BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF046K22

Length=755
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011074054.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    405   1e-134   Sesamum indicum [beniseed]
ref|XP_004238468.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    404   4e-134   Solanum lycopersicum
ref|XP_004253113.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    402   2e-133   Solanum lycopersicum
ref|XP_006435470.1|  hypothetical protein CICLE_v10000595mg             397   4e-133   
ref|XP_009608062.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    401   5e-133   Nicotiana tomentosiformis
ref|XP_009777872.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    400   6e-133   Nicotiana sylvestris
gb|EYU41211.1|  hypothetical protein MIMGU_mgv1a003012mg                400   1e-132   Erythranthe guttata [common monkey flower]
ref|XP_007018640.1|  Pyrophosphate--fructose 6-phosphate 1-phosph...    399   3e-132   
gb|KDO85265.1|  hypothetical protein CISIN_1g006964mg                   397   5e-132   Citrus sinensis [apfelsine]
ref|XP_006342524.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    398   7e-132   Solanum tuberosum [potatoes]
ref|XP_006435472.1|  hypothetical protein CICLE_v10000595mg             397   1e-131   Citrus clementina [clementine]
ref|XP_011099944.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    397   2e-131   Sesamum indicum [beniseed]
ref|XP_009759651.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    395   5e-131   Nicotiana sylvestris
ref|XP_009607500.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    395   6e-131   Nicotiana tomentosiformis
sp|P21342.2|PFPA_SOLTU  RecName: Full=Pyrophosphate--fructose 6-p...    395   6e-131   Solanum tuberosum [potatoes]
gb|AAC67587.1|  pyrophosphate-dependent phosphofructokinase alpha...    395   7e-131   Citrus x paradisi [grapefruit]
gb|ABK93964.1|  unknown                                                 395   8e-131   Populus trichocarpa [western balsam poplar]
ref|XP_002307823.1|  pyrophosphate-dependent phosphofructokinase ...    395   9e-131   Populus trichocarpa [western balsam poplar]
gb|KHG12069.1|  Pyrophosphate--fructose 6-phosphate 1-phosphotran...    395   1e-130   Gossypium arboreum [tree cotton]
ref|NP_001275358.1|  pyrophosphate--fructose 6-phosphate 1-phosph...    395   1e-130   Solanum tuberosum [potatoes]
ref|XP_008796200.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    395   1e-130   Phoenix dactylifera
ref|XP_002510738.1|  phosphofructokinase, putative                      394   3e-130   Ricinus communis
gb|KDP36731.1|  hypothetical protein JCGZ_08022                         394   4e-130   Jatropha curcas
gb|KCW70371.1|  hypothetical protein EUGRSUZ_F03611                     390   5e-130   Eucalyptus grandis [rose gum]
gb|EYU36601.1|  hypothetical protein MIMGU_mgv1a003013mg                393   5e-130   Erythranthe guttata [common monkey flower]
ref|XP_011041141.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    392   1e-129   Populus euphratica
gb|AHZ08764.1|  pyrophosphate--fructose 6-phosphate 1-phosphotran...    392   1e-129   Nicotiana tabacum [American tobacco]
gb|KJB29716.1|  hypothetical protein B456_005G115600                    390   2e-129   Gossypium raimondii
gb|KJB29713.1|  hypothetical protein B456_005G115600                    392   2e-129   Gossypium raimondii
ref|XP_011034779.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    391   2e-129   Populus euphratica
gb|KJB29715.1|  hypothetical protein B456_005G115600                    390   3e-129   Gossypium raimondii
sp|Q41140.1|PFPA_RICCO  RecName: Full=Pyrophosphate--fructose 6-p...    390   6e-129   Ricinus communis
ref|XP_010094500.1|  Pyrophosphate--fructose 6-phosphate 1-phosph...    390   7e-129   
gb|ADZ96380.2|  pyrophosphate--fructose 6-phosphate 1-phosphotran...    390   7e-129   Eriobotrya japonica [loquat]
ref|XP_003529192.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    390   8e-129   Glycine max [soybeans]
ref|XP_010927304.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    390   8e-129   Elaeis guineensis
gb|KCW68157.1|  hypothetical protein EUGRSUZ_F018231                    387   8e-129   Eucalyptus grandis [rose gum]
ref|XP_010063177.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    390   8e-129   Eucalyptus grandis [rose gum]
gb|AIE47261.1|  pyrophosphate-dependent phosphofructokinase             389   1e-128   Hevea brasiliensis [jebe]
ref|XP_008453023.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    389   1e-128   Cucumis melo [Oriental melon]
ref|XP_008346428.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    389   1e-128   
ref|XP_008373335.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    389   1e-128   
ref|XP_010537247.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    389   2e-128   Tarenaya hassleriana [spider flower]
ref|XP_003555655.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    387   8e-128   Glycine max [soybeans]
gb|KCW68155.1|  hypothetical protein EUGRSUZ_F018231                    386   9e-128   Eucalyptus grandis [rose gum]
ref|XP_010061240.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    387   9e-128   Eucalyptus grandis [rose gum]
ref|XP_010266302.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    387   1e-127   Nelumbo nucifera [Indian lotus]
gb|KJB29714.1|  hypothetical protein B456_005G115600                    387   1e-127   Gossypium raimondii
gb|KCW68156.1|  hypothetical protein EUGRSUZ_F018231                    386   2e-127   Eucalyptus grandis [rose gum]
ref|XP_010913868.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    387   2e-127   Elaeis guineensis
ref|XP_006386123.1|  hypothetical protein POPTR_0002s00490g             387   2e-127   
ref|XP_002300615.1|  pyrophosphate-dependent phosphofructokinase ...    386   2e-127   Populus trichocarpa [western balsam poplar]
ref|XP_004498195.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    386   2e-127   Cicer arietinum [garbanzo]
ref|XP_010266301.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    386   2e-127   Nelumbo nucifera [Indian lotus]
ref|XP_010684564.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    386   3e-127   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009372651.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    385   4e-127   Pyrus x bretschneideri [bai li]
ref|XP_010539758.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    385   1e-126   Tarenaya hassleriana [spider flower]
ref|XP_004145564.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    384   2e-126   
ref|XP_007210294.1|  hypothetical protein PRUPE_ppa002571mg             384   5e-126   
ref|XP_002276269.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    383   5e-126   Vitis vinifera
ref|XP_008237897.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    384   8e-126   
ref|XP_010932134.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    380   5e-125   Elaeis guineensis
ref|XP_008775478.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    380   9e-125   Phoenix dactylifera
ref|XP_007153134.1|  hypothetical protein PHAVU_003G009600g             379   1e-124   Phaseolus vulgaris [French bean]
ref|XP_009391869.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    379   1e-124   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009410339.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    379   2e-124   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008802157.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    379   2e-124   Phoenix dactylifera
ref|XP_010527650.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    379   2e-124   Tarenaya hassleriana [spider flower]
ref|XP_004300090.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    377   1e-123   Fragaria vesca subsp. vesca
ref|XP_009414937.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    375   4e-123   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009149574.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    375   5e-123   Brassica rapa
ref|XP_010270592.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    375   6e-123   Nelumbo nucifera [Indian lotus]
ref|XP_006390180.1|  hypothetical protein EUTSA_v10018291mg             375   8e-123   Eutrema salsugineum [saltwater cress]
gb|KFK35354.1|  hypothetical protein AALP_AA5G273800                    375   9e-123   Arabis alpina [alpine rockcress]
ref|XP_002889091.1|  hypothetical protein ARALYDRAFT_476813             374   1e-122   
ref|XP_006302013.1|  hypothetical protein CARUB_v10019988mg             373   3e-122   Capsella rubella
emb|CDX88295.1|  BnaC06g37390D                                          373   5e-122   
ref|XP_009106323.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    372   6e-122   Brassica rapa
ref|XP_010416575.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    372   1e-121   Camelina sativa [gold-of-pleasure]
ref|XP_010471809.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    372   1e-121   Camelina sativa [gold-of-pleasure]
ref|XP_006416345.1|  hypothetical protein EUTSA_v10007087mg             372   1e-121   Eutrema salsugineum [saltwater cress]
emb|CDX87587.1|  BnaA07g32860D                                          371   2e-121   
ref|XP_010477351.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    368   2e-121   Camelina sativa [gold-of-pleasure]
emb|CDY67022.1|  BnaC05g50320D                                          371   2e-121   Brassica napus [oilseed rape]
emb|CDY33660.1|  BnaC08g19600D                                          370   2e-121   Brassica napus [oilseed rape]
gb|EPS71673.1|  hypothetical protein M569_03082                         370   4e-121   Genlisea aurea
ref|XP_010428720.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    370   6e-121   Camelina sativa [gold-of-pleasure]
ref|XP_006306984.1|  hypothetical protein CARUB_v10008559mg             370   7e-121   
gb|KFK42073.1|  hypothetical protein AALP_AA2G207700                    369   1e-120   Arabis alpina [alpine rockcress]
ref|NP_173519.1|  pyrophosphate--fructose 6-phosphate 1-phosphotr...    369   2e-120   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010498548.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    369   2e-120   Camelina sativa [gold-of-pleasure]
dbj|BAF01310.1|  putative pyrophosphate-dependent phosphofructoki...    368   2e-120   Arabidopsis thaliana [mouse-ear cress]
ref|NP_177781.1|  pyrophosphate--fructose-6-phosphate 1-phosphotr...    368   3e-120   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002893141.1|  hypothetical protein ARALYDRAFT_472333             368   3e-120   
emb|CDX96611.1|  BnaA08g21540D                                          367   6e-120   
ref|XP_010459789.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    365   5e-119   Camelina sativa [gold-of-pleasure]
emb|CBI40779.3|  unnamed protein product                                366   6e-119   Vitis vinifera
gb|EMS68198.1|  Pyrophosphate--fructose 6-phosphate 1-phosphotran...    362   2e-118   Triticum urartu
dbj|BAJ92904.1|  predicted protein                                      363   3e-118   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003570229.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    361   1e-117   Brachypodium distachyon [annual false brome]
ref|XP_006849934.1|  hypothetical protein AMTR_s00022p00121950          359   7e-117   Amborella trichopoda
ref|XP_004498196.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    359   8e-117   
ref|XP_010235882.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    357   9e-116   
ref|XP_009417287.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    353   2e-114   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006435471.1|  hypothetical protein CICLE_v10000595mg             348   5e-114   
ref|XP_006435473.1|  hypothetical protein CICLE_v10000595mg             348   1e-112   
ref|XP_006659170.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    348   2e-112   Oryza brachyantha
ref|NP_001047918.1|  Os02g0714200                                       348   2e-112   
ref|NP_001057528.1|  Os06g0326400                                       347   5e-112   
ref|XP_002452651.1|  hypothetical protein SORBIDRAFT_04g030000          347   7e-112   Sorghum bicolor [broomcorn]
ref|XP_004953678.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    346   7e-112   Setaria italica
gb|EEC80509.1|  hypothetical protein OsI_22776                          346   8e-112   Oryza sativa Indica Group [Indian rice]
ref|XP_006648988.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    344   7e-111   Oryza brachyantha
dbj|BAD33246.1|  putative Pyrophosphate--fructose 6-phosphate 1-p...    344   8e-111   Oryza sativa Japonica Group [Japonica rice]
gb|ACN26363.1|  unknown                                                 343   2e-110   Zea mays [maize]
gb|AFW73096.1|  pyrophosphate--fructose 6-phosphate 1-phosphotran...    343   2e-110   
ref|NP_001146841.1|  LOC100280449                                       341   1e-109   Zea mays [maize]
ref|NP_001131947.1|  uncharacterized protein LOC100193340               341   1e-109   Zea mays [maize]
ref|XP_004965353.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    340   1e-109   Setaria italica
ref|XP_003589697.1|  Pyrophosphate-fructose 6-phosphate 1-phospho...    335   1e-107   
gb|AES59948.2|  pyrophosphate-fructose-6-phosphate 1-phosphotrans...    333   5e-107   Medicago truncatula
dbj|BAK04583.1|  predicted protein                                      333   2e-106   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003563894.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    328   7e-105   
gb|AEZ53899.1|  pyrophosphate-dependent fructose-6-phosphate 1-ph...    326   2e-104   Zea mays [maize]
ref|XP_008659507.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    325   1e-103   
ref|XP_004956505.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    315   1e-99    Setaria italica
ref|XP_006660512.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    301   3e-94    Oryza brachyantha
gb|EEC84297.1|  hypothetical protein OsI_30782                          299   8e-94    Oryza sativa Indica Group [Indian rice]
gb|EEE69397.1|  hypothetical protein OsJ_28754                          298   1e-93    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009385723.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    299   2e-93    Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAD33224.1|  putative pyrophosphate-dependent phosphofructoki...    298   4e-93    Oryza sativa Japonica Group [Japonica rice]
tpg|DAA49241.1|  TPA: hypothetical protein ZEAMMB73_624432              291   4e-92    
gb|AGY61464.1|  pyrophosphate-fructose-6-phosphate-phosphotransfe...    280   1e-91    Rorippa sylvestris
gb|AGY61463.1|  pyrophosphate-fructose-6-phosphate-phosphotransfe...    279   2e-91    Rorippa amphibia
gb|AGN30570.1|  pyrophosphate-fructose-6-phosphate-phosphotransfe...    293   4e-91    Oryza sativa Japonica Group [Japonica rice]
gb|ACL53065.1|  unknown                                                 291   1e-90    Zea mays [maize]
ref|XP_003573791.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    291   2e-90    Brachypodium distachyon [annual false brome]
ref|NP_001061602.1|  Os08g0345700                                       291   2e-90    
ref|NP_001130747.1|  uncharacterized protein LOC100191851               291   2e-90    Zea mays [maize]
ref|XP_004973257.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    290   5e-90    Setaria italica
dbj|BAJ94879.1|  predicted protein                                      285   6e-88    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002459996.1|  hypothetical protein SORBIDRAFT_02g020400          285   7e-88    Sorghum bicolor [broomcorn]
gb|AGY61461.1|  pyrophosphate-fructose-6-phosphate-phosphotransfe...    259   3e-82    Rorippa amphibia
ref|XP_008652527.1|  PREDICTED: LOW QUALITY PROTEIN: pyrophosphat...    263   2e-79    Zea mays [maize]
ref|XP_006837413.1|  hypothetical protein AMTR_s00111p00148440          259   1e-78    
dbj|BAJ85819.1|  predicted protein                                      257   2e-77    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_001773752.1|  predicted protein                                  252   2e-75    
ref|XP_006660071.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    247   2e-73    
gb|EMS49340.1|  Pyrophosphate--fructose 6-phosphate 1-phosphotran...    249   3e-73    Triticum urartu
ref|XP_001755711.1|  predicted protein                                  234   1e-68    
ref|XP_002978426.1|  hypothetical protein SELMODRAFT_108705             232   4e-68    
ref|XP_002970269.1|  hypothetical protein SELMODRAFT_171380             232   5e-68    
gb|AFW86518.1|  hypothetical protein ZEAMMB73_272382                    217   4e-65    
ref|XP_002444175.1|  hypothetical protein SORBIDRAFT_07g012720          223   6e-65    
ref|XP_009386806.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    211   2e-64    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010275338.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    217   8e-63    Nelumbo nucifera [Indian lotus]
gb|AAO72618.1|  fructose-6-phosphate 1-phosphotransferase               214   2e-62    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010935015.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    215   3e-62    Elaeis guineensis
ref|XP_010935016.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    214   4e-62    
gb|ABC69165.1|  phosphofructokinase V11                                 194   6e-57    Gossypium hirsutum [American cotton]
gb|ABR16683.1|  unknown                                                 190   2e-52    Picea sitchensis
gb|AIN94596.1|  diphosphate--fructose-6-phosphate 1-phosphotransf...    166   6e-44    Treponema putidum
ref|WP_010697336.1|  diphosphate-fructose-6-phosphate 1-phosphotr...    166   1e-43    Treponema denticola
ref|WP_010956991.1|  diphosphate--fructose-6-phosphate 1-phosphot...    165   1e-43    Treponema denticola
ref|WP_010699412.1|  diphosphate-fructose-6-phosphate 1-phosphotr...    165   1e-43    Treponema denticola
ref|WP_002693855.1|  diphosphate-fructose-6-phosphate 1-phosphotr...    165   1e-43    Treponema denticola
ref|WP_002689303.1|  diphosphate-fructose-6-phosphate 1-phosphotr...    165   1e-43    Treponema denticola
ref|WP_002669081.1|  diphosphate--fructose-6-phosphate 1-phosphot...    165   1e-43    Treponema denticola
ref|WP_002682935.1|  diphosphate-fructose-6-phosphate 1-phosphotr...    165   1e-43    Treponema denticola
gb|EMT11806.1|  Pyrophosphate--fructose 6-phosphate 1-phosphotran...    165   2e-43    
ref|WP_002678239.1|  diphosphate-fructose-6-phosphate 1-phosphotr...    165   2e-43    Treponema denticola
gb|EMT11805.1|  Pyrophosphate--fructose 6-phosphate 1-phosphotran...    154   1e-42    
ref|WP_037547210.1|  diphosphate--fructose-6-phosphate 1-phosphot...    160   9e-42    Spirochaeta lutea
ref|XP_004956506.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    160   9e-42    
ref|WP_006255527.1|  diphosphate--fructose-6-phosphate 1-phosphot...    160   1e-41    Alloprevotella tannerae
ref|WP_014455241.1|  diphosphate--fructose-6-phosphate 1-phosphot...    159   1e-41    Spirochaeta africana
ref|WP_037997392.1|  diphosphate--fructose-6-phosphate 1-phosphot...    159   3e-41    
ref|WP_037983302.1|  diphosphate--fructose-6-phosphate 1-phosphot...    159   3e-41    
emb|CBK21183.2|  unnamed protein product                                158   7e-41    Blastocystis hominis
ref|WP_006952714.1|  diphosphate--fructose-6-phosphate 1-phosphot...    156   2e-40    Prevotella micans
ref|WP_021909549.1|  diphosphate--fructose-6-phosphate 1-phosphot...    153   2e-40    
tpg|DAA60935.1|  TPA: hypothetical protein ZEAMMB73_638083              155   2e-40    
ref|WP_005846138.1|  MULTISPECIES: diphosphate--fructose-6-phosph...    156   3e-40    Bacteroides
ref|WP_022511727.1|  diphosphate--fructose-6-phosphate 1-phosphot...    155   3e-40    
ref|WP_025017895.1|  diphosphate--fructose-6-phosphate 1-phosphot...    155   4e-40    Bacteroides sartorii
ref|WP_008652858.1|  MULTISPECIES: diphosphate--fructose-6-phosph...    155   4e-40    Bacteroides
ref|WP_009346441.1|  diphosphate--fructose-6-phosphate 1-phosphot...    155   4e-40    Alloprevotella rava
ref|WP_025002795.1|  diphosphate--fructose-6-phosphate 1-phosphot...    155   5e-40    Prevotella dentasini
ref|WP_009161991.1|  diphosphate--fructose-6-phosphate 1-phosphot...    155   6e-40    Prevotella saccharolytica
gb|ADQ78315.1|  pyrophosphate-dependent phosphofructokinase             155   6e-40    Paludibacter propionicigenes WB4
ref|WP_013758252.1|  diphosphate--fructose-6-phosphate 1-phosphot...    155   6e-40    Treponema brennaborense
ref|WP_041620527.1|  diphosphate--fructose-6-phosphate 1-phosphot...    155   6e-40    Paludibacter propionicigenes
ref|WP_025798196.1|  diphosphate--fructose-6-phosphate 1-phosphot...    155   6e-40    Prevotella saccharolytica
ref|WP_021980053.1|  diphosphate--fructose-6-phosphate 1-phosphot...    155   7e-40    
ref|WP_007842406.1|  MULTISPECIES: diphosphate--fructose-6-phosph...    154   8e-40    Bacteroides
ref|WP_021687206.1|  diphosphate--fructose-6-phosphate 1-phosphot...    154   9e-40    Treponema lecithinolyticum
ref|WP_038605987.1|  diphosphate--fructose-6-phosphate 1-phosphot...    154   9e-40    
ref|WP_007837134.1|  diphosphate--fructose-6-phosphate 1-phosphot...    154   1e-39    Bacteroides
ref|WP_016276863.1|  MULTISPECIES: diphosphate-fructose-6-phospha...    154   1e-39    Bacteroides sartorii
ref|WP_005936237.1|  MULTISPECIES: diphosphate-fructose-6-phospha...    154   1e-39    Bacteroides
ref|XP_011041142.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    154   1e-39    Populus euphratica
ref|WP_024268710.1|  Pyrophosphate--fructose 6-phosphate 1-phosph...    154   1e-39    Salinispira pacifica
ref|WP_019188428.1|  diphosphate--fructose-6-phosphate 1-phosphot...    154   1e-39    Prevotella conceptionensis
ref|WP_005923725.1|  MULTISPECIES: diphosphate--fructose-6-phosph...    154   1e-39    Bacteroides salyersiae
ref|WP_042372185.1|  diphosphate--fructose-6-phosphate 1-phosphot...    154   1e-39    Bacteroides neonati
ref|WP_013968126.1|  diphosphate--fructose-6-phosphate 1-phosphot...    154   2e-39    Treponema caldarium
ref|WP_018669292.1|  diphosphate--fructose-6-phosphate 1-phosphot...    154   2e-39    Bacteroides gallinarum
ref|WP_032125634.1|  diphosphate--fructose-6-phosphate 1-phosphot...    154   2e-39    Candidatus Protochlamydia massiliensis
ref|XP_002984967.1|  hypothetical protein SELMODRAFT_234662             154   2e-39    Selaginella moellendorffii
ref|WP_008627564.1|  diphosphate--fructose-6-phosphate 1-phosphot...    153   2e-39    Paraprevotella xylaniphila
ref|WP_022252312.1|  diphosphate--fructose-6-phosphate 1-phosphot...    153   2e-39    
ref|WP_006189908.1|  diphosphate--fructose-6-phosphate 1-phosphot...    153   2e-39    Treponema vincentii
ref|WP_022406493.1|  diphosphate-fructose-6-phosphate 1-phosphotr...    153   3e-39    
ref|WP_008622743.1|  diphosphate--fructose-6-phosphate 1-phosphot...    153   3e-39    Paraprevotella clara
ref|WP_010527175.1|  diphosphate--fructose-6-phosphate 1-phosphot...    153   3e-39    Thermophagus xiamenensis
ref|WP_009229809.1|  diphosphate--fructose-6-phosphate 1-phosphot...    153   3e-39    Prevotella sp. oral taxon 317
ref|WP_026625143.1|  diphosphate--fructose-6-phosphate 1-phosphot...    153   4e-39    Dysgonomonas capnocytophagoides
ref|WP_025877362.1|  diphosphate--fructose-6-phosphate 1-phosphot...    153   4e-39    Prevotella corporis
ref|WP_009437358.1|  diphosphate--fructose-6-phosphate 1-phosphot...    152   4e-39    Prevotella sp. oral taxon 473
ref|WP_029901822.1|  diphosphate--fructose-6-phosphate 1-phosphot...    152   4e-39    Prevotella sp. 10(H)
gb|EFB41793.1|  hypothetical protein pah_c022o077                       152   5e-39    Parachlamydia acanthamoebae str. Hall's coccus
ref|WP_016518245.1|  diphosphate-fructose-6-phosphate 1-phosphotr...    152   5e-39    Treponema vincentii
ref|WP_007658653.1|  MULTISPECIES: diphosphate--fructose-6-phosph...    152   5e-39    Parabacteroides
ref|WP_022385737.1|  diphosphate--fructose-6-phosphate 1-phosphot...    152   7e-39    
ref|WP_027470899.1|  diphosphate--fructose-6-phosphate 1-phosphot...    152   7e-39    Saccharicrinis fermentans
ref|WP_022102965.1|  diphosphate--fructose-6-phosphate 1-phosphot...    152   7e-39    
ref|WP_036877364.1|  diphosphate--fructose-6-phosphate 1-phosphot...    152   8e-39    Prevotella oryzae
ref|XP_002986153.1|  hypothetical protein SELMODRAFT_234963             152   8e-39    Selaginella moellendorffii
ref|WP_006798230.1|  diphosphate--fructose-6-phosphate 1-phosphot...    152   8e-39    Dysgonomonas gadei
ref|WP_008158638.1|  diphosphate--fructose-6-phosphate 1-phosphot...    152   8e-39    Parabacteroides johnsonii
ref|WP_039420029.1|  MULTISPECIES: diphosphate--fructose-6-phosph...    152   9e-39    Porphyromonas
ref|WP_039419596.1|  diphosphate--fructose-6-phosphate 1-phosphot...    152   9e-39    Porphyromonas gulae
ref|WP_009235627.1|  diphosphate--fructose-6-phosphate 1-phosphot...    152   9e-39    Prevotella sp. oral taxon 472
ref|WP_032945214.1|  diphosphate--fructose-6-phosphate 1-phosphot...    152   9e-39    Bacteroides vulgatus
ref|WP_025278280.1|  diphosphate--fructose-6-phosphate 1-phosphot...    151   1e-38    Barnesiella viscericola
ref|WP_008861193.1|  diphosphate--fructose-6-phosphate 1-phosphot...    151   1e-38    Barnesiella intestinihominis
ref|WP_028727537.1|  diphosphate--fructose-6-phosphate 1-phosphot...    151   1e-38    Parabacteroides
ref|WP_021892263.1|  diphosphate-fructose-6-phosphate 1-phosphotr...    151   1e-38    Bacteroides sp. AF14-46
ref|WP_036897542.1|  diphosphate--fructose-6-phosphate 1-phosphot...    151   1e-38    Prevotella sp. S7 MS 2
gb|EDS15317.1|  diphosphate--fructose-6-phosphate 1-phosphotransf...    152   1e-38    Bacteroides stercoris ATCC 43183
ref|WP_022130193.1|  hypothetical protein                               151   1e-38    
ref|WP_039426896.1|  diphosphate--fructose-6-phosphate 1-phosphot...    151   1e-38    Porphyromonas gulae
ref|WP_009317720.1|  MULTISPECIES: diphosphate--fructose-6-phosph...    151   1e-38    Bacteroidales
ref|WP_013924907.1|  diphosphate--fructose-6-phosphate 1-phosphot...    151   1e-38    Parachlamydia acanthamoebae
ref|WP_036613717.1|  diphosphate--fructose-6-phosphate 1-phosphot...    151   1e-38    Parabacteroides distasonis
ref|WP_026292223.1|  diphosphate--fructose-6-phosphate 1-phosphot...    151   1e-38    Porphyromonas gulae
ref|WP_036650726.1|  diphosphate--fructose-6-phosphate 1-phosphot...    151   1e-38    Parabacteroides
ref|WP_025881004.1|  diphosphate--fructose-6-phosphate 1-phosphot...    151   1e-38    Prevotella baroniae
ref|WP_018966518.1|  diphosphate--fructose-6-phosphate 1-phosphot...    151   1e-38    Prevotella loescheii
ref|WP_008771783.1|  diphosphate--fructose-6-phosphate 1-phosphot...    151   1e-38    Bacteroidales
ref|WP_005640886.1|  diphosphate--fructose-6-phosphate 1-phosphot...    151   1e-38    Parabacteroides merdae
ref|WP_025065627.1|  diphosphate--fructose-6-phosphate 1-phosphot...    151   2e-38    Prevotella enoeca
ref|WP_007902847.1|  MULTISPECIES: diphosphate--fructose-6-phosph...    151   2e-38    Prevotella stercorea
ref|WP_028904978.1|  diphosphate--fructose-6-phosphate 1-phosphot...    151   2e-38    Prevotella intermedia
ref|WP_005647732.1|  diphosphate--fructose-6-phosphate 1-phosphot...    151   2e-38    Parabacteroides merdae
ref|WP_022322946.1|  diphosphate--fructose-6-phosphate 1-phosphot...    151   2e-38    Parabacteroides merdae
ref|WP_014709913.1|  diphosphate--fructose-6-phosphate 1-phosphot...    151   2e-38    Prevotella intermedia
ref|WP_039384525.1|  diphosphate--fructose-6-phosphate 1-phosphot...    151   2e-38    Neochlamydia sp. TUME1
ref|WP_021589756.1|  diphosphate--fructose-6-phosphate 1-phosphot...    150   2e-38    Prevotella baroniae
ref|WP_006843040.1|  diphosphate--fructose-6-phosphate 1-phosphot...    150   2e-38    Dysgonomonas mossii
ref|WP_002561703.1|  MULTISPECIES: diphosphate--fructose-6-phosph...    150   2e-38    Bacteroides
ref|WP_008145850.1|  MULTISPECIES: diphosphate--fructose-6-phosph...    150   2e-38    Parabacteroides johnsonii
ref|WP_010422435.1|  diphosphate--fructose-6-phosphate 1-phosphot...    150   2e-38    Anaerophaga thermohalophila
ref|WP_042244225.1|  diphosphate--fructose-6-phosphate 1-phosphot...    150   2e-38    Neochlamydia sp. S13
ref|WP_015711192.1|  diphosphate--fructose-6-phosphate 1-phosphot...    150   2e-38    Treponema azotonutricium
ref|WP_016525088.1|  diphosphate-fructose-6-phosphate 1-phosphotr...    150   2e-38    Treponema maltophilum
ref|WP_039876710.1|  diphosphate--fructose-6-phosphate 1-phosphot...    150   2e-38    Prevotella pleuritidis
ref|WP_024991268.1|  diphosphate--fructose-6-phosphate 1-phosphot...    150   2e-38    Prevotella pleuritidis
ref|WP_025071710.1|  diphosphate--fructose-6-phosphate 1-phosphot...    150   3e-38    Prevotella timonensis
ref|WP_008121761.1|  diphosphate--fructose-6-phosphate 1-phosphot...    150   3e-38    Prevotella timonensis
ref|WP_022158214.1|  diphosphate--fructose-6-phosphate 1-phosphot...    150   3e-38    
ref|WP_032590268.1|  diphosphate--fructose-6-phosphate 1-phosphot...    150   3e-38    Bacteroides fragilis
ref|WP_036790212.1|  MULTISPECIES: diphosphate--fructose-6-phosph...    150   3e-38    Porphyromonas
ref|WP_005788903.1|  MULTISPECIES: diphosphate--fructose-6-phosph...    150   3e-38    Bacteroides
ref|WP_016661325.1|  diphosphate-fructose-6-phosphate 1-phosphotr...    150   3e-38    Bacteroides stercoris
ref|WP_005815165.1|  diphosphate--fructose-6-phosphate 1-phosphot...    150   3e-38    Bacteroides fragilis
ref|WP_021940332.1|  hypothetical protein                               149   3e-38    
ref|WP_022103660.1|  MULTISPECIES: diphosphate--fructose-6-phosph...    150   3e-38    Bacteroides stercoris
ref|WP_032583802.1|  diphosphate--fructose-6-phosphate 1-phosphot...    150   3e-38    Bacteroides fragilis
gb|KIC73621.1|  Pyrophosphate--fructose 6-phosphate 1-phosphotran...    150   4e-38    
gb|ERK00034.1|  diphosphate--fructose-6-phosphate 1-phosphotransf...    150   4e-38    
ref|WP_005855923.1|  MULTISPECIES: diphosphate--fructose-6-phosph...    149   6e-38    
ref|WP_028909804.1|  diphosphate--fructose-6-phosphate 1-phosphot...    149   6e-38    
ref|WP_004365932.1|  diphosphate--fructose-6-phosphate 1-phosphot...    149   7e-38    
ref|WP_036869019.1|  diphosphate--fructose-6-phosphate 1-phosphot...    149   7e-38    
ref|WP_004290431.1|  diphosphate--fructose-6-phosphate 1-phosphot...    149   7e-38    
ref|WP_005780146.1|  MULTISPECIES: diphosphate--fructose-6-phosph...    149   7e-38    
gb|EKE04636.1|  hypothetical protein ACD_20C00035G0001                  149   7e-38    
ref|WP_004292707.1|  diphosphate--fructose-6-phosphate 1-phosphot...    149   7e-38    
ref|WP_028896044.1|  diphosphate--fructose-6-phosphate 1-phosphot...    149   9e-38    
gb|KJF43929.1|  diphosphate--fructose-6-phosphate 1-phosphotransf...    149   1e-37    
gb|EGV34403.1|  diphosphate-fructose-6-phosphate 1-phosphotransfe...    149   1e-37    
ref|WP_038563379.1|  diphosphate--fructose-6-phosphate 1-phosphot...    149   1e-37    
ref|WP_010663795.1|  diphosphate--fructose-6-phosphate 1-phosphot...    149   1e-37    
ref|WP_013945180.1|  diphosphate--fructose-6-phosphate 1-phosphot...    149   1e-37    
ref|WP_040561026.1|  diphosphate--fructose-6-phosphate 1-phosphot...    149   1e-37    
ref|WP_025070337.1|  diphosphate--fructose-6-phosphate 1-phosphot...    149   1e-37    
ref|WP_021931216.1|  diphosphate-fructose-6-phosphate 1-phosphotr...    149   1e-37    
ref|WP_024467519.1|  diphosphate--fructose-6-phosphate 1-phosphot...    149   1e-37    
ref|WP_006947947.1|  diphosphate--fructose-6-phosphate 1-phosphot...    148   1e-37    
ref|WP_009120576.1|  diphosphate--fructose-6-phosphate 1-phosphot...    148   1e-37    
ref|WP_036865072.1|  diphosphate--fructose-6-phosphate 1-phosphot...    148   1e-37    
ref|WP_009036817.1|  diphosphate-fructose-6-phosphate 1-phosphotr...    145   1e-37    
ref|WP_016777789.1|  diphosphate--fructose-6-phosphate 1-phosphot...    148   1e-37    
ref|WP_005798671.1|  diphosphate--fructose-6-phosphate 1-phosphot...    148   2e-37    
ref|WP_025839858.1|  diphosphate--fructose-6-phosphate 1-phosphot...    148   2e-37    
ref|WP_027449768.1|  diphosphate--fructose-6-phosphate 1-phosphot...    148   2e-37    
ref|WP_027456161.1|  diphosphate--fructose-6-phosphate 1-phosphot...    148   2e-37    
ref|WP_020966487.1|  diphosphate--fructose-6-phosphate 1-phosphot...    148   2e-37    
ref|WP_036927708.1|  diphosphate--fructose-6-phosphate 1-phosphot...    148   2e-37    
ref|WP_016524203.1|  diphosphate-fructose-6-phosphate 1-phosphotr...    148   2e-37    
ref|WP_022353894.1|  hypothetical protein                               148   2e-37    
ref|WP_010881989.1|  diphosphate--fructose-6-phosphate 1-phosphot...    148   2e-37    
ref|WP_022231625.1|  diphosphate--fructose-6-phosphate 1-phosphot...    148   2e-37    
ref|WP_014342471.1|  diphosphate--fructose-6-phosphate 1-phosphot...    148   2e-37    
ref|WP_044227866.1|  diphosphate--fructose-6-phosphate 1-phosphot...    148   2e-37    
ref|WP_006846630.1|  diphosphate--fructose-6-phosphate 1-phosphot...    148   2e-37    
ref|WP_021854968.1|  phosphofructokinase                                148   2e-37    
ref|WP_036864816.1|  diphosphate--fructose-6-phosphate 1-phosphot...    147   2e-37    
ref|XP_001770321.1|  predicted protein                                  147   3e-37    
ref|WP_036856523.1|  diphosphate--fructose-6-phosphate 1-phosphot...    147   3e-37    
ref|WP_019036414.1|  diphosphate--fructose-6-phosphate 1-phosphot...    147   3e-37    
tpg|DAA44428.1|  TPA: hypothetical protein ZEAMMB73_728226              144   3e-37    
ref|WP_008448175.1|  diphosphate--fructose-6-phosphate 1-phosphot...    147   3e-37    
ref|WP_022480045.1|  diphosphate--fructose-6-phosphate 1-phosphot...    147   3e-37    
ref|WP_004362686.1|  diphosphate-fructose-6-phosphate 1-phosphotr...    147   3e-37    
ref|WP_022217804.1|  diphosphate--fructose-6-phosphate 1-phosphot...    147   3e-37    
ref|WP_036872035.1|  diphosphate--fructose-6-phosphate 1-phosphot...    147   4e-37    
ref|WP_036829398.1|  diphosphate--fructose-6-phosphate 1-phosphot...    147   4e-37    
ref|WP_025001065.1|  diphosphate--fructose-6-phosphate 1-phosphot...    147   4e-37    
ref|WP_004359492.1|  diphosphate--fructose-6-phosphate 1-phosphot...    147   4e-37    
ref|WP_022121202.1|  diphosphate--fructose-6-phosphate 1-phosphot...    147   5e-37    
ref|WP_023924546.1|  diphosphate-fructose-6-phosphate 1-phosphotr...    147   5e-37    
ref|WP_022150455.1|  phosphofructokinase                                147   5e-37    
ref|WP_021671600.1|  diphosphate--fructose-6-phosphate 1-phosphot...    147   5e-37    
ref|WP_018109477.1|  diphosphate--fructose-6-phosphate 1-phosphot...    147   5e-37    
ref|WP_004337289.1|  diphosphate--fructose-6-phosphate 1-phosphot...    147   5e-37    
ref|WP_036866222.1|  diphosphate--fructose-6-phosphate 1-phosphot...    147   5e-37    
ref|WP_010261490.1|  diphosphate--fructose-6-phosphate 1-phosphot...    147   6e-37    
ref|WP_014625405.1|  diphosphate--fructose-6-phosphate 1-phosphot...    147   6e-37    
ref|WP_036925131.1|  diphosphate--fructose-6-phosphate 1-phosphot...    146   6e-37    
ref|WP_025267586.1|  diphosphate--fructose-6-phosphate 1-phosphot...    147   6e-37    
ref|WP_013314522.1|  diphosphate--fructose-6-phosphate 1-phosphot...    147   6e-37    
ref|WP_024752338.1|  diphosphate--fructose-6-phosphate 1-phosphot...    146   6e-37    
gb|EXZ67313.1|  diphosphate--fructose-6-phosphate 1-phosphotransf...    146   6e-37    
dbj|BAG83826.1|  pyrophosphate--fructose-6-phosphate 1-phosphotra...    146   6e-37    
ref|WP_018464632.1|  diphosphate--fructose-6-phosphate 1-phosphot...    146   6e-37    
ref|WP_021662033.1|  diphosphate--fructose-6-phosphate 1-phosphot...    146   6e-37    
ref|WP_024989602.1|  diphosphate--fructose-6-phosphate 1-phosphot...    146   6e-37    
ref|WP_013265533.1|  diphosphate--fructose-6-phosphate 1-phosphot...    146   6e-37    
ref|WP_002701079.1|  diphosphate--fructose-6-phosphate 1-phosphot...    146   6e-37    
ref|WP_004350381.1|  diphosphate--fructose-6-phosphate 1-phosphot...    146   7e-37    
ref|WP_041572541.1|  diphosphate--fructose-6-phosphate 1-phosphot...    146   7e-37    
ref|WP_018525631.1|  hypothetical protein                               146   7e-37    
ref|WP_036854388.1|  diphosphate--fructose-6-phosphate 1-phosphot...    146   8e-37    
ref|WP_025067563.1|  diphosphate--fructose-6-phosphate 1-phosphot...    146   8e-37    
ref|WP_004353492.1|  diphosphate--fructose-6-phosphate 1-phosphot...    146   8e-37    
ref|WP_023058711.1|  MULTISPECIES: diphosphate--fructose-6-phosph...    146   8e-37    
ref|WP_023847292.1|  diphosphate--fructose-6-phosphate 1-phosphot...    146   8e-37    
ref|WP_024996790.1|  diphosphate--fructose-6-phosphate 1-phosphot...    146   8e-37    
ref|WP_044533074.1|  diphosphate--fructose-6-phosphate 1-phosphot...    145   9e-37    
ref|WP_044233209.1|  diphosphate--fructose-6-phosphate 1-phosphot...    146   9e-37    
ref|WP_022302275.1|  phosphofructokinase                                145   9e-37    
ref|WP_012457385.1|  diphosphate--fructose-6-phosphate 1-phosphot...    146   1e-36    
ref|WP_025863645.1|  diphosphate--fructose-6-phosphate 1-phosphot...    146   1e-36    
ref|WP_022053735.1|  hypothetical protein                               145   1e-36    
ref|WP_007561750.1|  diphosphate--fructose-6-phosphate 1-phosphot...    145   1e-36    
ref|WP_004376175.1|  diphosphate--fructose-6-phosphate 1-phosphot...    145   1e-36    
ref|WP_007214428.1|  MULTISPECIES: diphosphate--fructose-6-phosph...    145   1e-36    
ref|WP_044190829.1|  diphosphate--fructose-6-phosphate 1-phosphot...    145   1e-36    
ref|WP_026285932.1|  diphosphate--fructose-6-phosphate 1-phosphot...    145   1e-36    
ref|WP_028899167.1|  diphosphate--fructose-6-phosphate 1-phosphot...    145   1e-36    
ref|WP_044264258.1|  diphosphate--fructose-6-phosphate 1-phosphot...    145   2e-36    
ref|WP_009010591.1|  diphosphate--fructose-6-phosphate 1-phosphot...    145   2e-36    
ref|WP_036890490.1|  diphosphate--fructose-6-phosphate 1-phosphot...    145   2e-36    
gb|EFB33295.1|  diphosphate--fructose-6-phosphate 1-phosphotransf...    145   2e-36    
ref|WP_013815410.1|  diphosphate--fructose-6-phosphate 1-phosphot...    145   2e-36    
ref|WP_004370527.1|  diphosphate--fructose-6-phosphate 1-phosphot...    145   2e-36    
ref|WP_007133749.1|  diphosphate--fructose-6-phosphate 1-phosphot...    145   2e-36    
ref|WP_004583807.1|  diphosphate--fructose-6-phosphate 1-phosphot...    145   2e-36    
ref|WP_023983193.1|  diphosphate-fructose-6-phosphate 1-phosphotr...    145   2e-36    
ref|WP_021663363.1|  diphosphate--fructose-6-phosphate 1-phosphot...    145   2e-36    
ref|WP_007570582.1|  MULTISPECIES: diphosphate--fructose-6-phosph...    145   2e-36    
ref|WP_028912949.1|  diphosphate--fructose-6-phosphate 1-phosphot...    145   2e-36    
ref|WP_036881935.1|  diphosphate--fructose-6-phosphate 1-phosphot...    145   2e-36    
ref|WP_021677112.1|  diphosphate--fructose-6-phosphate 1-phosphot...    145   2e-36    
ref|XP_001774878.1|  predicted protein                                  145   2e-36    
ref|WP_044468201.1|  diphosphate--fructose-6-phosphate 1-phosphot...    145   2e-36    
ref|WP_004357175.1|  diphosphate--fructose-6-phosphate 1-phosphot...    145   2e-36    
ref|WP_007663913.1|  diphosphate--fructose-6-phosphate 1-phosphot...    145   2e-36    
ref|WP_021670104.1|  diphosphate--fructose-6-phosphate 1-phosphot...    145   2e-36    
ref|WP_022392567.1|  diphosphate-fructose-6-phosphate 1-phosphotr...    145   2e-36    
ref|WP_021966993.1|  diphosphate--fructose-6-phosphate 1-phosphot...    145   2e-36    
ref|WP_013617020.1|  diphosphate--fructose-6-phosphate 1-phosphot...    145   2e-36    
ref|WP_022328315.1|  diphosphate--fructose-6-phosphate 1-phosphot...    145   3e-36    
ref|WP_036869025.1|  diphosphate--fructose-6-phosphate 1-phosphot...    145   3e-36    
ref|WP_022081702.1|  diphosphate-fructose-6-phosphate 1-phosphotr...    145   3e-36    
ref|WP_009131195.1|  diphosphate-fructose-6-phosphate 1-phosphotr...    144   3e-36    
ref|WP_010537577.1|  diphosphate--fructose-6-phosphate 1-phosphot...    144   3e-36    
ref|WP_008822440.1|  diphosphate--fructose-6-phosphate 1-phosphot...    144   3e-36    
ref|WP_025831498.1|  diphosphate--fructose-6-phosphate 1-phosphot...    144   3e-36    
ref|WP_022340120.1|  MULTISPECIES: hypothetical protein                 144   3e-36    
ref|WP_008144348.1|  MULTISPECIES: diphosphate--fructose-6-phosph...    144   3e-36    
ref|WP_013672124.1|  diphosphate--fructose-6-phosphate 1-phosphot...    144   4e-36    
ref|WP_005826644.1|  MULTISPECIES: diphosphate--fructose-6-phosph...    144   4e-36    
ref|WP_022111322.1|  diphosphate--fructose-6-phosphate 1-phosphot...    144   4e-36    
ref|WP_025790489.1|  diphosphate--fructose-6-phosphate 1-phosphot...    144   4e-36    
ref|WP_006044710.1|  diphosphate--fructose-6-phosphate 1-phosphot...    144   4e-36    
ref|WP_009123978.1|  diphosphate--fructose-6-phosphate 1-phosphot...    144   5e-36    
ref|WP_007758927.1|  diphosphate--fructose-6-phosphate 1-phosphot...    144   5e-36    
ref|WP_028908471.1|  diphosphate--fructose-6-phosphate 1-phosphot...    144   5e-36    
ref|WP_033149315.1|  diphosphate--fructose-6-phosphate 1-phosphot...    144   5e-36    
ref|WP_025081450.1|  diphosphate--fructose-6-phosphate 1-phosphot...    144   5e-36    
ref|WP_013064630.1|  diphosphate--fructose-6-phosphate 1-phosphot...    144   5e-36    
ref|WP_009227259.1|  diphosphate--fructose-6-phosphate 1-phosphot...    144   5e-36    
ref|WP_021964522.1|  phosphofructokinase                                144   6e-36    
ref|WP_036787718.1|  diphosphate--fructose-6-phosphate 1-phosphot...    144   6e-36    
ref|WP_014223699.1|  diphosphate--fructose-6-phosphate 1-phosphot...    144   6e-36    
ref|XP_007153992.1|  hypothetical protein PHAVU_003G082000g             144   7e-36    
ref|WP_007366298.1|  diphosphate--fructose-6-phosphate 1-phosphot...    144   7e-36    
gb|EPT34726.1|  diphosphate--fructose-6-phosphate 1-phosphotransf...    144   7e-36    
ref|WP_035455514.1|  diphosphate--fructose-6-phosphate 1-phosphot...    143   7e-36    
ref|WP_008564004.1|  diphosphate--fructose-6-phosphate 1-phosphot...    143   8e-36    
emb|CDZ81362.1|  6-phosphofructokinase                                  143   8e-36    
ref|WP_022275035.1|  diphosphate--fructose-6-phosphate 1-phosphot...    143   8e-36    
ref|WP_023937210.1|  pyrophosphate-fructose 6-phosphate 1-phospho...    143   8e-36    
ref|WP_028903737.1|  MULTISPECIES: diphosphate--fructose-6-phosph...    143   9e-36    
ref|WP_044168564.1|  diphosphate--fructose-6-phosphate 1-phosphot...    143   9e-36    
ref|WP_005467407.1|  diphosphate--fructose-6-phosphate 1-phosphot...    143   9e-36    
ref|WP_019967261.1|  diphosphate--fructose-6-phosphate 1-phosphot...    143   1e-35    
ref|WP_018361565.1|  diphosphate--fructose-6-phosphate 1-phosphot...    143   1e-35    
ref|WP_009433397.1|  diphosphate--fructose-6-phosphate 1-phosphot...    143   1e-35    
ref|WP_028973346.1|  diphosphate--fructose-6-phosphate 1-phosphot...    143   1e-35    
ref|WP_024994586.1|  diphosphate--fructose-6-phosphate 1-phosphot...    143   1e-35    
ref|WP_022163440.1|  diphosphate-fructose-6-phosphate 1-phosphotr...    143   1e-35    
ref|XP_003594152.1|  Pyrophosphate-fructose 6-phosphate 1-phospho...    143   1e-35    
ref|WP_007757428.1|  diphosphate--fructose-6-phosphate 1-phosphot...    142   1e-35    
ref|WP_036881252.1|  diphosphate--fructose-6-phosphate 1-phosphot...    142   1e-35    
ref|XP_007147679.1|  hypothetical protein PHAVU_006G145300g             143   1e-35    
ref|WP_026475518.1|  diphosphate--fructose-6-phosphate 1-phosphot...    142   1e-35    
ref|WP_004340656.1|  diphosphate--fructose-6-phosphate 1-phosphot...    142   2e-35    
ref|WP_009434216.1|  diphosphate--fructose-6-phosphate 1-phosphot...    142   2e-35    
ref|XP_005536036.1|  pyrophosphate--fructose-6-phosphate 1-phosph...    142   2e-35    
ref|WP_004345857.1|  diphosphate--fructose-6-phosphate 1-phosphot...    142   2e-35    
ref|WP_007172919.1|  diphosphate--fructose-6-phosphate 1-phosphot...    142   2e-35    
ref|WP_007412056.1|  diphosphate--fructose-6-phosphate 1-phosphot...    142   2e-35    
ref|WP_018028382.1|  diphosphate--fructose-6-phosphate 1-phosphot...    142   2e-35    
ref|WP_004383638.1|  diphosphate--fructose-6-phosphate 1-phosphot...    142   2e-35    
ref|WP_018909818.1|  diphosphate--fructose-6-phosphate 1-phosphot...    142   2e-35    
ref|WP_018358521.1|  diphosphate--fructose-6-phosphate 1-phosphot...    142   2e-35    
ref|WP_021846571.1|  diphosphate-fructose-6-phosphate 1-phosphotr...    142   2e-35    
ref|WP_024986627.1|  diphosphate--fructose-6-phosphate 1-phosphot...    142   3e-35    
ref|WP_022020075.1|  diphosphate-fructose-6-phosphate 1-phosphotr...    142   3e-35    
gb|KHN40852.1|  Pyrophosphate--fructose 6-phosphate 1-phosphotran...    141   3e-35    
ref|WP_036911117.1|  diphosphate--fructose-6-phosphate 1-phosphot...    141   3e-35    
ref|WP_042282134.1|  diphosphate--fructose-6-phosphate 1-phosphot...    141   3e-35    
ref|XP_005707151.1|  pyrophosphate--fructose-6-phosphate 1-phosph...    142   3e-35    
ref|WP_027951653.1|  diphosphate--fructose-6-phosphate 1-phosphot...    141   4e-35    
ref|WP_036888374.1|  diphosphate--fructose-6-phosphate 1-phosphot...    141   4e-35    
ref|WP_005846772.1|  diphosphate--fructose-6-phosphate 1-phosphot...    141   4e-35    
ref|WP_007574011.1|  diphosphate--fructose-6-phosphate 1-phosphot...    141   4e-35    
ref|WP_023939250.1|  pyrophosphate-fructose 6-phosphate 1-phospho...    141   4e-35    
ref|XP_001773466.1|  predicted protein                                  141   5e-35    
gb|KFK43462.1|  hypothetical protein AALP_AA1G128500                    141   5e-35    
ref|WP_021667347.1|  diphosphate--fructose-6-phosphate 1-phosphot...    141   5e-35    
ref|XP_003534704.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    141   6e-35    
ref|WP_022040715.1|  diphosphate/fructose-6-phosphate 1-phosphotr...    140   6e-35    
ref|WP_021851985.1|  diphosphate--fructose-6-phosphate 1-phosphot...    140   7e-35    
ref|WP_006745515.1|  diphosphate--fructose-6-phosphate 1-phosphot...    140   7e-35    
ref|WP_025074602.1|  diphosphate--fructose-6-phosphate 1-phosphot...    140   7e-35    
ref|XP_003547272.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    140   8e-35    
ref|WP_044160982.1|  diphosphate--fructose-6-phosphate 1-phosphot...    140   8e-35    
ref|WP_044115791.1|  diphosphate--fructose-6-phosphate 1-phosphot...    140   9e-35    
ref|WP_027325820.1|  diphosphate--fructose-6-phosphate 1-phosphot...    140   9e-35    
ref|WP_021947313.1|  diphosphate--fructose-6-phosphate 1-phosphot...    140   1e-34    
gb|KDU78280.1|  diphosphate--fructose-6-phosphate 1-phosphotransf...    140   1e-34    
ref|WP_015708501.1|  diphosphate--fructose-6-phosphate 1-phosphot...    140   1e-34    
ref|WP_021645136.1|  diphosphate--fructose-6-phosphate 1-phosphot...    140   1e-34    
ref|WP_014545075.1|  diphosphate--fructose-6-phosphate 1-phosphot...    140   1e-34    
ref|WP_022311541.1|  diphosphate--fructose-6-phosphate 1-phosphot...    140   2e-34    
emb|CAF23604.1|  putative 6-phosphofructokinase 1                       140   2e-34    
ref|WP_044045408.1|  diphosphate--fructose-6-phosphate 1-phosphot...    139   2e-34    
ref|WP_041419260.1|  diphosphate--fructose-6-phosphate 1-phosphot...    139   2e-34    
ref|WP_004333198.1|  diphosphate--fructose-6-phosphate 1-phosphot...    139   2e-34    
ref|WP_007277807.1|  diphosphate--fructose-6-phosphate 1-phosphot...    139   2e-34    
ref|WP_034542387.1|  diphosphate--fructose-6-phosphate 1-phosphot...    139   3e-34    
ref|WP_021896515.1|  pyrophosphate-dependent phosphofructokinase        139   3e-34    
emb|CCB88843.1|  pyrophosphate--fructose 6-phosphate 1-phosphotra...    139   3e-34    
dbj|GAE16760.1|  pyrophosphate-dependent fructose 6-phosphate-1-k...    139   3e-34    
ref|WP_013548412.1|  diphosphate--fructose-6-phosphate 1-phosphot...    139   3e-34    
ref|WP_022454393.1|  phosphofructokinase                                139   3e-34    
ref|XP_010035533.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    139   4e-34    
ref|WP_016267907.1|  diphosphate-fructose-6-phosphate 1-phosphotr...    138   4e-34    
ref|NP_001148574.1|  LOC100282190                                       138   5e-34    
ref|WP_025842353.1|  diphosphate--fructose-6-phosphate 1-phosphot...    138   5e-34    
gb|KIC72145.1|  Pyrophosphate--fructose 6-phosphate 1-phosphotran...    138   6e-34    
ref|XP_003529650.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    138   6e-34    
ref|WP_044653823.1|  diphosphate--fructose-6-phosphate 1-phosphot...    137   6e-34    
ref|WP_039358021.1|  diphosphate--fructose-6-phosphate 1-phosphot...    138   7e-34    
ref|XP_010686769.1|  PREDICTED: pyrophosphate--fructose 6-phospha...    138   7e-34    



>ref|XP_011074054.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha [Sesamum indicum]
Length=616

 Score =   405 bits (1040),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 209/239 (87%), Positives = 226/239 (95%), Gaps = 0/239 (0%)
 Frame = +1

Query  37   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  216
            MDSDFG+ RELSDLQKLRSQY+PELPPCLQGTTVRVEFGDAT AADPSG HTISR FPHT
Sbjct  1    MDSDFGIPRELSDLQKLRSQYQPELPPCLQGTTVRVEFGDATIAADPSGAHTISRSFPHT  60

Query  217  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  396
            +GQP+AHFLRA+AKVPDAQIITEHPA+RVG+VFCGRQSPGGHN +WGL +ALKVHNP S 
Sbjct  61   YGQPIAHFLRATAKVPDAQIITEHPAVRVGVVFCGRQSPGGHNVVWGLLEALKVHNPESV  120

Query  397  llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  576
            LLGFLGGSEGLFAQKTLE+TD+ILATYKNQGGYD+LGRTKDQIR+TEQVNAAL ACT+LK
Sbjct  121  LLGFLGGSEGLFAQKTLEVTDEILATYKNQGGYDLLGRTKDQIRTTEQVNAALNACTALK  180

Query  577  LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            LD LVI+GGVTSNTDAA LAE FAE KCPTKVVG+PVTLNGDLKNQFVETNVG+DTICK
Sbjct  181  LDALVIIGGVTSNTDAAQLAETFAERKCPTKVVGIPVTLNGDLKNQFVETNVGYDTICK  239



>ref|XP_004238468.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha [Solanum lycopersicum]
Length=616

 Score =   404 bits (1037),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 210/239 (88%), Positives = 225/239 (94%), Gaps = 0/239 (0%)
 Frame = +1

Query  37   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  216
            MD+D+G+ARELSDLQKLRS Y PELPPCLQGTTVRVE  DATTAADPSG HTI R FPHT
Sbjct  1    MDADYGIARELSDLQKLRSHYHPELPPCLQGTTVRVELRDATTAADPSGEHTIKRFFPHT  60

Query  217  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  396
            +GQPLAHFLRA+AKVPDAQIITEHPAIRVG++FCGRQSPGGHN IWGL+DALKVHNPN+ 
Sbjct  61   YGQPLAHFLRATAKVPDAQIITEHPAIRVGVLFCGRQSPGGHNVIWGLHDALKVHNPNNI  120

Query  397  llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  576
            LLGFLGGSEGLFAQKTLEITDD+LATYKNQGGYDMLGRTKDQIR+TEQVNAA+ AC +LK
Sbjct  121  LLGFLGGSEGLFAQKTLEITDDVLATYKNQGGYDMLGRTKDQIRTTEQVNAAMAACKALK  180

Query  577  LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            LDGLVI+GGVTSNTDAA+LAE FAE KCPTKVVGVPVTLNGDLKNQFVE NVGFDTICK
Sbjct  181  LDGLVIIGGVTSNTDAAHLAEKFAETKCPTKVVGVPVTLNGDLKNQFVEANVGFDTICK  239



>ref|XP_004253113.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha-like [Solanum lycopersicum]
Length=617

 Score =   402 bits (1032),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 211/239 (88%), Positives = 226/239 (95%), Gaps = 0/239 (0%)
 Frame = +1

Query  37   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  216
            MD+D+G+ARELSDLQKLRSQY+PELPPCLQGTTVRVE GDATTAADPSG H ISR FPHT
Sbjct  1    MDADYGIARELSDLQKLRSQYQPELPPCLQGTTVRVELGDATTAADPSGEHVISRSFPHT  60

Query  217  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  396
            +GQPLAHFLRA+AKV DAQIITEHPA RVGIVFCGRQSPGGHN IWG++DALK+HNPNST
Sbjct  61   YGQPLAHFLRATAKVSDAQIITEHPAKRVGIVFCGRQSPGGHNVIWGIHDALKIHNPNST  120

Query  397  llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  576
            LLGFLGGSEGLFAQKTLEIT+DILATYKNQGGYDMLGRTKDQIR+TEQVNAA+ AC +LK
Sbjct  121  LLGFLGGSEGLFAQKTLEITNDILATYKNQGGYDMLGRTKDQIRTTEQVNAAMAACKALK  180

Query  577  LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            LD L+I+GGVTSNTDAA LAE FAEAKC TKVVGVPVTLNGDLKNQFVETNVGFDTICK
Sbjct  181  LDALIIIGGVTSNTDAAQLAETFAEAKCQTKVVGVPVTLNGDLKNQFVETNVGFDTICK  239



>ref|XP_006435470.1| hypothetical protein CICLE_v10000595mg [Citrus clementina]
 gb|ESR48710.1| hypothetical protein CICLE_v10000595mg [Citrus clementina]
 gb|KDO85269.1| hypothetical protein CISIN_1g006964mg [Citrus sinensis]
 gb|KDO85270.1| hypothetical protein CISIN_1g006964mg [Citrus sinensis]
Length=494

 Score =   397 bits (1020),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 210/239 (88%), Positives = 226/239 (95%), Gaps = 0/239 (0%)
 Frame = +1

Query  37   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  216
            MDSDFG+ RELS LQ+LRS Y+PELPPCLQGTTVRVEFGD+TT ADP+  H+ISR FPHT
Sbjct  1    MDSDFGIPRELSGLQQLRSLYQPELPPCLQGTTVRVEFGDSTTTADPADTHSISRSFPHT  60

Query  217  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  396
            +GQPLAHFLRA+AKVPDAQIITEHPAIRVGIVFCGRQSPGGHN +WGLYDALK+HNP ST
Sbjct  61   YGQPLAHFLRATAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNVVWGLYDALKLHNPKST  120

Query  397  llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  576
            LLGFLGGSEGLFAQKTLE+T +IL+TYKNQGGYDMLGRTKDQIR+TEQVNAALTAC +L 
Sbjct  121  LLGFLGGSEGLFAQKTLEVTKEILSTYKNQGGYDMLGRTKDQIRTTEQVNAALTACKNLN  180

Query  577  LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            LDGLVI+GGVTSNTDAAYLAE FAEAKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK
Sbjct  181  LDGLVIIGGVTSNTDAAYLAETFAEAKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  239



>ref|XP_009608062.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha {ECO:0000255|HAMAP-Rule:MF_03185} [Nicotiana 
tomentosiformis]
Length=616

 Score =   401 bits (1030),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 208/239 (87%), Positives = 225/239 (94%), Gaps = 0/239 (0%)
 Frame = +1

Query  37   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  216
            MD+D+G+ RELSDLQKLRSQY+PELPPCLQGTTVRVE  DAT AADPSG HTI R FPHT
Sbjct  1    MDADYGIPRELSDLQKLRSQYQPELPPCLQGTTVRVELRDATIAADPSGEHTIKRFFPHT  60

Query  217  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  396
            +GQPLAHFLRA+AKVPDAQIITEHP IRVG++FCGRQSPGGHN IWGL+DALKVHNPN+T
Sbjct  61   YGQPLAHFLRATAKVPDAQIITEHPVIRVGVLFCGRQSPGGHNVIWGLHDALKVHNPNNT  120

Query  397  llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  576
            LLGFLGGSEGLFAQKTLEIT+D+LATYKNQGGYDMLGRTKDQIR+TEQVNA++ AC +LK
Sbjct  121  LLGFLGGSEGLFAQKTLEITNDVLATYKNQGGYDMLGRTKDQIRTTEQVNASMAACKALK  180

Query  577  LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            LDGLVI+GGVTSNTDAA LAE FAEAKCPTKVVGVPVTLNGDLKNQFVE NVGFDTICK
Sbjct  181  LDGLVIIGGVTSNTDAAQLAEKFAEAKCPTKVVGVPVTLNGDLKNQFVEANVGFDTICK  239



>ref|XP_009777872.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha [Nicotiana sylvestris]
Length=616

 Score =   400 bits (1029),  Expect = 6e-133, Method: Compositional matrix adjust.
 Identities = 208/239 (87%), Positives = 226/239 (95%), Gaps = 0/239 (0%)
 Frame = +1

Query  37   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  216
            MD+D+G+ RELSDLQKLRSQY+PELPPCLQGTTVRVE  DATTAADPSG HTI R FPHT
Sbjct  1    MDADYGIPRELSDLQKLRSQYQPELPPCLQGTTVRVELRDATTAADPSGEHTIKRFFPHT  60

Query  217  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  396
            +GQPLAHFLRA+AKVPDAQIITEHP IRVG++FCGRQSPGGHN +WGL+DALKVHNPN+T
Sbjct  61   YGQPLAHFLRATAKVPDAQIITEHPVIRVGVLFCGRQSPGGHNVLWGLHDALKVHNPNNT  120

Query  397  llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  576
            LLGFLGGSEGLFAQKTLEIT+D+LATYKNQGGYDMLGRTKDQIR+TEQVN+A+ AC +LK
Sbjct  121  LLGFLGGSEGLFAQKTLEITNDVLATYKNQGGYDMLGRTKDQIRTTEQVNSAMAACKALK  180

Query  577  LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            LDGLVI+GGVTSNTDAA LAE FAEAKCPTKVVGVPVTLNGDLKNQFVE NVGFDTICK
Sbjct  181  LDGLVIIGGVTSNTDAAQLAEKFAEAKCPTKVVGVPVTLNGDLKNQFVEANVGFDTICK  239



>gb|EYU41211.1| hypothetical protein MIMGU_mgv1a003012mg [Erythranthe guttata]
Length=616

 Score =   400 bits (1027),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 210/239 (88%), Positives = 223/239 (93%), Gaps = 0/239 (0%)
 Frame = +1

Query  37   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  216
            MDSD+G ARELSDLQKLRS Y+PELPPCLQGTTV VEFGD TTAADP G HTISR FPHT
Sbjct  1    MDSDYGTARELSDLQKLRSHYQPELPPCLQGTTVSVEFGDVTTAADPLGAHTISRSFPHT  60

Query  217  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  396
            +GQP+AHFLRASAKVPDAQIIT+HPA+RVG+VFCGRQSPGGHN IWGL DALKVHNP ST
Sbjct  61   YGQPIAHFLRASAKVPDAQIITDHPAVRVGVVFCGRQSPGGHNVIWGLLDALKVHNPKST  120

Query  397  llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  576
            LLGFLGGSEGLFAQKTLEITD ILATYKNQGGYD+LGRTKDQIR+TEQVNA+L ACT+LK
Sbjct  121  LLGFLGGSEGLFAQKTLEITDQILATYKNQGGYDLLGRTKDQIRTTEQVNASLKACTTLK  180

Query  577  LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            LD LVI+GGVTSNTDAA LAE FAE KCPTKVVG+PVTLNGDLKNQFVETNVGFDTICK
Sbjct  181  LDALVIIGGVTSNTDAAQLAETFAERKCPTKVVGIPVTLNGDLKNQFVETNVGFDTICK  239



>ref|XP_007018640.1| Pyrophosphate--fructose 6-phosphate 1-phosphotransferase subunit 
alpha [Theobroma cacao]
 gb|EOY15865.1| Pyrophosphate--fructose 6-phosphate 1-phosphotransferase subunit 
alpha [Theobroma cacao]
Length=617

 Score =   399 bits (1024),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 208/239 (87%), Positives = 225/239 (94%), Gaps = 0/239 (0%)
 Frame = +1

Query  37   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  216
            MDSDFG+ RELSDLQKLRSQY+P LPPCL+GTTVRVEFGDATTA DP+  HTISR FPHT
Sbjct  1    MDSDFGIPRELSDLQKLRSQYQPGLPPCLEGTTVRVEFGDATTALDPADAHTISRAFPHT  60

Query  217  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  396
            +GQPLAHFLRA+AKVPDAQIITEHPA+RVG+VFCGRQSPGGHN IWGL+ ALK+HNPNST
Sbjct  61   YGQPLAHFLRATAKVPDAQIITEHPAMRVGLVFCGRQSPGGHNVIWGLHKALKIHNPNST  120

Query  397  llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  576
            LLGFLGG++GLFAQKTLEITDDIL+TYKNQGGYD+LGRT+DQIR+TEQVNAALTAC  LK
Sbjct  121  LLGFLGGTQGLFAQKTLEITDDILSTYKNQGGYDLLGRTQDQIRTTEQVNAALTACNDLK  180

Query  577  LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            LDGLVI+GGVTSNTDAA LAE FAEAKC TKVVGVPVTLNGDLKNQFVE NVGFDTICK
Sbjct  181  LDGLVIIGGVTSNTDAAQLAETFAEAKCQTKVVGVPVTLNGDLKNQFVEANVGFDTICK  239



>gb|KDO85265.1| hypothetical protein CISIN_1g006964mg [Citrus sinensis]
Length=588

 Score =   397 bits (1021),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 210/239 (88%), Positives = 226/239 (95%), Gaps = 0/239 (0%)
 Frame = +1

Query  37   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  216
            MDSDFG+ RELS LQ+LRS Y+PELPPCLQGTTVRVEFGD+TT ADP+  H+ISR FPHT
Sbjct  1    MDSDFGIPRELSGLQQLRSLYQPELPPCLQGTTVRVEFGDSTTTADPADTHSISRSFPHT  60

Query  217  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  396
            +GQPLAHFLRA+AKVPDAQIITEHPAIRVGIVFCGRQSPGGHN +WGLYDALK+HNP ST
Sbjct  61   YGQPLAHFLRATAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNVVWGLYDALKLHNPKST  120

Query  397  llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  576
            LLGFLGGSEGLFAQKTLE+T +IL+TYKNQGGYDMLGRTKDQIR+TEQVNAALTAC +L 
Sbjct  121  LLGFLGGSEGLFAQKTLEVTKEILSTYKNQGGYDMLGRTKDQIRTTEQVNAALTACKNLN  180

Query  577  LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            LDGLVI+GGVTSNTDAAYLAE FAEAKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK
Sbjct  181  LDGLVIIGGVTSNTDAAYLAETFAEAKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  239



>ref|XP_006342524.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha-like [Solanum tuberosum]
Length=617

 Score =   398 bits (1022),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 210/239 (88%), Positives = 225/239 (94%), Gaps = 0/239 (0%)
 Frame = +1

Query  37   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  216
            MD+D+G+ARELSDLQKLRSQY+PELPPCLQGTTVRVE GDATTAAD SG H ISR FPHT
Sbjct  1    MDADYGIARELSDLQKLRSQYQPELPPCLQGTTVRVELGDATTAADHSGEHVISRSFPHT  60

Query  217  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  396
            +GQPLAHFLRA+AKV DAQIITEHPA RVGIVFCGRQSPGGHN IWG++DALK+HNPNST
Sbjct  61   YGQPLAHFLRATAKVSDAQIITEHPAKRVGIVFCGRQSPGGHNVIWGIHDALKIHNPNST  120

Query  397  llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  576
            LLGFLGGSEGLFAQKTLEIT+DILATYKNQGGYDMLGRTKDQIR+TEQVNAA+ AC +LK
Sbjct  121  LLGFLGGSEGLFAQKTLEITNDILATYKNQGGYDMLGRTKDQIRTTEQVNAAMAACKALK  180

Query  577  LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            LD L+I+GGVTSNTDAA LAE FAEAKC TKVVGVPVTLNGDLKNQFVETNVGFDTICK
Sbjct  181  LDALIIIGGVTSNTDAAQLAETFAEAKCQTKVVGVPVTLNGDLKNQFVETNVGFDTICK  239



>ref|XP_006435472.1| hypothetical protein CICLE_v10000595mg [Citrus clementina]
 ref|XP_006473868.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha-like [Citrus sinensis]
 gb|ABY25305.1| pyrophosphate-dependent phosphofructokinase alpha subunit [Citrus 
sinensis x Citrus trifoliata]
 gb|ESR48712.1| hypothetical protein CICLE_v10000595mg [Citrus clementina]
 gb|KDO85266.1| hypothetical protein CISIN_1g006964mg [Citrus sinensis]
Length=615

 Score =   397 bits (1021),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 210/239 (88%), Positives = 226/239 (95%), Gaps = 0/239 (0%)
 Frame = +1

Query  37   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  216
            MDSDFG+ RELS LQ+LRS Y+PELPPCLQGTTVRVEFGD+TT ADP+  H+ISR FPHT
Sbjct  1    MDSDFGIPRELSGLQQLRSLYQPELPPCLQGTTVRVEFGDSTTTADPADTHSISRSFPHT  60

Query  217  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  396
            +GQPLAHFLRA+AKVPDAQIITEHPAIRVGIVFCGRQSPGGHN +WGLYDALK+HNP ST
Sbjct  61   YGQPLAHFLRATAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNVVWGLYDALKLHNPKST  120

Query  397  llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  576
            LLGFLGGSEGLFAQKTLE+T +IL+TYKNQGGYDMLGRTKDQIR+TEQVNAALTAC +L 
Sbjct  121  LLGFLGGSEGLFAQKTLEVTKEILSTYKNQGGYDMLGRTKDQIRTTEQVNAALTACKNLN  180

Query  577  LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            LDGLVI+GGVTSNTDAAYLAE FAEAKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK
Sbjct  181  LDGLVIIGGVTSNTDAAYLAETFAEAKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  239



>ref|XP_011099944.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha-like [Sesamum indicum]
Length=626

 Score =   397 bits (1019),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 208/239 (87%), Positives = 224/239 (94%), Gaps = 0/239 (0%)
 Frame = +1

Query  37   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  216
            MDSDFG+ARELS LQ LRSQY+P+LPPCLQGTTV VEFGDATTA DPS  HTISR FPHT
Sbjct  1    MDSDFGVARELSHLQNLRSQYQPQLPPCLQGTTVSVEFGDATTAPDPSDTHTISRFFPHT  60

Query  217  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  396
            +GQPLAHFLRA+AKVP+AQ+ITE+PA+RVG+VFCGRQSPGGHN IWGL DALKVHNP ST
Sbjct  61   YGQPLAHFLRATAKVPNAQVITEYPAVRVGVVFCGRQSPGGHNVIWGLLDALKVHNPEST  120

Query  397  llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  576
            LLGFLGGSEGLFAQKTLEITDDIL TYKNQGGYD+LGRTKDQIR+TEQVNAAL+ACT+LK
Sbjct  121  LLGFLGGSEGLFAQKTLEITDDILRTYKNQGGYDLLGRTKDQIRTTEQVNAALSACTTLK  180

Query  577  LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            LD LVI+GGVTSNTDAA LAE FAE KCPTKVVG+PVTLNGDLKNQFVETNVGFDTICK
Sbjct  181  LDALVIIGGVTSNTDAAQLAETFAERKCPTKVVGIPVTLNGDLKNQFVETNVGFDTICK  239



>ref|XP_009759651.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha [Nicotiana sylvestris]
Length=616

 Score =   395 bits (1016),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 207/239 (87%), Positives = 224/239 (94%), Gaps = 0/239 (0%)
 Frame = +1

Query  37   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  216
            MD+D+G+ARELSDLQK RSQY+PELPPCLQGTTVRVE GDATTA+DPSG HTISR FPHT
Sbjct  1    MDADYGIARELSDLQKHRSQYQPELPPCLQGTTVRVELGDATTASDPSGEHTISRSFPHT  60

Query  217  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  396
            +GQPLAHFLRA+AKV DAQIITEHPA RVG+VFCGRQSPGGHN IWG++DALK+HNPNST
Sbjct  61   YGQPLAHFLRATAKVTDAQIITEHPAKRVGVVFCGRQSPGGHNVIWGIHDALKIHNPNST  120

Query  397  llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  576
            LLGFLGGSEGLFAQKTLEIT+D+L+TYKNQGGYDMLGRTKDQIRSTEQVNAA+ AC +LK
Sbjct  121  LLGFLGGSEGLFAQKTLEITNDVLSTYKNQGGYDMLGRTKDQIRSTEQVNAAMAACKTLK  180

Query  577  LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            LD L+IVGGVTSNTDAA LAE F EAKC TKVVGVPVTLNGDLKNQFVE NVGFDTICK
Sbjct  181  LDALIIVGGVTSNTDAAQLAETFTEAKCQTKVVGVPVTLNGDLKNQFVEINVGFDTICK  239



>ref|XP_009607500.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha {ECO:0000255|HAMAP-Rule:MF_03185}-like 
[Nicotiana tomentosiformis]
Length=616

 Score =   395 bits (1016),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 206/239 (86%), Positives = 226/239 (95%), Gaps = 0/239 (0%)
 Frame = +1

Query  37   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  216
            MD+D+G+ARELSDLQK RSQY+PELPPCLQGTTVRVE GDATTA+DPSG HTISR FPHT
Sbjct  1    MDADYGIARELSDLQKHRSQYQPELPPCLQGTTVRVELGDATTASDPSGEHTISRSFPHT  60

Query  217  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  396
            +GQPLAHFLRA+AKV DAQIITEHPA RVG+VFCGRQSPGGHN IWG++DALK+HNPNS+
Sbjct  61   YGQPLAHFLRATAKVADAQIITEHPAKRVGVVFCGRQSPGGHNVIWGIHDALKIHNPNSS  120

Query  397  llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  576
            LLGFLGGSEGLFAQKTLEIT+D+L+TYKNQGGYDMLGRTKDQIR+TEQVNAA+ AC +LK
Sbjct  121  LLGFLGGSEGLFAQKTLEITNDVLSTYKNQGGYDMLGRTKDQIRTTEQVNAAMAACKALK  180

Query  577  LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            LD L+I+GGVTSNTDAA LAE FAEAKC TKVVGVPVTLNGDLKNQFVETNVGFDTICK
Sbjct  181  LDALIIIGGVTSNTDAAQLAETFAEAKCQTKVVGVPVTLNGDLKNQFVETNVGFDTICK  239



>sp|P21342.2|PFPA_SOLTU RecName: Full=Pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha; Short=PFP; AltName: Full=6-phosphofructokinase, 
pyrophosphate dependent; AltName: Full=PPi-PFK; 
AltName: Full=Pyrophosphate-dependent 6-phosphofructose-1-kinase 
[Solanum tuberosum]
Length=616

 Score =   395 bits (1016),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 207/239 (87%), Positives = 222/239 (93%), Gaps = 0/239 (0%)
 Frame = +1

Query  37   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  216
            MD+D+G+ RELSDLQKLRS Y PELPPCLQGTTVRVE  DATTAADPSG HTI R FPHT
Sbjct  1    MDADYGIPRELSDLQKLRSHYHPELPPCLQGTTVRVELRDATTAADPSGEHTIKRFFPHT  60

Query  217  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  396
            +GQPLAHFLRA+AKVPDAQIITEHPAIRVG++FCGRQSPGGHN IWGL+DALKVHNP + 
Sbjct  61   YGQPLAHFLRATAKVPDAQIITEHPAIRVGVLFCGRQSPGGHNVIWGLHDALKVHNPKNI  120

Query  397  llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  576
            LLGFLGGSEGLFAQKTLEITDD+LATYKNQGGYDMLGRTKDQIR+TEQVNAA+ AC +LK
Sbjct  121  LLGFLGGSEGLFAQKTLEITDDVLATYKNQGGYDMLGRTKDQIRTTEQVNAAMAACKALK  180

Query  577  LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            LDGLVI+GGVTSNTDAA+LAE FAE KC TKVVGVPVTLNGDLKNQFVE NVGFDTICK
Sbjct  181  LDGLVIIGGVTSNTDAAHLAEKFAETKCLTKVVGVPVTLNGDLKNQFVEANVGFDTICK  239



>gb|AAC67587.1| pyrophosphate-dependent phosphofructokinase alpha subunit [Citrus 
x paradisi]
Length=615

 Score =   395 bits (1015),  Expect = 7e-131, Method: Compositional matrix adjust.
 Identities = 208/239 (87%), Positives = 225/239 (94%), Gaps = 0/239 (0%)
 Frame = +1

Query  37   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  216
            MDSDFG+ RELS LQ+LRS Y+PELPPCLQGTTVRVEFGD+TT ADP+  H+ISR FPHT
Sbjct  1    MDSDFGIPRELSGLQQLRSLYQPELPPCLQGTTVRVEFGDSTTTADPADTHSISRSFPHT  60

Query  217  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  396
            +GQPLAHFLRA+AKVPDAQIITEHPAIRVGIVFCGRQSPGGHN +WGLYDA+K+HNP ST
Sbjct  61   YGQPLAHFLRATAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNVVWGLYDAIKLHNPKST  120

Query  397  llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  576
            LLGFLGGSEGLFAQKTLE+T +I +TYKNQGGYDMLGRTKDQIR+TEQVNAALTAC +L 
Sbjct  121  LLGFLGGSEGLFAQKTLEVTKEIFSTYKNQGGYDMLGRTKDQIRTTEQVNAALTACKNLN  180

Query  577  LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            LDGLVI+GGVTSNTDAAYLAE FAEAKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK
Sbjct  181  LDGLVIIGGVTSNTDAAYLAETFAEAKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  239



>gb|ABK93964.1| unknown [Populus trichocarpa]
Length=617

 Score =   395 bits (1015),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 211/239 (88%), Positives = 224/239 (94%), Gaps = 0/239 (0%)
 Frame = +1

Query  37   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  216
            MDSDFG+ RELSDLQKLRS Y+PELPPCLQGT VRVE GDATTAADP+  H+ISR FP T
Sbjct  1    MDSDFGIPRELSDLQKLRSLYQPELPPCLQGTAVRVELGDATTAADPADVHSISRSFPLT  60

Query  217  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  396
            +GQPLAHFLRASAKV DAQIIT+HPA RVGIVFCGRQSPGGHN IWGL++ALK+HNPNST
Sbjct  61   YGQPLAHFLRASAKVSDAQIITDHPAFRVGIVFCGRQSPGGHNVIWGLHNALKIHNPNST  120

Query  397  llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  576
            LLGFLGGSEGLFAQKTLEITDDIL+TYKNQGGYD+LGRTKDQIR+TEQVNAALTAC  LK
Sbjct  121  LLGFLGGSEGLFAQKTLEITDDILSTYKNQGGYDLLGRTKDQIRTTEQVNAALTACKDLK  180

Query  577  LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            LDGLVI+GGVTSNTDAA LAE FAEAKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK
Sbjct  181  LDGLVIIGGVTSNTDAAQLAETFAEAKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  239



>ref|XP_002307823.1| pyrophosphate-dependent phosphofructokinase alpha subunit family 
protein [Populus trichocarpa]
 gb|EEE94819.1| pyrophosphate-dependent phosphofructokinase alpha subunit family 
protein [Populus trichocarpa]
Length=617

 Score =   395 bits (1015),  Expect = 9e-131, Method: Compositional matrix adjust.
 Identities = 211/239 (88%), Positives = 224/239 (94%), Gaps = 0/239 (0%)
 Frame = +1

Query  37   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  216
            MDSDFG+ RELSDLQKLRS Y+PELPPCLQGT VRVE GDATTAADP+  H+ISR FP T
Sbjct  1    MDSDFGIPRELSDLQKLRSLYQPELPPCLQGTAVRVELGDATTAADPADVHSISRSFPLT  60

Query  217  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  396
            +GQPLAHFLRASAKV DAQIIT+HPA RVGIVFCGRQSPGGHN IWGL++ALK+HNPNST
Sbjct  61   YGQPLAHFLRASAKVSDAQIITDHPAFRVGIVFCGRQSPGGHNVIWGLHNALKIHNPNST  120

Query  397  llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  576
            LLGFLGGSEGLFAQKTLEITDDIL+TYKNQGGYD+LGRTKDQIR+TEQVNAALTAC  LK
Sbjct  121  LLGFLGGSEGLFAQKTLEITDDILSTYKNQGGYDLLGRTKDQIRTTEQVNAALTACKDLK  180

Query  577  LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            LDGLVI+GGVTSNTDAA LAE FAEAKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK
Sbjct  181  LDGLVIIGGVTSNTDAAQLAETFAEAKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  239



>gb|KHG12069.1| Pyrophosphate--fructose 6-phosphate 1-phosphotransferase subunit 
alpha [Gossypium arboreum]
Length=616

 Score =   395 bits (1014),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 203/239 (85%), Positives = 225/239 (94%), Gaps = 0/239 (0%)
 Frame = +1

Query  37   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  216
            MDSD+G+ RELSDLQKLRSQY+P+LPPCL+GTTVRVEFGD TT+ DP+  HTI+R FPHT
Sbjct  1    MDSDYGIPRELSDLQKLRSQYQPQLPPCLEGTTVRVEFGDTTTSLDPADAHTIARAFPHT  60

Query  217  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  396
            +G+PLAHFLRA+AKVPDAQIITEHPAIRVG+VFCGRQSPGGHN +WGL+ ALK+HNPNST
Sbjct  61   YGKPLAHFLRATAKVPDAQIITEHPAIRVGLVFCGRQSPGGHNVVWGLHKALKIHNPNST  120

Query  397  llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  576
            LLGFLGG++GLFAQKTLEITDDIL+TYKNQGGYD+LGRT+DQIR+TEQV AAL AC  LK
Sbjct  121  LLGFLGGTQGLFAQKTLEITDDILSTYKNQGGYDLLGRTQDQIRTTEQVKAALAACNDLK  180

Query  577  LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            LDGLVI+GGVTSNTDAA LAE FAEAKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK
Sbjct  181  LDGLVIIGGVTSNTDAAQLAETFAEAKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  239



>ref|NP_001275358.1| pyrophosphate--fructose 6-phosphate 1-phosphotransferase subunit 
alpha [Solanum tuberosum]
 gb|AAA63451.1| pyrophosphate-fructose 6-phosphate 1-phosphotransferase alpha-subunit 
[Solanum tuberosum]
Length=616

 Score =   395 bits (1014),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 206/239 (86%), Positives = 222/239 (93%), Gaps = 0/239 (0%)
 Frame = +1

Query  37   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  216
            MD+D+G+ RELSDLQKLRS Y PELPPCLQGTTVRVE  DATTAADP+G HTI R FPHT
Sbjct  1    MDADYGIPRELSDLQKLRSHYHPELPPCLQGTTVRVELRDATTAADPAGEHTIKRFFPHT  60

Query  217  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  396
            +GQPLAHFLRA+AKVPDAQIITEHPAIRVG++FCGRQSPGGHN IWGL+DALKVHNP + 
Sbjct  61   YGQPLAHFLRATAKVPDAQIITEHPAIRVGVLFCGRQSPGGHNVIWGLHDALKVHNPKNI  120

Query  397  llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  576
            LLGFLGGSEGLFAQKTLEITDD+LATYKNQGGYDMLGRTKDQIR+TEQVNAA+ AC +LK
Sbjct  121  LLGFLGGSEGLFAQKTLEITDDVLATYKNQGGYDMLGRTKDQIRTTEQVNAAMAACKALK  180

Query  577  LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            LDGLVI+GGVTSNTDAA+LAE FAE KC TKVVGVPVTLNGDLKNQFVE NVGFDTICK
Sbjct  181  LDGLVIIGGVTSNTDAAHLAEKFAETKCLTKVVGVPVTLNGDLKNQFVEANVGFDTICK  239



>ref|XP_008796200.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha [Phoenix dactylifera]
Length=620

 Score =   395 bits (1014),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 204/239 (85%), Positives = 224/239 (94%), Gaps = 0/239 (0%)
 Frame = +1

Query  37   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  216
            MDSD+G+ RELSDLQK R+ Y+PELPPCLQGTTVRVEFGDATTA DP+  H I + FPHT
Sbjct  1    MDSDYGVPRELSDLQKQRALYQPELPPCLQGTTVRVEFGDATTAGDPASAHVIGQNFPHT  60

Query  217  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  396
            +GQPLAHFLRA+AKVPDAQIITEHPAIRVG+VF GRQSPGGHN IWGLYDA+K HNPNST
Sbjct  61   YGQPLAHFLRATAKVPDAQIITEHPAIRVGVVFSGRQSPGGHNVIWGLYDAIKAHNPNST  120

Query  397  llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  576
            LLGF+GG+EGLFAQKTL+ITDDIL+TYKNQGGYD+LGRTKDQIR+TEQVNAA+TAC +LK
Sbjct  121  LLGFVGGTEGLFAQKTLKITDDILSTYKNQGGYDLLGRTKDQIRTTEQVNAAMTACQALK  180

Query  577  LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            LDGLVI+GGVTSNTDAA LAE FAE+KCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK
Sbjct  181  LDGLVIIGGVTSNTDAAQLAETFAESKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  239



>ref|XP_002510738.1| phosphofructokinase, putative [Ricinus communis]
 gb|EEF52925.1| phosphofructokinase, putative [Ricinus communis]
Length=617

 Score =   394 bits (1011),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 206/239 (86%), Positives = 225/239 (94%), Gaps = 0/239 (0%)
 Frame = +1

Query  37   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  216
            MDSDFG+ RELSDLQKLRS Y+PELPPCLQGTTVRVE GD TTAAD +G HTISR FPHT
Sbjct  1    MDSDFGIPRELSDLQKLRSLYQPELPPCLQGTTVRVELGDGTTAADEAGAHTISRSFPHT  60

Query  217  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  396
            +GQPLAHFLRA+AKV DA II+EHPA+RVG+VFCGRQSPGGHN +WGL++ALK+HNPNST
Sbjct  61   YGQPLAHFLRATAKVADAHIISEHPAMRVGVVFCGRQSPGGHNVVWGLHNALKIHNPNST  120

Query  397  llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  576
            LLGFLGGSEGLFAQKTLE+TDDIL+TYKNQGGYD+LGRTKDQIR+TEQV+AALT C +LK
Sbjct  121  LLGFLGGSEGLFAQKTLEVTDDILSTYKNQGGYDLLGRTKDQIRTTEQVHAALTTCKNLK  180

Query  577  LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            LDGLVI+GGVTSNTDAA LAE FAEAKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK
Sbjct  181  LDGLVIIGGVTSNTDAAQLAETFAEAKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  239



>gb|KDP36731.1| hypothetical protein JCGZ_08022 [Jatropha curcas]
Length=617

 Score =   394 bits (1011),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 208/239 (87%), Positives = 222/239 (93%), Gaps = 0/239 (0%)
 Frame = +1

Query  37   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  216
            MDSDFG+ RELS+LQK RS Y+PELPPCLQGTTVRVEFGD T AAD +G HTISR FPHT
Sbjct  1    MDSDFGIPRELSELQKQRSHYQPELPPCLQGTTVRVEFGDGTIAADAAGAHTISRSFPHT  60

Query  217  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  396
            +GQPLAHFLRA+AKVPDA IITEHPA+RVGIVFCGRQSPGGHN IWGL +ALK+HNPNST
Sbjct  61   YGQPLAHFLRATAKVPDAHIITEHPAMRVGIVFCGRQSPGGHNVIWGLLNALKIHNPNST  120

Query  397  llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  576
            LLGFLGGSEGLFAQKTLEITD+IL+TYKNQGGYD+LGRTKDQIR+TEQV AALT C  LK
Sbjct  121  LLGFLGGSEGLFAQKTLEITDEILSTYKNQGGYDLLGRTKDQIRTTEQVKAALTTCQDLK  180

Query  577  LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            LDGLVI+GGVTSNTDAA LAE FAEAKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK
Sbjct  181  LDGLVIIGGVTSNTDAAQLAETFAEAKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  239



>gb|KCW70371.1| hypothetical protein EUGRSUZ_F03611 [Eucalyptus grandis]
Length=520

 Score =   390 bits (1001),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 206/239 (86%), Positives = 220/239 (92%), Gaps = 0/239 (0%)
 Frame = +1

Query  37   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  216
            MDSD+G+ RELSDLQK RS Y PELPPCLQGTTVRVE+GDATTAADP+  H+ISR FPHT
Sbjct  1    MDSDYGIPRELSDLQKQRSLYHPELPPCLQGTTVRVEYGDATTAADPADVHSISRYFPHT  60

Query  217  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  396
            +GQPLAHFLRA+A VPDA IITEHP IRVGIVFCGRQSPGGHN IWGLY ALK+HNP + 
Sbjct  61   YGQPLAHFLRATANVPDALIITEHPPIRVGIVFCGRQSPGGHNVIWGLYHALKIHNPKNV  120

Query  397  llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  576
            LLGFLGGSEGLFAQKTLEITDDIL+TYKNQGGYD+LGRTKDQIR+TEQVNAAL +C  LK
Sbjct  121  LLGFLGGSEGLFAQKTLEITDDILSTYKNQGGYDLLGRTKDQIRTTEQVNAALISCNDLK  180

Query  577  LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            LDGLVI+GGVTSNTDAA LAE FAEAKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK
Sbjct  181  LDGLVIIGGVTSNTDAAQLAETFAEAKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  239



>gb|EYU36601.1| hypothetical protein MIMGU_mgv1a003013mg [Erythranthe guttata]
Length=616

 Score =   393 bits (1010),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 202/239 (85%), Positives = 223/239 (93%), Gaps = 0/239 (0%)
 Frame = +1

Query  37   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  216
            MDSD+G+ARELSDLQKLRS Y+PELPPCLQGTTVRV FGDAT AADP+G HTISR FP T
Sbjct  1    MDSDYGIARELSDLQKLRSHYQPELPPCLQGTTVRVHFGDATAAADPTGAHTISRSFPLT  60

Query  217  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  396
            +GQPLAHFLR++AKVPDAQIITEH A+RVG+VFCGRQSPGGHN IWGL++ALKVHNP S 
Sbjct  61   YGQPLAHFLRSTAKVPDAQIITEHAAVRVGVVFCGRQSPGGHNVIWGLHEALKVHNPKSV  120

Query  397  llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  576
            LLGFLGGS+GLFAQKTLE+TD++LATYKNQGGYD+LGRTKDQIR+ EQVNAAL ACT+LK
Sbjct  121  LLGFLGGSDGLFAQKTLEVTDEVLATYKNQGGYDLLGRTKDQIRTIEQVNAALNACTALK  180

Query  577  LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            LD LVI+GGVTSNTDAA LAE FAE KCPTKVVG+PVTLNGDL+NQFVETNVGFDTICK
Sbjct  181  LDALVIIGGVTSNTDAAQLAETFAERKCPTKVVGIPVTLNGDLRNQFVETNVGFDTICK  239



>ref|XP_011041141.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha isoform X1 [Populus euphratica]
Length=617

 Score =   392 bits (1007),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 210/239 (88%), Positives = 222/239 (93%), Gaps = 0/239 (0%)
 Frame = +1

Query  37   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  216
            MDSDFG+ RELSDLQKLRS Y+PELPPCLQGT VRVE GDATTAADP+  H+ISR FP T
Sbjct  1    MDSDFGIPRELSDLQKLRSLYQPELPPCLQGTAVRVELGDATTAADPADVHSISRSFPLT  60

Query  217  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  396
            +GQPLAHFLRA+AKV DAQIIT HPA RVGIVFCGRQSPGGHN IWGL++ALKVHNPNST
Sbjct  61   YGQPLAHFLRATAKVSDAQIITYHPAFRVGIVFCGRQSPGGHNVIWGLHNALKVHNPNST  120

Query  397  llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  576
            LLGFLGGSEGLFAQKTLEITDDIL+TYKNQGGYD+LGRTKDQIR+TEQVNAALTAC  LK
Sbjct  121  LLGFLGGSEGLFAQKTLEITDDILSTYKNQGGYDLLGRTKDQIRTTEQVNAALTACKDLK  180

Query  577  LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            LDGLVI+GGVTSNTDAA LAE FAEAKCPTKVVGVPVT NGDLKNQFVETNVGFDTICK
Sbjct  181  LDGLVIIGGVTSNTDAAQLAETFAEAKCPTKVVGVPVTFNGDLKNQFVETNVGFDTICK  239



>gb|AHZ08764.1| pyrophosphate--fructose 6-phosphate 1-phosphotransferase [Nicotiana 
tabacum]
Length=616

 Score =   392 bits (1007),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 205/239 (86%), Positives = 223/239 (93%), Gaps = 0/239 (0%)
 Frame = +1

Query  37   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  216
            MD+D+G+ARELSDLQK RSQY+PELPPCLQGTTVRVE GD TTA+DPSG HTISR FPHT
Sbjct  1    MDADYGIARELSDLQKHRSQYQPELPPCLQGTTVRVELGDTTTASDPSGEHTISRSFPHT  60

Query  217  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  396
            +GQPLAHFLRA+AKV DAQIITEHPA RVG+VFCGRQSPGGHN IWG++DALK+HNPNST
Sbjct  61   YGQPLAHFLRATAKVTDAQIITEHPAKRVGVVFCGRQSPGGHNVIWGIHDALKIHNPNST  120

Query  397  llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  576
            LLGFLGGSEGLFAQKTLEIT+D+L+TYKNQGGYDMLGRTKDQIRSTEQV+AA+ AC +LK
Sbjct  121  LLGFLGGSEGLFAQKTLEITNDVLSTYKNQGGYDMLGRTKDQIRSTEQVSAAMAACKTLK  180

Query  577  LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            LD L+IVGGVTSNTDAA LAE F EAKC TKVVGVPVTLNGDLKNQFVE NVGFDTICK
Sbjct  181  LDALIIVGGVTSNTDAAQLAETFTEAKCQTKVVGVPVTLNGDLKNQFVEINVGFDTICK  239



>gb|KJB29716.1| hypothetical protein B456_005G115600 [Gossypium raimondii]
Length=586

 Score =   390 bits (1003),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 201/239 (84%), Positives = 223/239 (93%), Gaps = 0/239 (0%)
 Frame = +1

Query  37   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  216
            MDSD+G+ RELSDLQKLRSQY+P+LPPCL+GTTVRVEFGD TT+ DP+  HTI+R FPHT
Sbjct  1    MDSDYGIPRELSDLQKLRSQYQPQLPPCLEGTTVRVEFGDTTTSLDPADAHTIARAFPHT  60

Query  217  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  396
            +G+PLAHFLRA+AKVPDAQIITEHP IRVG+VFCGRQSP GHN +WGL+ ALK+HNPNST
Sbjct  61   YGKPLAHFLRATAKVPDAQIITEHPTIRVGLVFCGRQSPAGHNVVWGLHKALKIHNPNST  120

Query  397  llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  576
            LLGFLGG++GLFAQKTLEITDDIL+TYKNQGGYD+LGRT+DQIR+TEQV AAL AC  LK
Sbjct  121  LLGFLGGTQGLFAQKTLEITDDILSTYKNQGGYDLLGRTQDQIRTTEQVKAALAACNDLK  180

Query  577  LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            LDGLVI+GGVTSNTDAA LAE FAEAKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK
Sbjct  181  LDGLVIIGGVTSNTDAAQLAETFAEAKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  239



>gb|KJB29713.1| hypothetical protein B456_005G115600 [Gossypium raimondii]
Length=616

 Score =   392 bits (1006),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 201/239 (84%), Positives = 223/239 (93%), Gaps = 0/239 (0%)
 Frame = +1

Query  37   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  216
            MDSD+G+ RELSDLQKLRSQY+P+LPPCL+GTTVRVEFGD TT+ DP+  HTI+R FPHT
Sbjct  1    MDSDYGIPRELSDLQKLRSQYQPQLPPCLEGTTVRVEFGDTTTSLDPADAHTIARAFPHT  60

Query  217  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  396
            +G+PLAHFLRA+AKVPDAQIITEHP IRVG+VFCGRQSP GHN +WGL+ ALK+HNPNST
Sbjct  61   YGKPLAHFLRATAKVPDAQIITEHPTIRVGLVFCGRQSPAGHNVVWGLHKALKIHNPNST  120

Query  397  llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  576
            LLGFLGG++GLFAQKTLEITDDIL+TYKNQGGYD+LGRT+DQIR+TEQV AAL AC  LK
Sbjct  121  LLGFLGGTQGLFAQKTLEITDDILSTYKNQGGYDLLGRTQDQIRTTEQVKAALAACNDLK  180

Query  577  LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            LDGLVI+GGVTSNTDAA LAE FAEAKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK
Sbjct  181  LDGLVIIGGVTSNTDAAQLAETFAEAKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  239



>ref|XP_011034779.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha-like [Populus euphratica]
Length=617

 Score =   391 bits (1005),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 205/239 (86%), Positives = 218/239 (91%), Gaps = 0/239 (0%)
 Frame = +1

Query  37   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  216
            MDSDFG+ RELSDLQKLRS Y+PELPPCLQGTTVRVEFGDATT ADP+  H ISR FPHT
Sbjct  1    MDSDFGIPRELSDLQKLRSLYQPELPPCLQGTTVRVEFGDATTCADPADVHAISRAFPHT  60

Query  217  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  396
            +GQPLAHFLRA+AKVPDAQIIT+HPA+RVGIVFCGRQSPGGHN +WGL +ALK+HNP ST
Sbjct  61   YGQPLAHFLRATAKVPDAQIITDHPAVRVGIVFCGRQSPGGHNVVWGLQNALKIHNPKST  120

Query  397  llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  576
            LLGFLGGSEG FAQKTLEITDDIL TYKNQGGYD+LGRTKDQIR+TEQV AALTAC  LK
Sbjct  121  LLGFLGGSEGFFAQKTLEITDDILETYKNQGGYDLLGRTKDQIRTTEQVRAALTACKDLK  180

Query  577  LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            LD LVI+GGVTSNTDAA LAE FA  KC TKVVGVPVTLNGDLKNQFVETNVGFDTICK
Sbjct  181  LDALVIIGGVTSNTDAAQLAETFAVEKCQTKVVGVPVTLNGDLKNQFVETNVGFDTICK  239



>gb|KJB29715.1| hypothetical protein B456_005G115600 [Gossypium raimondii]
Length=589

 Score =   390 bits (1003),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 201/239 (84%), Positives = 223/239 (93%), Gaps = 0/239 (0%)
 Frame = +1

Query  37   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  216
            MDSD+G+ RELSDLQKLRSQY+P+LPPCL+GTTVRVEFGD TT+ DP+  HTI+R FPHT
Sbjct  1    MDSDYGIPRELSDLQKLRSQYQPQLPPCLEGTTVRVEFGDTTTSLDPADAHTIARAFPHT  60

Query  217  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  396
            +G+PLAHFLRA+AKVPDAQIITEHP IRVG+VFCGRQSP GHN +WGL+ ALK+HNPNST
Sbjct  61   YGKPLAHFLRATAKVPDAQIITEHPTIRVGLVFCGRQSPAGHNVVWGLHKALKIHNPNST  120

Query  397  llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  576
            LLGFLGG++GLFAQKTLEITDDIL+TYKNQGGYD+LGRT+DQIR+TEQV AAL AC  LK
Sbjct  121  LLGFLGGTQGLFAQKTLEITDDILSTYKNQGGYDLLGRTQDQIRTTEQVKAALAACNDLK  180

Query  577  LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            LDGLVI+GGVTSNTDAA LAE FAEAKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK
Sbjct  181  LDGLVIIGGVTSNTDAAQLAETFAEAKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  239



>sp|Q41140.1|PFPA_RICCO RecName: Full=Pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha; Short=PFP; AltName: Full=6-phosphofructokinase, 
pyrophosphate dependent; AltName: Full=PPi-PFK; 
AltName: Full=Pyrophosphate-dependent 6-phosphofructose-1-kinase 
[Ricinus communis]
 emb|CAA83682.1| pyrophosphate-dependent phosphofructokinase alpha subunit [Ricinus 
communis]
Length=617

 Score =   390 bits (1002),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 204/239 (85%), Positives = 223/239 (93%), Gaps = 0/239 (0%)
 Frame = +1

Query  37   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  216
            MDSDFG+ RELSDLQKLRS Y+PELPPCLQGTTVRVE GD TTA   +G HTISR FPHT
Sbjct  1    MDSDFGIPRELSDLQKLRSLYKPELPPCLQGTTVRVELGDGTTACSEAGAHTISRSFPHT  60

Query  217  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  396
            +GQPLAHFLRA+AKV DA II+EHPA+RVG+VFCGRQSPGGHN +WGL++ALK+HNPNST
Sbjct  61   YGQPLAHFLRATAKVADAHIISEHPAMRVGVVFCGRQSPGGHNVVWGLHNALKIHNPNST  120

Query  397  llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  576
            LLGFLGGSEGLFAQKTLE+TDDIL+TYKNQGGYD+LGRTKDQIR+TEQV+AALT C +LK
Sbjct  121  LLGFLGGSEGLFAQKTLEVTDDILSTYKNQGGYDLLGRTKDQIRTTEQVHAALTTCKNLK  180

Query  577  LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            LDGLVI+GGVTSNTDAA LAE FAEAKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK
Sbjct  181  LDGLVIIGGVTSNTDAAQLAETFAEAKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  239



>ref|XP_010094500.1| Pyrophosphate--fructose 6-phosphate 1-phosphotransferase subunit 
alpha [Morus notabilis]
 gb|EXB56254.1| Pyrophosphate--fructose 6-phosphate 1-phosphotransferase subunit 
alpha [Morus notabilis]
Length=631

 Score =   390 bits (1003),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 209/239 (87%), Positives = 221/239 (92%), Gaps = 0/239 (0%)
 Frame = +1

Query  37   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  216
            MDSD+G+ RELSDLQKLRS Y+P LPPCL+GTTVRVEFGDATT  DP+  HTISR FPHT
Sbjct  1    MDSDYGIPRELSDLQKLRSLYQPVLPPCLEGTTVRVEFGDATTTLDPTDVHTISRSFPHT  60

Query  217  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  396
            +GQPLAHFLRA+AKVPDA IITEHPA RVGIVFCGRQSPGGHN IWGLY+ALK+HNPNST
Sbjct  61   YGQPLAHFLRATAKVPDAHIITEHPAKRVGIVFCGRQSPGGHNVIWGLYNALKLHNPNST  120

Query  397  llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  576
            LLGFLGGSEGLFAQKTLEITDDILATYKNQGGYD+LGRTKDQIR+ EQVNAALTAC  LK
Sbjct  121  LLGFLGGSEGLFAQKTLEITDDILATYKNQGGYDLLGRTKDQIRTIEQVNAALTACKDLK  180

Query  577  LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            L GLVI+GGVTS TDAA LAE FAEAKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK
Sbjct  181  LVGLVIIGGVTSTTDAAQLAETFAEAKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  239



>gb|ADZ96380.2| pyrophosphate--fructose 6-phosphate 1-phosphotransferase [Eriobotrya 
japonica]
Length=617

 Score =   390 bits (1002),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 205/239 (86%), Positives = 221/239 (92%), Gaps = 0/239 (0%)
 Frame = +1

Query  37   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  216
            MDSD+G+ RELSDLQKLRSQY+PELPPCLQG TVRVEFGD TT+ DP+  HTISR FPHT
Sbjct  1    MDSDYGIPRELSDLQKLRSQYQPELPPCLQGATVRVEFGDTTTSLDPTDSHTISRYFPHT  60

Query  217  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  396
            +GQPLAHFLRA+AKVP AQ+ITEHP +RVGIVFCGRQSPGGHN IWGL++ALKVHNPN+T
Sbjct  61   YGQPLAHFLRATAKVPGAQVITEHPPVRVGIVFCGRQSPGGHNVIWGLHNALKVHNPNNT  120

Query  397  llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  576
            LLGFLGGSEGLFAQKTLEITD+ILATYKNQGGYD+LGRTKDQIR+ EQVNA LTAC  LK
Sbjct  121  LLGFLGGSEGLFAQKTLEITDEILATYKNQGGYDLLGRTKDQIRTVEQVNATLTACKDLK  180

Query  577  LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            LDGLVI+GGVTSNTDAA LAE FAEAKC TKVVGVPVTLNGDLKNQFVE NVGFDTICK
Sbjct  181  LDGLVIIGGVTSNTDAAQLAETFAEAKCSTKVVGVPVTLNGDLKNQFVEANVGFDTICK  239



>ref|XP_003529192.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha-like [Glycine max]
Length=617

 Score =   390 bits (1002),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 205/239 (86%), Positives = 222/239 (93%), Gaps = 0/239 (0%)
 Frame = +1

Query  37   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  216
            MDSD+G+ RELSDLQK+RS Y+PELPPCLQGTTVRVEFGDATT ADP+   TISR FP+T
Sbjct  1    MDSDYGIPRELSDLQKIRSLYQPELPPCLQGTTVRVEFGDATTTADPTDALTISRAFPNT  60

Query  217  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  396
            +G PLAHFLRA+AKVPDAQIITE P IRVGIVFCGRQSPGGHN IWGL++ALK+HNPNS 
Sbjct  61   YGHPLAHFLRATAKVPDAQIITEFPPIRVGIVFCGRQSPGGHNVIWGLHNALKIHNPNSV  120

Query  397  llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  576
            LLGFLGGSEGLFAQKTLEIT+DIL+TYKNQGGYD+LGRTKDQIR+TEQVNAAL AC +LK
Sbjct  121  LLGFLGGSEGLFAQKTLEITEDILSTYKNQGGYDLLGRTKDQIRTTEQVNAALAACNNLK  180

Query  577  LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            LDGLVI+GGVTSNTDAA LAE FA AKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK
Sbjct  181  LDGLVIIGGVTSNTDAAQLAETFAVAKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  239



>ref|XP_010927304.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha [Elaeis guineensis]
 ref|XP_010927305.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha [Elaeis guineensis]
Length=617

 Score =   390 bits (1002),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 203/239 (85%), Positives = 223/239 (93%), Gaps = 0/239 (0%)
 Frame = +1

Query  37   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  216
            MDSD+G+ RELSDLQK R+ Y+PELPPCLQGTTVRVEFGDATTAADP+  H I + FPHT
Sbjct  1    MDSDYGVPRELSDLQKQRTLYQPELPPCLQGTTVRVEFGDATTAADPASAHVIGQNFPHT  60

Query  217  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  396
            +GQPLAHFLRA+AKVPDAQIITEHPAIRVG+VF GRQSPGGHN IWGLYDA+K HN NST
Sbjct  61   YGQPLAHFLRATAKVPDAQIITEHPAIRVGVVFSGRQSPGGHNVIWGLYDAIKAHNRNST  120

Query  397  llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  576
            LLGF+GG+EGLFAQKTLEITDDIL+TYKNQGGYD+LGRTKDQIR+TEQVNAA+TAC +LK
Sbjct  121  LLGFVGGTEGLFAQKTLEITDDILSTYKNQGGYDLLGRTKDQIRTTEQVNAAMTACQALK  180

Query  577  LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            LDGLVI+GGVTSNTDAA LAE FAE++C TKVVGVPVTLNGDLKNQFVETNVGFDTICK
Sbjct  181  LDGLVIIGGVTSNTDAAQLAETFAESQCSTKVVGVPVTLNGDLKNQFVETNVGFDTICK  239



>gb|KCW68157.1| hypothetical protein EUGRSUZ_F018231 [Eucalyptus grandis]
Length=520

 Score =   387 bits (993),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 205/239 (86%), Positives = 223/239 (93%), Gaps = 0/239 (0%)
 Frame = +1

Query  37   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  216
            M+SD+G+ RELSDLQK RS Y+P+LPPCLQGTTVRVEFGDATTAADP+G HTISR FPHT
Sbjct  1    MESDYGIPRELSDLQKHRSLYQPDLPPCLQGTTVRVEFGDATTAADPAGSHTISRSFPHT  60

Query  217  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  396
            +GQPLAHFLRA+AKV DAQIITEHPA RVGIVFCGRQSPGGHN +WGLY ALK+HNP+S 
Sbjct  61   YGQPLAHFLRATAKVADAQIITEHPAKRVGIVFCGRQSPGGHNVVWGLYSALKIHNPSSV  120

Query  397  llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  576
            LLGFLGGSEGLFAQKTLEITD+IL+TYKNQGGYD+LGRTKDQIR+TEQVNAALT C +LK
Sbjct  121  LLGFLGGSEGLFAQKTLEITDEILSTYKNQGGYDLLGRTKDQIRTTEQVNAALTTCKNLK  180

Query  577  LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            LDGLVI+GGVTSNTDAA LAE FAEAKC TKVVGVPVTLNGDLKN FVET+VGFDTICK
Sbjct  181  LDGLVIIGGVTSNTDAAQLAETFAEAKCSTKVVGVPVTLNGDLKNPFVETDVGFDTICK  239



>ref|XP_010063177.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha [Eucalyptus grandis]
 gb|KCW70370.1| hypothetical protein EUGRSUZ_F03611 [Eucalyptus grandis]
Length=616

 Score =   390 bits (1002),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 206/239 (86%), Positives = 220/239 (92%), Gaps = 0/239 (0%)
 Frame = +1

Query  37   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  216
            MDSD+G+ RELSDLQK RS Y PELPPCLQGTTVRVE+GDATTAADP+  H+ISR FPHT
Sbjct  1    MDSDYGIPRELSDLQKQRSLYHPELPPCLQGTTVRVEYGDATTAADPADVHSISRYFPHT  60

Query  217  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  396
            +GQPLAHFLRA+A VPDA IITEHP IRVGIVFCGRQSPGGHN IWGLY ALK+HNP + 
Sbjct  61   YGQPLAHFLRATANVPDALIITEHPPIRVGIVFCGRQSPGGHNVIWGLYHALKIHNPKNV  120

Query  397  llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  576
            LLGFLGGSEGLFAQKTLEITDDIL+TYKNQGGYD+LGRTKDQIR+TEQVNAAL +C  LK
Sbjct  121  LLGFLGGSEGLFAQKTLEITDDILSTYKNQGGYDLLGRTKDQIRTTEQVNAALISCNDLK  180

Query  577  LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            LDGLVI+GGVTSNTDAA LAE FAEAKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK
Sbjct  181  LDGLVIIGGVTSNTDAAQLAETFAEAKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  239



>gb|AIE47261.1| pyrophosphate-dependent phosphofructokinase [Hevea brasiliensis]
Length=617

 Score =   389 bits (1000),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 203/239 (85%), Positives = 223/239 (93%), Gaps = 0/239 (0%)
 Frame = +1

Query  37   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  216
            MDSDFG+ RELS+LQKLRS Y P+LPPCLQGTTVRVEFGD+TTAAD +G  TISR FPHT
Sbjct  1    MDSDFGIPRELSELQKLRSIYEPDLPPCLQGTTVRVEFGDSTTAADAAGARTISRYFPHT  60

Query  217  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  396
            +GQPLAHFLRA+AKVPDA IITEHPA+RVGIVFCGRQSPGGHN +WGL +ALK+HNPNST
Sbjct  61   YGQPLAHFLRATAKVPDAHIITEHPAMRVGIVFCGRQSPGGHNVVWGLLNALKIHNPNST  120

Query  397  llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  576
            LLGFLGGSEGLFAQ+TLEITD++L+TYKNQGGYD+LGRT+DQIR+TEQVNAALT C  +K
Sbjct  121  LLGFLGGSEGLFAQRTLEITDEVLSTYKNQGGYDLLGRTRDQIRTTEQVNAALTTCKDMK  180

Query  577  LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            LDGLVI+GGVTSNTDAA LAE FAEAKC TKVVGVPVTLNGDLKNQFVETNVGFDTICK
Sbjct  181  LDGLVIIGGVTSNTDAAQLAETFAEAKCSTKVVGVPVTLNGDLKNQFVETNVGFDTICK  239



>ref|XP_008453023.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha [Cucumis melo]
Length=619

 Score =   389 bits (1000),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 204/239 (85%), Positives = 220/239 (92%), Gaps = 0/239 (0%)
 Frame = +1

Query  37   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  216
            MDSD+G+ R+LSDLQK+RS Y+P+LPPCLQGT VRVEFGDATTA DP+   TI R FPHT
Sbjct  1    MDSDYGIPRQLSDLQKIRSLYQPDLPPCLQGTAVRVEFGDATTAVDPADAPTICRAFPHT  60

Query  217  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  396
            +GQPLAHFLRA+AKVPDAQIITEHPAIRVG+VFCGRQSPGGHN IWGL+DALK+HNPNS 
Sbjct  61   YGQPLAHFLRATAKVPDAQIITEHPAIRVGVVFCGRQSPGGHNVIWGLHDALKIHNPNSI  120

Query  397  llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  576
            L GFLGGSEGLFAQKTLEITDDIL+TYKNQGGYD+LGRTKDQIR+ EQVNAAL  C  LK
Sbjct  121  LFGFLGGSEGLFAQKTLEITDDILSTYKNQGGYDLLGRTKDQIRTKEQVNAALKTCLDLK  180

Query  577  LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            LDGLVI+GGVTSNTDAA LAE FAEAKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK
Sbjct  181  LDGLVIIGGVTSNTDAAQLAETFAEAKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  239



>ref|XP_008346428.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha [Malus domestica]
Length=617

 Score =   389 bits (1000),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 204/239 (85%), Positives = 221/239 (92%), Gaps = 0/239 (0%)
 Frame = +1

Query  37   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  216
            MDSD+G+ RELSDLQKLRSQY+PELPPCLQG TVRVEFGD TT+ DP+  HTISR FPHT
Sbjct  1    MDSDYGIPRELSDLQKLRSQYQPELPPCLQGATVRVEFGDTTTSLDPTDSHTISRYFPHT  60

Query  217  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  396
            +GQPLAHFLRA+AKVP AQ+ITEHP +RVG+VFCGRQSPGGHN IWGL++ALKVHNPN+T
Sbjct  61   YGQPLAHFLRATAKVPGAQVITEHPPVRVGVVFCGRQSPGGHNVIWGLHNALKVHNPNNT  120

Query  397  llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  576
            LLGFLGGSEGLFAQKTLEITD+ILATYKNQGGYD+LGRTKDQIR+ EQVNA LTAC  LK
Sbjct  121  LLGFLGGSEGLFAQKTLEITDEILATYKNQGGYDLLGRTKDQIRTVEQVNATLTACKDLK  180

Query  577  LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            LDGLVI+GGVTSNTDAA LAE FAEAKC TKVVGVPVTLNGDLKNQFVE NVGFDTICK
Sbjct  181  LDGLVIIGGVTSNTDAAQLAETFAEAKCSTKVVGVPVTLNGDLKNQFVEANVGFDTICK  239



>ref|XP_008373335.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha [Malus domestica]
Length=617

 Score =   389 bits (1000),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 204/239 (85%), Positives = 221/239 (92%), Gaps = 0/239 (0%)
 Frame = +1

Query  37   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  216
            MDSD+G+ RELSDLQKLRSQY+PELPPCLQG TVRVEFGD TT+ DP+  HTISR FPHT
Sbjct  1    MDSDYGIPRELSDLQKLRSQYQPELPPCLQGATVRVEFGDTTTSLDPTDSHTISRYFPHT  60

Query  217  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  396
            +GQPLAHFLRA+AKVP AQ+ITEHP +RVG+VFCGRQSPGGHN IWGL++ALKVHNPN+T
Sbjct  61   YGQPLAHFLRATAKVPGAQVITEHPPVRVGVVFCGRQSPGGHNVIWGLHNALKVHNPNNT  120

Query  397  llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  576
            LLGFLGGSEGLFAQKTLEITD+ILATYKNQGGYD+LGRTKDQIR+ EQVNA LTAC  LK
Sbjct  121  LLGFLGGSEGLFAQKTLEITDEILATYKNQGGYDLLGRTKDQIRTVEQVNATLTACKDLK  180

Query  577  LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            LDGLVI+GGVTSNTDAA LAE FAEAKC TKVVGVPVTLNGDLKNQFVE NVGFDTICK
Sbjct  181  LDGLVIIGGVTSNTDAAQLAETFAEAKCSTKVVGVPVTLNGDLKNQFVEANVGFDTICK  239



>ref|XP_010537247.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha 2 [Tarenaya hassleriana]
Length=610

 Score =   389 bits (998),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 203/239 (85%), Positives = 221/239 (92%), Gaps = 0/239 (0%)
 Frame = +1

Query  37   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  216
            MDSDFG+ RELS LQ+LRSQY+PELPPCLQGTTVRVEFGD  T ++ +  H +SR FPHT
Sbjct  1    MDSDFGIPRELSPLQQLRSQYQPELPPCLQGTTVRVEFGDGATVSEAADAHVVSRAFPHT  60

Query  217  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  396
            + QPLAHFLRA+AKVPDAQIITEHPAIRVG+VFCGRQSPGGHN IWGLY+AL+VHNP S 
Sbjct  61   YSQPLAHFLRATAKVPDAQIITEHPAIRVGVVFCGRQSPGGHNVIWGLYEALQVHNPKSN  120

Query  397  llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  576
            LLGF+GGSEGLFA+KTLEITDDIL TYKNQGGYD+LGRTKDQIR+TEQVNAAL ACT LK
Sbjct  121  LLGFVGGSEGLFAKKTLEITDDILQTYKNQGGYDLLGRTKDQIRTTEQVNAALAACTELK  180

Query  577  LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            LDGLVI+GGVTSNTDAAYLAE FAEAKCPTKVVGVPVT+NGDLKNQFVETNVGFDTICK
Sbjct  181  LDGLVIIGGVTSNTDAAYLAEFFAEAKCPTKVVGVPVTINGDLKNQFVETNVGFDTICK  239



>ref|XP_003555655.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha-like [Glycine max]
 gb|KHM99024.1| Pyrophosphate--fructose 6-phosphate 1-phosphotransferase subunit 
alpha [Glycine soja]
Length=617

 Score =   387 bits (995),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 202/239 (85%), Positives = 220/239 (92%), Gaps = 0/239 (0%)
 Frame = +1

Query  37   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  216
            MDSD+G+ RELSDLQK+RS Y+PELPPCLQGTTVRVEFGDATT ADP+   T+ R FP+T
Sbjct  1    MDSDYGIPRELSDLQKIRSLYQPELPPCLQGTTVRVEFGDATTTADPTDALTVCRAFPNT  60

Query  217  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  396
            +G PLAHFLRA+AKVPDAQIITE P IRVGIVFCGRQSPGGHN IWG+++ALK+HNPNS 
Sbjct  61   YGHPLAHFLRATAKVPDAQIITEFPPIRVGIVFCGRQSPGGHNVIWGIHNALKIHNPNSV  120

Query  397  llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  576
            LLGFLGGSEGLFAQKTLEITDDIL+TYKNQGGYD+LGRTKDQIR+TEQVNAAL AC +LK
Sbjct  121  LLGFLGGSEGLFAQKTLEITDDILSTYKNQGGYDLLGRTKDQIRTTEQVNAALAACNNLK  180

Query  577  LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            LDGLVI+GGVTSNTDAA LAE F  AKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK
Sbjct  181  LDGLVIIGGVTSNTDAAQLAETFVVAKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  239



>gb|KCW68155.1| hypothetical protein EUGRSUZ_F018231, partial [Eucalyptus grandis]
Length=575

 Score =   386 bits (991),  Expect = 9e-128, Method: Compositional matrix adjust.
 Identities = 205/239 (86%), Positives = 223/239 (93%), Gaps = 0/239 (0%)
 Frame = +1

Query  37   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  216
            M+SD+G+ RELSDLQK RS Y+P+LPPCLQGTTVRVEFGDATTAADP+G HTISR FPHT
Sbjct  1    MESDYGIPRELSDLQKHRSLYQPDLPPCLQGTTVRVEFGDATTAADPAGSHTISRSFPHT  60

Query  217  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  396
            +GQPLAHFLRA+AKV DAQIITEHPA RVGIVFCGRQSPGGHN +WGLY ALK+HNP+S 
Sbjct  61   YGQPLAHFLRATAKVADAQIITEHPAKRVGIVFCGRQSPGGHNVVWGLYSALKIHNPSSV  120

Query  397  llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  576
            LLGFLGGSEGLFAQKTLEITD+IL+TYKNQGGYD+LGRTKDQIR+TEQVNAALT C +LK
Sbjct  121  LLGFLGGSEGLFAQKTLEITDEILSTYKNQGGYDLLGRTKDQIRTTEQVNAALTTCKNLK  180

Query  577  LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            LDGLVI+GGVTSNTDAA LAE FAEAKC TKVVGVPVTLNGDLKN FVET+VGFDTICK
Sbjct  181  LDGLVIIGGVTSNTDAAQLAETFAEAKCSTKVVGVPVTLNGDLKNPFVETDVGFDTICK  239



>ref|XP_010061240.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha [Eucalyptus grandis]
Length=617

 Score =   387 bits (995),  Expect = 9e-128, Method: Compositional matrix adjust.
 Identities = 205/239 (86%), Positives = 223/239 (93%), Gaps = 0/239 (0%)
 Frame = +1

Query  37   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  216
            M+SD+G+ RELSDLQK RS Y+P+LPPCLQGTTVRVEFGDATTAADP+G HTISR FPHT
Sbjct  1    MESDYGIPRELSDLQKHRSLYQPDLPPCLQGTTVRVEFGDATTAADPAGSHTISRSFPHT  60

Query  217  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  396
            +GQPLAHFLRA+AKV DAQIITEHPA RVGIVFCGRQSPGGHN +WGLY ALK+HNP+S 
Sbjct  61   YGQPLAHFLRATAKVADAQIITEHPAKRVGIVFCGRQSPGGHNVVWGLYSALKIHNPSSV  120

Query  397  llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  576
            LLGFLGGSEGLFAQKTLEITD+IL+TYKNQGGYD+LGRTKDQIR+TEQVNAALT C +LK
Sbjct  121  LLGFLGGSEGLFAQKTLEITDEILSTYKNQGGYDLLGRTKDQIRTTEQVNAALTTCKNLK  180

Query  577  LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            LDGLVI+GGVTSNTDAA LAE FAEAKC TKVVGVPVTLNGDLKN FVET+VGFDTICK
Sbjct  181  LDGLVIIGGVTSNTDAAQLAETFAEAKCSTKVVGVPVTLNGDLKNPFVETDVGFDTICK  239



>ref|XP_010266302.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha isoform X2 [Nelumbo nucifera]
Length=597

 Score =   387 bits (993),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 199/239 (83%), Positives = 219/239 (92%), Gaps = 0/239 (0%)
 Frame = +1

Query  37   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  216
            MDSDFG+ R+LSDLQK R+ Y PELPPCLQGTTVRVEFGDATT ADPSG H+ISR FPHT
Sbjct  1    MDSDFGIPRQLSDLQKYRALYEPELPPCLQGTTVRVEFGDATTTADPSGAHSISRAFPHT  60

Query  217  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  396
            +GQPLAHFLR  A+VPDAQIITEHPAIRVG+VFCGRQSPGGHN IWGL+ ALK+HN N+ 
Sbjct  61   YGQPLAHFLRPKAQVPDAQIITEHPAIRVGVVFCGRQSPGGHNVIWGLHSALKIHNSNNV  120

Query  397  llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  576
            LLGF+GG+EGLFAQKTLEITDDIL++YKNQGGYD+LGRTKDQIR++EQVNAAL +C +LK
Sbjct  121  LLGFIGGTEGLFAQKTLEITDDILSSYKNQGGYDLLGRTKDQIRTSEQVNAALASCKALK  180

Query  577  LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            LDGLVI+GGVTSNTDAA LAE FAE KC TKVVGVPVTLNGDLKNQFVE NVGFDTICK
Sbjct  181  LDGLVIIGGVTSNTDAAQLAETFAEEKCATKVVGVPVTLNGDLKNQFVEANVGFDTICK  239



>gb|KJB29714.1| hypothetical protein B456_005G115600 [Gossypium raimondii]
Length=617

 Score =   387 bits (994),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 201/240 (84%), Positives = 223/240 (93%), Gaps = 1/240 (0%)
 Frame = +1

Query  37   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  216
            MDSD+G+ RELSDLQKLRSQY+P+LPPCL+GTTVRVEFGD TT+ DP+  HTI+R FPHT
Sbjct  1    MDSDYGIPRELSDLQKLRSQYQPQLPPCLEGTTVRVEFGDTTTSLDPADAHTIARAFPHT  60

Query  217  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  396
            +G+PLAHFLRA+AKVPDAQIITEHP IRVG+VFCGRQSP GHN +WGL+ ALK+HNPNST
Sbjct  61   YGKPLAHFLRATAKVPDAQIITEHPTIRVGLVFCGRQSPAGHNVVWGLHKALKIHNPNST  120

Query  397  llgflggseglfAQKTLEITDDILATYKNQ-GGYDMLGRTKDQIRSTEQVNAALTACTSL  573
            LLGFLGG++GLFAQKTLEITDDIL+TYKNQ GGYD+LGRT+DQIR+TEQV AAL AC  L
Sbjct  121  LLGFLGGTQGLFAQKTLEITDDILSTYKNQEGGYDLLGRTQDQIRTTEQVKAALAACNDL  180

Query  574  KLDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            KLDGLVI+GGVTSNTDAA LAE FAEAKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK
Sbjct  181  KLDGLVIIGGVTSNTDAAQLAETFAEAKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  240



>gb|KCW68156.1| hypothetical protein EUGRSUZ_F018231, partial [Eucalyptus grandis]
Length=599

 Score =   386 bits (992),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 205/239 (86%), Positives = 223/239 (93%), Gaps = 0/239 (0%)
 Frame = +1

Query  37   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  216
            M+SD+G+ RELSDLQK RS Y+P+LPPCLQGTTVRVEFGDATTAADP+G HTISR FPHT
Sbjct  1    MESDYGIPRELSDLQKHRSLYQPDLPPCLQGTTVRVEFGDATTAADPAGSHTISRSFPHT  60

Query  217  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  396
            +GQPLAHFLRA+AKV DAQIITEHPA RVGIVFCGRQSPGGHN +WGLY ALK+HNP+S 
Sbjct  61   YGQPLAHFLRATAKVADAQIITEHPAKRVGIVFCGRQSPGGHNVVWGLYSALKIHNPSSV  120

Query  397  llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  576
            LLGFLGGSEGLFAQKTLEITD+IL+TYKNQGGYD+LGRTKDQIR+TEQVNAALT C +LK
Sbjct  121  LLGFLGGSEGLFAQKTLEITDEILSTYKNQGGYDLLGRTKDQIRTTEQVNAALTTCKNLK  180

Query  577  LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            LDGLVI+GGVTSNTDAA LAE FAEAKC TKVVGVPVTLNGDLKN FVET+VGFDTICK
Sbjct  181  LDGLVIIGGVTSNTDAAQLAETFAEAKCSTKVVGVPVTLNGDLKNPFVETDVGFDTICK  239



>ref|XP_010913868.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha-like [Elaeis guineensis]
Length=617

 Score =   387 bits (993),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 194/239 (81%), Positives = 222/239 (93%), Gaps = 0/239 (0%)
 Frame = +1

Query  37   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  216
            M+SDFG+ RELS+LQ+ R++Y PELPPCLQGTTVRVEFGD+TT ADPS  H ISR FPHT
Sbjct  1    MNSDFGVPRELSELQQKRAEYHPELPPCLQGTTVRVEFGDSTTTADPSSAHVISRAFPHT  60

Query  217  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  396
            F QPLAHFLRA+AKVPDAQIITEHP +RVG+VFCGRQSPGGHN +WGLY+A+K+HNP+S 
Sbjct  61   FEQPLAHFLRATAKVPDAQIITEHPPMRVGVVFCGRQSPGGHNVVWGLYNAIKIHNPDSV  120

Query  397  llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  576
            LLGF+GG+EG FAQKTLEITDD+L+TYKNQGGYD+LGRTKDQIR+TEQVNAA+T C +LK
Sbjct  121  LLGFVGGTEGFFAQKTLEITDDVLSTYKNQGGYDLLGRTKDQIRTTEQVNAAMTTCHALK  180

Query  577  LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            LDGLVI+GGVTSN+DAA LAE FAE+KCPTKVVGVPVTLNGDLKNQFVETNVGFDT+C+
Sbjct  181  LDGLVIIGGVTSNSDAAQLAETFAESKCPTKVVGVPVTLNGDLKNQFVETNVGFDTVCR  239



>ref|XP_006386123.1| hypothetical protein POPTR_0002s00490g [Populus trichocarpa]
 gb|ERP63920.1| hypothetical protein POPTR_0002s00490g [Populus trichocarpa]
Length=618

 Score =   387 bits (993),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 203/239 (85%), Positives = 216/239 (90%), Gaps = 0/239 (0%)
 Frame = +1

Query  37   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  216
            MDSDFG+ RELSDLQKLRS Y+P LPPCLQGTTVRVEFGD TT ADP+  H ISR FPHT
Sbjct  1    MDSDFGIPRELSDLQKLRSLYQPGLPPCLQGTTVRVEFGDVTTCADPADVHAISRAFPHT  60

Query  217  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  396
            +GQPLAHFLRA+AKVPDAQIIT+HPA+RVGIVFCGRQSPGGHN +WGL +ALK+HNP ST
Sbjct  61   YGQPLAHFLRATAKVPDAQIITDHPAVRVGIVFCGRQSPGGHNVVWGLQNALKIHNPKST  120

Query  397  llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  576
            LLGFLGGSEG FAQKTLEITDDIL TYKNQGGYD+LGRTKDQIR+TEQV AALTAC  LK
Sbjct  121  LLGFLGGSEGFFAQKTLEITDDILETYKNQGGYDLLGRTKDQIRTTEQVRAALTACKDLK  180

Query  577  LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            LD LVI+GGVTSNTDAA LAE FA  KC TKVVGVPVTLNGDLKNQFVETNVGFDTICK
Sbjct  181  LDALVIIGGVTSNTDAAQLAETFAVEKCQTKVVGVPVTLNGDLKNQFVETNVGFDTICK  239



>ref|XP_002300615.1| pyrophosphate-dependent phosphofructokinase alpha subunit family 
protein [Populus trichocarpa]
 gb|EEE79888.1| pyrophosphate-dependent phosphofructokinase alpha subunit family 
protein [Populus trichocarpa]
Length=617

 Score =   386 bits (992),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 203/239 (85%), Positives = 216/239 (90%), Gaps = 0/239 (0%)
 Frame = +1

Query  37   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  216
            MDSDFG+ RELSDLQKLRS Y+P LPPCLQGTTVRVEFGD TT ADP+  H ISR FPHT
Sbjct  1    MDSDFGIPRELSDLQKLRSLYQPGLPPCLQGTTVRVEFGDVTTCADPADVHAISRAFPHT  60

Query  217  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  396
            +GQPLAHFLRA+AKVPDAQIIT+HPA+RVGIVFCGRQSPGGHN +WGL +ALK+HNP ST
Sbjct  61   YGQPLAHFLRATAKVPDAQIITDHPAVRVGIVFCGRQSPGGHNVVWGLQNALKIHNPKST  120

Query  397  llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  576
            LLGFLGGSEG FAQKTLEITDDIL TYKNQGGYD+LGRTKDQIR+TEQV AALTAC  LK
Sbjct  121  LLGFLGGSEGFFAQKTLEITDDILETYKNQGGYDLLGRTKDQIRTTEQVRAALTACKDLK  180

Query  577  LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            LD LVI+GGVTSNTDAA LAE FA  KC TKVVGVPVTLNGDLKNQFVETNVGFDTICK
Sbjct  181  LDALVIIGGVTSNTDAAQLAETFAVEKCQTKVVGVPVTLNGDLKNQFVETNVGFDTICK  239



>ref|XP_004498195.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha-like isoform X1 [Cicer arietinum]
Length=616

 Score =   386 bits (992),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 204/239 (85%), Positives = 220/239 (92%), Gaps = 0/239 (0%)
 Frame = +1

Query  37   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  216
            MDSD+G+ RELSDLQKLRS Y+PELPPCLQGTTVRVEFGDATT ADPS   +ISR FP+T
Sbjct  1    MDSDYGIPRELSDLQKLRSLYQPELPPCLQGTTVRVEFGDATTTADPSDEPSISRSFPNT  60

Query  217  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  396
            +G PLAHFLRA+AKVPDAQIITEHP IRVG+VFCGRQSPGGHN IWGL+ ALK+HNP S 
Sbjct  61   YGHPLAHFLRATAKVPDAQIITEHPPIRVGLVFCGRQSPGGHNVIWGLHSALKIHNPYSV  120

Query  397  llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  576
            LLGFLGGS+GLFAQKTLEIT+DIL+TYKNQGGYD+LGRTKDQIR+TEQVNAAL AC  LK
Sbjct  121  LLGFLGGSDGLFAQKTLEITEDILSTYKNQGGYDLLGRTKDQIRTTEQVNAALAACNDLK  180

Query  577  LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            LDGLVI+GGVTSNTDAA LAE FA AKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK
Sbjct  181  LDGLVIIGGVTSNTDAAQLAETFAVAKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  239



>ref|XP_010266301.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha isoform X1 [Nelumbo nucifera]
Length=617

 Score =   386 bits (992),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 199/239 (83%), Positives = 219/239 (92%), Gaps = 0/239 (0%)
 Frame = +1

Query  37   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  216
            MDSDFG+ R+LSDLQK R+ Y PELPPCLQGTTVRVEFGDATT ADPSG H+ISR FPHT
Sbjct  1    MDSDFGIPRQLSDLQKYRALYEPELPPCLQGTTVRVEFGDATTTADPSGAHSISRAFPHT  60

Query  217  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  396
            +GQPLAHFLR  A+VPDAQIITEHPAIRVG+VFCGRQSPGGHN IWGL+ ALK+HN N+ 
Sbjct  61   YGQPLAHFLRPKAQVPDAQIITEHPAIRVGVVFCGRQSPGGHNVIWGLHSALKIHNSNNV  120

Query  397  llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  576
            LLGF+GG+EGLFAQKTLEITDDIL++YKNQGGYD+LGRTKDQIR++EQVNAAL +C +LK
Sbjct  121  LLGFIGGTEGLFAQKTLEITDDILSSYKNQGGYDLLGRTKDQIRTSEQVNAALASCKALK  180

Query  577  LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            LDGLVI+GGVTSNTDAA LAE FAE KC TKVVGVPVTLNGDLKNQFVE NVGFDTICK
Sbjct  181  LDGLVIIGGVTSNTDAAQLAETFAEEKCATKVVGVPVTLNGDLKNQFVEANVGFDTICK  239



>ref|XP_010684564.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha [Beta vulgaris subsp. vulgaris]
Length=617

 Score =   386 bits (991),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 203/239 (85%), Positives = 220/239 (92%), Gaps = 0/239 (0%)
 Frame = +1

Query  37   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  216
            MDSDFG+ RELSDLQK RS Y+PELPPCLQGTTVRVE+GD TTA DPS  H ISR FPHT
Sbjct  1    MDSDFGIPRELSDLQKQRSLYQPELPPCLQGTTVRVEYGDGTTAIDPSDVHAISRYFPHT  60

Query  217  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  396
            +GQPLAHFLRA+AKVPDAQIITEHP IRVGIVF GRQSPGGHN +WGLY+ALK+HN N+ 
Sbjct  61   YGQPLAHFLRATAKVPDAQIITEHPTIRVGIVFSGRQSPGGHNVVWGLYNALKIHNTNNI  120

Query  397  llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  576
            LLGFLGG+EGLFAQKTLEITDDIL+TYKNQGGYD+LGRTKDQIR+ EQVNAAL +C +LK
Sbjct  121  LLGFLGGTEGLFAQKTLEITDDILSTYKNQGGYDLLGRTKDQIRTIEQVNAALASCKALK  180

Query  577  LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            LDGLVI+GGVTSNTDAA LAE FAEAKCPTKVVGVPVTLNGDLKNQFVET+VGFDTICK
Sbjct  181  LDGLVIIGGVTSNTDAAQLAETFAEAKCPTKVVGVPVTLNGDLKNQFVETDVGFDTICK  239



>ref|XP_009372651.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha [Pyrus x bretschneideri]
Length=617

 Score =   385 bits (990),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 203/239 (85%), Positives = 219/239 (92%), Gaps = 0/239 (0%)
 Frame = +1

Query  37   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  216
            MDSD+G+ RELSDLQK RSQY+PELPPCLQG TVRVEFGD TT+ DP+  HTISR FPHT
Sbjct  1    MDSDYGIPRELSDLQKHRSQYQPELPPCLQGATVRVEFGDTTTSLDPTDSHTISRYFPHT  60

Query  217  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  396
            +GQPLAHFLRA+AKVP AQ+ITEHP +RVG+VFCGRQSPGGHN IWGL++ALKVHNPN+T
Sbjct  61   YGQPLAHFLRATAKVPGAQVITEHPPVRVGVVFCGRQSPGGHNVIWGLHNALKVHNPNNT  120

Query  397  llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  576
            LLGFLGGSEGLFAQKTLEITD ILATYKNQGGYD+LGRTKDQIR+ EQVNA LTAC  LK
Sbjct  121  LLGFLGGSEGLFAQKTLEITDQILATYKNQGGYDLLGRTKDQIRTVEQVNATLTACKDLK  180

Query  577  LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            LDGLVI+GGVTSNTDAA LAE FAEAKC TKVVGVPVTLNGDLKNQFVE NVGFDTICK
Sbjct  181  LDGLVIIGGVTSNTDAAQLAETFAEAKCSTKVVGVPVTLNGDLKNQFVEANVGFDTICK  239



>ref|XP_010539758.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha 2-like [Tarenaya hassleriana]
Length=613

 Score =   385 bits (988),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 201/239 (84%), Positives = 219/239 (92%), Gaps = 0/239 (0%)
 Frame = +1

Query  37   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  216
            MDSDFG+ RELS LQ+LRSQY+PELPPCLQGTTVRVEFGD TT A+ +  H ISR FPHT
Sbjct  1    MDSDFGIPRELSPLQQLRSQYQPELPPCLQGTTVRVEFGDGTTVAEAADAHIISRAFPHT  60

Query  217  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  396
            + QPLAHFLRA++KVPDAQIITEHPAIRVG+VF GRQSPGGHN IWGLY+ALKVHNP S 
Sbjct  61   YSQPLAHFLRATSKVPDAQIITEHPAIRVGVVFSGRQSPGGHNVIWGLYEALKVHNPKSA  120

Query  397  llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  576
            LLGF+GGSEGLFA+ TLEITDDIL TYKNQGGYD+LGRTKDQIR+TEQVNAAL +CT LK
Sbjct  121  LLGFVGGSEGLFAKNTLEITDDILQTYKNQGGYDLLGRTKDQIRTTEQVNAALASCTELK  180

Query  577  LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            LDGLVI+GGVTSNTDAA+LAE FAE KCPTKVVGVPVT+NGDLKNQFVETNVGFDTICK
Sbjct  181  LDGLVIIGGVTSNTDAAHLAEFFAETKCPTKVVGVPVTINGDLKNQFVETNVGFDTICK  239



>ref|XP_004145564.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha-like [Cucumis sativus]
 ref|XP_004157061.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha-like [Cucumis sativus]
 gb|KGN55545.1| hypothetical protein Csa_4G664520 [Cucumis sativus]
Length=619

 Score =   384 bits (986),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 202/239 (85%), Positives = 218/239 (91%), Gaps = 0/239 (0%)
 Frame = +1

Query  37   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  216
            MDSD+G+ R+LSDLQK+RS Y+P+LPPCLQGT VRVEFGD TTA DP+   T+SR FPHT
Sbjct  1    MDSDYGIPRQLSDLQKIRSLYQPDLPPCLQGTAVRVEFGDGTTAVDPADAPTVSRAFPHT  60

Query  217  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  396
            +GQ LAHFLRA+AKVPDAQIITEHPAIRVG+VFCGRQSPGGHN IWGL+DALKVHNPNS 
Sbjct  61   YGQRLAHFLRATAKVPDAQIITEHPAIRVGVVFCGRQSPGGHNVIWGLHDALKVHNPNSI  120

Query  397  llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  576
            L GFLGGSEGLF+QKTLEITDDIL TYKNQGGYD+LGRTKDQIR+ EQVNAAL  C  LK
Sbjct  121  LFGFLGGSEGLFSQKTLEITDDILTTYKNQGGYDLLGRTKDQIRTKEQVNAALKTCLDLK  180

Query  577  LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            LDGLVI+GGVTSNTDAA LAE FAEAKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK
Sbjct  181  LDGLVIIGGVTSNTDAAQLAETFAEAKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  239



>ref|XP_007210294.1| hypothetical protein PRUPE_ppa002571mg [Prunus persica]
 gb|EMJ11493.1| hypothetical protein PRUPE_ppa002571mg [Prunus persica]
Length=657

 Score =   384 bits (986),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 201/241 (83%), Positives = 218/241 (90%), Gaps = 0/241 (0%)
 Frame = +1

Query  31   VKMDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFP  210
            + MDSD+G+ RELSD+QK RSQY+PELPPCLQG TVRVEFGD TT+ DP+  HTI R FP
Sbjct  39   ISMDSDYGIPRELSDVQKFRSQYQPELPPCLQGATVRVEFGDTTTSLDPTDAHTIGRYFP  98

Query  211  HTFGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPN  390
            HT+GQPLAHFLRA+AKVP AQ+ITEHP  RVG+VFCGRQSPGGHN IWGL++ALKVHNP 
Sbjct  99   HTYGQPLAHFLRATAKVPGAQVITEHPPFRVGVVFCGRQSPGGHNVIWGLHNALKVHNPK  158

Query  391  STllgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTS  570
            STLLGFLGGSEGLFAQKTLEITD+ILATYKNQGGYD+LGRTKDQIR+ EQVNA LTAC  
Sbjct  159  STLLGFLGGSEGLFAQKTLEITDEILATYKNQGGYDLLGRTKDQIRTVEQVNATLTACKD  218

Query  571  LKLDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTIC  750
            LKLDGLVI+GGVTSNTDAA LAE FAEAKC TKVVGVPVTLNGDLKNQFVE NVGFDTIC
Sbjct  219  LKLDGLVIIGGVTSNTDAAQLAETFAEAKCQTKVVGVPVTLNGDLKNQFVEANVGFDTIC  278

Query  751  K  753
            K
Sbjct  279  K  279



>ref|XP_002276269.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha [Vitis vinifera]
Length=616

 Score =   383 bits (983),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 202/239 (85%), Positives = 221/239 (92%), Gaps = 0/239 (0%)
 Frame = +1

Query  37   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  216
            MDSDFG+ RELSDLQK R  Y PELPPCLQGTTVRVEFGDATTA+D SG  TISR FPHT
Sbjct  1    MDSDFGIPRELSDLQKHRCLYEPELPPCLQGTTVRVEFGDATTASDLSGARTISRSFPHT  60

Query  217  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  396
            +GQPLAHFLRA+AKVPDAQ+ITEHP IRVG+VFCGRQSPGGHN IWGL++ALK+HNP + 
Sbjct  61   YGQPLAHFLRATAKVPDAQVITEHPPIRVGVVFCGRQSPGGHNVIWGLHNALKIHNPKNI  120

Query  397  llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  576
            LLGFLGGSEGLFAQKTLEITDDIL+TYKNQGGYD+LGRTKDQIR+TEQVNAAL+ C +LK
Sbjct  121  LLGFLGGSEGLFAQKTLEITDDILSTYKNQGGYDLLGRTKDQIRTTEQVNAALSTCKNLK  180

Query  577  LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            L+GLVI+GGVTSNTDAA LAE FAEAKC TKVVGVPV+LNGDLKNQFVE+NVGFDTICK
Sbjct  181  LEGLVIIGGVTSNTDAAQLAETFAEAKCQTKVVGVPVSLNGDLKNQFVESNVGFDTICK  239



>ref|XP_008237897.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha [Prunus mume]
Length=668

 Score =   384 bits (986),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 201/241 (83%), Positives = 218/241 (90%), Gaps = 0/241 (0%)
 Frame = +1

Query  31   VKMDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFP  210
            + MDSD+G+ RELSD+QK RSQY+PELPPCLQG TVRVEFGD TT+ DP+  HTI R FP
Sbjct  50   ISMDSDYGIPRELSDVQKFRSQYQPELPPCLQGATVRVEFGDTTTSLDPTDAHTIGRYFP  109

Query  211  HTFGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPN  390
            HT+GQPLAHFLRA+AKVP AQ+ITEHP  RVG+VFCGRQSPGGHN IWGL++ALKVHNP 
Sbjct  110  HTYGQPLAHFLRATAKVPGAQVITEHPPFRVGVVFCGRQSPGGHNVIWGLHNALKVHNPK  169

Query  391  STllgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTS  570
            STLLGFLGGSEGLFAQKTLEITD+ILATYKNQGGYD+LGRTKDQIR+ EQVNA LTAC  
Sbjct  170  STLLGFLGGSEGLFAQKTLEITDEILATYKNQGGYDLLGRTKDQIRTVEQVNATLTACKD  229

Query  571  LKLDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTIC  750
            LKLDGLVI+GGVTSNTDAA LAE FAEAKC TKVVGVPVTLNGDLKNQFVE NVGFDTIC
Sbjct  230  LKLDGLVIIGGVTSNTDAAQLAETFAEAKCQTKVVGVPVTLNGDLKNQFVEANVGFDTIC  289

Query  751  K  753
            K
Sbjct  290  K  290



>ref|XP_010932134.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha [Elaeis guineensis]
Length=622

 Score =   380 bits (977),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 197/239 (82%), Positives = 221/239 (92%), Gaps = 0/239 (0%)
 Frame = +1

Query  37   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  216
            MDSD+G+ RELSD Q+ R+ Y+PELPPCLQGTTVRVEFGDATTAADP+  H I + FPHT
Sbjct  1    MDSDYGVPRELSDTQRQRTLYQPELPPCLQGTTVRVEFGDATTAADPASAHVIGQNFPHT  60

Query  217  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  396
            +GQ LAHFLRA+AKVPDAQIITEHPA RVG+VF GRQSPGGHN +WGLYDA+K HNP+ST
Sbjct  61   YGQSLAHFLRATAKVPDAQIITEHPATRVGVVFSGRQSPGGHNVVWGLYDAIKAHNPHST  120

Query  397  llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  576
            LLGF+GG+EGLFAQKTLEITDDIL+TYKNQGGYD+LGRTKDQIR+ EQVNAA+TAC +LK
Sbjct  121  LLGFVGGTEGLFAQKTLEITDDILSTYKNQGGYDLLGRTKDQIRTAEQVNAAMTACQTLK  180

Query  577  LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            L+GLVI+GGVTSN DAA+LAE FAE+KCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK
Sbjct  181  LNGLVILGGVTSNMDAAHLAETFAESKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  239



>ref|XP_008775478.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha-like [Phoenix dactylifera]
Length=617

 Score =   380 bits (975),  Expect = 9e-125, Method: Compositional matrix adjust.
 Identities = 194/239 (81%), Positives = 221/239 (92%), Gaps = 0/239 (0%)
 Frame = +1

Query  37   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  216
            M+SDFG+ RELS+LQ+ R++Y  ELPPCLQGTTVRVEFGD+TT ADPS  H ISR FPHT
Sbjct  1    MNSDFGVPRELSELQQKRAEYLAELPPCLQGTTVRVEFGDSTTTADPSSAHVISRAFPHT  60

Query  217  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  396
            FGQPLAHFLRA+AKVPDAQIITEHP +RVGIVF GRQSPGGHN +WGL++ALK+HNP+S 
Sbjct  61   FGQPLAHFLRATAKVPDAQIITEHPPMRVGIVFSGRQSPGGHNVVWGLHNALKIHNPDSV  120

Query  397  llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  576
            LLGFLGG+EG FAQKTLEIT+D+L+TYKNQGGYD+LGRTKDQIR+TEQVNAA+T C +LK
Sbjct  121  LLGFLGGTEGFFAQKTLEITNDVLSTYKNQGGYDLLGRTKDQIRTTEQVNAAMTTCRALK  180

Query  577  LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            LDGLVI+GGVTSN+DAA LAE FAE+KCPTKVVGVPVTLNGDLKNQFVETNVGFDT+C+
Sbjct  181  LDGLVIIGGVTSNSDAAQLAETFAESKCPTKVVGVPVTLNGDLKNQFVETNVGFDTVCR  239



>ref|XP_007153134.1| hypothetical protein PHAVU_003G009600g [Phaseolus vulgaris]
 gb|ESW25128.1| hypothetical protein PHAVU_003G009600g [Phaseolus vulgaris]
Length=617

 Score =   379 bits (974),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 200/239 (84%), Positives = 218/239 (91%), Gaps = 0/239 (0%)
 Frame = +1

Query  37   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  216
            MDSD+G+ RELSDLQK+RS Y+PELPPCLQGTTVRVEFGDATT+ADP+   TISR FP+T
Sbjct  1    MDSDYGIPRELSDLQKIRSLYQPELPPCLQGTTVRVEFGDATTSADPTDALTISRAFPNT  60

Query  217  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  396
            +G PLAHFLRA+AKVPDAQIITE P IRVGIVFCGRQSPGGHN IWGL++ALK HN NS 
Sbjct  61   YGHPLAHFLRATAKVPDAQIITEFPPIRVGIVFCGRQSPGGHNVIWGLHNALKTHNSNSV  120

Query  397  llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  576
            LLGFLGGSEGLFAQKTLEITD +L++YKNQGGYD+LGRTKDQIR+TEQVNAAL  C +LK
Sbjct  121  LLGFLGGSEGLFAQKTLEITDSVLSSYKNQGGYDLLGRTKDQIRTTEQVNAALATCNNLK  180

Query  577  LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            LDGLVI+GGVTSNTDAA LAE FA A CPTKVVGVPVTLNGDLKNQFVETNVGFDTICK
Sbjct  181  LDGLVIIGGVTSNTDAAQLAETFAVANCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  239



>ref|XP_009391869.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha {ECO:0000255|HAMAP-Rule:MF_03185}-like 
[Musa acuminata subsp. malaccensis]
Length=618

 Score =   379 bits (974),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 195/239 (82%), Positives = 219/239 (92%), Gaps = 0/239 (0%)
 Frame = +1

Query  37   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  216
            M+SDFG+ RELS+LQK R++Y PELPPCLQGTTVRVEFGD+TT ADPS  H I R FPHT
Sbjct  1    MESDFGVPRELSELQKKRAEYHPELPPCLQGTTVRVEFGDSTTCADPSSEHVIGRAFPHT  60

Query  217  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  396
            FGQPLAHFLRA+AKVPDAQIITEHP +RVG+VFCGRQSPGGHN +WGLY A+K+HNP+S 
Sbjct  61   FGQPLAHFLRATAKVPDAQIITEHPPMRVGVVFCGRQSPGGHNVVWGLYSAIKIHNPDSI  120

Query  397  llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  576
            LLGF+GG+EGLFAQ+TLEITD++LATYKNQGGYD+LGRT DQIR+TEQVNAALTAC  LK
Sbjct  121  LLGFVGGTEGLFAQRTLEITDEVLATYKNQGGYDLLGRTVDQIRTTEQVNAALTACRDLK  180

Query  577  LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            LDGLVIVGGVTSN+DAA LAE FAEAKCPTKVVGVPVT  GDLKNQFVET+VGFDT+C+
Sbjct  181  LDGLVIVGGVTSNSDAAQLAETFAEAKCPTKVVGVPVTFYGDLKNQFVETDVGFDTVCR  239



>ref|XP_009410339.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha {ECO:0000255|HAMAP-Rule:MF_03185} [Musa 
acuminata subsp. malaccensis]
Length=613

 Score =   379 bits (973),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 196/239 (82%), Positives = 220/239 (92%), Gaps = 0/239 (0%)
 Frame = +1

Query  37   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  216
            MDSD+G+ RELSDLQKLR+ Y+P LPPC+QGTTVRVEFGDATT +DP+G H IS+ FPHT
Sbjct  1    MDSDYGVLRELSDLQKLRALYQPGLPPCVQGTTVRVEFGDATTTSDPAGAHVISQAFPHT  60

Query  217  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  396
            +GQPLAHFLR +AKVPDAQII E PAIRVG+VFCGRQSPGGHN IWGL+ A+K HNPNST
Sbjct  61   YGQPLAHFLRPTAKVPDAQIIVEQPAIRVGVVFCGRQSPGGHNVIWGLHSAIKSHNPNST  120

Query  397  llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  576
            LLGF+GG+EGLFA+KTLEIT+DIL+TY+NQGGYD+LGRTKDQIR+TEQVNAA++AC  LK
Sbjct  121  LLGFVGGTEGLFAKKTLEITNDILSTYQNQGGYDLLGRTKDQIRTTEQVNAAMSACQELK  180

Query  577  LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            LDGLVI+GGVTSNTDAA LAE FAE KC TKVVGVPVTLNGDLKNQFVETNVGFDTICK
Sbjct  181  LDGLVIIGGVTSNTDAAQLAETFAELKCSTKVVGVPVTLNGDLKNQFVETNVGFDTICK  239



>ref|XP_008802157.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha-like [Phoenix dactylifera]
Length=617

 Score =   379 bits (972),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 199/239 (83%), Positives = 219/239 (92%), Gaps = 0/239 (0%)
 Frame = +1

Query  37   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  216
            MDS +G+ RELS LQK R+ Y+P LPPCLQ TTVRVEFGDATT+ADP+G H IS+ FP T
Sbjct  1    MDSAYGVPRELSGLQKQRALYQPGLPPCLQDTTVRVEFGDATTSADPAGAHVISQYFPRT  60

Query  217  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  396
            +GQPLAHFLRA AKVPDAQIITEHPAIRVG+VF GRQSPGGHN IWGLYDA+K HN NST
Sbjct  61   YGQPLAHFLRAKAKVPDAQIITEHPAIRVGVVFSGRQSPGGHNVIWGLYDAIKSHNHNST  120

Query  397  llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  576
            LLGF+GG+EGLFAQKTLEITDDIL+TYKNQGGYD+LGRTKDQIR+TEQVNAA+ AC +LK
Sbjct  121  LLGFVGGTEGLFAQKTLEITDDILSTYKNQGGYDLLGRTKDQIRTTEQVNAAMAACQALK  180

Query  577  LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            LDGLVI+GGVTSN DAA+LAE FAE+KCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK
Sbjct  181  LDGLVILGGVTSNMDAAHLAETFAESKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  239



>ref|XP_010527650.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha-like [Tarenaya hassleriana]
Length=614

 Score =   379 bits (972),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 201/239 (84%), Positives = 215/239 (90%), Gaps = 0/239 (0%)
 Frame = +1

Query  37   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  216
            MDSD+G+ RELSD+Q+LRS Y PELPPCLQGTTVRVEFGDATT A+    H I+R FP+T
Sbjct  1    MDSDYGIPRELSDIQELRSHYEPELPPCLQGTTVRVEFGDATTVAEVDSAHIIARAFPNT  60

Query  217  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  396
            +GQ L HFLRA+AKVP AQIITEH AIRVG +FCGRQSPGGHN IWGLYDALK+HNP ST
Sbjct  61   YGQRLVHFLRATAKVPGAQIITEHQAIRVGFLFCGRQSPGGHNVIWGLYDALKIHNPQST  120

Query  397  llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  576
            LLGFLGGSEGLFAQKTLEITDDIL TYKNQGGYD+LGRTKDQIR+TEQV+AAL AC  LK
Sbjct  121  LLGFLGGSEGLFAQKTLEITDDILRTYKNQGGYDLLGRTKDQIRTTEQVDAALEACRELK  180

Query  577  LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            LDGLVIVGGVTSNTDAA LAE FA AKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK
Sbjct  181  LDGLVIVGGVTSNTDAAQLAETFARAKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  239



>ref|XP_004300090.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha [Fragaria vesca subsp. vesca]
Length=618

 Score =   377 bits (967),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 199/239 (83%), Positives = 219/239 (92%), Gaps = 0/239 (0%)
 Frame = +1

Query  37   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  216
            MDSD+G+ RELS +QKLRSQY+P+LPPCLQGTTVRVEFGD TTAADP+  +TISR FP+T
Sbjct  1    MDSDYGIPRELSAVQKLRSQYQPDLPPCLQGTTVRVEFGDTTTAADPTDANTISRYFPNT  60

Query  217  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  396
            +GQPLAHFLRA+AKV  AQ+I+EHPA+RVGIVFCGRQSPGGHN IWGL  ALK HNPNST
Sbjct  61   YGQPLAHFLRATAKVAGAQVISEHPAMRVGIVFCGRQSPGGHNVIWGLLKALKTHNPNST  120

Query  397  llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  576
            LLGFLGGSEGLFAQKTLEITDD+LATYKNQGGYD+LGRTKDQIR+ EQVNA LTAC +LK
Sbjct  121  LLGFLGGSEGLFAQKTLEITDDVLATYKNQGGYDLLGRTKDQIRTKEQVNATLTACNALK  180

Query  577  LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            L GLVI+GGVTSNTDAA LAE FAEAKC TKVVGVPVT+NGDLKNQFVE NVGFDT+CK
Sbjct  181  LAGLVIIGGVTSNTDAAQLAETFAEAKCQTKVVGVPVTMNGDLKNQFVEANVGFDTVCK  239



>ref|XP_009414937.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha {ECO:0000255|HAMAP-Rule:MF_03185}-like 
[Musa acuminata subsp. malaccensis]
 ref|XP_009415019.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha {ECO:0000255|HAMAP-Rule:MF_03185}-like 
[Musa acuminata subsp. malaccensis]
Length=617

 Score =   375 bits (964),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 193/239 (81%), Positives = 217/239 (91%), Gaps = 0/239 (0%)
 Frame = +1

Query  37   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  216
            MDSDFG+ RELS+LQK R+QY PELPPCLQG TVRVEFGD+TT ADPS  + I R FPHT
Sbjct  1    MDSDFGVPRELSELQKKRAQYHPELPPCLQGITVRVEFGDSTTCADPSSTNVIGRAFPHT  60

Query  217  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  396
            FGQPLAHFLRA+AKVPDAQIITEHP +RVG++FCGRQSPGGHN +WGLY A+K+ NP+S 
Sbjct  61   FGQPLAHFLRATAKVPDAQIITEHPPMRVGVLFCGRQSPGGHNVVWGLYKAIKIRNPDSV  120

Query  397  llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  576
            LLGF+GG+EGLF QKT EITD++LATYKNQGGYD+LGRT DQIR+TEQVNAA+TAC  LK
Sbjct  121  LLGFVGGTEGLFTQKTREITDEVLATYKNQGGYDLLGRTVDQIRTTEQVNAAMTACNDLK  180

Query  577  LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            LDGLVI+GGVTSN+DAA LAE FAEAKCPTKVVGVPVTLNGDLKNQFVETNVGFDT+C+
Sbjct  181  LDGLVIIGGVTSNSDAAQLAETFAEAKCPTKVVGVPVTLNGDLKNQFVETNVGFDTVCR  239



>ref|XP_009149574.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha 1 [Brassica rapa]
 emb|CDY67203.1| BnaA06g38560D [Brassica napus]
Length=619

 Score =   375 bits (963),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 201/239 (84%), Positives = 215/239 (90%), Gaps = 0/239 (0%)
 Frame = +1

Query  37   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  216
            MDSDFG+ RELS LQ+LRSQY PELPPCLQGTTVRVEFGD TT A+ S  H ++R FPHT
Sbjct  1    MDSDFGIPRELSPLQQLRSQYHPELPPCLQGTTVRVEFGDGTTVAEASDSHIVARAFPHT  60

Query  217  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  396
             GQPLAHFLR +AKV DA IIT+ P+IRVGIVFCGRQ+PGGHN IWGLY+ALKVHN NST
Sbjct  61   LGQPLAHFLREAAKVSDAHIITQLPSIRVGIVFCGRQAPGGHNVIWGLYEALKVHNANST  120

Query  397  llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  576
            LLGFLGGSEGLFAQKTLEITDDIL TYKNQGGYD+LGRTKDQIR+TEQVNAAL ACT LK
Sbjct  121  LLGFLGGSEGLFAQKTLEITDDILQTYKNQGGYDLLGRTKDQIRTTEQVNAALKACTDLK  180

Query  577  LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            LDGLVI+GGVTSNTDAA+LAE FAEAKC TKVVGVPVT NGDLKNQFVE NVGFDTICK
Sbjct  181  LDGLVIIGGVTSNTDAAHLAEFFAEAKCSTKVVGVPVTTNGDLKNQFVEANVGFDTICK  239



>ref|XP_010270592.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha-like [Nelumbo nucifera]
Length=617

 Score =   375 bits (963),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 196/239 (82%), Positives = 218/239 (91%), Gaps = 0/239 (0%)
 Frame = +1

Query  37   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  216
            MDSDFG+ RELSDLQK R+ Y PE+PPCLQGTTVRVEFGDATT ADP+G   I R FPHT
Sbjct  1    MDSDFGVPRELSDLQKKRALYEPEVPPCLQGTTVRVEFGDATTTADPAGSLGIIRAFPHT  60

Query  217  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  396
            +GQPLAHFLR  ++VPDAQIIT+HPAIRVG+VFCGRQSPGGHN +WGLY+ALK+HNPN+ 
Sbjct  61   YGQPLAHFLRPKSQVPDAQIITDHPAIRVGVVFCGRQSPGGHNVVWGLYNALKIHNPNNV  120

Query  397  llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  576
            LLGFLGGSEGLFAQKTLEITDD+L++YKNQGG+DMLGRTKDQIR+TEQVNAAL +C +L 
Sbjct  121  LLGFLGGSEGLFAQKTLEITDDVLSSYKNQGGFDMLGRTKDQIRTTEQVNAALASCKALN  180

Query  577  LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            LDGLVI+GGVTSNTDAA LAE FAEAKC TKVVGVPVTL GDL+NQFVETNVGFDTICK
Sbjct  181  LDGLVIIGGVTSNTDAAQLAETFAEAKCTTKVVGVPVTLYGDLRNQFVETNVGFDTICK  239



>ref|XP_006390180.1| hypothetical protein EUTSA_v10018291mg [Eutrema salsugineum]
 gb|ESQ27466.1| hypothetical protein EUTSA_v10018291mg [Eutrema salsugineum]
Length=617

 Score =   375 bits (962),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 200/239 (84%), Positives = 216/239 (90%), Gaps = 0/239 (0%)
 Frame = +1

Query  37   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  216
            MDSDFG+ RELS LQ+LRSQY PELPPCLQGTTVRVE GD TT A     H I+R FPHT
Sbjct  1    MDSDFGIPRELSPLQQLRSQYHPELPPCLQGTTVRVELGDGTTVAKAGDAHIIARAFPHT  60

Query  217  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  396
             GQPLAHFLRA+AKVPDAQIITEHPAIRVGIVF GRQ+PGGHN IWGLY+ALKVHN  +T
Sbjct  61   LGQPLAHFLRATAKVPDAQIITEHPAIRVGIVFSGRQAPGGHNVIWGLYEALKVHNAKNT  120

Query  397  llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  576
            LLGFLGGSEGLFAQKTLEITD++L TYKNQGG+D+LGRTKDQIR+TEQVNAAL ACT LK
Sbjct  121  LLGFLGGSEGLFAQKTLEITDNVLQTYKNQGGFDLLGRTKDQIRTTEQVNAALKACTDLK  180

Query  577  LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            L+GLVI+GGVTSNTDAA+LAE FAEAKCPTKVVGVPVT+NGDLKNQFVE NVGFDTICK
Sbjct  181  LNGLVIIGGVTSNTDAAHLAEFFAEAKCPTKVVGVPVTINGDLKNQFVEANVGFDTICK  239



>gb|KFK35354.1| hypothetical protein AALP_AA5G273800 [Arabis alpina]
Length=619

 Score =   375 bits (962),  Expect = 9e-123, Method: Compositional matrix adjust.
 Identities = 200/239 (84%), Positives = 214/239 (90%), Gaps = 0/239 (0%)
 Frame = +1

Query  37   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  216
            MDSDFG+ RELS LQ+LRSQY PELPPCLQGTTVRVE GD TT A+ +  H ++R FPHT
Sbjct  1    MDSDFGIPRELSPLQQLRSQYHPELPPCLQGTTVRVELGDGTTVAEATDSHIMARAFPHT  60

Query  217  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  396
             GQPLAHFLR +AKV DAQIITE P+IRVGIVFCGRQSPGGHN IWGLY+ALKVHN  ST
Sbjct  61   LGQPLAHFLRETAKVSDAQIITELPSIRVGIVFCGRQSPGGHNVIWGLYEALKVHNAKST  120

Query  397  llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  576
            LLGFLGGSEGLFAQKTLE+TDDIL TYKNQGGYD+LGRTKDQIR+TEQVNAAL ACT LK
Sbjct  121  LLGFLGGSEGLFAQKTLEMTDDILQTYKNQGGYDLLGRTKDQIRTTEQVNAALKACTDLK  180

Query  577  LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            LDGLVI+GGVTSNTDAA+LAE F EAKCPTKVVGVPVT NGDLKNQFVE NVGFDTICK
Sbjct  181  LDGLVIIGGVTSNTDAAHLAEFFTEAKCPTKVVGVPVTTNGDLKNQFVEANVGFDTICK  239



>ref|XP_002889091.1| hypothetical protein ARALYDRAFT_476813 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65350.1| hypothetical protein ARALYDRAFT_476813 [Arabidopsis lyrata subsp. 
lyrata]
Length=617

 Score =   374 bits (960),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 200/239 (84%), Positives = 214/239 (90%), Gaps = 0/239 (0%)
 Frame = +1

Query  37   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  216
            MDSDFG+ RELS LQ+LRSQY PELPPCLQGTTVRVE GD TT A     H I+R FPHT
Sbjct  1    MDSDFGIPRELSPLQQLRSQYHPELPPCLQGTTVRVELGDGTTVAKAGDAHIIARAFPHT  60

Query  217  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  396
             GQPLAHFLRA+AKVPDAQIITEHPA RVGIVF GRQ+PGGHN +WGLY+ALKVHN  +T
Sbjct  61   LGQPLAHFLRATAKVPDAQIITEHPAKRVGIVFSGRQAPGGHNVVWGLYEALKVHNAKNT  120

Query  397  llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  576
            LLGFLGGSEGLFAQKTLEIT+D+L TYKNQGGYDMLGRTKDQIR+TEQVNAAL ACT LK
Sbjct  121  LLGFLGGSEGLFAQKTLEITEDVLQTYKNQGGYDMLGRTKDQIRTTEQVNAALKACTDLK  180

Query  577  LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            LDGLVI+GGVTSNTDAA+LAE FAEAKCPTKVVGVPVT+NGDLKNQFVE NVGFDT CK
Sbjct  181  LDGLVIIGGVTSNTDAAHLAEFFAEAKCPTKVVGVPVTINGDLKNQFVEANVGFDTTCK  239



>ref|XP_006302013.1| hypothetical protein CARUB_v10019988mg [Capsella rubella]
 gb|EOA34911.1| hypothetical protein CARUB_v10019988mg [Capsella rubella]
Length=617

 Score =   373 bits (958),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 200/239 (84%), Positives = 214/239 (90%), Gaps = 0/239 (0%)
 Frame = +1

Query  37   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  216
            MDSDFG+ RELS LQ+LRSQY PELPPCLQGTTVRVE GD TT A     H I+R FPHT
Sbjct  1    MDSDFGIPRELSPLQQLRSQYHPELPPCLQGTTVRVELGDGTTVAKAGDAHIIARAFPHT  60

Query  217  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  396
             GQPLAHFLRASAKVPDAQIITEHPA RVGIVF GRQ+PGGHN +WGLY+ALKVHN  +T
Sbjct  61   LGQPLAHFLRASAKVPDAQIITEHPAKRVGIVFSGRQAPGGHNVVWGLYEALKVHNAKNT  120

Query  397  llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  576
            LLGFLGGSEGLFAQKTLEITDD+L TYKNQGG+D+LGRTKDQIR+TEQVNAAL ACT LK
Sbjct  121  LLGFLGGSEGLFAQKTLEITDDVLQTYKNQGGFDLLGRTKDQIRTTEQVNAALKACTDLK  180

Query  577  LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            LDGLVI+GGVTSNTDAA+LAE FAEAKCPTKVVGVPVT+NGDLKNQFVE NVGFDT CK
Sbjct  181  LDGLVIIGGVTSNTDAAHLAEFFAEAKCPTKVVGVPVTINGDLKNQFVEANVGFDTTCK  239



>emb|CDX88295.1| BnaC06g37390D [Brassica napus]
Length=617

 Score =   373 bits (957),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 199/239 (83%), Positives = 215/239 (90%), Gaps = 0/239 (0%)
 Frame = +1

Query  37   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  216
            MDSDFG+ RELS LQ++RSQY P+LPPCLQGTTVRVEFGD TT A     H I+R FPHT
Sbjct  1    MDSDFGIPRELSPLQQIRSQYLPQLPPCLQGTTVRVEFGDGTTVAKAGDAHIIARAFPHT  60

Query  217  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  396
             GQPLAHFLRA+AKVPDAQIITEHPAIRVGIVF GRQ+PGGHN IWGLY+ALKVHN  +T
Sbjct  61   LGQPLAHFLRATAKVPDAQIITEHPAIRVGIVFSGRQAPGGHNVIWGLYEALKVHNAKNT  120

Query  397  llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  576
            LLGFLGGSEGLFAQK LEITDD+L TYKNQGG+D+LGRTKDQIR+TEQVNAAL ACT LK
Sbjct  121  LLGFLGGSEGLFAQKALEITDDVLQTYKNQGGFDLLGRTKDQIRTTEQVNAALKACTDLK  180

Query  577  LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            LDGLVI+GGVTSNTDAA+LAE FAEAKC TKVVGVPVT+NGDLKNQFVE NVGFDTICK
Sbjct  181  LDGLVIIGGVTSNTDAAHLAEFFAEAKCSTKVVGVPVTINGDLKNQFVEANVGFDTICK  239



>ref|XP_009106323.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha 2 [Brassica rapa]
Length=617

 Score =   372 bits (956),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 199/239 (83%), Positives = 216/239 (90%), Gaps = 0/239 (0%)
 Frame = +1

Query  37   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  216
            MDSDFG+ RELS LQ+LRSQY+P+LPPCLQG TVRVEFGD TT A     H I+R FPHT
Sbjct  1    MDSDFGIPRELSPLQQLRSQYQPQLPPCLQGRTVRVEFGDGTTVAKSGDSHIIARAFPHT  60

Query  217  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  396
             GQPLAHFLRA+AKVPDAQIITEHPAIRVGIVF GRQ+PGGHN IWGLY+ALKVHN  +T
Sbjct  61   LGQPLAHFLRANAKVPDAQIITEHPAIRVGIVFSGRQAPGGHNVIWGLYEALKVHNAKNT  120

Query  397  llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  576
            LLGFLGGSEGLFAQKT+EITDD+L TYKNQGG+D+LGRTKDQIR+TEQVNAAL ACT LK
Sbjct  121  LLGFLGGSEGLFAQKTVEITDDVLQTYKNQGGFDLLGRTKDQIRTTEQVNAALKACTDLK  180

Query  577  LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            LDGLVI+GGVTSNTDAA+LAE FAEAKC TKVVGVPVT+NGDLKNQFVE NVGFDTICK
Sbjct  181  LDGLVIIGGVTSNTDAAHLAEFFAEAKCSTKVVGVPVTINGDLKNQFVEANVGFDTICK  239



>ref|XP_010416575.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha 2 [Camelina sativa]
Length=617

 Score =   372 bits (955),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 198/239 (83%), Positives = 215/239 (90%), Gaps = 0/239 (0%)
 Frame = +1

Query  37   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  216
            MDSDFG+ RELS LQ+LRSQY PELPPCLQGTTVRVE GD TT A  +  H I+R FPH+
Sbjct  1    MDSDFGIPRELSPLQQLRSQYHPELPPCLQGTTVRVELGDGTTVAKAADAHIIARAFPHS  60

Query  217  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  396
             GQPLAHFLRA+AKVPDAQIITEHPA RVGIVF GRQ+PGGHN +WGLY+ALKVHN  +T
Sbjct  61   LGQPLAHFLRATAKVPDAQIITEHPAKRVGIVFSGRQAPGGHNVVWGLYEALKVHNAKNT  120

Query  397  llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  576
            LLGFLGGSEGLFAQKTLEITDD+L TYKNQGG+D+LGRTKDQIR+TEQVNAAL ACT LK
Sbjct  121  LLGFLGGSEGLFAQKTLEITDDVLQTYKNQGGFDLLGRTKDQIRTTEQVNAALKACTDLK  180

Query  577  LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            LDGLVI+GGVTSNTDAA+LAE FAEAKCPTKVVGVPVT+NGDLKNQFVE NVGFDT CK
Sbjct  181  LDGLVIIGGVTSNTDAAHLAEFFAEAKCPTKVVGVPVTINGDLKNQFVEANVGFDTTCK  239



>ref|XP_010471809.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha 2-like [Camelina sativa]
Length=617

 Score =   372 bits (954),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 198/239 (83%), Positives = 215/239 (90%), Gaps = 0/239 (0%)
 Frame = +1

Query  37   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  216
            MDSDFG+ RELS LQ+LRSQY PELPPCLQGTTVRVE GD TT A  +  H I+R FPH+
Sbjct  1    MDSDFGIPRELSPLQQLRSQYHPELPPCLQGTTVRVELGDGTTVAKAADAHIIARAFPHS  60

Query  217  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  396
             GQPLAHFLRA+AKVPDAQIITEHPA RVGIVF GRQ+PGGHN +WGLY+ALKVHN  +T
Sbjct  61   LGQPLAHFLRATAKVPDAQIITEHPAKRVGIVFSGRQAPGGHNVVWGLYEALKVHNAKNT  120

Query  397  llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  576
            LLGFLGGSEGLFAQKTLEITDD+L TYKNQGG+D+LGRTKDQIR+TEQVNAAL ACT LK
Sbjct  121  LLGFLGGSEGLFAQKTLEITDDVLQTYKNQGGFDLLGRTKDQIRTTEQVNAALKACTDLK  180

Query  577  LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            LDGLVI+GGVTSNTDAA+LAE FAEAKCPTKVVGVPVT+NGDLKNQFVE NVGFDT CK
Sbjct  181  LDGLVIIGGVTSNTDAAHLAEFFAEAKCPTKVVGVPVTINGDLKNQFVEANVGFDTTCK  239



>ref|XP_006416345.1| hypothetical protein EUTSA_v10007087mg [Eutrema salsugineum]
 gb|ESQ34698.1| hypothetical protein EUTSA_v10007087mg [Eutrema salsugineum]
Length=619

 Score =   372 bits (954),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 198/239 (83%), Positives = 213/239 (89%), Gaps = 0/239 (0%)
 Frame = +1

Query  37   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  216
            MDSDFG+ RELS LQ+LRSQY PELPPCLQGTTVRVE GD TT A+ +  H ++R FPHT
Sbjct  1    MDSDFGIPRELSPLQQLRSQYHPELPPCLQGTTVRVELGDGTTVAEAADSHIMARAFPHT  60

Query  217  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  396
             GQPLAHFLR +AKV DAQIITE P+IRVGIVFCGRQ+PGGHN IWGLY+ALKVHN  ST
Sbjct  61   LGQPLAHFLREAAKVSDAQIITELPSIRVGIVFCGRQAPGGHNVIWGLYEALKVHNAKST  120

Query  397  llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  576
            LLGFLGGSEGLFAQKTLEITDDIL TYKNQGGYD+LGRTKDQIR+TEQVNAAL ACT LK
Sbjct  121  LLGFLGGSEGLFAQKTLEITDDILQTYKNQGGYDLLGRTKDQIRTTEQVNAALKACTDLK  180

Query  577  LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            LDGLVI+GGVTSNTDAA+LAE F+E KC TKVVGVPVT NGDLKNQFVE NVGFDTICK
Sbjct  181  LDGLVIIGGVTSNTDAAHLAEFFSEVKCSTKVVGVPVTTNGDLKNQFVEANVGFDTICK  239



>emb|CDX87587.1| BnaA07g32860D [Brassica napus]
Length=617

 Score =   371 bits (953),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 198/239 (83%), Positives = 216/239 (90%), Gaps = 0/239 (0%)
 Frame = +1

Query  37   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  216
            MDSDFG+ RELS LQ+LRSQY+P+LPPCLQG TVRVEFGD TT A     H I+R FPHT
Sbjct  1    MDSDFGIPRELSPLQQLRSQYQPQLPPCLQGRTVRVEFGDGTTVAKSGDSHIIARAFPHT  60

Query  217  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  396
             GQPLAHFLRA+AKVPDAQIITEHPAIRVGIVF GRQ+PGGHN IWGLY+ALKVHN  +T
Sbjct  61   LGQPLAHFLRATAKVPDAQIITEHPAIRVGIVFSGRQAPGGHNVIWGLYEALKVHNAKNT  120

Query  397  llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  576
            LLGFLGGSEGLFAQKT+EITD++L TYKNQGG+D+LGRTKDQIR+TEQVNAAL ACT LK
Sbjct  121  LLGFLGGSEGLFAQKTVEITDEVLQTYKNQGGFDLLGRTKDQIRTTEQVNAALKACTYLK  180

Query  577  LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            LDGLVI+GGVTSNTDAA+LAE FAEAKC TKVVGVPVT+NGDLKNQFVE NVGFDTICK
Sbjct  181  LDGLVIIGGVTSNTDAAHLAEFFAEAKCSTKVVGVPVTINGDLKNQFVEANVGFDTICK  239



>ref|XP_010477351.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha 1-like [Camelina sativa]
Length=522

 Score =   368 bits (944),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 195/239 (82%), Positives = 216/239 (90%), Gaps = 0/239 (0%)
 Frame = +1

Query  37   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  216
            M+SDFG+ RELS LQ+LRSQY+P+LPPCLQGTTVRVE GD TT A+ +  HT++R FPHT
Sbjct  1    MNSDFGIPRELSPLQQLRSQYKPDLPPCLQGTTVRVELGDGTTVAEAADSHTMARAFPHT  60

Query  217  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  396
             GQPLAHFLR +A+V DA IITE P++RVGIVFCGRQ+PGGHN IWGL++ALKVHN NST
Sbjct  61   LGQPLAHFLRETAQVTDAHIITELPSVRVGIVFCGRQAPGGHNVIWGLFEALKVHNSNST  120

Query  397  llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  576
            LLGFLGGSEGLFAQKTLEITDDIL TYKNQGGYD+LGRTKDQI++TEQVNAAL ACT LK
Sbjct  121  LLGFLGGSEGLFAQKTLEITDDILQTYKNQGGYDLLGRTKDQIKTTEQVNAALKACTDLK  180

Query  577  LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            LDGLVI+GGVTSNTDAA+LAE F EAKC TKVVGVPVT NGDLKNQFVETNVGFDTICK
Sbjct  181  LDGLVIIGGVTSNTDAAHLAEFFVEAKCSTKVVGVPVTTNGDLKNQFVETNVGFDTICK  239



>emb|CDY67022.1| BnaC05g50320D [Brassica napus]
Length=619

 Score =   371 bits (952),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 200/239 (84%), Positives = 214/239 (90%), Gaps = 0/239 (0%)
 Frame = +1

Query  37   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  216
            MDSDFG+ RELS LQ+LRSQY+PELPPCLQGTTVRVEFGD TT A+ S  H I+R F HT
Sbjct  1    MDSDFGIPRELSPLQQLRSQYQPELPPCLQGTTVRVEFGDGTTVAEASDSHIIARAFTHT  60

Query  217  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  396
             GQPLAHFLR +AKV DA IIT+ P+IRVGIVFCGRQ+PGGHN IWGLY+ALKVHN  ST
Sbjct  61   LGQPLAHFLREAAKVSDAHIITQLPSIRVGIVFCGRQAPGGHNVIWGLYEALKVHNAKST  120

Query  397  llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  576
            LLGFLGGSEGLFAQKTLEITDDIL TYKNQGGYD+LGRTKDQIR+TEQVNAAL ACT LK
Sbjct  121  LLGFLGGSEGLFAQKTLEITDDILQTYKNQGGYDLLGRTKDQIRTTEQVNAALKACTDLK  180

Query  577  LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            LDGLVI+GGVTSNTDAA+LAE FAEAKC TKVVGVPVT NGDLKNQFVE NVGFDTICK
Sbjct  181  LDGLVIIGGVTSNTDAAHLAEFFAEAKCSTKVVGVPVTTNGDLKNQFVEANVGFDTICK  239



>emb|CDY33660.1| BnaC08g19600D [Brassica napus]
Length=598

 Score =   370 bits (950),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 199/239 (83%), Positives = 214/239 (90%), Gaps = 0/239 (0%)
 Frame = +1

Query  37   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  216
            MDSDFG+ RELS LQ+LRSQY+PELPPCLQGTTVRVE GD TT ++ S  H I+R FPHT
Sbjct  1    MDSDFGIPRELSPLQQLRSQYQPELPPCLQGTTVRVELGDGTTVSEASDSHIIARAFPHT  60

Query  217  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  396
             GQPLAHFLR +AKV DA IIT+ P+IRVGIVFCGRQ+PGGHN IWGLY+ALKVHN  ST
Sbjct  61   LGQPLAHFLRETAKVSDAHIITQLPSIRVGIVFCGRQAPGGHNVIWGLYEALKVHNAKST  120

Query  397  llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  576
            LLGFLGGSEGLFAQKTLEITDDIL TYKNQGGYD+LGRTKDQIR+TEQVNAAL ACT LK
Sbjct  121  LLGFLGGSEGLFAQKTLEITDDILQTYKNQGGYDLLGRTKDQIRTTEQVNAALKACTDLK  180

Query  577  LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            LDGLVI+GGVTSNTDAA+LAE FAEAKC TKVVGVPVT NGDLKNQFVE NVGFDTICK
Sbjct  181  LDGLVIIGGVTSNTDAAHLAEFFAEAKCSTKVVGVPVTTNGDLKNQFVEANVGFDTICK  239



>gb|EPS71673.1| hypothetical protein M569_03082, partial [Genlisea aurea]
Length=608

 Score =   370 bits (950),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 201/240 (84%), Positives = 218/240 (91%), Gaps = 1/240 (0%)
 Frame = +1

Query  37   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  216
            MDSD+G+ RELSDLQKLRS Y+PELPPC+QGTTVRVEFGDAT AADP+G HTISR  PHT
Sbjct  1    MDSDYGVPRELSDLQKLRSHYKPELPPCVQGTTVRVEFGDATAAADPAGAHTISRSLPHT  60

Query  217  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNP-NS  393
            +GQPLAHFLRA+AKVPDAQIITEHP +RVG+VFCGRQSPGGHN IWGL+DALK+HN  N 
Sbjct  61   YGQPLAHFLRATAKVPDAQIITEHPPVRVGVVFCGRQSPGGHNVIWGLFDALKLHNSKNV  120

Query  394  TllgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSL  573
             L     GSEGLFAQKTLEITD+ILATYKNQGGYD+LGRTKDQIR+TEQVNAAL +CT+L
Sbjct  121  LLGFLGRGSEGLFAQKTLEITDEILATYKNQGGYDLLGRTKDQIRTTEQVNAALNSCTAL  180

Query  574  KLDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            KLD LVI+GGVTSNTDAA LAE FAE KCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK
Sbjct  181  KLDALVIIGGVTSNTDAAQLAETFAERKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  240



>ref|XP_010428720.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha 2-like [Camelina sativa]
Length=617

 Score =   370 bits (949),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 197/239 (82%), Positives = 214/239 (90%), Gaps = 0/239 (0%)
 Frame = +1

Query  37   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  216
            MDSDFG+ RELS LQ+LRSQY PELPPCLQGTTVRVE GD TT A  +  H I+R FPH+
Sbjct  1    MDSDFGIPRELSPLQQLRSQYHPELPPCLQGTTVRVELGDGTTVAKAADAHIIARAFPHS  60

Query  217  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  396
             GQPLAHFLRA+A VPDAQIITEHPA RVGIVF GRQ+PGGHN +WGLY+ALKVHN  +T
Sbjct  61   LGQPLAHFLRATANVPDAQIITEHPAKRVGIVFSGRQAPGGHNVVWGLYEALKVHNVENT  120

Query  397  llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  576
            LLGFLGGSEGLFAQKTLEITDD+L TYKNQGG+D+LGRTKDQIR+TEQVNAAL ACT LK
Sbjct  121  LLGFLGGSEGLFAQKTLEITDDVLQTYKNQGGFDLLGRTKDQIRTTEQVNAALKACTDLK  180

Query  577  LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            LDGLVI+GGVTSNTDAA+LAE FAEAKCPTKVVGVPVT+NGDLKNQFVE NVGFDT CK
Sbjct  181  LDGLVIIGGVTSNTDAAHLAEFFAEAKCPTKVVGVPVTINGDLKNQFVEANVGFDTTCK  239



>ref|XP_006306984.1| hypothetical protein CARUB_v10008559mg, partial [Capsella rubella]
 gb|EOA39882.1| hypothetical protein CARUB_v10008559mg, partial [Capsella rubella]
Length=639

 Score =   370 bits (950),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 197/239 (82%), Positives = 215/239 (90%), Gaps = 0/239 (0%)
 Frame = +1

Query  37   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  216
            MDSDFG+ RELS LQ+LRSQY+PELPPCLQGTTVRVE GD TT A+ +  HT+ R FPHT
Sbjct  26   MDSDFGIPRELSPLQQLRSQYKPELPPCLQGTTVRVELGDGTTVAEAADSHTMVRAFPHT  85

Query  217  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  396
             GQPLAHFLR +A+V DA IITE P++RVGIVFCGRQ+PGGHN IWGL++ALKVHN  ST
Sbjct  86   LGQPLAHFLRETAQVTDAHIITELPSVRVGIVFCGRQAPGGHNVIWGLFEALKVHNSKST  145

Query  397  llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  576
            LLGFLGGSEGLFAQKTLEITDDIL TYKNQGGYD+LGRTKDQI++TEQVNAAL ACT LK
Sbjct  146  LLGFLGGSEGLFAQKTLEITDDILQTYKNQGGYDLLGRTKDQIKTTEQVNAALKACTDLK  205

Query  577  LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            LDGLVI+GGVTSNTDAA+LAE F EAKCPTKVVGVPVT NGDLKNQFVETNVGFDTICK
Sbjct  206  LDGLVIIGGVTSNTDAAHLAEFFVEAKCPTKVVGVPVTTNGDLKNQFVETNVGFDTICK  264



>gb|KFK42073.1| hypothetical protein AALP_AA2G207700 [Arabis alpina]
Length=617

 Score =   369 bits (948),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 197/239 (82%), Positives = 213/239 (89%), Gaps = 0/239 (0%)
 Frame = +1

Query  37   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  216
            MDSDFG+ RELS LQ+LRSQY+P LPPCLQGTTVRVE GD TT A     H I+R FPHT
Sbjct  1    MDSDFGIPRELSPLQQLRSQYQPLLPPCLQGTTVRVELGDGTTGAKAGDAHIIARAFPHT  60

Query  217  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  396
             GQPLAHFLRA+AKV DAQIITEHPAIRVGIVF GRQ+PGGHN IWGLY+ALKVHN  +T
Sbjct  61   LGQPLAHFLRANAKVVDAQIITEHPAIRVGIVFSGRQAPGGHNVIWGLYEALKVHNAKNT  120

Query  397  llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  576
            LLGFLGGSEGLFAQKT+EITDD+L TYKNQGG+D+LGRTKDQIR+TEQVNAAL ACT LK
Sbjct  121  LLGFLGGSEGLFAQKTVEITDDVLQTYKNQGGFDLLGRTKDQIRTTEQVNAALKACTDLK  180

Query  577  LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            LDGLVI+GGVTSNTDA +LAE FAE KCPTKVVGVPVT+NGDLKNQFVE NVGFDTICK
Sbjct  181  LDGLVIIGGVTSNTDAGHLAEFFAETKCPTKVVGVPVTINGDLKNQFVEANVGFDTICK  239



>ref|NP_173519.1| pyrophosphate--fructose 6-phosphate 1-phosphotransferase subunit 
alpha 1 [Arabidopsis thaliana]
 sp|Q9SYP2.1|PFPA1_ARATH RecName: Full=Pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha 1; Short=PFP 1; AltName: Full=6-phosphofructokinase, 
pyrophosphate dependent 1; AltName: Full=PPi-PFK 
1; AltName: Full=Pyrophosphate-dependent 6-phosphofructose-1-kinase 
1 [Arabidopsis thaliana]
 gb|AAD30596.1|AC007369_6 pyrophosphate-dependent phosphofructokinase alpha subunit [Arabidopsis 
thaliana]
 gb|AAL24337.1| pyrophosphate-dependent phosphofructokinase alpha subunit [Arabidopsis 
thaliana]
 gb|AAP37733.1| At1g20950 [Arabidopsis thaliana]
 gb|AEE30045.1| pyrophosphate--fructose 6-phosphate 1-phosphotransferase subunit 
alpha 1 [Arabidopsis thaliana]
Length=614

 Score =   369 bits (946),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 195/239 (82%), Positives = 214/239 (90%), Gaps = 0/239 (0%)
 Frame = +1

Query  37   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  216
            MDSDFG+ RELS LQ+LRSQY+PELPPCLQGTTVRVE GD TT A+ +  HT++R FPHT
Sbjct  1    MDSDFGIPRELSPLQQLRSQYKPELPPCLQGTTVRVELGDGTTVAEAADSHTMARAFPHT  60

Query  217  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  396
             GQPLAHFLR +A+VPDA IITE P++RVGIVFCGRQ+PGGHN IWGL++ALKVHN  ST
Sbjct  61   LGQPLAHFLRETAQVPDAHIITELPSVRVGIVFCGRQAPGGHNVIWGLFEALKVHNAKST  120

Query  397  llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  576
            LLGFLGGSEGLFAQKTLEITDDIL TYKNQGGYD+LGRTKDQI++TEQVNAAL ACT LK
Sbjct  121  LLGFLGGSEGLFAQKTLEITDDILQTYKNQGGYDLLGRTKDQIKTTEQVNAALKACTDLK  180

Query  577  LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            LDGLVI+GGV SNTDAA+LAE FA AKC TKVVGVPVT NGDLKNQFVE NVGFDTICK
Sbjct  181  LDGLVIIGGVISNTDAAHLAEFFAAAKCSTKVVGVPVTTNGDLKNQFVEANVGFDTICK  239



>ref|XP_010498548.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha 1 [Camelina sativa]
Length=614

 Score =   369 bits (946),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 195/239 (82%), Positives = 215/239 (90%), Gaps = 0/239 (0%)
 Frame = +1

Query  37   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  216
            MDSDFG+ RELS LQ+LRSQY+PE+PPCLQGTTVRVE GD TT A+ +  HT++R FPHT
Sbjct  1    MDSDFGIPRELSPLQQLRSQYKPEIPPCLQGTTVRVELGDGTTVAEAADSHTMARAFPHT  60

Query  217  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  396
             GQPLAHFLR +A+V DA IITE P++RVGIVFCGRQ+PGGHN IWGL++ALKVHN NST
Sbjct  61   LGQPLAHFLRETAQVTDAHIITELPSVRVGIVFCGRQAPGGHNVIWGLFEALKVHNSNST  120

Query  397  llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  576
            LLGFLGGSEGLFAQKTLEITDDIL TYKNQGGYD+LGRTKDQI++TEQVNA L ACT LK
Sbjct  121  LLGFLGGSEGLFAQKTLEITDDILQTYKNQGGYDLLGRTKDQIKTTEQVNATLKACTDLK  180

Query  577  LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            LDGLVI+GGVTSNTDAA+LAE F EAKC TKVVGVPVT NGDLKNQFVETNVGFDTICK
Sbjct  181  LDGLVIIGGVTSNTDAAHLAEFFVEAKCSTKVVGVPVTTNGDLKNQFVETNVGFDTICK  239



>dbj|BAF01310.1| putative pyrophosphate-dependent phosphofructokinase alpha subunit 
[Arabidopsis thaliana]
Length=617

 Score =   368 bits (945),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 197/239 (82%), Positives = 211/239 (88%), Gaps = 0/239 (0%)
 Frame = +1

Query  37   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  216
            MDSDFG+ RELS LQ+LRSQY PELPPCLQGTTVRVE GD TT A     H I+R FPHT
Sbjct  1    MDSDFGIPRELSPLQQLRSQYHPELPPCLQGTTVRVELGDGTTVAKAGDAHIIARAFPHT  60

Query  217  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  396
             GQPLAHFLRA+AKV DAQIITEHP  RVGIVFCGRQ+PGGHN +WGLY+ALKVHN  +T
Sbjct  61   LGQPLAHFLRATAKVADAQIITEHPVKRVGIVFCGRQAPGGHNVVWGLYEALKVHNAKNT  120

Query  397  llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  576
            LLGFLGGSEGLFAQKTLEITD++L TYKNQGGYDMLGRTKDQIR+TEQVNAAL ACT LK
Sbjct  121  LLGFLGGSEGLFAQKTLEITDEVLQTYKNQGGYDMLGRTKDQIRTTEQVNAALKACTDLK  180

Query  577  LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            LD LVI+GGVTSNTDAA+LAE FAEAKC TKVVGVPVT+NGDLKNQFVE NVGFDT CK
Sbjct  181  LDSLVIIGGVTSNTDAAHLAEFFAEAKCSTKVVGVPVTINGDLKNQFVEANVGFDTTCK  239



>ref|NP_177781.1| pyrophosphate--fructose-6-phosphate 1-phosphotransferase [Arabidopsis 
thaliana]
 sp|Q9C9K3.1|PFPA2_ARATH RecName: Full=Pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha 2; Short=PFP 2; AltName: Full=6-phosphofructokinase, 
pyrophosphate dependent 2; AltName: Full=PPi-PFK 
2; AltName: Full=Pyrophosphate-dependent 6-phosphofructose-1-kinase 
2 [Arabidopsis thaliana]
 gb|AAG51940.1|AC015450_1 putative pyrophosphate-dependent phosphofructokinase alpha subunit; 
63231-59202 [Arabidopsis thaliana]
 gb|AEE35858.1| pyrophosphate--fructose-6-phosphate 1-phosphotransferase [Arabidopsis 
thaliana]
Length=617

 Score =   368 bits (945),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 197/239 (82%), Positives = 211/239 (88%), Gaps = 0/239 (0%)
 Frame = +1

Query  37   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  216
            MDSDFG+ RELS LQ+LRSQY PELPPCLQGTTVRVE GD TT A     H I+R FPHT
Sbjct  1    MDSDFGIPRELSPLQQLRSQYHPELPPCLQGTTVRVELGDGTTVAKAGDAHIIARAFPHT  60

Query  217  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  396
             GQPLAHFLRA+AKV DAQIITEHP  RVGIVFCGRQ+PGGHN +WGLY+ALKVHN  +T
Sbjct  61   LGQPLAHFLRATAKVADAQIITEHPVKRVGIVFCGRQAPGGHNVVWGLYEALKVHNAKNT  120

Query  397  llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  576
            LLGFLGGSEGLFAQKTLEITD++L TYKNQGGYDMLGRTKDQIR+TEQVNAAL ACT LK
Sbjct  121  LLGFLGGSEGLFAQKTLEITDEVLQTYKNQGGYDMLGRTKDQIRTTEQVNAALKACTDLK  180

Query  577  LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            LD LVI+GGVTSNTDAA+LAE FAEAKC TKVVGVPVT+NGDLKNQFVE NVGFDT CK
Sbjct  181  LDSLVIIGGVTSNTDAAHLAEFFAEAKCSTKVVGVPVTINGDLKNQFVEANVGFDTTCK  239



>ref|XP_002893141.1| hypothetical protein ARALYDRAFT_472333 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69400.1| hypothetical protein ARALYDRAFT_472333 [Arabidopsis lyrata subsp. 
lyrata]
Length=614

 Score =   368 bits (944),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 195/239 (82%), Positives = 213/239 (89%), Gaps = 0/239 (0%)
 Frame = +1

Query  37   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  216
            MDSDFG+ RELS LQ+LRSQY PELPPCLQGTTVRVE GD TT A+ +  HT++R FPHT
Sbjct  1    MDSDFGIPRELSPLQQLRSQYHPELPPCLQGTTVRVELGDGTTVAEAADSHTMARAFPHT  60

Query  217  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  396
             GQPLAHFLR +A+V DA IITE P++RVGIVFCGRQ+PGGHN IWGL++ALKVHN  ST
Sbjct  61   LGQPLAHFLRETAQVADAHIITELPSVRVGIVFCGRQAPGGHNVIWGLFEALKVHNTKST  120

Query  397  llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  576
            LLGFLGGSEGLFAQKTLEITDDIL TYKNQGGYD+LGRTKDQI++TEQVNAAL ACT LK
Sbjct  121  LLGFLGGSEGLFAQKTLEITDDILQTYKNQGGYDLLGRTKDQIKTTEQVNAALKACTDLK  180

Query  577  LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            LDGLVI+GGV SNTDAA+LAE FA AKCPTKVVGVPVT NGDLKNQFVE NVGFDTICK
Sbjct  181  LDGLVIIGGVISNTDAAHLAEFFAAAKCPTKVVGVPVTTNGDLKNQFVEANVGFDTICK  239



>emb|CDX96611.1| BnaA08g21540D [Brassica napus]
Length=598

 Score =   367 bits (941),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 197/239 (82%), Positives = 212/239 (89%), Gaps = 0/239 (0%)
 Frame = +1

Query  37   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  216
            MDSDFG+ RELS LQ+LRS Y+PELPPCLQGTTVRVE GD TT ++ S  H I+R FPHT
Sbjct  1    MDSDFGIPRELSPLQQLRSHYQPELPPCLQGTTVRVELGDGTTVSEASDSHIIARAFPHT  60

Query  217  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  396
             GQPLAHFLR + KV DA IIT+ P+IRVGIVFCGRQ+PGGHN IWGLY+ALKVHN  ST
Sbjct  61   LGQPLAHFLRETTKVSDAHIITQLPSIRVGIVFCGRQAPGGHNVIWGLYEALKVHNAKST  120

Query  397  llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  576
            LLGFLGGSEGLFAQKTLEITDDIL TYKNQGGYD+LGRTKDQIR+TEQVNAAL ACT LK
Sbjct  121  LLGFLGGSEGLFAQKTLEITDDILQTYKNQGGYDLLGRTKDQIRTTEQVNAALKACTDLK  180

Query  577  LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            LDGLVI+GGVTSNTDAA+LAE FAEAKC TKVVGVPVT NGDLKNQFVE NVGFDTICK
Sbjct  181  LDGLVIIGGVTSNTDAAHLAEFFAEAKCSTKVVGVPVTTNGDLKNQFVEANVGFDTICK  239



>ref|XP_010459789.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha 1-like [Camelina sativa]
Length=614

 Score =   365 bits (936),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 194/239 (81%), Positives = 214/239 (90%), Gaps = 0/239 (0%)
 Frame = +1

Query  37   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  216
            MDSDFG+ RELS LQ+LRSQY+ +LPPCLQGTTVRVE GD TT A+ +  HT++R FPHT
Sbjct  1    MDSDFGIPRELSPLQQLRSQYKSDLPPCLQGTTVRVELGDGTTVAEAADSHTMARAFPHT  60

Query  217  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  396
             GQPLAHFLR +A+V DA IITE P++RVGIVFCGRQ+PGGHN IWGL++ALKVHN NST
Sbjct  61   LGQPLAHFLRETAQVTDAHIITELPSVRVGIVFCGRQAPGGHNVIWGLFEALKVHNSNST  120

Query  397  llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  576
            LLGFLGGSEGLFAQKTLEITDDIL TYKNQGGYD+LGRTKDQI++TEQVNAAL ACT LK
Sbjct  121  LLGFLGGSEGLFAQKTLEITDDILQTYKNQGGYDLLGRTKDQIKTTEQVNAALKACTDLK  180

Query  577  LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            LDGLVI+GGVTSNTDAA+LAE F EAKC TKVVG PVT NGDLKNQFVETNVGFDTICK
Sbjct  181  LDGLVIIGGVTSNTDAAHLAEFFVEAKCSTKVVGAPVTTNGDLKNQFVETNVGFDTICK  239



>emb|CBI40779.3| unnamed protein product [Vitis vinifera]
Length=653

 Score =   366 bits (939),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 196/276 (71%), Positives = 217/276 (79%), Gaps = 37/276 (13%)
 Frame = +1

Query  37   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  216
            MDSDFG+ RELSDLQK R  Y PELPPCLQGTTVRVEFGDATTA+D SG  TISR FPHT
Sbjct  1    MDSDFGIPRELSDLQKHRCLYEPELPPCLQGTTVRVEFGDATTASDLSGARTISRSFPHT  60

Query  217  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  396
            +GQPLAHFLRA+AKVPDAQ+ITEHP IRVG+VFCGRQSPGGHN IWGL++ALK+HNP + 
Sbjct  61   YGQPLAHFLRATAKVPDAQVITEHPPIRVGVVFCGRQSPGGHNVIWGLHNALKIHNPKNI  120

Query  397  llgflggsegl-------------------------------------fAQKTLEITDDI  465
            LLGFL   + +                                     FAQKTLEITDDI
Sbjct  121  LLGFLAQYDRMDNWAIMSSVMVMFEGYLASDAYNSNIHLSLFCGSEGLFAQKTLEITDDI  180

Query  466  LATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVIVGGVTSNTDaaylaeaf  645
            L+TYKNQGGYD+LGRTKDQIR+TEQVNAAL+ C +LKL+GLVI+GGVTSNTDAA LAE F
Sbjct  181  LSTYKNQGGYDLLGRTKDQIRTTEQVNAALSTCKNLKLEGLVIIGGVTSNTDAAQLAETF  240

Query  646  aeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            AEAKC TKVVGVPV+LNGDLKNQFVE+NVGFDTICK
Sbjct  241  AEAKCQTKVVGVPVSLNGDLKNQFVESNVGFDTICK  276



>gb|EMS68198.1| Pyrophosphate--fructose 6-phosphate 1-phosphotransferase subunit 
alpha [Triticum urartu]
 gb|EMT25737.1| Pyrophosphate--fructose 6-phosphate 1-phosphotransferase subunit 
alpha [Aegilops tauschii]
Length=581

 Score =   362 bits (930),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 182/239 (76%), Positives = 213/239 (89%), Gaps = 0/239 (0%)
 Frame = +1

Query  37   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  216
            MDSD+G+ RELS++Q+ R+ Y+PELPPCLQGTTVRVE+GD   AADP+G H IS  +PHT
Sbjct  1    MDSDYGVPRELSEVQQNRTLYQPELPPCLQGTTVRVEYGDVAIAADPAGAHVISHAYPHT  60

Query  217  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  396
            +GQPLAHFLR +A VPDA++I+EHPA+RVGIVFCGRQSPGGHN IWGL++A+K HN NS 
Sbjct  61   YGQPLAHFLRKAANVPDAKVISEHPAVRVGIVFCGRQSPGGHNVIWGLHEAIKAHNVNSK  120

Query  397  llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  576
            L+GFLGG++GL AQKTLEIT+++L++YKNQGGYDMLGRTKDQIR+TEQVN A+  C +LK
Sbjct  121  LIGFLGGTDGLLAQKTLEITNEVLSSYKNQGGYDMLGRTKDQIRTTEQVNGAMATCQALK  180

Query  577  LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            LD LVI+GGVTSNTDAA LAE FAEAKC TKVVGVPVTLNGDLKNQFVET VGFDTICK
Sbjct  181  LDALVIIGGVTSNTDAAQLAETFAEAKCATKVVGVPVTLNGDLKNQFVETTVGFDTICK  239



>dbj|BAJ92904.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=616

 Score =   363 bits (931),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 183/239 (77%), Positives = 213/239 (89%), Gaps = 0/239 (0%)
 Frame = +1

Query  37   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  216
            MDSD+G+ RELS++Q+ R+ Y+PELPPCLQGTTVRVE+GD   AADP+G H IS  FPHT
Sbjct  1    MDSDYGVPRELSEVQQKRTLYQPELPPCLQGTTVRVEYGDVAIAADPAGAHVISHAFPHT  60

Query  217  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  396
            +GQPLAHFLR +A VPDA++I+EHPA+RVGIVFCGRQSPGGHN IWGL++A+K HN NS 
Sbjct  61   YGQPLAHFLRKAANVPDAKVISEHPAVRVGIVFCGRQSPGGHNVIWGLHEAIKAHNLNSK  120

Query  397  llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  576
            L+GFLGG++GL AQKTLEIT+++L++YKNQGGYDMLGRTKDQIR+TEQVN A+  C +LK
Sbjct  121  LIGFLGGTDGLLAQKTLEITNEVLSSYKNQGGYDMLGRTKDQIRTTEQVNGAMATCQALK  180

Query  577  LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            LD LVI+GGVTSNTDAA LAE FAEAKC TKVVGVPVTLNGDLKNQFVET VGFDTICK
Sbjct  181  LDALVIIGGVTSNTDAAQLAETFAEAKCATKVVGVPVTLNGDLKNQFVETTVGFDTICK  239



>ref|XP_003570229.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha-like isoform X2 [Brachypodium distachyon]
Length=617

 Score =   361 bits (927),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 182/239 (76%), Positives = 213/239 (89%), Gaps = 0/239 (0%)
 Frame = +1

Query  37   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  216
            MDSD+G+ RELS++QK R+ Y+PELPPCLQGTTVRVE+GD   AADP+G H IS  FPHT
Sbjct  1    MDSDYGVPRELSEVQKQRTLYQPELPPCLQGTTVRVEYGDVAIAADPTGAHVISHAFPHT  60

Query  217  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  396
            +GQPLAHFLR +A VPDA++I+EHPA+RVG+VFCGRQSPGGHN IWGL++A+K HN NS 
Sbjct  61   YGQPLAHFLRKAAIVPDAKVISEHPAVRVGVVFCGRQSPGGHNVIWGLHEAIKAHNLNSK  120

Query  397  llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  576
            L+GFLGG++GL AQKTLEIT+++L++YKNQGGYDMLGRTKDQIR+TEQV  A+ +C +LK
Sbjct  121  LIGFLGGTDGLLAQKTLEITNEVLSSYKNQGGYDMLGRTKDQIRTTEQVKGAMASCQALK  180

Query  577  LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            LD LVI+GGVTSNTDAA LAE FAEAKC TKVVGVPVTLNGDLKNQFVET VGFDTICK
Sbjct  181  LDALVIIGGVTSNTDAAQLAETFAEAKCATKVVGVPVTLNGDLKNQFVETTVGFDTICK  239



>ref|XP_006849934.1| hypothetical protein AMTR_s00022p00121950 [Amborella trichopoda]
 gb|ERN11515.1| hypothetical protein AMTR_s00022p00121950 [Amborella trichopoda]
Length=615

 Score =   359 bits (922),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 188/236 (80%), Positives = 210/236 (89%), Gaps = 0/236 (0%)
 Frame = +1

Query  46   DFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQ  225
            DFG+ RELSDLQK R+ Y+P  PPCLQGTTVRVEFGD TT AD S  HTISR FP T+GQ
Sbjct  2    DFGIPRELSDLQKERTLYQPVPPPCLQGTTVRVEFGDGTTTADASDAHTISRSFPLTYGQ  61

Query  226  PLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllg  405
            PL HFLRA+A+VPDA+II EHP IRVG+VF GRQSPGGHN IWGLYDA+K HNPNSTLLG
Sbjct  62   PLVHFLRATAQVPDAKIIQEHPVIRVGVVFSGRQSPGGHNVIWGLYDAIKCHNPNSTLLG  121

Query  406  flggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDG  585
            F+GG++GLFA +TLE+T+ +L+TYKNQGGYDMLGR+KDQIR+TEQVNAAL AC +LKLD 
Sbjct  122  FVGGTDGLFALQTLEVTEKVLSTYKNQGGYDMLGRSKDQIRTTEQVNAALAACQALKLDA  181

Query  586  LVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            LVI+GGVTSNTDAA LAE FAE KCPTKVVGVPVTLNGDLKNQFVET+VGFDTICK
Sbjct  182  LVIIGGVTSNTDAAQLAETFAEKKCPTKVVGVPVTLNGDLKNQFVETDVGFDTICK  237



>ref|XP_004498196.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha-like isoform X2 [Cicer arietinum]
Length=604

 Score =   359 bits (921),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 195/239 (82%), Positives = 210/239 (88%), Gaps = 12/239 (5%)
 Frame = +1

Query  37   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  216
            MDSD+G+ RELSDLQKLRS Y+PELPPCLQGTTVRVEFGDATT ADPS   +I+      
Sbjct  1    MDSDYGIPRELSDLQKLRSLYQPELPPCLQGTTVRVEFGDATTTADPSDEPSIT------  54

Query  217  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  396
                  HFLRA+AKVPDAQIITEHP IRVG+VFCGRQSPGGHN IWGL+ ALK+HNP S 
Sbjct  55   ------HFLRATAKVPDAQIITEHPPIRVGLVFCGRQSPGGHNVIWGLHSALKIHNPYSV  108

Query  397  llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  576
            LLGFLGGS+GLFAQKTLEIT+DIL+TYKNQGGYD+LGRTKDQIR+TEQVNAAL AC  LK
Sbjct  109  LLGFLGGSDGLFAQKTLEITEDILSTYKNQGGYDLLGRTKDQIRTTEQVNAALAACNDLK  168

Query  577  LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            LDGLVI+GGVTSNTDAA LAE FA AKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK
Sbjct  169  LDGLVIIGGVTSNTDAAQLAETFAVAKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  227



>ref|XP_010235882.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha-like isoform X1 [Brachypodium distachyon]
Length=618

 Score =   357 bits (915),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 182/240 (76%), Positives = 213/240 (89%), Gaps = 1/240 (0%)
 Frame = +1

Query  37   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  216
            MDSD+G+ RELS++QK R+ Y+PELPPCLQGTTVRVE+GD   AADP+G H IS  FPHT
Sbjct  1    MDSDYGVPRELSEVQKQRTLYQPELPPCLQGTTVRVEYGDVAIAADPTGAHVISHAFPHT  60

Query  217  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  396
            +GQPLAHFLR +A VPDA++I+EHPA+RVG+VFCGRQSPGGHN IWGL++A+K HN NS 
Sbjct  61   YGQPLAHFLRKAAIVPDAKVISEHPAVRVGVVFCGRQSPGGHNVIWGLHEAIKAHNLNSK  120

Query  397  llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  576
            L+GFLGG++GL AQKTLEIT+++L++YKNQGGYDMLGRTKDQIR+TEQV  A+ +C +LK
Sbjct  121  LIGFLGGTDGLLAQKTLEITNEVLSSYKNQGGYDMLGRTKDQIRTTEQVKGAMASCQALK  180

Query  577  LDGLVIVGGVTSNTDaaylaeafaeaKCPTK-VVGVPVTLNGDLKNQFVETNVGFDTICK  753
            LD LVI+GGVTSNTDAA LAE FAEAKC TK VVGVPVTLNGDLKNQFVET VGFDTICK
Sbjct  181  LDALVIIGGVTSNTDAAQLAETFAEAKCATKQVVGVPVTLNGDLKNQFVETTVGFDTICK  240



>ref|XP_009417287.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha {ECO:0000255|HAMAP-Rule:MF_03185}-like 
[Musa acuminata subsp. malaccensis]
Length=616

 Score =   353 bits (905),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 184/239 (77%), Positives = 210/239 (88%), Gaps = 0/239 (0%)
 Frame = +1

Query  37   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  216
            M+SD+G+ R+LS LQK R+ Y+PELP CLQGTTVRVEFGD T AADP+  H I + FPHT
Sbjct  1    MESDYGVPRDLSGLQKQRALYQPELPLCLQGTTVRVEFGDTTIAADPADDHAIRQAFPHT  60

Query  217  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  396
             GQPLAHFLRA+A VPDAQII EHPAIRVGIVFCGRQSPGGHN IWGLY+A+K HNP ST
Sbjct  61   SGQPLAHFLRATANVPDAQIIEEHPAIRVGIVFCGRQSPGGHNVIWGLYNAIKSHNPEST  120

Query  397  llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  576
            L GF+GG+EGLFA++ L+ITDDIL+TYKNQGGYD+LGRTKDQIR++EQVNAA++AC  L 
Sbjct  121  LFGFVGGTEGLFARRILKITDDILSTYKNQGGYDLLGRTKDQIRTSEQVNAAMSACQELN  180

Query  577  LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            L GLVI+GGVTS+TDAA LAE F E+KC TKVVGVPVTLNGDLKNQ VET+VGFDTICK
Sbjct  181  LTGLVIIGGVTSHTDAAQLAETFVESKCQTKVVGVPVTLNGDLKNQIVETDVGFDTICK  239



>ref|XP_006435471.1| hypothetical protein CICLE_v10000595mg [Citrus clementina]
 gb|ESR48711.1| hypothetical protein CICLE_v10000595mg [Citrus clementina]
Length=502

 Score =   348 bits (894),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 187/211 (89%), Positives = 201/211 (95%), Gaps = 0/211 (0%)
 Frame = +1

Query  121  LQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFLRASAKVPDAQIITEHPAIR  300
            +QGTTVRVEFGD+TT ADP+  H+ISR FPHT+GQPLAHFLRA+AKVPDAQIITEHPAIR
Sbjct  37   MQGTTVRVEFGDSTTTADPADTHSISRSFPHTYGQPLAHFLRATAKVPDAQIITEHPAIR  96

Query  301  VGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggseglfAQKTLEITDDILATYK  480
            VGIVFCGRQSPGGHN +WGLYDALK+HNP STLLGFLGGSEGLFAQKTLE+T +IL+TYK
Sbjct  97   VGIVFCGRQSPGGHNVVWGLYDALKLHNPKSTLLGFLGGSEGLFAQKTLEVTKEILSTYK  156

Query  481  NQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVIVGGVTSNTDaaylaeafaeaKC  660
            NQGGYDMLGRTKDQIR+TEQVNAALTAC +L LDGLVI+GGVTSNTDAAYLAE FAEAKC
Sbjct  157  NQGGYDMLGRTKDQIRTTEQVNAALTACKNLNLDGLVIIGGVTSNTDAAYLAETFAEAKC  216

Query  661  PTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            PTKVVGVPVTLNGDLKNQFVETNVGFDTICK
Sbjct  217  PTKVVGVPVTLNGDLKNQFVETNVGFDTICK  247



>ref|XP_006435473.1| hypothetical protein CICLE_v10000595mg [Citrus clementina]
 ref|XP_006435474.1| hypothetical protein CICLE_v10000595mg [Citrus clementina]
 gb|ESR48713.1| hypothetical protein CICLE_v10000595mg [Citrus clementina]
 gb|ESR48714.1| hypothetical protein CICLE_v10000595mg [Citrus clementina]
 gb|KDO85267.1| hypothetical protein CISIN_1g006964mg [Citrus sinensis]
 gb|KDO85268.1| hypothetical protein CISIN_1g006964mg [Citrus sinensis]
Length=623

 Score =   348 bits (894),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 187/211 (89%), Positives = 201/211 (95%), Gaps = 0/211 (0%)
 Frame = +1

Query  121  LQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFLRASAKVPDAQIITEHPAIR  300
            +QGTTVRVEFGD+TT ADP+  H+ISR FPHT+GQPLAHFLRA+AKVPDAQIITEHPAIR
Sbjct  37   MQGTTVRVEFGDSTTTADPADTHSISRSFPHTYGQPLAHFLRATAKVPDAQIITEHPAIR  96

Query  301  VGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggseglfAQKTLEITDDILATYK  480
            VGIVFCGRQSPGGHN +WGLYDALK+HNP STLLGFLGGSEGLFAQKTLE+T +IL+TYK
Sbjct  97   VGIVFCGRQSPGGHNVVWGLYDALKLHNPKSTLLGFLGGSEGLFAQKTLEVTKEILSTYK  156

Query  481  NQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVIVGGVTSNTDaaylaeafaeaKC  660
            NQGGYDMLGRTKDQIR+TEQVNAALTAC +L LDGLVI+GGVTSNTDAAYLAE FAEAKC
Sbjct  157  NQGGYDMLGRTKDQIRTTEQVNAALTACKNLNLDGLVIIGGVTSNTDAAYLAETFAEAKC  216

Query  661  PTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            PTKVVGVPVTLNGDLKNQFVETNVGFDTICK
Sbjct  217  PTKVVGVPVTLNGDLKNQFVETNVGFDTICK  247



>ref|XP_006659170.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha-like [Oryza brachyantha]
Length=622

 Score =   348 bits (893),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 188/243 (77%), Positives = 213/243 (88%), Gaps = 0/243 (0%)
 Frame = +1

Query  25   GQVKMDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRL  204
            G V MDSD+G+ RELS LQK R+ YRP LPPCLQGTTVRVE+GDA  AAD +G H IS  
Sbjct  2    GSVAMDSDYGVPRELSALQKARALYRPGLPPCLQGTTVRVEYGDAAVAADVAGAHVISHA  61

Query  205  FPHTFGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHN  384
            FPHT+GQPLAHFLR ++ VPDA +I EHP +RVGIVF GRQSPGGHN IWGL+DA+K HN
Sbjct  62   FPHTYGQPLAHFLRKTSVVPDATVIREHPVVRVGIVFSGRQSPGGHNVIWGLHDAIKAHN  121

Query  385  PNSTllgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTAC  564
            PNS L+GFLGG++GLFAQKTLEITD++L++YKNQGGYDMLGRT+DQIR+TEQVNAA+TAC
Sbjct  122  PNSKLIGFLGGTDGLFAQKTLEITDEVLSSYKNQGGYDMLGRTRDQIRTTEQVNAAMTAC  181

Query  565  TSLKLDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDT  744
              LKLD LVI+GGVTSNTDAA L+E FAE+KC TKVVGVPVTLNGDLKNQFVET VGFDT
Sbjct  182  QDLKLDALVIIGGVTSNTDAAQLSETFAESKCSTKVVGVPVTLNGDLKNQFVETTVGFDT  241

Query  745  ICK  753
            ICK
Sbjct  242  ICK  244



>ref|NP_001047918.1| Os02g0714200 [Oryza sativa Japonica Group]
 dbj|BAD07793.1| putative diphosphate-fructose-6-phosphate 1-phosphotransferase 
alpha chain [Oryza sativa Japonica Group]
 dbj|BAF09832.1| Os02g0714200 [Oryza sativa Japonica Group]
 dbj|BAG91865.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC73886.1| hypothetical protein OsI_08678 [Oryza sativa Indica Group]
 gb|EEE57680.1| hypothetical protein OsJ_08132 [Oryza sativa Japonica Group]
Length=617

 Score =   348 bits (892),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 186/239 (78%), Positives = 214/239 (90%), Gaps = 0/239 (0%)
 Frame = +1

Query  37   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  216
            MDSD+G+ RELS++QK R+ Y+PELPPCLQGTTVRVE+GDA  AADP+G H IS  FPHT
Sbjct  1    MDSDYGVPRELSEVQKKRALYQPELPPCLQGTTVRVEYGDAAIAADPAGAHVISHAFPHT  60

Query  217  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  396
            +GQPLAHFLR +A VPDA +I+EHP +RVG+VFCGRQSPGGHN IWGL++A+K HNPNS 
Sbjct  61   YGQPLAHFLRKTANVPDATVISEHPVVRVGVVFCGRQSPGGHNVIWGLHEAIKAHNPNSK  120

Query  397  llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  576
            L+GFLGGS+GL AQKTLEITD++L++YKNQGGYDMLGRTKDQIR+TEQVN A+ +C +LK
Sbjct  121  LIGFLGGSDGLLAQKTLEITDEVLSSYKNQGGYDMLGRTKDQIRTTEQVNGAMASCQALK  180

Query  577  LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            LD LVI+GGVTSNTDAA LAE FAEAKC TKVVGVPVTLNGDLKNQFVET VGFDTICK
Sbjct  181  LDALVIIGGVTSNTDAAQLAETFAEAKCATKVVGVPVTLNGDLKNQFVETTVGFDTICK  239



>ref|NP_001057528.1| Os06g0326400 [Oryza sativa Japonica Group]
 dbj|BAF19442.1| Os06g0326400 [Oryza sativa Japonica Group]
 dbj|BAG89341.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE65619.1| hypothetical protein OsJ_21179 [Oryza sativa Japonica Group]
Length=622

 Score =   347 bits (890),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 186/243 (77%), Positives = 215/243 (88%), Gaps = 0/243 (0%)
 Frame = +1

Query  25   GQVKMDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRL  204
            G V MDSD+G+ RELS LQK R+ YRP+LPPCLQGTTV+VE+GDA  AAD +G H IS  
Sbjct  2    GSVAMDSDYGVPRELSALQKARALYRPDLPPCLQGTTVKVEYGDAAIAADVAGAHVISHA  61

Query  205  FPHTFGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHN  384
            FPHT+GQPLAHFLR +A VPDA +ITEHP +RVG+VF GRQSPGGHN IWGL+DA+K HN
Sbjct  62   FPHTYGQPLAHFLRKTAAVPDATVITEHPVVRVGVVFSGRQSPGGHNVIWGLHDAIKAHN  121

Query  385  PNSTllgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTAC  564
             NS L+GFLGG++GLFAQKTLEI+D++L++YKNQGGYD+LGRT+DQIR+TEQVNAA+TAC
Sbjct  122  ANSKLIGFLGGTDGLFAQKTLEISDEVLSSYKNQGGYDLLGRTRDQIRTTEQVNAAMTAC  181

Query  565  TSLKLDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDT  744
             +LKLD LVI+GGVTSNTDAA LAE FAE+KC TKVVGVPVTLNGDLKNQFVET VGFDT
Sbjct  182  QALKLDALVIIGGVTSNTDAAQLAETFAESKCSTKVVGVPVTLNGDLKNQFVETTVGFDT  241

Query  745  ICK  753
            ICK
Sbjct  242  ICK  244



>ref|XP_002452651.1| hypothetical protein SORBIDRAFT_04g030000 [Sorghum bicolor]
 gb|EES05627.1| hypothetical protein SORBIDRAFT_04g030000 [Sorghum bicolor]
Length=616

 Score =   347 bits (889),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 186/239 (78%), Positives = 215/239 (90%), Gaps = 0/239 (0%)
 Frame = +1

Query  37   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  216
            MDSD+G+ RELS++QK R+ Y+PELPPCLQGTTVRVE+GDA  AADP+G H IS +FPHT
Sbjct  1    MDSDYGVPRELSEVQKKRALYQPELPPCLQGTTVRVEYGDAAIAADPAGAHVISHVFPHT  60

Query  217  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  396
            +GQPLAHFLR +A VPDA++I+EH A+RVGIVFCGRQSPGGHN +WGLY+A+K HN NS 
Sbjct  61   YGQPLAHFLRKTAVVPDAKVISEHLAVRVGIVFCGRQSPGGHNVVWGLYEAIKAHNQNSK  120

Query  397  llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  576
            L+GFLGGS+GL AQ+TLEITD++LA+YKNQGGYDMLGRTKDQIR+TEQVN A+ +C +LK
Sbjct  121  LIGFLGGSDGLLAQRTLEITDEVLASYKNQGGYDMLGRTKDQIRTTEQVNGAMASCQALK  180

Query  577  LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            LD LVI+GGVTSNTDAA LAE FAEAKC TKVVGVPVTLNGDLKNQFVET VGFDTICK
Sbjct  181  LDALVIIGGVTSNTDAAQLAETFAEAKCATKVVGVPVTLNGDLKNQFVETTVGFDTICK  239



>ref|XP_004953678.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha-like [Setaria italica]
Length=616

 Score =   346 bits (888),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 186/239 (78%), Positives = 215/239 (90%), Gaps = 0/239 (0%)
 Frame = +1

Query  37   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  216
            MDSD+G+ RELS++QK R+ Y+PE+PPCLQGTTVRVE+GDA  AADP+G H IS+ FPHT
Sbjct  1    MDSDYGVPRELSEVQKKRALYQPEVPPCLQGTTVRVEYGDAAIAADPAGAHVISQAFPHT  60

Query  217  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  396
            +GQPLAHFLR +A VPDA++I+EHPA+RVGIVFCGRQSPGGHN IWGLY+A+K HN NS 
Sbjct  61   YGQPLAHFLRKTAVVPDAKVISEHPAVRVGIVFCGRQSPGGHNVIWGLYEAIKAHNQNSK  120

Query  397  llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  576
            L+GFLGGS+GL AQKTLEITD++L++YKNQGGYDMLGRTKDQIR+TEQV  A+ +C +LK
Sbjct  121  LIGFLGGSDGLLAQKTLEITDEVLSSYKNQGGYDMLGRTKDQIRTTEQVKGAMASCQALK  180

Query  577  LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            LD LVI+GGVTSNTDAA LAE FAEAKC TKVVGVPVTLNGDLKNQFVET VGFDTICK
Sbjct  181  LDALVIIGGVTSNTDAAQLAETFAEAKCATKVVGVPVTLNGDLKNQFVETTVGFDTICK  239



>gb|EEC80509.1| hypothetical protein OsI_22776 [Oryza sativa Indica Group]
Length=622

 Score =   346 bits (888),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 186/243 (77%), Positives = 215/243 (88%), Gaps = 0/243 (0%)
 Frame = +1

Query  25   GQVKMDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRL  204
            G V MDSD+G+ RELS LQK R+ YRP+LPPCLQGTTV+VE+GDA  AAD +G H IS  
Sbjct  2    GSVAMDSDYGVPRELSALQKARALYRPDLPPCLQGTTVKVEYGDAAIAADVAGAHVISHA  61

Query  205  FPHTFGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHN  384
            FPHT+GQPLAHFLR +A VPDA +ITEHP +RVG+VF GRQSPGGHN IWGL+DA+K HN
Sbjct  62   FPHTYGQPLAHFLRKTAAVPDATVITEHPLVRVGVVFSGRQSPGGHNVIWGLHDAIKAHN  121

Query  385  PNSTllgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTAC  564
             NS L+GFLGG++GLFAQKTLEI+D++L++YKNQGGYD+LGRT+DQIR+TEQVNAA+TAC
Sbjct  122  ANSKLIGFLGGTDGLFAQKTLEISDEVLSSYKNQGGYDLLGRTRDQIRTTEQVNAAMTAC  181

Query  565  TSLKLDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDT  744
             +LKLD LVI+GGVTSNTDAA LAE FAE+KC TKVVGVPVTLNGDLKNQFVET VGFDT
Sbjct  182  QALKLDALVIIGGVTSNTDAAQLAETFAESKCSTKVVGVPVTLNGDLKNQFVETTVGFDT  241

Query  745  ICK  753
            ICK
Sbjct  242  ICK  244



>ref|XP_006648988.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha-like [Oryza brachyantha]
Length=617

 Score =   344 bits (882),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 183/239 (77%), Positives = 211/239 (88%), Gaps = 0/239 (0%)
 Frame = +1

Query  37   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  216
            MDSD+G+ RELS++QK R+ Y+PELPPCLQGTTVRVE+GDA  AADP+G H IS  FPHT
Sbjct  1    MDSDYGVPRELSEVQKKRALYQPELPPCLQGTTVRVEYGDAAIAADPAGAHVISHAFPHT  60

Query  217  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  396
            +GQPLAHFLR +A VP+A +I EHP +RVG+VFCGRQSPGGHN IWGLY+A+K HNPNS 
Sbjct  61   YGQPLAHFLRKTANVPEATVIAEHPTVRVGVVFCGRQSPGGHNVIWGLYEAIKAHNPNSM  120

Query  397  llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  576
            L+GFLGGS+GL AQK  EIT+++L++YKNQGGYDMLGRTKDQIR+TEQVN A+ +C +LK
Sbjct  121  LIGFLGGSDGLLAQKAFEITEEVLSSYKNQGGYDMLGRTKDQIRTTEQVNGAMASCQALK  180

Query  577  LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            LD LVI+GGVTSNTDAA LAE FAEAKC TKVVGVPVTLNGDLKNQFVET VGFDTICK
Sbjct  181  LDALVIIGGVTSNTDAAQLAETFAEAKCATKVVGVPVTLNGDLKNQFVETTVGFDTICK  239



>dbj|BAD33246.1| putative Pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
alpha subunit [Oryza sativa Japonica Group]
Length=617

 Score =   344 bits (882),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 184/239 (77%), Positives = 213/239 (89%), Gaps = 0/239 (0%)
 Frame = +1

Query  37   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  216
            MDSD+G+ RELS LQK R+ YRP+LPPCLQGTTV+VE+GDA  AAD +G H IS  FPHT
Sbjct  1    MDSDYGVPRELSALQKARALYRPDLPPCLQGTTVKVEYGDAAIAADVAGAHVISHAFPHT  60

Query  217  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  396
            +GQPLAHFLR +A VPDA +ITEHP +RVG+VF GRQSPGGHN IWGL+DA+K HN NS 
Sbjct  61   YGQPLAHFLRKTAAVPDATVITEHPVVRVGVVFSGRQSPGGHNVIWGLHDAIKAHNANSK  120

Query  397  llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  576
            L+GFLGG++GLFAQKTLEI+D++L++YKNQGGYD+LGRT+DQIR+TEQVNAA+TAC +LK
Sbjct  121  LIGFLGGTDGLFAQKTLEISDEVLSSYKNQGGYDLLGRTRDQIRTTEQVNAAMTACQALK  180

Query  577  LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            LD LVI+GGVTSNTDAA LAE FAE+KC TKVVGVPVTLNGDLKNQFVET VGFDTICK
Sbjct  181  LDALVIIGGVTSNTDAAQLAETFAESKCSTKVVGVPVTLNGDLKNQFVETTVGFDTICK  239



>gb|ACN26363.1| unknown [Zea mays]
Length=616

 Score =   343 bits (879),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 184/239 (77%), Positives = 213/239 (89%), Gaps = 0/239 (0%)
 Frame = +1

Query  37   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  216
            MDSD+G+ RELS++QK R+ Y+PELPPCLQGTTVRVE+GDA  AADP+G H IS  FPHT
Sbjct  1    MDSDYGVPRELSEVQKKRTLYQPELPPCLQGTTVRVEYGDAAIAADPAGAHVISHAFPHT  60

Query  217  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  396
            +GQP+AHFLR +A VPDA++I+EH A+RVGIVFCGRQSPGGHN +WGLY+A+K HN NS 
Sbjct  61   YGQPIAHFLRKTAVVPDAKVISEHQAVRVGIVFCGRQSPGGHNVVWGLYEAIKAHNQNSK  120

Query  397  llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  576
            L+GFLGGS+GL AQ+TLEITD ++A+YKNQGGYDMLGRTKDQIR+TEQVN A+ +C +LK
Sbjct  121  LIGFLGGSDGLLAQRTLEITDKVIASYKNQGGYDMLGRTKDQIRTTEQVNGAMASCQALK  180

Query  577  LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            LD LVI+GGVTSNTDAA LAE FAEAKC TKVVGVPVTLNGDLKNQFVET VGFDTICK
Sbjct  181  LDALVIIGGVTSNTDAAQLAETFAEAKCATKVVGVPVTLNGDLKNQFVETTVGFDTICK  239



>gb|AFW73096.1| pyrophosphate--fructose 6-phosphate 1-phosphotransferase alpha 
subunit isoform 1 [Zea mays]
 gb|AFW73097.1| pyrophosphate--fructose 6-phosphate 1-phosphotransferase alpha 
subunit isoform 2 [Zea mays]
Length=618

 Score =   343 bits (879),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 184/239 (77%), Positives = 213/239 (89%), Gaps = 0/239 (0%)
 Frame = +1

Query  37   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  216
            MDSD+G+ RELS++QK R+ Y+PELPPCLQGTTVRVE+GDA  AADP+G H IS  FPHT
Sbjct  1    MDSDYGVPRELSEVQKKRTLYQPELPPCLQGTTVRVEYGDAAIAADPAGAHVISHAFPHT  60

Query  217  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  396
            +GQP+AHFLR +A VPDA++I+EH A+RVGIVFCGRQSPGGHN +WGLY+A+K HN NS 
Sbjct  61   YGQPIAHFLRKTAVVPDAKVISEHQAVRVGIVFCGRQSPGGHNVVWGLYEAIKAHNQNSK  120

Query  397  llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  576
            L+GFLGGS+GL AQ+TLEITD ++A+YKNQGGYDMLGRTKDQIR+TEQVN A+ +C +LK
Sbjct  121  LIGFLGGSDGLLAQRTLEITDKVIASYKNQGGYDMLGRTKDQIRTTEQVNGAMASCQALK  180

Query  577  LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            LD LVI+GGVTSNTDAA LAE FAEAKC TKVVGVPVTLNGDLKNQFVET VGFDTICK
Sbjct  181  LDALVIIGGVTSNTDAAQLAETFAEAKCATKVVGVPVTLNGDLKNQFVETTVGFDTICK  239



>ref|NP_001146841.1| LOC100280449 [Zea mays]
 gb|ACG23899.1| pyrophosphate--fructose 6-phosphate 1-phosphotransferase alpha 
subunit [Zea mays]
 gb|ACN28159.1| unknown [Zea mays]
 gb|AFW63610.1| Pyrophosphate--fructose 6-phosphate 1-phosphotransferase alpha 
subunit [Zea mays]
Length=616

 Score =   341 bits (874),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 182/239 (76%), Positives = 212/239 (89%), Gaps = 0/239 (0%)
 Frame = +1

Query  37   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  216
            MDSD+G+ RELS++QK R+ Y+PE+PPCLQGTTVRVE+GDA  AAD +G H IS  FPHT
Sbjct  1    MDSDYGVPRELSEVQKKRALYQPEVPPCLQGTTVRVEYGDAAIAADQAGAHVISHAFPHT  60

Query  217  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  396
            +GQPLAHFLR +A V DA++I+EHP +RVGIVFCGRQSPGGHN +WGLY+A+K HN NS 
Sbjct  61   YGQPLAHFLRKTAVVLDAKVISEHPVVRVGIVFCGRQSPGGHNVVWGLYEAIKAHNQNSK  120

Query  397  llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  576
            L+GFLGGS+GL AQ+TLEIT+++LA+YKNQGGYDMLGRTKDQIR+TEQVN A+ +C +LK
Sbjct  121  LIGFLGGSDGLLAQRTLEITNEVLASYKNQGGYDMLGRTKDQIRTTEQVNGAMASCQALK  180

Query  577  LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            LD LVI+GGVTSNTDAA LAE FAEAKC TKVVGVPVTLNGDLKNQFVET VGFDTICK
Sbjct  181  LDALVIIGGVTSNTDAAQLAETFAEAKCATKVVGVPVTLNGDLKNQFVETTVGFDTICK  239



>ref|NP_001131947.1| uncharacterized protein LOC100193340 [Zea mays]
 gb|ACG24291.1| pyrophosphate--fructose 6-phosphate 1-phosphotransferase alpha 
subunit [Zea mays]
Length=618

 Score =   341 bits (874),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 183/239 (77%), Positives = 212/239 (89%), Gaps = 0/239 (0%)
 Frame = +1

Query  37   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  216
            MDSD+G+ RELS++QK R+ Y+PELPPCLQGTTVRVE+GDA  AADP+G H IS  FPHT
Sbjct  1    MDSDYGVPRELSEVQKKRTLYQPELPPCLQGTTVRVEYGDAAIAADPAGAHVISHAFPHT  60

Query  217  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  396
            + QP+AHFLR +A VPDA++I+EH A+RVGIVFCGRQSPGGHN +WGLY+A+K HN NS 
Sbjct  61   YAQPIAHFLRKTAVVPDAKVISEHQAVRVGIVFCGRQSPGGHNVVWGLYEAIKAHNQNSK  120

Query  397  llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  576
            L+GFLGGS+GL AQ+TLEITD ++A+YKNQGGYDMLGRTKDQIR+TEQVN A+ +C +LK
Sbjct  121  LIGFLGGSDGLLAQRTLEITDKVIASYKNQGGYDMLGRTKDQIRTTEQVNGAMASCQALK  180

Query  577  LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            LD LVI+GGVTSNTDAA LAE FAEAKC TKVVGVPVTLNGDLKNQFVET VGFDTICK
Sbjct  181  LDALVIIGGVTSNTDAAQLAETFAEAKCATKVVGVPVTLNGDLKNQFVETTVGFDTICK  239



>ref|XP_004965353.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha-like [Setaria italica]
Length=622

 Score =   340 bits (873),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 185/243 (76%), Positives = 210/243 (86%), Gaps = 0/243 (0%)
 Frame = +1

Query  25   GQVKMDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRL  204
            G V M+SD+G+ RELS LQK R+ Y+PELPPCLQGTTVRVE+GDA  AAD +G H IS+ 
Sbjct  2    GSVAMESDYGVPRELSSLQKARALYQPELPPCLQGTTVRVEYGDAAIAADVAGAHVISQA  61

Query  205  FPHTFGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHN  384
            FPHT+GQPLAHFL  +A V DA I+TEHP +RVGIVF GRQSPGGHN IWGLYDA+K HN
Sbjct  62   FPHTYGQPLAHFLGKTANVQDATIMTEHPVVRVGIVFSGRQSPGGHNVIWGLYDAIKAHN  121

Query  385  PNSTllgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTAC  564
            PNS L+GFLGG++GLFAQKT++I+D+ LA+YKNQGGYDMLGRT+DQIR+TEQV A L  C
Sbjct  122  PNSKLIGFLGGTDGLFAQKTMDISDEALASYKNQGGYDMLGRTRDQIRTTEQVEATLAIC  181

Query  565  TSLKLDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDT  744
             +LKLD LVI+GGVTSNTDAA LAE FAE KCPTKVVGVPVTLNGDLKNQFVET VGFDT
Sbjct  182  QALKLDSLVIIGGVTSNTDAAQLAETFAELKCPTKVVGVPVTLNGDLKNQFVETTVGFDT  241

Query  745  ICK  753
            ICK
Sbjct  242  ICK  244



>ref|XP_003589697.1| Pyrophosphate-fructose 6-phosphate 1-phosphotransferase alpha 
subunit [Medicago truncatula]
Length=596

 Score =   335 bits (858),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 187/239 (78%), Positives = 200/239 (84%), Gaps = 20/239 (8%)
 Frame = +1

Query  37   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  216
            MDSD+G+ RELSDLQKLRS Y+PELPPCLQGTTVRVEFGD TT ADP+            
Sbjct  1    MDSDYGIPRELSDLQKLRSLYQPELPPCLQGTTVRVEFGDGTTTADPAD-----------  49

Query  217  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  396
                      A+AKVPDAQIITEHP IRVGIVF GRQSPGGHN IWGL+ ALK+HNP S 
Sbjct  50   ---------EATAKVPDAQIITEHPPIRVGIVFSGRQSPGGHNVIWGLHSALKIHNPKSV  100

Query  397  llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  576
            LLGFLGGSEGLF+QKTLEITDDIL+TYKNQGGYD+LGRTKDQIR+TEQVNAAL  C +LK
Sbjct  101  LLGFLGGSEGLFSQKTLEITDDILSTYKNQGGYDLLGRTKDQIRTTEQVNAALATCNNLK  160

Query  577  LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            LDGLVI+GGVTSNTDAA LAE FA AKCPTKVVGVPVTLNGDLKNQFVETNVGFDTI K
Sbjct  161  LDGLVIIGGVTSNTDAAQLAETFAVAKCPTKVVGVPVTLNGDLKNQFVETNVGFDTISK  219



>gb|AES59948.2| pyrophosphate-fructose-6-phosphate 1-phosphotransferase [Medicago 
truncatula]
Length=597

 Score =   333 bits (855),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 187/239 (78%), Positives = 200/239 (84%), Gaps = 19/239 (8%)
 Frame = +1

Query  37   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  216
            MDSD+G+ RELSDLQKLRS Y+PELPPCLQGTTVRVEFGD TT ADP+   TI+      
Sbjct  1    MDSDYGIPRELSDLQKLRSLYQPELPPCLQGTTVRVEFGDGTTTADPADEPTIT------  54

Query  217  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  396
                         KVPDAQIITEHP IRVGIVF GRQSPGGHN IWGL+ ALK+HNP S 
Sbjct  55   -------------KVPDAQIITEHPPIRVGIVFSGRQSPGGHNVIWGLHSALKIHNPKSV  101

Query  397  llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  576
            LLGFLGGSEGLF+QKTLEITDDIL+TYKNQGGYD+LGRTKDQIR+TEQVNAAL  C +LK
Sbjct  102  LLGFLGGSEGLFSQKTLEITDDILSTYKNQGGYDLLGRTKDQIRTTEQVNAALATCNNLK  161

Query  577  LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            LDGLVI+GGVTSNTDAA LAE FA AKCPTKVVGVPVTLNGDLKNQFVETNVGFDTI K
Sbjct  162  LDGLVIIGGVTSNTDAAQLAETFAVAKCPTKVVGVPVTLNGDLKNQFVETNVGFDTISK  220



>dbj|BAK04583.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=622

 Score =   333 bits (853),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 182/243 (75%), Positives = 207/243 (85%), Gaps = 0/243 (0%)
 Frame = +1

Query  25   GQVKMDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRL  204
            G V MDSD+G  RELS LQK R+ YRPELPPCLQGT VRVE GDA  AAD +  H I   
Sbjct  2    GSVAMDSDYGATRELSPLQKERALYRPELPPCLQGTAVRVEHGDAAIAADGADAHVIGHA  61

Query  205  FPHTFGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHN  384
            FPHT+GQPLAHFL  +A  PDA +IT+HPA+RVG+VF GRQSPGGHN IWGL++A+  HN
Sbjct  62   FPHTYGQPLAHFLPKTANAPDATVITKHPAVRVGVVFSGRQSPGGHNVIWGLHNAINSHN  121

Query  385  PNSTllgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTAC  564
            P+S L+GFLGG++GLFAQKTLEITD++L++YKNQGGYDMLGRT+DQIR+TEQV AA+T C
Sbjct  122  PSSKLIGFLGGTDGLFAQKTLEITDEVLSSYKNQGGYDMLGRTRDQIRTTEQVKAAMTTC  181

Query  565  TSLKLDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDT  744
             +LKLD LVIVGGVTSNTDAA LAE FAE+KC TKVVGVPVTLNGDLKNQFVET VGFDT
Sbjct  182  QALKLDALVIVGGVTSNTDAAQLAETFAESKCLTKVVGVPVTLNGDLKNQFVETTVGFDT  241

Query  745  ICK  753
            ICK
Sbjct  242  ICK  244



>ref|XP_003563894.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha-like [Brachypodium distachyon]
Length=626

 Score =   328 bits (842),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 177/246 (72%), Positives = 205/246 (83%), Gaps = 3/246 (1%)
 Frame = +1

Query  25   GQVKMDSDFGLARELSDLQKLRSQYRPELPPCL---QGTTVRVEFGDATTAADPSGGHTI  195
            G   ++SD+G  RELS LQK R+ YRPELPPCL   QGT VRVE+GDAT AAD +  H I
Sbjct  2    GSTAVNSDYGATRELSALQKERALYRPELPPCLHGNQGTAVRVEYGDATIAADGADAHVI  61

Query  196  SRLFPHTFGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALK  375
               FPHT+GQPLAHFL  +A   DA IITEHP +RVG+VF GRQSPGGHN IWGL+DAL 
Sbjct  62   GNAFPHTYGQPLAHFLPEAANAADAAIITEHPVVRVGVVFSGRQSPGGHNVIWGLHDALS  121

Query  376  VHNPNSTllgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAAL  555
             HNP+S L+GFLGG++GLFAQKTLEIT+++L++YKNQGGYDM+GRT+DQIR+TEQV AA+
Sbjct  122  AHNPSSKLIGFLGGTDGLFAQKTLEITEEVLSSYKNQGGYDMIGRTRDQIRTTEQVKAAM  181

Query  556  TACTSLKLDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVG  735
            T C +L LD LVI+GGVTSNTDAA LAE FAE+KC TK+VGVPVTLNGDLKNQFVET VG
Sbjct  182  TTCQTLMLDALVIIGGVTSNTDAAQLAETFAESKCSTKIVGVPVTLNGDLKNQFVETTVG  241

Query  736  FDTICK  753
            FDTICK
Sbjct  242  FDTICK  247



>gb|AEZ53899.1| pyrophosphate-dependent fructose-6-phosphate 1-phosphotransferase 
alpha subunit short variant, partial [Zea mays]
 gb|AEZ53900.1| pyrophosphate-dependent fructose-6-phosphate 1-phosphotransferase 
alpha subunit short variant [Zea mays]
Length=587

 Score =   326 bits (836),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 176/243 (72%), Positives = 201/243 (83%), Gaps = 0/243 (0%)
 Frame = +1

Query  25   GQVKMDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRL  204
            G V MD+D+G  RELS LQK R+ YRPE PPCLQG TV VE+GDA  AAD +G H IS  
Sbjct  2    GSVAMDADYGAPRELSPLQKARALYRPETPPCLQGPTVSVEYGDAAIAADVAGAHVISHA  61

Query  205  FPHTFGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHN  384
            FPHT+GQPL HFL  +A V DA I+TEHP +R+G+VF GRQSPGGHN IWGLYD +K HN
Sbjct  62   FPHTYGQPLVHFLTKTANVHDATIVTEHPVVRIGVVFSGRQSPGGHNVIWGLYDVVKAHN  121

Query  385  PNSTllgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTAC  564
             NS ++GFLGG++GLFAQKT+EITD+ L +YKNQGGYDMLGRT+DQIR+TEQV A +  C
Sbjct  122  SNSKIIGFLGGTDGLFAQKTIEITDEALPSYKNQGGYDMLGRTRDQIRTTEQVKATIGTC  181

Query  565  TSLKLDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDT  744
             +LKLD LVI+GGVTSNTDAA LAE FA+ KCPTKVVGVPVTLNGDLKNQFVET VGFDT
Sbjct  182  QALKLDALVIIGGVTSNTDAAQLAETFAQLKCPTKVVGVPVTLNGDLKNQFVETTVGFDT  241

Query  745  ICK  753
            ICK
Sbjct  242  ICK  244



>ref|XP_008659507.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha [Zea mays]
Length=622

 Score =   325 bits (834),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 176/243 (72%), Positives = 201/243 (83%), Gaps = 0/243 (0%)
 Frame = +1

Query  25   GQVKMDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRL  204
            G V MD+D+G  RELS LQK R+ YRPE PPCLQG TV VE+GDA  AAD +G H IS  
Sbjct  2    GSVAMDADYGAPRELSPLQKARALYRPETPPCLQGPTVSVEYGDAAIAADVAGAHVISHA  61

Query  205  FPHTFGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHN  384
            FPHT+GQPL HFL  +A V DA I+TEHP +R+G+VF GRQSPGGHN IWGLYD +K HN
Sbjct  62   FPHTYGQPLVHFLTKTANVHDATIVTEHPVVRIGVVFSGRQSPGGHNVIWGLYDVVKAHN  121

Query  385  PNSTllgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTAC  564
             NS ++GFLGG++GLFAQKT+EITD+ L +YKNQGGYDMLGRT+DQIR+TEQV A +  C
Sbjct  122  SNSKIIGFLGGTDGLFAQKTIEITDEALPSYKNQGGYDMLGRTRDQIRTTEQVKATIGTC  181

Query  565  TSLKLDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDT  744
             +LKLD LVI+GGVTSNTDAA LAE FA+ KCPTKVVGVPVTLNGDLKNQFVET VGFDT
Sbjct  182  QALKLDALVIIGGVTSNTDAAQLAETFAQLKCPTKVVGVPVTLNGDLKNQFVETTVGFDT  241

Query  745  ICK  753
            ICK
Sbjct  242  ICK  244



>ref|XP_004956505.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha-like isoform X1 [Setaria italica]
Length=620

 Score =   315 bits (807),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 162/239 (68%), Positives = 200/239 (84%), Gaps = 0/239 (0%)
 Frame = +1

Query  37   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  216
            M++D G  REL+ LQ+ R+ Y+PELPPCLQGT VRVEFGD+TT+ DP     ++++FP T
Sbjct  1    MNADQGSPRELTGLQRRRALYQPELPPCLQGTRVRVEFGDSTTSIDPKCADIVAQVFPQT  60

Query  217  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  396
            FGQ L HFL  ++KV DAQ+I EHP IRVG++F GRQSPGGHN IWG YDA+K  NP++ 
Sbjct  61   FGQKLVHFLEPNSKVSDAQVIKEHPPIRVGVLFSGRQSPGGHNVIWGTYDAMKAQNPHNV  120

Query  397  llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  576
            LLGF+GG+EGLFA+K LEITDD+L++YKNQGG+D+LGRT DQIR+TEQVNAA++ C  L 
Sbjct  121  LLGFIGGTEGLFAKKMLEITDDVLSSYKNQGGFDLLGRTVDQIRTTEQVNAAMSTCCDLS  180

Query  577  LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            LDGL+I+GGVTSN+DAA LAE FA+  C TKV+GVPVTL+GDLKNQFVET VGFDT+CK
Sbjct  181  LDGLIIIGGVTSNSDAAQLAETFAKHNCNTKVIGVPVTLSGDLKNQFVETTVGFDTVCK  239



>ref|XP_006660512.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha-like [Oryza brachyantha]
Length=620

 Score =   301 bits (771),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 159/241 (66%), Positives = 192/241 (80%), Gaps = 2/241 (1%)
 Frame = +1

Query  31   VKMDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFP  210
            + M++D G  REL+ LQ+ R+ Y+PELPPCLQG  +RVE GDATT  DP+  + +++ FP
Sbjct  1    MSMNADLGKPRELTGLQQRRALYQPELPPCLQGKAIRVELGDATTTIDPTCVNMVAQEFP  60

Query  211  HTFGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPN  390
            HTFGQPL HFL+++    DAQ    H +IRVG+VF GRQSPGGHN IWG+YDA+K  NP 
Sbjct  61   HTFGQPLVHFLKSNKL--DAQATDAHTSIRVGVVFSGRQSPGGHNVIWGIYDAMKTQNPQ  118

Query  391  STllgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTS  570
            S LLGF+GG+EGLF  KTL+ITDD+L+ YKNQGG+D LGRT DQI +TEQVNAA++ C  
Sbjct  119  SVLLGFIGGTEGLFTNKTLKITDDVLSAYKNQGGFDFLGRTVDQIHTTEQVNAAMSTCCD  178

Query  571  LKLDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTIC  750
            L LDGLVI+GGVTSN+DAA LAE FA   C TKVVGVPV+LNGDLKNQFVET VGFDT+C
Sbjct  179  LDLDGLVIIGGVTSNSDAAQLAETFASHNCKTKVVGVPVSLNGDLKNQFVETTVGFDTVC  238

Query  751  K  753
            K
Sbjct  239  K  239



>gb|EEC84297.1| hypothetical protein OsI_30782 [Oryza sativa Indica Group]
Length=581

 Score =   299 bits (765),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 158/241 (66%), Positives = 192/241 (80%), Gaps = 2/241 (1%)
 Frame = +1

Query  31   VKMDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFP  210
            + M++D G  REL+ LQ+ R+ Y+PELPPCL+G  +RVEFGD+TT  DP+  + + + FP
Sbjct  1    MSMNADLGKPRELTGLQQRRALYQPELPPCLEGKAIRVEFGDSTTTIDPTCANMVVQEFP  60

Query  211  HTFGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPN  390
            +TFGQPL HFL+ +    DAQ   EHP IRVG+VF GRQSPGGHN IWG+YDA+K  N  
Sbjct  61   NTFGQPLVHFLKPNKM--DAQANDEHPPIRVGVVFSGRQSPGGHNVIWGIYDAMKTQNLQ  118

Query  391  STllgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTS  570
            S LLGF+GG+EGLFA +TLEITDD+L+ Y+NQGG+D LGRT DQI +TEQVNAA++ C  
Sbjct  119  SVLLGFIGGTEGLFANQTLEITDDVLSAYRNQGGFDFLGRTVDQIHTTEQVNAAMSTCCD  178

Query  571  LKLDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTIC  750
            L LDGLVI+GGVTSN+DAA LAE FA   C TKVVGVPV+LNGDLKNQFVET VGFDT+C
Sbjct  179  LDLDGLVIIGGVTSNSDAAQLAETFANHNCKTKVVGVPVSLNGDLKNQFVETTVGFDTVC  238

Query  751  K  753
            K
Sbjct  239  K  239



>gb|EEE69397.1| hypothetical protein OsJ_28754 [Oryza sativa Japonica Group]
Length=579

 Score =   298 bits (764),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 158/239 (66%), Positives = 191/239 (80%), Gaps = 2/239 (1%)
 Frame = +1

Query  37   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  216
            M++D G  REL+ LQ+ R+ Y+PELPPCL+G  +RVEFGD+TT  DP+  + + + FP+T
Sbjct  1    MNADLGKPRELTGLQQRRALYQPELPPCLEGKAIRVEFGDSTTTIDPTCANMVVQEFPNT  60

Query  217  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  396
            FGQPL HFL+ +    DAQ   EHP IRVG+VF GRQSPGGHN IWG+YDA+K  N  S 
Sbjct  61   FGQPLVHFLKPNKM--DAQANDEHPPIRVGVVFSGRQSPGGHNVIWGIYDAMKTQNLQSV  118

Query  397  llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  576
            LLGF+GG+EGLFA +TLEITDD+L+ Y+NQGG+D LGRT DQI +TEQVNAA++ C  L 
Sbjct  119  LLGFIGGTEGLFANQTLEITDDVLSAYRNQGGFDFLGRTVDQIHTTEQVNAAMSTCCDLD  178

Query  577  LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            LDGLVI+GGVTSN+DAA LAE FA   C TKVVGVPV+LNGDLKNQFVET VGFDT+CK
Sbjct  179  LDGLVIIGGVTSNSDAAQLAETFANHNCKTKVVGVPVSLNGDLKNQFVETTVGFDTVCK  237



>ref|XP_009385723.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha {ECO:0000255|HAMAP-Rule:MF_03185}-like 
[Musa acuminata subsp. malaccensis]
Length=623

 Score =   299 bits (766),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 164/236 (69%), Positives = 188/236 (80%), Gaps = 0/236 (0%)
 Frame = +1

Query  46   DFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQ  225
            +FG   E S LQK RS Y P+LPPCLQG+ V+VEFGDATT  DP    +I R FP T+GQ
Sbjct  2    EFGAGIEFSTLQKQRSLYVPQLPPCLQGSHVQVEFGDATTVPDPLDAESIKRSFPLTYGQ  61

Query  226  PLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllg  405
            PL HF+ +  K P   +  + P +RVG+VFCGRQSPGGHN I GLYDA+K+HNP STLLG
Sbjct  62   PLVHFVSSLEKPPPNGVQDQQPPLRVGVVFCGRQSPGGHNIICGLYDAMKLHNPKSTLLG  121

Query  406  flggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDG  585
            F GG+EGLF QKTL I+DDI+A Y+NQGGYDMLGRTKDQI S EQVN+AL AC +L L+G
Sbjct  122  FCGGTEGLFVQKTLVISDDIVAAYRNQGGYDMLGRTKDQITSKEQVNSALNACQTLDLNG  181

Query  586  LVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            LV++GGVTSNTDAA LAE FAEAKC TKVVGVPVT  GDL+NQFVE NVGFDTICK
Sbjct  182  LVVIGGVTSNTDAAQLAETFAEAKCLTKVVGVPVTFYGDLQNQFVEANVGFDTICK  237



>dbj|BAD33224.1| putative pyrophosphate-dependent phosphofructokinase alpha subunit 
[Oryza sativa Japonica Group]
 dbj|BAD32985.1| putative pyrophosphate-dependent phosphofructokinase alpha subunit 
[Oryza sativa Japonica Group]
Length=618

 Score =   298 bits (763),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 158/239 (66%), Positives = 191/239 (80%), Gaps = 2/239 (1%)
 Frame = +1

Query  37   MDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHT  216
            M++D G  REL+ LQ+ R+ Y+PELPPCL+G  +RVEFGD+TT  DP+  + + + FP+T
Sbjct  1    MNADLGKPRELTGLQQRRALYQPELPPCLEGKAIRVEFGDSTTTIDPTCANMVVQEFPNT  60

Query  217  FGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNST  396
            FGQPL HFL+ +    DAQ   EHP IRVG+VF GRQSPGGHN IWG+YDA+K  N  S 
Sbjct  61   FGQPLVHFLKPNKM--DAQANDEHPPIRVGVVFSGRQSPGGHNVIWGIYDAMKTQNLQSV  118

Query  397  llgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLK  576
            LLGF+GG+EGLFA +TLEITDD+L+ Y+NQGG+D LGRT DQI +TEQVNAA++ C  L 
Sbjct  119  LLGFIGGTEGLFANQTLEITDDVLSAYRNQGGFDFLGRTVDQIHTTEQVNAAMSTCCDLD  178

Query  577  LDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            LDGLVI+GGVTSN+DAA LAE FA   C TKVVGVPV+LNGDLKNQFVET VGFDT+CK
Sbjct  179  LDGLVIIGGVTSNSDAAQLAETFANHNCKTKVVGVPVSLNGDLKNQFVETTVGFDTVCK  237



>tpg|DAA49241.1| TPA: hypothetical protein ZEAMMB73_624432 [Zea mays]
Length=488

 Score =   291 bits (746),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 157/240 (65%), Positives = 191/240 (80%), Gaps = 4/240 (2%)
 Frame = +1

Query  37   MDSDFGLARELSD-LQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPH  213
            M++DFG  +EL+  LQ+ R+ Y+P LPPCLQG TVR E+GDATT  DP+    +++ FPH
Sbjct  1    MNADFGAPKELAGGLQQRRALYQPRLPPCLQGPTVRAEYGDATTTIDPTCAQAVAQAFPH  60

Query  214  TFGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNS  393
            TFGQPL  F+  +A     +    HP IRVG+VF GRQSPGGHN +WGL+DALK +NP S
Sbjct  61   TFGQPLVSFVAPAAGAGAVE--ERHP-IRVGVVFSGRQSPGGHNVVWGLHDALKAYNPQS  117

Query  394  TllgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSL  573
             L GF+GG+EGLFA KTLEITDD+LA+YKNQGG+D+LGR+ DQIR+T+QVNAA+T C SL
Sbjct  118  LLYGFVGGTEGLFANKTLEITDDVLASYKNQGGFDLLGRSIDQIRTTKQVNAAMTTCHSL  177

Query  574  KLDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
             LDGLVI+GGVTSN+DAA LAE   +  C TKVVGVPV+LNGDLKNQFVET VGFDT+CK
Sbjct  178  NLDGLVIIGGVTSNSDAAQLAETLIQNNCKTKVVGVPVSLNGDLKNQFVETTVGFDTVCK  237



>gb|AGY61464.1| pyrophosphate-fructose-6-phosphate-phosphotransferase alpha1, 
partial [Rorippa sylvestris]
Length=185

 Score =   280 bits (716),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 157/180 (87%), Positives = 166/180 (92%), Gaps = 0/180 (0%)
 Frame = +1

Query  214  TFGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNS  393
            T GQPLAHFLRA+AKV DA IITE P+IRVGIVF GRQ+PGGHN IWGLY+ALKVHN  S
Sbjct  1    TLGQPLAHFLRATAKVSDAHIITELPSIRVGIVFSGRQAPGGHNVIWGLYEALKVHNAKS  60

Query  394  TllgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSL  573
            TLLGFLGGSEGLFAQKTLEITDDIL TYKNQGGYD+LGRTKDQIR+TEQVNAAL ACT L
Sbjct  61   TLLGFLGGSEGLFAQKTLEITDDILQTYKNQGGYDLLGRTKDQIRTTEQVNAALKACTDL  120

Query  574  KLDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            KLDGLVI+GGVTSNTDAA+LAE F EAKCPTKVVGVPVT+NGDLKNQFVE NVGFDTICK
Sbjct  121  KLDGLVIIGGVTSNTDAAHLAEFFVEAKCPTKVVGVPVTINGDLKNQFVEANVGFDTICK  180



>gb|AGY61463.1| pyrophosphate-fructose-6-phosphate-phosphotransferase alpha1, 
partial [Rorippa amphibia]
Length=185

 Score =   279 bits (714),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 156/180 (87%), Positives = 166/180 (92%), Gaps = 0/180 (0%)
 Frame = +1

Query  214  TFGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNS  393
            T GQPLAHFLRA+AKV DA IITE P+IRVGIVF GRQ+PGGHN IWGLY+ALKVHN  S
Sbjct  1    TLGQPLAHFLRATAKVSDAHIITELPSIRVGIVFSGRQAPGGHNVIWGLYEALKVHNAKS  60

Query  394  TllgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSL  573
            TLLGFLGGSEGLFAQKTLEITDDIL TYKNQGGYD+LGRTKDQIR+TEQVNAAL ACT L
Sbjct  61   TLLGFLGGSEGLFAQKTLEITDDILQTYKNQGGYDLLGRTKDQIRTTEQVNAALKACTDL  120

Query  574  KLDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            KLDGLVI+GGVTSNTDAA+LAE F EAKCPTKVVGVPVT+NGDLKNQFVE NVGFDT+CK
Sbjct  121  KLDGLVIIGGVTSNTDAAHLAEFFVEAKCPTKVVGVPVTINGDLKNQFVEANVGFDTVCK  180



>gb|AGN30570.1| pyrophosphate-fructose-6-phosphate-phosphotransferase PFPA4 [Oryza 
sativa Japonica Group]
Length=627

 Score =   293 bits (750),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 159/248 (64%), Positives = 192/248 (77%), Gaps = 9/248 (4%)
 Frame = +1

Query  31   VKMDSDFGLARELSDLQKLRSQYRPELPPCL-------QGTTVRVEFGDATTAADPSGGH  189
            + M++D G  REL+ LQ+ R+ Y+PELPPCL       QG  +RVEFGD+TT  DP+  +
Sbjct  1    MSMNADLGKPRELTGLQQRRALYQPELPPCLEFFNQHVQGKAIRVEFGDSTTTIDPTCAN  60

Query  190  TISRLFPHTFGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDA  369
             + + FP+TFGQPL HFL+ +    DAQ   EHP IRVG+VF GRQSPGGHN IWG+YDA
Sbjct  61   MVVQEFPNTFGQPLVHFLKPNKM--DAQANDEHPPIRVGVVFSGRQSPGGHNVIWGIYDA  118

Query  370  LKVHNPNSTllgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNA  549
            +K  N  S LLGF+GG+EGLFA +TLEITDD+L+ Y+NQGG+D LGRT DQI +TEQVNA
Sbjct  119  MKTQNLQSVLLGFIGGTEGLFANQTLEITDDVLSAYRNQGGFDFLGRTVDQIHTTEQVNA  178

Query  550  ALTACTSLKLDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETN  729
            A++ C  L LDGLVI+GGVTSN+DAA LAE FA   C TKVVGVPV+LNGDLKNQFVET 
Sbjct  179  AMSTCCDLDLDGLVIIGGVTSNSDAAQLAETFANHNCKTKVVGVPVSLNGDLKNQFVETT  238

Query  730  VGFDTICK  753
            VGFDT+CK
Sbjct  239  VGFDTVCK  246



>gb|ACL53065.1| unknown [Zea mays]
 gb|ACN27719.1| unknown [Zea mays]
 tpg|DAA49242.1| TPA: hypothetical protein ZEAMMB73_624432 [Zea mays]
Length=618

 Score =   291 bits (746),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 157/240 (65%), Positives = 191/240 (80%), Gaps = 4/240 (2%)
 Frame = +1

Query  37   MDSDFGLARELSD-LQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPH  213
            M++DFG  +EL+  LQ+ R+ Y+P LPPCLQG TVR E+GDATT  DP+    +++ FPH
Sbjct  1    MNADFGAPKELAGGLQQRRALYQPRLPPCLQGPTVRAEYGDATTTIDPTCAQAVAQAFPH  60

Query  214  TFGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNS  393
            TFGQPL  F+  +A     +    HP IRVG+VF GRQSPGGHN +WGL+DALK +NP S
Sbjct  61   TFGQPLVSFVAPAAGAGAVE--ERHP-IRVGVVFSGRQSPGGHNVVWGLHDALKAYNPQS  117

Query  394  TllgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSL  573
             L GF+GG+EGLFA KTLEITDD+LA+YKNQGG+D+LGR+ DQIR+T+QVNAA+T C SL
Sbjct  118  LLYGFVGGTEGLFANKTLEITDDVLASYKNQGGFDLLGRSIDQIRTTKQVNAAMTTCHSL  177

Query  574  KLDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
             LDGLVI+GGVTSN+DAA LAE   +  C TKVVGVPV+LNGDLKNQFVET VGFDT+CK
Sbjct  178  NLDGLVIIGGVTSNSDAAQLAETLIQNNCKTKVVGVPVSLNGDLKNQFVETTVGFDTVCK  237



>ref|XP_003573791.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha-like [Brachypodium distachyon]
Length=617

 Score =   291 bits (744),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 156/240 (65%), Positives = 193/240 (80%), Gaps = 5/240 (2%)
 Frame = +1

Query  37   MDSDFGLARELS-DLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPH  213
            M++D+G + EL   LQ+ R+ Y+P LPPCLQG TVRVE+GDATT  DP+G   ++R FP 
Sbjct  1    MNADYGASTELEGPLQQRRALYQPRLPPCLQGATVRVEYGDATTTIDPAGAPEVARAFPR  60

Query  214  TFGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNS  393
            T+GQPL +FL A+A         E P IRVG+VF GRQSPGGHN +WGL+DALK HNP+ 
Sbjct  61   TYGQPLVNFLAAAADKAAG----ERPPIRVGVVFSGRQSPGGHNLVWGLHDALKAHNPHC  116

Query  394  TllgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSL  573
             L GF+GG+EGLFA KTLEIT+D+LA+YKNQGG+D+LGR+ DQIR+++Q++AA+T CT+L
Sbjct  117  ALYGFIGGTEGLFANKTLEITNDVLASYKNQGGFDLLGRSIDQIRTSKQLSAAMTTCTNL  176

Query  574  KLDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
             LDGLVIVGGVTSN+DAA LAE   +  C TKVVGVPV+LNGDLKNQFVET VGFDT+CK
Sbjct  177  NLDGLVIVGGVTSNSDAAQLAETLVQNNCKTKVVGVPVSLNGDLKNQFVETTVGFDTVCK  236



>ref|NP_001061602.1| Os08g0345700 [Oryza sativa Japonica Group]
 dbj|BAC75438.1| putative pyrophosphate-dependent phosphofructokinase alpha subunit 
[Oryza sativa Japonica Group]
 dbj|BAF23516.1| Os08g0345700 [Oryza sativa Japonica Group]
 dbj|BAG94900.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG94364.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC83431.1| hypothetical protein OsI_28900 [Oryza sativa Indica Group]
 gb|EEE68536.1| hypothetical protein OsJ_26990 [Oryza sativa Japonica Group]
Length=617

 Score =   291 bits (744),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 157/240 (65%), Positives = 195/240 (81%), Gaps = 5/240 (2%)
 Frame = +1

Query  37   MDSDFGLARELSD-LQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPH  213
            M++DFG  ++L+  LQ+ RS Y+P LPPCLQG TV+VE+GDATT  DP+  + +++ FP 
Sbjct  1    MNADFGAPKDLAGGLQQRRSLYQPTLPPCLQGATVKVEYGDATTTIDPTCANVVAQAFPR  60

Query  214  TFGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNS  393
            T+GQPL  F+   A  PDA +  +   IRVG+VF GRQSPGGHN IWGL+DALK +NP+S
Sbjct  61   TYGQPLVSFV---APPPDA-VDKDRAPIRVGVVFSGRQSPGGHNVIWGLHDALKAYNPHS  116

Query  394  TllgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSL  573
             L GF+GG+EGLFA KT+EITDD+LA+YKNQGG+D+LGR+ DQIRST+QVNAA+T C +L
Sbjct  117  VLYGFVGGTEGLFANKTIEITDDVLASYKNQGGFDLLGRSIDQIRSTKQVNAAMTTCNNL  176

Query  574  KLDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
             LDGLVI+GGVTSN+DAA LAEA  +  C TKVVGVPV+LNGDLKNQFVET VGFDT+CK
Sbjct  177  NLDGLVIIGGVTSNSDAAQLAEALVQNNCKTKVVGVPVSLNGDLKNQFVETTVGFDTVCK  236



>ref|NP_001130747.1| uncharacterized protein LOC100191851 [Zea mays]
 gb|ACF79089.1| unknown [Zea mays]
Length=618

 Score =   291 bits (744),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 157/240 (65%), Positives = 191/240 (80%), Gaps = 4/240 (2%)
 Frame = +1

Query  37   MDSDFGLARELSD-LQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPH  213
            M++DFG  +EL+  LQ+ R+ Y+P LPPCLQG TVR E+GDATT  DP+    +++ FPH
Sbjct  1    MNADFGAPKELAGGLQQRRALYQPRLPPCLQGPTVRAEYGDATTTIDPTCAQAVAQPFPH  60

Query  214  TFGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNS  393
            TFGQPL  F+  +A     +    HP IRVG+VF GRQSPGGHN +WGL+DALK +NP S
Sbjct  61   TFGQPLVSFVAPAAGAGAVE--ERHP-IRVGVVFSGRQSPGGHNVVWGLHDALKAYNPQS  117

Query  394  TllgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSL  573
             L GF+GG+EGLFA KTLEITDD+LA+YKNQGG+D+LGR+ DQIR+T+QVNAA+T C SL
Sbjct  118  LLYGFVGGTEGLFANKTLEITDDVLASYKNQGGFDLLGRSIDQIRTTKQVNAAMTTCHSL  177

Query  574  KLDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
             LDGLVI+GGVTSN+DAA LAE   +  C TKVVGVPV+LNGDLKNQFVET VGFDT+CK
Sbjct  178  NLDGLVIIGGVTSNSDAAQLAETLIQNNCKTKVVGVPVSLNGDLKNQFVETTVGFDTVCK  237



>ref|XP_004973257.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha-like [Setaria italica]
Length=618

 Score =   290 bits (742),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 154/240 (64%), Positives = 192/240 (80%), Gaps = 4/240 (2%)
 Frame = +1

Query  37   MDSDFGLARELSD-LQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPH  213
            M++DFG  +EL+  LQ+ R+ Y+P LPPCLQG TVR E+GDATT  DPS  + +++ FP+
Sbjct  1    MNADFGAPKELAGGLQQRRALYQPRLPPCLQGPTVRAEYGDATTTIDPSCANVVAQAFPN  60

Query  214  TFGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNS  393
            TFGQPL  F+  +     A+   E P IRVG+VF GRQSPGGHN +WGL+DALK +NP+S
Sbjct  61   TFGQPLVSFVAPADAAAAAE---ERPPIRVGVVFSGRQSPGGHNVVWGLHDALKAYNPHS  117

Query  394  TllgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSL  573
             L GF+GG+EGLFA KTLEITDD+LA+YKNQGG+D+LGR+ DQIR+T+QV++A+  C SL
Sbjct  118  VLYGFVGGTEGLFANKTLEITDDVLASYKNQGGFDLLGRSIDQIRTTKQVSSAMATCRSL  177

Query  574  KLDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
             LDGLVI+GGVTSN+DAA LAE   +  C TKVVGVPV+LNGDLKNQFVET VGFDT+CK
Sbjct  178  NLDGLVIIGGVTSNSDAAQLAETLIQNNCKTKVVGVPVSLNGDLKNQFVETTVGFDTVCK  237



>dbj|BAJ94879.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=622

 Score =   285 bits (728),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 151/241 (63%), Positives = 189/241 (78%), Gaps = 2/241 (1%)
 Frame = +1

Query  37   MDSDFGLARELS-DLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPH  213
            M++D+G    L+  LQ+ R+ Y+P LPPCLQG TVR E+G+ATT  DP+G H +++ FP 
Sbjct  1    MNADYGAPTALAGPLQQRRALYQPRLPPCLQGATVRAEYGEATTTIDPAGAHAVAQAFPR  60

Query  214  TFGQPLAHFLRASAKVPDAQI-ITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPN  390
            T+GQ L  FL         +  + E P IRVG+VF GRQSPGGHN +WGL+DAL+ +NP+
Sbjct  61   TYGQRLVTFLAPDDAAGADKAAVHERPPIRVGVVFSGRQSPGGHNVVWGLHDALRAYNPH  120

Query  391  STllgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTS  570
            S L GF+GG+EGLFA KTLEITDD+LA+YKNQGG+D+LGR+ DQIRS++QV+AA+T C +
Sbjct  121  SVLYGFIGGTEGLFANKTLEITDDVLASYKNQGGFDLLGRSIDQIRSSKQVSAAMTTCHN  180

Query  571  LKLDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTIC  750
            L LDGLVIVGGVTSN+DAA LAE   +  C TKVVGVPV+LNGDLKNQFVET VGFDT+C
Sbjct  181  LNLDGLVIVGGVTSNSDAAQLAETLVQKNCKTKVVGVPVSLNGDLKNQFVETTVGFDTVC  240

Query  751  K  753
            K
Sbjct  241  K  241



>ref|XP_002459996.1| hypothetical protein SORBIDRAFT_02g020400 [Sorghum bicolor]
 gb|EER96517.1| hypothetical protein SORBIDRAFT_02g020400 [Sorghum bicolor]
Length=626

 Score =   285 bits (728),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 156/241 (65%), Positives = 187/241 (78%), Gaps = 5/241 (2%)
 Frame = +1

Query  46   DFGLARELSDLQKLRSQYRPELPPCL-QGTTVRVEFGDATTAADPSGGHTISRLFPHTFG  222
            D G  REL+ LQ+ R+ Y+PELPPCL QGT +RVEFGD+TT  D      +++ FPH FG
Sbjct  5    DLGSPRELTGLQRRRALYQPELPPCLVQGTRIRVEFGDSTTTIDSKCADIVAQAFPHIFG  64

Query  223  QPLAHFLRASAKV----PDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPN  390
            Q L  FL           DAQ+I E+  IRVG+VF GRQSPGGHN IWG YDALK  NP+
Sbjct  65   QKLVRFLEPHMDTVVSESDAQVIQENSPIRVGVVFSGRQSPGGHNVIWGTYDALKAQNPH  124

Query  391  STllgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTS  570
            + LLGF+GG+EGLFA+KTLEITDD+L++YKNQGG+D+LGRT DQIR+TEQ+NAA   C  
Sbjct  125  NVLLGFIGGTEGLFAKKTLEITDDVLSSYKNQGGFDLLGRTVDQIRTTEQINAAKATCCD  184

Query  571  LKLDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTIC  750
            L LDGL+I+GGVTSN+DAA LAE FAE  C TKV+GVPVTL+GDL+NQFVET VGFDT+C
Sbjct  185  LNLDGLIIIGGVTSNSDAAQLAEIFAEHNCKTKVIGVPVTLSGDLRNQFVETTVGFDTVC  244

Query  751  K  753
            K
Sbjct  245  K  245



>gb|AGY61461.1| pyrophosphate-fructose-6-phosphate-phosphotransferase alpha2, 
partial [Rorippa amphibia]
 gb|AGY61462.1| pyrophosphate-fructose-6-phosphate-phosphotransferase alpha2, 
partial [Rorippa sylvestris]
Length=267

 Score =   259 bits (661),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 148/170 (87%), Positives = 157/170 (92%), Gaps = 0/170 (0%)
 Frame = +1

Query  244  RASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggse  423
            RA+AKVPDAQIITEH   RVGIVF GRQ+PGGHN IWGLYDALKVHN  +TLLGFLGGSE
Sbjct  1    RATAKVPDAQIITEHSPKRVGIVFSGRQAPGGHNVIWGLYDALKVHNAKNTLLGFLGGSE  60

Query  424  glfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVIVGG  603
            GLFAQKTLEITDD+L TYKNQGGYD+LGRTKDQIR+T QVNAAL ACT LKLDGLVI+GG
Sbjct  61   GLFAQKTLEITDDVLQTYKNQGGYDLLGRTKDQIRTTVQVNAALKACTDLKLDGLVIIGG  120

Query  604  VTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            VTSNTDAA+LAE FAEAKCPTKVVGVPVT+NGDLKNQFVE NVGFDTICK
Sbjct  121  VTSNTDAAHLAEFFAEAKCPTKVVGVPVTINGDLKNQFVEANVGFDTICK  170



>ref|XP_008652527.1| PREDICTED: LOW QUALITY PROTEIN: pyrophosphate--fructose 6-phosphate 
1-phosphotransferase subunit alpha [Zea mays]
Length=623

 Score =   263 bits (671),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 154/243 (63%), Positives = 186/243 (77%), Gaps = 12/243 (5%)
 Frame = +1

Query  46   DFGLARELSDLQKLRSQYRPELPPCL-QGTTVRVEFGDATTAADPSGGHTISRLFPHTFG  222
            D G  REL+ LQ+ R+ Y+PELPPCL QGT  RVEFGD TT  D      +++ FPHTFG
Sbjct  5    DLGSPRELTGLQRRRALYQPELPPCLLQGT--RVEFGDPTTTIDSKCADIVAQAFPHTFG  62

Query  223  QPLAHFLR-----ASAKVPDAQIITEHPAIRVGIVFCGRQSP-GGHNAIWGLYDALKVHN  384
            Q L  FL        +   DAQ   E P +R+G+VF GRQSP GGHN IWG +DA+K  N
Sbjct  63   QRLVRFLEPHPDTVVSGSSDAQ---ERPPVRLGVVFSGRQSPRGGHNVIWGTFDAMKARN  119

Query  385  PNSTllgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTAC  564
            P+S LLGFLGG+EGLFA+KTLEIT+D+L++YKNQGG+D+LGRT DQIR+TEQV+AA +AC
Sbjct  120  PHSVLLGFLGGTEGLFAKKTLEITEDMLSSYKNQGGFDLLGRTVDQIRTTEQVDAAKSAC  179

Query  565  TSLKLDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDT  744
              L LDGL+I+GGVTSN+DAA LAE FAE  C TKV+GVPVTL+GDL+NQFVE  VGFDT
Sbjct  180  CDLNLDGLIIIGGVTSNSDAAQLAEFFAEHDCKTKVIGVPVTLSGDLRNQFVEATVGFDT  239

Query  745  ICK  753
            +CK
Sbjct  240  VCK  242



>ref|XP_006837413.1| hypothetical protein AMTR_s00111p00148440 [Amborella trichopoda]
 gb|ERN00267.1| hypothetical protein AMTR_s00111p00148440 [Amborella trichopoda]
Length=589

 Score =   259 bits (663),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 147/202 (73%), Positives = 168/202 (83%), Gaps = 2/202 (1%)
 Frame = +1

Query  148  FGDATTAADPSGGHTISRLFPHTFGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQ  327
            F DAT  ++P    +I R FP T+GQPL HFL  S  V DA ++ E   IRVG+VFCGRQ
Sbjct  16   FADATITSNPL--DSIGRSFPLTYGQPLLHFLAESDNVIDAHVVQELTPIRVGVVFCGRQ  73

Query  328  SPGGHNAIWGLYDALKVHNPNSTllgflggseglfAQKTLEITDDILATYKNQGGYDMLG  507
            SPGGHN I GL++A+K+HNP STLLGF+GGSEGLFAQKTLEIT D+++ Y+NQGGYDMLG
Sbjct  74   SPGGHNVICGLHEAIKIHNPKSTLLGFVGGSEGLFAQKTLEITKDVVSAYRNQGGYDMLG  133

Query  508  RTKDQIRSTEQVNAALTACTSLKLDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPV  687
            RTKDQIR+ EQVNAALT C +LKLDGLVI+GGVTSNTDAA LAE FAEAKC TKV+GVPV
Sbjct  134  RTKDQIRTNEQVNAALTTCQALKLDGLVIIGGVTSNTDAAQLAETFAEAKCQTKVIGVPV  193

Query  688  TLNGDLKNQFVETNVGFDTICK  753
            TL GDLKNQFVE +VGFDTICK
Sbjct  194  TLYGDLKNQFVEADVGFDTICK  215



>dbj|BAJ85819.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=598

 Score =   257 bits (656),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 137/211 (65%), Positives = 168/211 (80%), Gaps = 1/211 (0%)
 Frame = +1

Query  124  QGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFLRASAKVPDAQI-ITEHPAIR  300
            QG TVR E+G+ATT  DP+G H +++ FP T+GQ L  FL         +  + E P IR
Sbjct  7    QGATVRAEYGEATTTIDPAGAHAVAQAFPRTYGQRLVTFLAPDDAAGADKAAVHERPPIR  66

Query  301  VGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggseglfAQKTLEITDDILATYK  480
            VG+VF GRQSPGGHN +WGL+DAL+ +NP+S L GF+GG+EGLFA KTLEITDD+LA+YK
Sbjct  67   VGVVFSGRQSPGGHNVVWGLHDALRAYNPHSVLYGFIGGTEGLFANKTLEITDDVLASYK  126

Query  481  NQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVIVGGVTSNTDaaylaeafaeaKC  660
            NQGG+D+LGR+ DQIRS++QV+AA+T C +L LDGLVIVGGVTSN+DAA LAE   +  C
Sbjct  127  NQGGFDLLGRSIDQIRSSKQVSAAMTTCHNLNLDGLVIVGGVTSNSDAAQLAETLVQKNC  186

Query  661  PTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
             TKVVGVPV+LNGDLKNQFVET VGFDT+CK
Sbjct  187  KTKVVGVPVSLNGDLKNQFVETTVGFDTVCK  217



>ref|XP_001773752.1| predicted protein [Physcomitrella patens]
 gb|EDQ61369.1| predicted protein [Physcomitrella patens]
Length=613

 Score =   252 bits (643),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 136/230 (59%), Positives = 175/230 (76%), Gaps = 7/230 (3%)
 Frame = +1

Query  64   ELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFL  243
            +L  L  LR+QY P++PP L+G  V+V  GD TTAADPS    +SR +PHT+GQPL H +
Sbjct  11   KLQGLSALRAQYEPQIPPALKGGNVKVSKGDNTTAADPSDRLAVSRAYPHTYGQPLVHLV  70

Query  244  RASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggse  423
                         +H  +R+G+ FCGRQSPGGHN I GL+DALK  N +S L+GF+GG+E
Sbjct  71   SEDKA-------AKHSTLRIGVAFCGRQSPGGHNVITGLFDALKSQNADSVLIGFVGGTE  123

Query  424  glfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVIVGG  603
            G+FAQKT+E+T+D L  ++NQGGYD+LGRTKDQI+S++QVN A  AC +LKLD LV++GG
Sbjct  124  GIFAQKTVELTNDHLKDFRNQGGYDLLGRTKDQIKSSQQVNDAKAACEALKLDALVLIGG  183

Query  604  VTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
              +NTDAA LAE+F E+ C TKV+GVPVT++GDLKNQFVET+VGFDT CK
Sbjct  184  TGTNTDAAQLAESFLESGCTTKVIGVPVTIDGDLKNQFVETDVGFDTTCK  233



>ref|XP_006660071.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha-like [Oryza brachyantha]
Length=631

 Score =   247 bits (630),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 135/211 (64%), Positives = 165/211 (78%), Gaps = 3/211 (1%)
 Frame = +1

Query  121  LQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFLRASAKVPDAQIITEHPAIR  300
            + G TV+VE+GD TT  DP+  + ++  FP T+GQPL  F+   A    A        +R
Sbjct  43   MSGATVKVEYGDPTTTIDPTCANVVADAFPCTYGQPLVSFVAPPAD---AAADEARKPLR  99

Query  301  VGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggseglfAQKTLEITDDILATYK  480
            VG+VF GRQSPGGHN IWGL+DALK +NP+S L GF+GG+EGLFA KT+EITDD+LA+YK
Sbjct  100  VGVVFSGRQSPGGHNVIWGLHDALKAYNPHSVLYGFVGGTEGLFANKTIEITDDVLASYK  159

Query  481  NQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVIVGGVTSNTDaaylaeafaeaKC  660
            NQGG+D+LGR+ DQIRST+QVNAA+T C +L LDGLVI+GGVTSN+DAA LAE   +  C
Sbjct  160  NQGGFDLLGRSIDQIRSTKQVNAAMTTCNNLNLDGLVIIGGVTSNSDAAQLAETLVQNNC  219

Query  661  PTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
             TKVVGVPV+LNGDLKNQFVET VGFDT+CK
Sbjct  220  KTKVVGVPVSLNGDLKNQFVETTVGFDTVCK  250



>gb|EMS49340.1| Pyrophosphate--fructose 6-phosphate 1-phosphotransferase subunit 
alpha [Triticum urartu]
Length=794

 Score =   249 bits (637),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 137/223 (61%), Positives = 164/223 (74%), Gaps = 14/223 (6%)
 Frame = +1

Query  127  GTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFLRASAKVPDAQIITEHPAIRVG  306
            G TVRVE+GDAT   DP+G H +++ FP  +GQ L  FL         + + E P IRVG
Sbjct  141  GATVRVEYGDATATIDPTGAHAVAQAFPRPYGQRLVTFLAPDGTAGAGKAVDERPPIRVG  200

Query  307  IVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggseglfAQKTLEITDDILATYKNQ  486
            +VF GRQSPGGHN +WGL+DALK +NP S L GF+GG+EGLFA KTLEITDD+LA+YKNQ
Sbjct  201  VVFSGRQSPGGHNVVWGLHDALKAYNPQSILYGFIGGTEGLFANKTLEITDDVLASYKNQ  260

Query  487  GGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVIVGGVTSNTDaaylaeafaeaKCPT  666
            GG+D+LGR+ DQIRS++QV+AA+T C  L LDGLVIVGGVTSN+DAA LAE   +  C T
Sbjct  261  GGFDLLGRSIDQIRSSKQVSAAMTTCQDLNLDGLVIVGGVTSNSDAAQLAETLVQKNCKT  320

Query  667  K--------------VVGVPVTLNGDLKNQFVETNVGFDTICK  753
            K              VVGVPV+LNGDLKNQFVET VGFDT+CK
Sbjct  321  KGPRSLSGTNVFIEQVVGVPVSLNGDLKNQFVETTVGFDTVCK  363



>ref|XP_001755711.1| predicted protein [Physcomitrella patens]
 gb|EDQ79384.1| predicted protein [Physcomitrella patens]
Length=621

 Score =   234 bits (597),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 131/236 (56%), Positives = 175/236 (74%), Gaps = 5/236 (2%)
 Frame = +1

Query  55   LARELSDLQKL---RSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQ  225
            L R++S LQ L   R+QY+P +PP L+  +V+V  GDA+  A+ S    +S  +PHT+G 
Sbjct  5    LHRKVSKLQGLSAVRAQYQPRVPPALKCGSVKVSVGDASATAELSDRLAVSEAYPHTYGL  64

Query  226  PLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllg  405
            PL   +  S+  P+A      P  R+G+ FCGRQSPGGHN I GL+DALK  N NS L+G
Sbjct  65   PLVQLM--SSGGPNATTAKHLPLSRIGVAFCGRQSPGGHNVITGLFDALKSQNANSILIG  122

Query  406  flggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDG  585
            F+GG+EG+F+Q+T+E+T+D+L  ++NQGGYD+LGRTKDQI+S +Q+  A  AC +LKLD 
Sbjct  123  FIGGTEGIFSQRTVELTNDMLKDFRNQGGYDLLGRTKDQIKSYQQIKDAKAACEALKLDV  182

Query  586  LVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            LV++GG  +N+DAA LAE F E+ C TKVVG+PVT++GDLKNQFVETNVGFDT CK
Sbjct  183  LVLIGGCGTNSDAAQLAEFFLESGCTTKVVGIPVTIDGDLKNQFVETNVGFDTTCK  238



>ref|XP_002978426.1| hypothetical protein SELMODRAFT_108705 [Selaginella moellendorffii]
 gb|EFJ20412.1| hypothetical protein SELMODRAFT_108705 [Selaginella moellendorffii]
Length=616

 Score =   232 bits (592),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 128/232 (55%), Positives = 169/232 (73%), Gaps = 6/232 (3%)
 Frame = +1

Query  76   LQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFLRASA  255
            +Q +R  Y+  LPP L+   V++  GDATTA D S    I R F  T+GQPL H L    
Sbjct  7    IQGIRRGYKVSLPPALEAPNVQLVCGDATTAMDASDALAIQRSFSLTYGQPLVHLLPGKK  66

Query  256  KV------PDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflgg  417
                    P   ++ +  A RVG+VFCGRQSPGGHN + GL+DALK HNP++ L+G +GG
Sbjct  67   STGEKKLSPLRSVLCDAFAGRVGVVFCGRQSPGGHNIVAGLFDALKAHNPDNVLIGIVGG  126

Query  418  seglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVIV  597
            ++GLFAQK++EIT D+LA Y+NQGGYD+LGRTKDQI+S +QV+ A  AC ++KLDG+V++
Sbjct  127  TDGLFAQKSVEITADVLAVYRNQGGYDLLGRTKDQIKSVQQVDDARAACEAMKLDGIVLI  186

Query  598  GGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            GG  ++TDAA+LAE FA  +C TKV+ VP T++GDLKN FVET+VGFDT+CK
Sbjct  187  GGCGTSTDAAHLAENFAATECRTKVIAVPATIDGDLKNPFVETDVGFDTVCK  238



>ref|XP_002970269.1| hypothetical protein SELMODRAFT_171380 [Selaginella moellendorffii]
 gb|EFJ28399.1| hypothetical protein SELMODRAFT_171380 [Selaginella moellendorffii]
Length=616

 Score =   232 bits (592),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 128/232 (55%), Positives = 169/232 (73%), Gaps = 6/232 (3%)
 Frame = +1

Query  76   LQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFLRASA  255
            +Q +R  Y+  LPP L+   V++  GDATTA D S    I R F  T+GQPL H L    
Sbjct  7    IQGIRRGYKVSLPPALEAPNVQLVCGDATTAMDASDALAIQRSFSLTYGQPLVHLLPGKK  66

Query  256  KV------PDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflgg  417
                    P   ++ +  A RVG+VFCGRQSPGGHN + GL+DALK HNP++ L+G +GG
Sbjct  67   STGEKKLSPLRSVLCDAFAGRVGVVFCGRQSPGGHNIVAGLFDALKAHNPDNVLIGIVGG  126

Query  418  seglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVIV  597
            ++GLFAQK++EIT D+LA Y+NQGGYD+LGRTKDQI+S +QV+ A  AC ++KLDG+V++
Sbjct  127  TDGLFAQKSVEITADVLAVYRNQGGYDLLGRTKDQIKSVQQVDDARAACEAMKLDGIVLI  186

Query  598  GGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            GG  ++TDAA+LAE FA  +C TKV+ VP T++GDLKN FVET+VGFDT+CK
Sbjct  187  GGCGTSTDAAHLAENFAATECRTKVIAVPATIDGDLKNPFVETDVGFDTVCK  238



>gb|AFW86518.1| hypothetical protein ZEAMMB73_272382, partial [Zea mays]
Length=333

 Score =   217 bits (553),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 118/152 (78%), Positives = 134/152 (88%), Gaps = 0/152 (0%)
 Frame = +1

Query  298  RVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggseglfAQKTLEITDDILATY  477
            R+G+VF GRQSPGGHN IWGLYD +K HN NS ++GFLGG++GLFAQKT+EITD+ L +Y
Sbjct  4    RIGVVFSGRQSPGGHNVIWGLYDVVKAHNSNSKIIGFLGGTDGLFAQKTIEITDEALPSY  63

Query  478  KNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVIVGGVTSNTDaaylaeafaeaK  657
            KNQGGYDMLGRT+DQIR+TEQV A +  C +LKLD LVI+GGVTSNTDAA LAE FA+ K
Sbjct  64   KNQGGYDMLGRTRDQIRTTEQVKATIGTCQALKLDALVIIGGVTSNTDAAQLAETFAQLK  123

Query  658  CPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            CPTKVVGVPVTLNGDLKNQFVET VGFDTICK
Sbjct  124  CPTKVVGVPVTLNGDLKNQFVETTVGFDTICK  155



>ref|XP_002444175.1| hypothetical protein SORBIDRAFT_07g012720 [Sorghum bicolor]
 gb|EES13670.1| hypothetical protein SORBIDRAFT_07g012720 [Sorghum bicolor]
Length=582

 Score =   223 bits (569),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 126/181 (70%), Positives = 148/181 (82%), Gaps = 3/181 (2%)
 Frame = +1

Query  211  HTFGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPN  390
            HTFGQPL  F+  SA    A+    HP IRVG+VF GRQSPGGHN +WGL+DALK +NP 
Sbjct  24   HTFGQPLVSFVAPSADAAAAE--ERHP-IRVGVVFSGRQSPGGHNVVWGLHDALKAYNPQ  80

Query  391  STllgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTS  570
            S L GF+GG+EGLFA KTL +TDD+LA+YKNQGG+D+LGR+ DQIR+T+QVNAA+T C S
Sbjct  81   SVLYGFVGGTEGLFANKTLVLTDDVLASYKNQGGFDLLGRSIDQIRTTKQVNAAMTTCRS  140

Query  571  LKLDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTIC  750
            L LDGLVI+GGVTSN+DAA LAE   +  C TKVVGVPV+LNGDLKNQFVET VGFDT+C
Sbjct  141  LNLDGLVIIGGVTSNSDAAQLAETLIQNNCKTKVVGVPVSLNGDLKNQFVETTVGFDTVC  200

Query  751  K  753
            K
Sbjct  201  K  201



>ref|XP_009386806.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha {ECO:0000255|HAMAP-Rule:MF_03185}-like 
[Musa acuminata subsp. malaccensis]
Length=205

 Score =   211 bits (538),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 120/156 (77%), Positives = 136/156 (87%), Gaps = 4/156 (3%)
 Frame = +1

Query  298  RVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggseglfAQKTLEITDDILATY  477
            RVG+VFCGRQSPGGHN IWGL+ ALK HNP  TLLGF+GG+EGLF +KTL+IT+DIL+TY
Sbjct  5    RVGVVFCGRQSPGGHNVIWGLHSALKSHNPKGTLLGFVGGTEGLFVKKTLDITNDILSTY  64

Query  478  KNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVIVGGVTSNTDaaylaeafaeaK  657
            K+ GGYD+LGRTKDQIR++EQVNA ++ C  LKLDGLVI+GG+ SNTDAA LAE FAE K
Sbjct  65   KSSGGYDLLGRTKDQIRTSEQVNAVMSTCQELKLDGLVIIGGIPSNTDAAQLAETFAELK  124

Query  658  CPTK----VVGVPVTLNGDLKNQFVETNVGFDTICK  753
            CPTK    VVGVPVTLNGDLKNQFVE NVGFDTICK
Sbjct  125  CPTKFVPRVVGVPVTLNGDLKNQFVEINVGFDTICK  160



>ref|XP_010275338.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha-like [Nelumbo nucifera]
Length=562

 Score =   217 bits (553),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 135/236 (57%), Positives = 155/236 (66%), Gaps = 51/236 (22%)
 Frame = +1

Query  46   DFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQ  225
            +F    ELS LQK RS Y PELP CLQ                                 
Sbjct  2    EFAAVMELSGLQKQRSSYIPELPLCLQCY-------------------------------  30

Query  226  PLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllg  405
             L H+                   R+G++FCGRQSPGGHN + GL+DA+K HNP STLLG
Sbjct  31   -LKHY-------------------RIGVIFCGRQSPGGHNIVCGLHDAIKSHNPKSTLLG  70

Query  406  flggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDG  585
            F GG+EGLF+QKT+EIT+DI+ +Y+NQGGY MLGRTKDQIR++EQV AAL AC +LKLDG
Sbjct  71   FCGGTEGLFSQKTIEITEDIVLSYRNQGGYGMLGRTKDQIRTSEQVKAALDACEALKLDG  130

Query  586  LVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            LVIVGG+ SNTDAA LAE FA AKC TKVVGVPVT+ GDLKNQFVE NVGFDT CK
Sbjct  131  LVIVGGIISNTDAAQLAETFAVAKCRTKVVGVPVTIYGDLKNQFVEANVGFDTTCK  186



>gb|AAO72618.1| fructose-6-phosphate 1-phosphotransferase [Oryza sativa Japonica 
Group]
Length=449

 Score =   214 bits (544),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 115/153 (75%), Positives = 135/153 (88%), Gaps = 0/153 (0%)
 Frame = +1

Query  295  IRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggseglfAQKTLEITDDILAT  474
             RVG+VF GRQSPGGHN IWGL+DALK +NP+S L GF+GG+EGLFA KT+EITDD+LA+
Sbjct  28   FRVGVVFSGRQSPGGHNVIWGLHDALKAYNPHSVLYGFVGGTEGLFANKTIEITDDVLAS  87

Query  475  YKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVIVGGVTSNTDaaylaeafaea  654
            YKNQGG+D+LGR+ DQIRST+QVNAA+T C +L LDGLVI+GGVTSN+DAA LAEA  + 
Sbjct  88   YKNQGGFDLLGRSIDQIRSTKQVNAAMTTCNNLNLDGLVIIGGVTSNSDAAQLAEALVQN  147

Query  655  KCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
             C TKVVGVPV+LNGDLKNQFVET VGFDT+CK
Sbjct  148  NCKTKVVGVPVSLNGDLKNQFVETTVGFDTVCK  180



>ref|XP_010935015.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha-like isoform X1 [Elaeis guineensis]
Length=543

 Score =   215 bits (548),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 122/151 (81%), Positives = 134/151 (89%), Gaps = 0/151 (0%)
 Frame = +1

Query  301  VGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggseglfAQKTLEITDDILATYK  480
            VG+VFCGRQSPGGHN I GL+DA+K HNP STLLGF GG+EGLF QKTLEIT+D+++ Y+
Sbjct  12   VGVVFCGRQSPGGHNVICGLHDAMKSHNPKSTLLGFCGGTEGLFKQKTLEITEDVVSKYR  71

Query  481  NQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVIVGGVTSNTDaaylaeafaeaKC  660
            NQGGYDMLGRT DQIR+TEQVNA LT C +LKLDGLVI+GGVTSNTDAA LAE FAEAKC
Sbjct  72   NQGGYDMLGRTMDQIRTTEQVNAGLTTCQTLKLDGLVIIGGVTSNTDAAQLAETFAEAKC  131

Query  661  PTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
             TKVVGVPVT  GDLKNQFVE NVGFDTICK
Sbjct  132  STKVVGVPVTFYGDLKNQFVEANVGFDTICK  162



>ref|XP_010935016.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha-like isoform X2 [Elaeis guineensis]
Length=527

 Score =   214 bits (546),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 122/151 (81%), Positives = 134/151 (89%), Gaps = 0/151 (0%)
 Frame = +1

Query  301  VGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggseglfAQKTLEITDDILATYK  480
            VG+VFCGRQSPGGHN I GL+DA+K HNP STLLGF GG+EGLF QKTLEIT+D+++ Y+
Sbjct  12   VGVVFCGRQSPGGHNVICGLHDAMKSHNPKSTLLGFCGGTEGLFKQKTLEITEDVVSKYR  71

Query  481  NQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVIVGGVTSNTDaaylaeafaeaKC  660
            NQGGYDMLGRT DQIR+TEQVNA LT C +LKLDGLVI+GGVTSNTDAA LAE FAEAKC
Sbjct  72   NQGGYDMLGRTMDQIRTTEQVNAGLTTCQTLKLDGLVIIGGVTSNTDAAQLAETFAEAKC  131

Query  661  PTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
             TKVVGVPVT  GDLKNQFVE NVGFDTICK
Sbjct  132  STKVVGVPVTFYGDLKNQFVEANVGFDTICK  162



>gb|ABC69165.1| phosphofructokinase V11 [Gossypium hirsutum]
Length=267

 Score =   194 bits (493),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 115/133 (86%), Positives = 125/133 (94%), Gaps = 0/133 (0%)
 Frame = +1

Query  355  GLYDALKVHNPNSTllgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRST  534
            GL+ ALK+HNPNSTLLGFLGG++GLFAQKTLEITDDIL+TYKNQGGYD+LGRT+DQIR+T
Sbjct  17   GLHKALKIHNPNSTLLGFLGGTQGLFAQKTLEITDDILSTYKNQGGYDLLGRTQDQIRTT  76

Query  535  EQVNAALTACTSLKLDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQ  714
            EQV AAL AC  LKLDGLVI+GGVTSNTDAA LAE FAEAKCPT VVGVPVTLNGDLKNQ
Sbjct  77   EQVKAALAACNDLKLDGLVIIGGVTSNTDAAQLAETFAEAKCPTMVVGVPVTLNGDLKNQ  136

Query  715  FVETNVGFDTICK  753
            FVET+VGFDTICK
Sbjct  137  FVETDVGFDTICK  149



>gb|ABR16683.1| unknown [Picea sitchensis]
Length=558

 Score =   190 bits (482),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 121/246 (49%), Positives = 162/246 (66%), Gaps = 15/246 (6%)
 Frame = +1

Query  31   VKMDSDFGLARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFP  210
            + M++D G+      +QKLRS + P++PP L+G  V++  GD T+AA       I + F 
Sbjct  1    MDMENDTGI------MQKLRSLFVPQIPPALEGGRVQLLRGDTTSAAHSDDEDEIRKSFN  54

Query  211  HTFGQPLAHFLRASAKVPDAQIITEH---PAI-RVGIVF-CGRQSPGGHNAIWGLYDALK  375
             T+GQPL  F+  S  + D +   E    PA+ RVG+VF    +SPG HN I G++DALK
Sbjct  55   FTYGQPLVQFV--SQNLVDGE--NEENICPAVTRVGVVFGMEAESPGAHNVIAGIFDALK  110

Query  376  VHNPNSTllgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAAL  555
             HN  S L GF+GG+EGL +Q  L +TDD+L +Y+NQGG D+L ++  +I   +    A 
Sbjct  111  AHNNKSILFGFVGGTEGLCSQNALVVTDDMLKSYRNQGGSDLLEQSSKKIHDFQHREEAR  170

Query  556  TACTSLKLDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVG  735
             +C +LKLDGLV VGG ++NTDAA LAE F   KC T VVGVPVTL GDLKN+FVET+VG
Sbjct  171  RSCITLKLDGLVFVGGCSTNTDAARLAEYFKSRKCQTTVVGVPVTLEGDLKNEFVETDVG  230

Query  736  FDTICK  753
            FDT+CK
Sbjct  231  FDTVCK  236



>gb|AIN94596.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Treponema 
putidum]
Length=563

 Score =   166 bits (421),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 98/230 (43%), Positives = 148/230 (64%), Gaps = 11/230 (5%)
 Frame = +1

Query  70   SDLQKLRSQYRPELPPCLQG--TTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFL  243
            S +Q+LR  Y P++P   +   + ++ E G+AT A   S    +  +FPHT+G P+  F+
Sbjct  4    STMQRLRYHYEPKIPKVFEEPLSLIKPEIGEATHAQ--SNQAELKEIFPHTYGMPIIRFV  61

Query  244  RASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggse  423
            +  ++V       EH  ++ G++  G Q+PGGHN I GL+DALK  +PNS L GFL G E
Sbjct  62   KGKSEV-------EHKPLKFGVILSGGQAPGGHNVISGLFDALKKGSPNSKLYGFLSGPE  114

Query  424  glfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVIVGG  603
            GL   + +EI   ++  Y+N GG+D++G  + +I + EQV +++     L LD LVI+GG
Sbjct  115  GLVKGRYIEIKKSLIDKYRNTGGFDIIGSGRTKIETEEQVESSIQNVKKLNLDALVIIGG  174

Query  604  VTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
              SNT+AA+LA+ F +AK  TKV+GVP T++GDLKN+++ET+ GFDT  K
Sbjct  175  DDSNTNAAFLAKYFIQAKLNTKVIGVPKTIDGDLKNEYIETSFGFDTATK  224



>ref|WP_010697336.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Treponema 
denticola]
 gb|EMB21954.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Treponema 
denticola SP33]
 gb|EPF35925.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Treponema 
denticola SP32]
Length=560

 Score =   166 bits (419),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 99/230 (43%), Positives = 147/230 (64%), Gaps = 11/230 (5%)
 Frame = +1

Query  70   SDLQKLRSQYRPELPPCLQG--TTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFL  243
            S +Q+LR  Y P++P       + ++ E G+AT A   S    +  +FPHT+G P+  F+
Sbjct  4    STMQRLRYHYEPKIPKVFAEPLSLIKPEIGEATHAQ--SDQAELKEIFPHTYGMPIIRFV  61

Query  244  RASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggse  423
            +  ++V       EH  ++ G++  G Q+PGGHN I GL+DALK  N NS L GFL G E
Sbjct  62   KGKSEV-------EHTPLKFGVILSGGQAPGGHNVISGLFDALKKGNANSKLYGFLSGPE  114

Query  424  glfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVIVGG  603
            GL   + +EI   ++  Y+N GG+D++G  + +I + EQV +++     LKLD L+I+GG
Sbjct  115  GLIKGRYVEIKKALIDKYRNTGGFDIIGSGRTKIETEEQVESSIQNVKKLKLDALIIIGG  174

Query  604  VTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
              SNT+AA+LA+ F +AK  TKV+GVP T++GDLKNQ++ET+ GFDT  K
Sbjct  175  DDSNTNAAFLAKYFIQAKLDTKVIGVPKTIDGDLKNQYIETSFGFDTATK  224



>ref|WP_010956991.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Treponema 
denticola]
 ref|NP_972156.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Treponema 
denticola ATCC 35405]
 gb|AAS12067.1| phosphofructokinase, pyrophosphate-dependent [Treponema denticola 
ATCC 35405]
Length=560

 Score =   165 bits (418),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 98/230 (43%), Positives = 147/230 (64%), Gaps = 11/230 (5%)
 Frame = +1

Query  70   SDLQKLRSQYRPELPPCLQG--TTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFL  243
            S +Q+LR  Y P++P       + ++ E G+AT A   S    +  +FPHT+G P+  F+
Sbjct  4    STMQRLRYNYEPKIPKVFAEPLSLIKPEIGEATHAQ--SNQAELKEIFPHTYGMPIIRFV  61

Query  244  RASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggse  423
            +  ++V       EH  ++ G++  G Q+PGGHN I GL+DALK  N NS L GFL G E
Sbjct  62   KGKSEV-------EHKPLKFGVILSGGQAPGGHNVISGLFDALKKGNANSKLYGFLRGPE  114

Query  424  glfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVIVGG  603
            GL   + +EI   ++  Y+N GG+D++G  + +I + EQ+ +++     LKLD L+I+GG
Sbjct  115  GLVKGRYVEIKKALIDKYRNTGGFDIIGSGRTKIETEEQIESSIQNVKKLKLDALIIIGG  174

Query  604  VTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
              SNT+AA+LA+ F +AK  TKV+GVP T++GDLKNQ++ET+ GFDT  K
Sbjct  175  DDSNTNAAFLAKYFIQAKLDTKVIGVPKTIDGDLKNQYIETSFGFDTATK  224



>ref|WP_010699412.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Treponema 
denticola]
 gb|EMB21050.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Treponema 
denticola SP37]
 gb|EPF33080.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Treponema 
denticola SP44]
 gb|EPF40558.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Treponema 
denticola SP23]
Length=560

 Score =   165 bits (418),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 98/230 (43%), Positives = 147/230 (64%), Gaps = 11/230 (5%)
 Frame = +1

Query  70   SDLQKLRSQYRPELPPCLQG--TTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFL  243
            S +Q+LR  Y P++P       + ++ E G+AT A   S    +  +FPHT+G P+  F+
Sbjct  4    STMQRLRYNYEPKIPKVFAEPLSLIKPEIGEATHAQ--SNQAELKEIFPHTYGMPIIRFV  61

Query  244  RASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggse  423
            +  ++V       EH  ++ G++  G Q+PGGHN I GL+DALK  N NS L GFL G E
Sbjct  62   KGKSEV-------EHKPLKFGVILSGGQAPGGHNVISGLFDALKKGNANSKLYGFLRGPE  114

Query  424  glfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVIVGG  603
            GL   + +EI   ++  Y+N GG+D++G  + +I + EQ+ +++     LKLD L+I+GG
Sbjct  115  GLVKGRYVEIKKALIDKYRNTGGFDIIGSGRTKIETEEQIESSIQNVKKLKLDALIIIGG  174

Query  604  VTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
              SNT+AA+LA+ F +AK  TKV+GVP T++GDLKNQ++ET+ GFDT  K
Sbjct  175  DDSNTNAAFLAKYFIQAKLDTKVIGVPKTIDGDLKNQYIETSFGFDTATK  224



>ref|WP_002693855.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Treponema 
denticola]
 gb|EMB19415.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Treponema 
denticola OTK]
Length=560

 Score =   165 bits (418),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 98/230 (43%), Positives = 147/230 (64%), Gaps = 11/230 (5%)
 Frame = +1

Query  70   SDLQKLRSQYRPELPPCLQG--TTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFL  243
            S +Q+LR  Y P++P       + ++ E G+AT A   S    +  +FPHT+G P+  F+
Sbjct  4    STMQRLRYNYEPKIPKVFAEPLSLIKPEIGEATHAQ--SNQAELKEIFPHTYGMPIIRFV  61

Query  244  RASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggse  423
            +  ++V       EH  ++ G++  G Q+PGGHN I GL+DALK  N NS L GFL G E
Sbjct  62   KGKSEV-------EHKPLKFGVILSGGQAPGGHNVISGLFDALKKGNANSKLYGFLRGPE  114

Query  424  glfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVIVGG  603
            GL   + +EI   ++  Y+N GG+D++G  + +I + EQ+ +++     LKLD L+I+GG
Sbjct  115  GLVKGRYVEIKKALIDKYRNTGGFDIIGSGRTKIETEEQIESSIQNVKKLKLDALIIIGG  174

Query  604  VTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
              SNT+AA+LA+ F +AK  TKV+GVP T++GDLKNQ++ET+ GFDT  K
Sbjct  175  DDSNTNAAFLAKYFIQAKLDTKVIGVPKTIDGDLKNQYIETSFGFDTATK  224



>ref|WP_002689303.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Treponema 
denticola]
 gb|EMB28300.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Treponema 
denticola MYR-T]
 gb|EMB29042.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Treponema 
denticola H1-T]
 gb|EMB39731.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Treponema 
denticola ATCC 33520]
Length=560

 Score =   165 bits (418),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 98/230 (43%), Positives = 147/230 (64%), Gaps = 11/230 (5%)
 Frame = +1

Query  70   SDLQKLRSQYRPELPPCLQG--TTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFL  243
            S +Q+LR  Y P++P       + ++ E G+AT A   S    +  +FPHT+G P+  F+
Sbjct  4    STMQRLRYNYEPKIPKVFAEPLSLIKPEIGEATHAQ--SNQAELKEIFPHTYGMPIIRFV  61

Query  244  RASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggse  423
            +  ++V       EH  ++ G++  G Q+PGGHN I GL+DALK  N NS L GFL G E
Sbjct  62   KGKSEV-------EHKPLKFGVILSGGQAPGGHNVISGLFDALKKGNANSKLYGFLRGPE  114

Query  424  glfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVIVGG  603
            GL   + +EI   ++  Y+N GG+D++G  + +I + EQ+ +++     LKLD L+I+GG
Sbjct  115  GLVKGRCVEIKKALIDKYRNTGGFDIIGSGRTKIETEEQIESSIQNVKKLKLDALIIIGG  174

Query  604  VTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
              SNT+AA+LA+ F +AK  TKV+GVP T++GDLKNQ++ET+ GFDT  K
Sbjct  175  DDSNTNAAFLAKYFIQAKLDTKVIGVPKTIDGDLKNQYIETSFGFDTATK  224



>ref|WP_002669081.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Treponema 
denticola]
 gb|EGC77300.1| phosphofructokinase [Treponema denticola F0402]
 gb|EMB46853.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Treponema 
denticola AL-2]
Length=560

 Score =   165 bits (418),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 98/230 (43%), Positives = 147/230 (64%), Gaps = 11/230 (5%)
 Frame = +1

Query  70   SDLQKLRSQYRPELPPCLQG--TTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFL  243
            S +Q+LR  Y P++P       + ++ E G+AT A   S    +  +FPHT+G P+  F+
Sbjct  4    STMQRLRYNYEPKIPKVFAEPLSLIKPEIGEATHAQ--SNQAELKEIFPHTYGMPIIRFV  61

Query  244  RASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggse  423
            +  ++V       EH  ++ G++  G Q+PGGHN I GL+DALK  N NS L GFL G E
Sbjct  62   KGKSEV-------EHKPLKFGVILSGGQAPGGHNVISGLFDALKKGNANSKLYGFLRGPE  114

Query  424  glfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVIVGG  603
            GL   + +EI   ++  Y+N GG+D++G  + +I + EQ+ +++     LKLD L+I+GG
Sbjct  115  GLVKGRYVEIKKALIDKYRNTGGFDIIGSGRTKIETEEQIESSIQNVKKLKLDALIIIGG  174

Query  604  VTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
              SNT+AA+LA+ F +AK  TKV+GVP T++GDLKNQ++ET+ GFDT  K
Sbjct  175  DDSNTNAAFLAKYFIQAKLDTKVIGVPKTIDGDLKNQYIETSFGFDTATK  224



>ref|WP_002682935.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Treponema 
denticola]
 gb|EMB36139.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Treponema 
denticola H-22]
Length=560

 Score =   165 bits (418),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 98/230 (43%), Positives = 147/230 (64%), Gaps = 11/230 (5%)
 Frame = +1

Query  70   SDLQKLRSQYRPELPPCLQG--TTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFL  243
            S +Q+LR  Y P++P       + ++ E G+AT A   S    +  +FPHT+G P+  F+
Sbjct  4    STMQRLRYNYEPKIPKVFAEPLSLIKPEIGEATHAQ--SNQAELKEIFPHTYGMPIIRFV  61

Query  244  RASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggse  423
            +  ++V       EH  ++ G++  G Q+PGGHN I GL+DALK  N NS L GFL G E
Sbjct  62   KGKSEV-------EHKPLKFGVILSGGQAPGGHNVISGLFDALKKGNANSKLYGFLSGPE  114

Query  424  glfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVIVGG  603
            GL   + +EI   ++  Y+N GG+D++G  + +I + EQ+ +++     LKLD L+I+GG
Sbjct  115  GLIKGRYVEIKKALIDKYRNTGGFDIIGSGRTKIETEEQIESSIQNVKKLKLDALIIIGG  174

Query  604  VTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
              SNT+AA+LA+ F +AK  TKV+GVP T++GDLKNQ++ET+ GFDT  K
Sbjct  175  DDSNTNAAFLAKYFIQAKLNTKVIGVPKTIDGDLKNQYIETSFGFDTATK  224



>gb|EMT11806.1| Pyrophosphate--fructose 6-phosphate 1-phosphotransferase subunit 
alpha [Aegilops tauschii]
Length=558

 Score =   165 bits (418),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 86/107 (80%), Positives = 97/107 (91%), Gaps = 0/107 (0%)
 Frame = +1

Query  433  AQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVIVGGVTS  612
            AQKTLEIT+++ ++YKNQGGY MLGRT+DQIR+TEQV AA+T C +LKLD LVI+GGVTS
Sbjct  74   AQKTLEITEEVFSSYKNQGGYYMLGRTRDQIRTTEQVKAAMTTCQALKLDALVIIGGVTS  133

Query  613  NTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            NTDAA LAE FAE+KC TKVVGVPVTLNGDLKNQFVET VGFDTICK
Sbjct  134  NTDAAQLAETFAESKCSTKVVGVPVTLNGDLKNQFVETTVGFDTICK  180



>ref|WP_002678239.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Treponema 
denticola]
 gb|EMB43331.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Treponema 
denticola ASLM]
 gb|EMD56694.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Treponema 
denticola US-Trep]
Length=560

 Score =   165 bits (418),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 98/230 (43%), Positives = 147/230 (64%), Gaps = 11/230 (5%)
 Frame = +1

Query  70   SDLQKLRSQYRPELPPCLQG--TTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFL  243
            S +Q+LR  Y P++P       + ++ E G+AT A   S    +  +FPHT+G P+  F+
Sbjct  4    STMQRLRYNYEPKIPKVFAEPLSLIKPEIGEATHAQ--SNQAELKEIFPHTYGMPIIRFV  61

Query  244  RASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggse  423
            +  ++V       EH  ++ G++  G Q+PGGHN I GL+DALK  N NS L GFL G E
Sbjct  62   KGKSEV-------EHKPLKFGVILSGGQAPGGHNVISGLFDALKKGNANSKLYGFLRGPE  114

Query  424  glfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVIVGG  603
            GL   + +EI   ++  Y+N GG+D++G  + +I + EQ+ +++     LKLD L+I+GG
Sbjct  115  GLVKGRYVEIKKALIDKYRNTGGFDIIGSGRTKIETEEQIESSIQNVKKLKLDALIIIGG  174

Query  604  VTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
              SNT+AA+LA+ F +AK  TKV+GVP T++GDLKNQ++ET+ GFDT  K
Sbjct  175  DDSNTNAAFLAKYFIQAKLNTKVIGVPKTIDGDLKNQYIETSFGFDTATK  224



>gb|EMT11805.1| Pyrophosphate--fructose 6-phosphate 1-phosphotransferase subunit 
alpha [Aegilops tauschii]
Length=171

 Score =   154 bits (389),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 73/113 (65%), Positives = 89/113 (79%), Gaps = 0/113 (0%)
 Frame = +1

Query  55   LARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLA  234
            +  E+S LQK R++YRPELPP LQGT V+VE+GDA  AAD +  H I R FPHT+GQ LA
Sbjct  1    MGNEMSPLQKHRAEYRPELPPWLQGTAVKVEYGDAAIAADGADAHVIRRAFPHTYGQRLA  60

Query  235  HFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNS  393
            HFL  +A  PDA +ITEHPA+RVG+VF GRQSPGGHN +WGLY+A+  HNP+S
Sbjct  61   HFLPKTANAPDATVITEHPAVRVGVVFSGRQSPGGHNVVWGLYNAINSHNPSS  113



>ref|WP_037547210.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Spirochaeta 
sp. JC230]
 gb|KGE72441.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Spirochaeta 
sp. JC230]
Length=552

 Score =   160 bits (405),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 101/232 (44%), Positives = 142/232 (61%), Gaps = 11/232 (5%)
 Frame = +1

Query  64   ELSDLQKLRSQYRPELPPCLQGT--TVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAH  237
            E+S LQK R +Y P+LPP L G    + V FGD T +   +    + +LF  T+G+P+A 
Sbjct  2    EISALQKARLEYSPKLPPALSGAIDAIAVSFGDPTESI--ANQAELKQLFAKTYGKPIAA  59

Query  238  FLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflgg  417
            F     K  +  +  E   +RVG++  G Q+PGGHN I GLYD LK  NPNS L GFLGG
Sbjct  60   F----GKGANPNVGKE---LRVGVILSGGQAPGGHNVITGLYDGLKKANPNSVLFGFLGG  112

Query  418  seglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVIV  597
              GL   + +E TD+ +  Y+N GG+D++G  + +I +  Q  A L      KL+ +V++
Sbjct  113  PSGLIDDEAVEFTDEFIDRYRNTGGFDIIGSGRTKIETDAQFAAVLETAKKRKLNAVVVI  172

Query  598  GGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            GG  SNT+AA LAE F       +V+GVP T++GDLKN+++ET+ GFDT CK
Sbjct  173  GGDDSNTNAALLAEYFQTQGTDIQVIGVPKTIDGDLKNEYIETSFGFDTACK  224



>ref|XP_004956506.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha-like isoform X2 [Setaria italica]
Length=509

 Score =   160 bits (404),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 92/128 (72%), Positives = 113/128 (88%), Gaps = 0/128 (0%)
 Frame = +1

Query  370  LKVHNPNSTllgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNA  549
            +K  NP++ LLGF+GG+EGLFA+K LEITDD+L++YKNQGG+D+LGRT DQIR+TEQVNA
Sbjct  1    MKAQNPHNVLLGFIGGTEGLFAKKMLEITDDVLSSYKNQGGFDLLGRTVDQIRTTEQVNA  60

Query  550  ALTACTSLKLDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETN  729
            A++ C  L LDGL+I+GGVTSN+DAA LAE FA+  C TKV+GVPVTL+GDLKNQFVET 
Sbjct  61   AMSTCCDLSLDGLIIIGGVTSNSDAAQLAETFAKHNCNTKVIGVPVTLSGDLKNQFVETT  120

Query  730  VGFDTICK  753
            VGFDT+CK
Sbjct  121  VGFDTVCK  128



>ref|WP_006255527.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Alloprevotella 
tannerae]
 gb|EEX71434.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
tannerae ATCC 51259]
Length=550

 Score =   160 bits (405),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 97/230 (42%), Positives = 136/230 (59%), Gaps = 10/230 (4%)
 Frame = +1

Query  64   ELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFL  243
            E+S LQK RS Y+P+LP  L+G    +E     +  D +    I RLFPHT+G PL  F 
Sbjct  2    EISALQKARSSYQPKLPKGLRGNVDIIEGAPTESVGDQA---EIKRLFPHTYGMPLVEF-  57

Query  244  RASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggse  423
                    A+ + E+  I VGI+  G Q+PGGHN I GL+D LK  NP S L GFL G  
Sbjct  58   ------APAKEVKEYAPINVGIILSGGQAPGGHNVICGLFDELKKQNPKSKLYGFLMGPS  111

Query  424  glfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVIVGG  603
            GL   K  E+T +++  Y+N GG+DM+G  + ++ + EQ ++ L     L L+ ++I+GG
Sbjct  112  GLVDHKYKELTAEVIDKYRNTGGFDMIGSGRTKLETKEQFDSGLEIIRQLNLNAVIIIGG  171

Query  604  VTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
              SNT+A  LAE +A       V+G P T++GDLKN  +ET+ GFD+ CK
Sbjct  172  DDSNTNACMLAEYYASINAGVSVIGCPKTIDGDLKNDQIETSFGFDSACK  221



>ref|WP_014455241.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Spirochaeta 
africana]
 gb|AFG37252.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Spirochaeta 
africana DSM 8902]
Length=554

 Score =   159 bits (403),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 101/233 (43%), Positives = 144/233 (62%), Gaps = 13/233 (6%)
 Frame = +1

Query  64   ELSDLQKLRSQYRPELPPCLQG--TTVRVEFGDATTA-ADPSGGHTISRLFPHTFGQPLA  234
            +LS LQK R +Y+P+LP  LQ    ++ VEFG AT A AD +    +  LF  T+G+P+A
Sbjct  5    QLSPLQKARYEYQPKLPKALQSDLASISVEFGAATEAIADQA---RLKELFAKTYGKPIA  61

Query  235  HFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflg  414
             F   S  V           +RVG++  G Q+PGGHN I G+YD LK  NP S L+GF G
Sbjct  62   SFTSGSNDVSS-------KLLRVGVILSGGQAPGGHNVIAGIYDGLKKGNPESVLIGFKG  114

Query  415  gseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVI  594
            G  GL  +  +EITD  +  Y+N GG+DM+G  + +I + +Q   +L     L+L+ +V+
Sbjct  115  GPSGLLEKDYVEITDSFMDEYRNTGGFDMIGSGRTKISTDQQFADSLRVAKELQLNAVVV  174

Query  595  VGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            +GG  SNT+AA LAE F +     +V+GVP T++GDLKN+++ET+ GFDT  K
Sbjct  175  IGGDDSNTNAALLAEYFIQEGTNIQVIGVPKTIDGDLKNEYIETSFGFDTAVK  227



>ref|WP_037997392.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Tannerella 
sp. oral taxon BU063]
 gb|ETK12975.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Tannerella 
sp. oral taxon BU063 isolate Cell 8/11]
Length=548

 Score =   159 bits (401),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 100/228 (44%), Positives = 130/228 (57%), Gaps = 10/228 (4%)
 Frame = +1

Query  70   SDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFLRA  249
            S LQ  R+ Y P++P  L+G+   VE G AT AA       I RLFPHT+G P   F R 
Sbjct  4    SALQIARAAYVPKMPVALRGSVRAVE-GAATEAAGDK--EEIKRLFPHTYGMPAVTFERG  60

Query  250  SAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggsegl  429
             A  P        P I  G++  G Q+PGGHN I GL+D LK  NP S L GF+ G  GL
Sbjct  61   DAADP-------MPPINAGVILSGGQAPGGHNVIAGLFDGLKAANPESRLFGFILGPGGL  113

Query  430  fAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVIVGGVT  609
               K +E+T DI+  Y+N GG+DM+G  + ++   EQ +  L     L +  LVI+GG  
Sbjct  114  VEHKYMELTADIIDEYRNTGGFDMIGSGRTKLERREQFDKGLEILKELGISALVIIGGDD  173

Query  610  SNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            SNT+AA LAE +        V+G P T++GDLKN  +ET+ GFDT CK
Sbjct  174  SNTNAAVLAEYYRSIGAGVSVIGCPKTIDGDLKNDLIETSFGFDTACK  221



>ref|WP_037983302.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Tannerella 
sp. oral taxon BU063]
 gb|ETK00674.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Tannerella 
sp. oral taxon BU063 isolate Cell 2]
 gb|ETK04037.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Tannerella 
sp. oral taxon BU063 isolate Cell 5]
 gb|ETK06766.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Tannerella 
sp. oral taxon BU063 isolate Cell 1/3]
 gb|ETK08124.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Tannerella 
sp. oral taxon BU063 isolate Cell 6/7/9]
Length=548

 Score =   159 bits (401),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 100/228 (44%), Positives = 130/228 (57%), Gaps = 10/228 (4%)
 Frame = +1

Query  70   SDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFLRA  249
            S LQ  R+ Y P++P  L+G+   VE G AT AA       I RLFPHT+G P   F R 
Sbjct  4    SALQIARAAYVPKMPVALRGSVRAVE-GAATEAAGDK--EEIKRLFPHTYGMPAVTFERG  60

Query  250  SAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggsegl  429
             A  P        P I  G++  G Q+PGGHN I GL+D LK  NP S L GF+ G  GL
Sbjct  61   DAADP-------MPPINAGVILSGGQAPGGHNVIAGLFDGLKAANPESRLFGFILGPGGL  113

Query  430  fAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVIVGGVT  609
               K +E+T DI+  Y+N GG+DM+G  + ++   EQ +  L     L +  LVI+GG  
Sbjct  114  VEHKYMELTADIIDEYRNTGGFDMIGSGRTKLERREQFDKGLEILKELGISALVIIGGDD  173

Query  610  SNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            SNT+AA LAE +        V+G P T++GDLKN  +ET+ GFDT CK
Sbjct  174  SNTNAAVLAEYYRSIGAGVSVIGCPKTIDGDLKNDLIETSFGFDTACK  221



>emb|CBK21183.2| unnamed protein product [Blastocystis hominis]
 emb|CBK23261.2| unnamed protein product [Blastocystis hominis]
Length=606

 Score =   158 bits (399),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 104/249 (42%), Positives = 141/249 (57%), Gaps = 12/249 (5%)
 Frame = +1

Query  10   ESGEKGQVKMDSDFGLARELSDLQKLRSQYRPELPPCLQG-TTVRVEFGDATTAADPSGG  186
            ES + G + +D       +LS L K R  Y+P  P C +    V VEF D TT  D    
Sbjct  5    ESIQTGNIHIDEGERNIEDLSPLAKDRINYKPRYPACFENPEKVNVEFFDHTTFKDIDRP  64

Query  187  HTISRLFPHTFGQPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYD  366
              +   FP++   P+  F+    +           A+ VGIVFCGRQS GGHN I G++D
Sbjct  65   -LLEGYFPNSIHYPIMKFVDEEGRTD---------ALNVGIVFCGRQSSGGHNVITGVFD  114

Query  367  ALKVHNPNSTllgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVN  546
             L   NPNS L GF+GG+ GLF   ++E+T++ L  Y+N GGYD+LGR+ D+I S E  +
Sbjct  115  YLHKMNPNSKLYGFIGGTSGLFEGSSVELTEEKLKLYRNMGGYDLLGRSADKI-SEEDYS  173

Query  547  AALTACTSLKLDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVET  726
              +  CT L L GLV++GG  + TDA  L E F  +   T++V VP   + DLKN F+ET
Sbjct  174  KVVATCTKLNLHGLVLIGGAYTATDATLLTEFFLNSGVTTRIVVVPCDYSRDLKNHFIET  233

Query  727  NVGFDTICK  753
             VGFDT C+
Sbjct  234  TVGFDTFCR  242



>ref|WP_006952714.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
micans]
 gb|EHO69628.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Prevotella 
micans F0438]
Length=547

 Score =   156 bits (395),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 100/230 (43%), Positives = 139/230 (60%), Gaps = 11/230 (5%)
 Frame = +1

Query  64   ELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFL  243
            E+S LQK R+ Y+P+LP  LQG  V+++ G+ T + D      I +LFP+T+G PL  F 
Sbjct  2    EISALQKERAGYQPKLPKALQGA-VKIKEGEPTKSVDNQ--DDIKKLFPNTYGMPLVEF-  57

Query  244  RASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggse  423
                 VP  +  TE  A+ VG++  G Q+PGGHN I GL+D LK  NPN+ L GFL G  
Sbjct  58   -----VPTDK--TESKAVNVGVILSGGQAPGGHNVISGLFDELKKLNPNNRLYGFLMGPG  110

Query  424  glfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVIVGG  603
            GL     +EIT D +  Y+N GG+DM+G  + ++   EQ    L     L ++ +VI+GG
Sbjct  111  GLVDHNYIEITADFVQQYRNTGGFDMIGSGRTKLEQVEQFEKGLEIIRQLDINAIVIIGG  170

Query  604  VTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
              SNT+A  LAE +A  K   +V+G P T++GDLKN  +ET+ GFDT  K
Sbjct  171  DDSNTNACVLAEYYAAKKYGVQVIGCPKTIDGDLKNDQIETSFGFDTATK  220



>ref|WP_021909549.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
sp. CAG:755]
 emb|CCY15228.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
sp. CAG:755]
Length=357

 Score =   153 bits (387),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 93/228 (41%), Positives = 134/228 (59%), Gaps = 10/228 (4%)
 Frame = +1

Query  70   SDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFLRA  249
            S LQ  R+ Y+P+LP  L+G     E     + AD      I +LFP+T+G PL  F+ +
Sbjct  4    SALQIARAAYQPKLPQGLRGNVTIKEGAPTQSVADQ---EEIQKLFPNTYGMPLVEFVPS  60

Query  250  SAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggsegl  429
            S K        E+  + +G++  G Q+PGGHN I GLYD LK  NP + L GF+ G  GL
Sbjct  61   SEK-------REYAPMNIGVILSGGQAPGGHNVICGLYDELKKQNPANKLYGFILGPGGL  113

Query  430  fAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVIVGGVT  609
               K +E+T DI+  Y+N GG+DM+G  + ++ + EQ  + L     L +  +VI+GG  
Sbjct  114  VDHKYMELTGDIIDEYRNTGGFDMIGSGRTKLETKEQFESGLQIIRELNIKAVVIIGGDD  173

Query  610  SNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            SNT+A  LAE +A      +V+G P T++GDLKN+ +ET+ GFDT CK
Sbjct  174  SNTNACILAEYYAANNYGVQVIGCPKTIDGDLKNEQIETSFGFDTACK  221



>tpg|DAA60935.1| TPA: hypothetical protein ZEAMMB73_638083 [Zea mays]
Length=509

 Score =   155 bits (393),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 93/128 (73%), Positives = 113/128 (88%), Gaps = 0/128 (0%)
 Frame = +1

Query  370  LKVHNPNSTllgflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNA  549
            +K  NP+S LLGFLGG+EGLFA+KTLEIT+D+L++YKNQGG+D+LGRT DQIR+TEQV+A
Sbjct  1    MKARNPHSVLLGFLGGTEGLFAKKTLEITEDMLSSYKNQGGFDLLGRTVDQIRTTEQVDA  60

Query  550  ALTACTSLKLDGLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETN  729
            A +AC  L LDGL+I+GGVTSN+DAA LAE FAE  C TKV+GVPVTL+GDL+NQFVE  
Sbjct  61   AKSACCDLNLDGLIIIGGVTSNSDAAQLAEFFAEHDCKTKVIGVPVTLSGDLRNQFVEAT  120

Query  730  VGFDTICK  753
            VGFDT+CK
Sbjct  121  VGFDTVCK  128



>ref|WP_005846138.1| MULTISPECIES: diphosphate--fructose-6-phosphate 1-phosphotransferase 
[Bacteroides]
 gb|ABR39945.1| phosphofructokinase [Bacteroides vulgatus ATCC 8482]
 gb|EET15757.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
sp. 4_3_47FAA]
 gb|EFG16238.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
vulgatus PC510]
 gb|EFV67184.1| phosphofructokinase [Bacteroides sp. 3_1_40A]
 gb|EIY82003.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Bacteroides 
vulgatus CL09T03C04]
 gb|EOS05879.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Bacteroides 
vulgatus dnLKV7]
 emb|CDF19673.1| phosphofructokinase [Bacteroides vulgatus CAG:6]
 gb|KDS29549.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
vulgatus str. 3775 SR(B) 19]
 gb|KDS55713.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
vulgatus str. 3975 RP4]
Length=547

 Score =   156 bits (394),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 94/228 (41%), Positives = 135/228 (59%), Gaps = 11/228 (5%)
 Frame = +1

Query  70   SDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFLRA  249
            S LQ  R+ Y+P+LP  L+G  V+V+ G+ T +   +    I  LFP+T+G PL  F+  
Sbjct  4    SALQIARAAYQPKLPKALKGA-VKVKEGEPTQSV--ADQEAIKALFPNTYGMPLIQFVEG  60

Query  250  SAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggsegl  429
             A           PAI VG++  G Q+PGGHN I GL+D +K  N +S L GF+ G  GL
Sbjct  61   EA--------VNMPAINVGVILSGGQAPGGHNVISGLFDGIKALNKDSKLYGFILGPGGL  112

Query  430  fAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVIVGGVT  609
                 +E+T DI+  Y+N GG+D++G  + ++   EQ +  L     L +  LVI+GG  
Sbjct  113  VDHNYMELTSDIIDEYRNTGGFDIIGSGRTKLEKVEQFDKGLEIIKELGIKALVIIGGDD  172

Query  610  SNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            SNT+A  LAE +A   C  +V+G P T++GDLKN+ +ET+ GFDT CK
Sbjct  173  SNTNACVLAEYYAAKNCGVQVIGCPKTIDGDLKNEMIETSFGFDTACK  220



>ref|WP_022511727.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
sp. CAG:617]
 emb|CDF21647.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
sp. CAG:617]
Length=546

 Score =   155 bits (393),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 92/228 (40%), Positives = 134/228 (59%), Gaps = 10/228 (4%)
 Frame = +1

Query  70   SDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFLRA  249
            S LQ  R+ Y+P+LP  L+G     E     +  D      I +LFP+T+G P+  F+  
Sbjct  4    SALQCARAAYQPKLPKGLRGNVTIKEGAPTQSVGDQ---EEIKKLFPNTYGMPIVEFVPT  60

Query  250  SAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggsegl  429
              K        E+  I +G++  G Q+PGGHN I GLYD LK  NP + L GFL G  GL
Sbjct  61   DEK-------KEYAPINIGVILSGGQAPGGHNVICGLYDELKKQNPQNKLYGFLMGPGGL  113

Query  430  fAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVIVGGVT  609
               K +E+TD+++  Y+N GG+DM+G  + ++   +Q  + L     L ++ +VI+GG  
Sbjct  114  VNHKYIEMTDELINEYRNTGGFDMIGSGRTKLEEVDQFESGLKIINELGINAIVIIGGDD  173

Query  610  SNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            SNT+A  LAE +A  KC  +V+G P T++GDLKN+ +ET+ GFDT CK
Sbjct  174  SNTNACVLAEYYAAKKCGVQVIGCPKTIDGDLKNEQIETSFGFDTACK  221



>ref|WP_025017895.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
sartorii]
Length=547

 Score =   155 bits (393),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 94/228 (41%), Positives = 135/228 (59%), Gaps = 11/228 (5%)
 Frame = +1

Query  70   SDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFLRA  249
            S LQ  R+ Y+P+LP  L+G  V+V+ G+ T +   +    I  LFP+T+G PL  F+  
Sbjct  4    SALQIARAAYQPKLPKALKGA-VKVKEGEPTQSV--ADQEAIKALFPNTYGMPLIQFVEG  60

Query  250  SAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggsegl  429
             A           PAI VG++  G Q+PGGHN I GL+D +K  N +S L GF+ G  GL
Sbjct  61   EA--------VNMPAINVGVILSGGQAPGGHNVISGLFDGIKALNKDSKLYGFILGPGGL  112

Query  430  fAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVIVGGVT  609
                 +E+T DI+  Y+N GG+D++G  + ++   EQ +  L     L +  LVI+GG  
Sbjct  113  VDHNYMELTSDIIDEYRNTGGFDIIGSGRTKLEKEEQFDKGLEIIKELGIKALVIIGGDD  172

Query  610  SNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            SNT+A  LAE +A   C  +V+G P T++GDLKN+ +ET+ GFDT CK
Sbjct  173  SNTNACVLAEYYAAKNCGVQVIGCPKTIDGDLKNEMIETSFGFDTACK  220



>ref|WP_008652858.1| MULTISPECIES: diphosphate--fructose-6-phosphate 1-phosphotransferase 
[Bacteroides]
 gb|EEZ23442.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
sp. 3_1_33FAA]
 gb|AII62468.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
dorei]
Length=547

 Score =   155 bits (393),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 94/228 (41%), Positives = 135/228 (59%), Gaps = 11/228 (5%)
 Frame = +1

Query  70   SDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFLRA  249
            S LQ  R+ Y+P+LP  L+G  V+V+ G+ T +   +    I  LFP+T+G PL  F+  
Sbjct  4    SALQIARAAYQPKLPKALKGA-VKVKEGEPTQSV--ADQEAIKALFPNTYGMPLIQFVEG  60

Query  250  SAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggsegl  429
             A           PAI VG++  G Q+PGGHN I GL+D +K  N +S L GF+ G  GL
Sbjct  61   EA--------VNMPAINVGVILSGGQAPGGHNVISGLFDGIKALNKDSKLYGFILGPGGL  112

Query  430  fAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVIVGGVT  609
                 +E+T DI+  Y+N GG+D++G  + ++   EQ +  L     L +  LVI+GG  
Sbjct  113  VDHNYMELTSDIIDEYRNTGGFDIIGSGRTKLEKEEQFDKGLEIIKELGIKALVIIGGDD  172

Query  610  SNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            SNT+A  LAE +A   C  +V+G P T++GDLKN+ +ET+ GFDT CK
Sbjct  173  SNTNACVLAEYYAAKNCGVQVIGCPKTIDGDLKNEMIETSFGFDTACK  220



>ref|WP_009346441.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Alloprevotella 
rava]
 gb|EHG25079.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Alloprevotella 
rava F0323]
Length=550

 Score =   155 bits (393),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 94/229 (41%), Positives = 137/229 (60%), Gaps = 10/229 (4%)
 Frame = +1

Query  67   LSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFLR  246
            +S LQK R+ Y+P+LP  L+G  V ++ G+ T + D      I  LFP+T+G PL  F+ 
Sbjct  3    ISALQKARAAYQPKLPQGLRGN-VEIKEGEPTQSVDNQ--EEIKELFPNTYGMPLVEFIP  59

Query  247  ASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggseg  426
               K        E+  I +G++  G Q+PGGHN I GL+D LK  NPN+ L GFL G  G
Sbjct  60   TDTK-------KEYAPINIGVILSGGQAPGGHNVICGLFDELKKQNPNNKLYGFLMGPGG  112

Query  427  lfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVIVGGV  606
            L   + LEIT +++  Y+N GG+DM+G  + ++ + +Q  + L     L +  +VI+GG 
Sbjct  113  LVDHQYLEITSEVVEEYRNTGGFDMIGSGRTKLETEDQFESGLKIINELDIKAVVIIGGD  172

Query  607  TSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
             SNT+A  LAE +A       V+G P T++GDLKN+ +ET+ GFDT CK
Sbjct  173  DSNTNACMLAEYYAAKNTGVSVIGCPKTIDGDLKNEQIETSFGFDTACK  221



>ref|WP_025002795.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
dentasini]
Length=547

 Score =   155 bits (392),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 96/230 (42%), Positives = 138/230 (60%), Gaps = 11/230 (5%)
 Frame = +1

Query  64   ELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFL  243
            E+S LQK R+ Y+P+LP  LQGT V+++ G+ T + D      I +LFP+T+G PL  F+
Sbjct  2    EISALQKERAAYQPKLPKALQGT-VKIQEGEPTQSVDNQ--EDIKKLFPNTYGMPLIEFV  58

Query  244  RASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggse  423
             ++        +T    + VG++  G Q+PGGHN I GL+D +K  NP S L GFL G  
Sbjct  59   PSN--------VTNGKKVNVGVILSGGQAPGGHNVISGLFDEIKKLNPESRLYGFLMGPG  110

Query  424  glfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVIVGG  603
            GL     +EIT+D +  Y+N GG+DM+G  + ++   EQ    L     L +  +VI+GG
Sbjct  111  GLVNHNYIEITEDYVQNYRNTGGFDMIGSGRTKLEEEEQFEKGLEVIRELNIHAIVIIGG  170

Query  604  VTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
              SNT+A  LAE +A  K   +V+G P T++GDLKN  +ET+ GFDT  K
Sbjct  171  DDSNTNACVLAEYYAAKKYGVQVIGCPKTIDGDLKNDQIETSFGFDTATK  220



>ref|WP_009161991.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
saccharolytica]
 gb|EKY02337.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
saccharolytica F0055]
Length=546

 Score =   155 bits (392),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 100/230 (43%), Positives = 139/230 (60%), Gaps = 11/230 (5%)
 Frame = +1

Query  64   ELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFL  243
            E S LQK R+ Y+P+LP  LQG  V++  G  T + D      I +LFP+T+G PL  F+
Sbjct  2    EKSALQKARASYQPKLPKALQGA-VKIAEGAPTQSVDNQ--EDIKKLFPNTYGMPLIEFV  58

Query  244  RASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggse  423
            + + ++P         AI VGI+  G Q+PGGHN I GL+D +K  NPN+ L GFL G  
Sbjct  59   QGN-EIP-------AKAINVGIILSGGQAPGGHNVISGLFDEVKKLNPNNRLYGFLMGPG  110

Query  424  glfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVIVGG  603
            GL   K +EIT D L  Y+N GG+DM+G  + ++ +TEQ    L     L ++ +VI+GG
Sbjct  111  GLVDHKYIEITADFLNDYRNTGGFDMIGSGRTKLETTEQFEKGLEIIRKLDINAIVIIGG  170

Query  604  VTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
              SNT+A  LAE +A      +V+G P T++GDLKN  +ET+ GFDT  K
Sbjct  171  DDSNTNACVLAEYYAAKNYGVQVIGCPKTIDGDLKNDQIETSFGFDTATK  220



>gb|ADQ78315.1| pyrophosphate-dependent phosphofructokinase [Paludibacter propionicigenes 
WB4]
Length=551

 Score =   155 bits (392),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 92/228 (40%), Positives = 136/228 (60%), Gaps = 11/228 (5%)
 Frame = +1

Query  70   SDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFLRA  249
            S LQ  R+ Y+P+LP  L+G  V  E     + AD +    I  LFP+T+G PL  F   
Sbjct  7    SPLQIARASYQPKLPTALKGNVVLKEGAATESVADQA---DIKTLFPNTYGMPLISF---  60

Query  250  SAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggsegl  429
                 +A +  E+PA+  G++  G Q+PGGHN I GL+D LK  NPN+ L GFL G  GL
Sbjct  61   -----EAGVKKEYPAVAAGVILSGGQAPGGHNVICGLFDGLKALNPNNKLYGFLAGPSGL  115

Query  430  fAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVIVGGVT  609
                 +E+T +I+  Y+N GG+D++G  + ++    Q +     C  L ++ +VI+GG  
Sbjct  116  VDHNYIELTKEIVDEYRNTGGFDIIGSGRTKLEEEWQYDKGTEICKKLGINAIVIIGGDD  175

Query  610  SNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            SNT+A  LAE +++ K   +V+G P T++GDLKN+ +ET+ GFDT CK
Sbjct  176  SNTNACVLAEYYSQKKTGIQVIGCPKTIDGDLKNEMIETSFGFDTACK  223



>ref|WP_013758252.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Treponema 
brennaborense]
 gb|AEE16544.1| diphosphate/fructose-6-phosphate 1-phosphotransferase [Treponema 
brennaborense DSM 12168]
Length=553

 Score =   155 bits (392),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 103/235 (44%), Positives = 144/235 (61%), Gaps = 14/235 (6%)
 Frame = +1

Query  61   RELSDLQKLRSQYRPELPPCLQGT---TVRVEFGDATTA-ADPSGGHTISRLFPHTFGQP  228
            + +S LQ  R  Y+P+LP  L+      V +EFG  TTA AD +    ++ LF HT+G+P
Sbjct  2    KSVSALQTARYAYQPKLPAVLRDNEPENVALEFGKPTTALADQA---ELASLFKHTYGKP  58

Query  229  LAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgf  408
             A F + +      +I       RVG++  G Q+PGGHN I GLYD +K  N +S + GF
Sbjct  59   EALFKKGANPAAGKKI-------RVGVILSGGQAPGGHNVIAGLYDGIKKGNKDSVVFGF  111

Query  409  lggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGL  588
             GG  GL   + +EITD  +  Y+N GG+DM+G  + +I + EQ  A++     L LD +
Sbjct  112  TGGPSGLIDGEYVEITDSFMDEYRNTGGFDMIGSGRTKIETPEQYAASVATAKKLDLDAI  171

Query  589  VIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            VI+GG  SNT+AA LAE FAE    T+V+GVP T++GDLKN+ +ET+ GFDT CK
Sbjct  172  VIIGGDDSNTNAALLAERFAELGEKTRVIGVPKTIDGDLKNEQIETSFGFDTACK  226



>ref|WP_041620527.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Paludibacter 
propionicigenes]
Length=548

 Score =   155 bits (391),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 92/228 (40%), Positives = 136/228 (60%), Gaps = 11/228 (5%)
 Frame = +1

Query  70   SDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFLRA  249
            S LQ  R+ Y+P+LP  L+G  V  E     + AD +    I  LFP+T+G PL  F   
Sbjct  4    SPLQIARASYQPKLPTALKGNVVLKEGAATESVADQA---DIKTLFPNTYGMPLISF---  57

Query  250  SAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggsegl  429
                 +A +  E+PA+  G++  G Q+PGGHN I GL+D LK  NPN+ L GFL G  GL
Sbjct  58   -----EAGVKKEYPAVAAGVILSGGQAPGGHNVICGLFDGLKALNPNNKLYGFLAGPSGL  112

Query  430  fAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVIVGGVT  609
                 +E+T +I+  Y+N GG+D++G  + ++    Q +     C  L ++ +VI+GG  
Sbjct  113  VDHNYIELTKEIVDEYRNTGGFDIIGSGRTKLEEEWQYDKGTEICKKLGINAIVIIGGDD  172

Query  610  SNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            SNT+A  LAE +++ K   +V+G P T++GDLKN+ +ET+ GFDT CK
Sbjct  173  SNTNACVLAEYYSQKKTGIQVIGCPKTIDGDLKNEMIETSFGFDTACK  220



>ref|WP_025798196.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
saccharolytica]
Length=546

 Score =   155 bits (391),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 100/230 (43%), Positives = 139/230 (60%), Gaps = 11/230 (5%)
 Frame = +1

Query  64   ELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFL  243
            E S LQK R+ Y+P+LP  LQG  V++  G  T + D      I +LFP+T+G PL  F+
Sbjct  2    EKSALQKARASYQPKLPKALQGA-VKIAEGAPTQSVDNQ--EDIKKLFPNTYGMPLIEFV  58

Query  244  RASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggse  423
            + + ++P         AI VGI+  G Q+PGGHN I GL+D +K  NPN+ L GFL G  
Sbjct  59   QGN-EIP-------AKAINVGIILSGGQAPGGHNVISGLFDEVKKLNPNNRLYGFLMGPG  110

Query  424  glfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVIVGG  603
            GL   K +EIT D L  Y+N GG+DM+G  + ++ +TEQ    L     L ++ +VI+GG
Sbjct  111  GLVDHKYIEITADFLNDYRNTGGFDMIGSGRTKLETTEQFEKGLEIIRKLDINAIVIIGG  170

Query  604  VTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
              SNT+A  LAE +A      +V+G P T++GDLKN  +ET+ GFDT  K
Sbjct  171  DDSNTNACVLAEYYAAKNYGVQVIGCPKTIDGDLKNDQIETSFGFDTATK  220



>ref|WP_021980053.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Paraprevotella 
clara CAG:116]
 emb|CCZ02180.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Paraprevotella 
clara CAG:116]
Length=545

 Score =   155 bits (391),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 95/230 (41%), Positives = 132/230 (57%), Gaps = 11/230 (5%)
 Frame = +1

Query  64   ELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFL  243
            E S LQ  R+ Y+P+LP  LQG     E     + AD      I +LFP+T+G PL  F+
Sbjct  2    EKSALQIARAAYQPKLPKGLQGNVSVKEGAPTQSVADQ---EEIKKLFPNTYGMPLIEFV  58

Query  244  RASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggse  423
               A+         +    VG++  G Q+PGGHN I GL+D +K  NP S L GF+ G  
Sbjct  59   PGEAQ--------SYAPFNVGVILSGGQAPGGHNVICGLFDGIKRLNPESKLYGFILGPG  110

Query  424  glfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVIVGG  603
            GL   K +E+T DI+  Y+N GG+DM+G  + ++   EQ    L     L +  +VI+GG
Sbjct  111  GLVDHKYMELTADIIDQYRNTGGFDMIGSGRTKLEKEEQFEKGLEIIKELGIKAIVIIGG  170

Query  604  VTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
              SNT+A  LAE +A  KC  +V+G P T++GDLKN+ +ET+ GFDT CK
Sbjct  171  DDSNTNACVLAEYYAAKKCGVQVIGCPKTIDGDLKNEQIETSFGFDTACK  220



>ref|WP_007842406.1| MULTISPECIES: diphosphate--fructose-6-phosphate 1-phosphotransferase 
[Bacteroides]
 gb|EEO44717.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
dorei 5_1_36/D4]
 gb|EEO61472.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
sp. 9_1_42FAA]
 gb|EIY30074.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Bacteroides 
dorei CL02T00C15]
 gb|EIY38335.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Bacteroides 
dorei CL02T12C06]
 gb|EIY39999.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Bacteroides 
dorei CL03T12C01]
 emb|CDB37748.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Bacteroides 
dorei CAG:222]
Length=547

 Score =   154 bits (390),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 94/228 (41%), Positives = 134/228 (59%), Gaps = 11/228 (5%)
 Frame = +1

Query  70   SDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFLRA  249
            S LQ  R+ Y+P+LP  L+G  V+V+ G+ T +   +    I  LFP+T+G PL  F+  
Sbjct  4    SALQIARAAYQPKLPKALKGA-VKVKEGEPTQSV--ADQEAIKALFPNTYGMPLIQFVEG  60

Query  250  SAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggsegl  429
             A           PAI VG++  G Q+PGGHN I GL+D +K  N +S L GF+ G  GL
Sbjct  61   EA--------VNMPAINVGVILSGGQAPGGHNVISGLFDGIKALNKDSKLYGFILGPGGL  112

Query  430  fAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVIVGGVT  609
                 +E+T DI+  Y+N GG+D++G  + ++   EQ +  L     L +  LVI+GG  
Sbjct  113  VDHNYMELTSDIIDEYRNTGGFDIIGSGRTKLEKEEQFDKGLEIIKELGIKALVIIGGDD  172

Query  610  SNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            SNT+A  LAE +A   C  +V+G P T++GDLKN  +ET+ GFDT CK
Sbjct  173  SNTNACVLAEYYAAKNCGVQVIGCPKTIDGDLKNDMIETSFGFDTACK  220



>ref|WP_021687206.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Treponema 
lecithinolyticum]
 gb|ERJ93319.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Treponema 
lecithinolyticum ATCC 700332]
Length=552

 Score =   154 bits (390),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 103/231 (45%), Positives = 139/231 (60%), Gaps = 11/231 (5%)
 Frame = +1

Query  67   LSDLQKLRSQYRPELPPCLQGTT--VRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHF  240
            +S LQ  R  Y+P+LP  L G    V + FG  T A   S    + +LF HT+G+PLA  
Sbjct  4    ISALQNARYAYKPKLPAALSGKVDKVTLSFGKKTEAV--SDKTELKKLFAHTYGKPLAKV  61

Query  241  LRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggs  420
             + S    +A  + +   I+ G++  G Q+PGGHN I GLYDALK  N  S LLGFLGG 
Sbjct  62   QKGS----NANALKK---IKAGVILSGGQAPGGHNVICGLYDALKKGNEKSVLLGFLGGP  114

Query  421  eglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVIVG  600
             GL   K ++ +D ++  Y+N GG+D++G  + +I + EQ  AA       KLD LVI+G
Sbjct  115  SGLMENKFVKFSDKMIDQYRNTGGFDIIGSGRTKIETDEQYAAAAKTAKENKLDALVIIG  174

Query  601  GVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            G  SNT+AA LAE F      T+V+GVP T++GDLKN  +ET+ GFDT CK
Sbjct  175  GDDSNTNAALLAEYFVAHGIATQVIGVPKTIDGDLKNDLIETSFGFDTACK  225



>ref|WP_038605987.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
dorei]
 gb|AII68372.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
dorei]
Length=547

 Score =   154 bits (390),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 94/228 (41%), Positives = 135/228 (59%), Gaps = 11/228 (5%)
 Frame = +1

Query  70   SDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFLRA  249
            S LQ  R+ Y+P+LP  L+G  V+V+ G+ T +   +    I  LFP+T+G PL  F+  
Sbjct  4    SALQIARAAYQPKLPKALKGA-VKVKEGEPTQSV--ADQEAIKALFPNTYGMPLIQFVEG  60

Query  250  SAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggsegl  429
             A           PAI VG++  G Q+PGGHN I GL+D +K  N +S L GF+ G  GL
Sbjct  61   EA--------VNMPAINVGVILSGGQAPGGHNVISGLFDGVKSLNKDSKLYGFILGPGGL  112

Query  430  fAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVIVGGVT  609
                 +E+T DI+  Y+N GG+D++G  + ++   EQ +  L     L +  LVI+GG  
Sbjct  113  VDHNYMELTSDIIDEYRNTGGFDIIGSGRTKLEKEEQFDKGLEIIKELGIKALVIIGGDD  172

Query  610  SNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            SNT+A  LAE +A   C  +V+G P T++GDLKN+ +ET+ GFDT CK
Sbjct  173  SNTNACVLAEYYAAKNCGVQVIGCPKTIDGDLKNEMIETSFGFDTACK  220



>ref|WP_007837134.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
dorei]
 gb|EEB23867.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
dorei DSM 17855]
Length=547

 Score =   154 bits (390),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 94/228 (41%), Positives = 135/228 (59%), Gaps = 11/228 (5%)
 Frame = +1

Query  70   SDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFLRA  249
            S LQ  R+ Y+P+LP  L+G  V+V+ G+ T +   +    I  LFP+T+G PL  F+  
Sbjct  4    SALQIARAAYQPKLPKALKGA-VKVKEGEPTQSV--ADQEAIKALFPNTYGMPLIQFVEG  60

Query  250  SAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggsegl  429
             A           PAI VG++  G Q+PGGHN I GL+D +K  N +S L GF+ G  GL
Sbjct  61   EA--------VNMPAINVGVILSGGQAPGGHNVISGLFDGVKSLNKDSKLYGFILGPGGL  112

Query  430  fAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVIVGGVT  609
                 +E+T DI+  Y+N GG+D++G  + ++   EQ +  L     L +  LVI+GG  
Sbjct  113  VDHNYMELTSDIIDEYRNTGGFDIIGSGRTKLEKEEQFDKGLEIIKELGIKALVIIGGDD  172

Query  610  SNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            SNT+A  LAE +A   C  +V+G P T++GDLKN+ +ET+ GFDT CK
Sbjct  173  SNTNACVLAEYYAAKNCGVQVIGCPKTIDGDLKNEMIETSFGFDTACK  220



>ref|WP_016276863.1| MULTISPECIES: diphosphate-fructose-6-phosphate 1-phosphotransferase 
[Bacteroides]
 gb|EOS11933.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Bacteroides 
massiliensis dnLKV3]
Length=547

 Score =   154 bits (390),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 93/228 (41%), Positives = 135/228 (59%), Gaps = 11/228 (5%)
 Frame = +1

Query  70   SDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFLRA  249
            S LQ  R+ Y+P+LP  L+G  V+V+ G+ T +   +    I  LFP+T+G PL  F+  
Sbjct  4    SALQIARAAYQPKLPKALKGA-VKVKEGEPTQSV--ADQEAIKALFPNTYGMPLIQFVEG  60

Query  250  SAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggsegl  429
             +           PAI VG++  G Q+PGGHN I GL+D +K  N +S L GF+ G  GL
Sbjct  61   ES--------VNMPAINVGVILSGGQAPGGHNVISGLFDGIKALNKDSKLYGFILGPGGL  112

Query  430  fAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVIVGGVT  609
                 +E+T DI+  Y+N GG+D++G  + ++   EQ +  L     L +  LVI+GG  
Sbjct  113  VDHNYMELTSDIIDEYRNTGGFDIIGSGRTKLEKEEQFDKGLEIIKELGIKALVIIGGDD  172

Query  610  SNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            SNT+A  LAE +A   C  +V+G P T++GDLKN+ +ET+ GFDT CK
Sbjct  173  SNTNACVLAEYYAAKNCGVQVIGCPKTIDGDLKNEMIETSFGFDTACK  220



>ref|WP_005936237.1| MULTISPECIES: diphosphate-fructose-6-phosphate 1-phosphotransferase 
[Bacteroides]
 gb|EOA58122.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Bacteroides 
massiliensis B84634 = Timone 84634 = DSM 17679 = JCM 13223]
 emb|CDF13041.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Bacteroides 
sp. CAG:98]
Length=547

 Score =   154 bits (389),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 94/228 (41%), Positives = 135/228 (59%), Gaps = 11/228 (5%)
 Frame = +1

Query  70   SDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFLRA  249
            S LQ  R+ Y+P+LP  L+G  V+V+ G+ T +   +    I  LFP+T+G PL  F+  
Sbjct  4    SALQIARAAYQPKLPKALKGA-VKVKEGEPTQSV--ADQEAIKALFPNTYGMPLIQFVEG  60

Query  250  SAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggsegl  429
             A           PAI VG++  G Q+PGGHN I GL+D +K  N +S L GF+ G  GL
Sbjct  61   EA--------VNLPAINVGVILSGGQAPGGHNVISGLFDGIKALNKDSKLFGFILGPGGL  112

Query  430  fAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVIVGGVT  609
                 +E+T DI+  Y+N GG+D++G  + ++   EQ +  L     L +  LVI+GG  
Sbjct  113  VDHNYMELTADIIDEYRNTGGFDIIGSGRTKLEKEEQFDKGLEIIKELGIKALVIIGGDD  172

Query  610  SNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            SNT+A  LAE +A   C  +V+G P T++GDLKN+ +ET+ GFDT CK
Sbjct  173  SNTNACVLAEYYAAKNCGVQVIGCPKTIDGDLKNEMIETSFGFDTACK  220



>ref|XP_011041142.1| PREDICTED: pyrophosphate--fructose 6-phosphate 1-phosphotransferase 
subunit alpha isoform X2 [Populus euphratica]
Length=489

 Score =   154 bits (388),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 83/92 (90%), Positives = 86/92 (93%), Gaps = 0/92 (0%)
 Frame = +1

Query  478  KNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVIVGGVTSNTDaaylaeafaeaK  657
            K QGGYD+LGRTKDQIR+TEQVNAALTAC  LKLDGLVI+GGVTSNTDAA LAE FAEAK
Sbjct  20   KMQGGYDLLGRTKDQIRTTEQVNAALTACKDLKLDGLVIIGGVTSNTDAAQLAETFAEAK  79

Query  658  CPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            CPTKVVGVPVT NGDLKNQFVETNVGFDTICK
Sbjct  80   CPTKVVGVPVTFNGDLKNQFVETNVGFDTICK  111



>ref|WP_024268710.1| Pyrophosphate--fructose 6-phosphate 1-phosphotransferase, beta 
subunit [Salinispira pacifica]
 gb|AHC15807.1| Pyrophosphate--fructose 6-phosphate 1-phosphotransferase, beta 
subunit [Salinispira pacifica]
Length=553

 Score =   154 bits (389),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 100/233 (43%), Positives = 139/233 (60%), Gaps = 13/233 (6%)
 Frame = +1

Query  64   ELSDLQKLRSQYRPELPPCLQG--TTVRVEFGDAT-TAADPSGGHTISRLFPHTFGQPLA  234
            E+S LQK R +Y+P+LP  L    + +RVE GD T + AD      +  LFPH++G P+A
Sbjct  2    EISSLQKARYEYQPKLPAALDSAISDIRVELGDPTESVADQD---QVKSLFPHSYGAPIA  58

Query  235  HFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflg  414
             F     K       T    +RVG++  G Q+PGGHN I GLYD LK  N  S L+GFLG
Sbjct  59   VFASGKGK-------TSQNPLRVGVILSGGQAPGGHNVITGLYDGLKKANSQSNLVGFLG  111

Query  415  gseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVI  594
            G  GL     +   D  +  ++N GG+D++G  + +I + EQ  AAL      KLD +V+
Sbjct  112  GPSGLMDNDFIVFDDAKIDAFRNTGGFDIIGSGRTKIETDEQFAAALNTAKEQKLDAVVV  171

Query  595  VGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            +GG  SNT+AA LAE F +     +V+GVP T++GDLKN+++ET+ GFDT  K
Sbjct  172  IGGDDSNTNAALLAEYFKDNGTDIQVIGVPKTIDGDLKNEYIETSFGFDTAVK  224



>ref|WP_019188428.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Candidatus 
Prevotella conceptionensis]
Length=546

 Score =   154 bits (389),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 99/230 (43%), Positives = 138/230 (60%), Gaps = 11/230 (5%)
 Frame = +1

Query  64   ELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFL  243
            E S LQK R+ Y+P+LP  LQG  V+V  G  T + D  G   I +LFP+T+G PL  F+
Sbjct  2    EKSALQKARASYQPKLPKALQGA-VKVSEGAPTKSVDNQG--EIKKLFPNTYGMPLVEFV  58

Query  244  RASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggse  423
            +   ++P  +I        VGI+  G Q+PGGHN I GL+D +K  NPN+ L GFL G  
Sbjct  59   QGD-EMPSKEI-------NVGIILSGGQAPGGHNVISGLFDEVKRLNPNNRLYGFLMGPG  110

Query  424  glfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVIVGG  603
            GL     +EIT D +  Y+N GG+DM+G  + ++ +TEQ    L     L +  +VI+GG
Sbjct  111  GLVDHNYIEITADFIDEYRNTGGFDMIGSGRTKLETTEQFEKGLEIIRKLDIKAIVIIGG  170

Query  604  VTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
              SNT+A  LAE +A      +V+G P T++GDLKN+ +ET+ GFDT  K
Sbjct  171  DDSNTNACVLAEYYAAKNYGVQVIGCPKTIDGDLKNEQIETSFGFDTATK  220



>ref|WP_005923725.1| MULTISPECIES: diphosphate--fructose-6-phosphate 1-phosphotransferase 
[Bacteroides]
 gb|EIY62959.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Bacteroides 
salyersiae CL02T12C01]
 gb|EOA51424.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Bacteroides 
salyersiae WAL 10018 = DSM 18765 = JCM 12988]
 emb|CCY51654.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Bacteroides 
sp. CAG:189]
Length=547

 Score =   154 bits (389),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 93/228 (41%), Positives = 132/228 (58%), Gaps = 11/228 (5%)
 Frame = +1

Query  70   SDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFLRA  249
            S LQ  R+ Y+P+LP  L+G    VE     + AD      I +LFP+T+G PL  F   
Sbjct  4    SALQIARAAYQPKLPKALKGAVKAVEGAATQSVADQ---EAIQKLFPNTYGMPLIKFEAG  60

Query  250  SAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggsegl  429
             A         + PA+ VG++  G Q+PGGHN I GL+D +K  NP+S L GF+ G  GL
Sbjct  61   EA--------VKLPAMNVGVILSGGQAPGGHNVISGLFDGIKALNPDSKLYGFILGPGGL  112

Query  430  fAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVIVGGVT  609
                 +E+T DI+  Y+N GG+D++G  + ++   +Q    L     L +  LVI+GG  
Sbjct  113  VDHNYMELTSDIIDEYRNTGGFDIIGSGRTKLEKEDQFEKGLEILKELGIKALVIIGGDD  172

Query  610  SNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            SNT+A  LAE +A  K   +V+G P T++GDLKN+ +ET+ GFDT CK
Sbjct  173  SNTNACVLAEYYAAKKAGVQVIGCPKTIDGDLKNEMIETSFGFDTACK  220



>ref|WP_042372185.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroidaceae 
bacterium MS4]
Length=547

 Score =   154 bits (389),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 95/228 (42%), Positives = 134/228 (59%), Gaps = 11/228 (5%)
 Frame = +1

Query  70   SDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFLRA  249
            S LQ  R+ Y+P+LP  L+G+   VE     + AD      I +LFP+T+G PL  F   
Sbjct  4    SALQIARAAYQPKLPKALKGSVKAVEGAATQSVADQ---EAIKQLFPNTYGMPLITFEEG  60

Query  250  SAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggsegl  429
            +A         + PA+ VG++  G Q+PGGHN I GL+D LK  N  S L GF+ G  GL
Sbjct  61   AA--------VQLPAMNVGVILSGGQAPGGHNVISGLFDGLKALNKESRLFGFILGPGGL  112

Query  430  fAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVIVGGVT  609
                 +E+T DI+  Y+N GG+D++G  + ++ ST Q +  L     L +  LVI+GG  
Sbjct  113  VDHNYMELTADIIDEYRNTGGFDIIGSGRTKLESTAQFDKGLEIIDQLGIKALVIIGGDD  172

Query  610  SNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            SNT+A  LAE +A  K   +V+G P T++GDLKN+ +ET+ GFDT CK
Sbjct  173  SNTNACVLAEYYAAKKTGVQVIGCPKTIDGDLKNEMIETSFGFDTACK  220



>ref|WP_013968126.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Treponema 
caldaria]
 gb|AEJ18814.1| diphosphate/fructose-6-phosphate1-phosphotransfe rase [Treponema 
caldaria DSM 7334]
Length=551

 Score =   154 bits (388),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 106/233 (45%), Positives = 143/233 (61%), Gaps = 13/233 (6%)
 Frame = +1

Query  64   ELSDLQKLRSQYRPELPPCLQG--TTVRVEFGDAT-TAADPSGGHTISRLFPHTFGQPLA  234
            E+S LQK R  YRP+LP  L G  + + +EFG  T + AD +    +  LF H++G+PLA
Sbjct  2    EISALQKARYAYRPKLPVILTGPVSDIAIEFGTPTESVADQA---DLRALFKHSYGKPLA  58

Query  235  HFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflg  414
             F++          IT    + VG++  G Q+PGGHN I GLYD LK  N +S LLGFLG
Sbjct  59   RFVKGKN-----DKITRR--LTVGVILSGGQAPGGHNVIAGLYDGLKKGNKDSKLLGFLG  111

Query  415  gseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVI  594
            G  GL   K +EITD  +  Y+N GG+DM+G  + +I + EQ  A+L     L LD +VI
Sbjct  112  GPSGLIENKVVEITDAFMDEYRNTGGFDMIGSGRTKIETPEQFAASLETAKKLGLDAVVI  171

Query  595  VGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            +GG  SNT+AA LAE F E     +V+G P T++GDLKN+ +ET+ GFDT  K
Sbjct  172  IGGDDSNTNAALLAEYFLEKGEKIQVIGCPKTIDGDLKNEHIETSFGFDTATK  224



>ref|WP_018669292.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
gallinarum]
Length=548

 Score =   154 bits (388),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 94/228 (41%), Positives = 134/228 (59%), Gaps = 10/228 (4%)
 Frame = +1

Query  70   SDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFLRA  249
            S LQ  R+ Y+P+LP  L+GT   V      + AD      I +LFP+T+G PL  F  A
Sbjct  4    SALQIARAAYQPKLPKALRGTVKAVAGAATQSVADQ---EEIKKLFPNTYGMPLIKF-EA  59

Query  250  SAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggsegl  429
            + +V       E PA+ VG++  G Q+PGGHN I G++D +K  N +S L GF+ G  GL
Sbjct  60   TDEV------AEFPAVNVGVILSGGQAPGGHNVISGIFDGIKKLNKDSKLYGFILGPGGL  113

Query  430  fAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVIVGGVT  609
                 +E+T DI+  Y+N GG+D++G  + ++   EQ    L     L +  LVI+GG  
Sbjct  114  VDHNYMELTADIIDEYRNTGGFDIIGSGRTKLEKEEQFEKGLEILKELNIKALVIIGGDD  173

Query  610  SNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            SNT+A  LAE +A   C  +V+G P T++GDLKN+ +ET+ GFDT CK
Sbjct  174  SNTNACVLAEYYAAKNCGVQVIGCPKTIDGDLKNEMIETSFGFDTACK  221



>ref|WP_032125634.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Chlamydia 
sp. 'Diamant']
Length=556

 Score =   154 bits (388),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 99/231 (43%), Positives = 140/231 (61%), Gaps = 15/231 (6%)
 Frame = +1

Query  67   LSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFLR  246
            LS LQ+ R  Y P+LPP L+  +  V        A       + + FP T  QP+  F +
Sbjct  4    LSPLQRYRLGYEPKLPPILESPSCLVPHPKEGLEAI---NQDLRQQFPFTADQPVLTFQK  60

Query  247  ASAKVPDAQIITEHPA--IRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggs  420
                        + P   ++VG+V  G Q+PGGHN I GL+DALK ++ NS+L+GF  G 
Sbjct  61   GE----------QQPLRPLKVGVVLSGGQAPGGHNVIAGLFDALKKNHSNSSLIGFCNGP  110

Query  421  eglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVIVG  600
             G+   +++EIT+D+LA Y+NQGG+D++G  + +I + EQ  AA    T L LDGLV++G
Sbjct  111  NGIVKNQSIEITEDLLALYRNQGGFDLIGSGRTKIETPEQFEAAEKTVTCLSLDGLVVIG  170

Query  601  GVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            G  SNT+AA LAE F ++   T VVGVP T++GDLKN ++E + GFDT CK
Sbjct  171  GDDSNTNAAVLAEYFKQSGVKTHVVGVPKTIDGDLKNDYIEVSFGFDTACK  221



>ref|XP_002984967.1| hypothetical protein SELMODRAFT_234662 [Selaginella moellendorffii]
 gb|EFJ13842.1| hypothetical protein SELMODRAFT_234662 [Selaginella moellendorffii]
Length=560

 Score =   154 bits (388),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 98/228 (43%), Positives = 136/228 (60%), Gaps = 8/228 (4%)
 Frame = +1

Query  70   SDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFLRA  249
            S +Q  R  Y+P +P  L+G   +VE G +T+AA  +G   I++LFP  FGQP  H +  
Sbjct  22   SPVQSSRLDYKPPMPSVLEGH-FKVEHGSSTSAAGDAG--AIAQLFPKLFGQPSVHIVPC  78

Query  250  SAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggsegl  429
            +A         E   +R+G+V  G Q+PGGHN I GL+D L+ H P S LLGF GG  G+
Sbjct  79   AAAA-----FKEEVKLRIGVVLSGGQAPGGHNVIAGLFDYLQKHAPGSLLLGFRGGPAGI  133

Query  430  fAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVIVGGVT  609
               K +EIT + L  Y+NQGG+D++   +D+I + EQ   A      L LDG+V++GG  
Sbjct  134  MRCKYVEITSEFLYPYRNQGGFDIICSGRDKIETPEQFKQAEDTAVKLDLDGIVVIGGDD  193

Query  610  SNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            SNT+A  LAE F      T V+G P T++GDLK++ V  + GFDT CK
Sbjct  194  SNTNACLLAEYFRARNLKTHVIGCPKTIDGDLKSKEVPISFGFDTACK  241



>ref|WP_008627564.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Paraprevotella 
xylaniphila]
 gb|EGG53203.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Paraprevotella 
xylaniphila YIT 11841]
Length=545

 Score =   153 bits (387),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 95/230 (41%), Positives = 131/230 (57%), Gaps = 11/230 (5%)
 Frame = +1

Query  64   ELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFL  243
            E S LQ  R+ Y+P+LP  LQG     E     + AD      I +LFP+T+G PL  F+
Sbjct  2    EKSALQIARAAYQPKLPKGLQGNVSVKEGAPTQSVADQ---EEIKKLFPNTYGMPLIEFV  58

Query  244  RASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggse  423
               A+         +    VG++  G Q+PGGHN I GL+D +K  NP S L GF+ G  
Sbjct  59   PGEAQ--------SYAPFNVGVILSGGQAPGGHNVICGLFDGIKRLNPESKLYGFILGPG  110

Query  424  glfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVIVGG  603
            GL   K +E+T DI+  Y+N GG+DM+G  + ++   EQ    L     L +  +VI+GG
Sbjct  111  GLVDHKYMELTADIIDQYRNTGGFDMIGSGRTKLEKEEQFEKGLEIIKELGIKAIVIIGG  170

Query  604  VTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
              SNT+A  LAE +A  KC  +V+G P T++GDLKN  +ET+ GFDT CK
Sbjct  171  DDSNTNACVLAEYYAAKKCGVQVIGCPKTIDGDLKNDQIETSFGFDTACK  220



>ref|WP_022252312.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
sp. CAG:386]
 emb|CDC24261.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
sp. CAG:386]
Length=548

 Score =   153 bits (387),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 99/230 (43%), Positives = 136/230 (59%), Gaps = 11/230 (5%)
 Frame = +1

Query  64   ELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFL  243
            E S+LQ  R+ Y P+LP  LQG  V+V+ G  T + D      I +LFP+T+G PL  F 
Sbjct  2    EKSELQLARAAYLPKLPKGLQGN-VKVKEGAPTQSVDNQ--EEIKKLFPNTYGMPLVEF-  57

Query  244  RASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggse  423
                 VP  +       + VG++  G Q+PGGHN I GL+DALK  NP + L GFL G  
Sbjct  58   -----VPGDE--AHDTKMNVGVILSGGQAPGGHNVICGLFDALKKLNPANRLYGFLMGPG  110

Query  424  glfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVIVGG  603
            GL     +EIT D +  Y+N GG+DM+G  + ++  T+Q +  L     L +  +VI+GG
Sbjct  111  GLVDHNYMEITADFINDYRNTGGFDMIGSGRTKLEKTDQFDKGLEIIRELDIQAVVIIGG  170

Query  604  VTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
              SNT+A  LAE +A  KC  +V+G P T++GDLKN  +ET+ GFDT CK
Sbjct  171  DDSNTNACVLAEYYAAKKCGVQVIGCPKTIDGDLKNDQIETSFGFDTACK  220



>ref|WP_006189908.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Treponema 
vincentii]
 gb|EEV19357.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Treponema 
vincentii ATCC 35580]
Length=556

 Score =   153 bits (387),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 94/229 (41%), Positives = 133/229 (58%), Gaps = 7/229 (3%)
 Frame = +1

Query  67   LSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFLR  246
            +S L K R  Y P  P  L      +        A  +    I  LFPH +G+P+ HF++
Sbjct  3    VSQLHKARYAYIPRFPAILDEPIESIAMQKEQETASIANAEEIQPLFPHIYGKPVVHFVK  62

Query  247  ASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggseg  426
             +A +       +   +RVG +  G Q+PGGHN I GLYD L+  NPNS L GFLGG EG
Sbjct  63   GTAHI-------DKKPLRVGTILSGGQAPGGHNVIAGLYDGLQKANPNSKLFGFLGGPEG  115

Query  427  lfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVIVGGV  606
            L   + +EIT  I+  Y+N GG+DM+G  + +I + EQ+  A+     ++LD +VI+GG 
Sbjct  116  LVIGRAIEITGAIIEKYRNTGGFDMIGSGRAKIETPEQIAGAVETVKRMELDAVVIIGGD  175

Query  607  TSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
             SNT+AA L+E F +    T+++GVP T++GDLK   VET+ GFDT  K
Sbjct  176  DSNTNAAVLSEYFVQQGIATQIIGVPKTIDGDLKYDMVETSFGFDTATK  224



>ref|WP_022406493.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Prevotella 
sp. CAG:485]
 emb|CDE07571.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Prevotella 
sp. CAG:485]
Length=551

 Score =   153 bits (387),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 96/228 (42%), Positives = 138/228 (61%), Gaps = 9/228 (4%)
 Frame = +1

Query  70   SDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFLRA  249
            S LQK R  Y+P+LP  LQG  V+V++G  TT+        I+RLFPHT+G P+    R 
Sbjct  4    SALQKAREAYQPKLPRALQGA-VKVKYGSKTTSCGDE--EEIARLFPHTYGMPVVEMERD  60

Query  250  SAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggsegl  429
            S+  P      E P   VGI+  G Q+PGGHN + G++D +K  N    L GFL G  G 
Sbjct  61   SS--PKR---VEEP-FNVGIILSGGQAPGGHNVVSGIFDGIKRINSECRLYGFLMGPSGF  114

Query  430  fAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVIVGGVT  609
               + +E+T + +  Y+N GG+D++G  + ++ + EQ +  LT    L +  LVI+GG  
Sbjct  115  INHQYMELTANYIQQYRNTGGFDIIGSGRTKLETIEQFDKGLTILQELNIKALVIIGGDD  174

Query  610  SNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            SNT+AA LAE + E     +V+GVP T++GDLKN+++ET+ GFDT CK
Sbjct  175  SNTNAAVLAEYYKEIGADVQVIGVPKTIDGDLKNKWIETSFGFDTACK  222



>ref|WP_008622743.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Paraprevotella 
clara]
 gb|EHG98439.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Paraprevotella 
clara YIT 11840]
Length=545

 Score =   153 bits (387),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 95/230 (41%), Positives = 132/230 (57%), Gaps = 11/230 (5%)
 Frame = +1

Query  64   ELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFL  243
            E S LQ  R+ Y+P+LP  LQG     E     + AD      I +LFP+T+G PL  F+
Sbjct  2    EKSALQIARAAYQPKLPKGLQGNVSVKEGVPTQSVADQ---EEIKKLFPNTYGMPLIEFV  58

Query  244  RASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggse  423
               A+         +    VG++  G Q+PGGHN I GL+D +K  NP S L GF+ G  
Sbjct  59   PGEAQ--------SYAPFNVGVILSGGQAPGGHNVICGLFDGIKRLNPESKLYGFILGPG  110

Query  424  glfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVIVGG  603
            GL   K +E+T DI+  Y+N GG+DM+G  + ++   EQ    L     L +  +VI+GG
Sbjct  111  GLVDHKYMELTADIIDQYRNTGGFDMIGSGRTKLEKEEQFEKGLEIIKELGIKAIVIIGG  170

Query  604  VTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
              SNT+A  LAE +A  KC  +V+G P T++GDLKN+ +ET+ GFDT CK
Sbjct  171  DDSNTNACVLAEYYAAKKCGVQVIGCPKTIDGDLKNEQIETSFGFDTACK  220



>ref|WP_010527175.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Thermophagus 
xiamenensis]
Length=547

 Score =   153 bits (386),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 97/228 (43%), Positives = 135/228 (59%), Gaps = 10/228 (4%)
 Frame = +1

Query  70   SDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFLRA  249
            S LQ  R +Y P++P  L+G+   VE     + AD +    I ++FPHT+G P+  F  +
Sbjct  4    SALQIAREKYIPKVPAALKGSVKIVEGEKTQSVADQA---EIEKMFPHTYGLPVLSFETS  60

Query  250  SAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggsegl  429
              K        ++PAI+VG++  G Q+PGGHN I GL+D +K  N NS L GFLGG  GL
Sbjct  61   DEK-------KDYPAIKVGVILSGGQAPGGHNVISGLFDGIKRLNSNSQLYGFLGGPSGL  113

Query  430  fAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVIVGGVT  609
                  E+T DI+  Y+N GG+D++G  + ++    Q   AL  C  L +  LVI+GG  
Sbjct  114  TDNVYKELTSDIIDCYRNTGGFDIIGSGRTKLEEEWQFEKALENCKKLGIKALVIIGGDD  173

Query  610  SNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            SNT+AA LAE F       +VVGVP T++GDLK + +ET+ GFDT CK
Sbjct  174  SNTNAAVLAEYFMAKGAGIQVVGVPKTIDGDLKTEMIETSFGFDTACK  221



>ref|WP_009229809.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
sp. oral taxon 317]
 gb|EFC69384.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
sp. oral taxon 317 str. F0108]
Length=546

 Score =   153 bits (386),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 99/230 (43%), Positives = 137/230 (60%), Gaps = 11/230 (5%)
 Frame = +1

Query  64   ELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFL  243
            E S LQK R+ Y+P+LP  LQG  V+V  G  T + D      I +LFP+T+G PL  F+
Sbjct  2    EKSALQKARASYQPKLPKALQGA-VKVSEGAPTKSVDNQ--DEIKKLFPNTYGMPLVEFV  58

Query  244  RASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggse  423
            +   K+P  +I        VGI+  G Q+PGGHN I GL+D +K  NPN+ L GFL G  
Sbjct  59   QGD-KMPSKEI-------NVGIILSGGQAPGGHNVISGLFDEVKRLNPNNRLYGFLMGPG  110

Query  424  glfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVIVGG  603
            GL     +EIT D +  Y+N GG+DM+G  + ++ +TEQ    L     L +  +VI+GG
Sbjct  111  GLVDHNYIEITADFIDEYRNTGGFDMIGSGRTKLETTEQFEKGLEIIRKLDIKAIVIIGG  170

Query  604  VTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
              SNT+A  LAE +A      +V+G P T++GDLKN+ +ET+ GFDT  K
Sbjct  171  DDSNTNACVLAEYYAAKNYGVQVIGCPKTIDGDLKNEQIETSFGFDTATK  220



>ref|WP_026625143.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Dysgonomonas 
capnocytophagoides]
Length=548

 Score =   153 bits (386),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 94/229 (41%), Positives = 139/229 (61%), Gaps = 12/229 (5%)
 Frame = +1

Query  70   SDLQKLRSQYRPELPPCLQGTTVRVEFGDAT-TAADPSGGHTISRLFPHTFGQPLAHFLR  246
            S LQ  R+ Y+P++P  L G+ VRVE G AT + AD      + +LFP+T+G P+  F+ 
Sbjct  4    SALQVARAAYKPKMPKALYGS-VRVEEGAATQSVADQD---EVKKLFPNTYGMPILKFVE  59

Query  247  ASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggseg  426
            ++ K          PA+ VG++  G Q+PGGHN I G++D +K  N +S + GFL G  G
Sbjct  60   SAEK-------ANFPAMNVGVILSGGQAPGGHNVIAGIFDGIKSLNKDSKVYGFLMGPGG  112

Query  427  lfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVIVGGV  606
            L   K  E+T +I+  Y+N GG+D++G  + ++ + EQ +  L     L +  LVI+GG 
Sbjct  113  LVDHKYQELTSEIIDEYRNTGGFDIIGSGRTKLETKEQFDKGLEILKKLDIKALVIIGGD  172

Query  607  TSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
             SNT+A  LAE +A      +VVG P T++GDLKN+ +ET+ GFDT CK
Sbjct  173  DSNTNACVLAEYYAAINAGVQVVGCPKTIDGDLKNEMIETSFGFDTACK  221



>ref|WP_025877362.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
corporis]
Length=553

 Score =   153 bits (386),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 96/230 (42%), Positives = 140/230 (61%), Gaps = 11/230 (5%)
 Frame = +1

Query  64   ELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFL  243
            E S LQK R++Y+P+LP  LQG  V+++ G  T + D      I +LFP+T+G PL  F+
Sbjct  2    ETSALQKERAKYQPKLPKALQGA-VKIKEGKPTQSVDDY--EEIKKLFPNTYGMPLVEFV  58

Query  244  RASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggse  423
             A ++        +  +I VG++  G Q+PGGHN I GL+D LK  NPN+ L GFL G  
Sbjct  59   PADSQ--------DSLSINVGVILSGGQAPGGHNVISGLFDELKKINPNNRLYGFLMGPG  110

Query  424  glfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVIVGG  603
            GL     +EIT D++  Y+N GG+D++G  + ++ S +Q    L     L +  +VI+GG
Sbjct  111  GLVDHNYIEITSDLIHNYRNTGGFDLIGSGRTKLESIDQFERGLEIIRQLDIKAIVIIGG  170

Query  604  VTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
              SNT+A  LAE +A  K   +V+G P T++GDLKN+ +ET+ GFDT  K
Sbjct  171  DDSNTNACVLAEYYAAKKYGIQVIGCPKTIDGDLKNEQIETSFGFDTATK  220



>ref|WP_009437358.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
sp. oral taxon 473]
 gb|EKX89943.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
sp. oral taxon 473 str. F0040]
Length=546

 Score =   152 bits (385),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 98/230 (43%), Positives = 133/230 (58%), Gaps = 10/230 (4%)
 Frame = +1

Query  64   ELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFL  243
            E S LQ  R+ Y+P+LP  L+G    VE G  T + D      I  LFP+T+G PL +F 
Sbjct  2    EKSALQIARAAYQPKLPAGLRGNVKIVE-GAPTQSVDNQ--EEIKALFPNTYGMPLVNFE  58

Query  244  RASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggse  423
                K        E+  I +GI+  G Q+PGGHN I GLYD LK  NPNS L GFL G  
Sbjct  59   PTDEK-------KEYAPINIGIILSGGQAPGGHNVICGLYDGLKKQNPNSKLYGFLMGPG  111

Query  424  glfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVIVGG  603
            GL     LE+TD+++  Y+N GG+DM+G  + ++    Q    +     L ++ +VI+GG
Sbjct  112  GLVDHNYLEMTDELIDEYRNTGGFDMIGSGRTKLEEEAQFEKGMEVIRQLGINAIVIIGG  171

Query  604  VTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
              SNT+A  LAE +A  K   +V+G P T++GDLKN  +ET+ GFDT CK
Sbjct  172  DDSNTNACVLAEYYAAKKYGVQVIGCPKTIDGDLKNDQIETSFGFDTACK  221



>ref|WP_029901822.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
sp. 10(H)]
Length=548

 Score =   152 bits (385),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 95/229 (41%), Positives = 137/229 (60%), Gaps = 12/229 (5%)
 Frame = +1

Query  70   SDLQKLRSQYRPELPPCLQGTTVRVEFGDAT-TAADPSGGHTISRLFPHTFGQPLAHFLR  246
            S LQ  R+ Y+P++P  L G+ V++E G AT + AD      + +LFP+T+G P   F+ 
Sbjct  4    SALQIARATYKPKMPKALYGS-VKIEEGAATQSVADQ---EEVKKLFPNTYGMPTLKFVE  59

Query  247  ASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggseg  426
             S KV       ++PAI VG++  G Q+PGGHN I GL+D +K  N  S L GFL G  G
Sbjct  60   TSEKV-------DYPAINVGVILSGGQAPGGHNVIAGLFDGIKNLNSGSRLYGFLMGPGG  112

Query  427  lfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVIVGGV  606
            L      E+T DI+  Y+N GG+D++G  + ++ + EQ +  L     L +  LVI+GG 
Sbjct  113  LVDHDYKELTGDIIDEYRNTGGFDIIGSGRTKLETKEQFDKGLEILKKLNIKALVIIGGD  172

Query  607  TSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
             SNT+A  LAE +       +V+G P T++GDLKN+ +ET+ GFDT CK
Sbjct  173  DSNTNACVLAEYYKAIDAGVQVIGCPKTIDGDLKNEMIETSFGFDTACK  221



>gb|EFB41793.1| hypothetical protein pah_c022o077 [Parachlamydia acanthamoebae 
str. Hall's coccus]
 gb|KIA77973.1| Pyrophosphate--fructose 6-phosphate 1-phosphotransferase subunit 
beta 1 [Parachlamydia acanthamoebae]
Length=567

 Score =   152 bits (385),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 101/233 (43%), Positives = 136/233 (58%), Gaps = 9/233 (4%)
 Frame = +1

Query  55   LARELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLA  234
            L R  S LQK R  Y P LP  L+  T  V   +A    +      + +LF  T  Q L 
Sbjct  3    LMRIHSSLQKRRLAYLPRLPEILRSLTRLVPLFEAENHEN-ELPLPVVQLFSKTIDQQLL  61

Query  235  HFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflg  414
             F+    K         H  + VG+VF G Q+ GGHN I GL+DALK+ NP S + GFL 
Sbjct  62   RFVEGENKT--------HRPLNVGVVFSGGQASGGHNVISGLFDALKLLNPESKVFGFLN  113

Query  415  gseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVI  594
            G  G+   +++EIT +IL  ++N GG+D++G  + +I S +Q  AAL A   L LDGL+I
Sbjct  114  GPAGIINNQSMEITAEILKNFRNLGGFDLIGSGRTKIESPDQFQAALKAVQGLHLDGLLI  173

Query  595  VGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            +GG  SNT+AA+LAE F    C T VVG+P T++GDLKN+ +E + GFDT CK
Sbjct  174  IGGDDSNTNAAFLAEYFLAKGCKTCVVGIPKTIDGDLKNESIEVSFGFDTACK  226



>ref|WP_016518245.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Treponema 
vincentii]
 gb|EPF47448.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Treponema 
vincentii F0403]
Length=556

 Score =   152 bits (385),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 94/229 (41%), Positives = 133/229 (58%), Gaps = 7/229 (3%)
 Frame = +1

Query  67   LSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFLR  246
            +S L K R  Y P  P  L      +        A  +    I  LFPH +G+P+ HF++
Sbjct  3    VSQLHKARYAYIPRFPAILDEPIESIAMQKEQETASIANTEEIQPLFPHIYGKPVVHFVK  62

Query  247  ASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggseg  426
             +A +       +   +RVG +  G Q+PGGHN I GLYD L+  NPNS L GFLGG EG
Sbjct  63   GTAHI-------DKKPLRVGTILSGGQAPGGHNVIAGLYDGLQKANPNSKLFGFLGGPEG  115

Query  427  lfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVIVGGV  606
            L   + +EIT  I+  Y+N GG+DM+G  + +I + EQ+  A+     ++LD +VI+GG 
Sbjct  116  LVIGRAIEITGAIIEKYRNTGGFDMIGSGRAKIETPEQIAGAVETVKRMELDAVVIIGGD  175

Query  607  TSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
             SNT+AA L+E F +    T+++GVP T++GDLK   VET+ GFDT  K
Sbjct  176  DSNTNAAVLSEYFVQQGIATQIIGVPKTIDGDLKYDMVETSFGFDTATK  224



>ref|WP_007658653.1| MULTISPECIES: diphosphate--fructose-6-phosphate 1-phosphotransferase 
[Parabacteroides]
 gb|EKN07938.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Parabacteroides 
goldsteinii CL02T12C30]
 gb|EMZ30988.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Parabacteroides 
sp. ASF519]
 gb|EOS17848.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Parabacteroides 
goldsteinii dnLKV18]
Length=548

 Score =   152 bits (384),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 91/228 (40%), Positives = 135/228 (59%), Gaps = 10/228 (4%)
 Frame = +1

Query  70   SDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFLRA  249
            S LQ  R+ Y+P++P  L+G    V+     + AD      I +LFP+T+G P+  F ++
Sbjct  4    SALQIARAAYQPKVPAALKGAVKAVDGEYTESVADQ---EDIKKLFPNTYGMPIVTFEKS  60

Query  250  SAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggsegl  429
            + K        E PAI VG++  G Q+PGGHN I G++D +K  N +S L GF+ G  GL
Sbjct  61   NEK-------KEMPAINVGVILSGGQAPGGHNVIAGIFDGVKATNKDSRLYGFILGPGGL  113

Query  430  fAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVIVGGVT  609
               K +E+T DI+  Y+N GG+DM+G  + ++ + EQ +  L     L +  LVI+GG  
Sbjct  114  IDHKYMELTADIIDEYRNTGGFDMIGSGRTKLETKEQFDKGLEILKELDIKALVIIGGDD  173

Query  610  SNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            SNT+A  LAE +       +V+G P T++GDLKN+ +ET+ GFDT CK
Sbjct  174  SNTNACVLAEYYKAINAGVQVIGCPKTIDGDLKNEQIETSFGFDTACK  221



>ref|WP_022385737.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
sp. CAG:462]
 emb|CDD83168.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
sp. CAG:462]
Length=549

 Score =   152 bits (384),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 94/228 (41%), Positives = 131/228 (57%), Gaps = 10/228 (4%)
 Frame = +1

Query  70   SDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFLRA  249
            S LQ  R  Y+P+LP  L+G    VE G    A        + +LFP+T+G P+  F+ +
Sbjct  6    SALQLARKSYQPKLPKALRGAIEVVELGKTEPATHK---EELKKLFPNTYGMPILRFVES  62

Query  250  SAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggsegl  429
            + +        E+PAI VGI+  G  +PGGHN I GLYD LK +N +S L GF+ G  GL
Sbjct  63   TKQ-------KEYPAINVGIILSGGPAPGGHNVISGLYDGLKTNNKDSRLFGFILGPGGL  115

Query  430  fAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVIVGGVT  609
               +  E+T DI+  Y+N GG+D++G  + ++   EQ    L     L +  LVIVGG  
Sbjct  116  INHEYKELTADIIDEYRNTGGFDLIGTGRTKLEKEEQFEKGLEIMKKLDIKALVIVGGDD  175

Query  610  SNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            SNT+AA LAE +   +   +V+G P T++GDLKN  VE + GFDT CK
Sbjct  176  SNTNAAILAEYYQAKQAGIQVIGCPKTIDGDLKNDIVEASFGFDTTCK  223



>ref|WP_027470899.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Saccharicrinis 
fermentans]
 dbj|GAF03505.1| 6-phosphofructokinase [Saccharicrinis fermentans DSM 9555 = JCM 
21142]
Length=548

 Score =   152 bits (384),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 92/228 (40%), Positives = 135/228 (59%), Gaps = 10/228 (4%)
 Frame = +1

Query  70   SDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFLRA  249
            S LQ  R  Y P+LP  L+G+   VE  +  + AD S    I +LFP+T+G P+  F   
Sbjct  4    SPLQIARESYSPKLPKALKGSVKIVEGKNTESVADQS---DIQKLFPNTYGMPVLSFEAG  60

Query  250  SAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggsegl  429
             +          +  + VG++  G Q+PGGHN I G+YD LK  NP + + GFLGG  GL
Sbjct  61   DSS-------ANNEVMNVGLILSGGQAPGGHNVISGIYDGLKKLNPANKVYGFLGGPGGL  113

Query  430  fAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVIVGGVT  609
               K +E+TDDI+  Y+N GG+D++G  + ++    Q +  L  C +L ++ LVI+GG  
Sbjct  114  VDNKYMELTDDIVDHYRNTGGFDIIGSGRTKLEEEAQFDKGLENCKALGINALVIIGGDD  173

Query  610  SNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            SNT+A  LAE + +     +V+G P T++GDLKN+ +ET+ GFDT CK
Sbjct  174  SNTNACVLAEYYKQKNAGVQVIGCPKTIDGDLKNEMIETSFGFDTACK  221



>ref|WP_022102965.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
sp. CAG:5226]
 emb|CDA44849.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
sp. CAG:5226]
Length=546

 Score =   152 bits (384),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 95/230 (41%), Positives = 136/230 (59%), Gaps = 10/230 (4%)
 Frame = +1

Query  64   ELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFL  243
            E S LQ  R+ Y+P+LP  L+G  V ++ G+ T +        I +LFP+T+G PL  F+
Sbjct  2    EKSALQIARAAYQPKLPAGLRGN-VSIKEGEPTQSVGDQ--EEIKKLFPNTYGMPLVEFV  58

Query  244  RASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggse  423
              + K        E+  + +GI+  G Q+PGGHN I GLYD LK  NP + L GFL G  
Sbjct  59   PTNEK-------KEYAPMNIGIILSGGQAPGGHNVICGLYDELKKQNPANKLYGFLMGPG  111

Query  424  glfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVIVGG  603
            GL   K +E+TD I+  Y+N GG+DM+G  + ++   +Q  + L     L +  +VI+GG
Sbjct  112  GLVDHKYIELTDAIIDDYRNTGGFDMIGSGRTKLEEEDQFESGLKIIRELGIKAVVIIGG  171

Query  604  VTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
              SNT+A  LAE +A   C  +V+G P T++GDLKN  +ET+ GFDT CK
Sbjct  172  DDSNTNACVLAEYYAAHNCGVQVIGCPKTIDGDLKNDQIETSFGFDTACK  221



>ref|WP_036877364.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
oryzae]
Length=546

 Score =   152 bits (383),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 99/230 (43%), Positives = 137/230 (60%), Gaps = 11/230 (5%)
 Frame = +1

Query  64   ELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFL  243
            E S LQK R+ Y+P+LP  LQG  V+V+ G  T + D      I +LFP+T+G PL  F 
Sbjct  2    EKSALQKARAAYQPKLPKALQGA-VKVKEGAPTKSVDNQ--EEIKKLFPNTYGMPLVEF-  57

Query  244  RASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggse  423
                 VP  +  T   A+ VG++  G Q+PGGHN I GL+D +K  N N+ L GFL G  
Sbjct  58   -----VPGEE--TAQKAMNVGVILSGGQAPGGHNVISGLFDEIKKLNSNNRLFGFLMGPG  110

Query  424  glfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVIVGG  603
            GL   K +EIT+D LA Y+N GG+D++G  + ++   EQ    L     L +  ++I+GG
Sbjct  111  GLVDHKYVEITEDFLADYRNTGGFDIIGSGRTKLEKEEQFEKGLQIIRELDIKAIIIIGG  170

Query  604  VTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
              SNT+A  LAE +A  K   +V+G P T++GDLKN  +ET+ GFDT  K
Sbjct  171  DDSNTNACVLAEYYAAKKYGVQVIGCPKTIDGDLKNTQIETSFGFDTATK  220



>ref|XP_002986153.1| hypothetical protein SELMODRAFT_234963 [Selaginella moellendorffii]
 gb|EFJ12684.1| hypothetical protein SELMODRAFT_234963 [Selaginella moellendorffii]
Length=560

 Score =   152 bits (384),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 97/228 (43%), Positives = 135/228 (59%), Gaps = 8/228 (4%)
 Frame = +1

Query  70   SDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFLRA  249
            S +Q  R  Y+P +P  L+G   +VE G +T+A   +G   I++LFP  FGQP  H +  
Sbjct  22   SPVQSSRLDYKPPMPSVLEGH-FKVEHGSSTSAVGDAG--AIAQLFPKLFGQPSVHIVPC  78

Query  250  SAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggsegl  429
            +A         E   +R+G+V  G Q+PGGHN I GL+D L+ H P S LLGF GG  G+
Sbjct  79   AAAA-----FKEEVKLRIGVVLSGGQAPGGHNVIAGLFDYLQKHAPGSLLLGFRGGPAGI  133

Query  430  fAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVIVGGVT  609
               K +EIT + L  Y+NQGG+D++   +D+I + EQ   A      L LDG+V++GG  
Sbjct  134  MRCKYVEITSEFLYPYRNQGGFDIICSGRDKIETPEQFKQAEDTAVKLDLDGIVVIGGDD  193

Query  610  SNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            SNT+A  LAE F      T V+G P T++GDLK++ V  + GFDT CK
Sbjct  194  SNTNACLLAEYFRARNLKTHVIGCPKTIDGDLKSKEVPISFGFDTACK  241



>ref|WP_006798230.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Dysgonomonas 
gadei]
 gb|EGK03145.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Dysgonomonas 
gadei ATCC BAA-286]
Length=548

 Score =   152 bits (383),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 93/228 (41%), Positives = 135/228 (59%), Gaps = 10/228 (4%)
 Frame = +1

Query  70   SDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFLRA  249
            S LQ  R+ Y+P++P  L G+ V++E G AT +   +    + +LFP+T+G P   F+ A
Sbjct  4    SALQVARAAYKPKMPKALYGS-VKIEEGAATQSV--ADQEEVKKLFPNTYGMPTLKFVEA  60

Query  250  SAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggsegl  429
            S K         +PAI VG++  G Q+PGGHN I GL+D +K  N  S L GFL G  GL
Sbjct  61   SEK-------ANYPAINVGVILSGGQAPGGHNVIAGLFDGIKNLNSGSRLYGFLMGPGGL  113

Query  430  fAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVIVGGVT  609
                  E+T +I+  Y+N GG+D++G  + ++ S EQ +  L     L +  LVI+GG  
Sbjct  114  VDHDYKELTGEIIDEYRNTGGFDIIGSGRTKLESKEQFDKGLEILKKLDIKALVIIGGDD  173

Query  610  SNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            SNT+A  LAE +       +V+G P T++GDLKN+ +ET+ GFDT CK
Sbjct  174  SNTNACVLAEYYKAINAGVQVIGCPKTIDGDLKNEMIETSFGFDTACK  221



>ref|WP_008158638.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Parabacteroides 
johnsonii]
 gb|EKN05702.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Parabacteroides 
johnsonii CL02T12C29]
Length=548

 Score =   152 bits (383),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 91/228 (40%), Positives = 135/228 (59%), Gaps = 10/228 (4%)
 Frame = +1

Query  70   SDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFLRA  249
            S LQ  R+ Y+P++P  L+G    V+     + AD      I +LFP+T+G P+  F ++
Sbjct  4    SALQIARAAYQPKVPAALKGAVKAVDGEYTESVADQ---EDIKKLFPNTYGMPVVTFEKS  60

Query  250  SAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggsegl  429
            + K        E PA+ VG++  G Q+PGGHN I GL+D +K +N  S L GF+ G  GL
Sbjct  61   NEK-------KELPAMNVGVILSGGQAPGGHNVIAGLFDGIKANNAASRLYGFILGPGGL  113

Query  430  fAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVIVGGVT  609
               K +E+T DI+  Y+N GG+DM+G  + ++ + EQ +  L     L +  LVI+GG  
Sbjct  114  IDHKYMELTADIIDEYRNTGGFDMIGSGRTKLETKEQFDKGLEILKELDIKALVIIGGDD  173

Query  610  SNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            SNT+A  LAE +       +V+G P T++GDLKN+ +ET+ GFDT CK
Sbjct  174  SNTNACVLAEYYKAINAGVQVIGCPKTIDGDLKNEQIETSFGFDTACK  221



>ref|WP_039420029.1| MULTISPECIES: diphosphate--fructose-6-phosphate 1-phosphotransferase 
[Porphyromonas]
 gb|KGL55500.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Porphyromonas 
sp. COT-052 OH4946]
 gb|KGN67618.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Porphyromonas 
gulae]
 gb|KGN75569.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Porphyromonas 
gulae]
 gb|KGN87751.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Porphyromonas 
gulae]
 gb|KGN92373.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Porphyromonas 
gulae]
 gb|KGO02288.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Porphyromonas 
gulae]
Length=549

 Score =   152 bits (383),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 96/228 (42%), Positives = 134/228 (59%), Gaps = 10/228 (4%)
 Frame = +1

Query  70   SDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFLRA  249
            S L   R  YRP++P  LQG    +E G+AT A   S    I+ +FPHT+G PL  F   
Sbjct  4    SALHLARMSYRPKMPASLQGAVKIIE-GEATEAV--SDKEEIAAIFPHTYGLPLISFASG  60

Query  250  SAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggsegl  429
              +       TE+P   VG++  G Q+PGGHN I GL+D +K+ NP+S L GFL G +GL
Sbjct  61   GER-------TEYPPTNVGVILSGGQAPGGHNVIAGLFDEMKLLNPDSRLFGFLMGPDGL  113

Query  430  fAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVIVGGVT  609
               K  E+T +++  Y+N GG+DM+G  + ++   EQ  A L     L +  LVI+GG  
Sbjct  114  IEHKYRELTAEVIDEYRNTGGFDMIGSGRTKLDKPEQFEAGLEILRELDIKALVIIGGDD  173

Query  610  SNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            SNT+A  LAE +A      +V+G P T++GDLKN+ +ET+ GFDT  K
Sbjct  174  SNTNACILAEYYASIDAGIQVIGCPKTIDGDLKNKQIETSFGFDTAAK  221



>ref|WP_039419596.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Porphyromonas 
gulae]
 gb|KGL47250.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Porphyromonas 
gulae]
 gb|KGN72678.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Porphyromonas 
gulae]
 gb|KGO04092.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Porphyromonas 
gulae]
Length=549

 Score =   152 bits (383),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 96/228 (42%), Positives = 134/228 (59%), Gaps = 10/228 (4%)
 Frame = +1

Query  70   SDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFLRA  249
            S L   R  YRP++P  LQG    +E G+AT A   S    I+ +FPHT+G PL  F   
Sbjct  4    SALHLARMSYRPKMPASLQGAVKIIE-GEATEAV--SDKEEIAAIFPHTYGLPLISFASG  60

Query  250  SAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggsegl  429
              +       TE+P   VG++  G Q+PGGHN I GL+D +K+ NP+S L GFL G +GL
Sbjct  61   GER-------TEYPPTNVGVILSGGQAPGGHNVIAGLFDEMKLLNPDSRLFGFLMGPDGL  113

Query  430  fAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVIVGGVT  609
               K  E+T +++  Y+N GG+DM+G  + ++   EQ  A L     L +  LVI+GG  
Sbjct  114  IEHKYRELTAEVIDEYRNTGGFDMIGSGRTKLDKPEQFEAGLEILRELDIKALVIIGGDD  173

Query  610  SNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            SNT+A  LAE +A      +V+G P T++GDLKN+ +ET+ GFDT  K
Sbjct  174  SNTNACILAEYYASIDAGIQVIGCPKTIDGDLKNKQIETSFGFDTAAK  221



>ref|WP_009235627.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
sp. oral taxon 472]
 gb|EEX52180.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
sp. oral taxon 472 str. F0295]
Length=546

 Score =   152 bits (383),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 98/230 (43%), Positives = 137/230 (60%), Gaps = 11/230 (5%)
 Frame = +1

Query  64   ELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFL  243
            E S LQK R+ Y+P+LP  LQG  V+V  G  T + D      I +LFP+T+G PL  F+
Sbjct  2    EKSALQKARASYQPKLPKALQGA-VKVSEGAPTQSVDNQ--DEIKKLFPNTYGMPLVEFV  58

Query  244  RASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggse  423
            +   ++P  +I        VGI+  G Q+PGGHN I GL+D +K  NPN+ L GFL G  
Sbjct  59   QGD-EMPSKEI-------NVGIILSGGQAPGGHNVISGLFDEVKRLNPNNRLYGFLMGPG  110

Query  424  glfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVIVGG  603
            GL     +EIT D +  Y+N GG+DM+G  + ++ +TEQ    L     L +  +VI+GG
Sbjct  111  GLVDHDYIEITADFVEEYRNTGGFDMIGSGRTKLETTEQFEKGLEIIRELNIKAIVIIGG  170

Query  604  VTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
              SNT+A  LAE +A      +V+G P T++GDLKN+ +ET+ GFDT  K
Sbjct  171  DDSNTNACVLAEYYAAKNYGVQVIGCPKTIDGDLKNEQIETSFGFDTATK  220



>ref|WP_032945214.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
vulgatus]
 gb|KDS32096.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
vulgatus str. 3775 SL(B) 10 (iv)]
Length=547

 Score =   152 bits (383),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 93/228 (41%), Positives = 134/228 (59%), Gaps = 11/228 (5%)
 Frame = +1

Query  70   SDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFLRA  249
            S LQ  R+ Y+P+LP  L+G  V+V+ G+ T +   +    I  LFP+T+G PL  F+  
Sbjct  4    SALQIARAAYQPKLPKALKGA-VKVKEGEPTQSV--ADQEAIKALFPNTYGMPLIQFVEG  60

Query  250  SAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggsegl  429
             A           PAI VG++  G Q+PGGHN I GL+D +K  N +S L GF+ G  GL
Sbjct  61   EA--------VNMPAINVGVILSGGQAPGGHNVISGLFDGIKALNKDSKLYGFILGPGGL  112

Query  430  fAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVIVGGVT  609
                 +E+T DI+  Y+N GG+D++G  + ++   EQ +  L     L +  LVI+GG  
Sbjct  113  VDHNYMELTSDIIDEYRNTGGFDIIGSGRTKLEKVEQFDKGLEIIKELGIKALVIIGGDD  172

Query  610  SNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            SNT+A  LAE +A   C  +V+G P T++GDLKN+ +ET+ GFDT  K
Sbjct  173  SNTNACVLAEYYAAKNCGVQVIGCPKTIDGDLKNEMIETSFGFDTAFK  220



>ref|WP_025278280.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Barnesiella 
viscericola]
 gb|AHF12352.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Barnesiella 
viscericola DSM 18177]
Length=550

 Score =   151 bits (382),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 92/228 (40%), Positives = 135/228 (59%), Gaps = 11/228 (5%)
 Frame = +1

Query  70   SDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFLRA  249
            S LQ  R+ Y+P+LP  ++     VE     + AD      I++LFP+T+G P+  F  A
Sbjct  4    SALQTARASYQPKLPEAIKNGVTIVEGKATQSVADQ---EAIAKLFPNTYGMPVLRFEAA  60

Query  250  SAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggsegl  429
              K        E+PAI VG++  G Q+PGGHN I GL+D LK  N +S L GFL G  GL
Sbjct  61   PKK--------EYPAINVGVILSGGQAPGGHNVISGLFDGLKAMNKDSRLFGFLLGPGGL  112

Query  430  fAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVIVGGVT  609
               K +E+T DI+  Y+N GG+D++G  + ++ + EQ ++ L     L +  +VI+GG  
Sbjct  113  IDHKYMELTADIIDDYRNTGGFDIIGSGRTKLETKEQFDSGLEIIKELGIKAVVIIGGDD  172

Query  610  SNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            SNT+A  LAE + +     +V+G P T++GDLKN+ +E + GFDT CK
Sbjct  173  SNTNACVLAEYYKQIGAGVQVIGCPKTIDGDLKNEMIECSFGFDTACK  220



>ref|WP_008861193.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Barnesiella 
intestinihominis]
 gb|EJZ66519.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Barnesiella 
intestinihominis YIT 11860]
Length=549

 Score =   151 bits (382),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 91/228 (40%), Positives = 136/228 (60%), Gaps = 11/228 (5%)
 Frame = +1

Query  70   SDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFLRA  249
            S LQ  R+ Y+P+LP  ++     VE     + AD      I++LFP+T+G P+  F  A
Sbjct  4    SALQTARASYQPKLPEAIKNGVTIVEGKATQSVADQ---EAIAKLFPNTYGMPVLRFEAA  60

Query  250  SAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggsegl  429
            + K        E+PAI VG++  G Q+PGGHN I GL+D LK  N  S L GFL G  GL
Sbjct  61   AKK--------EYPAINVGVILSGGQAPGGHNVISGLFDGLKALNKESRLFGFLLGPGGL  112

Query  430  fAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVIVGGVT  609
               K +E+T DI+  Y+N GG+D++G  + ++ + +Q ++ L     L +  +VI+GG  
Sbjct  113  IEHKYMELTADIIDDYRNTGGFDIIGSGRTKLETKDQFDSGLEIIKELGIKAVVIIGGDD  172

Query  610  SNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            SNT+A  LAE + +     +V+G P T++GDLKN+ +E++ GFDT CK
Sbjct  173  SNTNACVLAEYYKQIGAGVQVIGCPKTIDGDLKNEMIESSFGFDTACK  220



>ref|WP_028727537.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Parabacteroides 
gordonii]
Length=548

 Score =   151 bits (382),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 91/228 (40%), Positives = 134/228 (59%), Gaps = 10/228 (4%)
 Frame = +1

Query  70   SDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFLRA  249
            S LQ  R+ Y+P++P  L+G    V+     + AD      I  LFP+T+G P+  F ++
Sbjct  4    SALQIARAAYQPKVPAALKGAVKAVDGEYTQSVADQ---EEIKELFPNTYGMPIVTFEKS  60

Query  250  SAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggsegl  429
            S K        + PAI VG++  G Q+PGGHN I G++D +K  N +S L GF+ G  GL
Sbjct  61   SEK-------KDMPAINVGVILSGGQAPGGHNVIAGIFDGVKATNKDSRLYGFILGPGGL  113

Query  430  fAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVIVGGVT  609
               K +E+T DI+  Y+N GG+DM+G  + ++ + EQ +  L     L +  LVI+GG  
Sbjct  114  IDHKYMELTADIIDEYRNTGGFDMIGSGRTKLETKEQFDKGLEILKELDIKALVIIGGDD  173

Query  610  SNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            SNT+A  LAE +       +V+G P T++GDLKN+ +ET+ GFDT CK
Sbjct  174  SNTNACVLAEYYKAINAGVQVIGCPKTIDGDLKNEQIETSFGFDTACK  221



>ref|WP_021892263.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Bacteroides 
sp. CAG:20]
 emb|CCX94843.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Bacteroides 
sp. CAG:20]
Length=549

 Score =   151 bits (382),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 91/228 (40%), Positives = 136/228 (60%), Gaps = 11/228 (5%)
 Frame = +1

Query  70   SDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFLRA  249
            S LQ  R+ Y+P+LP  ++     VE     + AD      I++LFP+T+G P+  F  A
Sbjct  4    SALQTARASYQPKLPEAIKNGVTIVEGKATQSVADQ---EAIAKLFPNTYGMPVLRFEAA  60

Query  250  SAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggsegl  429
            + K        E+PAI VG++  G Q+PGGHN I GL+D LK  N  S L GFL G  GL
Sbjct  61   AKK--------EYPAINVGVILSGGQAPGGHNVISGLFDGLKALNKESRLFGFLLGPGGL  112

Query  430  fAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVIVGGVT  609
               K +E+T DI+  Y+N GG+D++G  + ++ + +Q ++ L     L +  +VI+GG  
Sbjct  113  IEHKYMELTADIIDDYRNTGGFDIIGSGRTKLETKDQFDSGLEIIKELGIKAVVIIGGDD  172

Query  610  SNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            SNT+A  LAE + +     +V+G P T++GDLKN+ +E++ GFDT CK
Sbjct  173  SNTNACVLAEYYKQIGAGVQVIGCPKTIDGDLKNEMIESSFGFDTACK  220



>ref|WP_036897542.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
sp. S7 MS 2]
 gb|KGI60529.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
sp. S7 MS 2]
Length=546

 Score =   151 bits (382),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 97/230 (42%), Positives = 135/230 (59%), Gaps = 11/230 (5%)
 Frame = +1

Query  64   ELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFL  243
            E+S LQK R+ Y+P+LP  LQG  V+++ G+ T + D      I +LFP+T+G PL  F+
Sbjct  2    EISALQKERAGYQPKLPKALQGA-VKIKEGEPTQSVDNQ--EEIKKLFPNTYGMPLVEFI  58

Query  244  RASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggse  423
                K            + VGI+  G Q+PGGHN I GL+DA+K  NPN+ L GFL G  
Sbjct  59   PGDEK--------NSLEMNVGIILSGGQAPGGHNVISGLFDAVKNLNPNNRLYGFLMGPG  110

Query  424  glfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVIVGG  603
            GL     +EIT + L  Y+N GG+DM+G  + ++   EQ    L     L +  +VI+GG
Sbjct  111  GLVDHNYIEITPEFLDEYRNTGGFDMIGSGRTKLEKEEQFEKGLEIIRELNIKAIVIIGG  170

Query  604  VTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
              SNT+A  LAE +A  K   +V+G P T++GDLKN  +ET+ GFDT  K
Sbjct  171  DDSNTNACVLAEYYAAKKYGVQVIGCPKTIDGDLKNDQIETSFGFDTATK  220



>gb|EDS15317.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
stercoris ATCC 43183]
Length=571

 Score =   152 bits (383),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 95/237 (40%), Positives = 134/237 (57%), Gaps = 12/237 (5%)
 Frame = +1

Query  49   FGLAREL--SDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFG  222
            F   RE+  S LQ  R+ Y+P+LP  L GT   V      + AD      I +LFP+T+G
Sbjct  18   FKYLREMTKSALQIARAAYQPKLPKGLTGTVKAVAGAATQSVADQ---EEIKKLFPNTYG  74

Query  223  QPLAHFLRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTll  402
             PL  F      V       + PA+ VG++  G Q+PGGHN I G++D +K  N +S L 
Sbjct  75   MPLIKFENTDETV-------DFPAMNVGVILSGGQAPGGHNVISGIFDGIKKLNKDSKLY  127

Query  403  gflggseglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLD  582
            GF+ G  GL     +E+T DI+  Y+N GG+D++G  + ++   EQ    L     L + 
Sbjct  128  GFILGPGGLVDHNYMELTADIIDEYRNTGGFDIIGSGRTKLEKEEQFEKGLEILKELNIK  187

Query  583  GLVIVGGVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
             LVI+GG  SNT+A  LAE +A   C  +V+G P T++GDLKN+ +ET+ GFDT CK
Sbjct  188  ALVIIGGDDSNTNACVLAEYYAAKNCGVQVIGCPKTIDGDLKNEMIETSFGFDTACK  244



>ref|WP_022130193.1| hypothetical protein [Bacteroides sp. CAG:530]
 emb|CDA74844.1| putative uncharacterized protein [Bacteroides sp. CAG:530]
Length=547

 Score =   151 bits (382),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 95/228 (42%), Positives = 134/228 (59%), Gaps = 11/228 (5%)
 Frame = +1

Query  70   SDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFLRA  249
            S LQ  R+ Y+P+LP  LQG  V+V+ G+ T +   +    I  LFP+T+G PL  F+  
Sbjct  4    SALQIARAAYQPKLPKALQGA-VKVQEGEPTQSV--ADQEAIKELFPNTYGMPLIKFVEG  60

Query  250  SAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggsegl  429
             AK  DA        + VG++  G Q+PGGHN I GL+D +K  NP + L GFL G  GL
Sbjct  61   EAKNFDA--------MNVGVILSGGQAPGGHNVISGLFDGIKKLNPANKLYGFLMGPGGL  112

Query  430  fAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVIVGGVT  609
                 +E+T DI+  Y+N GG+DM+G  + ++ + EQ          L +  LVI+GG  
Sbjct  113  VDHNYMELTADIIDEYRNTGGFDMIGSGRTKLETVEQFEKGYEILKELGIKALVIIGGDD  172

Query  610  SNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            SNT+A  LAE +A      +V+G P T++GDLKN+ +ET+ GFDT CK
Sbjct  173  SNTNACVLAEYYAAKNYGVQVIGCPKTIDGDLKNEMIETSFGFDTACK  220



>ref|WP_039426896.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Porphyromonas 
gulae]
 gb|KGN83538.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Porphyromonas 
gulae]
Length=549

 Score =   151 bits (382),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 96/228 (42%), Positives = 134/228 (59%), Gaps = 10/228 (4%)
 Frame = +1

Query  70   SDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFLRA  249
            S L   R  YRP++P  LQG    +E G+AT A   S    I+ +FPHT+G PL  F   
Sbjct  4    SALHLARMSYRPKMPASLQGAVKIIE-GEATEAV--SDKEEIAAIFPHTYGLPLISFASG  60

Query  250  SAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggsegl  429
              +       TE+P   VG++  G Q+PGGHN I GL+D +K+ NP+S L GFL G +GL
Sbjct  61   GER-------TEYPPTNVGVILSGGQAPGGHNVIAGLFDEMKLLNPDSRLFGFLMGPDGL  113

Query  430  fAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVIVGGVT  609
               K  E+T +++  Y+N GG+DM+G  + ++   EQ  A L     L +  LVI+GG  
Sbjct  114  IEHKYRELTAEVIDEYRNTGGFDMIGSGRTKLDKPEQFEAGLEILRELDIKALVIIGGDD  173

Query  610  SNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            SNT+A  LAE +A      +V+G P T++GDLKN+ +ET+ GFDT  K
Sbjct  174  SNTNACILAEYYASIDTGIQVIGCPKTIDGDLKNKQIETSFGFDTAAK  221



>ref|WP_009317720.1| MULTISPECIES: diphosphate--fructose-6-phosphate 1-phosphotransferase 
[Porphyromonadaceae]
 gb|EHL86687.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Tannerella 
sp. 6_1_58FAA_CT1]
 emb|CDD89335.1| diphosphate-fructose-6-phosphate 1-phosphotransferase [Tannerella 
sp. CAG:51]
 gb|ERM88959.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Coprobacter 
fastidiosus NSB1]
Length=547

 Score =   151 bits (382),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 90/228 (39%), Positives = 136/228 (60%), Gaps = 10/228 (4%)
 Frame = +1

Query  70   SDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFLRA  249
            S LQ  R+ Y+P+LP  L+G+    E     + AD      I++LFP+T+G P+  F+ +
Sbjct  4    SALQIARAAYQPKLPKALKGSLKIQEGAPTQSVADQDA---IAKLFPNTYGMPVLSFIES  60

Query  250  SAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggsegl  429
            +        +  +PAI  G++  G Q+PGGHN I GL+D LK  N +S L GFL G  GL
Sbjct  61   NE-------VKNYPAINAGVILSGGQAPGGHNVIAGLFDGLKALNKDSRLYGFLLGPGGL  113

Query  430  fAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVIVGGVT  609
               K +E+T DI+  Y+N GG+D++G  + ++ + +Q +  L     L +  LVI+GG  
Sbjct  114  VDHKYIELTQDIIDEYRNTGGFDIIGSGRTKLETEDQFDKGLQIIKELNIKALVIIGGDD  173

Query  610  SNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            SNT+A  LAE + +     +V+G P T++GDLKN+ +ET+ GFDT CK
Sbjct  174  SNTNACVLAEYYKKNNTGVQVIGCPKTIDGDLKNEMIETSFGFDTACK  221



>ref|WP_013924907.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Parachlamydia 
acanthamoebae]
 emb|CCB86320.1| pyrophosphate--fructose 6-phosphate 1-phosphotransferase subunit 
beta [Parachlamydia acanthamoebae UV-7]
Length=564

 Score =   151 bits (382),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 99/228 (43%), Positives = 134/228 (59%), Gaps = 9/228 (4%)
 Frame = +1

Query  70   SDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFLRA  249
            S LQK R  Y P LP  L+  T  V   +A    +      + +LF  T  Q L  F+  
Sbjct  5    SSLQKRRLAYLPRLPEILRSLTRLVPLFEAENHEN-ELPLPVVQLFSKTIDQQLLRFVEG  63

Query  250  SAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggsegl  429
              K         H  + VG+VF G Q+ GGHN I GL+DALK+ NP S + GFL G  G+
Sbjct  64   ENKT--------HRPLNVGVVFSGGQASGGHNVISGLFDALKLLNPESKVFGFLNGPAGI  115

Query  430  fAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVIVGGVT  609
               +++EIT +IL  ++N GG+D++G  + +I S +Q  AAL A   L LDGL+I+GG  
Sbjct  116  INNQSMEITAEILKNFRNLGGFDLIGSGRTKIESPDQFQAALKAVQGLHLDGLLIIGGDD  175

Query  610  SNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            SNT+AA+LAE F    C T VVG+P T++GDLKN+ +E + GFDT CK
Sbjct  176  SNTNAAFLAEYFLAKGCKTCVVGIPKTIDGDLKNESIEVSFGFDTACK  223



>ref|WP_036613717.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Parabacteroides 
distasonis]
 gb|KDS49395.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Parabacteroides 
distasonis str. 3776 Po2 i]
Length=547

 Score =   151 bits (382),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 90/228 (39%), Positives = 134/228 (59%), Gaps = 10/228 (4%)
 Frame = +1

Query  70   SDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFLRA  249
            S LQ  R+ Y+P++P  L+G    V+     + AD      I +LFP+T+G P+  F ++
Sbjct  4    SALQIARAAYQPKVPAALKGAVKAVDGEYTQSVADQ---EEIKKLFPNTYGMPIVTFEKS  60

Query  250  SAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggsegl  429
            + +          P + VG++  G Q+PGGHN I GL+D +K HN +S L GF+ G  GL
Sbjct  61   NEE-------KAMPVMNVGVILSGGQAPGGHNVIAGLFDGIKAHNADSRLYGFILGPGGL  113

Query  430  fAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVIVGGVT  609
               K +E+T DI+  Y+N GG+DM+G  + ++ +TEQ +  L     L +  LVI+GG  
Sbjct  114  IDHKYMELTADIIDEYRNTGGFDMIGSGRTKLETTEQFDKGLQILKELDIKALVIIGGDD  173

Query  610  SNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            SNT+A  LAE +       +V+G P T++GDLKN  +ET+ GFDT CK
Sbjct  174  SNTNACVLAEYYKAIGAGVQVIGCPKTIDGDLKNAQIETSFGFDTACK  221



>ref|WP_026292223.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Porphyromonas 
gulae]
 gb|KGN77932.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Porphyromonas 
gulae]
Length=549

 Score =   151 bits (382),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 95/228 (42%), Positives = 134/228 (59%), Gaps = 10/228 (4%)
 Frame = +1

Query  70   SDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFLRA  249
            S L   R  YRP++P  LQG    +E G+AT A   S    I+ +FPHT+G PL  F   
Sbjct  4    SALHLARMSYRPKMPASLQGAVKIIE-GEATEAV--SDKEEIAAIFPHTYGLPLISFASG  60

Query  250  SAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggsegl  429
              +       TE+P   VG++  G Q+PGGHN I GL+D +K+ NP+S L GFL G +GL
Sbjct  61   GER-------TEYPPTNVGVILSGGQAPGGHNVIAGLFDEMKLLNPDSRLFGFLMGPDGL  113

Query  430  fAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVIVGGVT  609
               K  E+T +++  Y+N GG+DM+G  + ++   EQ  A L     L +  L+I+GG  
Sbjct  114  IEHKYRELTAEVIDEYRNTGGFDMIGSGRTKLDKPEQFEAGLEILRELDIKALIIIGGDD  173

Query  610  SNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            SNT+A  LAE +A      +V+G P T++GDLKN+ +ET+ GFDT  K
Sbjct  174  SNTNACILAEYYASIDAGIQVIGCPKTIDGDLKNKQIETSFGFDTAAK  221



>ref|WP_036650726.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Parabacteroides 
distasonis]
 gb|KDS37338.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Parabacteroides 
distasonis str. 3776 D15 i]
 gb|KDS73592.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Parabacteroides 
distasonis str. 3776 D15 iv]
Length=547

 Score =   151 bits (382),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 90/228 (39%), Positives = 134/228 (59%), Gaps = 10/228 (4%)
 Frame = +1

Query  70   SDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFLRA  249
            S LQ  R+ Y+P++P  L+G    V+     + AD      I +LFP+T+G P+  F ++
Sbjct  4    SALQIARAAYQPKVPAALKGAVKAVDGEYTQSVADQ---EEIKKLFPNTYGMPIVTFEKS  60

Query  250  SAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggsegl  429
            + +          P + VG++  G Q+PGGHN I GL+D +K HN +S L GF+ G  GL
Sbjct  61   NEE-------KAMPVMNVGVILSGGQAPGGHNVIAGLFDGIKAHNADSRLYGFILGPGGL  113

Query  430  fAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVIVGGVT  609
               K +E+T DI+  Y+N GG+DM+G  + ++ +TEQ +  L     L +  LVI+GG  
Sbjct  114  IDHKYMELTADIIDEYRNTGGFDMIGSGRTKLETTEQFDKGLQILKELDIKALVIIGGDD  173

Query  610  SNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            SNT+A  LAE +       +V+G P T++GDLKN  +ET+ GFDT CK
Sbjct  174  SNTNACVLAEYYKAIGAGVQVIGCPKTIDGDLKNAQIETSFGFDTACK  221



>ref|WP_025881004.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
baroniae]
Length=548

 Score =   151 bits (382),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 96/231 (42%), Positives = 137/231 (59%), Gaps = 11/231 (5%)
 Frame = +1

Query  61   RELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHF  240
            +E+S LQK R+ Y+P+LP  L G  V+V+ G+ T +   +    I  LFP+T+G PL  F
Sbjct  2    KEISALQKERAAYQPKLPKALMGA-VKVKEGEPTQSV--ANQQEIKELFPNTYGMPLVEF  58

Query  241  LRASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggs  420
            +    K  +A++        VG++  G Q+PGGHN I GL+DA+K  NPN+ L GFL G 
Sbjct  59   VSGD-KANEAEM-------NVGVILSGGQAPGGHNVISGLFDAVKKLNPNNRLFGFLMGP  110

Query  421  eglfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVIVG  600
             GL     +EIT D +  Y+N GG+DM+G  + ++   EQ    L     L +  +VI+G
Sbjct  111  GGLVDHNYVEITSDFIDQYRNTGGFDMIGSGRTKLEKEEQFEKGLVILRELNIKAVVIIG  170

Query  601  GVTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            G  SNT+A  LAE +A      +V+G P T++GDLKN  +ET+ GFDT CK
Sbjct  171  GDDSNTNACVLAEYYAAKNYGVQVIGCPKTIDGDLKNDQIETSFGFDTACK  221



>ref|WP_018966518.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
loescheii]
 gb|KDR53753.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Prevotella 
loescheii DSM 19665 = JCM 12249 = ATCC 15930]
Length=546

 Score =   151 bits (381),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 98/230 (43%), Positives = 137/230 (60%), Gaps = 11/230 (5%)
 Frame = +1

Query  64   ELSDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFL  243
            E S LQK R+ Y+P+LP  LQG  V+V  G  T + D      I +LFP+T+G PL  F+
Sbjct  2    EKSALQKARASYQPKLPKALQGA-VKVSEGAHTQSVDNQ--DEIKKLFPNTYGMPLVEFV  58

Query  244  RASAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggse  423
            +   ++P  +I        VGI+  G Q+PGGHN I GL+D +K  NPN+ L GFL G  
Sbjct  59   QGD-EMPSKEI-------NVGIILSGGQAPGGHNVISGLFDEVKRLNPNNRLYGFLMGPG  110

Query  424  glfAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVIVGG  603
            GL     +EIT D +  Y+N GG+DM+G  + ++ +TEQ    L     L +  +VI+GG
Sbjct  111  GLVDHDYIEITADFVEEYRNTGGFDMIGSGRTKLETTEQFENGLEIIRELNIKAIVIIGG  170

Query  604  VTSNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
              SNT+A  LAE +A      +V+G P T++GDLKN+ +ET+ GFDT  K
Sbjct  171  DDSNTNACVLAEYYAAKNYGVQVIGCPKTIDGDLKNEQIETSFGFDTATK  220



>ref|WP_008771783.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
sp. 2_1_33B]
 gb|EEY84374.1| diphosphate--fructose-6-phosphate 1-phosphotransferase [Bacteroides 
sp. 2_1_33B]
Length=547

 Score =   151 bits (381),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 90/228 (39%), Positives = 134/228 (59%), Gaps = 10/228 (4%)
 Frame = +1

Query  70   SDLQKLRSQYRPELPPCLQGTTVRVEFGDATTAADPSGGHTISRLFPHTFGQPLAHFLRA  249
            S LQ  R+ Y+P++P  L+G    V+     + AD      I +LFP+T+G P+  F ++
Sbjct  4    SALQIARAAYQPKVPAALKGAVKAVDGEYTQSVADQ---EEIKKLFPNTYGMPIVTFEKS  60

Query  250  SAKVPDAQIITEHPAIRVGIVFCGRQSPGGHNAIWGLYDALKVHNPNSTllgflggsegl  429
            + +          P + VG++  G Q+PGGHN I GL+D +K HN +S L GF+ G  GL
Sbjct  61   NEE-------KAMPVMNVGVILSGGQAPGGHNVIAGLFDGIKAHNADSRLYGFILGPGGL  113

Query  430  fAQKTLEITDDILATYKNQGGYDMLGRTKDQIRSTEQVNAALTACTSLKLDGLVIVGGVT  609
               K +E+T DI+  Y+N GG+DM+G  + ++ +TEQ +  L     L +  LVI+GG  
Sbjct  114  IDHKYMELTADIIDEYRNTGGFDMIGSGRTKLETTEQFDKGLQILKELDIKALVIIGGDD  173

Query  610  SNTDaaylaeafaeaKCPTKVVGVPVTLNGDLKNQFVETNVGFDTICK  753
            SNT+A  LAE +       +V+G P T++GDLKN  +ET+ GFDT CK
Sbjct  174  SNTNACVLAEYYKAIGAGVQVIGCPKTIDGDLKNAQIETSFGFDTACK  221



Lambda      K        H        a         alpha
   0.316    0.134    0.398    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1401010927050