQTGTAEGFAKALGEE  128

Query  488  AKARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFLATYGDGEPTDNAARFYKWFSE  667
            A+ARYEK   K+VDLDDYA DDDEYEEKLKKE + FFFLATYGDGEPTDNAARFYKWF+E
Sbjct  129  ARARYEKTRFKIVDLDDYAADDDEYEEKLKKEDVAFFFLATYGDGEPTDNAARFYKWFTE  188

Query  668  GKERGVWLK  694
            G +RG WLK
Sbjct  189  GNDRGEWLK  197



>dbj|BAJ33878.1| unnamed protein product [Thellungiella halophila]
Length=711

 Score =   197 bits (500),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 122/189 (65%), Positives = 148/189 (78%), Gaps = 6/189 (3%)
 Frame = +2

Query  143  KLSPFDFMAAIFKGGRIF--DQSNAS---SESASPVAMLMDNKELMAMLTTSVAVLIGCV  307
            K+SPFD M+AI KG  +   D +NAS   S +A   +ML++N++   ++TTS+AVLIGC+
Sbjct  10   KVSPFDLMSAIIKGEPVVVSDPANASAYESVAAELSSMLIENRQFAMIVTTSIAVLIGCI  69

Query  308  FVLVWRRASSSAKKAVEPPNPEVPKAAEEETGEDGRKKITIFFGTQTGTAEGFAKALAEE  487
             +LVWRR+ +   K VEP  P V K  E++  +DGRKK+TIFFGTQTGTAEGFAKAL EE
Sbjct  70   VMLVWRRSGTGNSKRVEPLKPLVIKPREDDV-DDGRKKVTIFFGTQTGTAEGFAKALGEE  128

Query  488  AKARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFLATYGDGEPTDNAARFYKWFSE  667
            A+ARYEK   K+VDLDDYA DDDEYEEKLKKE + FFFLATYGDGEPTDNAARFYKWF+E
Sbjct  129  ARARYEKTRFKIVDLDDYAADDDEYEEKLKKEDVAFFFLATYGDGEPTDNAARFYKWFTE  188

Query  668  GKERGVWLK  694
            G +RG WLK
Sbjct  189  GNDRGEWLK  197



>gb|KDO43873.1| hypothetical protein CISIN_1g005072mg [Citrus sinensis]
Length=598

 Score =   195 bits (496),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 122/186 (66%), Positives = 152/186 (82%), Gaps = 2/186 (1%)
 Frame = +2

Query  143  KLSPFDFMAAIFKGGRIFDQSNASSESASPVA-MLMDNKELMAMLTTSVAVLIGCVFVLV  319
            K+SPFD M+AI +GG++   + +SS S   VA +++DNKE + +LTTS+AVLIGCV V +
Sbjct  14   KVSPFDLMSAIIRGGKVDPSNVSSSGSGVEVASIVLDNKEFVMILTTSIAVLIGCVVVFI  73

Query  320  WRRASSSAKKAVEPPNPEVPKAAEEETGEDGRKKITIFFGTQTGTAEGFAKALAEEAKAR  499
             RR+SSS  K VEP  P V K  E E  +DG++K+TIFFGTQTGTAEGFAKALA+EA+AR
Sbjct  74   LRRSSSSKPKKVEPLKPLVVKEPEVEV-DDGKQKVTIFFGTQTGTAEGFAKALADEARAR  132

Query  500  YEKANvkvvdlddyavdddeyeeklkkeSLVFFFLATYGDGEPTDNAARFYKWFSEGKER  679
            Y+KA  KVVD+DDYA ++DEYEEKLKKE++VFFFLATYGDGEPTDNAARFYKWF+E KE 
Sbjct  133  YDKAIFKVVDIDDYADEEDEYEEKLKKENIVFFFLATYGDGEPTDNAARFYKWFTEQKEG  192

Query  680  GVWLKR  697
            G WL++
Sbjct  193  GEWLQK  198



>gb|KJB53795.1| hypothetical protein B456_009G005600 [Gossypium raimondii]
Length=657

 Score =   196 bits (498),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 121/184 (66%), Positives = 145/184 (79%), Gaps = 5/184 (3%)
 Frame = +2

Query  149  SPFDFMAAIFKGGRIFDQSNASSESASPVA-MLMDNKELMAMLTTSVAVLIGCVFVLVWR  325
            SP D M+A+ K     D SNASS+SA+ V  +L  N+E + +LTTS+AVLIGCV +L+WR
Sbjct  13   SPLDLMSALIKAK--MDPSNASSDSAAQVTTVLFGNREFIMILTTSIAVLIGCVVILIWR  70

Query  326  RASSSAKKAVEPP-NPEVPKAAEEETGEDGRKKITIFFGTQTGTAEGFAKALAEEAKARY  502
            R+SS   K ++ P  P + K  E E  +DG+KK+TI FGTQTGT+EGFAKAL EEAKARY
Sbjct  71   RSSSQKPKEIQLPLKPSIIKEPELEV-DDGKKKVTILFGTQTGTSEGFAKALVEEAKARY  129

Query  503  EKANvkvvdlddyavdddeyeeklkkeSLVFFFLATYGDGEPTDNAARFYKWFSEGKERG  682
            EKA   +VDLDDYA DD+EYEEK+KKESL FFFLATYGDGEPTDNAARFYKWF+EGKERG
Sbjct  130  EKATFNIVDLDDYAADDEEYEEKMKKESLAFFFLATYGDGEPTDNAARFYKWFTEGKERG  189

Query  683  VWLK  694
             WL+
Sbjct  190  EWLQ  193



>gb|KJB53797.1| hypothetical protein B456_009G005600 [Gossypium raimondii]
Length=711

 Score =   196 bits (499),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 121/184 (66%), Positives = 145/184 (79%), Gaps = 5/184 (3%)
 Frame = +2

Query  149  SPFDFMAAIFKGGRIFDQSNASSESASPVA-MLMDNKELMAMLTTSVAVLIGCVFVLVWR  325
            SP D M+A+ K     D SNASS+SA+ V  +L  N+E + +LTTS+AVLIGCV +L+WR
Sbjct  13   SPLDLMSALIKAK--MDPSNASSDSAAQVTTVLFGNREFIMILTTSIAVLIGCVVILIWR  70

Query  326  RASSSAKKAVEPP-NPEVPKAAEEETGEDGRKKITIFFGTQTGTAEGFAKALAEEAKARY  502
            R+SS   K ++ P  P + K  E E  +DG+KK+TI FGTQTGT+EGFAKAL EEAKARY
Sbjct  71   RSSSQKPKEIQLPLKPSIIKEPELEV-DDGKKKVTILFGTQTGTSEGFAKALVEEAKARY  129

Query  503  EKANvkvvdlddyavdddeyeeklkkeSLVFFFLATYGDGEPTDNAARFYKWFSEGKERG  682
            EKA   +VDLDDYA DD+EYEEK+KKESL FFFLATYGDGEPTDNAARFYKWF+EGKERG
Sbjct  130  EKATFNIVDLDDYAADDEEYEEKMKKESLAFFFLATYGDGEPTDNAARFYKWFTEGKERG  189

Query  683  VWLK  694
             WL+
Sbjct  190  EWLQ  193



>gb|KJB53794.1| hypothetical protein B456_009G005600 [Gossypium raimondii]
Length=710

 Score =   196 bits (499),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 121/184 (66%), Positives = 145/184 (79%), Gaps = 5/184 (3%)
 Frame = +2

Query  149  SPFDFMAAIFKGGRIFDQSNASSESASPVA-MLMDNKELMAMLTTSVAVLIGCVFVLVWR  325
            SP D M+A+ K     D SNASS+SA+ V  +L  N+E + +LTTS+AVLIGCV +L+WR
Sbjct  13   SPLDLMSALIKAK--MDPSNASSDSAAQVTTVLFGNREFIMILTTSIAVLIGCVVILIWR  70

Query  326  RASSSAKKAVEPP-NPEVPKAAEEETGEDGRKKITIFFGTQTGTAEGFAKALAEEAKARY  502
            R+SS   K ++ P  P + K  E E  +DG+KK+TI FGTQTGT+EGFAKAL EEAKARY
Sbjct  71   RSSSQKPKEIQLPLKPSIIKEPELEV-DDGKKKVTILFGTQTGTSEGFAKALVEEAKARY  129

Query  503  EKANvkvvdlddyavdddeyeeklkkeSLVFFFLATYGDGEPTDNAARFYKWFSEGKERG  682
            EKA   +VDLDDYA DD+EYEEK+KKESL FFFLATYGDGEPTDNAARFYKWF+EGKERG
Sbjct  130  EKATFNIVDLDDYAADDEEYEEKMKKESLAFFFLATYGDGEPTDNAARFYKWFTEGKERG  189

Query  683  VWLK  694
             WL+
Sbjct  190  EWLQ  193



>gb|KDO43872.1| hypothetical protein CISIN_1g005072mg [Citrus sinensis]
Length=616

 Score =   195 bits (496),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 122/186 (66%), Positives = 152/186 (82%), Gaps = 2/186 (1%)
 Frame = +2

Query  143  KLSPFDFMAAIFKGGRIFDQSNASSESASPVA-MLMDNKELMAMLTTSVAVLIGCVFVLV  319
            K+SPFD M+AI +GG++   + +SS S   VA +++DNKE + +LTTS+AVLIGCV V +
Sbjct  14   KVSPFDLMSAIIRGGKVDPSNVSSSGSGVEVASIVLDNKEFVMILTTSIAVLIGCVVVFI  73

Query  320  WRRASSSAKKAVEPPNPEVPKAAEEETGEDGRKKITIFFGTQTGTAEGFAKALAEEAKAR  499
             RR+SSS  K VEP  P V K  E E  +DG++K+TIFFGTQTGTAEGFAKALA+EA+AR
Sbjct  74   LRRSSSSKPKKVEPLKPLVVKEPEVEV-DDGKQKVTIFFGTQTGTAEGFAKALADEARAR  132

Query  500  YEKANvkvvdlddyavdddeyeeklkkeSLVFFFLATYGDGEPTDNAARFYKWFSEGKER  679
            Y+KA  KVVD+DDYA ++DEYEEKLKKE++VFFFLATYGDGEPTDNAARFYKWF+E KE 
Sbjct  133  YDKAIFKVVDIDDYADEEDEYEEKLKKENIVFFFLATYGDGEPTDNAARFYKWFTEQKEG  192

Query  680  GVWLKR  697
            G WL++
Sbjct  193  GEWLQK  198



>gb|ACN54324.1| NADPH:cytochrome P450 reductase [Gossypium hirsutum]
Length=710

 Score =   196 bits (498),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 119/184 (65%), Positives = 146/184 (79%), Gaps = 5/184 (3%)
 Frame = +2

Query  149  SPFDFMAAIFKGGRIFDQSNASSESASPVA-MLMDNKELMAMLTTSVAVLIGCVFVLVWR  325
            SP D M+A+ K     D SNASS+SA+ V  +L +N+E + +LTTS+AVLIGCV +L+WR
Sbjct  13   SPLDLMSALVKAK--MDPSNASSDSAAQVTTVLFENREFVMILTTSIAVLIGCVVILIWR  70

Query  326  RASSSAKKAVEPP-NPEVPKAAEEETGEDGRKKITIFFGTQTGTAEGFAKALAEEAKARY  502
            R++S   K ++ P  P + K  E E  +DG+KK+TI FGTQTGTAEGFAKAL EEAKARY
Sbjct  71   RSASQKPKQIQLPLKPSIIKEPELEV-DDGKKKVTILFGTQTGTAEGFAKALVEEAKARY  129

Query  503  EKANvkvvdlddyavdddeyeeklkkeSLVFFFLATYGDGEPTDNAARFYKWFSEGKERG  682
            EKA   +VDLDDYA DD+EYEEK+KK++L FFFLATYGDGEPTDNAARFYKWF+EGKERG
Sbjct  130  EKATFNIVDLDDYAADDEEYEEKMKKDNLAFFFLATYGDGEPTDNAARFYKWFTEGKERG  189

Query  683  VWLK  694
             WL+
Sbjct  190  EWLQ  193



>ref|XP_010688489.1| PREDICTED: NADPH--cytochrome P450 reductase [Beta vulgaris subsp. 
vulgaris]
Length=705

 Score =   196 bits (498),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 119/192 (62%), Positives = 151/192 (79%), Gaps = 5/192 (3%)
 Frame = +2

Query  125  MEPTSEKLSPFDFMAAIFKGGRIFDQSNASSESASPVAMLMDNKELMAMLTTSVAVLIGC  304
            M+  S K+SP D M+A+ KG   F+Q NAS E +S  A++++N+E++  +TTS+AVLIGC
Sbjct  1    MDSNSIKVSPLDLMSALLKGN--FEQLNASFEDSSAAALIVENREVLMFVTTSIAVLIGC  58

Query  305  VFVLVWRRASS--SAKKAVEPPNPEVPKAAEEETGEDGRKKITIFFGTQTGTAEGFAKAL  478
             F+ +W++++   S+K   E P P + K  + E  +DG+KK+T+FFGTQTGTAEGFAKAL
Sbjct  59   AFLFIWKKSNGGKSSKVVSELPKPLILKDDDVEV-DDGKKKVTVFFGTQTGTAEGFAKAL  117

Query  479  AEEAKARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFLATYGDGEPTDNAARFYKW  658
             EEAKARYEKA  K+VDLDDYA DDDEYE KLKKE+L FFFLATYGDGEPTDNAARFYKW
Sbjct  118  VEEAKARYEKATFKIVDLDDYAGDDDEYERKLKKENLAFFFLATYGDGEPTDNAARFYKW  177

Query  659  FSEGKERGVWLK  694
            F EGK+RG WL+
Sbjct  178  FLEGKDRGEWLQ  189



>gb|KHG09184.1| NADPH--cytochrome P450 reductase [Gossypium arboreum]
Length=710

 Score =   196 bits (498),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 120/184 (65%), Positives = 146/184 (79%), Gaps = 5/184 (3%)
 Frame = +2

Query  149  SPFDFMAAIFKGGRIFDQSNASSESASPVA-MLMDNKELMAMLTTSVAVLIGCVFVLVWR  325
            SP D M+A+ K     D SNASS+SA+ V  +L +N+E + +LTTS+AVLIGCV +L+WR
Sbjct  13   SPLDLMSALVKAK--MDPSNASSDSAAQVTTVLFENREFVMILTTSIAVLIGCVVILIWR  70

Query  326  RASSSAKKAVEPP-NPEVPKAAEEETGEDGRKKITIFFGTQTGTAEGFAKALAEEAKARY  502
            R++S   K ++ P  P + K  E E  +DG+KK+TI FGTQTGTAEGFAKAL EEAKARY
Sbjct  71   RSASQKPKQIQLPLKPSIIKEPELEV-DDGKKKVTILFGTQTGTAEGFAKALVEEAKARY  129

Query  503  EKANvkvvdlddyavdddeyeeklkkeSLVFFFLATYGDGEPTDNAARFYKWFSEGKERG  682
            EKA   +VDLDDYA DD+EYEEK+KKE+L FFFLATYGDGEPTDNAARFYKWF+EGKERG
Sbjct  130  EKATFNIVDLDDYAADDEEYEEKMKKENLAFFFLATYGDGEPTDNAARFYKWFTEGKERG  189

Query  683  VWLK  694
             WL+
Sbjct  190  EWLQ  193



>gb|KJB22135.1| hypothetical protein B456_004G0316001, partial [Gossypium raimondii]
 gb|KJB22136.1| hypothetical protein B456_004G0316001, partial [Gossypium raimondii]
 gb|KJB22137.1| hypothetical protein B456_004G0316001, partial [Gossypium raimondii]
Length=312

 Score =   188 bits (477),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 129/185 (70%), Positives = 151/185 (82%), Gaps = 4/185 (2%)
 Frame = +2

Query  143  KLSPFDFMAAIFKGGRIFDQSNASSESASPVA-MLMDNKELMAMLTTSVAVLIGCVFVLV  319
            K+SP D M+AI K     D SNAS++SA+ +A ML++NKE + +LTTS+AVL+GCV VLV
Sbjct  12   KVSPLDLMSAIIKAK--MDPSNASADSAAEMATMLLENKEFVMILTTSIAVLVGCVVVLV  69

Query  320  WRRASSSAKKAVEPPNPEVPKAAEEETGEDGRKKITIFFGTQTGTAEGFAKALAEEAKAR  499
            WRR+ S   K + PP P + K  E E  +DG+KK+TIFFGTQTGTAEGFAKAL EEAKAR
Sbjct  70   WRRSGSQKPKQITPPKPLIVKDRENEV-DDGKKKVTIFFGTQTGTAEGFAKALVEEAKAR  128

Query  500  YEKANvkvvdlddyavdddeyeeklkkeSLVFFFLATYGDGEPTDNAARFYKWFSEGKER  679
            Y+KA  KVVDLDDYA DDDEYEEK+KKESL FFFLATYGDGEPTDNAARFYKWF+EGKER
Sbjct  129  YDKATFKVVDLDDYAADDDEYEEKMKKESLAFFFLATYGDGEPTDNAARFYKWFTEGKER  188

Query  680  GVWLK  694
            G WL+
Sbjct  189  GEWLQ  193



>gb|KDO43869.1| hypothetical protein CISIN_1g005072mg [Citrus sinensis]
Length=710

 Score =   196 bits (497),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 122/186 (66%), Positives = 152/186 (82%), Gaps = 2/186 (1%)
 Frame = +2

Query  143  KLSPFDFMAAIFKGGRIFDQSNASSESASPVA-MLMDNKELMAMLTTSVAVLIGCVFVLV  319
            K+SPFD M+AI +GG++   + +SS S   VA +++DNKE + +LTTS+AVLIGCV V +
Sbjct  14   KVSPFDLMSAIIRGGKVDPSNVSSSGSGVEVASIVLDNKEFVMILTTSIAVLIGCVVVFI  73

Query  320  WRRASSSAKKAVEPPNPEVPKAAEEETGEDGRKKITIFFGTQTGTAEGFAKALAEEAKAR  499
             RR+SSS  K VEP  P V K  E E  +DG++K+TIFFGTQTGTAEGFAKALA+EA+AR
Sbjct  74   LRRSSSSKPKKVEPLKPLVVKEPEVEV-DDGKQKVTIFFGTQTGTAEGFAKALADEARAR  132

Query  500  YEKANvkvvdlddyavdddeyeeklkkeSLVFFFLATYGDGEPTDNAARFYKWFSEGKER  679
            Y+KA  KVVD+DDYA ++DEYEEKLKKE++VFFFLATYGDGEPTDNAARFYKWF+E KE 
Sbjct  133  YDKAIFKVVDIDDYADEEDEYEEKLKKENIVFFFLATYGDGEPTDNAARFYKWFTEQKEG  192

Query  680  GVWLKR  697
            G WL++
Sbjct  193  GEWLQK  198



>gb|KDO43870.1| hypothetical protein CISIN_1g005072mg [Citrus sinensis]
Length=687

 Score =   196 bits (497),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 122/186 (66%), Positives = 152/186 (82%), Gaps = 2/186 (1%)
 Frame = +2

Query  143  KLSPFDFMAAIFKGGRIFDQSNASSESASPVA-MLMDNKELMAMLTTSVAVLIGCVFVLV  319
            K+SPFD M+AI +GG++   + +SS S   VA +++DNKE + +LTTS+AVLIGCV V +
Sbjct  14   KVSPFDLMSAIIRGGKVDPSNVSSSGSGVEVASIVLDNKEFVMILTTSIAVLIGCVVVFI  73

Query  320  WRRASSSAKKAVEPPNPEVPKAAEEETGEDGRKKITIFFGTQTGTAEGFAKALAEEAKAR  499
             RR+SSS  K VEP  P V K  E E  +DG++K+TIFFGTQTGTAEGFAKALA+EA+AR
Sbjct  74   LRRSSSSKPKKVEPLKPLVVKEPEVEV-DDGKQKVTIFFGTQTGTAEGFAKALADEARAR  132

Query  500  YEKANvkvvdlddyavdddeyeeklkkeSLVFFFLATYGDGEPTDNAARFYKWFSEGKER  679
            Y+KA  KVVD+DDYA ++DEYEEKLKKE++VFFFLATYGDGEPTDNAARFYKWF+E KE 
Sbjct  133  YDKAIFKVVDIDDYADEEDEYEEKLKKENIVFFFLATYGDGEPTDNAARFYKWFTEQKEG  192

Query  680  GVWLKR  697
            G WL++
Sbjct  193  GEWLQK  198



>gb|KDO43868.1| hypothetical protein CISIN_1g005072mg [Citrus sinensis]
Length=715

 Score =   196 bits (497),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 122/186 (66%), Positives = 152/186 (82%), Gaps = 2/186 (1%)
 Frame = +2

Query  143  KLSPFDFMAAIFKGGRIFDQSNASSESASPVA-MLMDNKELMAMLTTSVAVLIGCVFVLV  319
            K+SPFD M+AI +GG++   + +SS S   VA +++DNKE + +LTTS+AVLIGCV V +
Sbjct  14   KVSPFDLMSAIIRGGKVDPSNVSSSGSGVEVASIVLDNKEFVMILTTSIAVLIGCVVVFI  73

Query  320  WRRASSSAKKAVEPPNPEVPKAAEEETGEDGRKKITIFFGTQTGTAEGFAKALAEEAKAR  499
             RR+SSS  K VEP  P V K  E E  +DG++K+TIFFGTQTGTAEGFAKALA+EA+AR
Sbjct  74   LRRSSSSKPKKVEPLKPLVVKEPEVEV-DDGKQKVTIFFGTQTGTAEGFAKALADEARAR  132

Query  500  YEKANvkvvdlddyavdddeyeeklkkeSLVFFFLATYGDGEPTDNAARFYKWFSEGKER  679
            Y+KA  KVVD+DDYA ++DEYEEKLKKE++VFFFLATYGDGEPTDNAARFYKWF+E KE 
Sbjct  133  YDKAIFKVVDIDDYADEEDEYEEKLKKENIVFFFLATYGDGEPTDNAARFYKWFTEQKEG  192

Query  680  GVWLKR  697
            G WL++
Sbjct  193  GEWLQK  198



>ref|XP_004146317.1| PREDICTED: NADPH--cytochrome P450 reductase 2-like [Cucumis sativus]
 gb|AIT72028.1| cytochrome P450 reductase [Cucumis sativus]
 gb|KGN65457.1| hypothetical protein Csa_1G423150 [Cucumis sativus]
Length=708

 Score =   195 bits (496),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 122/192 (64%), Positives = 151/192 (79%), Gaps = 4/192 (2%)
 Frame = +2

Query  122  EMEPTSEKLSPFDFMAAIFKGGRIFDQSNASSESASPVA-MLMDNKELMAMLTTSVAVLI  298
            + E +S K SPFDFM+AI KG    D SN+S +S    A ++ +N+EL+A+LTTS+AV+I
Sbjct  2    QSESSSMKASPFDFMSAIIKGR--MDPSNSSFQSTGEGASVIFENRELVAILTTSIAVMI  59

Query  299  GCVFVLVWRRASSSAKKAVEPPNPEVPKAAEEETGEDGRKKITIFFGTQTGTAEGFAKAL  478
            GC  VLVWRR+ +   K +E P P + K  E E  +DG+KK+TIFFGTQTGTAEGFAKAL
Sbjct  60   GCFVVLVWRRSGNRKVKTIELPKPLLGKEPEPEV-DDGKKKVTIFFGTQTGTAEGFAKAL  118

Query  479  AEEAKARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFLATYGDGEPTDNAARFYKW  658
            ++EAKARY+KA  +VVDLDDY  D+DEYE+KLKKES+  FFLATYGDGEPTDNAARFYKW
Sbjct  119  SDEAKARYDKAKFRVVDLDDYGADEDEYEQKLKKESVAVFFLATYGDGEPTDNAARFYKW  178

Query  659  FSEGKERGVWLK  694
            F+EGKERG  L+
Sbjct  179  FTEGKERGECLQ  190



>ref|XP_006474185.1| PREDICTED: NADPH--cytochrome P450 reductase-like isoform X1 [Citrus 
sinensis]
Length=715

 Score =   195 bits (496),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 122/186 (66%), Positives = 152/186 (82%), Gaps = 2/186 (1%)
 Frame = +2

Query  143  KLSPFDFMAAIFKGGRIFDQSNASSESASPVA-MLMDNKELMAMLTTSVAVLIGCVFVLV  319
            K+SPFD M+AI +GG++   + +SS S   VA +++DNKE + +LTTS+AVLIGCV V +
Sbjct  14   KVSPFDLMSAIIRGGKVDPSNVSSSGSGVEVASIVLDNKEFVMILTTSIAVLIGCVVVFI  73

Query  320  WRRASSSAKKAVEPPNPEVPKAAEEETGEDGRKKITIFFGTQTGTAEGFAKALAEEAKAR  499
             RR+SSS  K VEP  P V K  E E  +DG++K+TIFFGTQTGTAEGFAKALA+EA+AR
Sbjct  74   LRRSSSSKPKKVEPLKPLVVKEPEVEV-DDGKQKVTIFFGTQTGTAEGFAKALADEARAR  132

Query  500  YEKANvkvvdlddyavdddeyeeklkkeSLVFFFLATYGDGEPTDNAARFYKWFSEGKER  679
            Y+KA  KVVD+DDYA ++DEYEEKLKKE++VFFFLATYGDGEPTDNAARFYKWF+E KE 
Sbjct  133  YDKAIFKVVDIDDYADEEDEYEEKLKKENIVFFFLATYGDGEPTDNAARFYKWFTEQKEG  192

Query  680  GVWLKR  697
            G WL++
Sbjct  193  GEWLQK  198



>ref|XP_006453370.1| hypothetical protein CICLE_v10007535mg [Citrus clementina]
 gb|ESR66610.1| hypothetical protein CICLE_v10007535mg [Citrus clementina]
Length=764

 Score =   195 bits (496),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 122/186 (66%), Positives = 152/186 (82%), Gaps = 2/186 (1%)
 Frame = +2

Query  143  KLSPFDFMAAIFKGGRIFDQSNASSESASPVA-MLMDNKELMAMLTTSVAVLIGCVFVLV  319
            K+SPFD M+AI +GG++   + +SS S   VA +++DNKE + +LTTS+AVLIGCV V +
Sbjct  63   KVSPFDLMSAIIRGGKVDPSNVSSSGSGVEVASIVLDNKEFVMILTTSIAVLIGCVVVFI  122

Query  320  WRRASSSAKKAVEPPNPEVPKAAEEETGEDGRKKITIFFGTQTGTAEGFAKALAEEAKAR  499
             RR+SSS  K VEP  P V K  E E  +DG++K+TIFFGTQTGTAEGFAKALA+EA+AR
Sbjct  123  LRRSSSSKPKKVEPLKPLVVKEPEVEV-DDGKQKVTIFFGTQTGTAEGFAKALADEARAR  181

Query  500  YEKANvkvvdlddyavdddeyeeklkkeSLVFFFLATYGDGEPTDNAARFYKWFSEGKER  679
            Y+KA  KVVD+DDYA ++DEYEEKLKKE++VFFFLATYGDGEPTDNAARFYKWF+E KE 
Sbjct  182  YDKAIFKVVDIDDYADEEDEYEEKLKKENIVFFFLATYGDGEPTDNAARFYKWFTEQKEG  241

Query  680  GVWLKR  697
            G WL++
Sbjct  242  GEWLQK  247



>ref|XP_009108997.1| PREDICTED: NADPH--cytochrome P450 reductase 2 [Brassica rapa]
Length=707

 Score =   194 bits (494),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 120/186 (65%), Positives = 143/186 (77%), Gaps = 5/186 (3%)
 Frame = +2

Query  152  PFDFMAAIFKGG--RIFDQSNAS---SESASPVAMLMDNKELMAMLTTSVAVLIGCVFVL  316
            PFD M+AIFKG    + D +NAS   S +A   +ML++N+    ++T S+AVLIGC+ +L
Sbjct  8    PFDLMSAIFKGEPVDVSDPANASAYESVAAELTSMLIENRNFAMIITISIAVLIGCIVLL  67

Query  317  VWRRASSSAKKAVEPPNPEVPKAAEEETGEDGRKKITIFFGTQTGTAEGFAKALAEEAKA  496
            VWRR+S+   K  EP  P V K   E+  +DGRKK+TIFFGTQTGTAEGFAKAL EEA+A
Sbjct  68   VWRRSSARNSKPAEPLKPLVIKPPREDEVDDGRKKVTIFFGTQTGTAEGFAKALGEEARA  127

Query  497  RYEKANvkvvdlddyavdddeyeeklkkeSLVFFFLATYGDGEPTDNAARFYKWFSEGKE  676
            RYEK   K+VDLDDYA DDDEYEEKLKKE + FFFLATYGDGEPTDNAARFYKWF+EG +
Sbjct  128  RYEKTKFKIVDLDDYAADDDEYEEKLKKEDVAFFFLATYGDGEPTDNAARFYKWFTEGSD  187

Query  677  RGVWLK  694
            RG WLK
Sbjct  188  RGEWLK  193



>emb|CDY03543.1| BnaC03g68020D [Brassica napus]
Length=710

 Score =   194 bits (492),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 118/186 (63%), Positives = 143/186 (77%), Gaps = 5/186 (3%)
 Frame = +2

Query  152  PFDFMAAIFKGGRIF--DQSNAS---SESASPVAMLMDNKELMAMLTTSVAVLIGCVFVL  316
            PFD M+AI KG  +   D +NAS   S +A   +ML++N+    ++TTS+A+LIGC+ +L
Sbjct  11   PFDLMSAIIKGEPVVVSDPANASAYESVAAELTSMLIENRNFAMIITTSIAILIGCIVLL  70

Query  317  VWRRASSSAKKAVEPPNPEVPKAAEEETGEDGRKKITIFFGTQTGTAEGFAKALAEEAKA  496
            VWRR+S+   K  EP  P V K   E+  +DGRKK+TIFFGTQTGTAEGFAKAL EEA+A
Sbjct  71   VWRRSSAGNSKPGEPLKPLVIKPPREDEVDDGRKKVTIFFGTQTGTAEGFAKALGEEARA  130

Query  497  RYEKANvkvvdlddyavdddeyeeklkkeSLVFFFLATYGDGEPTDNAARFYKWFSEGKE  676
            RYEK   K+VDLDDYA DDDEYEEKLK+E + FFFLATYGDGEPTDNAARFYKWF+EG +
Sbjct  131  RYEKTRFKIVDLDDYAADDDEYEEKLKQEDVAFFFLATYGDGEPTDNAARFYKWFTEGSD  190

Query  677  RGVWLK  694
            RG WLK
Sbjct  191  RGEWLK  196



>gb|ACF35280.1| cytochrome P450 reductase-like protein [Nothapodytes nimmoniana]
Length=709

 Score =   194 bits (492),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 134/195 (69%), Positives = 157/195 (81%), Gaps = 8/195 (4%)
 Frame = +2

Query  125  MEPTSEKLSPFDFMAAIFKGGRIFDQSNASSESASP----VAMLMDNKELMAMLTTSVAV  292
            M+  + K+SP D M AIFKGGR+ DQSN S +S  P    VAML++N+EL+ +LTTS+AV
Sbjct  1    MQSGNMKVSPLDLMTAIFKGGRV-DQSNMSLDSDEPLPTTVAMLLENRELVMLLTTSLAV  59

Query  293  LIGCVFVLVWRRASSSAKKAVEPPNPEVPKAAEEETG-EDGRKKITIFFGTQTGTAEGFA  469
            L+G + VLV RR   SAK+ VEPP   V K  EEET  +DG+KK+TIFFGTQTGTAEGFA
Sbjct  60   LMGLMVVLVLRR--RSAKQEVEPPKVTVTKVVEEETEVDDGKKKVTIFFGTQTGTAEGFA  117

Query  470  KALAEEAKARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFLATYGDGEPTDNAARF  649
            KALAEEAKARYEKA+ KV DLDDYA DDD+YEEK KKE+L FFFLATYGDGEPTDNAA F
Sbjct  118  KALAEEAKARYEKASFKVFDLDDYAADDDQYEEKFKKETLAFFFLATYGDGEPTDNAATF  177

Query  650  YKWFSEGKERGVWLK  694
            YKWF+EGK++G WLK
Sbjct  178  YKWFTEGKKKGDWLK  192



>ref|NP_849472.2| NADPH--cytochrome P450 reductase 2 [Arabidopsis thaliana]
 gb|AEE85737.1| NADPH--cytochrome P450 reductase 2 [Arabidopsis thaliana]
Length=712

 Score =   193 bits (491),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 123/185 (66%), Positives = 143/185 (77%), Gaps = 6/185 (3%)
 Frame = +2

Query  155  FDFMAAIFKGGRIF--DQSNAS---SESASPVAMLMDNKELMAMLTTSVAVLIGCVFVLV  319
             D MAAI KG  +   D +NAS   S +A   +ML++N++   ++TTS+AVLIGC+ +LV
Sbjct  12   IDLMAAIIKGEPVIVSDPANASAYESVAAELSSMLIENRQFAMIVTTSIAVLIGCIVMLV  71

Query  320  WRRASSSAKKAVEPPNPEVPKAAEEETGEDGRKKITIFFGTQTGTAEGFAKALAEEAKAR  499
            WRR+ S   K VEP  P V K  EEE  +DGRKK+TIFFGTQTGTAEGFAKAL EEAKAR
Sbjct  72   WRRSGSGNSKRVEPLKPLVIKPREEEI-DDGRKKVTIFFGTQTGTAEGFAKALGEEAKAR  130

Query  500  YEKANvkvvdlddyavdddeyeeklkkeSLVFFFLATYGDGEPTDNAARFYKWFSEGKER  679
            YEK   K+VDLDDYA DDDEYEEKLKKE + FFFLATYGDGEPTDNAARFYKWF+EG +R
Sbjct  131  YEKTRFKIVDLDDYAADDDEYEEKLKKEDVAFFFLATYGDGEPTDNAARFYKWFTEGNDR  190

Query  680  GVWLK  694
            G WLK
Sbjct  191  GEWLK  195



>ref|NP_194750.1| NADPH--cytochrome P450 reductase 2 [Arabidopsis thaliana]
 sp|Q9SUM3.1|NCPR2_ARATH RecName: Full=NADPH--cytochrome P450 reductase 2 [Arabidopsis 
thaliana]
 gb|AAK17169.1|AF325101_1 NADPH-ferrihemoprotein reductase (ATR2) [Arabidopsis thaliana]
 emb|CAB52465.1| NADPH-ferrihemoprotein reductase (ATR2) [Arabidopsis thaliana]
 emb|CAB81014.1| NADPH-ferrihemoprotein reductase (ATR2) [Arabidopsis thaliana]
 gb|AEE85738.1| NADPH--cytochrome P450 reductase 2 [Arabidopsis thaliana]
Length=711

 Score =   193 bits (491),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 123/185 (66%), Positives = 143/185 (77%), Gaps = 6/185 (3%)
 Frame = +2

Query  155  FDFMAAIFKGGRIF--DQSNAS---SESASPVAMLMDNKELMAMLTTSVAVLIGCVFVLV  319
             D MAAI KG  +   D +NAS   S +A   +ML++N++   ++TTS+AVLIGC+ +LV
Sbjct  12   IDLMAAIIKGEPVIVSDPANASAYESVAAELSSMLIENRQFAMIVTTSIAVLIGCIVMLV  71

Query  320  WRRASSSAKKAVEPPNPEVPKAAEEETGEDGRKKITIFFGTQTGTAEGFAKALAEEAKAR  499
            WRR+ S   K VEP  P V K  EEE  +DGRKK+TIFFGTQTGTAEGFAKAL EEAKAR
Sbjct  72   WRRSGSGNSKRVEPLKPLVIKPREEEI-DDGRKKVTIFFGTQTGTAEGFAKALGEEAKAR  130

Query  500  YEKANvkvvdlddyavdddeyeeklkkeSLVFFFLATYGDGEPTDNAARFYKWFSEGKER  679
            YEK   K+VDLDDYA DDDEYEEKLKKE + FFFLATYGDGEPTDNAARFYKWF+EG +R
Sbjct  131  YEKTRFKIVDLDDYAADDDEYEEKLKKEDVAFFFLATYGDGEPTDNAARFYKWFTEGNDR  190

Query  680  GVWLK  694
            G WLK
Sbjct  191  GEWLK  195



>emb|CAA46815.1| NADPH-ferrihemoprotein reductase [Arabidopsis thaliana]
Length=712

 Score =   193 bits (490),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 123/185 (66%), Positives = 143/185 (77%), Gaps = 6/185 (3%)
 Frame = +2

Query  155  FDFMAAIFKGGRIF--DQSNAS---SESASPVAMLMDNKELMAMLTTSVAVLIGCVFVLV  319
             D MAAI KG  +   D +NAS   S +A   +ML++N++   ++TTS+AVLIGC+ +LV
Sbjct  12   IDLMAAIIKGEPVIVSDPANASAYESVAAELSSMLIENRQFAMIVTTSIAVLIGCIVMLV  71

Query  320  WRRASSSAKKAVEPPNPEVPKAAEEETGEDGRKKITIFFGTQTGTAEGFAKALAEEAKAR  499
            WRR+ S   K VEP  P V K  EEE  +DGRKK+TIFFGTQTGTAEGFAKAL EEAKAR
Sbjct  72   WRRSGSGNSKRVEPLKPLVIKPREEEI-DDGRKKVTIFFGTQTGTAEGFAKALGEEAKAR  130

Query  500  YEKANvkvvdlddyavdddeyeeklkkeSLVFFFLATYGDGEPTDNAARFYKWFSEGKER  679
            YEK   K+VDLDDYA DDDEYEEKLKKE + FFFLATYGDGEPTDNAARFYKWF+EG +R
Sbjct  131  YEKTRFKIVDLDDYAADDDEYEEKLKKEDVAFFFLATYGDGEPTDNAARFYKWFTEGNDR  190

Query  680  GVWLK  694
            G WLK
Sbjct  191  GEWLK  195



>gb|KDO43871.1| hypothetical protein CISIN_1g005072mg [Citrus sinensis]
Length=714

 Score =   191 bits (486),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 122/186 (66%), Positives = 152/186 (82%), Gaps = 3/186 (2%)
 Frame = +2

Query  143  KLSPFDFMAAIFKGGRIFDQSNASSESASPVA-MLMDNKELMAMLTTSVAVLIGCVFVLV  319
            K+SPFD M+AI +GG++   + +SS S   VA +++DNKE + +LTTS+AVLIGCV V +
Sbjct  14   KVSPFDLMSAIIRGGKVDPSNVSSSGSGVEVASIVLDNKEFVMILTTSIAVLIGCVVVFI  73

Query  320  WRRASSSAKKAVEPPNPEVPKAAEEETGEDGRKKITIFFGTQTGTAEGFAKALAEEAKAR  499
             RR+SSS  K VEP  P V K  E E  +DG++K+TIFFGTQTGTAEGFAKALA+EA+AR
Sbjct  74   LRRSSSSKPKKVEPLKPLVVKEPEVEV-DDGKQKVTIFFGTQTGTAEGFAKALADEARAR  132

Query  500  YEKANvkvvdlddyavdddeyeeklkkeSLVFFFLATYGDGEPTDNAARFYKWFSEGKER  679
            Y+KA  KVVD+DDYA ++DEYEEKLKKE++VFFFLATYGDGEPTDNAARFYKWF+E KE 
Sbjct  133  YDKAIFKVVDIDDYADEEDEYEEKLKKENIVFFFLATYGDGEPTDNAARFYKWFTE-KEG  191

Query  680  GVWLKR  697
            G WL++
Sbjct  192  GEWLQK  197



>ref|XP_002869386.1| hypothetical protein ARALYDRAFT_913457 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45645.1| hypothetical protein ARALYDRAFT_913457 [Arabidopsis lyrata subsp. 
lyrata]
Length=711

 Score =   191 bits (486),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 122/185 (66%), Positives = 143/185 (77%), Gaps = 6/185 (3%)
 Frame = +2

Query  155  FDFMAAIFKGGRIF--DQSNAS---SESASPVAMLMDNKELMAMLTTSVAVLIGCVFVLV  319
             D MAAI KG  +   D +NAS   S +A   +ML++N++   ++TTS+AVLIGC+ +LV
Sbjct  12   IDLMAAIIKGEPVIVSDPANASAYESVAAELSSMLIENRQFAMIVTTSIAVLIGCIVMLV  71

Query  320  WRRASSSAKKAVEPPNPEVPKAAEEETGEDGRKKITIFFGTQTGTAEGFAKALAEEAKAR  499
            WRR+ S   K VEP  P V K  EEE  +DG+KK+TIFFGTQTGTAEGFAKAL EEAKAR
Sbjct  72   WRRSGSGNSKRVEPLKPLVIKPREEEI-DDGKKKVTIFFGTQTGTAEGFAKALGEEAKAR  130

Query  500  YEKANvkvvdlddyavdddeyeeklkkeSLVFFFLATYGDGEPTDNAARFYKWFSEGKER  679
            YEK   K+VDLDDYA DDDEYEEKLKKE + FFFLATYGDGEPTDNAARFYKWF+EG +R
Sbjct  131  YEKTRFKIVDLDDYAADDDEYEEKLKKEDVAFFFLATYGDGEPTDNAARFYKWFTEGNDR  190

Query  680  GVWLK  694
            G WLK
Sbjct  191  GEWLK  195



>ref|XP_006453369.1| hypothetical protein CICLE_v10007535mg [Citrus clementina]
 gb|ESR66609.1| hypothetical protein CICLE_v10007535mg [Citrus clementina]
Length=763

 Score =   191 bits (486),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 122/186 (66%), Positives = 152/186 (82%), Gaps = 3/186 (2%)
 Frame = +2

Query  143  KLSPFDFMAAIFKGGRIFDQSNASSESASPVA-MLMDNKELMAMLTTSVAVLIGCVFVLV  319
            K+SPFD M+AI +GG++   + +SS S   VA +++DNKE + +LTTS+AVLIGCV V +
Sbjct  63   KVSPFDLMSAIIRGGKVDPSNVSSSGSGVEVASIVLDNKEFVMILTTSIAVLIGCVVVFI  122

Query  320  WRRASSSAKKAVEPPNPEVPKAAEEETGEDGRKKITIFFGTQTGTAEGFAKALAEEAKAR  499
             RR+SSS  K VEP  P V K  E E  +DG++K+TIFFGTQTGTAEGFAKALA+EA+AR
Sbjct  123  LRRSSSSKPKKVEPLKPLVVKEPEVEV-DDGKQKVTIFFGTQTGTAEGFAKALADEARAR  181

Query  500  YEKANvkvvdlddyavdddeyeeklkkeSLVFFFLATYGDGEPTDNAARFYKWFSEGKER  679
            Y+KA  KVVD+DDYA ++DEYEEKLKKE++VFFFLATYGDGEPTDNAARFYKWF+E KE 
Sbjct  182  YDKAIFKVVDIDDYADEEDEYEEKLKKENIVFFFLATYGDGEPTDNAARFYKWFTE-KEG  240

Query  680  GVWLKR  697
            G WL++
Sbjct  241  GEWLQK  246



>ref|XP_006474186.1| PREDICTED: NADPH--cytochrome P450 reductase-like isoform X2 [Citrus 
sinensis]
Length=714

 Score =   191 bits (485),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 122/186 (66%), Positives = 152/186 (82%), Gaps = 3/186 (2%)
 Frame = +2

Query  143  KLSPFDFMAAIFKGGRIFDQSNASSESASPVA-MLMDNKELMAMLTTSVAVLIGCVFVLV  319
            K+SPFD M+AI +GG++   + +SS S   VA +++DNKE + +LTTS+AVLIGCV V +
Sbjct  14   KVSPFDLMSAIIRGGKVDPSNVSSSGSGVEVASIVLDNKEFVMILTTSIAVLIGCVVVFI  73

Query  320  WRRASSSAKKAVEPPNPEVPKAAEEETGEDGRKKITIFFGTQTGTAEGFAKALAEEAKAR  499
             RR+SSS  K VEP  P V K  E E  +DG++K+TIFFGTQTGTAEGFAKALA+EA+AR
Sbjct  74   LRRSSSSKPKKVEPLKPLVVKEPEVEV-DDGKQKVTIFFGTQTGTAEGFAKALADEARAR  132

Query  500  YEKANvkvvdlddyavdddeyeeklkkeSLVFFFLATYGDGEPTDNAARFYKWFSEGKER  679
            Y+KA  KVVD+DDYA ++DEYEEKLKKE++VFFFLATYGDGEPTDNAARFYKWF+E KE 
Sbjct  133  YDKAIFKVVDIDDYADEEDEYEEKLKKENIVFFFLATYGDGEPTDNAARFYKWFTE-KEG  191

Query  680  GVWLKR  697
            G WL++
Sbjct  192  GEWLQK  197



>emb|CDY51656.1| BnaAnng10960D [Brassica napus]
Length=706

 Score =   190 bits (482),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 120/192 (63%), Positives = 147/192 (77%), Gaps = 6/192 (3%)
 Frame = +2

Query  134  TSEKLSPFDFMAAIFKGGRIF--DQSNAS---SESASPVAMLMDNKELMAMLTTSVAVLI  298
            +S   SPFD M+AI KG  +   D +NAS   S +A   +ML++N++   +++TS+AVLI
Sbjct  2    SSSSYSPFDLMSAIIKGEPVVVSDPANASAYESVAAELSSMLIENRQFAMIISTSIAVLI  61

Query  299  GCVFVLVWRRASSSAKKAVEPPNPEVPKAAEEETGEDGRKKITIFFGTQTGTAEGFAKAL  478
            GC+ +L+WRR+  S K+ VE   P V K   E+  +DGRKK+TIFFGTQTGTAEGFAKAL
Sbjct  62   GCIVMLLWRRSGGSPKR-VETLKPLVIKPPSEDEVDDGRKKVTIFFGTQTGTAEGFAKAL  120

Query  479  AEEAKARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFLATYGDGEPTDNAARFYKW  658
             EEA+ARYEK   K+VDLDDYA DDDEYEEKLKKE + FFFLATYGDGEPTDNAARFYKW
Sbjct  121  GEEARARYEKTRFKIVDLDDYAADDDEYEEKLKKEDVAFFFLATYGDGEPTDNAARFYKW  180

Query  659  FSEGKERGVWLK  694
            F+EG +RG WLK
Sbjct  181  FTEGDDRGEWLK  192



>dbj|BAG68945.1| cytochrome P450 reductase [Lotus japonicus]
Length=706

 Score =   189 bits (480),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 119/191 (62%), Positives = 148/191 (77%), Gaps = 6/191 (3%)
 Frame = +2

Query  128  EPTSEKLSPFDFMAAIFKGGRIFDQSNASSESASPVAMLMDNKELMAMLTTSVAVLIGCV  307
            E +S K+SP D M+A+ KG    D SN SS S +  ++ ++N+E + +LTTS+AVLIGCV
Sbjct  3    ESSSMKISPLDLMSAMIKG--TLDPSNVSSTSGAG-SVFLENREFVMVLTTSIAVLIGCV  59

Query  308  FVLVWRRASSSAKKAVEPPNPEVPKAAEEETGEDGRKKITIFFGTQTGTAEGFAKALAEE  487
             V +WRR++ +  K++EPP   V K ++E   +DG +K+TIFFGTQTGTAEGFAKA+AEE
Sbjct  60   VVFIWRRSTGNKAKSIEPPKRVVEKLSDEAEVDDGTRKVTIFFGTQTGTAEGFAKAIAEE  119

Query  488  AKARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFLATYGDGEPTDNAARFYKWFSE  667
            AK RYEKA  K+VD+DDYA DDDEYEEKLKKE+L  FFLATYGDGEPTDNAARFYKWF E
Sbjct  120  AKVRYEKAKFKIVDMDDYAQDDDEYEEKLKKETLALFFLATYGDGEPTDNAARFYKWFLE  179

Query  668  G--KERGVWLK  694
            G  KE G WL+
Sbjct  180  GDEKEEG-WLR  189



>gb|ACF35282.1| cytochrome P450 reductase-like protein [Nothapodytes nimmoniana]
Length=681

 Score =   188 bits (477),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 124/192 (65%), Positives = 150/192 (78%), Gaps = 11/192 (6%)
 Frame = +2

Query  125  MEPTSEKLSPFDFMAAIFKGGRIFDQSNASSESASPVAMLMDNKELMAMLTTSVAVLIGC  304
            ME  + K S FDFMAA+  GGR F+ S  S  S  P  ML++N+ELM +LTTSVAVLIGC
Sbjct  1    MESINMKGSSFDFMAALLNGGR-FESSKTSWGSGEP--MLLENRELMMVLTTSVAVLIGC  57

Query  305  VFVLVWRRASSS-AKKAVEPPNPEVPKAAEEETG-EDGRKKITIFFGTQTGTAEGFAKAL  478
            V VLV RR+++  + K V      + K+ EEE+  +DG+KK+TIFFGTQTGTAEGFAKAL
Sbjct  58   VAVLVCRRSTAQRSAKGV------LAKSLEEESEVDDGKKKVTIFFGTQTGTAEGFAKAL  111

Query  479  AEEAKARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFLATYGDGEPTDNAARFYKW  658
            AEEA+ RY+  +VKV+DLDDYA+DD+EY +KL KE+LVFFFLATYGDGEPTDNAARFYKW
Sbjct  112  AEEARTRYQNTSVKVIDLDDYAIDDEEYGKKLSKETLVFFFLATYGDGEPTDNAARFYKW  171

Query  659  FSEGKERGVWLK  694
            F EG+ER  WLK
Sbjct  172  FKEGEERRDWLK  183



>ref|XP_008789667.1| PREDICTED: NADPH--cytochrome P450 reductase [Phoenix dactylifera]
Length=706

 Score =   187 bits (476),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 120/191 (63%), Positives = 143/191 (75%), Gaps = 5/191 (3%)
 Frame = +2

Query  125  MEPTSEKLSPFDFMAAIFKGGRIFDQSNASSESASPVAMLMDNKELMAMLTTSVAVLIGC  304
            ME  S K SP D  +AI  G  + D    S E+   +AM+ +N++L+ +LTTS+AVL+GC
Sbjct  1    MESGSMKPSPLDPFSAILTGKFVGD--GVSPETG--MAMIAENRQLLMILTTSIAVLVGC  56

Query  305  VFVLVWRR-ASSSAKKAVEPPNPEVPKAAEEETGEDGRKKITIFFGTQTGTAEGFAKALA  481
              VLVWRR A     + VEPP P V K   E   +DG+KK+TIFFGTQTGTAEGFAKALA
Sbjct  57   AIVLVWRRSAGKKVSRPVEPPRPLVVKPDREPDMDDGKKKVTIFFGTQTGTAEGFAKALA  116

Query  482  EEAKARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFLATYGDGEPTDNAARFYKWF  661
            EEAK RY+KA  KVVDLDDYA DD++YEEK+KKE+L  FFLATYGDGEPTDNAARFYKWF
Sbjct  117  EEAKMRYDKATFKVVDLDDYAADDEDYEEKMKKETLALFFLATYGDGEPTDNAARFYKWF  176

Query  662  SEGKERGVWLK  694
            +EGKERG  L+
Sbjct  177  TEGKERGNRLE  187



>gb|AIC73829.1| cytochrome P450 reductase [Panax ginseng]
Length=678

 Score =   187 bits (475),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 112/154 (73%), Positives = 131/154 (85%), Gaps = 1/154 (1%)
 Frame = +2

Query  233  VAMLMDNKELMAMLTTSVAVLIGCVFVLVWRRASSS-AKKAVEPPNPEVPKAAEEETGED  409
            +AML++N+EL+ +LTTSVA+LIGCV  L+WRR+SS  + K++EPP   +PK   EE  +D
Sbjct  8    LAMLVENQELLMLLTTSVAILIGCVVFLLWRRSSSQRSAKSLEPPKLVIPKIEPEEEVDD  67

Query  410  GRKKITIFFGTQTGTAEGFAKALAEEAKARYEKANvkvvdlddyavdddeyeeklkkeSL  589
            G+KK+TIFFGTQTGTAEGFAKA +EEA+ARYEKA  KV+DLDDYA DDDEYE KLKKESL
Sbjct  68   GKKKVTIFFGTQTGTAEGFAKAFSEEARARYEKAKFKVIDLDDYAGDDDEYESKLKKESL  127

Query  590  VFFFLATYGDGEPTDNAARFYKWFSEGKERGVWL  691
             FFFLATYGDGEPTDNAARFYKWFSEGKE   WL
Sbjct  128  AFFFLATYGDGEPTDNAARFYKWFSEGKENREWL  161



>ref|XP_006283224.1| hypothetical protein CARUB_v10004254mg [Capsella rubella]
 gb|EOA16122.1| hypothetical protein CARUB_v10004254mg [Capsella rubella]
Length=710

 Score =   187 bits (474),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 121/185 (65%), Positives = 141/185 (76%), Gaps = 6/185 (3%)
 Frame = +2

Query  155  FDFMAAIFKGGRIF--DQSNAS---SESASPVAMLMDNKELMAMLTTSVAVLIGCVFVLV  319
             D MAAI KG  +   D +NAS   S +A   +ML++N++   ++TTS+AVLIGC+ +LV
Sbjct  11   IDLMAAIIKGVPVVVSDPANASAYESVAAELSSMLIENRQFAMIVTTSIAVLIGCIVMLV  70

Query  320  WRRASSSAKKAVEPPNPEVPKAAEEETGEDGRKKITIFFGTQTGTAEGFAKALAEEAKAR  499
             RR+ S   K VEP  P V K  +EE  +DGRKK+TIFFGTQTGTAEGFAKAL EEAKAR
Sbjct  71   LRRSGSGDSKRVEPLKPLVLKPRDEEI-DDGRKKVTIFFGTQTGTAEGFAKALGEEAKAR  129

Query  500  YEKANvkvvdlddyavdddeyeeklkkeSLVFFFLATYGDGEPTDNAARFYKWFSEGKER  679
            YEK   K+VDLDDYA DDDEYEEKLKKE + FFFLATYGDGEPTDNAARFYKWF+EG ER
Sbjct  130  YEKIRFKIVDLDDYAADDDEYEEKLKKEDVAFFFLATYGDGEPTDNAARFYKWFTEGNER  189

Query  680  GVWLK  694
            G WL 
Sbjct  190  GEWLN  194



>gb|AEW43314.1| NADPH cytochrome P450 reductase [Picrorhiza kurrooa]
Length=710

 Score =   186 bits (473),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 132/193 (68%), Positives = 150/193 (78%), Gaps = 5/193 (3%)
 Frame = +2

Query  125  MEPTSEKLSPFDFMAAIFKGGRIFDQSNASSESASP--VAMLMDNKELMAMLTTSVAVLI  298
            M+ T EKLSP D M AI KG  + D  N SSESA    VAML++ +EL+ M+TTS+AVLI
Sbjct  1    MQSTPEKLSPLDLMTAILKGVNL-DTLNISSESAPAPVVAMLLEYRELLMMVTTSIAVLI  59

Query  299  GCVFVLVWRRASSSAKKAVEPPNPEVPKA-AEEETGEDGRKKITIFFGTQTGTAEGFAKA  475
            GC   L  R      KKAVEPP   VPK   E E  +DG+KK+TIFFGTQTGTAEGFAKA
Sbjct  60   GCAVFLALR-GGKKKKKAVEPPKLVVPKGPVEPEEVDDGKKKVTIFFGTQTGTAEGFAKA  118

Query  476  LAEEAKARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFLATYGDGEPTDNAARFYK  655
            LAEEAKARY++A  KVVDLDDYA DD+EYEEK+KKE+L FFFLATYGDGEPTDNAARFYK
Sbjct  119  LAEEAKARYQQAKFKVVDLDDYAADDEEYEEKMKKETLAFFFLATYGDGEPTDNAARFYK  178

Query  656  WFSEGKERGVWLK  694
            WF+EGKE+G WLK
Sbjct  179  WFTEGKEKGDWLK  191



>emb|CDX72222.1| BnaC07g42440D [Brassica napus]
Length=708

 Score =   186 bits (473),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 118/187 (63%), Positives = 144/187 (77%), Gaps = 6/187 (3%)
 Frame = +2

Query  152  PFDFMAAIFKGGRIF--DQSNAS---SESASPVAMLMDNKELMAMLTTSVAVLIGCVFVL  316
            PFD M+AI KG  +   D +NAS   S +A   +ML++N++   +++TS+AVLIGC+ +L
Sbjct  8    PFDLMSAIIKGEPVVVSDPANASAYESVAAELSSMLIENRQFAMIISTSIAVLIGCIVML  67

Query  317  VWRRASSS-AKKAVEPPNPEVPKAAEEETGEDGRKKITIFFGTQTGTAEGFAKALAEEAK  493
            +WRR+  S + K VE   P V K   E+  +DGRKK+TIFFGTQTGTAEGFAKAL EEA+
Sbjct  68   LWRRSGGSGSSKRVETLKPLVIKPPREDEVDDGRKKVTIFFGTQTGTAEGFAKALGEEAR  127

Query  494  ARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFLATYGDGEPTDNAARFYKWFSEGK  673
            ARYEK   K+VDLDDYA DDDEYEEKLKKE + FFFLATYGDGEPTDNAARFYKWF+EG 
Sbjct  128  ARYEKTRFKIVDLDDYAADDDEYEEKLKKEDVAFFFLATYGDGEPTDNAARFYKWFTEGD  187

Query  674  ERGVWLK  694
            +RG WLK
Sbjct  188  DRGEWLK  194



>ref|XP_010928663.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Elaeis guineensis]
Length=706

 Score =   186 bits (471),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 118/191 (62%), Positives = 142/191 (74%), Gaps = 5/191 (3%)
 Frame = +2

Query  125  MEPTSEKLSPFDFMAAIFKGGRIFDQSNASSESASPVAMLMDNKELMAMLTTSVAVLIGC  304
            M+  S K S  D ++AI  G   F     S E+ +  AM+ +N++L+ +LTTS+AVL+GC
Sbjct  1    MDSGSMKPSALDPLSAILTGK--FGGDGVSPETVT--AMITENRQLLMILTTSIAVLVGC  56

Query  305  VFVLVWRR-ASSSAKKAVEPPNPEVPKAAEEETGEDGRKKITIFFGTQTGTAEGFAKALA  481
              VLVWRR A     + VEPP P + K   E   +DG+KK+TIFFGTQTGTAEGFAKALA
Sbjct  57   AIVLVWRRSAGKKVSRPVEPPKPLMVKTDLESEVDDGKKKVTIFFGTQTGTAEGFAKALA  116

Query  482  EEAKARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFLATYGDGEPTDNAARFYKWF  661
            EEAK RY+KA  KVVDLDDYA DD+EYEEK+KKE L  FFLATYGDGEPTDNAARFYKWF
Sbjct  117  EEAKVRYDKATFKVVDLDDYAADDEEYEEKMKKEMLALFFLATYGDGEPTDNAARFYKWF  176

Query  662  SEGKERGVWLK  694
            +EG+ERG WL+
Sbjct  177  TEGEERGNWLE  187



>gb|ABB88839.2| NADPH cytochrome P450 reductase [Stevia rebaudiana]
Length=710

 Score =   185 bits (469),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 121/199 (61%), Positives = 151/199 (76%), Gaps = 12/199 (6%)
 Frame = +2

Query  125  MEPTSEKLSPFDFMAAIFKGGRIFDQSNASSESASP-----VAMLMDNKELMAMLTTSVA  289
            M+  S K+SPFD ++A    G+  ++ NAS ES  P     + ML++N+EL+ + TTS A
Sbjct  1    MQSDSVKVSPFDLVSAAM-NGKAMEKLNAS-ESEDPTTLPALKMLVENRELLTLFTTSFA  58

Query  290  VLIGCVFVLVWRRASSSAKKAVEPPNPEV---PKAAEEETGEDGRKKITIFFGTQTGTAE  460
            VLIGC+  L+WRR+SS  KK V+ P P+V    K  +E   +DG+KK++IF+GTQTGTAE
Sbjct  59   VLIGCLVFLMWRRSSS--KKLVQDPVPQVIVVKKKEKESEVDDGKKKVSIFYGTQTGTAE  116

Query  461  GFAKALAEEAKARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFLATYGDGEPTDNA  640
            GFAKAL EEAK RYEK + KV+DLDDYA DDDEYEEKLKKESL FFFLATYGDGEPTDNA
Sbjct  117  GFAKALVEEAKVRYEKTSFKVIDLDDYAADDDEYEEKLKKESLAFFFLATYGDGEPTDNA  176

Query  641  ARFYKWFSEGKERGVWLKR  697
            A FYKWF+EG ++G WLK+
Sbjct  177  ANFYKWFTEGDDKGEWLKK  195



>gb|KHG21257.1| NADPH--cytochrome P450 reductase [Gossypium arboreum]
Length=711

 Score =   185 bits (469),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 128/185 (69%), Positives = 151/185 (82%), Gaps = 4/185 (2%)
 Frame = +2

Query  143  KLSPFDFMAAIFKGGRIFDQSNASSESASPVA-MLMDNKELMAMLTTSVAVLIGCVFVLV  319
            K+SP D M+AI K     D SNAS++SA+ +A ML++NKE + +LTTS+AVL+GCV VLV
Sbjct  12   KVSPLDLMSAIIK--EKMDPSNASADSAAEMATMLLENKEFVMILTTSIAVLVGCVVVLV  69

Query  320  WRRASSSAKKAVEPPNPEVPKAAEEETGEDGRKKITIFFGTQTGTAEGFAKALAEEAKAR  499
            WRR+ S   K + PP P + K   +E  +DG+KK+TIFFGTQTGTAEGFAKAL EEAKAR
Sbjct  70   WRRSFSQKPKQITPPKPLIVKDRGDEV-DDGKKKVTIFFGTQTGTAEGFAKALVEEAKAR  128

Query  500  YEKANvkvvdlddyavdddeyeeklkkeSLVFFFLATYGDGEPTDNAARFYKWFSEGKER  679
            Y+KA  KVVDLDDYA DDDEYEEK+KKESL FFFLATYGDGEPTDNAARFYKWF+EGKER
Sbjct  129  YDKATFKVVDLDDYAADDDEYEEKMKKESLAFFFLATYGDGEPTDNAARFYKWFTEGKER  188

Query  680  GVWLK  694
            G WL+
Sbjct  189  GEWLQ  193



>gb|AHA50098.1| CYP450 reductase [Panax ginseng]
Length=709

 Score =   184 bits (468),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 127/190 (67%), Positives = 148/190 (78%), Gaps = 7/190 (4%)
 Frame = +2

Query  143  KLSPFDFMAAIFKGGRIFDQSNASSESAS-----PVAMLMDNKELMAMLTTSVAVLIGCV  307
            K+SPFD M  I +GG I D  N+S  +A       +AML+ N+EL+ +LTTSVAVLIGCV
Sbjct  3    KVSPFDLMTEILRGGSI-DPPNSSVSAAGASMQPSLAMLVVNRELLMLLTTSVAVLIGCV  61

Query  308  FVLVWRRASSSAK-KAVEPPNPEVPKAAEEETGEDGRKKITIFFGTQTGTAEGFAKALAE  484
             VLVWR++SS    K+ E P   +PK   EE  +DG+KK+TIFFGTQTGTAEGFAKALAE
Sbjct  62   VVLVWRKSSSQKHAKSFEAPKLLIPKIEPEEVVDDGKKKVTIFFGTQTGTAEGFAKALAE  121

Query  485  EAKARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFLATYGDGEPTDNAARFYKWFS  664
            EAKARYEKA  KV+DLDDYA +DD+YE KLKKESL FFFLATYGDGEPTDNAARFYKWF+
Sbjct  122  EAKARYEKAIFKVIDLDDYAPEDDDYETKLKKESLAFFFLATYGDGEPTDNAARFYKWFT  181

Query  665  EGKERGVWLK  694
            EGKE+  WL 
Sbjct  182  EGKEKREWLN  191



>emb|CDX68634.1| BnaC01g08190D [Brassica napus]
Length=712

 Score =   184 bits (468),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 124/199 (62%), Positives = 147/199 (74%), Gaps = 10/199 (5%)
 Frame = +2

Query  125  MEPTSEKLSPFDFMAAIFKGGRIF--DQSNAS---SESASPVAMLMDNKELMAMLTTSVA  289
            M  T  K SPFD M+AI KG  +   D +NAS   S +A   ++L +N++L  ++TTS+A
Sbjct  1    MSSTPMKASPFDLMSAIIKGEPVVVSDPANASAYESVAAELSSILTENRQLAMIVTTSIA  60

Query  290  VLIGCVFVLVWRRASSSA----KKAVEPPNPEVPKAAEEETGEDGRKKITIFFGTQTGTA  457
            VLIGC+ +LVWRR+  S+    K+      P V K  E+E  +DGRKK+TIFFGTQTGTA
Sbjct  61   VLIGCIVMLVWRRSGGSSGNSSKRVETTLKPLVIKPREDEV-DDGRKKVTIFFGTQTGTA  119

Query  458  EGFAKALAEEAKARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFLATYGDGEPTDN  637
            EGFAKAL EEAKARYEK   K+VDLDDYA DDDEYEEKLKKE + FFFLATYGDGEPTDN
Sbjct  120  EGFAKALGEEAKARYEKIRFKIVDLDDYAADDDEYEEKLKKEDVAFFFLATYGDGEPTDN  179

Query  638  AARFYKWFSEGKERGVWLK  694
            AARFYKWF+EG  RG WLK
Sbjct  180  AARFYKWFTEGNHRGEWLK  198



>ref|XP_010433014.1| PREDICTED: NADPH--cytochrome P450 reductase 2-like [Camelina 
sativa]
Length=709

 Score =   184 bits (467),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 121/185 (65%), Positives = 142/185 (77%), Gaps = 7/185 (4%)
 Frame = +2

Query  155  FDFMAAIFKGGRIF--DQSNAS---SESASPVAMLMDNKELMAMLTTSVAVLIGCVFVLV  319
             D MAAI KG  +   D +NAS   S +A   +ML++N++   ++TTS+AVLIGC+ +LV
Sbjct  9    IDLMAAIIKGEPVVVSDPANASAYESVAAELSSMLIENRQFAMIVTTSIAVLIGCIVMLV  68

Query  320  WRRASSSAK-KAVEPPNPEVPKAAEEETGEDGRKKITIFFGTQTGTAEGFAKALAEEAKA  496
             RR+ SS   K VEPP   V K  EE+  +DGRKK+TIFFGTQTGTAEGFAKAL EEAKA
Sbjct  69   LRRSGSSGDSKRVEPPKSLVIKRREEDV-DDGRKKVTIFFGTQTGTAEGFAKALGEEAKA  127

Query  497  RYEKANvkvvdlddyavdddeyeeklkkeSLVFFFLATYGDGEPTDNAARFYKWFSEGKE  676
            RYEK   K+VDLDDYA DDDEYEEKLKKE + FFFLATYGDGEPTDNAARFYKWF+EG +
Sbjct  128  RYEKIRFKIVDLDDYAADDDEYEEKLKKEDVAFFFLATYGDGEPTDNAARFYKWFTEGND  187

Query  677  RGVWL  691
            RG WL
Sbjct  188  RGEWL  192



>emb|CDY14183.1| BnaA08g13140D [Brassica napus]
Length=696

 Score =   184 bits (467),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 117/182 (64%), Positives = 138/182 (76%), Gaps = 5/182 (3%)
 Frame = +2

Query  164  MAAIFKGG--RIFDQSNAS---SESASPVAMLMDNKELMAMLTTSVAVLIGCVFVLVWRR  328
            M AIFKG    + D +NAS   S +A   +ML +N+    ++TTS+AVLIGC+ ++VWR+
Sbjct  1    MYAIFKGEPVDVSDPANASAYESVAAELTSMLTENRNFAMIITTSIAVLIGCIVMIVWRK  60

Query  329  ASSSAKKAVEPPNPEVPKAAEEETGEDGRKKITIFFGTQTGTAEGFAKALAEEAKARYEK  508
            +SS   K  EP  P V K   E+  EDGRKK+TIFFGTQTGTAEGF KAL EEA+ARYEK
Sbjct  61   SSSGNSKPGEPLKPLVIKPPREDEVEDGRKKVTIFFGTQTGTAEGFTKALGEEARARYEK  120

Query  509  ANvkvvdlddyavdddeyeeklkkeSLVFFFLATYGDGEPTDNAARFYKWFSEGKERGVW  688
               K+VDLDDYA DDDEYEEKLKKE + FFFLATYGDGEPTDNAARFYKWF+EG +RG W
Sbjct  121  TRFKIVDLDDYAADDDEYEEKLKKEDVAFFFLATYGDGEPTDNAARFYKWFTEGSDRGEW  180

Query  689  LK  694
            LK
Sbjct  181  LK  182



>ref|XP_010438203.1| PREDICTED: NADPH--cytochrome P450 reductase 2 [Camelina sativa]
Length=709

 Score =   184 bits (467),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 121/185 (65%), Positives = 142/185 (77%), Gaps = 7/185 (4%)
 Frame = +2

Query  155  FDFMAAIFKGGRIF--DQSNAS---SESASPVAMLMDNKELMAMLTTSVAVLIGCVFVLV  319
             D MAAI KG  +   D +NAS   S +A   +ML++N++   ++TTS+AVLIGC+ +LV
Sbjct  9    IDLMAAIIKGEPVVVSDPANASAYESVAAELSSMLIENRQFAMIVTTSIAVLIGCIVMLV  68

Query  320  WRRASSSAK-KAVEPPNPEVPKAAEEETGEDGRKKITIFFGTQTGTAEGFAKALAEEAKA  496
             RR+ SS   K VEPP   V K  EE+  +DGRKK+TIFFGTQTGTAEGFAKAL EEAKA
Sbjct  69   LRRSGSSGDSKRVEPPKSLVIKRREEDV-DDGRKKVTIFFGTQTGTAEGFAKALGEEAKA  127

Query  497  RYEKANvkvvdlddyavdddeyeeklkkeSLVFFFLATYGDGEPTDNAARFYKWFSEGKE  676
            RYEK   K+VDLDDYA DDDEYEEKLKKE + FFFLATYGDGEPTDNAARFYKWF+EG +
Sbjct  128  RYEKIRFKIVDLDDYAADDDEYEEKLKKEDVAFFFLATYGDGEPTDNAARFYKWFTEGND  187

Query  677  RGVWL  691
            RG WL
Sbjct  188  RGEWL  192



>gb|AIO11759.1| cytochrome p450 reductase [Croton stellatopilosus]
 emb|CDM63949.1| cytochrom p450 reductase [Croton stellatopilosus]
Length=711

 Score =   182 bits (461),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 116/190 (61%), Positives = 142/190 (75%), Gaps = 7/190 (4%)
 Frame = +2

Query  137  SEKLSPFDFMAAIFKGGRIFDQSNASSES--ASPVAMLMDNKELMAMLTTSVAVLIGCVF  310
            ++KLSPFD M+AI KG    D +N SS+S  A    + ++N++ + +LTTS+AVLIGC  
Sbjct  7    ADKLSPFDLMSAIIKGN--MDLTNVSSDSGVAEVATLFLENRQFVMILTTSIAVLIGCAV  64

Query  311  VLVWRRASSSAKKA--VEPPNPEVPKAAEEETGEDGRKKITIFFGTQTGTAEGFAKALAE  484
            V V RR++    K   + P  P + K  E E  +DG+K +TI +GTQTGTAEGFAKA AE
Sbjct  65   VYVLRRSNVQKSKPPPIVPTKPLIVKELEPEP-DDGQKTVTILYGTQTGTAEGFAKAFAE  123

Query  485  EAKARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFLATYGDGEPTDNAARFYKWFS  664
            E KARYEKA  K+VDLDDYA DDDEYE KLKKESLV FF+ATYGDGEPTDNAARFYKWF+
Sbjct  124  EGKARYEKAKFKIVDLDDYAADDDEYEMKLKKESLVLFFVATYGDGEPTDNAARFYKWFT  183

Query  665  EGKERGVWLK  694
            EGK+RG WL+
Sbjct  184  EGKDRGEWLR  193



>gb|KDP36395.1| hypothetical protein JCGZ_08664 [Jatropha curcas]
Length=711

 Score =   182 bits (461),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 129/196 (66%), Positives = 152/196 (78%), Gaps = 9/196 (5%)
 Frame = +2

Query  125  MEPT--SEKLSPFDFMAAIFKGGRIFDQSNASSES-ASPVA-MLMDNKELMAMLTTSVAV  292
            M+P+  S K+SPFD M+AI KG    D +N SSES A  VA M ++N+E + +LTTS+AV
Sbjct  1    MQPSTGSMKISPFDLMSAIIKGN--IDPTNVSSESGAVEVATMFLENREFVMILTTSIAV  58

Query  293  LIGCVFVLVWRRASSSAKKA--VEPPNPEVPKAAEEETGEDGRKKITIFFGTQTGTAEGF  466
            LIGC  VLV RR+S    K   +EPP P + K  E E  +DG+KK+TIFFGTQTGTAEGF
Sbjct  59   LIGCAVVLVLRRSSGQKSKTAIIEPPKPLIVKEPEPEV-DDGQKKVTIFFGTQTGTAEGF  117

Query  467  AKALAEEAKARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFLATYGDGEPTDNAAR  646
            AKALAEEAKARYEKA  +VVDLD++A DDDEYE KLKKESL  FF+ATYGDGEPTDNAAR
Sbjct  118  AKALAEEAKARYEKATFRVVDLDEFAADDDEYERKLKKESLCLFFVATYGDGEPTDNAAR  177

Query  647  FYKWFSEGKERGVWLK  694
            FYKWF+EG ERG WL+
Sbjct  178  FYKWFTEGNERGEWLQ  193



>ref|XP_010447751.1| PREDICTED: NADPH--cytochrome P450 reductase 2-like [Camelina 
sativa]
Length=710

 Score =   181 bits (460),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 118/186 (63%), Positives = 138/186 (74%), Gaps = 8/186 (4%)
 Frame = +2

Query  155  FDFMAAIFKGGRIF--DQSNASS-ESASP--VAMLMDNKELMAMLTTSVAVLIGCVFVLV  319
             D MAAI KG  +   D +NAS+ ES +    +ML++N++   ++TTS+AVLIGC+ +LV
Sbjct  9    IDLMAAIIKGEPVVVSDPANASAYESVADELSSMLIENRQFAMIVTTSIAVLIGCIVMLV  68

Query  320  WRRASSSAK-KAVEPPNPEVPKAAEEETGEDGRKKITIFFGTQTGTAEGFAKALAEEAKA  496
             RR+ SS   K VEPP   V K  EE+  +DGRKK+TIFFGTQTGTAEGFAKAL EEAKA
Sbjct  69   LRRSGSSGDSKRVEPPKSLVIKRREEDV-DDGRKKVTIFFGTQTGTAEGFAKALGEEAKA  127

Query  497  RYEKAN-vkvvdlddyavdddeyeeklkkeSLVFFFLATYGDGEPTDNAARFYKWFSEGK  673
            RYEK     V   D  A DDDEYEEKLKKE LVFFFLATYGDGEPTDNAARFYKWF+EG 
Sbjct  128  RYEKIRFKIVDLDDYAAADDDEYEEKLKKEDLVFFFLATYGDGEPTDNAARFYKWFTEGN  187

Query  674  ERGVWL  691
            +RG WL
Sbjct  188  DRGEWL  193



>ref|XP_010265447.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Nelumbo nucifera]
Length=704

 Score =   181 bits (459),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 129/192 (67%), Positives = 149/192 (78%), Gaps = 6/192 (3%)
 Frame = +2

Query  125  MEPTSEKLSPFDFMAAIFKGGRIFDQSNASSESASPVAMLMDNKELMAMLTTSVAVLIGC  304
            M   S K+S  D M+A  K  R  D SN S+ S    A+L++NKE + +LTTS+AVLIGC
Sbjct  1    MNSESVKVSALDLMSAFLK--RNSDPSNVSTTSGE--AILIENKEFLMILTTSIAVLIGC  56

Query  305  VFVLVWRRASSSAK-KAVEPPNPEVPKAAEEETGEDGRKKITIFFGTQTGTAEGFAKALA  481
            VFV VWRR+S   + K VE P P + K  E E  +DG KK+TIFFGTQTGT+EGFAKALA
Sbjct  57   VFVFVWRRSSGQKESKGVEAPKPVIVKEPEPEV-DDGTKKVTIFFGTQTGTSEGFAKALA  115

Query  482  EEAKARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFLATYGDGEPTDNAARFYKWF  661
            EEAKARYEKA  KVVDLDDYA DDDEYEEK+KKE+L FFFLATYGDGEPTDNAARFYKWF
Sbjct  116  EEAKARYEKATFKVVDLDDYAADDDEYEEKMKKETLAFFFLATYGDGEPTDNAARFYKWF  175

Query  662  SEGKERGVWLKR  697
            +EGKERG WL++
Sbjct  176  TEGKERGTWLEK  187



>ref|XP_004296434.1| PREDICTED: NADPH--cytochrome P450 reductase 2 [Fragaria vesca 
subsp. vesca]
Length=709

 Score =   181 bits (459),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 122/187 (65%), Positives = 144/187 (77%), Gaps = 3/187 (2%)
 Frame = +2

Query  134  TSEKLSPFDFMAAIFKGGRIFDQSNASSESASPVAMLMDNKELMAMLTTSVAVLIGCVFV  313
            +S K+SP D MAAIF+G    D SN SS  A   +++++N+E + +LTTS+AVLIGCV V
Sbjct  7    SSMKISPLDLMAAIFRGK--MDPSNTSSAGAEVASVILENREFVMILTTSIAVLIGCVVV  64

Query  314  LVWRRASSSAKKAVEPPNPEVPKAAEEETGEDGRKKITIFFGTQTGTAEGFAKALAEEAK  493
             VWRR+S+   K V+P  P V    E E  +DG KK+TIFFGTQTGTAEGFAKALAEEAK
Sbjct  65   FVWRRSSAQKPKLVQPLKPLVIPEPEPEL-DDGSKKVTIFFGTQTGTAEGFAKALAEEAK  123

Query  494  ARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFLATYGDGEPTDNAARFYKWFSEGK  673
            ARY+K   KVVDLDDYA DD+ YEEKLK ESL  FFLATYGDGEPTDNAARFYKWF+EGK
Sbjct  124  ARYDKVTFKVVDLDDYAADDEAYEEKLKNESLAIFFLATYGDGEPTDNAARFYKWFTEGK  183

Query  674  ERGVWLK  694
            E+  WL+
Sbjct  184  EKEAWLQ  190



>ref|XP_010525727.1| PREDICTED: NADPH--cytochrome P450 reductase 2 [Tarenaya hassleriana]
Length=713

 Score =   181 bits (458),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 129/188 (69%), Positives = 145/188 (77%), Gaps = 5/188 (3%)
 Frame = +2

Query  143  KLSPFDFMAAIFKG-GRIFDQSNAS---SESASPVAMLMDNKELMAMLTTSVAVLIGCVF  310
            K+SP D M+AI KG   + D +NAS   S +A   A+L +N+E  A+LTTS+AVLIGCVF
Sbjct  11   KMSPLDLMSAIIKGKSAVSDPANASVYESVAAEFAAILTENREFAALLTTSIAVLIGCVF  70

Query  311  VLVWRRASSSAKKAVEPPNPEVPKAAEEETGEDGRKKITIFFGTQTGTAEGFAKALAEEA  490
             LVWRR+  +  K VEP  P V K  EEE  EDGRKK+TIFFGTQTGTAEGFAKALAEEA
Sbjct  71   FLVWRRSGGNKPKRVEPLKPLVLKPREEEV-EDGRKKVTIFFGTQTGTAEGFAKALAEEA  129

Query  491  KARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFLATYGDGEPTDNAARFYKWFSEG  670
            KARYEKA  KVVDL+DYA DDDEY EKLKKE   FFFLATYGDGEPTDNAARFYKWF+EG
Sbjct  130  KARYEKARFKVVDLEDYAADDDEYAEKLKKEKFAFFFLATYGDGEPTDNAARFYKWFTEG  189

Query  671  KERGVWLK  694
             + G  LK
Sbjct  190  DDNGEMLK  197



>emb|CDP02981.1| unnamed protein product [Coffea canephora]
Length=662

 Score =   180 bits (456),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 113/146 (77%), Positives = 124/146 (85%), Gaps = 1/146 (1%)
 Frame = +2

Query  269  MLTTSVAVLIGCVFVLVWRRASSSAKKAVEPPNPEVPKAAEE-ETGEDGRKKITIFFGTQ  445
            +LTTSVAVLIGCV  LVWRR+S+S KK  EPP   + K+ EE E  +DGR K+TIFFGTQ
Sbjct  2    ILTTSVAVLIGCVVALVWRRSSASTKKVAEPPKLIMTKSVEEPEEIDDGRTKVTIFFGTQ  61

Query  446  TGTAEGFAKALAEEAKARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFLATYGDGE  625
            TGTAEGFAKALA+EAKARYEKA  KV DLDDYA DD+EYEEKLKKE+L FFFLATYGDGE
Sbjct  62   TGTAEGFAKALADEAKARYEKAVFKVTDLDDYAADDEEYEEKLKKETLAFFFLATYGDGE  121

Query  626  PTDNAARFYKWFSEGKERGVWLKRSS  703
            PTDNAARFYKWF+EGKERG WLK  S
Sbjct  122  PTDNAARFYKWFAEGKERGDWLKNLS  147



>gb|KFK29577.1| nadph-ferrihemoprotein reductase [Arabis alpina]
Length=715

 Score =   180 bits (456),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 115/184 (63%), Positives = 140/184 (76%), Gaps = 6/184 (3%)
 Frame = +2

Query  146  LSPFDFMAAIFKGGRIF--DQSNAS---SESASPVAMLMDNKELMAMLTTSVAVLIGCVF  310
            +SP D M+AI KG  +   D +NAS   S +A    ML++N++   ++TTS+AVLIGC+ 
Sbjct  13   VSPLDLMSAIIKGEPVVVSDPANASAYESVAAELSTMLIENRQFAMIVTTSIAVLIGCIV  72

Query  311  VLVWRRASSSAKKAVEPPNPEVPKAAEEETGEDGRKKITIFFGTQTGTAEGFAKALAEEA  490
            +LV+RR+ S   K VEP  P V K  E+E  +DGRKK+TIFFGTQTGTAEGFAKAL +EA
Sbjct  73   MLVYRRSGSGNSKRVEPLKPLVIKPREDEV-DDGRKKVTIFFGTQTGTAEGFAKALGDEA  131

Query  491  KARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFLATYGDGEPTDNAARFYKWFSEG  670
            + RYEK   K+VDLDDYA DDDEYEEKLKKE + FFFLATYGDGEPTDNAARFYKWF+E 
Sbjct  132  RVRYEKTRFKIVDLDDYAADDDEYEEKLKKEDVAFFFLATYGDGEPTDNAARFYKWFTEE  191

Query  671  KERG  682
             +RG
Sbjct  192  NDRG  195



>ref|XP_009385909.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Musa acuminata 
subsp. malaccensis]
Length=703

 Score =   179 bits (455),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 113/189 (60%), Positives = 139/189 (74%), Gaps = 5/189 (3%)
 Frame = +2

Query  125  MEPTSEKLSPFDFMAAIFKGGRIFDQSNASSESASPVAMLMDNKELMAMLTTSVAVLIGC  304
            M+  S K SP D ++AI  G       +     A  +A + +N++L+A++TTSVAVL+GC
Sbjct  1    MQSESAKPSPLDLLSAILAGSL---GGDGLPSGAGSLAAIAENRQLLAIVTTSVAVLVGC  57

Query  305  VFVLVWRRASSSAKKAVEPPNPEVPKAAEEETGEDGRKKITIFFGTQTGTAEGFAKALAE  484
              +  +RR  SS KK  EPP P V +   E   +DG+KK+T+FFGTQTGTAEGFAKAL +
Sbjct  58   ALIFFFRR--SSGKKPAEPPKPLVVRVLPELEVDDGKKKVTVFFGTQTGTAEGFAKALTD  115

Query  485  EAKARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFLATYGDGEPTDNAARFYKWFS  664
            EAKARY+ A  KVVDLD+YA DDDEYEEK+KKE+L  FFLATYGDGEPTDNAARFYKWF+
Sbjct  116  EAKARYQNAIFKVVDLDEYAADDDEYEEKMKKETLAVFFLATYGDGEPTDNAARFYKWFT  175

Query  665  EGKERGVWL  691
            EGKERG WL
Sbjct  176  EGKERGNWL  184



>ref|XP_008391625.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Malus domestica]
Length=712

 Score =   178 bits (452),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 123/194 (63%), Positives = 147/194 (76%), Gaps = 5/194 (3%)
 Frame = +2

Query  122  EMEPTSEKLSPFDFMAAIFKGGRIFDQSNASSE--SASPVAMLMDNKELMAMLTTSVAVL  295
            E    S K+SP D MAAI KG    D +NAS++   A   +++++N+E + +LTTS+AVL
Sbjct  2    ESSSNSMKISPLDLMAAIIKGK--MDPANASADFSGAQVTSVILENREFVMILTTSIAVL  59

Query  296  IGCVFVLVWRRASSSAK-KAVEPPNPEVPKAAEEETGEDGRKKITIFFGTQTGTAEGFAK  472
            IGCV V V RR SS  + + ++PP P +    E E  +DG +K+TIFFGTQTGTAEGFAK
Sbjct  60   IGCVVVFVLRRFSSQKQSRVLQPPKPLIVLEPEPEEVDDGSRKVTIFFGTQTGTAEGFAK  119

Query  473  ALAEEAKARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFLATYGDGEPTDNAARFY  652
            ALAEEAKARYEK   KVVDLDDYA DD+ YEEKLK ESL FFFLATYGDGEPTDNAARFY
Sbjct  120  ALAEEAKARYEKVTFKVVDLDDYAADDEAYEEKLKNESLAFFFLATYGDGEPTDNAARFY  179

Query  653  KWFSEGKERGVWLK  694
            KWF+EG+ERG WLK
Sbjct  180  KWFTEGEERGEWLK  193



>ref|XP_008451695.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Cucumis melo]
Length=705

 Score =   178 bits (452),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 124/192 (65%), Positives = 149/192 (78%), Gaps = 6/192 (3%)
 Frame = +2

Query  125  MEPTSE--KLSPFDFMAAIFKGGRIFDQSNASSESASPVA-MLMDNKELMAMLTTSVAVL  295
            M+P S   K+SP + M+AI +  +  D S  SSES   VA +++DN+E + +LTTS+AVL
Sbjct  1    MQPESRSMKVSPLELMSAIIR--KAMDPSQDSSESVREVATLILDNREFVMILTTSIAVL  58

Query  296  IGCVFVLVWRRASSSAKKAVEPPNPEVPKAAEEETGEDGRKKITIFFGTQTGTAEGFAKA  475
            IGCV V VW+R+S    K  EPP   + K  E E  +DG+KK+T+FFGTQTGTAEGFAKA
Sbjct  59   IGCVVVFVWKRSSGQKSKPFEPPKQLIVKEPEPEV-DDGKKKVTVFFGTQTGTAEGFAKA  117

Query  476  LAEEAKARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFLATYGDGEPTDNAARFYK  655
            LAEEAKARY+KA  +VVDLDDYA DDDEYEEKLKKE+L  FFLATYGDGEPTDNAARFYK
Sbjct  118  LAEEAKARYDKATFRVVDLDDYAADDDEYEEKLKKETLAIFFLATYGDGEPTDNAARFYK  177

Query  656  WFSEGKERGVWL  691
            WFSEGKE+G W+
Sbjct  178  WFSEGKEKGEWI  189



>ref|XP_011010331.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Populus euphratica]
Length=712

 Score =   178 bits (452),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 119/189 (63%), Positives = 141/189 (75%), Gaps = 6/189 (3%)
 Frame = +2

Query  143  KLSPFDFMAAIFKGGRIFDQSNASSESASPVA----MLMDNKELMAMLTTSVAVLIGCVF  310
            K+SP + M AI +G    D  N SSES    A    ++++N+E + +LTTS+AVL+G V 
Sbjct  9    KVSPLELMQAIIRGK--VDPENVSSESGGSAAEMATLILENREFVMILTTSIAVLVGYVV  66

Query  311  VLVWRRASSSAKKAVEPPNPEVPKAAEEETGEDGRKKITIFFGTQTGTAEGFAKALAEEA  490
            VL+WRR+S   K  V  P   +     E   +DG+KK+TIFFGTQTGTAEGFAKALAEEA
Sbjct  67   VLIWRRSSGYQKPKVPVPPKPLIVKDLEPEVDDGKKKVTIFFGTQTGTAEGFAKALAEEA  126

Query  491  KARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFLATYGDGEPTDNAARFYKWFSEG  670
            +ARYEKA  K VDLDDYA DDDEYEEKLKKESLV FFLATYGDGEPTDNAARFYKWF++G
Sbjct  127  RARYEKAIFKTVDLDDYAEDDDEYEEKLKKESLVIFFLATYGDGEPTDNAARFYKWFTDG  186

Query  671  KERGVWLKR  697
             ERG WLK+
Sbjct  187  NERGEWLKQ  195



>gb|AHB33950.1| cytochrome P450 reductase [Santalum album]
Length=704

 Score =   178 bits (452),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 118/196 (60%), Positives = 143/196 (73%), Gaps = 11/196 (6%)
 Frame = +2

Query  125  MEPTSEKLSPFDFMAAIFKGGRIFDQSNASSESASPVAMLMDNKELMAMLTTSVAVLIGC  304
            M+ +S KL P D M AIF GG       + + S   ++ML++N+E++  LTTS+AVLIGC
Sbjct  1    MQLSSVKLIPLDLMTAIFNGG------GSPAGSGEALSMLLENREVVVALTTSLAVLIGC  54

Query  305  VFVLVWRRASS----SAKKAVE-PPNPEVPKAAEEETGEDGRKKITIFFGTQTGTAEGFA  469
            VF  +WR +SS    +A K VE    P + K +E    +DG+KK+TIFFGTQTGTAEGFA
Sbjct  55   VFAYLWRFSSSQKAVAAAKGVEVARKPVIGKESEAAEVDDGKKKVTIFFGTQTGTAEGFA  114

Query  470  KALAEEAKARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFLATYGDGEPTDNAARF  649
            KAL EEAKARYEKA  K+VDLDDYA +DDEYEEKLKKE    FFLATYGDGEPTDNAARF
Sbjct  115  KALVEEAKARYEKAIFKLVDLDDYAAEDDEYEEKLKKEKFALFFLATYGDGEPTDNAARF  174

Query  650  YKWFSEGKERGVWLKR  697
            YKWF+E  E G WL++
Sbjct  175  YKWFTEENESGEWLQK  190



>emb|CDY28169.1| BnaA01g06800D [Brassica napus]
Length=696

 Score =   178 bits (451),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 118/195 (61%), Positives = 143/195 (73%), Gaps = 18/195 (9%)
 Frame = +2

Query  125  MEPTSEKLSPFDFMAAIFKGGRIF--DQSNAS---SESASPVAMLMDNKELMAMLTTSVA  289
            M  T  K+SPFD M+AI KG  +   D +NAS   S +A   ++L +N++L  ++TTS+A
Sbjct  1    MSSTPMKVSPFDLMSAIIKGEPVVVSDPANASAYESVAAELSSILTENRQLAMIVTTSIA  60

Query  290  VLIGCVFVLVWRRASSSAKKAVEPPNPEVPKAAEEETGEDGRKKITIFFGTQTGTAEGFA  469
            VLIGC+ +LVWRR+  S+  +              +  +DGRKK+TIFFGTQTGTAEGFA
Sbjct  61   VLIGCIVMLVWRRSGGSSGNS-------------SKRVDDGRKKVTIFFGTQTGTAEGFA  107

Query  470  KALAEEAKARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFLATYGDGEPTDNAARF  649
            KAL EEAKARYEK   K+VDLDDYA DDDEYEEKLKKE + FFFLATYGDGEPTDNAARF
Sbjct  108  KALGEEAKARYEKIRFKIVDLDDYAADDDEYEEKLKKEDVAFFFLATYGDGEPTDNAARF  167

Query  650  YKWFSEGKERGVWLK  694
            YKWF+EG +RG WLK
Sbjct  168  YKWFTEGNDRGEWLK  182



>ref|XP_004168364.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Cucumis sativus]
Length=708

 Score =   178 bits (451),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 124/192 (65%), Positives = 149/192 (78%), Gaps = 6/192 (3%)
 Frame = +2

Query  125  MEPTSE--KLSPFDFMAAIFKGGRIFDQSNASSESASPVA-MLMDNKELMAMLTTSVAVL  295
            M+P S   K+SP + M+AI +  +  D S  SSES   VA +++DN+E + +LTTS+AVL
Sbjct  1    MQPESRSMKVSPLELMSAIIR--KAMDPSQDSSESVREVATLILDNREFVMILTTSIAVL  58

Query  296  IGCVFVLVWRRASSSAKKAVEPPNPEVPKAAEEETGEDGRKKITIFFGTQTGTAEGFAKA  475
            IGCV V VW+R+S    K  EPP   + K  E E  +DG+KK+T+FFGTQTGTAEGFAKA
Sbjct  59   IGCVVVFVWKRSSGQKAKPFEPPKQLIVKEPEPEV-DDGKKKVTVFFGTQTGTAEGFAKA  117

Query  476  LAEEAKARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFLATYGDGEPTDNAARFYK  655
            LAEEAKARY+KA  +VVDLDDYA DDDEYEEKLKKE+L  FFLATYGDGEPTDNAARFYK
Sbjct  118  LAEEAKARYDKATFRVVDLDDYAADDDEYEEKLKKETLAIFFLATYGDGEPTDNAARFYK  177

Query  656  WFSEGKERGVWL  691
            WFSEGKE+G W+
Sbjct  178  WFSEGKEKGEWI  189



>ref|XP_004148333.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Cucumis sativus]
 gb|KGN61141.1| hypothetical protein Csa_2G059720 [Cucumis sativus]
Length=708

 Score =   178 bits (451),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 124/192 (65%), Positives = 149/192 (78%), Gaps = 6/192 (3%)
 Frame = +2

Query  125  MEPTSE--KLSPFDFMAAIFKGGRIFDQSNASSESASPVA-MLMDNKELMAMLTTSVAVL  295
            M+P S   K+SP + M+AI +  +  D S  SSES   VA +++DN+E + +LTTS+AVL
Sbjct  1    MQPESRSMKVSPLELMSAIIR--KAMDPSQDSSESVREVATLILDNREFVMILTTSIAVL  58

Query  296  IGCVFVLVWRRASSSAKKAVEPPNPEVPKAAEEETGEDGRKKITIFFGTQTGTAEGFAKA  475
            IGCV V VW+R+S    K  EPP   + K  E E  +DG+KK+T+FFGTQTGTAEGFAKA
Sbjct  59   IGCVVVFVWKRSSGQKAKPFEPPKQLIVKEPEPEV-DDGKKKVTVFFGTQTGTAEGFAKA  117

Query  476  LAEEAKARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFLATYGDGEPTDNAARFYK  655
            LAEEAKARY+KA  +VVDLDDYA DDDEYEEKLKKE+L  FFLATYGDGEPTDNAARFYK
Sbjct  118  LAEEAKARYDKATFRVVDLDDYAADDDEYEEKLKKETLAIFFLATYGDGEPTDNAARFYK  177

Query  656  WFSEGKERGVWL  691
            WFSEGKE+G W+
Sbjct  178  WFSEGKEKGEWI  189



>gb|KCW80968.1| hypothetical protein EUGRSUZ_C02330 [Eucalyptus grandis]
Length=703

 Score =   177 bits (450),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 127/188 (68%), Positives = 147/188 (78%), Gaps = 8/188 (4%)
 Frame = +2

Query  143  KLSPFDFMAAIFKGGRIFDQSNASSESASPVA-MLMDNKELMAMLTTSVAVLIGCVFVLV  319
            K SP D MAAI  G    D SN+S+E AS +A ++++N++ + +LTTS+AVLIGCV V V
Sbjct  11   KASPLDLMAAIITGK--VDPSNSSAEPASELASIILENRQFVMILTTSIAVLIGCVVVFV  68

Query  320  WRRASSSAKK---AVEPPNPEVPKAAEEETGEDGRKKITIFFGTQTGTAEGFAKALAEEA  490
            WRR  SSAKK     EPP P   +   E   +DG+KK+ IFFGTQTGTAEGFAKA+AEEA
Sbjct  69   WRR--SSAKKPRLGFEPPKPPAVREEPEPEVDDGKKKVAIFFGTQTGTAEGFAKAMAEEA  126

Query  491  KARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFLATYGDGEPTDNAARFYKWFSEG  670
            KARYEKA  KVVDLDDYA DD+EYEEKLKKE+L FFFLATYGDGEPTDNAARFYKWF EG
Sbjct  127  KARYEKAVFKVVDLDDYAADDEEYEEKLKKENLAFFFLATYGDGEPTDNAARFYKWFYEG  186

Query  671  KERGVWLK  694
            KERG WL+
Sbjct  187  KERGEWLQ  194



>ref|XP_010048643.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Eucalyptus 
grandis]
 gb|KCW80967.1| hypothetical protein EUGRSUZ_C02330 [Eucalyptus grandis]
Length=711

 Score =   177 bits (450),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 127/188 (68%), Positives = 147/188 (78%), Gaps = 8/188 (4%)
 Frame = +2

Query  143  KLSPFDFMAAIFKGGRIFDQSNASSESASPVA-MLMDNKELMAMLTTSVAVLIGCVFVLV  319
            K SP D MAAI  G    D SN+S+E AS +A ++++N++ + +LTTS+AVLIGCV V V
Sbjct  11   KASPLDLMAAIITGK--VDPSNSSAEPASELASIILENRQFVMILTTSIAVLIGCVVVFV  68

Query  320  WRRASSSAKK---AVEPPNPEVPKAAEEETGEDGRKKITIFFGTQTGTAEGFAKALAEEA  490
            WRR  SSAKK     EPP P   +   E   +DG+KK+ IFFGTQTGTAEGFAKA+AEEA
Sbjct  69   WRR--SSAKKPRLGFEPPKPPAVREEPEPEVDDGKKKVAIFFGTQTGTAEGFAKAMAEEA  126

Query  491  KARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFLATYGDGEPTDNAARFYKWFSEG  670
            KARYEKA  KVVDLDDYA DD+EYEEKLKKE+L FFFLATYGDGEPTDNAARFYKWF EG
Sbjct  127  KARYEKAVFKVVDLDDYAADDEEYEEKLKKENLAFFFLATYGDGEPTDNAARFYKWFYEG  186

Query  671  KERGVWLK  694
            KERG WL+
Sbjct  187  KERGEWLQ  194



>ref|XP_007154761.1| hypothetical protein PHAVU_003G145400g [Phaseolus vulgaris]
 gb|ESW26755.1| hypothetical protein PHAVU_003G145400g [Phaseolus vulgaris]
Length=707

 Score =   177 bits (450),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 115/188 (61%), Positives = 144/188 (77%), Gaps = 4/188 (2%)
 Frame = +2

Query  134  TSEKLSPFDFMAAIFKGGRIFDQSNASSESASPVAMLMDNKELMAMLTTSVAVLIGCVFV  313
            +S K+SP D M+A+ KG    D SN SS ++S   + ++N++ + +LTTS+AV IGCV V
Sbjct  5    SSMKISPLDLMSAMIKG--TLDPSNTSSSNSSAATVFLENRQFVMILTTSIAVFIGCVVV  62

Query  314  LVWRRASSSAKKAVEPPNPEVPKAAEEETGEDGRKKITIFFGTQTGTAEGFAKALAEEAK  493
             VWRR+++   K +EPP   V K  E E  +DG KK+T+FFGTQTGTAEGF+KA+AEEAK
Sbjct  63   FVWRRSATPKTKPLEPPKRVVEKLPEIEL-DDGTKKVTVFFGTQTGTAEGFSKAIAEEAK  121

Query  494  ARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFLATYGDGEPTDNAARFYKWFSEGK  673
            ARYEKA  +VVDLDDYA DD+EYE +LKKE  V FFLATYGDGEPTDNAARFYKWF+EG 
Sbjct  122  ARYEKATFRVVDLDDYAADDEEYEARLKKEKYVLFFLATYGDGEPTDNAARFYKWFTEGG  181

Query  674  ERGV-WLK  694
            E+G  WL+
Sbjct  182  EKGEGWLE  189



>emb|CAQ37789.1| NADPH:cytochrome P450 reductase [Solenostemon scutellarioides]
Length=711

 Score =   177 bits (449),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 136/193 (70%), Positives = 152/193 (79%), Gaps = 4/193 (2%)
 Frame = +2

Query  125  MEPTSEKLSPFDFMAAIFKGGRIFDQSNASSESASP--VAMLMDNKELMAMLTTSVAVLI  298
            ME T EKLSP D M AI KG ++ D SN S+    P  VAMLM+NK+LM MLTTSVAVL+
Sbjct  1    MESTIEKLSPLDLMTAILKGVKL-DNSNGSAGVEHPAVVAMLMENKDLMMMLTTSVAVLL  59

Query  299  GCVFVLVWRRASSSAKKAVEPPNPEVPKA-AEEETGEDGRKKITIFFGTQTGTAEGFAKA  475
            G V  LVWRR + SAKK VEP    VPK   E E  +DG+KK+TIFFGTQTGTAEGFAKA
Sbjct  60   GLVVYLVWRRGAGSAKKVVEPQKLVVPKGPVEVEEVDDGKKKVTIFFGTQTGTAEGFAKA  119

Query  476  LAEEAKARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFLATYGDGEPTDNAARFYK  655
            LAEEAKARY +AN KVVD+DDYA DD+EYEEK+KKE+  FFFLATYGDGEPTDNAARFYK
Sbjct  120  LAEEAKARYPQANFKVVDMDDYAADDEEYEEKMKKETFAFFFLATYGDGEPTDNAARFYK  179

Query  656  WFSEGKERGVWLK  694
            WFSEGK+RG   K
Sbjct  180  WFSEGKDRGDMFK  192



>gb|AGO03799.1| cytochrome P450-like protein [Tanacetum cinerariifolium]
Length=709

 Score =   176 bits (447),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 113/197 (57%), Positives = 146/197 (74%), Gaps = 7/197 (4%)
 Frame = +2

Query  125  MEPTSEKLSPFDFMAAIFKGGRIFDQSNASSE-SASP-VAMLMDNKELMAMLTTSVAVLI  298
            M+  S ++SPFD  +++    ++ +  N S E + SP + ML++N++++ + TT++AVLI
Sbjct  1    MQTDSVQVSPFDLASSLL-NVKLTETLNTSEELTMSPAMKMLVENRDMLTLFTTTIAVLI  59

Query  299  GCVFVLVWRRA---SSSAKKAVEPPNPEVPKA-AEEETGEDGRKKITIFFGTQTGTAEGF  466
            GCV VLVWR++    S   K VE     +PK   + E  +DG+KK+TI FGTQTGTAEGF
Sbjct  60   GCVVVLVWRKSFTKKSVVNKEVETMKIVLPKKEIKHEEVDDGKKKVTILFGTQTGTAEGF  119

Query  467  AKALAEEAKARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFLATYGDGEPTDNAAR  646
            AKAL EEAK RYEKA  K +DLDDYA DD+EYEEK KKESL FFFLATYGDGEPTDNAAR
Sbjct  120  AKALLEEAKVRYEKAVFKAIDLDDYAADDEEYEEKFKKESLAFFFLATYGDGEPTDNAAR  179

Query  647  FYKWFSEGKERGVWLKR  697
            FYKWF+EG ++G WLK+
Sbjct  180  FYKWFTEGDDKGEWLKK  196



>gb|EYU20907.1| hypothetical protein MIMGU_mgv1a002097mg [Erythranthe guttata]
Length=715

 Score =   174 bits (442),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 130/196 (66%), Positives = 155/196 (79%), Gaps = 6/196 (3%)
 Frame = +2

Query  125  MEPTSEKLSPFDFMAAIFKGGRI----FDQSNASSESASPVAMLMDNKELMAMLTTSVAV  292
            MEPT EKLS  D +AAIFKG ++        +ASS S++ VAMLM+N+ L+ +LTTS AV
Sbjct  1    MEPTPEKLSALDVVAAIFKGVKLDSSNGSSESASSASSAVVAMLMENRNLVMVLTTSFAV  60

Query  293  LIGCVFVLVWRRASSSAKK-AVEPPNPEVPKAAEEETG-EDGRKKITIFFGTQTGTAEGF  466
            L+GC  VL WRR   SAKK  VEP   +V KAA E    +DG+KK+++FFGTQTGTAEGF
Sbjct  61   LVGCAVVLAWRRTGGSAKKKQVEPSKLQVEKAAAEAAEIDDGKKKVSVFFGTQTGTAEGF  120

Query  467  AKALAEEAKARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFLATYGDGEPTDNAAR  646
            AKA AEEAKARY++AN KV+DLDDYA DD++YEEKLKKE+L FFFLA+YGDGEPTDNAAR
Sbjct  121  AKAFAEEAKARYQEANFKVIDLDDYAEDDEQYEEKLKKETLAFFFLASYGDGEPTDNAAR  180

Query  647  FYKWFSEGKERGVWLK  694
            FYKWF+EG ERG WLK
Sbjct  181  FYKWFTEGNERGDWLK  196



>ref|XP_008776011.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Phoenix dactylifera]
Length=484

 Score =   172 bits (436),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 117/195 (60%), Positives = 139/195 (71%), Gaps = 19/195 (10%)
 Frame = +2

Query  119  SEMEPTSEKLSPFDFMAAIFKGGRIFDQSNASSESASPVAMLMDNKELMAMLTTSVAVLI  298
            +EM+P +      D M+AI  G   +D      E       +    +L+A+LTTSVAVL+
Sbjct  4    AEMKPLA-----LDLMSAILSGK--YDGEGVPPE-------VRGKWDLVAVLTTSVAVLV  49

Query  299  GCVFVLVWRRASSS-AKKAVEPPNPEVPKAAEEETGE--DGRKKITIFFGTQTGTAEGFA  469
            GC  +L+WRR+    A  A+EPP P  P   EE   E  DGRKK+ +FFGTQTGTAEGFA
Sbjct  50   GCALLLLWRRSGGKKAAPAIEPPRP--PAVGEEPQHEIDDGRKKVAVFFGTQTGTAEGFA  107

Query  470  KALAEEAKARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFLATYGDGEPTDNAARF  649
            K+L EEA+ARYEKA  KVVDLDDYA DDDEYEEK+KKE+L  FFLATYGDGEPTDNAARF
Sbjct  108  KSLTEEARARYEKAVFKVVDLDDYAADDDEYEEKIKKETLALFFLATYGDGEPTDNAARF  167

Query  650  YKWFSEGKERGVWLK  694
            YKWF+EGKERGVWL+
Sbjct  168  YKWFTEGKERGVWLQ  182



>ref|XP_006372087.1| hypothetical protein POPTR_0018s09980g [Populus trichocarpa]
 gb|ERP49884.1| hypothetical protein POPTR_0018s09980g [Populus trichocarpa]
Length=466

 Score =   171 bits (434),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 123/188 (65%), Positives = 142/188 (76%), Gaps = 6/188 (3%)
 Frame = +2

Query  143  KLSPFDFMAAIFKGGRIFDQSNASSESASPVA----MLMDNKELMAMLTTSVAVLIGCVF  310
            K+SP D M AI KG    D +N SSES   VA    ++++N+E + +LTTS+AVLIGCV 
Sbjct  9    KVSPLDLMQAIIKGK--VDPANVSSESGGSVAEVATLILENREFVMILTTSIAVLIGCVV  66

Query  311  VLVWRRASSSAKKAVEPPNPEVPKAAEEETGEDGRKKITIFFGTQTGTAEGFAKALAEEA  490
            VL+WRR+S   +  V  P   +     E   +DG+KK+TIFFGTQTGTAEGFAKALAEEA
Sbjct  67   VLIWRRSSGYQRPKVPVPPKPLIVKDLEPEVDDGKKKVTIFFGTQTGTAEGFAKALAEEA  126

Query  491  KARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFLATYGDGEPTDNAARFYKWFSEG  670
            KARY+KA  K VDLDDYA DDDEYEEKLKKE LV FFLATYGDGEPTDNAARFYKWF+EG
Sbjct  127  KARYDKATFKTVDLDDYAGDDDEYEEKLKKEDLVIFFLATYGDGEPTDNAARFYKWFTEG  186

Query  671  KERGVWLK  694
             ERG WLK
Sbjct  187  NERGEWLK  194



>ref|XP_009408053.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Musa acuminata 
subsp. malaccensis]
Length=705

 Score =   174 bits (440),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 106/190 (56%), Positives = 139/190 (73%), Gaps = 4/190 (2%)
 Frame = +2

Query  125  MEPTSEKLSPFDFMAAIFKGGRIFDQSNASSESASPVAMLMDNKELMAMLTTSVAVLIGC  304
            M+  + K SP D ++AI +G     + +     A   AM++++++++ +L+TSVAVL+GC
Sbjct  1    MQTGTGKPSPIDLLSAILEGSL---RGDGFPPGAGAAAMIVEDRQILMILSTSVAVLVGC  57

Query  305  VFVLVWRRASSSAKKAVEPPNPEVPKAAEEETGEDGRKKITIFFGTQTGTAEGFAKALAE  484
              +   RR S   KK VEPP P   +       +DG+KK+++FFGTQTGTAEGFAKAL +
Sbjct  58   ALIFFLRR-SGGKKKLVEPPKPLAVRVLPAAEADDGKKKVSVFFGTQTGTAEGFAKALVD  116

Query  485  EAKARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFLATYGDGEPTDNAARFYKWFS  664
            EA ARY  A+ KVVDLD+YA DDDEYEEK+KKE+L  FF+ATYGDGEPTDNAARFYKWF+
Sbjct  117  EATARYNNASFKVVDLDEYAADDDEYEEKMKKETLALFFVATYGDGEPTDNAARFYKWFT  176

Query  665  EGKERGVWLK  694
            EGKERG+WLK
Sbjct  177  EGKERGLWLK  186



>ref|XP_003549436.1| PREDICTED: NADPH--cytochrome P450 reductase [Glycine max]
Length=707

 Score =   173 bits (438),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 123/189 (65%), Positives = 146/189 (77%), Gaps = 5/189 (3%)
 Frame = +2

Query  134  TSEKLSPFDFMAAIFKGGRIFDQSNASSES-ASPVAMLMDNKELMAMLTTSVAVLIGCVF  310
            +S K+SP D M+AIFKG    D SN SS + A+  A L++N++ + +LTTSVAVLIGCV 
Sbjct  5    SSMKISPLDLMSAIFKGK--LDPSNVSSSTNAAAAAFLLENRDFLMLLTTSVAVLIGCVV  62

Query  311  VLVWRRASSSAKKAVEPPNPEVPKAAEEETGEDGRKKITIFFGTQTGTAEGFAKALAEEA  490
            V +WRR+SS   K +EPP   V K  E E  +DG KK+TI FGTQTGTAEGFAKA AEEA
Sbjct  63   VFIWRRSSSPKAKPLEPPKRVVEKLPEIEV-DDGTKKVTILFGTQTGTAEGFAKATAEEA  121

Query  491  KARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFLATYGDGEPTDNAARFYKWFSEG  670
            KARYEKA  +VVD+DDYA DDDEYEE+ KKE+ V FFLATYGDGEPTDNAARFYKWF+EG
Sbjct  122  KARYEKATFRVVDMDDYAADDDEYEERFKKETHVLFFLATYGDGEPTDNAARFYKWFTEG  181

Query  671  KERGV-WLK  694
             E+G  WL+
Sbjct  182  GEKGEGWLQ  190



>ref|XP_011043963.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Populus euphratica]
Length=712

 Score =   173 bits (438),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 127/196 (65%), Positives = 148/196 (76%), Gaps = 8/196 (4%)
 Frame = +2

Query  125  MEPTSE--KLSPFDFMAAIFKGGRIFDQSNASSESASPVA----MLMDNKELMAMLTTSV  286
            ME TS   K+SP D M AI KG    D +N SSES   VA    ++++N+E + +LTTS+
Sbjct  1    MESTSSSIKVSPLDIMQAIIKGK--VDPTNVSSESGGSVAEVATLILENREFVMILTTSI  58

Query  287  AVLIGCVFVLVWRRASSSAKKAVEPPNPEVPKAAEEETGEDGRKKITIFFGTQTGTAEGF  466
            AVLIGCV VL+WRR+S   +  V  P   +     E   +DG+KK+TIFFGTQTGTAEGF
Sbjct  59   AVLIGCVVVLIWRRSSGYQRPKVPVPPKPLIVKDLEPEVDDGKKKVTIFFGTQTGTAEGF  118

Query  467  AKALAEEAKARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFLATYGDGEPTDNAAR  646
            AKALAEEAKARY+KA  K +DLDDYAVDDDEYEEKLKKE+LV FFLATYGDGEPTDNAAR
Sbjct  119  AKALAEEAKARYDKATFKTIDLDDYAVDDDEYEEKLKKENLVIFFLATYGDGEPTDNAAR  178

Query  647  FYKWFSEGKERGVWLK  694
            FYKWF+EG ERG WLK
Sbjct  179  FYKWFTEGNERGEWLK  194



>ref|XP_006372088.1| hypothetical protein POPTR_0018s09980g [Populus trichocarpa]
 gb|ERP49885.1| hypothetical protein POPTR_0018s09980g [Populus trichocarpa]
Length=516

 Score =   171 bits (433),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 123/188 (65%), Positives = 142/188 (76%), Gaps = 6/188 (3%)
 Frame = +2

Query  143  KLSPFDFMAAIFKGGRIFDQSNASSESASPVA----MLMDNKELMAMLTTSVAVLIGCVF  310
            K+SP D M AI KG    D +N SSES   VA    ++++N+E + +LTTS+AVLIGCV 
Sbjct  9    KVSPLDLMQAIIKGK--VDPANVSSESGGSVAEVATLILENREFVMILTTSIAVLIGCVV  66

Query  311  VLVWRRASSSAKKAVEPPNPEVPKAAEEETGEDGRKKITIFFGTQTGTAEGFAKALAEEA  490
            VL+WRR+S   +  V  P   +     E   +DG+KK+TIFFGTQTGTAEGFAKALAEEA
Sbjct  67   VLIWRRSSGYQRPKVPVPPKPLIVKDLEPEVDDGKKKVTIFFGTQTGTAEGFAKALAEEA  126

Query  491  KARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFLATYGDGEPTDNAARFYKWFSEG  670
            KARY+KA  K VDLDDYA DDDEYEEKLKKE LV FFLATYGDGEPTDNAARFYKWF+EG
Sbjct  127  KARYDKATFKTVDLDDYAGDDDEYEEKLKKEDLVIFFLATYGDGEPTDNAARFYKWFTEG  186

Query  671  KERGVWLK  694
             ERG WLK
Sbjct  187  NERGEWLK  194



>gb|AAC05022.1| NADPH:ferrihemoprotein oxidoreductase [Eschscholzia californica]
Length=705

 Score =   172 bits (435),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 120/190 (63%), Positives = 150/190 (79%), Gaps = 5/190 (3%)
 Frame = +2

Query  125  MEPTSEKLSPFDFMAAIFKGGRIFDQSNASSESASPVAMLMDNKELMAMLTTSVAVLIGC  304
            ME T+ K+S FD  ++I  G    D SN SS+S++  A+L++N+E++ +LTT++AV IGC
Sbjct  1    MEQTAVKVSLFDLFSSILNGK--LDPSNFSSDSSA--AILIENREILMILTTAIAVFIGC  56

Query  305  VFVLVWRRASSSAKKAVEPPNPEVPKAAEEETGEDGRKKITIFFGTQTGTAEGFAKALAE  484
             F+ VWRR+S+ + K VE     V K  E E  +DG+KK+TIFFGTQTGTAEGFAKALAE
Sbjct  57   GFLYVWRRSSNKSSKIVETQKLIVEKEPEPEV-DDGKKKVTIFFGTQTGTAEGFAKALAE  115

Query  485  EAKARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFLATYGDGEPTDNAARFYKWFS  664
            EAKARYEKA  KV+DLDDY  DDDE+EEKLKKE++  FFLATYGDGEPTDNAARFYKWF+
Sbjct  116  EAKARYEKAIFKVIDLDDYGADDDEFEEKLKKETIALFFLATYGDGEPTDNAARFYKWFT  175

Query  665  EGKERGVWLK  694
            EGKER +WL+
Sbjct  176  EGKEREMWLQ  185



>ref|XP_010913661.1| PREDICTED: LOW QUALITY PROTEIN: NADPH--cytochrome P450 reductase-like 
[Elaeis guineensis]
Length=706

 Score =   171 bits (434),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 119/191 (62%), Positives = 146/191 (76%), Gaps = 5/191 (3%)
 Frame = +2

Query  125  MEPTSEKLSPFDFMAAIFKGGRIFDQSNASSESASPVAMLMDNKELMAMLTTSVAVLIGC  304
            ME  S KLSP D ++AI  G   F     S E  +  AM+ +N++L+ +LTTS+AVL+GC
Sbjct  1    MESESMKLSPMDLLSAILTGK--FSVEGVSLEMGA--AMIAENRQLLMILTTSLAVLVGC  56

Query  305  VFVLVWRRASSS-AKKAVEPPNPEVPKAAEEETGEDGRKKITIFFGTQTGTAEGFAKALA  481
            V V VWRR++   A + VEPP P V K   E   +DG+KK+TIFFGTQTGTAEGFAKALA
Sbjct  57   VIVFVWRRSTGKKASRPVEPPRPLVLKTDLEPEVDDGKKKVTIFFGTQTGTAEGFAKALA  116

Query  482  EEAKARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFLATYGDGEPTDNAARFYKWF  661
            EEAKARY+KA  KVVDLD+YA DD+EYEEK+KKE+L  FFLATYGDGEPTDNAA+FY+WF
Sbjct  117  EEAKARYDKATFKVVDLDEYADDDEEYEEKMKKETLALFFLATYGDGEPTDNAAKFYRWF  176

Query  662  SEGKERGVWLK  694
            +EGKER  W++
Sbjct  177  TEGKERENWVE  187



>gb|AAK15261.1|AF302498_1 NADPH-cytochrome P450 oxydoreductase isoform 3 [Populus trichocarpa 
x Populus deltoides]
Length=712

 Score =   171 bits (434),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 122/188 (65%), Positives = 142/188 (76%), Gaps = 6/188 (3%)
 Frame = +2

Query  143  KLSPFDFMAAIFKGGRIFDQSNASSESASPVA----MLMDNKELMAMLTTSVAVLIGCVF  310
            K+SP D M AI KG    D +N SSES   VA    ++++N+E + +LTTS+AVLIGCV 
Sbjct  9    KVSPLDLMQAIIKGK--VDPANVSSESGGSVAEVATLILENREFVMILTTSIAVLIGCVV  66

Query  311  VLVWRRASSSAKKAVEPPNPEVPKAAEEETGEDGRKKITIFFGTQTGTAEGFAKALAEEA  490
            VL+WRR+S   +  V  P   +     E   +DG+KK+TIFFGTQTGTAEGFAKALAEEA
Sbjct  67   VLIWRRSSGYQRPKVPVPPKPLIVKDLEPEVDDGKKKVTIFFGTQTGTAEGFAKALAEEA  126

Query  491  KARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFLATYGDGEPTDNAARFYKWFSEG  670
            KARY+KA  K VD+DDYA DDDEYEEKLKKE LV FFLATYGDGEPTDNAARFYKWF+EG
Sbjct  127  KARYDKATFKTVDMDDYAGDDDEYEEKLKKEDLVIFFLATYGDGEPTDNAARFYKWFTEG  186

Query  671  KERGVWLK  694
             ERG WLK
Sbjct  187  NERGEWLK  194



>ref|XP_002324469.1| putative NADPH-cytochrome P450 reductase family protein [Populus 
trichocarpa]
 gb|EEF03034.1| putative NADPH-cytochrome P450 reductase family protein [Populus 
trichocarpa]
Length=712

 Score =   171 bits (433),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 123/188 (65%), Positives = 142/188 (76%), Gaps = 6/188 (3%)
 Frame = +2

Query  143  KLSPFDFMAAIFKGGRIFDQSNASSESASPVA----MLMDNKELMAMLTTSVAVLIGCVF  310
            K+SP D M AI KG    D +N SSES   VA    ++++N+E + +LTTS+AVLIGCV 
Sbjct  9    KVSPLDLMQAIIKGK--VDPANVSSESGGSVAEVATLILENREFVMILTTSIAVLIGCVV  66

Query  311  VLVWRRASSSAKKAVEPPNPEVPKAAEEETGEDGRKKITIFFGTQTGTAEGFAKALAEEA  490
            VL+WRR+S   +  V  P   +     E   +DG+KK+TIFFGTQTGTAEGFAKALAEEA
Sbjct  67   VLIWRRSSGYQRPKVPVPPKPLIVKDLEPEVDDGKKKVTIFFGTQTGTAEGFAKALAEEA  126

Query  491  KARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFLATYGDGEPTDNAARFYKWFSEG  670
            KARY+KA  K VDLDDYA DDDEYEEKLKKE LV FFLATYGDGEPTDNAARFYKWF+EG
Sbjct  127  KARYDKATFKTVDLDDYAGDDDEYEEKLKKEDLVIFFLATYGDGEPTDNAARFYKWFTEG  186

Query  671  KERGVWLK  694
             ERG WLK
Sbjct  187  NERGEWLK  194



>ref|XP_008383106.1| PREDICTED: NADPH--cytochrome P450 reductase isoform X2 [Malus 
domestica]
Length=708

 Score =   169 bits (429),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 119/192 (62%), Positives = 140/192 (73%), Gaps = 5/192 (3%)
 Frame = +2

Query  122  EMEPTSEKLSPFDFMAAIFKGGRIFDQSNASSESASPVAMLMDNKELMAMLTTSVAVLIG  301
            E    S K+SP D MAAI KG        A    A   +++++N+E + +LTTS+AVLIG
Sbjct  2    ESSSNSMKISPLDLMAAIIKG----KMDPADFSGAQVTSVILENREFVMILTTSIAVLIG  57

Query  302  CVFVLVWRRASSSAKKAV-EPPNPEVPKAAEEETGEDGRKKITIFFGTQTGTAEGFAKAL  478
            CV VLV RR+S+     V + P P + +  E    ++G KK+TIFFGTQTGTAEGFAKAL
Sbjct  58   CVVVLVLRRSSAQKHPGVIQSPRPLIVEEPEPVEADNGSKKVTIFFGTQTGTAEGFAKAL  117

Query  479  AEEAKARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFLATYGDGEPTDNAARFYKW  658
            AEEAKARYEK   KVVDLDDYA DD+ YEEKLK ESL FFFLATYGDGEPTDNAARFYKW
Sbjct  118  AEEAKARYEKVTFKVVDLDDYAADDEAYEEKLKNESLAFFFLATYGDGEPTDNAARFYKW  177

Query  659  FSEGKERGVWLK  694
            F+EG+ERG WLK
Sbjct  178  FTEGEERGEWLK  189



>ref|XP_008383105.1| PREDICTED: NADPH--cytochrome P450 reductase isoform X1 [Malus 
domestica]
Length=709

 Score =   169 bits (429),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 119/192 (62%), Positives = 140/192 (73%), Gaps = 5/192 (3%)
 Frame = +2

Query  122  EMEPTSEKLSPFDFMAAIFKGGRIFDQSNASSESASPVAMLMDNKELMAMLTTSVAVLIG  301
            E    S K+SP D MAAI KG        A    A   +++++N+E + +LTTS+AVLIG
Sbjct  2    ESSSNSMKISPLDLMAAIIKG----KMDPADFSGAQVTSVILENREFVMILTTSIAVLIG  57

Query  302  CVFVLVWRRASSSAKKAV-EPPNPEVPKAAEEETGEDGRKKITIFFGTQTGTAEGFAKAL  478
            CV VLV RR+S+     V + P P + +  E    ++G KK+TIFFGTQTGTAEGFAKAL
Sbjct  58   CVVVLVLRRSSAQKHPGVIQSPRPLIVEEPEPVEADNGSKKVTIFFGTQTGTAEGFAKAL  117

Query  479  AEEAKARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFLATYGDGEPTDNAARFYKW  658
            AEEAKARYEK   KVVDLDDYA DD+ YEEKLK ESL FFFLATYGDGEPTDNAARFYKW
Sbjct  118  AEEAKARYEKVTFKVVDLDDYAADDEAYEEKLKNESLAFFFLATYGDGEPTDNAARFYKW  177

Query  659  FSEGKERGVWLK  694
            F+EG+ERG WLK
Sbjct  178  FTEGEERGEWLK  189



>gb|AAB97736.1| NADPH cytochrome P450 reductase [Petroselinum crispum]
Length=681

 Score =   169 bits (427),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 108/154 (70%), Positives = 129/154 (84%), Gaps = 0/154 (0%)
 Frame = +2

Query  236  AMLMDNKELMAMLTTSVAVLIGCVFVLVWRRASSSAKKAVEPPNPEVPKAAEEETGEDGR  415
            A L++N++L+ +LTTS+AVLIGC  VLVWRR+S  + K+VEPP   VPK   E+  +DG+
Sbjct  12   ATLLENRDLLMLLTTSIAVLIGCAVVLVWRRSSLRSVKSVEPPKLIVPKVEIEDEVDDGK  71

Query  416  KKITIFFGTQTGTAEGFAKALAEEAKARYEKANvkvvdlddyavdddeyeeklkkeSLVF  595
            KK+T+FFGTQTGTAEGFAKA AEEAKARYEKA  +VVDLDDYA +D+EYE K KKES  F
Sbjct  72   KKVTVFFGTQTGTAEGFAKAFAEEAKARYEKAKFRVVDLDDYAAEDEEYEAKFKKESFAF  131

Query  596  FFLATYGDGEPTDNAARFYKWFSEGKERGVWLKR  697
            FFLATYGDGEPTDNAARFYKWFSEG+E+G WL +
Sbjct  132  FFLATYGDGEPTDNAARFYKWFSEGEEKGDWLNK  165



>gb|AAS90127.1| NADPH cytochrome P450 reductase [Ammi majus]
Length=681

 Score =   169 bits (427),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 108/154 (70%), Positives = 130/154 (84%), Gaps = 0/154 (0%)
 Frame = +2

Query  236  AMLMDNKELMAMLTTSVAVLIGCVFVLVWRRASSSAKKAVEPPNPEVPKAAEEETGEDGR  415
            A L++N++L+ +LTTS+AVLIGC  VLVWRR+S  + K+VEPP   VPK   E+  +DG+
Sbjct  12   ATLLENRDLLMLLTTSIAVLIGCAVVLVWRRSSLRSVKSVEPPKLIVPKVEIEDEVDDGK  71

Query  416  KKITIFFGTQTGTAEGFAKALAEEAKARYEKANvkvvdlddyavdddeyeeklkkeSLVF  595
            KK+T+FFGTQTGTAEGFAKA AEEAKARYEKA  +V+DLDDYA +D+EYEEK KKES  F
Sbjct  72   KKVTVFFGTQTGTAEGFAKAFAEEAKARYEKAKFRVIDLDDYAAEDEEYEEKFKKESFAF  131

Query  596  FFLATYGDGEPTDNAARFYKWFSEGKERGVWLKR  697
            FFLATYGDGEPTDNAARFYKWFSEG+E+G WL +
Sbjct  132  FFLATYGDGEPTDNAARFYKWFSEGEEKGEWLNK  165



>ref|XP_008781895.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Phoenix dactylifera]
Length=706

 Score =   169 bits (427),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 117/191 (61%), Positives = 144/191 (75%), Gaps = 5/191 (3%)
 Frame = +2

Query  125  MEPTSEKLSPFDFMAAIFKGGRIFDQSNASSESASPVAMLMDNKELMAMLTTSVAVLIGC  304
            ME  S K SP D ++AI  G   F     S E+ +  A++ +N++L+ +LTTS+AVL+GC
Sbjct  1    MESGSMKPSPLDLLSAILTGK--FGVEGMSQETGA--ALIAENRQLLMILTTSIAVLVGC  56

Query  305  VFVLVWRRASSS-AKKAVEPPNPEVPKAAEEETGEDGRKKITIFFGTQTGTAEGFAKALA  481
              V VWRR++   A + VEPP P V K   E   +DG+KK+TIFFGTQTGTAEGFAKALA
Sbjct  57   AIVFVWRRSTGKKASRPVEPPRPLVVKTDLEPEVDDGKKKVTIFFGTQTGTAEGFAKALA  116

Query  482  EEAKARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFLATYGDGEPTDNAARFYKWF  661
            EEAKARY+KA  KVVDLDDYA DD+EYEE +KKE+L  FFLATYGDGEPTDNAARF++WF
Sbjct  117  EEAKARYDKATFKVVDLDDYAADDEEYEENMKKETLAVFFLATYGDGEPTDNAARFFRWF  176

Query  662  SEGKERGVWLK  694
            +EGKER  WL+
Sbjct  177  TEGKERESWLE  187



>gb|AIL29328.1| cytochrome P450 reductase [Pinus contorta]
Length=718

 Score =   167 bits (424),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 113/184 (61%), Positives = 137/184 (74%), Gaps = 6/184 (3%)
 Frame = +2

Query  143  KLSPFDFMAAIFKGGRIFDQSNASSESASPVAMLMDNKELMAMLTTSVAVLIGCVFVLVW  322
            ++S  D++ A+F  G+     +  +   S V +L +N +L+ +LTTS+AVLIGCV   VW
Sbjct  21   EISRLDYVLALFVNGK----GDLGAMMGSAV-VLRENSQLLMVLTTSLAVLIGCVLFFVW  75

Query  323  RRASSSAKKAVEPPNPEVPKAAEEETGEDGRKKITIFFGTQTGTAEGFAKALAEEAKARY  502
            RR  S+  K  E P P V +  EEE  + G+KK+T+FFGTQTGTAEGFAK+LAEEAKARY
Sbjct  76   RRGGSAPSKPPEKPTPLVKEEEEEEEDDSGKKKVTVFFGTQTGTAEGFAKSLAEEAKARY  135

Query  503  EKANvkvvdlddyavdddeyeeklkkeSLVFFFLATYGDGEPTDNAARFYKWFSEG-KER  679
            +KA  KVVDLDDYA DD+ YEEKLKKE L FF LATYGDGEPTDNAARFYKWF+EG KER
Sbjct  136  DKAVFKVVDLDDYAADDELYEEKLKKEKLAFFMLATYGDGEPTDNAARFYKWFTEGEKER  195

Query  680  GVWL  691
            G WL
Sbjct  196  GPWL  199



>ref|XP_009414761.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Musa acuminata 
subsp. malaccensis]
Length=700

 Score =   167 bits (423),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 109/190 (57%), Positives = 136/190 (72%), Gaps = 9/190 (5%)
 Frame = +2

Query  125  MEPTSEKLSPFDFMAAIFKGGRIFDQSNASSESASPVAMLMDNKELMAMLTTSVAVLIGC  304
            M   S K SP D ++AI +G  +   + A+       A + +N++L+A+LTTSVAVL+GC
Sbjct  1    MRSGSAKPSPLDLLSAILRGDGLPPGTGAA-------AAIAENQQLLAILTTSVAVLVGC  53

Query  305  VFVLVWRRASSSAKKAVEPPNPEVPKAAEEETGEDGRKKITIFFGTQTGTAEGFAKALAE  484
             F+  +RR  S  KK    P P V K   E   +DG+KK+T+FFGTQTGTAEGFAKALA+
Sbjct  54   AFMFFFRR--SLGKKPPSLPKPLVVKVQPEAEVDDGKKKVTVFFGTQTGTAEGFAKALAD  111

Query  485  EAKARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFLATYGDGEPTDNAARFYKWFS  664
            EAK+RY     KVVDLD YA DDDEYEEK+KKE+L  FF+ATYGDGEPTDNAARF+KWF+
Sbjct  112  EAKSRYHNTAFKVVDLDQYAADDDEYEEKMKKETLALFFMATYGDGEPTDNAARFFKWFT  171

Query  665  EGKERGVWLK  694
            EGKER  WL+
Sbjct  172  EGKERENWLE  181



>gb|EPS67504.1| hypothetical protein M569_07270, partial [Genlisea aurea]
Length=710

 Score =   167 bits (422),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 114/190 (60%), Positives = 142/190 (75%), Gaps = 4/190 (2%)
 Frame = +2

Query  137  SEKLSPFDFMAAIFKGGRIFDQSNASSESASPVAMLMDNKELMAMLTTSVAVLIGCVFVL  316
            SEKLS FD MAAI KGG+  + SN    S+   ++L + +E + +LTTS AVL+GCV V 
Sbjct  2    SEKLSLFDLMAAILKGGKPDESSNLLWNSSELSSLLKEKREFVMLLTTSFAVLVGCVLVF  61

Query  317  VWRRASSSAK----KAVEPPNPEVPKAAEEETGEDGRKKITIFFGTQTGTAEGFAKALAE  484
            +WRRA  SAK    +A +    +  +  EEE   DG+K+I+IFFGTQTGTAEGFAKA AE
Sbjct  62   MWRRAVGSAKAKDFEATKFVLSKGDEDEEEEDAGDGKKRISIFFGTQTGTAEGFAKAFAE  121

Query  485  EAKARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFLATYGDGEPTDNAARFYKWFS  664
            EA+ARY +A  KV+DLD+YA DD++YEEKLKKE+L  FFLA+YGDGEPTDNA+RFYKWF+
Sbjct  122  EARARYPQATFKVIDLDEYADDDEQYEEKLKKEALAIFFLASYGDGEPTDNASRFYKWFT  181

Query  665  EGKERGVWLK  694
            E  ERG WLK
Sbjct  182  EDTERGEWLK  191



>ref|XP_004507857.1| PREDICTED: NADPH--cytochrome P450 reductase-like isoform X1 [Cicer 
arietinum]
Length=715

 Score =   166 bits (420),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 112/183 (61%), Positives = 143/183 (78%), Gaps = 5/183 (3%)
 Frame = +2

Query  134  TSEKLSPFDFMAAIFKGGRIFDQSNASSESASPVAMLMDNKELMAMLTTSVAVLIGCVFV  313
            +S K SP D M+AI KG    D SN SS+ ++  +++++N+E + +LTTSVAVLIGCV V
Sbjct  5    SSMKFSPLDLMSAIIKGK--LDPSNVSSQVSA--SLMLENREFVMLLTTSVAVLIGCVVV  60

Query  314  LVWRRASSSAKKAVEPPNPEVPKAAEEETGEDGRKKITIFFGTQTGTAEGFAKALAEEAK  493
            L+WRR+++   K +E P   + K  E +  +DG KK+T+ FGTQTGTAEGFAKA+AEEAK
Sbjct  61   LIWRRSNAQKSKPIEVPKRIIDKLPELDV-DDGTKKVTVLFGTQTGTAEGFAKAIAEEAK  119

Query  494  ARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFLATYGDGEPTDNAARFYKWFSEGK  673
            ARY+KA  +VVD+DDYA DDDEYEEK KKE+++ FFLATYGDGEPTDNAARFYKWF+EG 
Sbjct  120  ARYDKAKFRVVDMDDYAADDDEYEEKFKKETVIIFFLATYGDGEPTDNAARFYKWFTEGN  179

Query  674  ERG  682
            E G
Sbjct  180  EGG  182



>ref|XP_004507858.1| PREDICTED: NADPH--cytochrome P450 reductase-like isoform X2 [Cicer 
arietinum]
Length=705

 Score =   166 bits (419),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 112/183 (61%), Positives = 143/183 (78%), Gaps = 5/183 (3%)
 Frame = +2

Query  134  TSEKLSPFDFMAAIFKGGRIFDQSNASSESASPVAMLMDNKELMAMLTTSVAVLIGCVFV  313
            +S K SP D M+AI KG    D SN SS+ ++  +++++N+E + +LTTSVAVLIGCV V
Sbjct  5    SSMKFSPLDLMSAIIKGK--LDPSNVSSQVSA--SLMLENREFVMLLTTSVAVLIGCVVV  60

Query  314  LVWRRASSSAKKAVEPPNPEVPKAAEEETGEDGRKKITIFFGTQTGTAEGFAKALAEEAK  493
            L+WRR+++   K +E P   + K  E +  +DG KK+T+ FGTQTGTAEGFAKA+AEEAK
Sbjct  61   LIWRRSNAQKSKPIEVPKRIIDKLPELDV-DDGTKKVTVLFGTQTGTAEGFAKAIAEEAK  119

Query  494  ARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFLATYGDGEPTDNAARFYKWFSEGK  673
            ARY+KA  +VVD+DDYA DDDEYEEK KKE+++ FFLATYGDGEPTDNAARFYKWF+EG 
Sbjct  120  ARYDKAKFRVVDMDDYAADDDEYEEKFKKETVIIFFLATYGDGEPTDNAARFYKWFTEGN  179

Query  674  ERG  682
            E G
Sbjct  180  EGG  182



>ref|XP_010929254.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Elaeis guineensis]
Length=704

 Score =   165 bits (418),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 115/185 (62%), Positives = 138/185 (75%), Gaps = 7/185 (4%)
 Frame = +2

Query  143  KLSPFDFMAAIFKGGRIFDQSNASSESASPVAMLMDNKELMAMLTTSVAVLIGCVFVLVW  322
            K S  D M+AI  G   +D    + E    +  +  N+EL+A+LTTSVAVL+GC  +L+W
Sbjct  7    KFSALDLMSAILTGK--YDGEGVAPE----IRGIAGNRELLAVLTTSVAVLLGCALLLLW  60

Query  323  RRASSSAKK-AVEPPNPEVPKAAEEETGEDGRKKITIFFGTQTGTAEGFAKALAEEAKAR  499
            RR+    +  AVEPP P   +       +DGRKK+T+FFGTQTGTAEGFAK+L EEA+AR
Sbjct  61   RRSGGKKETPAVEPPRPLAVRDEPGHEVDDGRKKVTVFFGTQTGTAEGFAKSLTEEARAR  120

Query  500  YEKANvkvvdlddyavdddeyeeklkkeSLVFFFLATYGDGEPTDNAARFYKWFSEGKER  679
            YEKA  KVVDLDDYA DDDEYEEK+KKE+L  FFLATYGDGEPTDNAARFYKWF+EGKER
Sbjct  121  YEKAVFKVVDLDDYAADDDEYEEKMKKETLALFFLATYGDGEPTDNAARFYKWFTEGKER  180

Query  680  GVWLK  694
            GVWL+
Sbjct  181  GVWLQ  185



>ref|XP_010526342.1| PREDICTED: NADPH--cytochrome P450 reductase 2-like [Tarenaya 
hassleriana]
Length=716

 Score =   165 bits (417),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 119/192 (62%), Positives = 147/192 (77%), Gaps = 7/192 (4%)
 Frame = +2

Query  137  SEKLSPFDFMAAIFKGGR-IFDQSNAS---SESASPVAMLMDNKELMAMLTTSVAVLIGC  304
            S K+SPF  M+AI KG   + D +NAS   S +A   A++ +N+E  +++TTS+AVLIGC
Sbjct  9    SVKISPFGRMSAIIKGKSGMADTANASAYESFAAEFAAIITENREFASLITTSIAVLIGC  68

Query  305  VFVLVWRRASSSAKKA--VEPPNPEVPKAAEEETGEDGRKKITIFFGTQTGTAEGFAKAL  478
            V +LVWRR+ +   K   VEPP P V +  E E  +DGRK +TIFFGTQTGTAEGFAKAL
Sbjct  69   VVLLVWRRSGTGGNKPKRVEPPKPLVLRPREVEV-DDGRKMVTIFFGTQTGTAEGFAKAL  127

Query  479  AEEAKARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFLATYGDGEPTDNAARFYKW  658
            AEEAKARY+KA  KVVDL+DYA +DDEY +KLKKE + FFFLATYGDGEPTDNAARFYKW
Sbjct  128  AEEAKARYDKARFKVVDLEDYAPEDDEYADKLKKEKIAFFFLATYGDGEPTDNAARFYKW  187

Query  659  FSEGKERGVWLK  694
            F+EG ++G  +K
Sbjct  188  FTEGNDKGECVK  199



>gb|AAC09468.2| putative NADPH-cytochrome P450 reductase [Pisum sativum]
Length=704

 Score =   165 bits (417),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 111/181 (61%), Positives = 142/181 (78%), Gaps = 5/181 (3%)
 Frame = +2

Query  134  TSEKLSPFDFMAAIFKGGRIFDQSNASSESASPVAMLMDNKELMAMLTTSVAVLIGCVFV  313
            ++ K SP D M AI KG   F+ SN SS++  P +++ +N+E + +LTTS+AVLIGCV V
Sbjct  5    STMKFSPLDLMTAIIKGK--FNPSNDSSQA--PASIIFENREFVMILTTSIAVLIGCVVV  60

Query  314  LVWRRASSSAKKAVEPPNPEVPKAAEEETGEDGRKKITIFFGTQTGTAEGFAKALAEEAK  493
            L+WRR++S+  K +E P   + K  E +  +DG+KK+T+FFGTQTGTAEGFAKA+AEEAK
Sbjct  61   LIWRRSNSNKSKQIEVPKLVIKKLPELDV-DDGKKKVTVFFGTQTGTAEGFAKAIAEEAK  119

Query  494  ARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFLATYGDGEPTDNAARFYKWFSEGK  673
            ARYEKA  +VVD+DDYA DDDEY EKLK+E++  FFLATYGDGEPTDNAARFYKWF+E  
Sbjct  120  ARYEKAKFRVVDMDDYAADDDEYLEKLKRETMALFFLATYGDGEPTDNAARFYKWFTEEY  179

Query  674  E  676
            E
Sbjct  180  E  180



>ref|XP_009382841.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Musa acuminata 
subsp. malaccensis]
Length=694

 Score =   163 bits (413),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 106/185 (57%), Positives = 128/185 (69%), Gaps = 17/185 (9%)
 Frame = +2

Query  143  KLSPFDFMAAIFKGGRIFDQSNASSESASPVAMLMDNKELMAMLTTSVAVLIGCVFVLVW  322
            K SP D +++I  GG          + A P A       L  +L TS+AVL+GC F+  W
Sbjct  7    KPSPLDLLSSILTGG----------DGAPPEA------GLAVILATSIAVLVGCAFIFFW  50

Query  323  RRA-SSSAKKAVEPPNPEVPKAAEEETGEDGRKKITIFFGTQTGTAEGFAKALAEEAKAR  499
            R +    A   V+PP P       E   +DG++K+T+FFGTQTGTAEGFAKALA+EAKAR
Sbjct  51   RSSLGGKASSPVQPPKPLTVNVVREVEADDGKRKVTVFFGTQTGTAEGFAKALADEAKAR  110

Query  500  YEKANvkvvdlddyavdddeyeeklkkeSLVFFFLATYGDGEPTDNAARFYKWFSEGKER  679
            Y+KA  KVVDLD+YA DDDEYEEK+KKE+L  FFLATYGDGEPTDNAARFYKWF+EG ER
Sbjct  111  YDKAVFKVVDLDEYAADDDEYEEKMKKETLALFFLATYGDGEPTDNAARFYKWFTEGNER  170

Query  680  GVWLK  694
            G WL+
Sbjct  171  GNWLE  175



>gb|AAB97737.1| NADPH cytochrome P450 reductase [Petroselinum crispum]
Length=699

 Score =   163 bits (412),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 113/192 (59%), Positives = 142/192 (74%), Gaps = 13/192 (7%)
 Frame = +2

Query  125  MEPTSEKLSPFDFMAAIFKGGRIFDQSNASSESASPVAMLMDNKELMAMLTTSVAVLIGC  304
            M+  S ++SP D +A+I K            +S   + +L++N++++ +LTTS AVLIG 
Sbjct  1    MQSESMEVSPVDLLASILK-----------IDSVESMTLLLENRDVLMLLTTSFAVLIGL  49

Query  305  VFVLVWRRASSSAK--KAVEPPNPEVPKAAEEETGEDGRKKITIFFGTQTGTAEGFAKAL  478
              V++WRR+++  K  K +EP    +PK   EE  +DG+KK+TIF+GTQTGTAEGFAKAL
Sbjct  50   GLVMMWRRSTTMTKSAKKLEPAKIVIPKFEMEEEVDDGKKKVTIFYGTQTGTAEGFAKAL  109

Query  479  AEEAKARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFLATYGDGEPTDNAARFYKW  658
            AEEAKARY+ A  K +DLDDYA DDDEYE KLKKES+VFFFLATYGDGEPTDNAARFYKW
Sbjct  110  AEEAKARYQDAIFKTIDLDDYAGDDDEYETKLKKESMVFFFLATYGDGEPTDNAARFYKW  169

Query  659  FSEGKERGVWLK  694
            F EGKERG WL 
Sbjct  170  FCEGKERGEWLN  181



>emb|CBX24555.1| NADPH:cytochrome P450 reductase [Salvia miltiorrhiza]
Length=705

 Score =   161 bits (408),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 127/195 (65%), Positives = 147/195 (75%), Gaps = 14/195 (7%)
 Frame = +2

Query  125  MEPTSEKLSPFDFMAAIFKGGRIFDQSNASSESASP---VAMLMDNKELMAMLTTSVAVL  295
            MEP+S+KLSP DF+ AI KG           E  +P    AMLM+N++L  +LTTSVAVL
Sbjct  1    MEPSSKKLSPLDFITAILKG---------DIEGVAPRGVAAMLMENRDLAMVLTTSVAVL  51

Query  296  IGCVFVLVWRR-ASSSAKKAVEPPNPEVPKAAEEETGEDGRK-KITIFFGTQTGTAEGFA  469
            IGCV VL WRR A S+ KK ++PP   VPK A E    +  K K+++FFGTQTGTAEGFA
Sbjct  52   IGCVVVLAWRRTAGSAGKKQLQPPKLVVPKPAAEPEEAEDEKTKVSVFFGTQTGTAEGFA  111

Query  470  KALAEEAKARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFLATYGDGEPTDNAARF  649
            KA AEEAKARY +A  KV+DLDDYA DDDEYEEKLKKESL FFFLA+YGDGEPTDNAARF
Sbjct  112  KAFAEEAKARYPQAKFKVIDLDDYAADDDEYEEKLKKESLAFFFLASYGDGEPTDNAARF  171

Query  650  YKWFSEGKERGVWLK  694
            YKWF+EGK+R  WLK
Sbjct  172  YKWFTEGKDREDWLK  186



>emb|CCO62220.1| putative cytochrome P450 reductase [Actaea racemosa]
Length=699

 Score =   161 bits (407),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 117/190 (62%), Positives = 141/190 (74%), Gaps = 12/190 (6%)
 Frame = +2

Query  125  MEPTSEKLSPFDFMAAIFKGGRIFDQSNASSESASPVAMLMDNKELMAMLTTSVAVLIGC  304
            M+  S K SP D M+AI  G                VA+L++N+E++ +LTT++AVLIGC
Sbjct  1    MQSESVKFSPIDLMSAILNG----------KSDPLDVAVLIENREVLMILTTAIAVLIGC  50

Query  305  VFVLVWRRASSS-AKKAVEPPNPEVPKAAEEETGEDGRKKITIFFGTQTGTAEGFAKALA  481
            V +LVWRR+S   + K V    P + K  E E  +DG+KK+T+FFGTQTGTAEGFAKALA
Sbjct  51   VVLLVWRRSSGQKSSKDVVHLKPLIVKKDEPEV-DDGKKKVTVFFGTQTGTAEGFAKALA  109

Query  482  EEAKARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFLATYGDGEPTDNAARFYKWF  661
            EEAKARYEKA  KVVDLDDYA DDDEYEE+LKKE++  FF+ATYGDGEPTDNAARFYKWF
Sbjct  110  EEAKARYEKAVFKVVDLDDYAQDDDEYEERLKKETIALFFVATYGDGEPTDNAARFYKWF  169

Query  662  SEGKERGVWL  691
            SEGKER  W+
Sbjct  170  SEGKEREAWI  179



>gb|EPS66345.1| hypothetical protein M569_08425 [Genlisea aurea]
Length=683

 Score =   160 bits (405),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 103/157 (66%), Positives = 123/157 (78%), Gaps = 3/157 (2%)
 Frame = +2

Query  233  VAMLMDNKELMAMLTTSVAVLIGCVFVLVWRRASSSA-KKAVEPPNPEVPKAAE--EETG  403
            VAM  +NK+L+ +  TS+AVL G V  L WR+ S S  KKA +  N  VPK  +  EE  
Sbjct  5    VAMFFENKDLVMIAATSLAVLFGLVIFLTWRKTSGSENKKAGQSQNIVVPKGKDDVEELD  64

Query  404  EDGRKKITIFFGTQTGTAEGFAKALAEEAKARYEKANvkvvdlddyavdddeyeeklkke  583
            ++G KK+TIF+GTQTGTAEGFAKALAEEA+ARY++A  KVVDLDDY  DD+EYEEK+KKE
Sbjct  65   DEGTKKVTIFYGTQTGTAEGFAKALAEEARARYQQAKFKVVDLDDYGADDEEYEEKMKKE  124

Query  584  SLVFFFLATYGDGEPTDNAARFYKWFSEGKERGVWLK  694
            S+  FFLATYGDGEPTDNAARFYKWF+EG E+G WLK
Sbjct  125  SIALFFLATYGDGEPTDNAARFYKWFTEGNEKGEWLK  161



>ref|XP_003610109.1| NADPH cytochrome P450 reductase [Medicago truncatula]
 gb|AES92306.1| NADPH-cytochrome P450 family 2 reductase [Medicago truncatula]
Length=701

 Score =   160 bits (405),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 112/178 (63%), Positives = 137/178 (77%), Gaps = 7/178 (4%)
 Frame = +2

Query  134  TSEKLSPFDFMAAIFKGGRIFDQSNASSESASPVAMLMDNKELMAMLTTSVAVLIGCVFV  313
            +S K SP D M+A+ KG    D SN +     P +++++N+E + +LTTS+AVLIGCV V
Sbjct  5    SSMKFSPLDLMSALIKGK--IDPSNGTV----PASLILENREFVMILTTSIAVLIGCVVV  58

Query  314  LVWRRASSSAKKAVEPPNPEVPKAAEEETGEDGRKKITIFFGTQTGTAEGFAKALAEEAK  493
            L+WRR++S   K +E P   + K  E E  +DG KK+T+FFGTQTGTAEGFAKA+AEEAK
Sbjct  59   LIWRRSNSQKPKPIEVPKRVIEKLPELEI-DDGTKKVTVFFGTQTGTAEGFAKAIAEEAK  117

Query  494  ARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFLATYGDGEPTDNAARFYKWFSE  667
            ARYEKA  KVVD+DDYA DDDEYEEKLKKE++  FFLATYGDGEPTDNAARFYKWF E
Sbjct  118  ARYEKAKFKVVDMDDYAADDDEYEEKLKKETMALFFLATYGDGEPTDNAARFYKWFEE  175



>ref|XP_003541616.1| PREDICTED: NADPH--cytochrome P450 reductase [Glycine max]
Length=707

 Score =   159 bits (403),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 115/187 (61%), Positives = 145/187 (78%), Gaps = 3/187 (2%)
 Frame = +2

Query  137  SEKLSPFDFMAAIFKGGRIFDQSNASSESASPVAMLMDNKELMAMLTTSVAVLIGCVFVL  316
            S K+SP D M+AI KG ++   + +SS S +  A+L++N++ + +LTTSVAVL+GC  V 
Sbjct  6    SMKISPLDLMSAIIKG-KLDPSNVSSSSSNAAAAVLLENRQFLMLLTTSVAVLVGCFVVF  64

Query  317  VWRRASSSAKKAVEPPNPEVPKAAEEETGEDGRKKITIFFGTQTGTAEGFAKALAEEAKA  496
            +WRR+SS   K +EPP   + K  E E  +DG KK+TIFFGTQTGTAEGFAKA+AEEAKA
Sbjct  65   IWRRSSSPKAKPLEPPKRVIEKLPEIEV-DDGTKKVTIFFGTQTGTAEGFAKAIAEEAKA  123

Query  497  RYEKANvkvvdlddyavdddeyeeklkkeSLVFFFLATYGDGEPTDNAARFYKWFSEGKE  676
            RY+KA  +VVD+DDYA DDDEYEE+ KKE+   FFLATYGDGEPTDNAARFYKWF+EG E
Sbjct  124  RYDKATFRVVDMDDYAADDDEYEERFKKETHALFFLATYGDGEPTDNAARFYKWFTEGGE  183

Query  677  RGV-WLK  694
            +G  WL+
Sbjct  184  KGEGWLE  190



>ref|XP_006381796.1| putative NADPH-cytochrome P450 reductase family protein [Populus 
trichocarpa]
 gb|AAK15260.1|AF302497_1 NADPH-cytochrome P450 oxydoreductase isoform 2 [Populus trichocarpa 
x Populus deltoides]
 gb|ERP59593.1| putative NADPH-cytochrome P450 reductase family protein [Populus 
trichocarpa]
Length=712

 Score =   158 bits (400),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 121/188 (64%), Positives = 139/188 (74%), Gaps = 6/188 (3%)
 Frame = +2

Query  143  KLSPFDFMAAIFKGGRIFDQSNASSESASPVA----MLMDNKELMAMLTTSVAVLIGCVF  310
            K+SP + M AI KG    D +N SSES    A    ++ +N+E + +LTTS+AVLIG V 
Sbjct  9    KVSPLELMQAIIKGK--VDPTNVSSESGGSAAEMATLIRENREFVIILTTSIAVLIGYVV  66

Query  311  VLVWRRASSSAKKAVEPPNPEVPKAAEEETGEDGRKKITIFFGTQTGTAEGFAKALAEEA  490
            VL+WRR+S   K  V  P   +     E   +DG+KK+TIFFGTQTGTAEGFAKALAEEA
Sbjct  67   VLIWRRSSGYQKPKVPVPPKPLIVKDLEPEVDDGKKKVTIFFGTQTGTAEGFAKALAEEA  126

Query  491  KARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFLATYGDGEPTDNAARFYKWFSEG  670
            KARYEKA  K VDLDDYA DDDEYEEKLKKESL  FFLATYGDGEPTDNAARFYKWF++G
Sbjct  127  KARYEKAIFKTVDLDDYAEDDDEYEEKLKKESLAIFFLATYGDGEPTDNAARFYKWFTDG  186

Query  671  KERGVWLK  694
             ERG WLK
Sbjct  187  NERGEWLK  194



>emb|CBI17838.3| unnamed protein product [Vitis vinifera]
Length=660

 Score =   157 bits (396),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 109/142 (77%), Positives = 121/142 (85%), Gaps = 1/142 (1%)
 Frame = +2

Query  269  MLTTSVAVLIGCVFVLVWRRASSSAKKAVEPPNPEVPKAAEEETGEDGRKKITIFFGTQT  448
            +LTTS+AVLIGCV VL+WRR+     K  EPP P + K  E E  +DG++K+TIFFGTQT
Sbjct  2    ILTTSIAVLIGCVVVLIWRRSGQKQSKTPEPPKPLIVKDLEVEV-DDGKQKVTIFFGTQT  60

Query  449  GTAEGFAKALAEEAKARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFLATYGDGEP  628
            GTAEGFAKALAEEAKARYEKA  KVVDLDDYA DDDEYEEKLKKE+L FFFLATYGDGEP
Sbjct  61   GTAEGFAKALAEEAKARYEKAIFKVVDLDDYAGDDDEYEEKLKKETLAFFFLATYGDGEP  120

Query  629  TDNAARFYKWFSEGKERGVWLK  694
            TDNAARFYKWF+EGKERG WL+
Sbjct  121  TDNAARFYKWFAEGKERGEWLQ  142



>emb|CAA89837.3| NADPH-cytochrome P450 reductase [Pseudotsuga menziesii]
Length=719

 Score =   156 bits (395),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 113/185 (61%), Positives = 133/185 (72%), Gaps = 7/185 (4%)
 Frame = +2

Query  143  KLSPFDFMAAIFKGGRIFDQSNASSESASPVAMLMDNKELMAMLTTSVAVLIGCVFVLVW  322
            ++S  D + ++F  G+         ESA    +L +N EL+ +LTTS+AVLI CV + VW
Sbjct  21   EISRLDHVFSLFVNGK--GDLGGMMESA---VVLRENSELLMVLTTSLAVLIACVLLFVW  75

Query  323  RRASSSAKKAVEPPNPEVPKAAEEETGED-GRKKITIFFGTQTGTAEGFAKALAEEAKAR  499
            RR  S+  K  E P P      EEE  +D G+KK+T+FFGTQTGTAEGFAKAL EEAKAR
Sbjct  76   RRGGSAPSKLPEKPTPLGRVEEEEEEEDDSGKKKVTVFFGTQTGTAEGFAKALVEEAKAR  135

Query  500  YEKANvkvvdlddyavdddeyeeklkkeSLVFFFLATYGDGEPTDNAARFYKWFSEG-KE  676
            Y+KA  KVVDLDDYA DD++YEEKLKKE L FF LATYGDGEPTDNAARFYKWFSE  KE
Sbjct  136  YDKAVFKVVDLDDYAADDEQYEEKLKKEKLAFFMLATYGDGEPTDNAARFYKWFSETEKE  195

Query  677  RGVWL  691
            RG WL
Sbjct  196  RGPWL  200



>gb|EAZ10065.1| hypothetical protein OsI_32371 [Oryza sativa Indica Group]
Length=717

 Score =   155 bits (391),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 105/188 (56%), Positives = 132/188 (70%), Gaps = 15/188 (8%)
 Frame = +2

Query  149  SPFDFMAAIFKG-GRIFDQSNASSESASPVAMLMDNKELMAMLTTSVAVLIGCVFVLVWR  325
            S  D +AA+  G GR  ++    S        L +N+ L+ +LTTS+AVL+GC   L+ R
Sbjct  18   SALDLVAALLTGRGRPEEEGWPPS--------LAENRHLLVLLTTSLAVLVGCGVALLVR  69

Query  326  RASSSAKKA-VEPPNPEVPKAAE-----EETGEDGRKKITIFFGTQTGTAEGFAKALAEE  487
            R+S SA  A  + P P  P  A+     E   +DGR+++ +FFGTQTGTAEGFAKALAEE
Sbjct  70   RSSISAPAARAQEPQPRAPAPAKRKQEAEPDPDDGRQRVAVFFGTQTGTAEGFAKALAEE  129

Query  488  AKARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFLATYGDGEPTDNAARFYKWFSE  667
            AK+RY+KA  KV+DLD+YA DD+EYE+KLKKE +  FF+ATYGDGEPTDNAARFYKWF E
Sbjct  130  AKSRYDKAVFKVLDLDEYAADDEEYEQKLKKEIIALFFVATYGDGEPTDNAARFYKWFGE  189

Query  668  GKERGVWL  691
            G ERG WL
Sbjct  190  GNERGEWL  197



>ref|XP_009384791.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Musa acuminata 
subsp. malaccensis]
Length=694

 Score =   154 bits (389),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 116/191 (61%), Positives = 132/191 (69%), Gaps = 17/191 (9%)
 Frame = +2

Query  125  MEPTSEKLSPFDFMAAIFKGGRIFDQSNASSESASPVAMLMDNKELMAMLTTSVAVLIGC  304
            M+P     SP + ++AI  GG          E A P A      EL  +L TS+AVL+GC
Sbjct  1    MQPERANPSPLELISAILTGG----------EGAPPDA------ELAVILATSIAVLLGC  44

Query  305  VFVLVWRRAS-SSAKKAVEPPNPEVPKAAEEETGEDGRKKITIFFGTQTGTAEGFAKALA  481
             F+ +WRR+S   A K  EP  P   K   E   + GRKK+TIFFGTQTGTAEGFAKALA
Sbjct  45   TFIFLWRRSSVQKASKPAEPLKPLSVKVDREPEADYGRKKVTIFFGTQTGTAEGFAKALA  104

Query  482  EEAKARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFLATYGDGEPTDNAARFYKWF  661
            EEAKARY+KA  KVVDLDDYA DDDEYE+KLKKE L  FFLATYGDGEPTDNAARFYKWF
Sbjct  105  EEAKARYDKATFKVVDLDDYAADDDEYEDKLKKEPLALFFLATYGDGEPTDNAARFYKWF  164

Query  662  SEGKERGVWLK  694
            +EGKE G WL+
Sbjct  165  TEGKEHGNWLE  175



>ref|NP_001063914.1| Os09g0558900 [Oryza sativa Japonica Group]
 dbj|BAD45947.1| putative NADPH-cytochrome P450 oxydoreductase isoform 3 [Oryza 
sativa Japonica Group]
 dbj|BAF25828.1| Os09g0558900 [Oryza sativa Japonica Group]
Length=714

 Score =   154 bits (388),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 106/188 (56%), Positives = 132/188 (70%), Gaps = 15/188 (8%)
 Frame = +2

Query  149  SPFDFMAAIFKG-GRIFDQSNASSESASPVAMLMDNKELMAMLTTSVAVLIGCVFVLVWR  325
            S  D +AA+  G GR  ++    S        L +N+ L+ +LTTS+AVL+GC   L+ R
Sbjct  15   SALDLVAALLTGRGRPEEEGWPPS--------LAENRHLIVLLTTSLAVLVGCGVALLVR  66

Query  326  RASSSAK--KAVEP----PNPEVPKAAEEETGEDGRKKITIFFGTQTGTAEGFAKALAEE  487
            R+S SA   +A EP    P P   K   E   +DGR+++ +FFGTQTGTAEGFAKALAEE
Sbjct  67   RSSISAPAVRAQEPQPRAPAPAKRKQEAEPDPDDGRQRVAVFFGTQTGTAEGFAKALAEE  126

Query  488  AKARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFLATYGDGEPTDNAARFYKWFSE  667
            AK+RY+KA  KV+DLD+YA DD+EYE+KLKKE +  FF+ATYGDGEPTDNAARFYKWF E
Sbjct  127  AKSRYDKAVFKVLDLDEYAADDEEYEQKLKKEIIALFFVATYGDGEPTDNAARFYKWFGE  186

Query  668  GKERGVWL  691
            G ERG WL
Sbjct  187  GNERGEWL  194



>ref|XP_010914150.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Elaeis guineensis]
Length=701

 Score =   153 bits (387),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 117/183 (64%), Positives = 136/183 (74%), Gaps = 14/183 (8%)
 Frame = +2

Query  155  FDFMAAIFKGGRIFDQSNASSESASPVAMLMDNKELMAMLTTSVAVLIGCVFVLVWRRAS  334
             D M+AI  G   +D      E       +  ++EL+A+LTTSVAVL+GCV +L+WRR  
Sbjct  11   LDLMSAIVNGK--YDGDGVPPE-------IRGSRELLAVLTTSVAVLLGCVLLLLWRR--  59

Query  335  SSAKKA---VEPPNPEVPKAAEEETGEDGRKKITIFFGTQTGTAEGFAKALAEEAKARYE  505
            S  KKA   VEPP P   +   E   + GRKK+T+FFGTQTGTAEGFAKALAEEA+ARYE
Sbjct  60   SGGKKATLVVEPPRPLEFREETENELDSGRKKVTVFFGTQTGTAEGFAKALAEEARARYE  119

Query  506  KANvkvvdlddyavdddeyeeklkkeSLVFFFLATYGDGEPTDNAARFYKWFSEGKERGV  685
            KA  KVVDLDDYA DDDEYEEK+K E+L  FFLATYGDGEPTDNAARFYKWF+EGKERGV
Sbjct  120  KAIFKVVDLDDYAADDDEYEEKMKNETLALFFLATYGDGEPTDNAARFYKWFTEGKERGV  179

Query  686  WLK  694
            WL+
Sbjct  180  WLQ  182



>gb|KCW78708.1| hypothetical protein EUGRSUZ_C00154 [Eucalyptus grandis]
Length=583

 Score =   152 bits (384),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 109/167 (65%), Positives = 132/167 (79%), Gaps = 2/167 (1%)
 Frame = +2

Query  194  FDQSNASSESASPVAMLMDNKELMAMLTTSVAVLIGCVFVLVWRRASSSAKKAVEPPNPE  373
             D+ NASSE  + +A L+   +++A+LTT +A+LIG V    W R+ S   ++ EPP P 
Sbjct  1    MDRPNASSEYVAELASLLFENKVLAILTTIIALLIGWV-AFRWSRSGSQKPRSFEPPKPL  59

Query  374  VPKAAEEETGEDGRKKITIFFGTQTGTAEGFAKALAEEAKARYEKANvkvvdlddyavdd  553
            + K  E E  +DG+KK+TIFFGTQTGTAEGFAKA+AEEAKARYEKA  +VVDLDDYA DD
Sbjct  60   IVKETEPE-ADDGKKKVTIFFGTQTGTAEGFAKAMAEEAKARYEKAVFRVVDLDDYAADD  118

Query  554  deyeeklkkeSLVFFFLATYGDGEPTDNAARFYKWFSEGKERGVWLK  694
            +EYEEKLKKE+LV FFLATYGDGEPTDNAARFYKWF+EG ERG WL+
Sbjct  119  EEYEEKLKKETLVIFFLATYGDGEPTDNAARFYKWFTEGNERGQWLQ  165



>gb|KCW78707.1| hypothetical protein EUGRSUZ_C00154 [Eucalyptus grandis]
Length=626

 Score =   152 bits (384),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 109/167 (65%), Positives = 132/167 (79%), Gaps = 2/167 (1%)
 Frame = +2

Query  194  FDQSNASSESASPVAMLMDNKELMAMLTTSVAVLIGCVFVLVWRRASSSAKKAVEPPNPE  373
             D+ NASSE  + +A L+   +++A+LTT +A+LIG V    W R+ S   ++ EPP P 
Sbjct  1    MDRPNASSEYVAELASLLFENKVLAILTTIIALLIGWV-AFRWSRSGSQKPRSFEPPKPL  59

Query  374  VPKAAEEETGEDGRKKITIFFGTQTGTAEGFAKALAEEAKARYEKANvkvvdlddyavdd  553
            + K  E E  +DG+KK+TIFFGTQTGTAEGFAKA+AEEAKARYEKA  +VVDLDDYA DD
Sbjct  60   IVKETEPE-ADDGKKKVTIFFGTQTGTAEGFAKAMAEEAKARYEKAVFRVVDLDDYAADD  118

Query  554  deyeeklkkeSLVFFFLATYGDGEPTDNAARFYKWFSEGKERGVWLK  694
            +EYEEKLKKE+LV FFLATYGDGEPTDNAARFYKWF+EG ERG WL+
Sbjct  119  EEYEEKLKKETLVIFFLATYGDGEPTDNAARFYKWFTEGNERGQWLQ  165



>gb|EEE70211.1| hypothetical protein OsJ_30318 [Oryza sativa Japonica Group]
Length=795

 Score =   153 bits (387),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 105/187 (56%), Positives = 130/187 (70%), Gaps = 13/187 (7%)
 Frame = +2

Query  149  SPFDFMAAIFKGGRIFDQSNASSESASPVAMLMDNKELMAMLTTSVAVLIGCVFVLVWRR  328
            S  D +AA+  G     +     E   P   L +N+ L+ +LTTS+AVL+GC   L+ RR
Sbjct  40   SALDLVAALLTG-----RGRPEEEGWPP--SLAENRHLIVLLTTSLAVLVGCGVALLVRR  92

Query  329  ASSSAK--KAVEP----PNPEVPKAAEEETGEDGRKKITIFFGTQTGTAEGFAKALAEEA  490
            +S SA   +A EP    P P   K   E   +DGR+++ +FFGTQTGTAEGFAKALAEEA
Sbjct  93   SSISAPAVRAQEPQPRAPAPAKRKQEAEPDPDDGRQRVAVFFGTQTGTAEGFAKALAEEA  152

Query  491  KARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFLATYGDGEPTDNAARFYKWFSEG  670
            K+RY+KA  KV+DLD+YA DD+EYE+KLKKE +  FF+ATYGDGEPTDNAARFYKWF EG
Sbjct  153  KSRYDKAVFKVLDLDEYAADDEEYEQKLKKEIIALFFVATYGDGEPTDNAARFYKWFGEG  212

Query  671  KERGVWL  691
             ERG WL
Sbjct  213  NERGEWL  219



>ref|XP_010046982.1| PREDICTED: NADPH--cytochrome P450 reductase 2-like [Eucalyptus 
grandis]
 gb|KCW78706.1| hypothetical protein EUGRSUZ_C00154 [Eucalyptus grandis]
Length=683

 Score =   152 bits (384),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 109/167 (65%), Positives = 132/167 (79%), Gaps = 2/167 (1%)
 Frame = +2

Query  194  FDQSNASSESASPVAMLMDNKELMAMLTTSVAVLIGCVFVLVWRRASSSAKKAVEPPNPE  373
             D+ NASSE  + +A L+   +++A+LTT +A+LIG V    W R+ S   ++ EPP P 
Sbjct  1    MDRPNASSEYVAELASLLFENKVLAILTTIIALLIGWV-AFRWSRSGSQKPRSFEPPKPL  59

Query  374  VPKAAEEETGEDGRKKITIFFGTQTGTAEGFAKALAEEAKARYEKANvkvvdlddyavdd  553
            + K  E E  +DG+KK+TIFFGTQTGTAEGFAKA+AEEAKARYEKA  +VVDLDDYA DD
Sbjct  60   IVKETEPE-ADDGKKKVTIFFGTQTGTAEGFAKAMAEEAKARYEKAVFRVVDLDDYAADD  118

Query  554  deyeeklkkeSLVFFFLATYGDGEPTDNAARFYKWFSEGKERGVWLK  694
            +EYEEKLKKE+LV FFLATYGDGEPTDNAARFYKWF+EG ERG WL+
Sbjct  119  EEYEEKLKKETLVIFFLATYGDGEPTDNAARFYKWFTEGNERGQWLQ  165



>dbj|BAJ41269.1| NADPH-P450 reductase 2 [Zingiber officinale]
Length=701

 Score =   147 bits (372),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 114/194 (59%), Positives = 139/194 (72%), Gaps = 14/194 (7%)
 Frame = +2

Query  125  MEPTSEKLSPFDFMAAIFKGGRIFDQSNASSESASPVAMLMDNKELMAMLTTSVAVLIGC  304
            M+  SEK SP D ++A+     +   S     ++       +N+ L+A+L+T VAVL+GC
Sbjct  1    MQTGSEKASPLDLLSAV-----VASLSGGDGLASGAGDAFAENRLLIAVLSTVVAVLVGC  55

Query  305  VFVL-VWRRASSSAKKAVEPPNPEVPKA---AEEETGEDGRKKITIFFGTQTGTAEGFAK  472
            V +  VWR   SS +K  EP  P V K    AEEE  + G+KK+T+FFGTQTGTAEGFAK
Sbjct  56   VAIFFVWR---SSGRKPAEPLKPLVVKTQMYAEEE--DQGKKKVTVFFGTQTGTAEGFAK  110

Query  473  ALAEEAKARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFLATYGDGEPTDNAARFY  652
            ALAEEAKARY  A  KVVD+D+YA +DDEYEE LKKESL  FFLATYGDGEPTDNAARFY
Sbjct  111  ALAEEAKARYPNAIFKVVDIDEYAAEDDEYEENLKKESLALFFLATYGDGEPTDNAARFY  170

Query  653  KWFSEGKERGVWLK  694
            KWF+EGKERG+WL+
Sbjct  171  KWFTEGKERGIWLE  184



>gb|KDO81197.1| hypothetical protein CISIN_1g005496mg [Citrus sinensis]
Length=635

 Score =   146 bits (369),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 97/150 (65%), Positives = 122/150 (81%), Gaps = 5/150 (3%)
 Frame = +2

Query  260  LMAMLTTSVAVLIGCVFVLVWRRASSSAKKAVEPPNPEVPKAAEEETGED----GRKKIT  427
            ++ + TTS AV+IG + VLVW+++SS   K V+P  P  P +A++E  E     G+ K+T
Sbjct  29   VILIATTSFAVVIG-LLVLVWKKSSSDRSKEVKPVVPLKPLSAKDEDDEADIAAGKTKVT  87

Query  428  IFFGTQTGTAEGFAKALAEEAKARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFLA  607
            +F+GTQTGTAEGFAKALAEE KARYEKA VKVVDLDDYA+DD++YEEKLKKE+L FF +A
Sbjct  88   VFYGTQTGTAEGFAKALAEEIKARYEKAAVKVVDLDDYAMDDEQYEEKLKKETLAFFMVA  147

Query  608  TYGDGEPTDNAARFYKWFSEGKERGVWLKR  697
            TYGDGEPTDNAARFYKWF+EG +RG WL++
Sbjct  148  TYGDGEPTDNAARFYKWFTEGNDRGPWLQQ  177



>gb|KDO81198.1| hypothetical protein CISIN_1g005496mg [Citrus sinensis]
Length=599

 Score =   146 bits (368),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 97/150 (65%), Positives = 122/150 (81%), Gaps = 5/150 (3%)
 Frame = +2

Query  260  LMAMLTTSVAVLIGCVFVLVWRRASSSAKKAVEPPNPEVPKAAEEETGED----GRKKIT  427
            ++ + TTS AV+IG + VLVW+++SS   K V+P  P  P +A++E  E     G+ K+T
Sbjct  29   VILIATTSFAVVIG-LLVLVWKKSSSDRSKEVKPVVPLKPLSAKDEDDEADIAAGKTKVT  87

Query  428  IFFGTQTGTAEGFAKALAEEAKARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFLA  607
            +F+GTQTGTAEGFAKALAEE KARYEKA VKVVDLDDYA+DD++YEEKLKKE+L FF +A
Sbjct  88   VFYGTQTGTAEGFAKALAEEIKARYEKAAVKVVDLDDYAMDDEQYEEKLKKETLAFFMVA  147

Query  608  TYGDGEPTDNAARFYKWFSEGKERGVWLKR  697
            TYGDGEPTDNAARFYKWF+EG +RG WL++
Sbjct  148  TYGDGEPTDNAARFYKWFTEGNDRGPWLQQ  177



>gb|KDO81196.1| hypothetical protein CISIN_1g005496mg [Citrus sinensis]
Length=669

 Score =   146 bits (369),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 97/150 (65%), Positives = 122/150 (81%), Gaps = 5/150 (3%)
 Frame = +2

Query  260  LMAMLTTSVAVLIGCVFVLVWRRASSSAKKAVEPPNPEVPKAAEEETGED----GRKKIT  427
            ++ + TTS AV+IG + VLVW+++SS   K V+P  P  P +A++E  E     G+ K+T
Sbjct  29   VILIATTSFAVVIG-LLVLVWKKSSSDRSKEVKPVVPLKPLSAKDEDDEADIAAGKTKVT  87

Query  428  IFFGTQTGTAEGFAKALAEEAKARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFLA  607
            +F+GTQTGTAEGFAKALAEE KARYEKA VKVVDLDDYA+DD++YEEKLKKE+L FF +A
Sbjct  88   VFYGTQTGTAEGFAKALAEEIKARYEKAAVKVVDLDDYAMDDEQYEEKLKKETLAFFMVA  147

Query  608  TYGDGEPTDNAARFYKWFSEGKERGVWLKR  697
            TYGDGEPTDNAARFYKWF+EG +RG WL++
Sbjct  148  TYGDGEPTDNAARFYKWFTEGNDRGPWLQQ  177



>ref|XP_006472452.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Citrus sinensis]
Length=694

 Score =   146 bits (369),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 97/150 (65%), Positives = 122/150 (81%), Gaps = 5/150 (3%)
 Frame = +2

Query  260  LMAMLTTSVAVLIGCVFVLVWRRASSSAKKAVEPPNPEVPKAAEEETGED----GRKKIT  427
            ++ + TTS AV+IG + VLVW+++SS   K V+P  P  P +A++E  E     G+ K+T
Sbjct  29   VILIATTSFAVVIG-LLVLVWKKSSSDRSKEVKPVVPLKPLSAKDEDDEADIAAGKTKVT  87

Query  428  IFFGTQTGTAEGFAKALAEEAKARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFLA  607
            +F+GTQTGTAEGFAKALAEE KARYEKA VKVVDLDDYA+DD++YEEKLKKE+L FF +A
Sbjct  88   VFYGTQTGTAEGFAKALAEEIKARYEKAAVKVVDLDDYAMDDEQYEEKLKKETLAFFMVA  147

Query  608  TYGDGEPTDNAARFYKWFSEGKERGVWLKR  697
            TYGDGEPTDNAARFYKWF+EG +RG WL++
Sbjct  148  TYGDGEPTDNAARFYKWFTEGNDRGPWLQQ  177



>gb|KDO81193.1| hypothetical protein CISIN_1g005496mg [Citrus sinensis]
Length=694

 Score =   146 bits (369),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 97/150 (65%), Positives = 122/150 (81%), Gaps = 5/150 (3%)
 Frame = +2

Query  260  LMAMLTTSVAVLIGCVFVLVWRRASSSAKKAVEPPNPEVPKAAEEETGED----GRKKIT  427
            ++ + TTS AV+IG + VLVW+++SS   K V+P  P  P +A++E  E     G+ K+T
Sbjct  29   VILIATTSFAVVIG-LLVLVWKKSSSDRSKEVKPVVPLKPLSAKDEDDEADIAAGKTKVT  87

Query  428  IFFGTQTGTAEGFAKALAEEAKARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFLA  607
            +F+GTQTGTAEGFAKALAEE KARYEKA VKVVDLDDYA+DD++YEEKLKKE+L FF +A
Sbjct  88   VFYGTQTGTAEGFAKALAEEIKARYEKAAVKVVDLDDYAMDDEQYEEKLKKETLAFFMVA  147

Query  608  TYGDGEPTDNAARFYKWFSEGKERGVWLKR  697
            TYGDGEPTDNAARFYKWF+EG +RG WL++
Sbjct  148  TYGDGEPTDNAARFYKWFTEGNDRGPWLQQ  177



>ref|XP_008338958.1| PREDICTED: NADPH--cytochrome P450 reductase [Malus domestica]
Length=692

 Score =   146 bits (369),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 100/150 (67%), Positives = 121/150 (81%), Gaps = 6/150 (4%)
 Frame = +2

Query  260  LMAMLTTSVAVLIGCVFVLVWRRASSSAKKAVEPPNPEVPKAAEEETGE----DGRKKIT  427
            ++ + TTS+A++IG V VLVWRR+S  +++  +   P+ P A EEE  E     G+ ++T
Sbjct  27   VVVIATTSIALIIG-VLVLVWRRSSDRSREVKQLVVPK-PLAVEEEKDEFEVAAGKIRVT  84

Query  428  IFFGTQTGTAEGFAKALAEEAKARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFLA  607
            IF+GTQTGTAEGFAKALAEE KARYEKA VKVVDLDDYA DDD+YEEKLKKE+L FF LA
Sbjct  85   IFYGTQTGTAEGFAKALAEEIKARYEKAAVKVVDLDDYAEDDDKYEEKLKKETLAFFMLA  144

Query  608  TYGDGEPTDNAARFYKWFSEGKERGVWLKR  697
            TYGDGEPTDNAARFYKWF+EGK+RG WL+ 
Sbjct  145  TYGDGEPTDNAARFYKWFTEGKDRGDWLQH  174



>ref|XP_008219252.1| PREDICTED: NADPH--cytochrome P450 reductase isoform X2 [Prunus 
mume]
Length=692

 Score =   146 bits (368),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 99/149 (66%), Positives = 120/149 (81%), Gaps = 4/149 (3%)
 Frame = +2

Query  260  LMAMLTTSVAVLIGCVFVLVWRRASSSAK--KAVEPPNPEVPKAAEEE-TGEDGRKKITI  430
            ++ + TTSVA+++G V VLVWRR+S  ++  K +  P P V K  E+E     G+ ++TI
Sbjct  27   VVVIATTSVALILG-VLVLVWRRSSDRSREVKQLAVPKPLVVKDEEDEFEVASGKTRVTI  85

Query  431  FFGTQTGTAEGFAKALAEEAKARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFLAT  610
            F+GTQTGTAEGFAKALAEE KARYEKA VKV+DLDDYA DDD+YEEKLKKE+L FF LAT
Sbjct  86   FYGTQTGTAEGFAKALAEEIKARYEKAAVKVLDLDDYAEDDDKYEEKLKKETLAFFMLAT  145

Query  611  YGDGEPTDNAARFYKWFSEGKERGVWLKR  697
            YGDGEPTDNAARFYKWF+EGK+RG WL+ 
Sbjct  146  YGDGEPTDNAARFYKWFTEGKDRGGWLQH  174



>ref|XP_007226979.1| hypothetical protein PRUPE_ppa002280mg [Prunus persica]
 gb|EMJ28178.1| hypothetical protein PRUPE_ppa002280mg [Prunus persica]
Length=692

 Score =   146 bits (368),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 99/149 (66%), Positives = 120/149 (81%), Gaps = 4/149 (3%)
 Frame = +2

Query  260  LMAMLTTSVAVLIGCVFVLVWRRASSSAK--KAVEPPNPEVPKAAEEE-TGEDGRKKITI  430
            ++ + TTSVA+++G V VLVWRR+S  ++  K +  P P V K  E+E     G+ ++TI
Sbjct  27   VVVIATTSVALILG-VLVLVWRRSSDRSREVKQLAVPKPLVVKDEEDEFEVASGKTRVTI  85

Query  431  FFGTQTGTAEGFAKALAEEAKARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFLAT  610
            F+GTQTGTAEGFAKALAEE KARYEKA VKV+DLDDYA DDD+YEEKLKKE+L FF LAT
Sbjct  86   FYGTQTGTAEGFAKALAEEIKARYEKAAVKVLDLDDYAEDDDKYEEKLKKETLAFFMLAT  145

Query  611  YGDGEPTDNAARFYKWFSEGKERGVWLKR  697
            YGDGEPTDNAARFYKWF+EGK+RG WL+ 
Sbjct  146  YGDGEPTDNAARFYKWFTEGKDRGGWLQH  174



>ref|XP_009376208.1| PREDICTED: NADPH--cytochrome P450 reductase [Pyrus x bretschneideri]
Length=692

 Score =   146 bits (368),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 98/149 (66%), Positives = 119/149 (80%), Gaps = 4/149 (3%)
 Frame = +2

Query  260  LMAMLTTSVAVLIGCVFVLVWRRASSSAKKAVEPPNPEVPKAAEEETGED---GRKKITI  430
            ++ + TTS+A++IG V VLVWRR+S  +++  +   P+  +  EEE   D   G+ ++TI
Sbjct  27   VVVIATTSIALIIG-VLVLVWRRSSDRSREVKQLVVPKPLEVKEEEDEFDVAAGKSRVTI  85

Query  431  FFGTQTGTAEGFAKALAEEAKARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFLAT  610
            F+GTQTGTAEGFAKALAEE KARYEKA VKVVDLDDYA DDD YEEKLKKE+L FF LAT
Sbjct  86   FYGTQTGTAEGFAKALAEEIKARYEKAAVKVVDLDDYAEDDDTYEEKLKKETLAFFMLAT  145

Query  611  YGDGEPTDNAARFYKWFSEGKERGVWLKR  697
            YGDGEPTDNAARFYKWF+EGK+RG WL+ 
Sbjct  146  YGDGEPTDNAARFYKWFTEGKDRGSWLQH  174



>ref|XP_008219251.1| PREDICTED: NADPH--cytochrome P450 reductase isoform X1 [Prunus 
mume]
Length=728

 Score =   145 bits (367),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 99/149 (66%), Positives = 120/149 (81%), Gaps = 4/149 (3%)
 Frame = +2

Query  260  LMAMLTTSVAVLIGCVFVLVWRRASSSAK--KAVEPPNPEVPKAAEEE-TGEDGRKKITI  430
            ++ + TTSVA+++G V VLVWRR+S  ++  K +  P P V K  E+E     G+ ++TI
Sbjct  27   VVVIATTSVALILG-VLVLVWRRSSDRSREVKQLAVPKPLVVKDEEDEFEVASGKTRVTI  85

Query  431  FFGTQTGTAEGFAKALAEEAKARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFLAT  610
            F+GTQTGTAEGFAKALAEE KARYEKA VKV+DLDDYA DDD+YEEKLKKE+L FF LAT
Sbjct  86   FYGTQTGTAEGFAKALAEEIKARYEKAAVKVLDLDDYAEDDDKYEEKLKKETLAFFMLAT  145

Query  611  YGDGEPTDNAARFYKWFSEGKERGVWLKR  697
            YGDGEPTDNAARFYKWF+EGK+RG WL+ 
Sbjct  146  YGDGEPTDNAARFYKWFTEGKDRGGWLQH  174



>ref|XP_006433816.1| hypothetical protein CICLE_v10000469mg [Citrus clementina]
 gb|ESR47056.1| hypothetical protein CICLE_v10000469mg [Citrus clementina]
Length=694

 Score =   145 bits (366),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 97/150 (65%), Positives = 121/150 (81%), Gaps = 5/150 (3%)
 Frame = +2

Query  260  LMAMLTTSVAVLIGCVFVLVWRRASSSAKKAVEPPNPEVPKAAEEETGED----GRKKIT  427
            ++ + TTS AV IG + VLVW+++SS   K V+P  P  P +A++E  E     G+ K+T
Sbjct  29   VILIATTSFAVAIG-LLVLVWKKSSSDRSKEVKPVVPLKPLSAKDEDDEADIAAGKTKVT  87

Query  428  IFFGTQTGTAEGFAKALAEEAKARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFLA  607
            +F+GTQTGTAEGFAKALAEE KARYEKA VKVVDLDDYA+DD++YEEKLKKE+L FF +A
Sbjct  88   VFYGTQTGTAEGFAKALAEEIKARYEKAAVKVVDLDDYAMDDEQYEEKLKKETLAFFMVA  147

Query  608  TYGDGEPTDNAARFYKWFSEGKERGVWLKR  697
            TYGDGEPTDNAARFYKWF+EG +RG WL++
Sbjct  148  TYGDGEPTDNAARFYKWFTEGNDRGPWLQQ  177



>ref|XP_010277516.1| PREDICTED: NADPH--cytochrome P450 reductase-like isoform X2 [Nelumbo 
nucifera]
Length=651

 Score =   140 bits (354),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 100/147 (68%), Positives = 113/147 (77%), Gaps = 2/147 (1%)
 Frame = +2

Query  260  LMAMLTTSVAVLIGCVFVLVWRR-ASSSAKKAVEPPNPEVPKAAEEETGEDGRKKITIFF  436
             + +LTTS AVL+   F LVWRR A     K VE   P   +  EE   + G+ KITIFF
Sbjct  29   FVVVLTTSAAVLVALAF-LVWRRSAPEKPLKPVEALKPVSFEEEEEVEVDPGKTKITIFF  87

Query  437  GTQTGTAEGFAKALAEEAKARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFLATYG  616
            GTQTGTAEGFAKALAEE +ARY+KA VKVVDLDDYA DDD+YEEKLKKE+L FF +ATYG
Sbjct  88   GTQTGTAEGFAKALAEEVRARYDKAVVKVVDLDDYAADDDQYEEKLKKETLAFFMVATYG  147

Query  617  DGEPTDNAARFYKWFSEGKERGVWLKR  697
            DGEPTDNAARFYKWF+EGKERG WL+ 
Sbjct  148  DGEPTDNAARFYKWFTEGKERGTWLQH  174



>gb|KHN17598.1| NADPH--cytochrome P450 reductase [Glycine soja]
Length=715

 Score =   141 bits (356),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 113/196 (58%), Positives = 143/196 (73%), Gaps = 11/196 (6%)
 Frame = +2

Query  134  TSEKLSPFDFMAAIFKGGRIFDQSNASSESASPVAMLMDNKELMAMLTTSVAVLIGC---  304
            +S K+SP D M+AIFKG ++   + +SS +A+  A L++N++ + +LTTS  +L+     
Sbjct  5    SSMKISPLDLMSAIFKG-KLDPSNVSSSSTAAAAAFLLENRDFLMLLTTSFLMLLTTSVA  63

Query  305  -----VFVLVWRRASSSAKKAVEPPNPEVPKAAEEETGEDGRKKITIFFGTQTGTAEGFA  469
                 V V +WRR+SS   K +EPP   + K  E E  +DG KK+TI FGTQTGTAEGFA
Sbjct  64   VLVGCVVVFIWRRSSSPKAKPLEPPKRVIEKLPEIEV-DDGTKKVTILFGTQTGTAEGFA  122

Query  470  KALAEEAKARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFLATYGDGEPTDNAARF  649
            KA AEEAKARYEKA  +VVD+DDYA DDDEYEE+ KKE+ V FFLATYGDGEPTDNAARF
Sbjct  123  KATAEEAKARYEKATFRVVDMDDYAADDDEYEERFKKETHVLFFLATYGDGEPTDNAARF  182

Query  650  YKWFSEGKERGV-WLK  694
            YKWF+EG E+G  WL+
Sbjct  183  YKWFTEGGEKGEGWLQ  198



>ref|XP_010277515.1| PREDICTED: NADPH--cytochrome P450 reductase-like isoform X1 [Nelumbo 
nucifera]
Length=691

 Score =   140 bits (354),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 100/147 (68%), Positives = 113/147 (77%), Gaps = 2/147 (1%)
 Frame = +2

Query  260  LMAMLTTSVAVLIGCVFVLVWRR-ASSSAKKAVEPPNPEVPKAAEEETGEDGRKKITIFF  436
             + +LTTS AVL+   F LVWRR A     K VE   P   +  EE   + G+ KITIFF
Sbjct  29   FVVVLTTSAAVLVALAF-LVWRRSAPEKPLKPVEALKPVSFEEEEEVEVDPGKTKITIFF  87

Query  437  GTQTGTAEGFAKALAEEAKARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFLATYG  616
            GTQTGTAEGFAKALAEE +ARY+KA VKVVDLDDYA DDD+YEEKLKKE+L FF +ATYG
Sbjct  88   GTQTGTAEGFAKALAEEVRARYDKAVVKVVDLDDYAADDDQYEEKLKKETLAFFMVATYG  147

Query  617  DGEPTDNAARFYKWFSEGKERGVWLKR  697
            DGEPTDNAARFYKWF+EGKERG WL+ 
Sbjct  148  DGEPTDNAARFYKWFTEGKERGTWLQH  174



>ref|XP_004299743.1| PREDICTED: NADPH--cytochrome P450 reductase [Fragaria vesca subsp. 
vesca]
Length=689

 Score =   140 bits (354),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 93/144 (65%), Positives = 117/144 (81%), Gaps = 4/144 (3%)
 Frame = +2

Query  275  TTSVAVLIGCVFVLVWRRASSSAK--KAVEPPNPEVPKAAEEE-TGEDGRKKITIFFGTQ  445
            TTS+A++IG V V++WRR+S  ++  K +  P   V K  E+E     G+ +++IF+GTQ
Sbjct  32   TTSIALIIG-VLVVLWRRSSDRSREFKQLAVPKAVVVKEEEDEFEVASGKTRVSIFYGTQ  90

Query  446  TGTAEGFAKALAEEAKARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFLATYGDGE  625
            TGTAEGFAKALAEE KARYEKA VKV+DLDDYA +DD+Y EKLKKE++VFF LATYGDGE
Sbjct  91   TGTAEGFAKALAEEIKARYEKAAVKVIDLDDYAAEDDKYGEKLKKETMVFFMLATYGDGE  150

Query  626  PTDNAARFYKWFSEGKERGVWLKR  697
            PTDNAARFYKWF+EG +RGVWL++
Sbjct  151  PTDNAARFYKWFTEGTDRGVWLEQ  174



>gb|KHN39959.1| NADPH--cytochrome P450 reductase [Glycine soja]
Length=689

 Score =   140 bits (353),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 100/153 (65%), Positives = 118/153 (77%), Gaps = 11/153 (7%)
 Frame = +2

Query  260  LMAMLTTSVAVLIGCVFVLVWRRASSSAKKAVEPPNPEVPKAAEEETGED------GRKK  421
            +M +  TSVA++IG + V VWR++S  +K   E     VPK   +E  ED      G+ +
Sbjct  24   VMVIAATSVALVIG-LLVFVWRKSSDRSK---EQKPLAVPKLLVKEDEEDEVDAGSGKTR  79

Query  422  ITIFFGTQTGTAEGFAKALAEEAKARYEKANvkvvdlddyavdddeyeeklkkeSLVFFF  601
            + IFFGTQTGTAEGFAKALAEE KARYEKA VKV DLDDYA+DDD+YEEKLKKESL FF 
Sbjct  80   VAIFFGTQTGTAEGFAKALAEEIKARYEKAAVKVADLDDYAMDDDQYEEKLKKESLAFFM  139

Query  602  LATYGDGEPTDNAARFYKWFSEGK-ERGVWLKR  697
            LATYGDGEPTDNAARFYKWF+EGK ERG+WL++
Sbjct  140  LATYGDGEPTDNAARFYKWFTEGKDERGIWLQQ  172



>ref|NP_001236742.1| NADPH:P450 reductase [Glycine max]
 gb|AAN85869.1| NADPH:P450 reductase [Glycine max]
Length=689

 Score =   140 bits (352),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 100/153 (65%), Positives = 118/153 (77%), Gaps = 11/153 (7%)
 Frame = +2

Query  260  LMAMLTTSVAVLIGCVFVLVWRRASSSAKKAVEPPNPEVPKAAEEETGED------GRKK  421
            +M +  TSVA++IG + V VWR++S  +K   E     VPK   +E  ED      G+ +
Sbjct  24   VMVIAATSVALVIG-LLVFVWRKSSDRSK---EQKPLAVPKLLVKEDEEDEVDAGSGKTR  79

Query  422  ITIFFGTQTGTAEGFAKALAEEAKARYEKANvkvvdlddyavdddeyeeklkkeSLVFFF  601
            + IFFGTQTGTAEGFAKALAEE KARYEKA VKV DLDDYA+DDD+YEEKLKKESL FF 
Sbjct  80   VAIFFGTQTGTAEGFAKALAEEIKARYEKAAVKVADLDDYAMDDDQYEEKLKKESLAFFM  139

Query  602  LATYGDGEPTDNAARFYKWFSEGK-ERGVWLKR  697
            LATYGDGEPTDNAARFYKWF+EGK ERG+WL++
Sbjct  140  LATYGDGEPTDNAARFYKWFTEGKDERGIWLQQ  172



>gb|KHN22700.1| NADPH--cytochrome P450 reductase [Glycine soja]
Length=707

 Score =   140 bits (352),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 116/187 (62%), Positives = 146/187 (78%), Gaps = 3/187 (2%)
 Frame = +2

Query  137  SEKLSPFDFMAAIFKGGRIFDQSNASSESASPVAMLMDNKELMAMLTTSVAVLIGCVFVL  316
            S K+SP D M+AI KG ++   + +SS S +  A+L++N++ + +LTTSVAVL+GCV V 
Sbjct  6    SMKISPLDLMSAIIKG-KLDPSNVSSSSSNAAAAVLLENRQFLMLLTTSVAVLVGCVVVF  64

Query  317  VWRRASSSAKKAVEPPNPEVPKAAEEETGEDGRKKITIFFGTQTGTAEGFAKALAEEAKA  496
            +WRR+SS   K +EPP   + K  E E  +DG KK+TIFFGTQTGTAEGFAKA+AEEAKA
Sbjct  65   IWRRSSSPKAKPLEPPKRVIEKLPEIEV-DDGTKKVTIFFGTQTGTAEGFAKAIAEEAKA  123

Query  497  RYEKANvkvvdlddyavdddeyeeklkkeSLVFFFLATYGDGEPTDNAARFYKWFSEGKE  676
            RY+KA  +VVD+DDYA DDDEYEE+ KKE+   FFLATYGDGEPTDNAARFYKWF+EG E
Sbjct  124  RYDKATFRVVDMDDYAADDDEYEERFKKETHALFFLATYGDGEPTDNAARFYKWFTEGGE  183

Query  677  RGV-WLK  694
            +G  WL+
Sbjct  184  KGEGWLE  190



>ref|XP_006845640.1| hypothetical protein AMTR_s00019p00222550 [Amborella trichopoda]
 gb|ERN07315.1| hypothetical protein AMTR_s00019p00222550 [Amborella trichopoda]
Length=711

 Score =   140 bits (352),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 111/185 (60%), Positives = 131/185 (71%), Gaps = 10/185 (5%)
 Frame = +2

Query  143  KLSPFDFMAAIFKGGRIFDQSNASSESASPVAMLMDNKELMAMLTTSVAVLIGCVFVLVW  322
            ++SP D M+A+  G  I        E+        +N +L+ +LTTSVAVLIGCVF  VW
Sbjct  14   EISPLDLMSALINGKEI---PAILPENGR------ENPQLLVILTTSVAVLIGCVFFFVW  64

Query  323  RRASSSAKKAVEPPNPEVPKAAEEETGED-GRKKITIFFGTQTGTAEGFAKALAEEAKAR  499
            RR+       V   N  V    E+E   D G++K+TIFFGTQTGTAEGFAKALAEEAKAR
Sbjct  65   RRSLGQKSGKVVEVNKLVVVKPEQEAEVDPGKEKVTIFFGTQTGTAEGFAKALAEEAKAR  124

Query  500  YEKANvkvvdlddyavdddeyeeklkkeSLVFFFLATYGDGEPTDNAARFYKWFSEGKER  679
            Y+KA  KVVDLDDYA DDDEYEEKL+KE + FF LATYGDGEPTDNAARFYKWF EG +R
Sbjct  125  YDKAIFKVVDLDDYAADDDEYEEKLRKEKIAFFMLATYGDGEPTDNAARFYKWFIEGNDR  184

Query  680  GVWLK  694
            G+WL+
Sbjct  185  GIWLQ  189



>ref|XP_003578634.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Brachypodium 
distachyon]
Length=697

 Score =   139 bits (351),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 104/160 (65%), Positives = 124/160 (78%), Gaps = 2/160 (1%)
 Frame = +2

Query  218  ESASPVAMLMDNKELMAMLTTSVAVLIGCVFVLVWRRASSSA-KKAVEPPNPEVPKAAEE  394
            E AS +A+  DN+ ++A+LTTS+AVL+GC   L  RR+SS+A  +      P   KA E+
Sbjct  18   EGASLLALAEDNRRILALLTTSLAVLVGCGVALFLRRSSSAAGPQPATASRPLAAKAREK  77

Query  395  ETG-EDGRKKITIFFGTQTGTAEGFAKALAEEAKARYEKANvkvvdlddyavdddeyeek  571
            E   +DGR ++ +FFGTQTGTAEGFAKALAEEAKARY+KA  KVVDLDDYA +DD+Y EK
Sbjct  78   EPDPDDGRLRVAVFFGTQTGTAEGFAKALAEEAKARYDKAVFKVVDLDDYAAEDDDYAEK  137

Query  572  lkkeSLVFFFLATYGDGEPTDNAARFYKWFSEGKERGVWL  691
            LKKE +  FFLATYGDGEPTDNAARFYKWFSEG ERG WL
Sbjct  138  LKKEIIALFFLATYGDGEPTDNAARFYKWFSEGNERGEWL  177



>gb|AAS00459.1| NADPH:cytochrome P450-reductase [Hypericum androsaemum]
Length=685

 Score =   139 bits (350),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 96/157 (61%), Positives = 119/157 (76%), Gaps = 3/157 (2%)
 Frame = +2

Query  236  AMLMDNKELMAMLTTSVAVLIGCVFVLVWRRASSSAKKA---VEPPNPEVPKAAEEETGE  406
            A+ +    ++ ++TTS+  +IG V + +W+R+S   K     V PP P   K  EEE   
Sbjct  12   ALGVGTDSVLVVITTSLVAVIGVVALFLWKRSSDRGKDPKTLVVPPKPLSLKEEEEEDEA  71

Query  407  DGRKKITIFFGTQTGTAEGFAKALAEEAKARYEKANvkvvdlddyavdddeyeeklkkeS  586
            +G+ K+ IF+GTQTGTAEGFAKALAEE K RYEKA VKVVDLDDYA+DDD+YEEKLKKE+
Sbjct  72   EGKTKVCIFYGTQTGTAEGFAKALAEEIKVRYEKAVVKVVDLDDYALDDDQYEEKLKKET  131

Query  587  LVFFFLATYGDGEPTDNAARFYKWFSEGKERGVWLKR  697
            L FF +ATYGDGEPTDNAARFYKWF+E  ERGVWL++
Sbjct  132  LAFFMVATYGDGEPTDNAARFYKWFTEEHERGVWLQQ  168



>gb|AAT76449.1| NADPH:cytochrome P450 reductase [Taxus cuspidata]
Length=717

 Score =   139 bits (350),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 102/151 (68%), Positives = 118/151 (78%), Gaps = 0/151 (0%)
 Frame = +2

Query  239  MLMDNKELMAMLTTSVAVLIGCVFVLVWRRASSSAKKAVEPPNPEVPKAAEEETGEDGRK  418
            +L +N + + +LTT++AVL+ CVF  VWRR  S  +K    P P V +  EEE  +  +K
Sbjct  47   ILTENSQNLMILTTALAVLVACVFFFVWRRGGSDTQKPAVRPTPLVKEEDEEEEDDSAKK  106

Query  419  KITIFFGTQTGTAEGFAKALAEEAKARYEKANvkvvdlddyavdddeyeeklkkeSLVFF  598
            K+TIFFGTQTGTAEGFAKALAEEAKARYEKA  KVVDLD+YA DD++YEEKLKKE L FF
Sbjct  107  KVTIFFGTQTGTAEGFAKALAEEAKARYEKAVFKVVDLDNYAADDEQYEEKLKKEKLAFF  166

Query  599  FLATYGDGEPTDNAARFYKWFSEGKERGVWL  691
             LATYGDGEPTDNAARFYKWF EGKER  WL
Sbjct  167  MLATYGDGEPTDNAARFYKWFLEGKEREPWL  197



>ref|XP_002514049.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF48632.1| cytochrome P450, putative [Ricinus communis]
Length=692

 Score =   139 bits (349),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 95/149 (64%), Positives = 118/149 (79%), Gaps = 4/149 (3%)
 Frame = +2

Query  260  LMAMLTTSVAVLIGCVFVLVWRRASSSAKKA---VEPPNPEVPKAAEEETGEDGRKKITI  430
            ++ ++TTS AV+IG + V +W+R+S  +K+    V P +  V    +E     G+ K+TI
Sbjct  29   VVVIITTSFAVIIG-LLVFLWKRSSDRSKEVTPLVVPKSLSVKDEEDEAETLAGKTKVTI  87

Query  431  FFGTQTGTAEGFAKALAEEAKARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFLAT  610
            F+GTQTGTAEGFAKALAEE KARYEKA VKVVDLDDYA+DDD+YEEKLKKE+L FF +AT
Sbjct  88   FYGTQTGTAEGFAKALAEEIKARYEKAAVKVVDLDDYAMDDDQYEEKLKKETLTFFMVAT  147

Query  611  YGDGEPTDNAARFYKWFSEGKERGVWLKR  697
            YGDGEPTDNAARFYKWF+E  ERGVWL++
Sbjct  148  YGDGEPTDNAARFYKWFTEEHERGVWLQQ  176



>ref|XP_002265859.2| PREDICTED: NADPH--cytochrome P450 reductase [Vitis vinifera]
 emb|CBI19275.3| unnamed protein product [Vitis vinifera]
Length=688

 Score =   138 bits (348),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 97/169 (57%), Positives = 125/169 (74%), Gaps = 4/169 (2%)
 Frame = +2

Query  200  QSNASSESASPVAMLMDNKELMAMLTTSVAVLIGCVFVLVWRRASS---SAKKAVEPPNP  370
            +SN  +   + + + + ++  + +LTT+VAV++G + + VWR +S      K  V P   
Sbjct  4    ESNLINTVEAFLGVSLGSESAVVILTTTVAVILG-LLIFVWRISSDRGRDVKPLVVPKAV  62

Query  371  EVPKAAEEETGEDGRKKITIFFGTQTGTAEGFAKALAEEAKARYEKANvkvvdlddyavd  550
             +P   +E     G+ K+T+FFGTQTGTAEGFAKALAEE KARY+KA +KVVDLDDYAVD
Sbjct  63   AIPAEEDEAEAAVGKTKVTVFFGTQTGTAEGFAKALAEEIKARYDKATIKVVDLDDYAVD  122

Query  551  ddeyeeklkkeSLVFFFLATYGDGEPTDNAARFYKWFSEGKERGVWLKR  697
            DD+YEEKLKKE+L FF LATYGDGEPTDNAARFYKWF+EGKER  WL++
Sbjct  123  DDQYEEKLKKEALAFFMLATYGDGEPTDNAARFYKWFTEGKEREAWLQQ  171



>gb|KJB58864.1| hypothetical protein B456_009G229300 [Gossypium raimondii]
Length=586

 Score =   137 bits (345),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 91/151 (60%), Positives = 119/151 (79%), Gaps = 6/151 (4%)
 Frame = +2

Query  260  LMAMLTTSVAVLIGCVFVLVWRRASSSAKKAVEPPNPEVPKAAEEETGED-----GRKKI  424
            ++ + TTS+AV++G + V +W+++ S   + V+P     P + ++E  +D     G+ K+
Sbjct  27   MIVVATTSLAVILG-LLVFLWKKSGSERSRDVKPLVAPKPVSLKDEEDDDAVIAAGKTKV  85

Query  425  TIFFGTQTGTAEGFAKALAEEAKARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFL  604
            TIF+GTQTGTAEGFAKALAEE KARYEKA VKVVDLDDYA+DD++YEEKLKKE+L FF +
Sbjct  86   TIFYGTQTGTAEGFAKALAEEIKARYEKAAVKVVDLDDYAMDDEQYEEKLKKETLAFFMV  145

Query  605  ATYGDGEPTDNAARFYKWFSEGKERGVWLKR  697
            ATYGDGEPTDNAARFYKWF+EG ER  WL++
Sbjct  146  ATYGDGEPTDNAARFYKWFTEGNERQPWLQQ  176



>gb|KJB58865.1| hypothetical protein B456_009G229300 [Gossypium raimondii]
Length=694

 Score =   138 bits (347),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 91/151 (60%), Positives = 119/151 (79%), Gaps = 6/151 (4%)
 Frame = +2

Query  260  LMAMLTTSVAVLIGCVFVLVWRRASSSAKKAVEPPNPEVPKAAEEETGED-----GRKKI  424
            ++ + TTS+AV++G + V +W+++ S   + V+P     P + ++E  +D     G+ K+
Sbjct  27   MIVVATTSLAVILG-LLVFLWKKSGSERSRDVKPLVAPKPVSLKDEEDDDAVIAAGKTKV  85

Query  425  TIFFGTQTGTAEGFAKALAEEAKARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFL  604
            TIF+GTQTGTAEGFAKALAEE KARYEKA VKVVDLDDYA+DD++YEEKLKKE+L FF +
Sbjct  86   TIFYGTQTGTAEGFAKALAEEIKARYEKAAVKVVDLDDYAMDDEQYEEKLKKETLAFFMV  145

Query  605  ATYGDGEPTDNAARFYKWFSEGKERGVWLKR  697
            ATYGDGEPTDNAARFYKWF+EG ER  WL++
Sbjct  146  ATYGDGEPTDNAARFYKWFTEGNERQPWLQQ  176



>pir||A47298 NADPH-ferrihemoprotein reductase (EC 1.6.2.4) - mung bean
Length=690

 Score =   138 bits (347),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 100/149 (67%), Positives = 118/149 (79%), Gaps = 4/149 (3%)
 Frame = +2

Query  260  LMAMLTTSVAVLIGCVFVLVWRRASSSAK--KAVEPPNPEVPKAAEEETGEDGRKKITIF  433
            L+ + TTS AV++G + V +W+++S  +K  K V  P   + +  EE     G+ K+TIF
Sbjct  27   LLLIATTSAAVVVG-LLVFLWKKSSDRSKEVKPVVVPRDLMMEEEEEVDVAAGKTKVTIF  85

Query  434  FGTQTGTAEGFAKALAEEAKARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFLATY  613
            FGTQTGTAEGFAKALAEE KARYEKA VKVVDLDDYA DDD YEEKLKKESLVFF LATY
Sbjct  86   FGTQTGTAEGFAKALAEEIKARYEKAAVKVVDLDDYAADDDLYEEKLKKESLVFFMLATY  145

Query  614  GDGEPTDNAARFYKWFSEGK-ERGVWLKR  697
            GDGEPTDNAARFYKWF+EGK ERG+WL++
Sbjct  146  GDGEPTDNAARFYKWFTEGKDERGIWLQK  174



>emb|CDP11509.1| unnamed protein product [Coffea canephora]
Length=691

 Score =   138 bits (347),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 100/167 (60%), Positives = 127/167 (76%), Gaps = 7/167 (4%)
 Frame = +2

Query  212  SSESASPVAMLMDNKELMAMLTTSVAVLIGCVFVLVWRRASSSAKK----AVEPPNPEVP  379
            S ESA  V++  D  +++ +LTTS+A ++G + V +W+R+S  +K+     +   N  VP
Sbjct  10   SIESALGVSLGEDGNQVLLVLTTSLAAIVG-LLVFLWKRSSDRSKETKPLVITKLNTSVP  68

Query  380  KAAEEETGEDGRKKITIFFGTQTGTAEGFAKALAEEAKARYEKANvkvvdlddyavddde  559
            +  EE+  +  + K+TIFFGTQTGTAEGFAKAL EE KARYEKA VKVVDLDDYA DDD+
Sbjct  69   EE-EEDDVDPSKVKVTIFFGTQTGTAEGFAKALGEEIKARYEKAVVKVVDLDDYAADDDQ  127

Query  560  yeeklkkeSLVFFFLATYGDGEPTDNAARFYKWFSEG-KERGVWLKR  697
            YEEKLKKE+L FF +ATYGDGEPTDNAARFYKWFSEG K+R  WL++
Sbjct  128  YEEKLKKETLAFFMVATYGDGEPTDNAARFYKWFSEGLKDREPWLQQ  174



>gb|KJB58863.1| hypothetical protein B456_009G229300 [Gossypium raimondii]
Length=693

 Score =   138 bits (347),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 91/151 (60%), Positives = 119/151 (79%), Gaps = 6/151 (4%)
 Frame = +2

Query  260  LMAMLTTSVAVLIGCVFVLVWRRASSSAKKAVEPPNPEVPKAAEEETGED-----GRKKI  424
            ++ + TTS+AV++G + V +W+++ S   + V+P     P + ++E  +D     G+ K+
Sbjct  27   MIVVATTSLAVILG-LLVFLWKKSGSERSRDVKPLVAPKPVSLKDEEDDDAVIAAGKTKV  85

Query  425  TIFFGTQTGTAEGFAKALAEEAKARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFL  604
            TIF+GTQTGTAEGFAKALAEE KARYEKA VKVVDLDDYA+DD++YEEKLKKE+L FF +
Sbjct  86   TIFYGTQTGTAEGFAKALAEEIKARYEKAAVKVVDLDDYAMDDEQYEEKLKKETLAFFMV  145

Query  605  ATYGDGEPTDNAARFYKWFSEGKERGVWLKR  697
            ATYGDGEPTDNAARFYKWF+EG ER  WL++
Sbjct  146  ATYGDGEPTDNAARFYKWFTEGNERQPWLQQ  176



>ref|XP_010530279.1| PREDICTED: NADPH--cytochrome P450 reductase 1-like [Tarenaya 
hassleriana]
Length=694

 Score =   137 bits (346),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 96/151 (64%), Positives = 118/151 (78%), Gaps = 9/151 (6%)
 Frame = +2

Query  263  MAMLTTSVAVLIGCVFVLVWRRASSSAKKAVEPPNPEVPK---AAEEETGED---GRKKI  424
            + + TTS+AV++G   VL+WR+ ++   + V+P    VPK   A +E+   D   G+ ++
Sbjct  32   LVIATTSLAVIVGFA-VLLWRKTATDRSREVKPVV--VPKSLMAKDEDDNFDLGSGKTRV  88

Query  425  TIFFGTQTGTAEGFAKALAEEAKARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFL  604
            TIFFGTQTGTAEGFAKALAEE KARYEKA VKVVD+DDYA DDD YEEKLKKE+L FF +
Sbjct  89   TIFFGTQTGTAEGFAKALAEEIKARYEKAAVKVVDMDDYAADDDLYEEKLKKETLAFFVV  148

Query  605  ATYGDGEPTDNAARFYKWFSEGKERGVWLKR  697
            ATYGDGEPTDNAARFYKWF+EG E GVWL++
Sbjct  149  ATYGDGEPTDNAARFYKWFTEGNESGVWLQQ  179



>gb|AAX59902.1| cytochrome P450 reductase [Taxus wallichiana var. chinensis]
Length=717

 Score =   138 bits (347),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 106/182 (58%), Positives = 129/182 (71%), Gaps = 4/182 (2%)
 Frame = +2

Query  146  LSPFDFMAAIFKGGRIFDQSNASSESASPVAMLMDNKELMAMLTTSVAVLIGCVFVLVWR  325
            +S  D + A+   G+  D    +  +     +L +N + + +LTT++AVL+ CVF  VWR
Sbjct  20   ISRLDHIFALLLNGKGGDLGAMTGSAL----ILTENSQNLMILTTALAVLVACVFFFVWR  75

Query  326  RASSSAKKAVEPPNPEVPKAAEEETGEDGRKKITIFFGTQTGTAEGFAKALAEEAKARYE  505
            R  S  +K    P P V +  EEE  +  +KK+TIFFGT+TGTAEGFAKALAEEAKARYE
Sbjct  76   RGGSDTQKPAVKPTPLVKEEDEEEEDDSAKKKVTIFFGTRTGTAEGFAKALAEEAKARYE  135

Query  506  KANvkvvdlddyavdddeyeeklkkeSLVFFFLATYGDGEPTDNAARFYKWFSEGKERGV  685
            KA  KVVDLD+YA DD++YEEKLKKE L FF LATYGDGEPTDNAARFYKWF EGKER  
Sbjct  136  KAVFKVVDLDNYAADDEQYEEKLKKEKLAFFMLATYGDGEPTDNAARFYKWFLEGKEREP  195

Query  686  WL  691
            WL
Sbjct  196  WL  197



>ref|XP_007018237.1| NADPH--cytochrome P450 reductase isoform 4 [Theobroma cacao]
 gb|EOY15462.1| NADPH--cytochrome P450 reductase isoform 4 [Theobroma cacao]
Length=517

 Score =   136 bits (342),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 89/151 (59%), Positives = 119/151 (79%), Gaps = 6/151 (4%)
 Frame = +2

Query  260  LMAMLTTSVAVLIGCVFVLVWRRASSSAKKAVEPPNPEVPKAAEEETGED-----GRKKI  424
            ++ + TTS+AV++G + V +W++++S     ++P     P + +++  +D     G+ K+
Sbjct  27   MIVIATTSLAVILG-LLVFLWKKSASERSHDIKPLVTPKPISLKDDEDDDAVIAAGKTKV  85

Query  425  TIFFGTQTGTAEGFAKALAEEAKARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFL  604
            TIF+GTQTGTAEGFAKALAEE KARYEKA VKVVDLDDYA+DD++YEEKLKKE+L FF +
Sbjct  86   TIFYGTQTGTAEGFAKALAEEIKARYEKAAVKVVDLDDYALDDEQYEEKLKKETLAFFMV  145

Query  605  ATYGDGEPTDNAARFYKWFSEGKERGVWLKR  697
            ATYGDGEPTDNAARFYKWF+EG ER  WL++
Sbjct  146  ATYGDGEPTDNAARFYKWFTEGNEREPWLQQ  176



>ref|XP_010520739.1| PREDICTED: NADPH--cytochrome P450 reductase 1-like [Tarenaya 
hassleriana]
Length=694

 Score =   137 bits (346),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 91/149 (61%), Positives = 116/149 (78%), Gaps = 5/149 (3%)
 Frame = +2

Query  263  MAMLTTSVAVLIGCVFVLVWRRASSSAKKAVEPPN-PEVPKAAEEETGED---GRKKITI  430
            + + TTS+AV++G   VL+WR+ ++   + ++P   P+   A +E+   D   G+ ++TI
Sbjct  32   LVIATTSLAVIVGFA-VLLWRKTAADRSREMKPVTVPQSLMAKDEDDDLDMGSGKTRVTI  90

Query  431  FFGTQTGTAEGFAKALAEEAKARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFLAT  610
            FFGTQTGTAEGFAKAL EE KARYEKA VKVVD+DDYA DDD+Y EKLKKE+L FF +AT
Sbjct  91   FFGTQTGTAEGFAKALTEEIKARYEKAAVKVVDMDDYAADDDQYAEKLKKETLAFFIIAT  150

Query  611  YGDGEPTDNAARFYKWFSEGKERGVWLKR  697
            YGDGEPTDNAARFYKWF+EG ERG WL++
Sbjct  151  YGDGEPTDNAARFYKWFTEGNERGAWLQQ  179



>gb|AAS92623.1| NADPH:cytochrome P450-reductase [Centaurium erythraea]
Length=692

 Score =   137 bits (345),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 101/167 (60%), Positives = 127/167 (76%), Gaps = 6/167 (4%)
 Frame = +2

Query  212  SSESASPVAMLMD-NKELMAMLTTSVAVLIGCVFVLVWRRASSSAKKAVEPPNPEVPKAA  388
            S ESA  V++  D +K ++ +LTTS+AV++G V V +W+R+S  +++      P++  A 
Sbjct  10   SIESALGVSLGEDGDKVVILVLTTSLAVIVGLV-VFLWKRSSDRSRETKSVVVPKLVTAL  68

Query  389  EEETGE----DGRKKITIFFGTQTGTAEGFAKALAEEAKARYEKANvkvvdlddyavddd  556
            +EE  E      + K+T+FFGTQTGTAEGFAKALAEE K RYEKA VKVVDLDDYA DDD
Sbjct  69   QEEEEEVDLDPSKVKVTVFFGTQTGTAEGFAKALAEEIKTRYEKAVVKVVDLDDYAADDD  128

Query  557  eyeeklkkeSLVFFFLATYGDGEPTDNAARFYKWFSEGKERGVWLKR  697
            +YEEKLKKE+L FF +ATYGDGEPTDNAARFYKWFSE KER  WL++
Sbjct  129  QYEEKLKKETLAFFMVATYGDGEPTDNAARFYKWFSEVKEREPWLQQ  175



>ref|XP_010692385.1| PREDICTED: NADPH--cytochrome P450 reductase [Beta vulgaris subsp. 
vulgaris]
Length=693

 Score =   137 bits (345),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 94/148 (64%), Positives = 114/148 (77%), Gaps = 4/148 (3%)
 Frame = +2

Query  263  MAMLTTSVAVLIGCVFVLVWRRA---SSSAKKAVEPPNPEVPKAAEEETGEDGRKKITIF  433
            + +L TS+AV++G VFVL WRR+   S  +K  V P + +V    +E     G+ K++IF
Sbjct  30   ILLLWTSIAVIVGLVFVL-WRRSNDNSGDSKVVVAPKSLKVEPEEDELEIAAGKTKVSIF  88

Query  434  FGTQTGTAEGFAKALAEEAKARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFLATY  613
            FGTQTGTAEGFAKALAEE KARY+KA VKV+DLDDYA DDD YE KLKKE+L FF +ATY
Sbjct  89   FGTQTGTAEGFAKALAEEIKARYDKALVKVLDLDDYAADDDLYEVKLKKETLAFFMVATY  148

Query  614  GDGEPTDNAARFYKWFSEGKERGVWLKR  697
            GDGEPTDNAARFYKWF+EG ER  WL++
Sbjct  149  GDGEPTDNAARFYKWFTEGNEREPWLQQ  176



>gb|ACN54323.1| NADPH:cytochrome P450 reductase [Gossypium hirsutum]
Length=693

 Score =   137 bits (344),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 91/151 (60%), Positives = 118/151 (78%), Gaps = 6/151 (4%)
 Frame = +2

Query  260  LMAMLTTSVAVLIGCVFVLVWRRASSSAKKAVEPPNPEVPKAAEEETGED-----GRKKI  424
            ++ + TTS+AV++G + V  W+++ S   + V+P     P + ++E  +D     G+ K+
Sbjct  27   MIVIATTSLAVILG-LLVFFWKKSGSERSRDVKPLVAPKPVSLKDEEDDDAVIAAGKTKV  85

Query  425  TIFFGTQTGTAEGFAKALAEEAKARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFL  604
            TIF+GTQTGTAEGFAKALAEE KARYEKA VKVVDLDDYA+DD++YEEKLKKE+L FF +
Sbjct  86   TIFYGTQTGTAEGFAKALAEEIKARYEKAAVKVVDLDDYAMDDEQYEEKLKKETLAFFMV  145

Query  605  ATYGDGEPTDNAARFYKWFSEGKERGVWLKR  697
            ATYGDGEPTDNAARFYKWF+EG ER  WL++
Sbjct  146  ATYGDGEPTDNAARFYKWFTEGNERLPWLQQ  176



>ref|XP_007018234.1| P450 reductase 1 isoform 1 [Theobroma cacao]
 gb|EOY15459.1| P450 reductase 1 isoform 1 [Theobroma cacao]
Length=693

 Score =   136 bits (342),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 89/151 (59%), Positives = 119/151 (79%), Gaps = 6/151 (4%)
 Frame = +2

Query  260  LMAMLTTSVAVLIGCVFVLVWRRASSSAKKAVEPPNPEVPKAAEEETGED-----GRKKI  424
            ++ + TTS+AV++G + V +W++++S     ++P     P + +++  +D     G+ K+
Sbjct  27   MIVIATTSLAVILG-LLVFLWKKSASERSHDIKPLVTPKPISLKDDEDDDAVIAAGKTKV  85

Query  425  TIFFGTQTGTAEGFAKALAEEAKARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFL  604
            TIF+GTQTGTAEGFAKALAEE KARYEKA VKVVDLDDYA+DD++YEEKLKKE+L FF +
Sbjct  86   TIFYGTQTGTAEGFAKALAEEIKARYEKAAVKVVDLDDYALDDEQYEEKLKKETLAFFMV  145

Query  605  ATYGDGEPTDNAARFYKWFSEGKERGVWLKR  697
            ATYGDGEPTDNAARFYKWF+EG ER  WL++
Sbjct  146  ATYGDGEPTDNAARFYKWFTEGNEREPWLQQ  176



>sp|P37116.1|NCPR_VIGRR RecName: Full=NADPH--cytochrome P450 reductase; Short=CPR; Short=P450R 
[Vigna radiata var. radiata]
 gb|AAA34240.1| NADPH cytochrome P450 [Vigna radiata]
Length=690

 Score =   136 bits (342),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 99/149 (66%), Positives = 117/149 (79%), Gaps = 4/149 (3%)
 Frame = +2

Query  260  LMAMLTTSVAVLIGCVFVLVWRRASSSAK--KAVEPPNPEVPKAAEEETGEDGRKKITIF  433
            L+ + TTS AV++G + V +W+++S  +K  K V  P   + +  EE     G+ K+TIF
Sbjct  27   LLLIATTSAAVVVG-LLVFLWKKSSDRSKEVKPVVVPRDLMMEEEEEVDVAAGKTKVTIF  85

Query  434  FGTQTGTAEGFAKALAEEAKARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFLATY  613
            FGTQTGTAEGFAKALAEE KARYEKA VKVVDLDDYA DDD YEEKLKKESLVFF LATY
Sbjct  86   FGTQTGTAEGFAKALAEEIKARYEKAAVKVVDLDDYAADDDLYEEKLKKESLVFFMLATY  145

Query  614  GDGEPTDNAARFYKWFSEGK-ERGVWLKR  697
            GDGEP DNAARFYKWF+EGK ERG+WL++
Sbjct  146  GDGEPIDNAARFYKWFTEGKDERGIWLQK  174



>ref|XP_004501653.1| PREDICTED: NADPH--cytochrome P450 reductase-like isoform X1 [Cicer 
arietinum]
Length=700

 Score =   136 bits (342),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 96/149 (64%), Positives = 118/149 (79%), Gaps = 4/149 (3%)
 Frame = +2

Query  260  LMAMLTTSVAVLIGCVFVLVWRRAS--SSAKKAVEPPNPEVPKAAEEETGEDGRKKITIF  433
            L+ ++TTS AV+IG + V +W+++S  S+  K V  P   V +  ++    DG+ K+T+ 
Sbjct  28   LILIVTTSAAVVIG-LLVFLWKKSSDRSNELKPVIVPKSLVKEEDDDIDVGDGKTKVTVL  86

Query  434  FGTQTGTAEGFAKALAEEAKARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFLATY  613
            FGTQTGTAEGFAKALAEE KARYEKA VKVVDLDDYA+DDD+YEEKLKKE+L FF +ATY
Sbjct  87   FGTQTGTAEGFAKALAEEIKARYEKAVVKVVDLDDYAMDDDQYEEKLKKETLAFFMVATY  146

Query  614  GDGEPTDNAARFYKWFSEGK-ERGVWLKR  697
            GDGEPTDNAARFYKWF+EGK ERG WL+ 
Sbjct  147  GDGEPTDNAARFYKWFTEGKDERGTWLQH  175



>ref|XP_004501654.1| PREDICTED: NADPH--cytochrome P450 reductase-like isoform X2 [Cicer 
arietinum]
Length=692

 Score =   135 bits (341),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 96/149 (64%), Positives = 118/149 (79%), Gaps = 4/149 (3%)
 Frame = +2

Query  260  LMAMLTTSVAVLIGCVFVLVWRRAS--SSAKKAVEPPNPEVPKAAEEETGEDGRKKITIF  433
            L+ ++TTS AV+IG + V +W+++S  S+  K V  P   V +  ++    DG+ K+T+ 
Sbjct  28   LILIVTTSAAVVIG-LLVFLWKKSSDRSNELKPVIVPKSLVKEEDDDIDVGDGKTKVTVL  86

Query  434  FGTQTGTAEGFAKALAEEAKARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFLATY  613
            FGTQTGTAEGFAKALAEE KARYEKA VKVVDLDDYA+DDD+YEEKLKKE+L FF +ATY
Sbjct  87   FGTQTGTAEGFAKALAEEIKARYEKAVVKVVDLDDYAMDDDQYEEKLKKETLAFFMVATY  146

Query  614  GDGEPTDNAARFYKWFSEGK-ERGVWLKR  697
            GDGEPTDNAARFYKWF+EGK ERG WL+ 
Sbjct  147  GDGEPTDNAARFYKWFTEGKDERGTWLQH  175



>ref|XP_010254555.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Nelumbo nucifera]
Length=692

 Score =   135 bits (341),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 94/148 (64%), Positives = 114/148 (77%), Gaps = 3/148 (2%)
 Frame = +2

Query  260  LMAMLTTSVAVLIGCVFVLVWRRASSSAK--KAVEPPNPEVPKAAEEETGEDGRKKITIF  433
             + + TTSVAVL+G VF  +W+R+S+  K  K V    P   +  +E   + G+ K+TIF
Sbjct  29   FILIFTTSVAVLVGLVF-FIWKRSSAPEKPAKPVVVLKPSSLEEEDEVEVDPGKTKVTIF  87

Query  434  FGTQTGTAEGFAKALAEEAKARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFLATY  613
            FGTQTGTAEGFAKALAEE +ARY+KA VKVVDLDDYA DDD+Y EKLKKE+L FF +ATY
Sbjct  88   FGTQTGTAEGFAKALAEEIRARYDKAVVKVVDLDDYAADDDQYGEKLKKETLAFFIVATY  147

Query  614  GDGEPTDNAARFYKWFSEGKERGVWLKR  697
            GDGEPTDNAARFYKWF+EG+E G WL+ 
Sbjct  148  GDGEPTDNAARFYKWFTEGEESGAWLQH  175



>ref|XP_007018236.1| NADPH--cytochrome P450 reductase isoform 3 [Theobroma cacao]
 gb|EOY15461.1| NADPH--cytochrome P450 reductase isoform 3 [Theobroma cacao]
Length=736

 Score =   136 bits (342),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 89/151 (59%), Positives = 119/151 (79%), Gaps = 6/151 (4%)
 Frame = +2

Query  260  LMAMLTTSVAVLIGCVFVLVWRRASSSAKKAVEPPNPEVPKAAEEETGED-----GRKKI  424
            ++ + TTS+AV++G + V +W++++S     ++P     P + +++  +D     G+ K+
Sbjct  27   MIVIATTSLAVILG-LLVFLWKKSASERSHDIKPLVTPKPISLKDDEDDDAVIAAGKTKV  85

Query  425  TIFFGTQTGTAEGFAKALAEEAKARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFL  604
            TIF+GTQTGTAEGFAKALAEE KARYEKA VKVVDLDDYA+DD++YEEKLKKE+L FF +
Sbjct  86   TIFYGTQTGTAEGFAKALAEEIKARYEKAAVKVVDLDDYALDDEQYEEKLKKETLAFFMV  145

Query  605  ATYGDGEPTDNAARFYKWFSEGKERGVWLKR  697
            ATYGDGEPTDNAARFYKWF+EG ER  WL++
Sbjct  146  ATYGDGEPTDNAARFYKWFTEGNEREPWLQQ  176



>ref|XP_003602898.1| NADPH cytochrome P450 reductase [Medicago truncatula]
 gb|AES73149.1| NADPH-cytochrome P450 family 2 reductase [Medicago truncatula]
Length=692

 Score =   135 bits (341),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 96/149 (64%), Positives = 119/149 (80%), Gaps = 4/149 (3%)
 Frame = +2

Query  260  LMAMLTTSVAVLIGCVFVLVWRRASSSAK--KAVEPPNPEVPKAAEEETGEDGRKKITIF  433
            ++ ++TTS AV+IG + V +W+++S  +K  K V  P   V +  ++    DG+ K+T+F
Sbjct  28   VVLIVTTSAAVIIG-LLVFLWKKSSDRSKELKPVIVPKSLVKEEDDDADIADGKTKVTVF  86

Query  434  FGTQTGTAEGFAKALAEEAKARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFLATY  613
            FGTQTGTAEGFAKALAEE KARYEKA VKVVD+DDYA DDD+YEEKLKKE+L FF LATY
Sbjct  87   FGTQTGTAEGFAKALAEEIKARYEKAFVKVVDMDDYAADDDQYEEKLKKETLAFFMLATY  146

Query  614  GDGEPTDNAARFYKWFSEGK-ERGVWLKR  697
            GDGEPTDNAARFYKWF+EGK ERG WL++
Sbjct  147  GDGEPTDNAARFYKWFTEGKDERGTWLQQ  175



>gb|ADI49691.1| cytochrome P450 reductase [Withania somnifera]
Length=686

 Score =   135 bits (341),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 97/160 (61%), Positives = 119/160 (74%), Gaps = 5/160 (3%)
 Frame = +2

Query  227  SPVAMLMDNKELMAMLTTSVAVLIGCVFVLVWRRASSSAKKAVEP---PNPEVPKAAEEE  397
            S + + + +  ++ +LTTS AV++G V   + R  SS  +K V+P   P     +  EE 
Sbjct  13   SSIGVSLGSDMVLMLLTTSFAVIVGLVVFFLKR--SSDQRKEVKPVVLPKSLHLEPEEET  70

Query  398  TGEDGRKKITIFFGTQTGTAEGFAKALAEEAKARYEKANvkvvdlddyavdddeyeeklk  577
              E G+ K+T+FFGTQTGTAEGFAKAL+EE KARYEKA VKVVD+DDYA DDD YEEKLK
Sbjct  71   EIEPGKIKVTVFFGTQTGTAEGFAKALSEEIKARYEKAVVKVVDMDDYAADDDLYEEKLK  130

Query  578  keSLVFFFLATYGDGEPTDNAARFYKWFSEGKERGVWLKR  697
            KE+L FF +ATYGDGEPTDNAARFYKWF+EG ERGVWL+ 
Sbjct  131  KETLAFFMVATYGDGEPTDNAARFYKWFTEGHERGVWLQH  170



>gb|KHG05124.1| NADPH--cytochrome P450 reductase [Gossypium arboreum]
Length=693

 Score =   135 bits (341),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 89/151 (59%), Positives = 117/151 (77%), Gaps = 6/151 (4%)
 Frame = +2

Query  260  LMAMLTTSVAVLIGCVFVLVWRRASSSAKKAVEPPNPEVPKAAEEETGED-----GRKKI  424
            ++ + TTS+AV++G + +  W+++ S   + V+P     P + ++E  +D     G+ K+
Sbjct  27   MIVIATTSLAVILG-LLLFFWKKSGSERSRDVKPLVAPKPVSLKDEEDDDDVIASGKTKV  85

Query  425  TIFFGTQTGTAEGFAKALAEEAKARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFL  604
            TIF+GTQTGTAEGFAKALAEE KARYEKA VKVVDLDDYA+DD++YEEK KKE+L FF +
Sbjct  86   TIFYGTQTGTAEGFAKALAEEIKARYEKAAVKVVDLDDYAMDDEQYEEKFKKETLAFFMV  145

Query  605  ATYGDGEPTDNAARFYKWFSEGKERGVWLKR  697
            ATYGDGEPTDNAARFYKWF+EG ER  WL++
Sbjct  146  ATYGDGEPTDNAARFYKWFTEGNERQPWLQQ  176



>emb|CAA81211.1| NADPH-ferrihemoprotein reductase [Vicia sativa]
Length=692

 Score =   135 bits (341),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 94/149 (63%), Positives = 118/149 (79%), Gaps = 4/149 (3%)
 Frame = +2

Query  260  LMAMLTTSVAVLIGCVFVLVWRRASSSAK--KAVEPPNPEVPKAAEEETGEDGRKKITIF  433
            ++ + TTS AV+IG + V +WR++   ++  + V  P   V    +E   + G+ K+T+F
Sbjct  28   VVIIATTSAAVIIG-LLVFLWRKSPDRSRELRPVIVPKFTVKHEDDEVEVDRGKTKVTVF  86

Query  434  FGTQTGTAEGFAKALAEEAKARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFLATY  613
            +GTQTGTAEGFAKALAEE KARYEKA VKVVD+DDYA+DDD+YEEKLKKE+LVFF LATY
Sbjct  87   YGTQTGTAEGFAKALAEEIKARYEKAVVKVVDMDDYAIDDDQYEEKLKKETLVFFMLATY  146

Query  614  GDGEPTDNAARFYKWFSEGK-ERGVWLKR  697
            GDGEPTDNAARFYKWF+EGK ERG WL++
Sbjct  147  GDGEPTDNAARFYKWFTEGKEERGTWLQQ  175



>ref|XP_007141274.1| hypothetical protein PHAVU_008G182200g [Phaseolus vulgaris]
 gb|ESW13268.1| hypothetical protein PHAVU_008G182200g [Phaseolus vulgaris]
Length=685

 Score =   135 bits (339),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 97/150 (65%), Positives = 117/150 (78%), Gaps = 5/150 (3%)
 Frame = +2

Query  260  LMAMLTTSVAVLIGCVFVLVWRRASSSAKKAVEPPNPEVPKAAEEETGED---GRKKITI  430
            ++ ++TTS AVLIG + V V +++S  +K+      P++    EEE   D   G+ ++ +
Sbjct  20   VLLIVTTSAAVLIG-LLVFVLKKSSDRSKEQKSLAVPKLALRQEEEDEADVGLGKTRVVV  78

Query  431  FFGTQTGTAEGFAKALAEEAKARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFLAT  610
            FFGTQTGTAEGFAKALAEE KARYEKA VKVVDLDDYA+DDD+YEEKLKKESL FF LAT
Sbjct  79   FFGTQTGTAEGFAKALAEEIKARYEKAAVKVVDLDDYAMDDDQYEEKLKKESLAFFMLAT  138

Query  611  YGDGEPTDNAARFYKWFSEGK-ERGVWLKR  697
            YGDGEPTDNAARF KWFSEGK ERG WL++
Sbjct  139  YGDGEPTDNAARFCKWFSEGKDERGTWLQQ  168



>ref|XP_007136327.1| hypothetical protein PHAVU_009G036200g [Phaseolus vulgaris]
 gb|ESW08321.1| hypothetical protein PHAVU_009G036200g [Phaseolus vulgaris]
Length=692

 Score =   135 bits (339),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 100/153 (65%), Positives = 120/153 (78%), Gaps = 11/153 (7%)
 Frame = +2

Query  260  LMAMLTTSVAVLIGCVFVLVWRRASSSAKKAVEPPNPEVPK--AAEEETGE----DGRKK  421
            L+ + TTS AV+IG + V +W+++S  +K+ V+P    VPK    EEE  E     G+ K
Sbjct  27   LLLIATTSAAVVIGLI-VFLWKKSSDRSKE-VKPVI--VPKDLLMEEEDDEVDVGAGKTK  82

Query  422  ITIFFGTQTGTAEGFAKALAEEAKARYEKANvkvvdlddyavdddeyeeklkkeSLVFFF  601
            +T+FFGTQTGTAEGFAKALAEE KARYEKA VKV+DLDDYA DDD+YEEKLKKE+L FF 
Sbjct  83   VTVFFGTQTGTAEGFAKALAEEIKARYEKAAVKVIDLDDYAPDDDQYEEKLKKETLAFFM  142

Query  602  LATYGDGEPTDNAARFYKWFSEG-KERGVWLKR  697
            LATYGDGEPTDNAARFYKWF+EG  ERG WL++
Sbjct  143  LATYGDGEPTDNAARFYKWFTEGIDERGTWLQK  175



>ref|XP_004973052.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Setaria italica]
Length=702

 Score =   135 bits (339),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 91/136 (67%), Positives = 106/136 (78%), Gaps = 9/136 (7%)
 Frame = +2

Query  308  FVLVWRRASSSAKKAVEPPNPEVPK--------AAEEETGEDGRKKITIFFGTQTGTAEG  463
            FVL WRRA++  K+  E    E  +        AA+E   +DGRKK+T+FFGTQTGTAEG
Sbjct  49   FVL-WRRAAAGKKRKREVAVAEAAQVKARGAKGAADEAFADDGRKKVTVFFGTQTGTAEG  107

Query  464  FAKALAEEAKARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFLATYGDGEPTDNAA  643
            FAK+LAEEAKARY+KA  KV DL+DYA +D+EYEEKLKKE L  FF+ATYGDGEPTDNAA
Sbjct  108  FAKSLAEEAKARYDKAIFKVADLEDYAAEDEEYEEKLKKEKLALFFVATYGDGEPTDNAA  167

Query  644  RFYKWFSEGKERGVWL  691
            RFYKWF+EG ERGVWL
Sbjct  168  RFYKWFTEGNERGVWL  183



>ref|XP_003522768.1| PREDICTED: NADPH--cytochrome P450 reductase [Glycine max]
 gb|KHN08276.1| NADPH--cytochrome P450 reductase [Glycine soja]
Length=691

 Score =   134 bits (338),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 96/149 (64%), Positives = 119/149 (80%), Gaps = 4/149 (3%)
 Frame = +2

Query  260  LMAMLTTSVAVLIGCVFVLVWRRASSSAKKAVEPPNPE-VPKAAEEETG-EDGRKKITIF  433
            L+ + TTS AV+IG + V +W+++S  +K+      P+ +PK  ++E    DG+ K+TIF
Sbjct  27   LLLIATTSAAVIIG-LLVFLWKKSSDRSKEVKPVIVPKGLPKDEDDEIDVADGKTKVTIF  85

Query  434  FGTQTGTAEGFAKALAEEAKARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFLATY  613
            FGTQTGTAEGFAKALAEE KARY+KA VKVVDLDDYA DDD+YEEKLKKE++ FF LATY
Sbjct  86   FGTQTGTAEGFAKALAEEIKARYDKAAVKVVDLDDYAADDDQYEEKLKKETVAFFMLATY  145

Query  614  GDGEPTDNAARFYKWFSEGK-ERGVWLKR  697
            GDGEPTDNAARFYKWF+EGK ERG  L++
Sbjct  146  GDGEPTDNAARFYKWFTEGKDERGTSLQQ  174



>ref|XP_010086660.1| NADPH--cytochrome P450 reductase [Morus notabilis]
 gb|EXB22547.1| NADPH--cytochrome P450 reductase [Morus notabilis]
Length=687

 Score =   134 bits (337),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 92/149 (62%), Positives = 118/149 (79%), Gaps = 4/149 (3%)
 Frame = +2

Query  260  LMAMLTTSVAVLIGCVFVLVWRRASSSAK--KAVEPPNPEVPKAAEEETG-EDGRKKITI  430
            ++ + TT+VA+++G + VLVWRR+S  ++  K V  P P + K  + E     G+ K+T+
Sbjct  23   VIVIATTAVALILG-LLVLVWRRSSDRSREVKPVVVPKPLLVKDEDNEVELASGKTKVTV  81

Query  431  FFGTQTGTAEGFAKALAEEAKARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFLAT  610
            F+GTQTGTAEGFAKALAEE +ARYEKA VKVVD+DDYAVDDD+YEEKLKKE+L FF +AT
Sbjct  82   FYGTQTGTAEGFAKALAEEIRARYEKAVVKVVDMDDYAVDDDQYEEKLKKETLAFFMVAT  141

Query  611  YGDGEPTDNAARFYKWFSEGKERGVWLKR  697
            YGDGEPTDNAARFYKWF+EG  +  WL++
Sbjct  142  YGDGEPTDNAARFYKWFTEGDNKASWLQQ  170



>gb|ACF17649.1| putative cytochrome reductase [Capsicum annuum]
 gb|AFV95075.1| cytochrome P450 reductase [Capsicum annuum]
Length=686

 Score =   134 bits (337),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 96/160 (60%), Positives = 119/160 (74%), Gaps = 5/160 (3%)
 Frame = +2

Query  227  SPVAMLMDNKELMAMLTTSVAVLIGCVFVLVWRRASSSAKKAVEP---PNPEVPKAAEEE  397
            S + + + +  ++ +LTTS AV++G V   + R  SS   K V+P   P     +  EE 
Sbjct  13   SAIGVSLGSDAVLMLLTTSFAVIVGLVVFFLKR--SSDRSKEVKPVVFPKSLNVEPEEEI  70

Query  398  TGEDGRKKITIFFGTQTGTAEGFAKALAEEAKARYEKANvkvvdlddyavdddeyeeklk  577
              E G+ K+T+FFGTQTGTAEGFAKAL+EE KARYEKA VKVVD+DDYA DDD YEEKLK
Sbjct  71   EVEPGKVKVTVFFGTQTGTAEGFAKALSEEIKARYEKAVVKVVDMDDYAADDDLYEEKLK  130

Query  578  keSLVFFFLATYGDGEPTDNAARFYKWFSEGKERGVWLKR  697
            KE++ FF +ATYGDGEPTDNAARFYKWF+EG+ERGVWL+ 
Sbjct  131  KETIAFFMVATYGDGEPTDNAARFYKWFTEGQERGVWLQH  170



>ref|XP_004238001.1| PREDICTED: NADPH--cytochrome P450 reductase [Solanum lycopersicum]
Length=686

 Score =   134 bits (336),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 102/167 (61%), Positives = 122/167 (73%), Gaps = 7/167 (4%)
 Frame = +2

Query  212  SSESASPVAMLMDNKELMAMLTTSVAVLIGCVFVLVWRRASSSAKKAVEP---PNPEVPK  382
            S ESA  V++  D   ++ +LTTS AV++G V   + R  SS   K V+P   P     +
Sbjct  10   SIESALGVSLGSDT--VLVLLTTSFAVIVGLVVFFLKR--SSDRSKEVKPVVFPKSLHVE  65

Query  383  AAEEETGEDGRKKITIFFGTQTGTAEGFAKALAEEAKARYEKANvkvvdlddyavdddey  562
              EE   E G+ K+T+FFGTQTGTAEGFAKAL+EE KARYEKA VKVVD+DDYA DDD Y
Sbjct  66   PEEETELEPGKVKVTVFFGTQTGTAEGFAKALSEEIKARYEKAVVKVVDMDDYAADDDIY  125

Query  563  eeklkkeSLVFFFLATYGDGEPTDNAARFYKWFSEGKERGVWLKRSS  703
            EEKLKKE+L FF +ATYGDGEPTDNAARFYKWF+EG+ERG WL+  S
Sbjct  126  EEKLKKETLAFFMVATYGDGEPTDNAARFYKWFTEGQERGAWLQNLS  172



>ref|XP_009786522.1| PREDICTED: NADPH--cytochrome P450 reductase [Nicotiana sylvestris]
Length=686

 Score =   134 bits (336),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 100/165 (61%), Positives = 122/165 (74%), Gaps = 7/165 (4%)
 Frame = +2

Query  212  SSESASPVAMLMDNKELMAMLTTSVAVLIGCVFVLVWRRASSSAKKAVEP---PNPEVPK  382
            S ESA  V++  D   ++ +LTTS AV++G V + + R  SS   K V+P   P     +
Sbjct  10   SIESALGVSLGSDT--VLVLLTTSFAVIVGLVVLFLKR--SSDRSKEVKPIVFPKSLHVE  65

Query  383  AAEEETGEDGRKKITIFFGTQTGTAEGFAKALAEEAKARYEKANvkvvdlddyavdddey  562
              EE   E G+ K+T+FFGTQTGTAEGFAKAL+EE KARYEKA VKVVD+DDYA DDD Y
Sbjct  66   PEEEIELEPGKVKVTVFFGTQTGTAEGFAKALSEEIKARYEKAVVKVVDMDDYAADDDLY  125

Query  563  eeklkkeSLVFFFLATYGDGEPTDNAARFYKWFSEGKERGVWLKR  697
            EEKLKKE++ FF +ATYGDGEPTDNAARFYKWF+EG+ERG WL+ 
Sbjct  126  EEKLKKETVAFFMVATYGDGEPTDNAARFYKWFTEGQERGTWLQH  170



>gb|AAZ39648.1| cytochrome P450 NADPH-reductase [Petunia x hybrida]
Length=687

 Score =   133 bits (334),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 100/165 (61%), Positives = 122/165 (74%), Gaps = 7/165 (4%)
 Frame = +2

Query  212  SSESASPVAMLMDNKELMAMLTTSVAVLIGCVFVLVWRRASSSAKKAVEP---PNPEVPK  382
            S ESA  V++  D   L+ +LTTS A+++G +  L+ R  SS   K V+P         +
Sbjct  11   SIESAFGVSLSTDT--LIVLLTTSFALIVGLIVFLLKR--SSDRSKEVKPVVFTKSLNTE  66

Query  383  AAEEETGEDGRKKITIFFGTQTGTAEGFAKALAEEAKARYEKANvkvvdlddyavdddey  562
              EE   E G+ K+T+FFGTQTGTAEGFAK++AEE KARYEKA VKVVD+DDYA DDD Y
Sbjct  67   PEEETELEPGKVKVTVFFGTQTGTAEGFAKSIAEEIKARYEKAVVKVVDMDDYAADDDLY  126

Query  563  eeklkkeSLVFFFLATYGDGEPTDNAARFYKWFSEGKERGVWLKR  697
            EEKLKKE+L FF +ATYGDGEPTDNAARFYKWF+EG+ERGVWL+ 
Sbjct  127  EEKLKKETLAFFMVATYGDGEPTDNAARFYKWFTEGQERGVWLQH  171



>ref|XP_006338052.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Solanum tuberosum]
Length=686

 Score =   132 bits (333),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 101/167 (60%), Positives = 122/167 (73%), Gaps = 7/167 (4%)
 Frame = +2

Query  212  SSESASPVAMLMDNKELMAMLTTSVAVLIGCVFVLVWRRASSSAKKAVEP---PNPEVPK  382
            S ESA  V++  D   ++ +LTTS AV++G V   + R  SS   K V+P   P     +
Sbjct  10   SIESALGVSLGSDT--VLVLLTTSFAVIVGLVVFFLKR--SSDRSKEVKPVVFPKSLHVE  65

Query  383  AAEEETGEDGRKKITIFFGTQTGTAEGFAKALAEEAKARYEKANvkvvdlddyavdddey  562
              EE   E G+ K+T+FFGTQTGTAEGFAKAL+EE KARYEKA VKVVD+DDYA DDD Y
Sbjct  66   PEEETELEPGKVKVTVFFGTQTGTAEGFAKALSEEIKARYEKAVVKVVDMDDYAADDDIY  125

Query  563  eeklkkeSLVFFFLATYGDGEPTDNAARFYKWFSEGKERGVWLKRSS  703
            EEKLKKE++ FF +ATYGDGEPTDNAARFYKWF+EG+ERG WL+  S
Sbjct  126  EEKLKKETVAFFMVATYGDGEPTDNAARFYKWFTEGQERGAWLQNLS  172



>gb|AIG15451.1| NADPH-cytochrome P450 reductase 1 [Azadirachta indica]
Length=695

 Score =   132 bits (333),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 92/150 (61%), Positives = 115/150 (77%), Gaps = 5/150 (3%)
 Frame = +2

Query  260  LMAMLTTSVAVLIGCVFVLVWRRASSSAK--KAVEPPNPEVPKAAEEETGED--GRKKIT  427
            ++ + TT  AV+IG + VL W+++S  +K  K V P    V K  + +  +   G+ K+T
Sbjct  30   VIVIATTLFAVVIG-LLVLAWKKSSDRSKEVKPVVPLKSPVLKKEDHDEADIVWGKTKVT  88

Query  428  IFFGTQTGTAEGFAKALAEEAKARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFLA  607
            IF+GTQTGTAEGFAKALAEE KARYEKA VKVVDLDDYA DD++Y EKLKKE+L FF +A
Sbjct  89   IFYGTQTGTAEGFAKALAEEIKARYEKAAVKVVDLDDYAADDEQYGEKLKKETLTFFMVA  148

Query  608  TYGDGEPTDNAARFYKWFSEGKERGVWLKR  697
            TYGDGEPTDNAARFYKWF+E  +RGVWL++
Sbjct  149  TYGDGEPTDNAARFYKWFTEENDRGVWLQQ  178



>gb|AHB33949.1| cytochrome P450 reductase [Santalum album]
Length=692

 Score =   132 bits (333),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 94/150 (63%), Positives = 114/150 (76%), Gaps = 12/150 (8%)
 Frame = +2

Query  269  MLTTSVAVLIGCVFVLVWRRASSSAKKAVEPPNPEV-----PKAAEEETGE--DGRKKIT  427
            ++TTS A+++G V + +WRR+   +K+      P V     P  AEE+ GE   G+ K+T
Sbjct  31   IVTTSAALIVGFV-MFMWRRSGEKSKEL----RPVVALKAAPIEAEEDDGEVDSGKTKVT  85

Query  428  IFFGTQTGTAEGFAKALAEEAKARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFLA  607
            +FFGTQTGTAEGFAKALAEE KARYEKA VKVVDLDDYA DDD+Y EKLK E+L FF +A
Sbjct  86   VFFGTQTGTAEGFAKALAEEIKARYEKAVVKVVDLDDYAADDDQYGEKLKNETLTFFMVA  145

Query  608  TYGDGEPTDNAARFYKWFSEGKERGVWLKR  697
            TYGDGEPTDNAARFYKWF+E KER  WL++
Sbjct  146  TYGDGEPTDNAARFYKWFTEEKEREAWLQQ  175



>ref|XP_003526551.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Glycine max]
 gb|KHN08988.1| NADPH--cytochrome P450 reductase [Glycine soja]
Length=691

 Score =   132 bits (332),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 97/149 (65%), Positives = 115/149 (77%), Gaps = 4/149 (3%)
 Frame = +2

Query  260  LMAMLTTSVAVLIGCVFVLVWRRASSSAK--KAVEPPNPEVPKAAEEETGEDGRKKITIF  433
            L+ + TTS A++IG + V +W+++S  +K  K V  P        +E    DG+ K+TIF
Sbjct  27   LLLIATTSAALIIG-LLVFLWKKSSDRSKELKPVIVPKGLPKDDDDEVDVADGKTKVTIF  85

Query  434  FGTQTGTAEGFAKALAEEAKARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFLATY  613
            FGTQTGTAEGFAKALAEE KARY+KA VKVVDLDDYA DDD+YEEKLKKE+L FF LATY
Sbjct  86   FGTQTGTAEGFAKALAEEIKARYDKAAVKVVDLDDYAADDDQYEEKLKKETLAFFMLATY  145

Query  614  GDGEPTDNAARFYKWFSEGK-ERGVWLKR  697
            GDGEPTDNAARFYKWF+EGK ERG WL+ 
Sbjct  146  GDGEPTDNAARFYKWFTEGKDERGTWLQH  174



>gb|KDP41487.1| hypothetical protein JCGZ_15894 [Jatropha curcas]
Length=689

 Score =   131 bits (330),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 90/149 (60%), Positives = 117/149 (79%), Gaps = 4/149 (3%)
 Frame = +2

Query  260  LMAMLTTSVAVLIGCVFVLVWRRASSSAKKA---VEPPNPEVPKAAEEETGEDGRKKITI  430
            L+ ++TTSVAV++G +FV + +++S  +K+    V P +  V K  ++     G+ ++ I
Sbjct  25   LLLIVTTSVAVIVG-LFVFLLKKSSDRSKEVKPVVVPKSLTVKKEEDDAEALAGKTRVII  83

Query  431  FFGTQTGTAEGFAKALAEEAKARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFLAT  610
            F+GTQTGTAEGFAK+L+EE KARYEKA VKVVDLDDYA DD+EYEEKLKKE+L FF +AT
Sbjct  84   FYGTQTGTAEGFAKSLSEEIKARYEKAAVKVVDLDDYAADDEEYEEKLKKETLSFFMVAT  143

Query  611  YGDGEPTDNAARFYKWFSEGKERGVWLKR  697
            YGDGEPTDNAARFYKW +E  ERGVWL++
Sbjct  144  YGDGEPTDNAARFYKWLTEENERGVWLQQ  172



>ref|XP_009630023.1| PREDICTED: NADPH--cytochrome P450 reductase [Nicotiana tomentosiformis]
Length=686

 Score =   130 bits (328),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 99/165 (60%), Positives = 122/165 (74%), Gaps = 7/165 (4%)
 Frame = +2

Query  212  SSESASPVAMLMDNKELMAMLTTSVAVLIGCVFVLVWRRASSSAKKAVEP---PNPEVPK  382
            S ESA  V++  D   ++ +LTTS AV++G V + + R  SS   K V+P   P     +
Sbjct  10   SIESALGVSLGSDT--VLVLLTTSFAVIVGLVVLFLKR--SSDRSKEVKPIVFPKSLHVE  65

Query  383  AAEEETGEDGRKKITIFFGTQTGTAEGFAKALAEEAKARYEKANvkvvdlddyavdddey  562
            + EE   E G+ K+T+FFGTQTGTAEGFAKAL+EE KA YEKA VKVVD+DDYA DDD Y
Sbjct  66   SEEEIELEPGKVKVTVFFGTQTGTAEGFAKALSEEIKASYEKAVVKVVDMDDYAADDDLY  125

Query  563  eeklkkeSLVFFFLATYGDGEPTDNAARFYKWFSEGKERGVWLKR  697
            EEKLKKE++ FF +ATYGDGEPTDNAARFYKWF+EG+ERG WL+ 
Sbjct  126  EEKLKKETVAFFMVATYGDGEPTDNAARFYKWFTEGQERGTWLQH  170



>gb|ACG27711.1| NADPH--cytochrome P450 reductase [Zea mays]
Length=703

 Score =   131 bits (329),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 94/139 (68%), Positives = 108/139 (78%), Gaps = 11/139 (8%)
 Frame = +2

Query  308  FVLVWRRASSSAKKAVEPPNPEVP---------KAAEEE-TGEDGRKKITIFFGTQTGTA  457
            FVL WRRA++  K+  E                KAAEEE   +DGRKK+T+FFGTQTGTA
Sbjct  48   FVL-WRRAAAGKKRKREAAVAAAEATQAKARGGKAAEEEKPADDGRKKVTVFFGTQTGTA  106

Query  458  EGFAKALAEEAKARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFLATYGDGEPTDN  637
            EGFAKALAEEAK+RY+KA+ KVVDLDDYA +D+EYEEKLK+E L  FF+ATYGDGEPTDN
Sbjct  107  EGFAKALAEEAKSRYDKASFKVVDLDDYAAEDEEYEEKLKEEKLALFFVATYGDGEPTDN  166

Query  638  AARFYKWFSEGKERGVWLK  694
            AARFYKWF+EG ERGVWL 
Sbjct  167  AARFYKWFTEGNERGVWLN  185



>gb|ACF35281.1| cytochrome P450 reductase-like protein [Nothapodytes nimmoniana]
Length=692

 Score =   130 bits (328),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 92/152 (61%), Positives = 118/152 (78%), Gaps = 9/152 (6%)
 Frame = +2

Query  260  LMAMLTTSVAVLIGCVFVLVWRRASSSAKKAVEPPNPEVPKAAEEETGED------GRKK  421
            ++ + TTSVAV+ G + V +W+R+S+ + +  +P    VPKA + +  E+      G+KK
Sbjct  27   VVLIATTSVAVITG-LLVFLWKRSSNQSTEVKKPV--VVPKALQLDAEEEEVEVGPGKKK  83

Query  422  ITIFFGTQTGTAEGFAKALAEEAKARYEKANvkvvdlddyavdddeyeeklkkeSLVFFF  601
            +T+FFGTQTGTAEGFAK+LAEE  ARYEKA VKVVDLDDYA  D++YEEKLKKE+L FF 
Sbjct  84   VTVFFGTQTGTAEGFAKSLAEEINARYEKAVVKVVDLDDYASLDNQYEEKLKKETLAFFM  143

Query  602  LATYGDGEPTDNAARFYKWFSEGKERGVWLKR  697
            +ATYGDGEPTDNAARFYKWF+E KER  WL++
Sbjct  144  VATYGDGEPTDNAARFYKWFTEEKERKPWLQQ  175



>ref|NP_001146345.1| uncharacterized protein LOC100279923 [Zea mays]
 gb|ACL53735.1| unknown [Zea mays]
Length=294

 Score =   126 bits (317),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 87/131 (66%), Positives = 104/131 (79%), Gaps = 2/131 (2%)
 Frame = +2

Query  308  FVLVWRRAS--SSAKKAVEPPNPEVPKAAEEETGEDGRKKITIFFGTQTGTAEGFAKALA  481
             + VW R+   + +K    P  P   K   +   +DGRK++TIFFGTQTGTAEGFAK++A
Sbjct  44   IIAVWFRSGGGTPSKPVATPVRPPPVKVDADADVDDGRKRVTIFFGTQTGTAEGFAKSMA  103

Query  482  EEAKARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFLATYGDGEPTDNAARFYKWF  661
            EEA+ARYEKA  KVVDLDDYA +D+EYEEKLKKE++V FFLATYGDGEPTDNAARFYKWF
Sbjct  104  EEARARYEKAVFKVVDLDDYAQEDEEYEEKLKKETVVLFFLATYGDGEPTDNAARFYKWF  163

Query  662  SEGKERGVWLK  694
            +EGKE+ VWLK
Sbjct  164  TEGKEKEVWLK  174



>ref|XP_009138145.1| PREDICTED: NADPH--cytochrome P450 reductase 1-like [Brassica 
rapa]
Length=695

 Score =   130 bits (327),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 92/150 (61%), Positives = 119/150 (79%), Gaps = 5/150 (3%)
 Frame = +2

Query  260  LMAMLTTSVAVLIGCVFVLVWRRASSSAKKAVEP-PNPEVPKAAEEETGED---GRKKIT  427
            ++ + TTS+A+++G V VLVWR+ +S   K ++P   P+   A +E+   D   G+++++
Sbjct  31   VLVIATTSLALVVGFV-VLVWRKTTSDQSKELKPLVIPKSLMAKDEDEDVDLGSGKERVS  89

Query  428  IFFGTQTGTAEGFAKALAEEAKARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFLA  607
            IFFGTQTGTAEGFAKALAEE KARYEKA VKV+DLDDYA DDD+YEEKLKKE+L FF +A
Sbjct  90   IFFGTQTGTAEGFAKALAEEIKARYEKAAVKVIDLDDYAADDDQYEEKLKKETLSFFCVA  149

Query  608  TYGDGEPTDNAARFYKWFSEGKERGVWLKR  697
            TYGDGEPTDNAARFYKWF+EG E  + L++
Sbjct  150  TYGDGEPTDNAARFYKWFTEGTEGDIRLQK  179



>dbj|BAC41516.1| NADPH-cytochrome P-450 reductase [Ophiorrhiza pumila]
Length=690

 Score =   130 bits (327),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 96/166 (58%), Positives = 124/166 (75%), Gaps = 6/166 (4%)
 Frame = +2

Query  212  SSESASPVAMLMDNKELMAMLTTSVAVLIGCVFVLVWRRASSSAKKAVEPPNPEVPKA--  385
            S ESA  V++  D  +++ +LTTS+AV++G + + +W+R+    K+ ++P       A  
Sbjct  10   SIESALGVSLGDDVNQILLVLTTSLAVIVG-LLMFLWKRSGDRGKE-IKPVGCSQGCALL  67

Query  386  --AEEETGEDGRKKITIFFGTQTGTAEGFAKALAEEAKARYEKANvkvvdlddyavddde  559
               E+E  +  + K+T+FFGTQTGTAEGFAKAL+EE KARYEKA  KV DLDDYA DDD+
Sbjct  68   VEEEKEEVDPTKVKVTVFFGTQTGTAEGFAKALSEEIKARYEKAVFKVFDLDDYAADDDQ  127

Query  560  yeeklkkeSLVFFFLATYGDGEPTDNAARFYKWFSEGKERGVWLKR  697
            YEEKLKKE+L FF LATYGDGEPTDNAARFYKWF+EGKER  WL++
Sbjct  128  YEEKLKKETLAFFMLATYGDGEPTDNAARFYKWFTEGKEREPWLQQ  173



>emb|CDY34288.1| BnaA01g13910D [Brassica napus]
Length=695

 Score =   130 bits (327),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 92/150 (61%), Positives = 119/150 (79%), Gaps = 5/150 (3%)
 Frame = +2

Query  260  LMAMLTTSVAVLIGCVFVLVWRRASSSAKKAVEP-PNPEVPKAAEEETGED---GRKKIT  427
            ++ + TTS+A+++G V VLVWR+ +S   K ++P   P+   A +E+   D   G+++++
Sbjct  31   VLVIATTSLALVVGFV-VLVWRKTTSDQSKELKPLVIPKSLMAKDEDEDVDLGSGKERVS  89

Query  428  IFFGTQTGTAEGFAKALAEEAKARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFLA  607
            IFFGTQTGTAEGFAKALAEE KARYEKA VKV+DLDDYA DDD+YEEKLKKE+L FF +A
Sbjct  90   IFFGTQTGTAEGFAKALAEEIKARYEKAAVKVIDLDDYAADDDQYEEKLKKETLSFFCVA  149

Query  608  TYGDGEPTDNAARFYKWFSEGKERGVWLKR  697
            TYGDGEPTDNAARFYKWF+EG E  + L++
Sbjct  150  TYGDGEPTDNAARFYKWFTEGTEGDIRLQK  179



>emb|CDY03447.1| BnaC01g16350D [Brassica napus]
Length=695

 Score =   129 bits (325),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 92/153 (60%), Positives = 122/153 (80%), Gaps = 10/153 (7%)
 Frame = +2

Query  260  LMAMLTTSVAVLIGCVFVLVWRRASSSAKKAVEPPNPEVPKA--AEEETGED-----GRK  418
            ++ + TTS+A+++G V VLVW++ +S   + ++P    +PK+  A++E  ED     G++
Sbjct  31   VLVIATTSLALVVGFV-VLVWKKTTSDQSQELKPLV--IPKSLMAKDEDEEDVDLGSGKE  87

Query  419  KITIFFGTQTGTAEGFAKALAEEAKARYEKANvkvvdlddyavdddeyeeklkkeSLVFF  598
            +++IFFGTQTGTAEGFAKALAEE KARYEKA VKV+DLDDYA DDD+YEEKLKKE+L FF
Sbjct  88   RVSIFFGTQTGTAEGFAKALAEEIKARYEKAAVKVIDLDDYAADDDQYEEKLKKETLSFF  147

Query  599  FLATYGDGEPTDNAARFYKWFSEGKERGVWLKR  697
             +ATYGDGEPTDNAARFYKWF+EG E  + L++
Sbjct  148  CVATYGDGEPTDNAARFYKWFTEGTEGDIRLQQ  180



>gb|EYU36460.1| hypothetical protein MIMGU_mgv1a002296mg [Erythranthe guttata]
Length=690

 Score =   129 bits (324),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 94/149 (63%), Positives = 115/149 (77%), Gaps = 9/149 (6%)
 Frame = +2

Query  269  MLTTSVAVLIGCVFVLVWRRASSSAKKAVEPPNPEVPK------AAEEETGEDGRKKITI  430
            +LTTS A+++G + + +W+R+S    KA +P    VPK        EEE  +  + K+ +
Sbjct  28   VLTTSAALILG-LLIFIWKRSSGDLSKAAKPVV--VPKLVTLKDDEEEEDLDPDKVKVAV  84

Query  431  FFGTQTGTAEGFAKALAEEAKARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFLAT  610
            FFGTQTGTAEGFAKALAEE KARYEKA VKV+DLDDYA DDD+YEEKLKKE+L FF +AT
Sbjct  85   FFGTQTGTAEGFAKALAEEIKARYEKAVVKVIDLDDYAADDDQYEEKLKKETLAFFMVAT  144

Query  611  YGDGEPTDNAARFYKWFSEGKERGVWLKR  697
            YGDGEPTDNAARFYKWF+EGKER  WL++
Sbjct  145  YGDGEPTDNAARFYKWFTEGKEREPWLQQ  173



>ref|XP_008667834.1| PREDICTED: uncharacterized protein LOC100279923 isoform X2 [Zea 
mays]
 tpg|DAA35632.1| TPA: hypothetical protein ZEAMMB73_666259 [Zea mays]
Length=694

 Score =   128 bits (322),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 87/131 (66%), Positives = 104/131 (79%), Gaps = 2/131 (2%)
 Frame = +2

Query  308  FVLVWRRAS--SSAKKAVEPPNPEVPKAAEEETGEDGRKKITIFFGTQTGTAEGFAKALA  481
             + VW R+   + +K    P  P   K   +   +DGRK++TIFFGTQTGTAEGFAK++A
Sbjct  44   IIAVWFRSGGGTPSKPVATPVRPPPVKVDADADVDDGRKRVTIFFGTQTGTAEGFAKSMA  103

Query  482  EEAKARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFLATYGDGEPTDNAARFYKWF  661
            EEA+ARYEKA  KVVDLDDYA +D+EYEEKLKKE++V FFLATYGDGEPTDNAARFYKWF
Sbjct  104  EEARARYEKAVFKVVDLDDYAQEDEEYEEKLKKETVVLFFLATYGDGEPTDNAARFYKWF  163

Query  662  SEGKERGVWLK  694
            +EGKE+ VWLK
Sbjct  164  TEGKEKEVWLK  174



>ref|XP_008667833.1| PREDICTED: uncharacterized protein LOC100279923 isoform X1 [Zea 
mays]
 tpg|DAA35631.1| TPA: hypothetical protein ZEAMMB73_666259 [Zea mays]
Length=695

 Score =   128 bits (322),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 87/131 (66%), Positives = 104/131 (79%), Gaps = 2/131 (2%)
 Frame = +2

Query  308  FVLVWRRAS--SSAKKAVEPPNPEVPKAAEEETGEDGRKKITIFFGTQTGTAEGFAKALA  481
             + VW R+   + +K    P  P   K   +   +DGRK++TIFFGTQTGTAEGFAK++A
Sbjct  44   IIAVWFRSGGGTPSKPVATPVRPPPVKVDADADVDDGRKRVTIFFGTQTGTAEGFAKSMA  103

Query  482  EEAKARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFLATYGDGEPTDNAARFYKWF  661
            EEA+ARYEKA  KVVDLDDYA +D+EYEEKLKKE++V FFLATYGDGEPTDNAARFYKWF
Sbjct  104  EEARARYEKAVFKVVDLDDYAQEDEEYEEKLKKETVVLFFLATYGDGEPTDNAARFYKWF  163

Query  662  SEGKERGVWLK  694
            +EGKE+ VWLK
Sbjct  164  TEGKEKEVWLK  174



>gb|KJB14708.1| hypothetical protein B456_002G138900 [Gossypium raimondii]
Length=672

 Score =   128 bits (321),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 89/151 (59%), Positives = 112/151 (74%), Gaps = 6/151 (4%)
 Frame = +2

Query  260  LMAMLTTSVAVLIGCVFVLVWRRASSSAKKAVEPPNPEVPKAAEEETGED-----GRKKI  424
            ++ + TTS+AV++    + +W+   S     V+      P + + +  +D     G+KK+
Sbjct  27   MLMIATTSLAVIL-VFLIFLWKNLVSQRSPDVKLLVASKPVSLKVDEDDDALVASGKKKV  85

Query  425  TIFFGTQTGTAEGFAKALAEEAKARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFL  604
            TIF+GTQTGTAEGFAKALAEE KARYEKA VK VDLDDYAVDD+EYEEKLKKE+L FF +
Sbjct  86   TIFYGTQTGTAEGFAKALAEEIKARYEKAAVKAVDLDDYAVDDEEYEEKLKKETLAFFMV  145

Query  605  ATYGDGEPTDNAARFYKWFSEGKERGVWLKR  697
            ATYGDGEPTDN+ARFYKWF+EG ER  WL+R
Sbjct  146  ATYGDGEPTDNSARFYKWFTEGNERQSWLQR  176



>ref|XP_003579401.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Brachypodium 
distachyon]
Length=692

 Score =   128 bits (321),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 90/127 (71%), Positives = 100/127 (79%), Gaps = 2/127 (2%)
 Frame = +2

Query  320  WRRASSSA--KKAVEPPNPEVPKAAEEETGEDGRKKITIFFGTQTGTAEGFAKALAEEAK  493
            W R+   A  K A  P  P   K   +   +DGRK++TIFFGTQTGTAEGFAKA+AEEAK
Sbjct  47   WFRSGGGAPSKPAATPLRPPPVKVDADADADDGRKRVTIFFGTQTGTAEGFAKAMAEEAK  106

Query  494  ARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFLATYGDGEPTDNAARFYKWFSEGK  673
             RYEK   KVVDLDDYA +DDEYEEKLKKE+LV FFLATYGDGEPTDNAARFYKWF+EGK
Sbjct  107  VRYEKTVFKVVDLDDYAAEDDEYEEKLKKETLVLFFLATYGDGEPTDNAARFYKWFTEGK  166

Query  674  ERGVWLK  694
            E+ VWLK
Sbjct  167  EKEVWLK  173



>gb|KJB14707.1| hypothetical protein B456_002G138900 [Gossypium raimondii]
Length=693

 Score =   128 bits (321),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 89/151 (59%), Positives = 112/151 (74%), Gaps = 6/151 (4%)
 Frame = +2

Query  260  LMAMLTTSVAVLIGCVFVLVWRRASSSAKKAVEPPNPEVPKAAEEETGED-----GRKKI  424
            ++ + TTS+AV++    + +W+   S     V+      P + + +  +D     G+KK+
Sbjct  27   MLMIATTSLAVIL-VFLIFLWKNLVSQRSPDVKLLVASKPVSLKVDEDDDALVASGKKKV  85

Query  425  TIFFGTQTGTAEGFAKALAEEAKARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFL  604
            TIF+GTQTGTAEGFAKALAEE KARYEKA VK VDLDDYAVDD+EYEEKLKKE+L FF +
Sbjct  86   TIFYGTQTGTAEGFAKALAEEIKARYEKAAVKAVDLDDYAVDDEEYEEKLKKETLAFFMV  145

Query  605  ATYGDGEPTDNAARFYKWFSEGKERGVWLKR  697
            ATYGDGEPTDN+ARFYKWF+EG ER  WL+R
Sbjct  146  ATYGDGEPTDNSARFYKWFTEGNERQSWLQR  176



>ref|XP_006653834.1| PREDICTED: NADPH--cytochrome P450 reductase-like, partial [Oryza 
brachyantha]
Length=628

 Score =   127 bits (319),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 80/105 (76%), Positives = 93/105 (89%), Gaps = 0/105 (0%)
 Frame = +2

Query  380  KAAEEETGEDGRKKITIFFGTQTGTAEGFAKALAEEAKARYEKANvkvvdlddyavddde  559
            K   +   +DGRK++TIFFGTQTGTAEGFAKA+AEEA+ARYEKA  KVVDLDDYA +D+E
Sbjct  4    KIVADADADDGRKRVTIFFGTQTGTAEGFAKAMAEEARARYEKAVFKVVDLDDYAAEDEE  63

Query  560  yeeklkkeSLVFFFLATYGDGEPTDNAARFYKWFSEGKERGVWLK  694
            YEEKL+KE++V  FLATYGDGEPTDNAARFYKWF+EGKE+ VWLK
Sbjct  64   YEEKLRKETVVLLFLATYGDGEPTDNAARFYKWFTEGKEKEVWLK  108



>ref|XP_004960247.1| PREDICTED: NADPH--cytochrome P450 reductase-like isoform X2 [Setaria 
italica]
Length=694

 Score =   127 bits (320),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 80/97 (82%), Positives = 92/97 (95%), Gaps = 0/97 (0%)
 Frame = +2

Query  404  EDGRKKITIFFGTQTGTAEGFAKALAEEAKARYEKANvkvvdlddyavdddeyeeklkke  583
            +DGRK++TIFFGTQTGTAEGFAK++AEEA+ARYEKA  KVVDLDDYA +D+EYEEKLKKE
Sbjct  78   DDGRKRVTIFFGTQTGTAEGFAKSMAEEARARYEKAVFKVVDLDDYAQEDEEYEEKLKKE  137

Query  584  SLVFFFLATYGDGEPTDNAARFYKWFSEGKERGVWLK  694
            ++V FFLATYGDGEPTDNAARFYKWF+EGKE+ VWLK
Sbjct  138  TVVLFFLATYGDGEPTDNAARFYKWFTEGKEKEVWLK  174



>ref|XP_009130253.1| PREDICTED: NADPH--cytochrome P450 reductase 2-like [Brassica 
rapa]
Length=681

 Score =   127 bits (320),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 99/195 (51%), Positives = 124/195 (64%), Gaps = 33/195 (17%)
 Frame = +2

Query  125  MEPTSEKLSPFDFMAAIFKGGRIF--DQSNAS---SESASPVAMLMDNKELMAMLTTSVA  289
            M  T  K+SPFD M+AI KG  +   D +NAS   S +A   ++L +N++L  ++TTS+A
Sbjct  1    MSSTPMKVSPFDLMSAIIKGEPVVVSDPANASAYESVAAELSSILTENRQLAMIVTTSIA  60

Query  290  VLIGCVFVLVWRRASSSAKKAVEPPNPEVPKAAEEETGEDGRKKITIFFGTQTGTAEGFA  469
            VLIGC+ +LVWRR+  S+  +         K  E    ++                    
Sbjct  61   VLIGCIVMLVWRRSGGSSGNSS--------KRVETTLKQN--------------------  92

Query  470  KALAEEAKARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFLATYGDGEPTDNAARF  649
            +AL EEAKARYEK   K+VDLDDYA DDDEYEEKLKKE + FFFLA YGDGEPTDNAARF
Sbjct  93   RALGEEAKARYEKIRFKIVDLDDYAADDDEYEEKLKKEDVAFFFLAPYGDGEPTDNAARF  152

Query  650  YKWFSEGKERGVWLK  694
            YKWF+EGK+RG WLK
Sbjct  153  YKWFTEGKDRGEWLK  167



>ref|XP_004960246.1| PREDICTED: NADPH--cytochrome P450 reductase-like isoform X1 [Setaria 
italica]
Length=707

 Score =   127 bits (319),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 80/97 (82%), Positives = 92/97 (95%), Gaps = 0/97 (0%)
 Frame = +2

Query  404  EDGRKKITIFFGTQTGTAEGFAKALAEEAKARYEKANvkvvdlddyavdddeyeeklkke  583
            +DGRK++TIFFGTQTGTAEGFAK++AEEA+ARYEKA  KVVDLDDYA +D+EYEEKLKKE
Sbjct  78   DDGRKRVTIFFGTQTGTAEGFAKSMAEEARARYEKAVFKVVDLDDYAQEDEEYEEKLKKE  137

Query  584  SLVFFFLATYGDGEPTDNAARFYKWFSEGKERGVWLK  694
            ++V FFLATYGDGEPTDNAARFYKWF+EGKE+ VWLK
Sbjct  138  TVVLFFLATYGDGEPTDNAARFYKWFTEGKEKEVWLK  174



>ref|XP_008676669.1| PREDICTED: uncharacterized protein LOC100216882 isoform X1 [Zea 
mays]
 gb|AFW62053.1| hypothetical protein ZEAMMB73_790468 [Zea mays]
Length=702

 Score =   127 bits (319),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 88/139 (63%), Positives = 105/139 (76%), Gaps = 12/139 (9%)
 Frame = +2

Query  308  FVLVWRRASSSAKKAVEPPNPEVP---------KAAEEE-TGEDGRKKITIFFGTQTGTA  457
            FVL WRRA++  K+  E                KAAEEE   +DGRKK+T+FFGTQTGT+
Sbjct  48   FVL-WRRAAAGKKRKREAAVAAAEATQAKARGGKAAEEEKPADDGRKKVTVFFGTQTGTS  106

Query  458  EGFAKALAEEAKARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFLATYGDGEPTDN  637
            EGFAKALAEEAK+RY+KA+ KVVDLDDYA +D+EYE+  K++    FF+ATYGDGEPTDN
Sbjct  107  EGFAKALAEEAKSRYDKASFKVVDLDDYAAEDEEYEKLKKEKL-ALFFVATYGDGEPTDN  165

Query  638  AARFYKWFSEGKERGVWLK  694
            AARFYKWF+EG ERGVWL 
Sbjct  166  AARFYKWFTEGNERGVWLN  184



>ref|XP_009138137.1| PREDICTED: NADPH--cytochrome P450 reductase 1-like [Brassica 
rapa]
Length=694

 Score =   127 bits (318),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 94/176 (53%), Positives = 126/176 (72%), Gaps = 10/176 (6%)
 Frame = +2

Query  194  FDQSNA-SSESASPVAMLMD----NKELMAMLTTSVAVLIGCVFVLVWRRASSSAKKAVE  358
            FD S+A + +  S + M +D    +  ++ + TTS+A+ +G   VL+W++ +S   + V+
Sbjct  5    FDASSALAKQLKSVLGMSLDTPVSDDAVLVIATTSLALAVGFA-VLLWKKTTSDQSREVK  63

Query  359  P---PNPEVPKAAEEETGEDGRKKITIFFGTQTGTAEGFAKALAEEAKARYEKANvkvvd  529
            P   P   + K  EE+ G  G+ +++IFFGTQTG AEGFAKALAEE K RYEKA VKV+D
Sbjct  64   PLMVPKSLMTKEEEEDLGS-GKSRVSIFFGTQTGNAEGFAKALAEEIKVRYEKAAVKVID  122

Query  530  lddyavdddeyeeklkkeSLVFFFLATYGDGEPTDNAARFYKWFSEGKERGVWLKR  697
            LDDYA DDD+YEEKLK E+L FF +ATYGDGEPTDNAARFYKWF+EG E  + L++
Sbjct  123  LDDYAADDDQYEEKLKTETLSFFCVATYGDGEPTDNAARFYKWFTEGNEGDMRLQQ  178



>ref|XP_009791726.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Nicotiana sylvestris]
Length=686

 Score =   126 bits (317),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 90/159 (57%), Positives = 117/159 (74%), Gaps = 3/159 (2%)
 Frame = +2

Query  227  SPVAMLMDNKELMAMLTTSVAVLIGCVFVLVWRRASSSAK--KAVEPPNPEVPKAAEEET  400
            S + + + +  ++ +LT S AV++G V VL  +R+S  +K  K +  P     +  EE  
Sbjct  13   SELGVSLGSDTVLVLLTMSFAVIVGLV-VLFLKRSSDRSKEVKPIMFPKSLHVEPEEEIE  71

Query  401  GEDGRKKITIFFGTQTGTAEGFAKALAEEAKARYEKANvkvvdlddyavdddeyeeklkk  580
             E G+ K+T+FFGTQTGTAEGF+KAL+EE K RYEKA VKV+D+DDYA DDD Y+EKLKK
Sbjct  72   LEPGKVKVTVFFGTQTGTAEGFSKALSEEIKTRYEKAVVKVMDMDDYAADDDLYKEKLKK  131

Query  581  eSLVFFFLATYGDGEPTDNAARFYKWFSEGKERGVWLKR  697
            E + FF +ATYGDGEPTDNAARFYKWF+EG+ERG WL+ 
Sbjct  132  EIVAFFMVATYGDGEPTDNAARFYKWFTEGQERGTWLQH  170



>emb|CAE01547.2| OSJNBb0022F16.2 [Oryza sativa Japonica Group]
 emb|CAE03554.2| OSJNBa0060D06.20 [Oryza sativa Japonica Group]
Length=695

 Score =   126 bits (316),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 78/97 (80%), Positives = 91/97 (94%), Gaps = 0/97 (0%)
 Frame = +2

Query  404  EDGRKKITIFFGTQTGTAEGFAKALAEEAKARYEKANvkvvdlddyavdddeyeeklkke  583
            +DGRK++T+FFGTQTGTAEGFAKA+AEEA+ARYEKA  KVVDLDDYA +D+EYEEKL+KE
Sbjct  79   DDGRKRVTVFFGTQTGTAEGFAKAMAEEARARYEKAVFKVVDLDDYAAEDEEYEEKLRKE  138

Query  584  SLVFFFLATYGDGEPTDNAARFYKWFSEGKERGVWLK  694
            ++V  FLATYGDGEPTDNAARFYKWF+EGKE+ VWLK
Sbjct  139  TIVLLFLATYGDGEPTDNAARFYKWFTEGKEKEVWLK  175



>ref|XP_006413419.1| hypothetical protein EUTSA_v10024568mg [Eutrema salsugineum]
 gb|ESQ54872.1| hypothetical protein EUTSA_v10024568mg [Eutrema salsugineum]
Length=694

 Score =   125 bits (314),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 87/155 (56%), Positives = 119/155 (77%), Gaps = 5/155 (3%)
 Frame = +2

Query  245  MDNKELMAMLTTSVAVLIGCVFVLVWRRASSSAKKAVEP-PNPEVPKAAEEETGED---G  412
            + +  ++A+ TTS+A+ +G   VL+W++++S   + ++P   P+   A +E+   D   G
Sbjct  26   LSDDVVLAIATTSLALAVGFA-VLLWKKSASDRSRELKPLVIPKSLMAKDEDDDVDLISG  84

Query  413  RKKITIFFGTQTGTAEGFAKALAEEAKARYEKANvkvvdlddyavdddeyeeklkkeSLV  592
            + +++IFFGTQTGTAEGFAKALAEE +ARYEKA VKV+DLDDYA DDD+Y EKLKKE+L 
Sbjct  85   KTRVSIFFGTQTGTAEGFAKALAEEIRARYEKAAVKVIDLDDYAADDDQYHEKLKKETLA  144

Query  593  FFFLATYGDGEPTDNAARFYKWFSEGKERGVWLKR  697
            FF +ATYGDGEPTDNAARFYKWF+EG E  + L++
Sbjct  145  FFCVATYGDGEPTDNAARFYKWFTEGNELDIRLQQ  179



>ref|XP_002307336.1| NADPH-cytochrome P450 oxydoreductase isoform 1 family protein 
[Populus trichocarpa]
 gb|AAK15259.1|AF302496_1 NADPH-cytochrome P450 oxydoreductase isoform 1 [Populus trichocarpa 
x Populus deltoides]
 gb|EEE94332.1| NADPH-cytochrome P450 oxydoreductase isoform 1 family protein 
[Populus trichocarpa]
Length=692

 Score =   125 bits (313),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 93/156 (60%), Positives = 113/156 (72%), Gaps = 14/156 (9%)
 Frame = +2

Query  272  LTTSVAVLIGCVFV------LVWRRASSSAKKAVEPPNPEVPKAAEEETGED------GR  415
            L+ SV V+I   F       ++  + SS   K V+P    VPK+   +  ED      G+
Sbjct  24   LSDSVVVIITTSFAALVGLVVLVLKRSSDRSKDVKPL--VVPKSLSIKDEEDESEALGGK  81

Query  416  KKITIFFGTQTGTAEGFAKALAEEAKARYEKANvkvvdlddyavdddeyeeklkkeSLVF  595
             K+TIF+GTQTGTAEGFAKALAEE KARYEKA VKV DLDDYA++DD+YEEKLKKE+L  
Sbjct  82   TKVTIFYGTQTGTAEGFAKALAEEVKARYEKAAVKVFDLDDYAMEDDQYEEKLKKETLAL  141

Query  596  FFLATYGDGEPTDNAARFYKWFSEGKERGVWLKRSS  703
            F +ATYGDGEPTDNAARFYKWF+EG ERG+WL++ S
Sbjct  142  FMVATYGDGEPTDNAARFYKWFTEGNERGIWLQQLS  177



>ref|XP_011016946.1| PREDICTED: LOW QUALITY PROTEIN: NADPH--cytochrome P450 reductase-like 
[Populus euphratica]
Length=692

 Score =   125 bits (313),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 93/154 (60%), Positives = 115/154 (75%), Gaps = 10/154 (6%)
 Frame = +2

Query  260  LMAMLTTSVAVLIGCVFVLVWRRASSSAKKAVEPPNPEVPKAAEEETGED------GRKK  421
            ++ ++TTS AV+ G V V + +R SS   K V+P    VPK+   +  ED      G+ K
Sbjct  28   VVVIITTSFAVVFGLV-VFISKR-SSDRSKVVKPL--VVPKSLSVKDEEDEPEALAGKTK  83

Query  422  ITIFFGTQTGTAEGFAKALAEEAKARYEKANvkvvdlddyavdddeyeeklkkeSLVFFF  601
            +TIF+GTQTGTA GFAKALAEE KARYEKA VKVVDLDDY V+DD+YEEKLKKE+L  F 
Sbjct  84   VTIFYGTQTGTAGGFAKALAEEVKARYEKAAVKVVDLDDYDVEDDQYEEKLKKETLALFM  143

Query  602  LATYGDGEPTDNAARFYKWFSEGKERGVWLKRSS  703
            +ATYGDGEPTDN+ARFYKWF+EG  RG+W ++ S
Sbjct  144  VATYGDGEPTDNSARFYKWFTEGNVRGIWRQQLS  177



>emb|CDY34287.1| BnaA01g13900D [Brassica napus]
Length=694

 Score =   124 bits (312),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 93/176 (53%), Positives = 125/176 (71%), Gaps = 10/176 (6%)
 Frame = +2

Query  194  FDQSNA-SSESASPVAMLMD----NKELMAMLTTSVAVLIGCVFVLVWRRASSSAKKAVE  358
            FD S+A + +  S + M +D    +  ++ + TTS+A+ +G    L+W++ +S   + V+
Sbjct  5    FDASSALAKQLKSVLGMSLDTPVSDDAVLVIATTSLALAVGFA-ALLWKKTTSDQSREVK  63

Query  359  P---PNPEVPKAAEEETGEDGRKKITIFFGTQTGTAEGFAKALAEEAKARYEKANvkvvd  529
            P   P   + K  EE+ G  G+ +++IFFGTQTG AEGFAKALAEE K RYEKA VKV+D
Sbjct  64   PLMVPKSLMTKEEEEDLGS-GKSRVSIFFGTQTGNAEGFAKALAEEIKVRYEKAAVKVID  122

Query  530  lddyavdddeyeeklkkeSLVFFFLATYGDGEPTDNAARFYKWFSEGKERGVWLKR  697
            LDDYA DDD+Y+EKLKKE+L FF +ATYGDGEPTDNAARFYKWF+EG E    L++
Sbjct  123  LDDYAADDDQYKEKLKKETLSFFCVATYGDGEPTDNAARFYKWFTEGNEGDTRLQQ  178



>ref|XP_002447240.1| hypothetical protein SORBIDRAFT_06g031110 [Sorghum bicolor]
 gb|EES11568.1| hypothetical protein SORBIDRAFT_06g031110 [Sorghum bicolor]
Length=694

 Score =   124 bits (311),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 79/95 (83%), Positives = 90/95 (95%), Gaps = 0/95 (0%)
 Frame = +2

Query  410  GRKKITIFFGTQTGTAEGFAKALAEEAKARYEKANvkvvdlddyavdddeyeeklkkeSL  589
            GRK++TIFFGTQTGTAEGFAK++AEEA+ARYEKA  KVVDLDDYA +D+EYEEKLKKE++
Sbjct  80   GRKRVTIFFGTQTGTAEGFAKSMAEEARARYEKAVFKVVDLDDYAQEDEEYEEKLKKETV  139

Query  590  VFFFLATYGDGEPTDNAARFYKWFSEGKERGVWLK  694
            V FFLATYGDGEPTDNAARFYKWF+EGKE+ VWLK
Sbjct  140  VLFFLATYGDGEPTDNAARFYKWFTEGKEKEVWLK  174



>ref|XP_002867662.1| hypothetical protein ARALYDRAFT_492391 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43921.1| hypothetical protein ARALYDRAFT_492391 [Arabidopsis lyrata subsp. 
lyrata]
Length=692

 Score =   124 bits (310),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 88/150 (59%), Positives = 117/150 (78%), Gaps = 5/150 (3%)
 Frame = +2

Query  260  LMAMLTTSVAVLIGCVFVLVWRRASSSAKKAVEPPN-PEVPKAAEEETGED---GRKKIT  427
            ++ + TTS+A++ G V VL+WR+ ++   + ++P   P+   A +E+   D   G+ +++
Sbjct  28   VLVIATTSLALVAGFV-VLLWRKTTADRSQELKPLMIPKSLMAKDEDDDLDLGSGKTRVS  86

Query  428  IFFGTQTGTAEGFAKALAEEAKARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFLA  607
            IFFGTQTGTAEGFAKAL+EE KARYEKA VKV+DLDDYA DDD+YEEKLKKE+L FF +A
Sbjct  87   IFFGTQTGTAEGFAKALSEEIKARYEKAAVKVIDLDDYAADDDQYEEKLKKETLAFFCVA  146

Query  608  TYGDGEPTDNAARFYKWFSEGKERGVWLKR  697
            TYGDGEPTDNAARFYKWF+E  ER + L++
Sbjct  147  TYGDGEPTDNAARFYKWFTEENEREIRLQQ  176



>ref|NP_001159331.1| uncharacterized protein LOC100304425 [Zea mays]
 gb|ACN25819.1| unknown [Zea mays]
 gb|ACN28051.1| unknown [Zea mays]
 gb|AFW59698.1| hypothetical protein ZEAMMB73_961001 [Zea mays]
Length=694

 Score =   124 bits (310),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 85/128 (66%), Positives = 100/128 (78%), Gaps = 2/128 (2%)
 Frame = +2

Query  317  VWRRASSSA--KKAVEPPNPEVPKAAEEETGEDGRKKITIFFGTQTGTAEGFAKALAEEA  490
            VW R+   A  K    P  P   K   +   +DGRK++TIFFGTQTGTAEGFAK++A+EA
Sbjct  47   VWFRSGGGAPSKPVATPLRPPPVKVDADADVDDGRKRVTIFFGTQTGTAEGFAKSMADEA  106

Query  491  KARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFLATYGDGEPTDNAARFYKWFSEG  670
            + RYEKA  KVVDLDDYA +D+EYEEKLKKE++  FFLATYGDGEPTDNAARFYKWF+EG
Sbjct  107  RVRYEKAVFKVVDLDDYAQEDEEYEEKLKKETVALFFLATYGDGEPTDNAARFYKWFTEG  166

Query  671  KERGVWLK  694
            KE+ VWLK
Sbjct  167  KEKEVWLK  174



>ref|XP_010448554.1| PREDICTED: NADPH--cytochrome P450 reductase 1-like [Camelina 
sativa]
Length=691

 Score =   123 bits (308),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 84/152 (55%), Positives = 114/152 (75%), Gaps = 4/152 (3%)
 Frame = +2

Query  245  MDNKELMAMLTTSVAVLIGCVFVLVWRRASSSAKKAVEP---PNPEVPKAAEEETGEDGR  415
            M +  ++ + TTS+A++ G V VL+WR+ ++   + ++P   P   + K  ++     G+
Sbjct  23   MSDDVVLVIATTSLALVAGFV-VLLWRKTTADQTRELKPMVLPKSLMAKDDDDADLGSGK  81

Query  416  KKITIFFGTQTGTAEGFAKALAEEAKARYEKANvkvvdlddyavdddeyeeklkkeSLVF  595
             +++IFFGTQTGTAEGFAKAL+EE KARYE A V+V+DLDDYA DDD+YEEKLKKE+L F
Sbjct  82   TRVSIFFGTQTGTAEGFAKALSEEIKARYEHAAVRVIDLDDYAADDDQYEEKLKKETLAF  141

Query  596  FFLATYGDGEPTDNAARFYKWFSEGKERGVWL  691
            F +ATYGDGEPTDNAARF+KWF+E  ER + L
Sbjct  142  FCVATYGDGEPTDNAARFFKWFTEDNERDISL  173



>ref|XP_011015338.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Populus euphratica]
 ref|XP_011015339.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Populus euphratica]
Length=692

 Score =   122 bits (306),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 92/156 (59%), Positives = 112/156 (72%), Gaps = 14/156 (9%)
 Frame = +2

Query  272  LTTSVAVLIGCVFV------LVWRRASSSAKKAVEPPNPEVPKAAEEETGED------GR  415
            L+ SV V+I   F       ++  + SS   K V+P    VPK+   +  ED      G+
Sbjct  24   LSDSVVVIITTSFAALVGLVVLVLKRSSDRSKDVKPL--VVPKSVSIKDEEDESEALGGK  81

Query  416  KKITIFFGTQTGTAEGFAKALAEEAKARYEKANvkvvdlddyavdddeyeeklkkeSLVF  595
             K+TIF+GTQTGTAEGFAKALAEE KARYEKA VKV DLDDYA++DD+YEEKLKKE+L  
Sbjct  82   TKVTIFYGTQTGTAEGFAKALAEEVKARYEKAAVKVFDLDDYAMEDDQYEEKLKKETLAL  141

Query  596  FFLATYGDGEPTDNAARFYKWFSEGKERGVWLKRSS  703
            F +ATYGDGEPTDNAARFYKWF+EG ER +WL++ S
Sbjct  142  FMVATYGDGEPTDNAARFYKWFTEGNEREIWLQQLS  177



>ref|XP_006285937.1| hypothetical protein CARUB_v10007449mg [Capsella rubella]
 gb|EOA18835.1| hypothetical protein CARUB_v10007449mg [Capsella rubella]
Length=692

 Score =   122 bits (306),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 86/152 (57%), Positives = 117/152 (77%), Gaps = 9/152 (6%)
 Frame = +2

Query  260  LMAMLTTSVAVLIGCVFVLVWRRASSSAKKAVEPPNPEVPKAAEEETGE------DGRKK  421
            ++ + TTS+A++ G V VL+WR++++   + ++P    +PK+   +  +       G+ +
Sbjct  28   VLVIATTSLALVAGFV-VLLWRKSTADQSRELKPLV--IPKSLMSKDDDDDVDLGSGKTR  84

Query  422  ITIFFGTQTGTAEGFAKALAEEAKARYEKANvkvvdlddyavdddeyeeklkkeSLVFFF  601
            ++IFFGTQTGTAEGFAKAL+EE KARYEKA+V+V+DLDDYA DDD+YEEKLKKESL FF 
Sbjct  85   VSIFFGTQTGTAEGFAKALSEEIKARYEKASVRVIDLDDYAADDDQYEEKLKKESLAFFC  144

Query  602  LATYGDGEPTDNAARFYKWFSEGKERGVWLKR  697
            +ATYGDGEPTDNAARFYKWF+E  ER + L +
Sbjct  145  VATYGDGEPTDNAARFYKWFTEENERDISLPQ  176



>ref|XP_008653023.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Zea mays]
 tpg|DAA62574.1| TPA: hypothetical protein ZEAMMB73_030302 [Zea mays]
Length=709

 Score =   122 bits (306),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 98/154 (64%), Positives = 117/154 (76%), Gaps = 3/154 (2%)
 Frame = +2

Query  242  LMDNKELMAMLTTSVAVLIGC---VFVLVWRRASSSAKKAVEPPNPEVPKAAEEETGEDG  412
            L +N+ L  +LTTS+AVL+GC   + V       ++A  A  PP P   K  +E   +DG
Sbjct  36   LAENRHLFLLLTTSLAVLVGCGVALLVRRSSAPRAAAAAAQAPPRPLAVKPKDEPDPDDG  95

Query  413  RKKITIFFGTQTGTAEGFAKALAEEAKARYEKANvkvvdlddyavdddeyeeklkkeSLV  592
            R+++ +FFGTQTGTAEGFAKALAEEAKARY+KA  KVVDL+DYA +D+EYEEKLKKES+ 
Sbjct  96   RQRVIVFFGTQTGTAEGFAKALAEEAKARYDKAVFKVVDLEDYAAEDEEYEEKLKKESIA  155

Query  593  FFFLATYGDGEPTDNAARFYKWFSEGKERGVWLK  694
             FFLATYGDGEPTDNAARFYKWFSEG ERG WL 
Sbjct  156  LFFLATYGDGEPTDNAARFYKWFSEGNERGEWLN  189



>ref|XP_010433757.1| PREDICTED: NADPH--cytochrome P450 reductase 1 isoform X1 [Camelina 
sativa]
 ref|XP_010433758.1| PREDICTED: NADPH--cytochrome P450 reductase 1 isoform X2 [Camelina 
sativa]
 ref|XP_010433759.1| PREDICTED: NADPH--cytochrome P450 reductase 1 isoform X3 [Camelina 
sativa]
Length=691

 Score =   122 bits (305),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 84/147 (57%), Positives = 112/147 (76%), Gaps = 4/147 (3%)
 Frame = +2

Query  260  LMAMLTTSVAVLIGCVFVLVWRRASSSAKKAVEP---PNPEVPKAAEEETGEDGRKKITI  430
            ++ + TTS+A++ G V VL+WR+ ++   + ++P   P   + K  ++     G+ +++I
Sbjct  28   VLVIATTSLALVAGFV-VLLWRKTTADQTRELKPMVLPKSLMAKDDDDADLGSGKTRVSI  86

Query  431  FFGTQTGTAEGFAKALAEEAKARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFLAT  610
            FFGTQTGTAEGFAKAL+EE KARYE A V+V+DLDDYA DDD+YEEKLKKE+L FF +AT
Sbjct  87   FFGTQTGTAEGFAKALSEEIKARYENAAVRVIDLDDYAADDDQYEEKLKKETLAFFCVAT  146

Query  611  YGDGEPTDNAARFYKWFSEGKERGVWL  691
            YGDGEPTDNAARFYKWF+E  ER + L
Sbjct  147  YGDGEPTDNAARFYKWFTEENERDISL  173



>ref|XP_004957625.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Setaria italica]
Length=705

 Score =   122 bits (305),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 96/155 (62%), Positives = 119/155 (77%), Gaps = 5/155 (3%)
 Frame = +2

Query  242  LMDNKELMAMLTTSVAVLIGC-VFVLVWRRASSSAKKAVEPPNPE----VPKAAEEETGE  406
            L +++ L+ +LTTS+AVL+GC V +LV R A++    +      +      K  +E   +
Sbjct  31   LAEDRHLLVLLTTSLAVLVGCGVALLVRRSAAAPRAASAAAAQAQTRPLAAKPKDEPDPD  90

Query  407  DGRKKITIFFGTQTGTAEGFAKALAEEAKARYEKANvkvvdlddyavdddeyeeklkkeS  586
            DGR+++T+FFGTQTGTAEGFAKALAEEAKARY++A  KVVDLDDYA +D+EY EKLKKES
Sbjct  91   DGRQRVTVFFGTQTGTAEGFAKALAEEAKARYDRAVFKVVDLDDYAAEDEEYGEKLKKES  150

Query  587  LVFFFLATYGDGEPTDNAARFYKWFSEGKERGVWL  691
            +  FFLATYGDGEPTDNAARFYKWFSEG ERG WL
Sbjct  151  IALFFLATYGDGEPTDNAARFYKWFSEGNERGEWL  185



>ref|NP_194183.1| NADPH--cytochrome P450 reductase 1 [Arabidopsis thaliana]
 sp|Q9SB48.1|NCPR1_ARATH RecName: Full=NADPH--cytochrome P450 reductase 1 [Arabidopsis 
thaliana]
 emb|CAA23011.1| NADPH-ferrihemoprotein reductase ATR1 [Arabidopsis thaliana]
 emb|CAB79362.1| NADPH-ferrihemoprotein reductase ATR1 [Arabidopsis thaliana]
 gb|AAK96879.1| NADPH-ferrihemoprotein reductase ATR1 [Arabidopsis thaliana]
 gb|AAP37785.1| At4g24520 [Arabidopsis thaliana]
 gb|AEE84919.1| NADPH--cytochrome P450 reductase 1 [Arabidopsis thaliana]
 gb|AGA15807.1| CPR1 [Expression vector pUDE172]
Length=692

 Score =   122 bits (305),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 87/155 (56%), Positives = 118/155 (76%), Gaps = 5/155 (3%)
 Frame = +2

Query  245  MDNKELMAMLTTSVAVLIGCVFVLVWRRASSSAKKAVEPPN-PEVPKAAEEETGED---G  412
            + +  ++ + TTS+A++ G V VL+W++ ++     ++P   P+   A +E+   D   G
Sbjct  23   LSDDVVLVIATTSLALVAGFV-VLLWKKTTADRSGELKPLMIPKSLMAKDEDDDLDLGSG  81

Query  413  RKKITIFFGTQTGTAEGFAKALAEEAKARYEKANvkvvdlddyavdddeyeeklkkeSLV  592
            + +++IFFGTQTGTAEGFAKAL+EE KARYEKA VKV+DLDDYA DDD+YEEKLKKE+L 
Sbjct  82   KTRVSIFFGTQTGTAEGFAKALSEEIKARYEKAAVKVIDLDDYAADDDQYEEKLKKETLA  141

Query  593  FFFLATYGDGEPTDNAARFYKWFSEGKERGVWLKR  697
            FF +ATYGDGEPTDNAARFYKWF+E  ER + L++
Sbjct  142  FFCVATYGDGEPTDNAARFYKWFTEENERDIKLQQ  176



>ref|XP_009137450.1| PREDICTED: NADPH--cytochrome P450 reductase 1 isoform X1 [Brassica 
rapa]
Length=695

 Score =   121 bits (304),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 87/141 (62%), Positives = 111/141 (79%), Gaps = 5/141 (4%)
 Frame = +2

Query  287  AVLIGCVFVLVWRRASSSAKKAVEPPN-PEVPKAAEEETGED---GRKKITIFFGTQTGT  454
            AV++G V VL+WR+ +S   + ++P   P+   A +E+   D   G+ +++IFFGTQTGT
Sbjct  40   AVVVGFV-VLLWRKTTSDRGQELKPLMIPKSLMAKDEDDDVDLGSGKTRVSIFFGTQTGT  98

Query  455  AEGFAKALAEEAKARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFLATYGDGEPTD  634
            AEGFAKALAEE KARYEKA VKV+DLDDYA DDD+YEEK+KKE+L FF +ATYGDGEPTD
Sbjct  99   AEGFAKALAEEIKARYEKAAVKVIDLDDYAADDDQYEEKMKKETLAFFCIATYGDGEPTD  158

Query  635  NAARFYKWFSEGKERGVWLKR  697
            NAARFYKWF+EG E  + L++
Sbjct  159  NAARFYKWFTEGNEGEIRLQQ  179



>emb|CDY11017.1| BnaA03g46760D [Brassica napus]
Length=695

 Score =   121 bits (304),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 87/141 (62%), Positives = 111/141 (79%), Gaps = 5/141 (4%)
 Frame = +2

Query  287  AVLIGCVFVLVWRRASSSAKKAVEPPN-PEVPKAAEEETGED---GRKKITIFFGTQTGT  454
            AV++G V VL+WR+ +S   + ++P   P+   A +E+   D   G+ +++IFFGTQTGT
Sbjct  40   AVVVGFV-VLLWRKTTSDRGQELKPLMIPKSLMAKDEDDDVDLGSGKTRVSIFFGTQTGT  98

Query  455  AEGFAKALAEEAKARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFLATYGDGEPTD  634
            AEGFAKALAEE KARYEKA VKV+DLDDYA DDD+YEEK+KKE+L FF +ATYGDGEPTD
Sbjct  99   AEGFAKALAEEIKARYEKAAVKVIDLDDYAADDDQYEEKMKKETLAFFCIATYGDGEPTD  158

Query  635  NAARFYKWFSEGKERGVWLKR  697
            NAARFYKWF+EG E  + L++
Sbjct  159  NAARFYKWFTEGNEGEIRLQQ  179



>emb|CDY70343.1| BnaCnng67910D, partial [Brassica napus]
Length=593

 Score =   120 bits (301),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 92/177 (52%), Positives = 124/177 (70%), Gaps = 13/177 (7%)
 Frame = +2

Query  194  FDQSNA-SSESASPVAMLMD----NKELMAMLTTSVAVLIGCVFVLVWRRASSSAKKAVE  358
            FD S+A + +  S + M +D    +  ++ + TTS+A+ +G    L+W++ +S  ++ V+
Sbjct  5    FDASSALAKQLKSVLGMSLDTPVSDDVVLVIATTSLALAVGFA-ALLWKKTTSDQRREVK  63

Query  359  PPNPEVPKAAEEETGED-----GRKKITIFFGTQTGTAEGFAKALAEEAKARYEKANvkv  523
            P    VPK+      +D     G+ +++IFFGTQTG AEGFAKALAEE K RYEKA VKV
Sbjct  64   PLM--VPKSLIMAKDDDVDLGSGKSRVSIFFGTQTGNAEGFAKALAEEIKVRYEKAAVKV  121

Query  524  vdlddyavdddeyeeklkkeSLVFFFLATYGDGEPTDNAARFYKWFSEGKERGVWLK  694
            +DLDDYA DDD+Y+EKLKKE+L FF +ATYGDGEPTDNAARFYKWF+EG E    L+
Sbjct  122  IDLDDYAADDDQYKEKLKKETLAFFCVATYGDGEPTDNAARFYKWFTEGNEGDTRLQ  178



>ref|XP_010439016.1| PREDICTED: NADPH--cytochrome P450 reductase 1-like [Camelina 
sativa]
Length=691

 Score =   120 bits (302),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 84/147 (57%), Positives = 112/147 (76%), Gaps = 4/147 (3%)
 Frame = +2

Query  260  LMAMLTTSVAVLIGCVFVLVWRRASSSAKKAVEP---PNPEVPKAAEEETGEDGRKKITI  430
            ++ + TTS+A++ G V VL+WR+ ++   + ++P   P   + K  ++     G+ +++I
Sbjct  28   VLVIATTSLALVAGFV-VLLWRKTTADQTRELKPMVLPKSLMAKDDDDADLGSGKTRVSI  86

Query  431  FFGTQTGTAEGFAKALAEEAKARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFLAT  610
            FFGTQTGTAEGFAKAL+EE KARYE A V+VVDLDDYA DDD+YEEKLKKE+L FF +AT
Sbjct  87   FFGTQTGTAEGFAKALSEEIKARYENAAVRVVDLDDYAADDDQYEEKLKKETLAFFCVAT  146

Query  611  YGDGEPTDNAARFYKWFSEGKERGVWL  691
            YGDGEPTDNAARF+KWF+E  ER + L
Sbjct  147  YGDGEPTDNAARFFKWFTEDNERDISL  173



>emb|CDX92639.1| BnaC07g38970D [Brassica napus]
Length=695

 Score =   120 bits (301),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 86/141 (61%), Positives = 111/141 (79%), Gaps = 5/141 (4%)
 Frame = +2

Query  287  AVLIGCVFVLVWRRASSSAKKAVEPPN-PEVPKAAEEETGED---GRKKITIFFGTQTGT  454
            A++ G V VL+WR+ +S   + ++P   P+   A +E+   D   G+++++IFFGTQTGT
Sbjct  40   ALVFGFV-VLLWRKTTSDRGQELKPLMIPKSLMAKDEDDDVDLGSGKERVSIFFGTQTGT  98

Query  455  AEGFAKALAEEAKARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFLATYGDGEPTD  634
            AEGFAKALAEE KARYEKA VKV+DLDDYA DDD+YEEK+KKE+L FF +ATYGDGEPTD
Sbjct  99   AEGFAKALAEEIKARYEKAAVKVIDLDDYAGDDDQYEEKMKKETLAFFCIATYGDGEPTD  158

Query  635  NAARFYKWFSEGKERGVWLKR  697
            NAARFYKWF+EG E  + L++
Sbjct  159  NAARFYKWFTEGNEGDIRLQQ  179



>ref|XP_010234513.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Brachypodium 
distachyon]
Length=700

 Score =   120 bits (300),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 88/139 (63%), Positives = 106/139 (76%), Gaps = 7/139 (5%)
 Frame = +2

Query  299  GCVFVLVWRRASSSAKK-------AVEPPNPEVPKAAEEETGEDGRKKITIFFGTQTGTA  457
            GC  +++WRR ++  K+       A  P      K  +EE  +DGRK++ +FFGTQTGTA
Sbjct  48   GCALLVLWRRTAAGKKRREADKVAAAAPGMQGKAKGGKEEPKDDGRKRVAVFFGTQTGTA  107

Query  458  EGFAKALAEEAKARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFLATYGDGEPTDN  637
            EGFAKALAEEAKARY+KA  KVVDLDDYA +D+EYEEK+KKE L  FF+ATYGDGEPTDN
Sbjct  108  EGFAKALAEEAKARYDKATFKVVDLDDYAAEDEEYEEKIKKEKLALFFVATYGDGEPTDN  167

Query  638  AARFYKWFSEGKERGVWLK  694
            AARFYKWF+EG +RGVWL 
Sbjct  168  AARFYKWFTEGNDRGVWLN  186



>ref|NP_001061346.1| Os08g0243500, partial [Oryza sativa Japonica Group]
 dbj|BAF23260.1| Os08g0243500, partial [Oryza sativa Japonica Group]
Length=651

 Score =   119 bits (298),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 74/93 (80%), Positives = 87/93 (94%), Gaps = 0/93 (0%)
 Frame = +2

Query  413  RKKITIFFGTQTGTAEGFAKALAEEAKARYEKANvkvvdlddyavdddeyeeklkkeSLV  592
            RK++T+FFGTQTGTAEGFAKALAEEAK+RY+KA  KVVDLD+YA++D+EYEE+LKKE + 
Sbjct  40   RKRVTVFFGTQTGTAEGFAKALAEEAKSRYDKAIFKVVDLDEYAMEDEEYEERLKKEKIS  99

Query  593  FFFLATYGDGEPTDNAARFYKWFSEGKERGVWL  691
             FF+ATYGDGEPTDNAARFYKWF+EG ERGVWL
Sbjct  100  LFFVATYGDGEPTDNAARFYKWFTEGNERGVWL  132



>emb|CAA46814.1| NADPH-ferrihemoprotein reductase [Arabidopsis thaliana]
Length=692

 Score =   118 bits (296),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 86/155 (55%), Positives = 117/155 (75%), Gaps = 5/155 (3%)
 Frame = +2

Query  245  MDNKELMAMLTTSVAVLIGCVFVLVWRRASSSAKKAVEPPN-PEVPKAAEEETGED---G  412
            + +  ++ + TTS+A++ G V VL+W++ ++     ++P   P+   A +E+   D   G
Sbjct  23   LSDDVVLVIATTSLALVAGFV-VLLWKKTTADRSGELKPLMIPKSLMAKDEDDDLDLGSG  81

Query  413  RKKITIFFGTQTGTAEGFAKALAEEAKARYEKANvkvvdlddyavdddeyeeklkkeSLV  592
            + +++IFFGTQTGTAEGFAKAL+EE KARYEKA VKV+DLDDYA DDD+YEEKLKKE+L 
Sbjct  82   KTRVSIFFGTQTGTAEGFAKALSEEIKARYEKAAVKVIDLDDYAADDDQYEEKLKKETLA  141

Query  593  FFFLATYGDGEPTDNAARFYKWFSEGKERGVWLKR  697
            FF +ATYGDGEPTDNAARF KWF+E  ER + L++
Sbjct  142  FFCVATYGDGEPTDNAARFSKWFTEENERDIKLQQ  176



>gb|AAC05021.1| NADPH:ferrihemoprotein oxidoreductase [Papaver somniferum]
 gb|AHF27398.1| NADPH:ferrihemoprotein oxidoreductase [synthetic construct]
Length=683

 Score =   117 bits (292),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 93/146 (64%), Positives = 113/146 (77%), Gaps = 1/146 (1%)
 Frame = +2

Query  260  LMAMLTTSVAVLIGCVFVLVWRRASSSAKKAVEPPNPEVPKAAEEETGEDGRKKITIFFG  439
            +  M+TT  ++LIG  F     ++SSS  K +E   P + K  EE   + G+ K+TIFFG
Sbjct  27   IFIMVTTVASMLIGFGF-FACMKSSSSQSKPIETYKPIIDKEEEEIEVDPGKIKLTIFFG  85

Query  440  TQTGTAEGFAKALAEEAKARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFLATYGD  619
            TQTGTAEGFAKALAEE KA+Y+KA VKVVDLDDYA +DD+YEEKLKKESLVFF +ATYGD
Sbjct  86   TQTGTAEGFAKALAEEIKAKYKKAVVKVVDLDDYAAEDDQYEEKLKKESLVFFMVATYGD  145

Query  620  GEPTDNAARFYKWFSEGKERGVWLKR  697
            GEPTDNAARFYKWF++  ERG WL++
Sbjct  146  GEPTDNAARFYKWFTQEHERGEWLQQ  171



>dbj|BAJ41268.1| NADPH-P450 reductase 1 [Zingiber officinale]
Length=703

 Score =   116 bits (291),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 101/200 (51%), Positives = 123/200 (62%), Gaps = 28/200 (14%)
 Frame = +2

Query  125  MEPTSEKLSPFDFMAAIFKGGRIFDQSN----ASSESASPVAMLMDNKELMAMLTTSVAV  292
            M+P    +S  D MAAI  G    D SN    AS  S +P  +              VAV
Sbjct  1    MQPGD--VSTTDLMAAILNGK--LDASNLLQWASKLSENPRFL-------------EVAV  43

Query  293  LIGCV--FVLVWRRASSSAKKAVEPPNPEVPKAA-----EEETGEDGRKKITIFFGTQTG  451
            L+GC+  F+L W+++       V  P     K A     + E  + G+KK+T+FFG+QTG
Sbjct  44   LVGCLSAFLLFWQKSGGKEPARVAAPPAPAAKRAKKMVRDTEDADFGKKKVTLFFGSQTG  103

Query  452  TAEGFAKALAEEAKARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFLATYGDGEPT  631
            TAE FAK LA+EA ARY+K   KVVDLDDYA ++ EYEEKLKKE+L  FFLATYGDGEPT
Sbjct  104  TAERFAKTLADEANARYKKVVFKVVDLDDYAFENHEYEEKLKKETLGLFFLATYGDGEPT  163

Query  632  DNAARFYKWFSEGKERGVWL  691
            DNAARFYKWF E KER V+L
Sbjct  164  DNAARFYKWFFEAKERNVYL  183



>ref|XP_002960044.1| hypothetical protein SELMODRAFT_401997 [Selaginella moellendorffii]
 gb|EFJ37583.1| hypothetical protein SELMODRAFT_401997 [Selaginella moellendorffii]
Length=597

 Score =   115 bits (289),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 81/144 (56%), Positives = 102/144 (71%), Gaps = 3/144 (2%)
 Frame = +2

Query  269  MLTTSVAVLIGCVFVLVWRRASSSAKKAVEPPNPEVPKAAEEETGE-DG-RKKITIFFGT  442
            +    +A++     + +WRRA SS +++      +     EEE  E DG   K+T+FFGT
Sbjct  10   LFLLGLALIFASAALFLWRRADSSKRESEPVKVVKPVVEIEEEGDELDGFSNKVTVFFGT  69

Query  443  QTGTAEGFAKALAEEAKARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFLATYGDG  622
            QTGTAEGFAKALAEEAK+RYEK   K+VDLD+YA DD+ Y+ KLKKE+   F LATYGDG
Sbjct  70   QTGTAEGFAKALAEEAKSRYEKVLFKIVDLDNYAADDETYQLKLKKENFAIFMLATYGDG  129

Query  623  EPTDNAARFYKWFSE-GKERGVWL  691
            EPTDNAARFYK+ +E G+ERG WL
Sbjct  130  EPTDNAARFYKFLTEGGEERGSWL  153



>ref|NP_001190823.1| NADPH--cytochrome P450 reductase 1 [Arabidopsis thaliana]
 gb|AEE84920.1| NADPH--cytochrome P450 reductase 1 [Arabidopsis thaliana]
Length=688

 Score =   116 bits (290),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 70/155 (45%), Positives = 105/155 (68%), Gaps = 9/155 (6%)
 Frame = +2

Query  245  MDNKELMAMLTTSVAVLIGCVFVLVWRRASSSAKKAVEPPN-PEVPKAAEEETGED---G  412
            + +  ++ + TTS+A++ G V VL+W++ ++     ++P   P+   A +E+   D   G
Sbjct  23   LSDDVVLVIATTSLALVAGFV-VLLWKKTTADRSGELKPLMIPKSLMAKDEDDDLDLGSG  81

Query  413  RKKITIFFGTQTGTAEGFAKALAEEAKARYEKANvkvvdlddyavdddeyeeklkkeSLV  592
            + +++IFFGTQTGTAEGFAKAL+EE KARYEKA VK     D    +++ +++    +L 
Sbjct  82   KTRVSIFFGTQTGTAEGFAKALSEEIKARYEKAAVKDDYAADDDQYEEKLKKE----TLA  137

Query  593  FFFLATYGDGEPTDNAARFYKWFSEGKERGVWLKR  697
            FF +ATYGDGEPTDNAARFYKWF+E  ER + L++
Sbjct  138  FFCVATYGDGEPTDNAARFYKWFTEENERDIKLQQ  172



>emb|CAC83301.1| cytochrome P450 reductase [Triticum aestivum]
Length=703

 Score =   112 bits (281),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 90/135 (67%), Positives = 106/135 (79%), Gaps = 3/135 (2%)
 Frame = +2

Query  296  IGCVFVLVWRRASSSAKKAVEPPNPEVPKAA---EEETGEDGRKKITIFFGTQTGTAEGF  466
            +GC   L++RR+SS A           P AA   +E   +DGR+++ +FFGTQTGTAEGF
Sbjct  49   VGCGVALLFRRSSSGAAPLAHKSAAAKPLAAKKDQEPDPDDGRQRVALFFGTQTGTAEGF  108

Query  467  AKALAEEAKARYEKANvkvvdlddyavdddeyeeklkkeSLVFFFLATYGDGEPTDNAAR  646
            AKALAEEAKARY+KA  KV+DLDDYA +D+EYEEKLKKE++ FFFLATYGDGEPTDNAAR
Sbjct  109  AKALAEEAKARYDKAVFKVLDLDDYAAEDEEYEEKLKKENIAFFFLATYGDGEPTDNAAR  168

Query  647  FYKWFSEGKERGVWL  691
            FYKWFSEG ERG WL
Sbjct  169  FYKWFSEGNERGEWL  183



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1273595176425