BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF046J12

Length=736
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011091454.1|  PREDICTED: elongation factor 1-alpha-like          472   3e-163   Sesamum indicum [beniseed]
ref|XP_002279598.1|  PREDICTED: elongation factor 1-alpha               471   5e-163   Vitis vinifera
ref|XP_003536362.1|  PREDICTED: elongation factor 1-alpha-like is...    470   1e-162   Glycine max [soybeans]
ref|XP_009403341.1|  PREDICTED: elongation factor 1-alpha-like          470   1e-162   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010937512.1|  PREDICTED: elongation factor 1-alpha               470   2e-162   Elaeis guineensis
gb|KCW51623.1|  hypothetical protein EUGRSUZ_J01112                     465   2e-162   Eucalyptus grandis [rose gum]
ref|XP_002277159.1|  PREDICTED: elongation factor 1-alpha               470   2e-162   Vitis vinifera
ref|XP_011089340.1|  PREDICTED: elongation factor 1-alpha isoform X2    470   2e-162   
ref|XP_007009762.1|  GTP binding Elongation factor Tu family prot...    466   2e-162   
ref|XP_011089874.1|  PREDICTED: elongation factor 1-alpha               469   3e-162   Sesamum indicum [beniseed]
ref|XP_003604587.1|  Elongation factor 1-alpha                          469   4e-162   Medicago truncatula
gb|AFJ04514.1|  elongation factor 1-alpha                               468   4e-162   Vernicia fordii [tung oil tree]
ref|XP_010032224.1|  PREDICTED: elongation factor 1-alpha isoform X3    469   5e-162   
ref|XP_009403064.1|  PREDICTED: elongation factor 1-alpha-like          469   5e-162   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008792062.1|  PREDICTED: elongation factor 1-alpha               469   5e-162   Phoenix dactylifera
ref|XP_008790814.1|  PREDICTED: elongation factor 1-alpha-like          469   5e-162   Phoenix dactylifera
ref|XP_008789061.1|  PREDICTED: elongation factor 1-alpha-like          469   5e-162   Phoenix dactylifera
ref|XP_007009760.1|  GTP binding Elongation factor Tu family prot...    469   5e-162   Theobroma cacao [chocolate]
ref|XP_009342345.1|  PREDICTED: elongation factor 1-alpha-like          468   6e-162   Pyrus x bretschneideri [bai li]
ref|XP_008792073.1|  PREDICTED: elongation factor 1-alpha-like          468   6e-162   Phoenix dactylifera
ref|XP_010032221.1|  PREDICTED: elongation factor 1-alpha isoform X1    468   7e-162   Eucalyptus grandis [rose gum]
ref|XP_010937806.1|  PREDICTED: elongation factor 1-alpha-like          468   7e-162   Elaeis guineensis
ref|XP_008463920.1|  PREDICTED: elongation factor 1-alpha               468   7e-162   Cucumis melo [Oriental melon]
gb|EPS66069.1|  elongation factor 1-alpha                               468   7e-162   Genlisea aurea
ref|XP_009388387.1|  PREDICTED: elongation factor 1-alpha-like          468   8e-162   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010939624.1|  PREDICTED: elongation factor 1-alpha-like          468   9e-162   Elaeis guineensis
ref|XP_004251154.1|  PREDICTED: elongation factor 1-alpha-like          468   9e-162   Solanum lycopersicum
gb|ABF94275.1|  Elongation factor 1-alpha, putative, expressed          464   9e-162   Oryza sativa Japonica Group [Japonica rice]
gb|KHG28979.1|  Elongation factor 1-alpha                               468   9e-162   Gossypium arboreum [tree cotton]
ref|XP_006340223.1|  PREDICTED: elongation factor 1-alpha-like          468   9e-162   Solanum tuberosum [potatoes]
ref|XP_010535587.1|  PREDICTED: elongation factor 1-alpha               468   9e-162   Tarenaya hassleriana [spider flower]
ref|XP_009420035.1|  PREDICTED: elongation factor 1-alpha               468   9e-162   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004157309.1|  PREDICTED: elongation factor 1-alpha-like          468   9e-162   
gb|AAX54511.1|  elongation factor 1 alpha                               468   1e-161   Actinidia deliciosa [Chinese gooseberry]
ref|XP_010542598.1|  PREDICTED: elongation factor 1-alpha-like          468   1e-161   Tarenaya hassleriana [spider flower]
ref|XP_010043711.1|  PREDICTED: elongation factor 1-alpha               468   1e-161   Eucalyptus grandis [rose gum]
ref|XP_004149547.1|  PREDICTED: elongation factor 1-alpha-like          468   1e-161   Cucumis sativus [cucumbers]
ref|XP_008457229.1|  PREDICTED: elongation factor 1-alpha               468   1e-161   Cucumis melo [Oriental melon]
ref|XP_004138964.1|  PREDICTED: elongation factor 1-alpha-like          468   1e-161   Cucumis sativus [cucumbers]
ref|NP_001290506.1|  elongation factor 1-alpha                          468   1e-161   Elaeis guineensis
ref|XP_010916901.1|  PREDICTED: elongation factor 1-alpha               468   1e-161   Elaeis guineensis
ref|XP_010557310.1|  PREDICTED: elongation factor 1-alpha-like          468   1e-161   Tarenaya hassleriana [spider flower]
ref|XP_008783722.1|  PREDICTED: elongation factor 1-alpha isoform X1    468   1e-161   
gb|AGY80449.1|  elongation factor 1-alpha                               468   1e-161   Dendrocalamus latiflorus [sweet bamboo]
gb|ABA12220.1|  translation elongation factor 1A-4                      468   1e-161   Gossypium hirsutum [American cotton]
gb|ACG70967.1|  translation elongation factor 1                         459   1e-161   Ziziphus jujuba [Chinese jujube]
gb|KDP29086.1|  hypothetical protein JCGZ_16475                         468   1e-161   Jatropha curcas
ref|XP_011089339.1|  PREDICTED: elongation factor 1-alpha isoform X1    468   1e-161   Sesamum indicum [beniseed]
ref|XP_010521772.1|  PREDICTED: elongation factor 1-alpha-like          468   1e-161   Tarenaya hassleriana [spider flower]
ref|XP_010244958.1|  PREDICTED: elongation factor 1-alpha-like          468   1e-161   Nelumbo nucifera [Indian lotus]
ref|NP_001151074.1|  elongation factor 1-alpha                          468   1e-161   
ref|XP_002284964.1|  PREDICTED: elongation factor 1-alpha               468   2e-161   Vitis vinifera
dbj|BAA34348.1|  elongation factor-1 alpha                              468   2e-161   Nicotiana paniculata
ref|XP_009762748.1|  PREDICTED: elongation factor 1-alpha-like          468   2e-161   Nicotiana sylvestris
ref|XP_009613861.1|  PREDICTED: elongation factor 1-alpha-like          468   2e-161   Nicotiana tomentosiformis
ref|XP_002460859.1|  hypothetical protein SORBIDRAFT_02g036420          467   2e-161   Sorghum bicolor [broomcorn]
gb|AAY56337.1|  elongation factor-1 alpha                               467   2e-161   Musa acuminata [banana]
ref|XP_003604823.1|  Elongation factor 1-alpha                          467   2e-161   
sp|O49169.1|EF1A_MANES  RecName: Full=Elongation factor 1-alpha; ...    467   2e-161   Manihot esculenta [manioc]
ref|XP_002528028.1|  elongation factor 1-alpha, putative                467   2e-161   
ref|XP_010920912.1|  PREDICTED: elongation factor 1-alpha-like          467   2e-161   Elaeis guineensis
ref|XP_009381507.1|  PREDICTED: elongation factor 1-alpha-like          467   2e-161   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007009751.1|  GTP binding Elongation factor Tu family prot...    467   2e-161   Theobroma cacao [chocolate]
ref|XP_010521578.1|  PREDICTED: elongation factor 1-alpha               467   3e-161   Tarenaya hassleriana [spider flower]
dbj|BAO57272.1|  elongation factor 1-alpha                              467   3e-161   Ipomoea nil [qian niu]
gb|AES74993.2|  GTP-binding elongation factor Tu family protein         467   3e-161   Medicago truncatula
ref|XP_008233357.1|  PREDICTED: elongation factor 1-alpha-like          466   3e-161   Prunus mume [ume]
ref|XP_008224492.1|  PREDICTED: elongation factor 1-alpha               466   3e-161   Prunus mume [ume]
ref|XP_007151593.1|  hypothetical protein PHAVU_004G060000g             466   3e-161   Phaseolus vulgaris [French bean]
gb|AHA84124.1|  elongation factor 1-alpha                               466   4e-161   Phaseolus vulgaris [French bean]
gb|AFW87115.1|  putative translation elongation factor Tu family ...    459   4e-161   
ref|XP_009617039.1|  PREDICTED: elongation factor 1-alpha               466   4e-161   Nicotiana tomentosiformis
ref|XP_007207457.1|  hypothetical protein PRUPE_ppa005717mg             466   4e-161   Prunus persica
gb|EPS66340.1|  elongation factor 1-alpha                               466   4e-161   Genlisea aurea
gb|EEE58429.1|  hypothetical protein OsJ_09630                          466   4e-161   Oryza sativa Japonica Group [Japonica rice]
gb|AAD56019.1|AF181491_1  elongation factor-1 alpha 2                   466   5e-161   Lilium longiflorum [Easter lily]
ref|XP_009392715.1|  PREDICTED: elongation factor 1-alpha-like          466   5e-161   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHN14872.1|  Elongation factor 1-alpha                               466   5e-161   Glycine soja [wild soybean]
gb|ABA12219.1|  translation elongation factor 1A-3                      466   5e-161   Gossypium hirsutum [American cotton]
ref|XP_004163381.1|  PREDICTED: LOW QUALITY PROTEIN: elongation f...    466   5e-161   
ref|XP_003553292.1|  PREDICTED: elongation factor 1-alpha isoform 1     466   5e-161   Glycine max [soybeans]
ref|XP_010032223.1|  PREDICTED: elongation factor 1-alpha isoform X2    466   5e-161   Eucalyptus grandis [rose gum]
gb|KHG26926.1|  Elongation factor 1-alpha                               466   5e-161   Gossypium arboreum [tree cotton]
gb|KHG23927.1|  Elongation factor 1-alpha                               466   5e-161   Gossypium arboreum [tree cotton]
gb|AAD56020.1|AF181492_1  elongation factor-1 alpha 3                   466   5e-161   Lilium longiflorum [Easter lily]
ref|XP_009593325.1|  PREDICTED: elongation factor 1-alpha               466   6e-161   Nicotiana tomentosiformis
ref|XP_004307410.1|  PREDICTED: elongation factor 1-alpha               466   6e-161   Fragaria vesca subsp. vesca
ref|XP_010541344.1|  PREDICTED: elongation factor 1-alpha               466   6e-161   Tarenaya hassleriana [spider flower]
gb|ABA12223.1|  translation elongation factor 1A-7                      466   6e-161   Gossypium hirsutum [American cotton]
gb|ABA12221.1|  translation elongation factor 1A-5                      466   6e-161   Gossypium hirsutum [American cotton]
gb|ABA12225.1|  translation elongation factor 1A-9                      466   6e-161   Gossypium hirsutum [American cotton]
ref|XP_006846237.1|  hypothetical protein AMTR_s00012p00237190          466   6e-161   Amborella trichopoda
gb|AGH32502.1|  translation elongation factor-1 alpha                   466   6e-161   Stylosanthes guianensis [stylo]
ref|XP_010937804.1|  PREDICTED: elongation factor 1-alpha-like          466   6e-161   Elaeis guineensis
ref|XP_009421379.1|  PREDICTED: elongation factor 1-alpha-like          466   6e-161   
ref|XP_003547695.1|  PREDICTED: elongation factor 1-alpha isoform 2     466   6e-161   Glycine max [soybeans]
gb|ABA12217.1|  translation elongation factor 1A-1                      466   7e-161   Gossypium hirsutum [American cotton]
ref|NP_001049145.1|  Os03g0177400                                       466   7e-161   
gb|ABA12218.1|  translation elongation factor 1A-2                      466   8e-161   Gossypium hirsutum [American cotton]
ref|XP_009783256.1|  PREDICTED: elongation factor 1-alpha               466   8e-161   Nicotiana sylvestris
ref|XP_009342341.1|  PREDICTED: elongation factor 1-alpha               466   8e-161   Pyrus x bretschneideri [bai li]
gb|KHN42761.1|  Elongation factor 1-alpha                               466   8e-161   Glycine soja [wild soybean]
ref|XP_010067278.1|  PREDICTED: elongation factor 1-alpha-like          466   8e-161   Eucalyptus grandis [rose gum]
gb|KHG01531.1|  Elongation factor 1-alpha                               466   8e-161   Gossypium arboreum [tree cotton]
gb|EYU36203.1|  hypothetical protein MIMGU_mgv1a006301mg                466   8e-161   Erythranthe guttata [common monkey flower]
ref|XP_004512426.1|  PREDICTED: elongation factor 1-alpha-like          466   8e-161   Cicer arietinum [garbanzo]
gb|AAD27590.1|AF121261_1  elongation factor 1-alpha 1                   466   9e-161   Lilium longiflorum [Easter lily]
gb|KEH43536.1|  GTP-binding elongation factor Tu family protein         466   9e-161   Medicago truncatula
gb|AES62210.2|  GTP-binding elongation factor Tu family protein         466   9e-161   Medicago truncatula
gb|KJB09231.1|  hypothetical protein B456_001G130700                    465   9e-161   Gossypium raimondii
dbj|BAA23658.1|  EF-1 alpha                                             465   9e-161   Oryza sativa [red rice]
ref|XP_006646939.1|  PREDICTED: elongation factor 1-alpha-like          465   9e-161   Oryza brachyantha
gb|ADR70874.1|  eukaryotic translation elongation factor 1-alpha        466   9e-161   Hevea brasiliensis [jebe]
ref|XP_004489551.1|  PREDICTED: elongation factor 1-alpha-like          465   1e-160   Cicer arietinum [garbanzo]
gb|AEK98799.1|  translation elongation factor 1 alfa                    457   1e-160   Carthamus tinctorius
ref|NP_001077483.1|  elongation factor 1-alpha 2                        462   1e-160   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003558459.1|  PREDICTED: elongation factor 1-alpha               465   1e-160   Brachypodium distachyon [annual false brome]
gb|KCW65375.1|  hypothetical protein EUGRSUZ_G02807                     464   1e-160   Eucalyptus grandis [rose gum]
gb|AAC15413.1|  translation elongation factor-1 alpha                   465   1e-160   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007015466.1|  GTP binding Elongation factor Tu family prot...    465   1e-160   Theobroma cacao [chocolate]
ref|XP_007015463.1|  GTP binding Elongation factor Tu family protein    465   1e-160   
gb|AFW90638.1|  elongation factor 1-alpha-like protein                  460   1e-160   Solanum tuberosum [potatoes]
ref|XP_009793830.1|  PREDICTED: elongation factor 1-alpha-like          465   1e-160   Nicotiana sylvestris
gb|AGI15328.1|  elongation factor 1                                     465   1e-160   Aegiceras corniculatum
ref|XP_009380678.1|  PREDICTED: elongation factor 1-alpha-like          465   1e-160   
ref|XP_010669658.1|  PREDICTED: elongation factor 1-alpha-like          465   1e-160   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009126611.1|  PREDICTED: elongation factor 1-alpha 1-like        465   1e-160   Brassica rapa
ref|XP_009148045.1|  PREDICTED: elongation factor 1-alpha 1             465   1e-160   Brassica rapa
ref|XP_008349743.1|  PREDICTED: elongation factor 1-alpha isoform X2    463   1e-160   
ref|XP_007143679.1|  hypothetical protein PHAVU_007G092500g             465   1e-160   Phaseolus vulgaris [French bean]
ref|XP_007218005.1|  hypothetical protein PRUPE_ppa005706mg             465   1e-160   Prunus persica
ref|XP_006436251.1|  hypothetical protein CICLE_v10033471mg             465   1e-160   Citrus clementina [clementine]
ref|XP_009358244.1|  PREDICTED: elongation factor 1-alpha-like          465   1e-160   Pyrus x bretschneideri [bai li]
gb|KHG20498.1|  Elongation factor 1-alpha                               465   2e-160   Gossypium arboreum [tree cotton]
gb|KDO48480.1|  hypothetical protein CISIN_1g0132372mg                  465   2e-160   Citrus sinensis [apfelsine]
ref|XP_011026992.1|  PREDICTED: elongation factor 1-alpha isoform X2    465   2e-160   Populus euphratica
gb|KDP29083.1|  hypothetical protein JCGZ_16472                         465   2e-160   Jatropha curcas
ref|XP_002518073.1|  elongation factor 1-alpha, putative                465   2e-160   Ricinus communis
gb|ACS68200.1|  elongation factor 1 alpha                               465   2e-160   Brassica napus [oilseed rape]
gb|AAL32631.1|  putative elongation factor 1-a                          465   2e-160   Arabidopsis thaliana [mouse-ear cress]
emb|CDO98621.1|  unnamed protein product                                461   2e-160   Coffea canephora [robusta coffee]
ref|NP_001234035.1|  elongation factor 1-alpha                          465   2e-160   Solanum lycopersicum
ref|XP_006378755.1|  hypothetical protein POPTR_0010s22560g             465   2e-160   
ref|XP_010542596.1|  PREDICTED: elongation factor 1-alpha-like          465   2e-160   Tarenaya hassleriana [spider flower]
dbj|BAM13874.1|  elongation factor 1 alpha                              464   2e-160   Symplocarpus renifolius
ref|NP_001280807.1|  elongation factor 1-alpha-like                     464   2e-160   Malus domestica [apple tree]
gb|AAN31833.1|  putative translation elongation factor eEF-1 alph...    464   2e-160   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008358325.1|  PREDICTED: elongation factor 1-alpha               464   2e-160   Malus domestica [apple tree]
ref|XP_006387491.1|  hypothetical protein POPTR_0966s00200g             464   2e-160   Populus trichocarpa [western balsam poplar]
ref|NP_200847.1|  elongation factor 1-alpha 4                           464   2e-160   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001105587.1|  elongation factor 1-alpha                          464   2e-160   Zea mays [maize]
dbj|BAH19898.1|  AT1G07930                                              464   2e-160   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006280459.1|  hypothetical protein CARUB_v10026391mg             464   2e-160   Capsella rubella
ref|XP_007205199.1|  hypothetical protein PRUPE_ppa005718mg             464   3e-160   Prunus persica
ref|XP_010032225.1|  PREDICTED: elongation factor 1-alpha-like          464   3e-160   Eucalyptus grandis [rose gum]
ref|XP_009131916.1|  PREDICTED: elongation factor 1-alpha 1-like        464   3e-160   Brassica rapa
gb|ADI24333.1|  elongation factor 1-alpha                               464   3e-160   Miscanthus sinensis
ref|XP_010248287.1|  PREDICTED: elongation factor 1-alpha               462   3e-160   Nelumbo nucifera [Indian lotus]
gb|AIZ68131.1|  translation elongation factor 1-alpha                   464   3e-160   Ornithogalum longebracteatum [sea-onion]
sp|Q41803.1|EF1A_MAIZE  RecName: Full=Elongation factor 1-alpha; ...    464   3e-160   Zea mays [maize]
ref|NP_001152668.1|  LOC100286309                                       464   3e-160   Zea mays [maize]
gb|ABU63160.1|  elongation factor                                       464   3e-160   Saccharum officinarum [noble cane]
ref|XP_011026991.1|  PREDICTED: elongation factor 1-alpha isoform X1    464   3e-160   Populus euphratica
ref|XP_008224543.1|  PREDICTED: elongation factor 1-alpha               464   4e-160   Prunus mume [ume]
gb|ABA12222.1|  translation elongation factor 1A-6                      464   4e-160   Gossypium hirsutum [American cotton]
gb|KHG27341.1|  Elongation factor 1-alpha                               464   4e-160   Gossypium arboreum [tree cotton]
gb|KJB76528.1|  hypothetical protein B456_012G093800                    464   4e-160   Gossypium raimondii
ref|XP_007222129.1|  hypothetical protein PRUPE_ppa005702mg             464   4e-160   Prunus persica
gb|AEQ94148.1|  elongation factor 1                                     455   4e-160   Elaeis guineensis
ref|XP_006856244.1|  hypothetical protein AMTR_s00059p00216110          464   4e-160   Amborella trichopoda
gb|ACI96243.1|  elongation factor 1-alpha                               464   4e-160   Prunus persica
ref|NP_001032107.1|  elongation factor 1-alpha 4                        462   4e-160   
gb|ACN40740.1|  unknown                                                 464   4e-160   Picea sitchensis
gb|KHG15275.1|  Elongation factor 1-alpha                               463   5e-160   Gossypium arboreum [tree cotton]
gb|ABR17675.1|  unknown                                                 464   5e-160   Picea sitchensis
gb|ABB16977.1|  elongation factor 1-alpha-like protein                  459   5e-160   Solanum tuberosum [potatoes]
gb|AFO67216.1|  putative elongation factor 1-alpha                      457   5e-160   Aralia elata
emb|CDX95108.1|  BnaC05g05630D                                          465   5e-160   
ref|XP_011031783.1|  PREDICTED: elongation factor 1-alpha-like          464   5e-160   Populus euphratica
gb|EYU18863.1|  hypothetical protein MIMGU_mgv1a006280mg                464   5e-160   Erythranthe guttata [common monkey flower]
gb|AAK32834.1|AF361822_1  At1g07930/T6D22_3                             464   5e-160   Arabidopsis thaliana [mouse-ear cress]
dbj|BAC22125.1|  eukaryotic elongation factor 1A                        464   5e-160   Bruguiera sexangula
ref|XP_009126609.1|  PREDICTED: elongation factor 1-alpha 1-like        463   6e-160   Brassica rapa
gb|ABA12224.1|  translation elongation factor 1A-8                      463   6e-160   Gossypium hirsutum [American cotton]
ref|XP_004984833.1|  PREDICTED: elongation factor 1-alpha-like          463   6e-160   Setaria italica
gb|ADR70875.1|  eukaryotic translation elongation factor 1-alpha        463   6e-160   Hevea brasiliensis [jebe]
ref|XP_010456376.1|  PREDICTED: elongation factor 1-alpha 1 isofo...    461   6e-160   
sp|Q03033.1|EF1A_WHEAT  RecName: Full=Elongation factor 1-alpha; ...    463   6e-160   Triticum aestivum [Canadian hard winter wheat]
gb|AGI78242.1|  elongation factor 1 alpha                               463   7e-160   Caragana korshinskii
ref|XP_010032227.1|  PREDICTED: elongation factor 1-alpha-like          463   7e-160   Eucalyptus grandis [rose gum]
ref|NP_001274875.1|  elongation factor 1-alpha-like protein             463   8e-160   Solanum tuberosum [potatoes]
gb|ABB72813.1|  elongation factor 1-alpha-like protein                  463   8e-160   Solanum tuberosum [potatoes]
gb|EYU18869.1|  hypothetical protein MIMGU_mgv1a010191mg                458   8e-160   Erythranthe guttata [common monkey flower]
emb|CDP08919.1|  unnamed protein product                                462   8e-160   Coffea canephora [robusta coffee]
dbj|BAC23049.1|  Elongation factor 1-alpha                              463   8e-160   Solanum tuberosum [potatoes]
emb|CAA34456.1|  elongation factor 1-alpha                              463   8e-160   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008380545.1|  PREDICTED: elongation factor 1-alpha-like          463   8e-160   Malus domestica [apple tree]
gb|ABB86283.1|  elongation factor-1 alpha-like                          463   8e-160   Solanum tuberosum [potatoes]
gb|AAN77897.1|  elongation factor 1 alpha                               463   9e-160   Stevia rebaudiana
gb|AAK25877.1|AF360167_1  putative translation elongation factor ...    463   9e-160   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006343452.1|  PREDICTED: elongation factor 1-alpha-like          463   1e-159   Solanum tuberosum [potatoes]
dbj|BAM13877.1|  elongation factor 1 alpha                              462   1e-159   Arum maculatum [cuckoo-pint]
ref|XP_008385284.1|  PREDICTED: elongation factor 1-alpha-like          462   1e-159   
gb|AFC88830.1|  putative elongation factor 1-alpha                      462   1e-159   Miscanthus sinensis
ref|XP_002315287.1|  hypothetical protein POPTR_0010s22620g             462   1e-159   
ref|XP_007151789.1|  hypothetical protein PHAVU_004G075100g             462   1e-159   Phaseolus vulgaris [French bean]
ref|XP_004309883.1|  PREDICTED: elongation factor 1-alpha-like          462   1e-159   Fragaria vesca subsp. vesca
emb|CDP07148.1|  unnamed protein product                                461   1e-159   Coffea canephora [robusta coffee]
ref|XP_009144204.1|  PREDICTED: elongation factor 1-alpha 1-like        462   1e-159   Brassica rapa
ref|XP_006858667.1|  hypothetical protein AMTR_s00066p00072310          462   1e-159   Amborella trichopoda
dbj|BAC66180.1|  elongation factor 1A                                   462   1e-159   Avicennia marina
gb|AFP44110.1|  elongation factor 1-alpha                               462   2e-159   Lycoris longituba
gb|KHN18669.1|  Elongation factor 1-alpha                               462   2e-159   Glycine soja [wild soybean]
ref|XP_002311106.1|  ADR12-2 family protein                             462   2e-159   Populus trichocarpa [western balsam poplar]
gb|AGV54713.1|  elongation factor 1-alpha                               462   2e-159   Phaseolus vulgaris [French bean]
gb|AEQ75495.1|  elongation factor 1-alpha                               462   2e-159   Rosa multiflora [Japanese rose]
ref|XP_004962249.1|  PREDICTED: elongation factor 1-alpha-like          462   2e-159   
ref|XP_004962277.1|  PREDICTED: elongation factor 1-alpha-like is...    462   2e-159   Setaria italica
ref|XP_006417745.1|  hypothetical protein EUTSA_v10007619mg             462   2e-159   Eutrema salsugineum [saltwater cress]
gb|AHB86963.1|  elongation factor 1-alpha                               462   2e-159   Sedum alfredii
gb|AFQ37422.1|  translation elongation factor-1 alpha 1                 462   2e-159   Larix kaempferi [karamatsu]
gb|EMS52529.1|  Elongation factor 1-alpha                               462   2e-159   Triticum urartu
gb|AIZ74328.1|  translation elongation factor 1-alpha                   462   2e-159   Pinus massoniana [Chinese red pine]
sp|P25698.2|EF1A_SOYBN  RecName: Full=Elongation factor 1-alpha; ...    462   2e-159   Glycine max [soybeans]
ref|XP_006600131.1|  PREDICTED: elongation factor-1A isoform X1         462   2e-159   
ref|NP_001237425.1|  elongation factor-1A                               462   2e-159   
ref|XP_008380544.1|  PREDICTED: elongation factor 1-alpha-like          462   2e-159   Malus domestica [apple tree]
ref|XP_002312029.1|  ADR12-2 family protein                             462   2e-159   Populus trichocarpa [western balsam poplar]
ref|XP_010669657.1|  PREDICTED: elongation factor 1-alpha               462   2e-159   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010669660.1|  PREDICTED: elongation factor 1-alpha-like          462   2e-159   Beta vulgaris subsp. vulgaris [field beet]
dbj|BAF02151.1|  elongation factor 1-alpha                              462   3e-159   Arabidopsis thaliana [mouse-ear cress]
gb|ABV26710.1|  elongation factor 1 alpha                               462   3e-159   Gerbera hybrid cultivar
ref|XP_006424633.1|  hypothetical protein CICLE_v10028443mg             461   3e-159   Citrus clementina [clementine]
ref|XP_008656153.1|  PREDICTED: elongation factor 1-alpha-like          461   3e-159   Zea mays [maize]
ref|XP_008656156.1|  PREDICTED: elongation factor 1-alpha-like is...    461   3e-159   Zea mays [maize]
ref|XP_002311107.1|  ADR12-2 family protein                             461   3e-159   Populus trichocarpa [western balsam poplar]
ref|NP_001105617.1|  elongation factor alpha3                           461   3e-159   Zea mays [maize]
gb|AGT16893.1|  elongation factor 1-alpha                               461   4e-159   Saccharum hybrid cultivar R570
ref|XP_006424629.1|  hypothetical protein CICLE_v10028446mg             461   4e-159   Citrus clementina [clementine]
gb|AID52924.1|  elongation factor 1-alpha                               461   4e-159   Carthamus tinctorius
ref|NP_001288407.1|  elongation factor 1-alpha-like                     461   4e-159   Zea mays [maize]
ref|NP_001105565.1|  elongation factor alpha5                           461   4e-159   
gb|AHZ58493.1|  translation elongation factor alpha                     461   5e-159   Syntrichia caninervis
gb|AFW77593.1|  putative translation elongation factor Tu family ...    461   5e-159   
gb|AAL57653.1|  At1g07930/T6D22_3                                       461   5e-159   Arabidopsis thaliana [mouse-ear cress]
gb|ACR38047.1|  unknown                                                 461   5e-159   Zea mays [maize]
ref|XP_006381487.1|  hypothetical protein POPTR_0006s13310g             461   5e-159   Populus trichocarpa [western balsam poplar]
sp|P43643.1|EF1A_TOBAC  RecName: Full=Elongation factor 1-alpha; ...    461   5e-159   Nicotiana tabacum [American tobacco]
ref|XP_002968422.1|  hypothetical protein SELMODRAFT_169717             461   5e-159   Selaginella moellendorffii
dbj|BAC22126.1|  eukaryotic elongation factor 1A                        461   5e-159   Suaeda japonica
gb|ACG31866.1|  elongation factor 1-alpha                               461   6e-159   Zea mays [maize]
gb|AAL69396.1|  elongation factor 1-alpha                               461   6e-159   Elaeis oleifera
gb|AEN79476.1|  elongation factor 1-alpha                               461   7e-159   Ziziphus jujuba [Chinese jujube]
gb|ABF94276.1|  Elongation factor 1-alpha, putative, expressed          461   7e-159   Oryza sativa Japonica Group [Japonica rice]
sp|O24534.1|EF1A_VICFA  RecName: Full=Elongation factor 1-alpha; ...    461   8e-159   Vicia faba [broad bean]
gb|AGC94754.1|  elongation factor 1 alpha                               460   1e-158   Euphorbia lathyris
ref|XP_011004182.1|  PREDICTED: elongation factor 1-alpha-like          460   1e-158   Populus euphratica
ref|XP_002970583.1|  hypothetical protein SELMODRAFT_171512             460   1e-158   Selaginella moellendorffii
ref|NP_001105933.1|  elongation factor alpha2                           460   1e-158   
gb|AGJ50595.1|  EF1alpha                                                460   1e-158   Pericallis cruenta
gb|AGD99674.1|  eukaryotic elongation factor 1A                         460   2e-158   Salicornia bigelovii
ref|NP_001288465.1|  elongation factor 1-alpha-like                     459   2e-158   Zea mays [maize]
ref|XP_011040946.1|  PREDICTED: elongation factor 1-alpha-like is...    459   2e-158   Populus euphratica
gb|AER42621.1|  elongation factor 1 alpha                               459   2e-158   Hordeum brevisubulatum
gb|EMS49772.1|  Elongation factor 1-alpha                               459   2e-158   Triticum urartu
gb|EMS59091.1|  Elongation factor 1-alpha                               461   2e-158   Triticum urartu
gb|EMT12343.1|  Elongation factor 1-alpha                               459   3e-158   
ref|XP_007027265.1|  GTP binding Elongation factor Tu family protein    463   4e-158   
gb|AAR82894.1|  elongation factor 1-alpha                               459   4e-158   Cichorium intybus [radicchio]
gb|AAL79774.1|AF331849_1  elongation factor 1 alpha                     458   5e-158   Saccharum hybrid cultivar CP65-357
ref|XP_004309880.1|  PREDICTED: elongation factor 1-alpha               458   6e-158   Fragaria vesca subsp. vesca
gb|ABK24843.1|  unknown                                                 458   7e-158   Picea sitchensis
gb|AAK82537.1|  At1g07930/T6D22_3                                       458   7e-158   Arabidopsis thaliana [mouse-ear cress]
gb|ACN41180.1|  unknown                                                 458   8e-158   Picea sitchensis
gb|ABK25072.1|  unknown                                                 458   8e-158   Picea sitchensis
gb|ADD71925.1|  translation elongation factor 1 alpha                   456   9e-158   Actaea racemosa
gb|ABK24265.1|  unknown                                                 458   9e-158   Picea sitchensis
ref|XP_001753181.1|  predicted protein                                  457   1e-157   
ref|XP_001766482.1|  predicted protein                                  457   1e-157   
ref|XP_001763201.1|  predicted protein                                  457   1e-157   
gb|ACG34498.1|  elongation factor 1-alpha                               457   2e-157   
gb|AFQ37423.1|  translation elongation factor-1 alpha 2                 457   2e-157   
ref|NP_001105935.1|  elongation factor alpha8                           457   2e-157   
ref|XP_001753059.1|  predicted protein                                  457   2e-157   
gb|AHE76183.1|  elongation factor 1-alpha                               457   2e-157   
dbj|BAC22127.1|  eukaryotic elongation factor 1A                        457   3e-157   
ref|XP_002968419.1|  hypothetical protein SELMODRAFT_270693             456   3e-157   
sp|P29521.1|EF1A1_DAUCA  RecName: Full=Elongation factor 1-alpha;...    456   4e-157   
gb|ABD66517.1|  EF-1 alpha                                              456   4e-157   
ref|XP_001753167.1|  predicted protein                                  456   4e-157   
dbj|BAG80668.1|  elongation factor 1 alpha                              454   4e-157   
ref|NP_001105934.1|  elongation factor alpha7                           456   5e-157   
ref|XP_002970579.1|  hypothetical protein SELMODRAFT_270852             456   5e-157   
ref|XP_001763194.1|  predicted protein                                  456   6e-157   
gb|AIX10769.1|  elongation factor 1 alpha                               456   8e-157   
gb|AGV54654.1|  elongation factor 1-alpha                               455   8e-157   
gb|AAQ15280.1|  elongation factor 1 alpha                               447   9e-157   
gb|AAF99703.1|  elongation factor                                       455   1e-156   
sp|P34823.1|EF1A2_DAUCA  RecName: Full=Elongation factor 1-alpha;...    455   1e-156   
sp|P34824.1|EF1A1_HORVU  RecName: Full=Elongation factor 1-alpha;...    455   1e-156   
sp|Q40034.1|EF1A2_HORVU  RecName: Full=Elongation factor 1-alpha;...    454   2e-156   
gb|AAL79775.1|  elongation factor 1 alpha                               454   2e-156   
gb|EMS65134.1|  Elongation factor 1-alpha                               461   3e-156   
gb|ACN40081.1|  unknown                                                 454   3e-156   
dbj|BAL14665.1|  elongation factor 1-alpha                              454   4e-156   
gb|AEE98364.1|  elongation factor 1-alpha                               453   5e-156   
ref|XP_003618775.1|  Elongation factor 1-alpha                          470   1e-155   
ref|XP_004143833.1|  PREDICTED: uncharacterized protein LOC101220517    468   1e-155   
emb|CAC27139.1|  translation elongation factor-1 alpha                  451   5e-155   
ref|NP_001104939.1|  elongation factor alpha6                           451   6e-155   
gb|AAQ15281.1|  elongation factor 1 alpha                               442   1e-154   
gb|AIM48895.1|  elongation factor 1-alpha                               449   1e-154   
gb|ABC74971.1|  elongation factor 1 alpha                               439   9e-154   
ref|XP_002892424.1|  T6D22.2                                            464   9e-154   
ref|XP_011031813.1|  PREDICTED: LOW QUALITY PROTEIN: HBS1-like pr...    466   1e-153   
gb|AAV71174.1|  elongation factor 1-alpha                               439   1e-153   
gb|EMT09703.1|  Elongation factor 1-alpha                               456   3e-153   
gb|AAR89627.1|  elongation factor 1 alpha                               438   4e-153   
gb|AAF79822.1|AC026875_2  T6D22.2                                       462   6e-153   
emb|CAA68246.1|  factor 1-alpha                                         437   9e-153   
gb|ABX82323.1|  elongation factor 1 subunit alpha                       436   1e-152   
gb|AEG78681.1|  elongation factor 1 alpha                               436   2e-152   
sp|Q41011.1|EF1A_PEA  RecName: Full=Elongation factor 1-alpha; Sh...    443   5e-152   
gb|AHL28542.1|  elongation factor 1-alpha                               434   1e-151   
dbj|BAK08744.1|  elongation factor 1-alpha                              442   2e-151   
dbj|BAK08818.1|  elongation factor 1-alpha                              442   2e-151   
dbj|BAK08819.1|  elongation factor 1-alpha                              441   3e-151   
ref|NP_001275481.1|  elongation factor 1-alpha-like                     440   1e-150   
gb|ABF00115.1|  elongation factor 1-alpha                               440   1e-150   
gb|AES59072.2|  GTP-binding elongation factor Tu family protein         441   1e-150   
ref|XP_003588821.1|  Elongation factor 1-alpha                          438   6e-150   
gb|AAX81595.1|  elongation factor elF1-alpha                            428   2e-149   
ref|NP_001104938.1|  elongation factor 1 alpha                          436   3e-149   
gb|AHL28535.1|  elongation factor 1-alpha                               427   4e-149   
gb|AGF25313.1|  elongation factor 1-alpha                               423   9e-148   
gb|ACA24136.1|  eukaryotic elongation factor 1-alpha                    429   3e-147   
gb|ABE01138.1|  elongation factor 1-alpha                               424   1e-146   
gb|ABQ81941.1|  elongation factor 1-alpha                               422   2e-146   
gb|ABW20463.1|  elongation factor 1-alpha                               425   7e-146   
emb|CAD60652.1|  elongation factor                                      424   2e-144   
gb|AFB18314.1|  translation elongation factor-1 alpha                   421   3e-144   
ref|XP_005650451.1|  translation elongation factor                      418   3e-142   
dbj|BAK23239.1|  eukaryotic translation elongation factor 1 alpha       417   6e-142   
emb|CDY06289.1|  BnaA09g49140D                                          408   5e-141   
emb|CDY06287.1|  BnaA09g49160D                                          406   1e-140   
emb|CDY67375.1|  BnaC03g71520D                                          407   2e-140   
gb|KJB48747.1|  hypothetical protein B456_008G084000                    412   3e-140   
gb|KJB76560.1|  hypothetical protein B456_012G094600                    412   4e-140   
emb|CDY61938.1|  BnaCnng38780D                                          412   7e-140   
emb|CDX88757.1|  BnaA03g08920D                                          410   8e-140   
emb|CDX93604.1|  BnaA06g04440D                                          412   2e-139   
emb|CAA65798.1|  EF1-alpha                                              401   3e-139   
gb|KEH43146.1|  elongation factor Tu (EF-Tu) GTP-binding family p...    406   2e-137   
gb|ABQ81936.1|  elongation factor 1-alpha                               405   3e-137   
emb|CDY22710.1|  BnaC08g43440D                                          404   7e-137   
gb|AAD28440.1|  elongation factor 1-alpha                               404   1e-136   
emb|CDY58828.1|  BnaAnng15460D                                          406   1e-135   
gb|ACN59909.1|  translation elongation factor-1 alpha                   391   5e-135   
gb|AAO12048.1|  elongation factor 1-alpha                               386   4e-133   
gb|ABO28827.1|  elongation factor 1-alpha                               384   8e-133   
gb|ACL97367.1|  elongation factor-1 alpha                               392   4e-132   
ref|XP_003284439.1|  elongation factor 1 alpha                          392   8e-132   
ref|XP_003591959.1|  Elongation factor 1-alpha                          394   3e-131   
ref|XP_645839.1|  elongation factor 1 alpha                             390   6e-131   
ref|XP_004360206.1|  elongation factor 1 alpha                          389   8e-131   
dbj|GAM26397.1|  hypothetical protein SAMD00019534_095720               390   8e-131   
gb|AAD03711.1|  elongation translation factor 1 alpha                   389   2e-130   
gb|AID66749.1|  elongation factor 1 alpha                               383   8e-130   
gb|AHH02823.1|  elongation factor 1 alpha                               378   8e-130   
dbj|GAM23387.1|  hypothetical protein SAMD00019534_065620               385   3e-129   
gb|ACN59918.1|  translation elongation factor-1 alpha                   375   1e-128   
gb|ABQ81935.1|  elongation factor 1-alpha                               383   1e-128   
emb|CAA39442.1|  elongation factor 1 alpha                              383   2e-128   
prf||1616364A  elongation factor 1a                                     383   2e-128
emb|CAA39443.1|  elongation factor 1 alpha                              383   2e-128   
gb|AHA92093.1|  elongation factor 1                                     375   3e-128   
gb|EWM21485.1|  translation elongation factor 1                         382   3e-128   
gb|ESL07732.1|  elongation factor 1-alpha                               379   4e-128   
ref|XP_001464664.1|  elongation factor 1-alpha                          380   2e-127   
ref|XP_003873870.1|  elongation factor 1-alpha                          379   2e-127   
ref|XP_001563777.1|  elongation factor 1-alpha                          380   4e-127   
ref|XP_003873865.1|  elongation factor 1-alpha                          379   5e-127   
ref|XP_001682258.1|  elongation factor 1-alpha                          379   7e-127   
gb|ACN59924.1|  translation elongation factor-1 alpha                   372   7e-127   
ref|XP_010697699.1|  elongation factor 1-alpha                          379   9e-127   
ref|XP_003392396.1|  elongation factor 1-alpha                          381   9e-127   
ref|XP_009435907.1|  PREDICTED: elongation factor 1-alpha 2             371   2e-126   
gb|ESL10875.1|  elongation factor 1-alpha (EF-1-alpha)                  379   3e-126   
gb|AAX40412.1|  elongation factor 1-alpha                               377   4e-126   
gb|ACO50110.1|  elongation factor 1 alpha                               377   4e-126   
gb|AAB48400.1|  elongation factor EF-1a                                 377   4e-126   
gb|AHI45318.1|  elongation factor 1 alpha                               377   5e-126   
gb|AIW52353.1|  elongation factor 1 alpha                               372   6e-126   
gb|KDP29084.1|  hypothetical protein JCGZ_16473                         375   7e-126   
ref|XP_001682260.1|  elongation factor 1-alpha                          377   7e-126   
ref|XP_003626756.1|  Elongation factor 1-alpha                          378   8e-126   
ref|XP_002186303.1|  translation elongation factor, EF-1, alpha s...    376   1e-125   
gb|KEH40223.1|  GTP-binding elongation factor Tu family protein         376   1e-125   
gb|EDL26403.1|  mCG15232, isoform CRA_d                                 370   1e-125   
gb|ESL05580.1|  elongation factor 1-alpha (EF-1-alpha)                  376   1e-125   
ref|XP_002181593.1|  predicted protein                                  375   1e-125   
gb|EDL77725.1|  rCG25445, isoform CRA_f                                 370   2e-125   
gb|ESL09377.1|  elongation factor 1-alpha                               376   2e-125   
gb|ACL97363.1|  elongation factor-1 alpha                               374   3e-125   
ref|XP_009035936.1|  hypothetical protein AURANDRAFT_36932              375   3e-125   
gb|ESL06743.1|  elongation factor 1-alpha                               378   3e-125   
gb|ACO50111.1|  elongation factor 1 alpha                               375   3e-125   
gb|EPY42364.1|  elongation factor 1-alpha                               369   4e-125   
ref|XP_002904717.1|  translation elongation factor 1-alpha, putative    374   4e-125   
gb|AGH70141.1|  eukaryotic translation elongation factor 1 alpha        366   4e-125   
gb|AAF63516.1|AF242732_1  translation elongation factor 1a              374   7e-125   
gb|ACI02318.1|  elongation factor alpha G5                              374   7e-125   
emb|CAF89666.1|  unnamed protein product                                370   7e-125   
emb|CAG00281.1|  unnamed protein product                                374   7e-125   
ref|XP_008905681.1|  elongation factor 1-alpha                          374   8e-125   
ref|XP_002117044.1|  elongation factor 1 alpha                          374   8e-125   
ref|XP_003963863.1|  PREDICTED: LOW QUALITY PROTEIN: elongation f...    374   8e-125   
ref|NP_001183947.1|  uncharacterized protein LOC100502553               372   8e-125   
ref|NP_001002371.1|  elongation factor 1-alpha 2                        374   1e-124   
emb|CCC51155.1|  putative elongation factor 1-alpha                     374   1e-124   
gb|EDL26401.1|  mCG15232, isoform CRA_b                                 370   1e-124   
ref|NP_956303.1|  eukaryotic translation elongation factor 1 alph...    374   1e-124   
dbj|BAN33726.1|  elongation factor 1alpha                               374   1e-124   
emb|CDQ86379.1|  unnamed protein product                                368   1e-124   
gb|ABN54675.1|  translation elongation factor 1 alpha                   367   1e-124   
gb|ELR44723.1|  Elongation factor 1-alpha 2                             374   1e-124   
emb|CAF89665.1|  unnamed protein product                                368   1e-124   
gb|ELW50063.1|  Putative elongation factor 1-alpha-like 3               366   1e-124   
gb|AAU47272.1|  elongation factor alpha G5                              374   1e-124   
gb|AFC75715.1|  translation elongation factor 1 alpha                   374   1e-124   
ref|XP_819439.1|  elongation factor 1-alpha (EF-1-alpha)                374   1e-124   
ref|XP_804709.1|  elongation factor 1-alpha (EF-1-alpha)                373   1e-124   
emb|CCC51157.1|  putative EF-1-alpha                                    373   1e-124   
gb|EPY33773.1|  elongation factor 1-alpha                               366   2e-124   
gb|ACT36602.1|  elongation factor 1 alpha                               370   2e-124   
gb|AFC75714.1|  translation elongation factor 1 alpha                   373   2e-124   
gb|AET50884.1|  hypothetical protein                                    373   2e-124   
gb|EDL77724.1|  rCG25445, isoform CRA_e                                 369   2e-124   
gb|EKF38338.1|  elongation factor 1-alpha (ef-1-alpha), putative        374   2e-124   
gb|KFQ31255.1|  Elongation factor 1-alpha 2                             374   2e-124   
gb|AIM46989.1|  translation elongation factor 1-alpha                   373   2e-124   
sp|P14963.1|EF1A_EUGGR  RecName: Full=Elongation factor 1-alpha; ...    373   2e-124   
ref|XP_822465.1|  elongation factor 1-alpha                             373   2e-124   
emb|CDI83049.1|  elongation factor 1-alpha, putative                    373   2e-124   
gb|AAX40413.1|  elongation factor 1-alpha                               373   2e-124   
tpg|DAA05867.1|  TPA: eukaryotic translation elongation factor 1A       374   2e-124   
ref|XP_806835.1|  elongation factor 1-alpha (EF-1-alpha)                371   2e-124   
gb|AAI54753.1|  Zgc:110335                                              373   2e-124   
gb|AGT16628.1|  elongation factor 1 alpha                               371   2e-124   
ref|NP_001017795.1|  eukaryotic translation elongation factor 1 a...    373   2e-124   
ref|NP_001167438.1|  Elongation factor 1-alpha 1                        373   2e-124   
dbj|BAJ96087.1|  predicted protein                                      372   2e-124   
ref|XP_008319518.1|  PREDICTED: elongation factor 1-alpha, somati...    373   2e-124   
ref|XP_011217823.1|  PREDICTED: putative elongation factor 1-alph...    368   2e-124   
sp|P86933.1|EF1A_TRYBB  RecName: Full=Elongation factor 1-alpha; ...    373   3e-124   
gb|EKG06689.1|  elongation factor 1-alpha (ef-1-alpha), putative        374   3e-124   
ref|XP_010744212.1|  PREDICTED: elongation factor 1-alpha 1-like        373   3e-124   
ref|XP_010730917.1|  PREDICTED: elongation factor 1-alpha 1             373   3e-124   
gb|KJB48746.1|  hypothetical protein B456_008G084000                    370   3e-124   
ref|XP_006235797.1|  PREDICTED: elongation factor 1-alpha 2 isofo...    374   3e-124   
ref|XP_006639575.1|  PREDICTED: elongation factor 1-alpha 2-like        373   3e-124   
ref|XP_008404506.1|  PREDICTED: elongation factor 1-alpha 1             373   3e-124   
emb|CDJ63491.1|  elongation factor 1-alpha, putative                    373   3e-124   
ref|XP_006638682.1|  PREDICTED: elongation factor 1-alpha 1-like        373   4e-124   
ref|XP_005746073.1|  PREDICTED: elongation factor 1-alpha 1-like        373   4e-124   
ref|XP_007567352.1|  PREDICTED: elongation factor 1-alpha 1             373   4e-124   
ref|XP_005805806.1|  PREDICTED: elongation factor 1-alpha 1-like        373   4e-124   
gb|KFM79139.1|  Elongation factor 1-alpha                               365   4e-124   
ref|XP_005733783.1|  PREDICTED: elongation factor 1-alpha 1-like ...    372   4e-124   
ref|XP_004553494.1|  PREDICTED: elongation factor 1-alpha 1-like        372   4e-124   
gb|KHG24249.1|  Elongation factor 1-alpha                               370   4e-124   
ref|XP_004077036.1|  PREDICTED: elongation factor 1-alpha 1             372   4e-124   
ref|XP_005811264.1|  PREDICTED: elongation factor 1-alpha 1-like ...    372   5e-124   
ref|XP_008427063.1|  PREDICTED: elongation factor 1-alpha 1-like        372   5e-124   
ref|XP_005470211.1|  PREDICTED: elongation factor 1-alpha 1-like        372   5e-124   
ref|XP_004261630.1|  elongation factor 1-alpha, putative                372   5e-124   
ref|XP_008277210.1|  PREDICTED: elongation factor 1-alpha 1             372   5e-124   
dbj|BAN41950.1|  elongation factor 1-alpha, putative                    372   5e-124   
ref|XP_002026026.1|  GL10091                                            370   5e-124   
ref|XP_806829.1|  elongation factor 1-alpha (EF-1-alpha)                372   5e-124   
ref|XP_007551163.1|  PREDICTED: elongation factor 1-alpha 1-like        372   5e-124   
gb|EPY26186.1|  elongation factor 1-alpha                               367   5e-124   
ref|XP_008300933.1|  PREDICTED: elongation factor 1-alpha 1-like        372   5e-124   
ref|XP_005698451.1|  PREDICTED: elongation factor 1-alpha 1-like        368   6e-124   
gb|ACB05693.1|  elongation factor 1 alpha                               370   6e-124   
gb|ACO50115.1|  elongation factor 1 alpha                               371   6e-124   
ref|XP_005506801.1|  PREDICTED: elongation factor 1-alpha 1             372   7e-124   
gb|EFB23649.1|  hypothetical protein PANDA_003064                       365   7e-124   
ref|XP_005963050.1|  PREDICTED: elongation factor 1-alpha 1-like        364   7e-124   
ref|XP_004785941.1|  PREDICTED: elongation factor 1-alpha 2 isofo...    372   7e-124   
gb|ABB02622.1|  elongation factor 1-alpha-like protein                  370   7e-124   
gb|EPQ04746.1|  Elongation factor 1-alpha 1                             371   8e-124   
gb|EHB17794.1|  Elongation factor 1-alpha 2                             370   8e-124   
ref|XP_004620338.1|  PREDICTED: elongation factor 1-alpha 2 isofo...    372   8e-124   
ref|XP_008155341.1|  PREDICTED: elongation factor 1-alpha 2             372   8e-124   
ref|XP_006167177.1|  PREDICTED: elongation factor 1-alpha 2             370   8e-124   
ref|XP_011231232.1|  PREDICTED: elongation factor 1-alpha 2             370   8e-124   
ref|XP_004586009.1|  PREDICTED: elongation factor 1-alpha 2             372   8e-124   
gb|EMC83487.1|  Elongation factor 1-alpha 2                             372   9e-124   
gb|AAA41967.1|  statin-related protein                                  372   9e-124   



>ref|XP_011091454.1| PREDICTED: elongation factor 1-alpha-like [Sesamum indicum]
Length=449

 Score =   472 bits (1214),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 224/226 (99%), Positives = 225/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD+I EP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMIQEP  226



>ref|XP_002279598.1| PREDICTED: elongation factor 1-alpha [Vitis vinifera]
 emb|CAN66350.1| hypothetical protein VITISV_044270 [Vitis vinifera]
Length=447

 Score =   471 bits (1212),  Expect = 5e-163, Method: Compositional matrix adjust.
 Identities = 223/226 (99%), Positives = 226/226 (100%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSK+RYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKSRYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD+IHEP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMIHEP  226



>ref|XP_003536362.1| PREDICTED: elongation factor 1-alpha-like isoformX2 [Glycine 
max]
 ref|XP_006589439.1| PREDICTED: elongation factor 1-alpha-like isoform X3 [Glycine 
max]
 ref|XP_006589440.1| PREDICTED: elongation factor 1-alpha-like isoform X4 [Glycine 
max]
 gb|KHN17117.1| Elongation factor 1-alpha [Glycine soja]
Length=448

 Score =   470 bits (1210),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 224/226 (99%), Positives = 225/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I+EP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEP  226



>ref|XP_009403341.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
Length=447

 Score =   470 bits (1209),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 223/226 (99%), Positives = 226/226 (100%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI+EP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLINEP  226



>ref|XP_010937512.1| PREDICTED: elongation factor 1-alpha [Elaeis guineensis]
Length=447

 Score =   470 bits (1209),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 222/226 (98%), Positives = 225/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD++ EP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMVQEP  226



>gb|KCW51623.1| hypothetical protein EUGRSUZ_J01112 [Eucalyptus grandis]
Length=330

 Score =   465 bits (1197),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 222/226 (98%), Positives = 225/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I+EP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEP  226



>ref|XP_002277159.1| PREDICTED: elongation factor 1-alpha [Vitis vinifera]
 ref|XP_010658430.1| PREDICTED: elongation factor 1-alpha [Vitis vinifera]
 emb|CAN76417.1| hypothetical protein VITISV_018410 [Vitis vinifera]
 emb|CAN69000.1| hypothetical protein VITISV_022484 [Vitis vinifera]
Length=447

 Score =   470 bits (1209),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 222/226 (98%), Positives = 225/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD++ EP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMVQEP  226



>ref|XP_011089340.1| PREDICTED: elongation factor 1-alpha isoform X2 [Sesamum indicum]
 ref|XP_011089341.1| PREDICTED: elongation factor 1-alpha isoform X3 [Sesamum indicum]
 ref|XP_011089342.1| PREDICTED: elongation factor 1-alpha isoform X4 [Sesamum indicum]
 ref|XP_011089875.1| PREDICTED: elongation factor 1-alpha [Sesamum indicum]
Length=449

 Score =   470 bits (1209),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 223/226 (99%), Positives = 225/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI EP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIQEP  226



>ref|XP_007009762.1| GTP binding Elongation factor Tu family protein isoform 3, partial 
[Theobroma cacao]
 gb|EOY18572.1| GTP binding Elongation factor Tu family protein isoform 3, partial 
[Theobroma cacao]
Length=367

 Score =   466 bits (1200),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 223/226 (99%), Positives = 225/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I+EP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEP  226



>ref|XP_011089874.1| PREDICTED: elongation factor 1-alpha [Sesamum indicum]
Length=449

 Score =   469 bits (1207),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 222/226 (98%), Positives = 225/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD+I EP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMIQEP  226



>ref|XP_003604587.1| Elongation factor 1-alpha [Medicago truncatula]
 gb|AES86784.1| GTP-binding elongation factor Tu family protein [Medicago truncatula]
Length=447

 Score =   469 bits (1207),  Expect = 4e-162, Method: Compositional matrix adjust.
 Identities = 223/226 (99%), Positives = 225/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSK+RYDEIVKEVSSYMKK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKSRYDEIVKEVSSYMKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I+EP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEP  226



>gb|AFJ04514.1| elongation factor 1-alpha, partial [Vernicia fordii]
Length=438

 Score =   468 bits (1205),  Expect = 4e-162, Method: Compositional matrix adjust.
 Identities = 223/226 (99%), Positives = 226/226 (100%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI+EP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLINEP  226



>ref|XP_010032224.1| PREDICTED: elongation factor 1-alpha isoform X3 [Eucalyptus grandis]
Length=447

 Score =   469 bits (1206),  Expect = 5e-162, Method: Compositional matrix adjust.
 Identities = 223/226 (99%), Positives = 225/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I+EP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEP  226



>ref|XP_009403064.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
Length=447

 Score =   469 bits (1206),  Expect = 5e-162, Method: Compositional matrix adjust.
 Identities = 222/226 (98%), Positives = 225/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEI+KEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNP+KIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI EP
Sbjct  181  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIQEP  226



>ref|XP_008792062.1| PREDICTED: elongation factor 1-alpha [Phoenix dactylifera]
Length=447

 Score =   469 bits (1206),  Expect = 5e-162, Method: Compositional matrix adjust.
 Identities = 222/226 (98%), Positives = 225/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNP+KIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI EP
Sbjct  181  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIQEP  226



>ref|XP_008790814.1| PREDICTED: elongation factor 1-alpha-like [Phoenix dactylifera]
Length=447

 Score =   469 bits (1206),  Expect = 5e-162, Method: Compositional matrix adjust.
 Identities = 222/226 (98%), Positives = 224/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEK H+NIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHLNIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI EP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIQEP  226



>ref|XP_008789061.1| PREDICTED: elongation factor 1-alpha-like [Phoenix dactylifera]
 ref|XP_008789062.1| PREDICTED: elongation factor 1-alpha-like [Phoenix dactylifera]
 ref|XP_008789063.1| PREDICTED: elongation factor 1-alpha-like [Phoenix dactylifera]
Length=447

 Score =   469 bits (1206),  Expect = 5e-162, Method: Compositional matrix adjust.
 Identities = 222/226 (98%), Positives = 225/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNP+KIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI EP
Sbjct  181  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIQEP  226



>ref|XP_007009760.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
 ref|XP_007009761.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
 gb|EOY18570.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
 gb|EOY18571.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
Length=449

 Score =   469 bits (1206),  Expect = 5e-162, Method: Compositional matrix adjust.
 Identities = 223/226 (99%), Positives = 225/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I+EP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEP  226



>ref|XP_009342345.1| PREDICTED: elongation factor 1-alpha-like [Pyrus x bretschneideri]
Length=447

 Score =   468 bits (1205),  Expect = 6e-162, Method: Compositional matrix adjust.
 Identities = 222/226 (98%), Positives = 224/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCA+LIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAILIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD IHEP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQIHEP  226



>ref|XP_008792073.1| PREDICTED: elongation factor 1-alpha-like [Phoenix dactylifera]
Length=447

 Score =   468 bits (1205),  Expect = 6e-162, Method: Compositional matrix adjust.
 Identities = 222/226 (98%), Positives = 225/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNP+KIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI EP
Sbjct  181  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIQEP  226



>ref|XP_010032221.1| PREDICTED: elongation factor 1-alpha isoform X1 [Eucalyptus grandis]
 ref|XP_010032222.1| PREDICTED: elongation factor 1-alpha isoform X1 [Eucalyptus grandis]
Length=449

 Score =   468 bits (1205),  Expect = 7e-162, Method: Compositional matrix adjust.
 Identities = 223/226 (99%), Positives = 225/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I+EP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEP  226



>ref|XP_010937806.1| PREDICTED: elongation factor 1-alpha-like [Elaeis guineensis]
Length=447

 Score =   468 bits (1205),  Expect = 7e-162, Method: Compositional matrix adjust.
 Identities = 222/226 (98%), Positives = 225/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMI+RSTNLDWYKGPTLLEALDLI EP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIDRSTNLDWYKGPTLLEALDLIQEP  226



>ref|XP_008463920.1| PREDICTED: elongation factor 1-alpha [Cucumis melo]
Length=448

 Score =   468 bits (1205),  Expect = 7e-162, Method: Compositional matrix adjust.
 Identities = 222/226 (98%), Positives = 224/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKAHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI EP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIQEP  226



>gb|EPS66069.1| elongation factor 1-alpha, partial [Genlisea aurea]
Length=446

 Score =   468 bits (1204),  Expect = 7e-162, Method: Compositional matrix adjust.
 Identities = 222/226 (98%), Positives = 225/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNP+KIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI EP
Sbjct  181  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIQEP  226



>ref|XP_009388387.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
Length=447

 Score =   468 bits (1204),  Expect = 8e-162, Method: Compositional matrix adjust.
 Identities = 222/226 (98%), Positives = 225/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNP+KIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI EP
Sbjct  181  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIQEP  226



>ref|XP_010939624.1| PREDICTED: elongation factor 1-alpha-like [Elaeis guineensis]
 ref|XP_010939625.1| PREDICTED: elongation factor 1-alpha-like [Elaeis guineensis]
Length=447

 Score =   468 bits (1204),  Expect = 9e-162, Method: Compositional matrix adjust.
 Identities = 221/226 (98%), Positives = 224/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGK KVHINIV+IGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKAKVHINIVIIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD+I EP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMIQEP  226



>ref|XP_004251154.1| PREDICTED: elongation factor 1-alpha-like [Solanum lycopersicum]
Length=447

 Score =   468 bits (1204),  Expect = 9e-162, Method: Compositional matrix adjust.
 Identities = 222/226 (98%), Positives = 225/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD ++EP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQLNEP  226



>gb|ABF94275.1| Elongation factor 1-alpha, putative, expressed [Oryza sativa 
Japonica Group]
Length=347

 Score =   464 bits (1194),  Expect = 9e-162, Method: Compositional matrix adjust.
 Identities = 221/226 (98%), Positives = 224/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I+EP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEP  226



>gb|KHG28979.1| Elongation factor 1-alpha [Gossypium arboreum]
Length=447

 Score =   468 bits (1204),  Expect = 9e-162, Method: Compositional matrix adjust.
 Identities = 222/226 (98%), Positives = 225/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I+EP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEP  226



>ref|XP_006340223.1| PREDICTED: elongation factor 1-alpha-like [Solanum tuberosum]
Length=447

 Score =   468 bits (1204),  Expect = 9e-162, Method: Compositional matrix adjust.
 Identities = 222/226 (98%), Positives = 225/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD ++EP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQLNEP  226



>ref|XP_010535587.1| PREDICTED: elongation factor 1-alpha [Tarenaya hassleriana]
Length=449

 Score =   468 bits (1204),  Expect = 9e-162, Method: Compositional matrix adjust.
 Identities = 222/226 (98%), Positives = 225/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I+EP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEP  226



>ref|XP_009420035.1| PREDICTED: elongation factor 1-alpha [Musa acuminata subsp. malaccensis]
 ref|XP_009420036.1| PREDICTED: elongation factor 1-alpha [Musa acuminata subsp. malaccensis]
Length=447

 Score =   468 bits (1204),  Expect = 9e-162, Method: Compositional matrix adjust.
 Identities = 222/226 (98%), Positives = 225/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI EP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIQEP  226



>ref|XP_004157309.1| PREDICTED: elongation factor 1-alpha-like [Cucumis sativus]
Length=449

 Score =   468 bits (1204),  Expect = 9e-162, Method: Compositional matrix adjust.
 Identities = 221/226 (98%), Positives = 224/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFET KYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETAKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSK+RYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKSRYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD +HEP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQVHEP  226



>gb|AAX54511.1| elongation factor 1 alpha [Actinidia deliciosa]
Length=447

 Score =   468 bits (1204),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 222/226 (98%), Positives = 225/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLL+ALDLI EP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDLISEP  226



>ref|XP_010542598.1| PREDICTED: elongation factor 1-alpha-like [Tarenaya hassleriana]
Length=449

 Score =   468 bits (1204),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 222/226 (98%), Positives = 225/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I+EP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEP  226



>ref|XP_010043711.1| PREDICTED: elongation factor 1-alpha [Eucalyptus grandis]
 gb|KCW85696.1| hypothetical protein EUGRSUZ_B02473 [Eucalyptus grandis]
Length=449

 Score =   468 bits (1204),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 223/226 (99%), Positives = 225/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI EP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLILEP  226



>ref|XP_004149547.1| PREDICTED: elongation factor 1-alpha-like [Cucumis sativus]
Length=449

 Score =   468 bits (1204),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 222/226 (98%), Positives = 224/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI EP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIQEP  226



>ref|XP_008457229.1| PREDICTED: elongation factor 1-alpha [Cucumis melo]
Length=447

 Score =   468 bits (1204),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 222/226 (98%), Positives = 224/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI EP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLISEP  226



>ref|XP_004138964.1| PREDICTED: elongation factor 1-alpha-like [Cucumis sativus]
 ref|XP_004162426.1| PREDICTED: elongation factor 1-alpha-like [Cucumis sativus]
Length=447

 Score =   468 bits (1204),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 222/226 (98%), Positives = 224/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI EP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLISEP  226



>ref|NP_001290506.1| elongation factor 1-alpha [Elaeis guineensis]
 ref|XP_010922532.1| PREDICTED: elongation factor 1-alpha [Elaeis guineensis]
 gb|AAT45847.1| elongation factor 1-alpha 1 [Elaeis guineensis]
Length=447

 Score =   468 bits (1204),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 221/226 (98%), Positives = 225/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNP+KIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD+I EP
Sbjct  181  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMIQEP  226



>ref|XP_010916901.1| PREDICTED: elongation factor 1-alpha [Elaeis guineensis]
 ref|XP_010910504.1| PREDICTED: elongation factor 1-alpha [Elaeis guineensis]
Length=447

 Score =   468 bits (1203),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 221/226 (98%), Positives = 225/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNP+KIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD+I EP
Sbjct  181  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMIQEP  226



>ref|XP_010557310.1| PREDICTED: elongation factor 1-alpha-like [Tarenaya hassleriana]
 ref|XP_010557311.1| PREDICTED: elongation factor 1-alpha-like [Tarenaya hassleriana]
Length=449

 Score =   468 bits (1203),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 222/226 (98%), Positives = 225/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I+EP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEP  226



>ref|XP_008783722.1| PREDICTED: elongation factor 1-alpha isoform X1 [Phoenix dactylifera]
Length=447

 Score =   468 bits (1203),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 221/226 (98%), Positives = 225/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNP+KIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD+I EP
Sbjct  181  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMIQEP  226



>gb|AGY80449.1| elongation factor 1-alpha [Dendrocalamus latiflorus]
Length=447

 Score =   468 bits (1203),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 222/226 (98%), Positives = 225/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I+EP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEP  226



>gb|ABA12220.1| translation elongation factor 1A-4 [Gossypium hirsutum]
 gb|KJB62497.1| hypothetical protein B456_009G420000 [Gossypium raimondii]
 gb|KJB62498.1| hypothetical protein B456_009G420000 [Gossypium raimondii]
 gb|KJB62499.1| hypothetical protein B456_009G420100 [Gossypium raimondii]
 gb|KJB62500.1| hypothetical protein B456_009G420100 [Gossypium raimondii]
Length=447

 Score =   468 bits (1203),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 222/226 (98%), Positives = 225/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I+EP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEP  226



>gb|ACG70967.1| translation elongation factor 1, partial [Ziziphus jujuba]
Length=227

 Score =   459 bits (1181),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 220/226 (97%), Positives = 224/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNP+KI FVPISGFEGDNMIERSTNLDWYKGPTLLEALD I+EP
Sbjct  181  VGYNPEKISFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEP  226



>gb|KDP29086.1| hypothetical protein JCGZ_16475 [Jatropha curcas]
Length=447

 Score =   468 bits (1203),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 222/226 (98%), Positives = 226/226 (100%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHIHIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI+EP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLINEP  226



>ref|XP_011089339.1| PREDICTED: elongation factor 1-alpha isoform X1 [Sesamum indicum]
 ref|XP_011089346.1| PREDICTED: elongation factor 1-alpha-like [Sesamum indicum]
Length=449

 Score =   468 bits (1203),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 221/226 (98%), Positives = 225/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNP+KIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD+I EP
Sbjct  181  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMIQEP  226



>ref|XP_010521772.1| PREDICTED: elongation factor 1-alpha-like [Tarenaya hassleriana]
Length=449

 Score =   468 bits (1203),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 222/226 (98%), Positives = 225/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I+EP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEP  226



>ref|XP_010244958.1| PREDICTED: elongation factor 1-alpha-like [Nelumbo nucifera]
 ref|XP_010244959.1| PREDICTED: elongation factor 1-alpha-like [Nelumbo nucifera]
Length=449

 Score =   468 bits (1203),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 221/226 (98%), Positives = 226/226 (100%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLL+ALD+I+EP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDMINEP  226



>ref|NP_001151074.1| elongation factor 1-alpha [Zea mays]
 gb|ACG41520.1| elongation factor 1-alpha [Zea mays]
 tpg|DAA63136.1| TPA: putative translation elongation factor Tu family protein 
[Zea mays]
Length=447

 Score =   468 bits (1203),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 222/226 (98%), Positives = 224/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEV SY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVGSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I+EP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEP  226



>ref|XP_002284964.1| PREDICTED: elongation factor 1-alpha [Vitis vinifera]
 ref|XP_002284924.1| PREDICTED: elongation factor 1-alpha [Vitis vinifera]
 ref|XP_010651131.1| PREDICTED: elongation factor 1-alpha [Vitis vinifera]
 emb|CAN64511.1| hypothetical protein VITISV_035691 [Vitis vinifera]
Length=447

 Score =   468 bits (1203),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 221/226 (98%), Positives = 226/226 (100%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETT+YYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTRYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD+I+EP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEP  226



>dbj|BAA34348.1| elongation factor-1 alpha [Nicotiana paniculata]
Length=447

 Score =   468 bits (1203),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 222/226 (98%), Positives = 225/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I+EP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEP  226



>ref|XP_009762748.1| PREDICTED: elongation factor 1-alpha-like [Nicotiana sylvestris]
Length=447

 Score =   468 bits (1203),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 222/226 (98%), Positives = 225/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I+EP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEP  226



>ref|XP_009613861.1| PREDICTED: elongation factor 1-alpha-like [Nicotiana tomentosiformis]
 ref|XP_009626606.1| PREDICTED: elongation factor 1-alpha-like [Nicotiana tomentosiformis]
 ref|XP_009597916.1| PREDICTED: elongation factor 1-alpha-like [Nicotiana tomentosiformis]
Length=447

 Score =   468 bits (1203),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 222/226 (98%), Positives = 225/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I+EP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEP  226



>ref|XP_002460859.1| hypothetical protein SORBIDRAFT_02g036420 [Sorghum bicolor]
 gb|EER97380.1| hypothetical protein SORBIDRAFT_02g036420 [Sorghum bicolor]
Length=447

 Score =   467 bits (1202),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 222/226 (98%), Positives = 224/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEV SY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVGSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I+EP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEP  226



>gb|AAY56337.1| elongation factor-1 alpha [Musa acuminata]
Length=447

 Score =   467 bits (1202),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 221/226 (98%), Positives = 224/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDST 
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTA  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEI+KEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNP+KIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI EP
Sbjct  181  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIQEP  226



>ref|XP_003604823.1| Elongation factor 1-alpha [Medicago truncatula]
Length=448

 Score =   467 bits (1202),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 222/226 (98%), Positives = 225/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSK+RYDEIVKEVSSYMKK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKSRYDEIVKEVSSYMKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I+EP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEP  226



>sp|O49169.1|EF1A_MANES RecName: Full=Elongation factor 1-alpha; Short=EF-1-alpha [Manihot 
esculenta]
 gb|AAC39447.1| elongation factor 1-alpha [Manihot esculenta]
Length=449

 Score =   467 bits (1202),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 222/226 (98%), Positives = 224/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I EP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQIQEP  226



>ref|XP_002528028.1| elongation factor 1-alpha, putative [Ricinus communis]
 gb|EEF34346.1| elongation factor 1-alpha, putative [Ricinus communis]
Length=449

 Score =   467 bits (1202),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 222/226 (98%), Positives = 225/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I+EP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEP  226



>ref|XP_010920912.1| PREDICTED: elongation factor 1-alpha-like [Elaeis guineensis]
Length=447

 Score =   467 bits (1202),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 221/226 (98%), Positives = 225/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNP+KIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD+I EP
Sbjct  181  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMIQEP  226



>ref|XP_009381507.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009381508.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009381509.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
Length=447

 Score =   467 bits (1202),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 220/226 (97%), Positives = 225/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEI+KEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLL+ALD+I EP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDMIQEP  226



>ref|XP_007009751.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
 ref|XP_007009752.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
 gb|EOY18561.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
 gb|EOY18562.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
Length=449

 Score =   467 bits (1202),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 222/226 (98%), Positives = 225/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I+EP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEP  226



>ref|XP_010521578.1| PREDICTED: elongation factor 1-alpha [Tarenaya hassleriana]
Length=449

 Score =   467 bits (1201),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 222/226 (98%), Positives = 225/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I+EP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEP  226



>dbj|BAO57272.1| elongation factor 1-alpha [Ipomoea nil]
Length=447

 Score =   467 bits (1201),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 220/226 (97%), Positives = 225/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEI+KEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD+I+EP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEP  226



>gb|AES74993.2| GTP-binding elongation factor Tu family protein [Medicago truncatula]
 gb|KEH25376.1| GTP-binding elongation factor Tu family protein [Medicago truncatula]
Length=447

 Score =   467 bits (1201),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 221/226 (98%), Positives = 225/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEK+HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKIHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I+EP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEP  226



>ref|XP_008233357.1| PREDICTED: elongation factor 1-alpha-like [Prunus mume]
Length=447

 Score =   466 bits (1200),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 220/226 (97%), Positives = 225/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEK+HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKIHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFET KYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETNKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEI+KEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI+EP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLINEP  226



>ref|XP_008224492.1| PREDICTED: elongation factor 1-alpha [Prunus mume]
Length=447

 Score =   466 bits (1200),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 221/226 (98%), Positives = 224/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCA+LIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAILIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNP+KIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI EP
Sbjct  181  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLISEP  226



>ref|XP_007151593.1| hypothetical protein PHAVU_004G060000g [Phaseolus vulgaris]
 gb|ESW23587.1| hypothetical protein PHAVU_004G060000g [Phaseolus vulgaris]
Length=447

 Score =   466 bits (1200),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 221/226 (98%), Positives = 225/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEI+KEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I+EP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEP  226



>gb|AHA84124.1| elongation factor 1-alpha [Phaseolus vulgaris]
Length=447

 Score =   466 bits (1200),  Expect = 4e-161, Method: Compositional matrix adjust.
 Identities = 221/226 (98%), Positives = 225/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEI+KEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I+EP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEP  226



>gb|AFW87115.1| putative translation elongation factor Tu family protein isoform 
1 [Zea mays]
 gb|AFW87116.1| putative translation elongation factor Tu family protein isoform 
2 [Zea mays]
 gb|AFW87117.1| putative translation elongation factor Tu family protein isoform 
3 [Zea mays]
 gb|AFW87118.1| putative translation elongation factor Tu family protein isoform 
4 [Zea mays]
 gb|AFW87119.1| putative translation elongation factor Tu family protein isoform 
5 [Zea mays]
Length=255

 Score =   459 bits (1181),  Expect = 4e-161, Method: Compositional matrix adjust.
 Identities = 221/226 (98%), Positives = 224/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKI FVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI+EP
Sbjct  181  VGYNPDKIHFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLINEP  226



>ref|XP_009617039.1| PREDICTED: elongation factor 1-alpha [Nicotiana tomentosiformis]
Length=447

 Score =   466 bits (1200),  Expect = 4e-161, Method: Compositional matrix adjust.
 Identities = 221/226 (98%), Positives = 225/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETT+YYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTRYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I+EP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEP  226



>ref|XP_007207457.1| hypothetical protein PRUPE_ppa005717mg [Prunus persica]
 gb|EMJ08656.1| hypothetical protein PRUPE_ppa005717mg [Prunus persica]
Length=447

 Score =   466 bits (1200),  Expect = 4e-161, Method: Compositional matrix adjust.
 Identities = 221/226 (98%), Positives = 224/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCA+LIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAILIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNP+KIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI EP
Sbjct  181  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLISEP  226



>gb|EPS66340.1| elongation factor 1-alpha, partial [Genlisea aurea]
Length=441

 Score =   466 bits (1199),  Expect = 4e-161, Method: Compositional matrix adjust.
 Identities = 221/226 (98%), Positives = 225/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNP+KIPFVPISGFEGDNMIERSTNLDWYKGPTLL+ALDLI EP
Sbjct  181  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDLIQEP  226



>gb|EEE58429.1| hypothetical protein OsJ_09630 [Oryza sativa Japonica Group]
Length=427

 Score =   466 bits (1198),  Expect = 4e-161, Method: Compositional matrix adjust.
 Identities = 221/226 (98%), Positives = 224/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I+EP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEP  226



>gb|AAD56019.1|AF181491_1 elongation factor-1 alpha 2 [Lilium longiflorum]
Length=447

 Score =   466 bits (1199),  Expect = 5e-161, Method: Compositional matrix adjust.
 Identities = 220/226 (97%), Positives = 225/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCA+LIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAILIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERS NLDWYKGPTLLEALD+I+EP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSINLDWYKGPTLLEALDMINEP  226



>ref|XP_009392715.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009392716.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
Length=447

 Score =   466 bits (1199),  Expect = 5e-161, Method: Compositional matrix adjust.
 Identities = 221/226 (98%), Positives = 225/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNP+KIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI EP
Sbjct  181  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIQEP  226



>gb|KHN14872.1| Elongation factor 1-alpha [Glycine soja]
Length=447

 Score =   466 bits (1199),  Expect = 5e-161, Method: Compositional matrix adjust.
 Identities = 221/226 (98%), Positives = 224/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I+EP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEP  226



>gb|ABA12219.1| translation elongation factor 1A-3 [Gossypium hirsutum]
Length=448

 Score =   466 bits (1199),  Expect = 5e-161, Method: Compositional matrix adjust.
 Identities = 221/226 (98%), Positives = 225/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNP+KIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I+EP
Sbjct  181  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEP  226



>ref|XP_004163381.1| PREDICTED: LOW QUALITY PROTEIN: elongation factor 1-alpha-like 
[Cucumis sativus]
Length=449

 Score =   466 bits (1199),  Expect = 5e-161, Method: Compositional matrix adjust.
 Identities = 221/226 (98%), Positives = 223/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+ K
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLXK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI EP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIQEP  226



>ref|XP_003553292.1| PREDICTED: elongation factor 1-alpha isoform 1 [Glycine max]
Length=447

 Score =   466 bits (1199),  Expect = 5e-161, Method: Compositional matrix adjust.
 Identities = 221/226 (98%), Positives = 224/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I+EP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEP  226



>ref|XP_010032223.1| PREDICTED: elongation factor 1-alpha isoform X2 [Eucalyptus grandis]
Length=447

 Score =   466 bits (1199),  Expect = 5e-161, Method: Compositional matrix adjust.
 Identities = 221/226 (98%), Positives = 225/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEK+HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKIHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I+EP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEP  226



>gb|KHG26926.1| Elongation factor 1-alpha [Gossypium arboreum]
Length=448

 Score =   466 bits (1199),  Expect = 5e-161, Method: Compositional matrix adjust.
 Identities = 221/226 (98%), Positives = 225/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNP+KIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I+EP
Sbjct  181  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEP  226



>gb|KHG23927.1| Elongation factor 1-alpha [Gossypium arboreum]
Length=449

 Score =   466 bits (1199),  Expect = 5e-161, Method: Compositional matrix adjust.
 Identities = 221/226 (98%), Positives = 225/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNP+KIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I+EP
Sbjct  181  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEP  226



>gb|AAD56020.1|AF181492_1 elongation factor-1 alpha 3 [Lilium longiflorum]
Length=447

 Score =   466 bits (1199),  Expect = 5e-161, Method: Compositional matrix adjust.
 Identities = 221/226 (98%), Positives = 224/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCA+LIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAILIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKY+KARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYAKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I EP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQISEP  226



>ref|XP_009593325.1| PREDICTED: elongation factor 1-alpha [Nicotiana tomentosiformis]
Length=447

 Score =   466 bits (1199),  Expect = 6e-161, Method: Compositional matrix adjust.
 Identities = 221/226 (98%), Positives = 225/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLL+ALD I+EP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDQINEP  226



>ref|XP_004307410.1| PREDICTED: elongation factor 1-alpha [Fragaria vesca subsp. vesca]
Length=447

 Score =   466 bits (1199),  Expect = 6e-161, Method: Compositional matrix adjust.
 Identities = 220/226 (97%), Positives = 225/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDAT+PKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATSPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            +GYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD+I+EP
Sbjct  181  IGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEP  226



>ref|XP_010541344.1| PREDICTED: elongation factor 1-alpha [Tarenaya hassleriana]
Length=449

 Score =   466 bits (1199),  Expect = 6e-161, Method: Compositional matrix adjust.
 Identities = 220/226 (97%), Positives = 225/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEI+KEV+SY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVASYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I+EP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEP  226



>gb|ABA12223.1| translation elongation factor 1A-7 [Gossypium hirsutum]
Length=448

 Score =   466 bits (1199),  Expect = 6e-161, Method: Compositional matrix adjust.
 Identities = 221/226 (98%), Positives = 225/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNP+KIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I+EP
Sbjct  181  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEP  226



>gb|ABA12221.1| translation elongation factor 1A-5 [Gossypium hirsutum]
Length=448

 Score =   466 bits (1199),  Expect = 6e-161, Method: Compositional matrix adjust.
 Identities = 221/226 (98%), Positives = 225/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNP+KIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I+EP
Sbjct  181  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEP  226



>gb|ABA12225.1| translation elongation factor 1A-9 [Gossypium hirsutum]
Length=448

 Score =   466 bits (1199),  Expect = 6e-161, Method: Compositional matrix adjust.
 Identities = 221/226 (98%), Positives = 225/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNP+KIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I+EP
Sbjct  181  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEP  226



>ref|XP_006846237.1| hypothetical protein AMTR_s00012p00237190 [Amborella trichopoda]
 gb|ERN07912.1| hypothetical protein AMTR_s00012p00237190 [Amborella trichopoda]
Length=447

 Score =   466 bits (1199),  Expect = 6e-161, Method: Compositional matrix adjust.
 Identities = 221/226 (98%), Positives = 224/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARY+EI KEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYEEITKEVSSYIKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD+I EP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMISEP  226



>gb|AGH32502.1| translation elongation factor-1 alpha [Stylosanthes guianensis]
Length=447

 Score =   466 bits (1198),  Expect = 6e-161, Method: Compositional matrix adjust.
 Identities = 221/226 (98%), Positives = 224/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I+EP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEP  226



>ref|XP_010937804.1| PREDICTED: elongation factor 1-alpha-like [Elaeis guineensis]
 ref|XP_010937805.1| PREDICTED: elongation factor 1-alpha-like [Elaeis guineensis]
Length=447

 Score =   466 bits (1198),  Expect = 6e-161, Method: Compositional matrix adjust.
 Identities = 221/226 (98%), Positives = 225/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNP+KIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD+I EP
Sbjct  181  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMILEP  226



>ref|XP_009421379.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
Length=447

 Score =   466 bits (1198),  Expect = 6e-161, Method: Compositional matrix adjust.
 Identities = 220/226 (97%), Positives = 225/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNP+KIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD+I EP
Sbjct  181  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMIQEP  226



>ref|XP_003547695.1| PREDICTED: elongation factor 1-alpha isoform 2 [Glycine max]
 gb|KHN27573.1| Elongation factor 1-alpha [Glycine soja]
Length=447

 Score =   466 bits (1198),  Expect = 6e-161, Method: Compositional matrix adjust.
 Identities = 221/226 (98%), Positives = 225/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARY+EIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYEEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I+EP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEP  226



>gb|ABA12217.1| translation elongation factor 1A-1 [Gossypium hirsutum]
Length=447

 Score =   466 bits (1198),  Expect = 7e-161, Method: Compositional matrix adjust.
 Identities = 221/226 (98%), Positives = 225/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERSTNLDW+KGPTLLEALD I+EP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWHKGPTLLEALDQINEP  226



>ref|NP_001049145.1| Os03g0177400 [Oryza sativa Japonica Group]
 ref|NP_001049146.1| Os03g0177500 [Oryza sativa Japonica Group]
 ref|NP_001049147.1| Os03g0177900 [Oryza sativa Japonica Group]
 ref|NP_001049148.1| Os03g0178000 [Oryza sativa Japonica Group]
 ref|XP_006649493.1| PREDICTED: elongation factor 1-alpha-like [Oryza brachyantha]
 ref|XP_006649494.1| PREDICTED: elongation factor 1-alpha-like [Oryza brachyantha]
 sp|O64937.2|EF1A_ORYSJ RecName: Full=Elongation factor 1-alpha; Short=EF-1-alpha [Oryza 
sativa Japonica Group]
 dbj|BAA23657.1| EF-1 alpha [Oryza sativa]
 dbj|BAA23659.1| EF-1 alpha [Oryza sativa]
 dbj|BAA23660.1| EF-1 alpha [Oryza sativa]
 gb|ABF94269.1| Elongation factor 1-alpha, putative [Oryza sativa Japonica Group]
 gb|ABF94270.1| Elongation factor 1-alpha, putative, expressed [Oryza sativa 
Japonica Group]
 gb|ABF94273.1| Elongation factor 1-alpha, putative, expressed [Oryza sativa 
Japonica Group]
 gb|ABF94274.1| Elongation factor 1-alpha, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF11059.1| Os03g0177400 [Oryza sativa Japonica Group]
 dbj|BAF11060.1| Os03g0177500 [Oryza sativa Japonica Group]
 dbj|BAF11061.1| Os03g0177900 [Oryza sativa Japonica Group]
 dbj|BAF11062.1| Os03g0178000 [Oryza sativa Japonica Group]
 gb|EAZ25788.1| hypothetical protein OsJ_09631 [Oryza sativa Japonica Group]
 gb|EAZ25791.1| hypothetical protein OsJ_09634 [Oryza sativa Japonica Group]
 gb|EAZ25792.1| hypothetical protein OsJ_09635 [Oryza sativa Japonica Group]
 dbj|BAG87945.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG93078.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97075.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC74621.1| hypothetical protein OsI_10237 [Oryza sativa Indica Group]
 gb|EEC74622.1| hypothetical protein OsI_10241 [Oryza sativa Indica Group]
 gb|EEC74623.1| hypothetical protein OsI_10242 [Oryza sativa Indica Group]
 gb|ADM86871.1| elongation factor-1 alpha [Oryza sativa Japonica Group]
 gb|ADM86885.1| elongation factor-1 alpha [Oryza sativa Japonica Group]
 gb|ADM86886.1| elongation factor-1 alpha [Oryza sativa Japonica Group]
 gb|ADM86887.1| elongation factor-1 alpha [Oryza sativa Japonica Group]
Length=447

 Score =   466 bits (1198),  Expect = 7e-161, Method: Compositional matrix adjust.
 Identities = 221/226 (98%), Positives = 224/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I+EP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEP  226



>gb|ABA12218.1| translation elongation factor 1A-2 [Gossypium hirsutum]
 gb|KHG05237.1| Elongation factor 1-alpha [Gossypium arboreum]
 gb|KJB14364.1| hypothetical protein B456_002G121500 [Gossypium raimondii]
Length=447

 Score =   466 bits (1198),  Expect = 8e-161, Method: Compositional matrix adjust.
 Identities = 221/226 (98%), Positives = 224/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I+EP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEP  226



>ref|XP_009783256.1| PREDICTED: elongation factor 1-alpha [Nicotiana sylvestris]
 dbj|BAA09709.1| elongation factor-1 alpha [Nicotiana tabacum]
Length=447

 Score =   466 bits (1198),  Expect = 8e-161, Method: Compositional matrix adjust.
 Identities = 221/226 (98%), Positives = 224/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I+EP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEP  226



>ref|XP_009342341.1| PREDICTED: elongation factor 1-alpha [Pyrus x bretschneideri]
Length=447

 Score =   466 bits (1198),  Expect = 8e-161, Method: Compositional matrix adjust.
 Identities = 221/226 (98%), Positives = 225/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETT+YYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTRYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKI FVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI+EP
Sbjct  181  VGYNPDKIAFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLINEP  226



>gb|KHN42761.1| Elongation factor 1-alpha [Glycine soja]
Length=447

 Score =   466 bits (1198),  Expect = 8e-161, Method: Compositional matrix adjust.
 Identities = 221/226 (98%), Positives = 225/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERST+LDWYKGPTLLEALD I+EP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTSLDWYKGPTLLEALDQINEP  226



>ref|XP_010067278.1| PREDICTED: elongation factor 1-alpha-like [Eucalyptus grandis]
Length=447

 Score =   466 bits (1198),  Expect = 8e-161, Method: Compositional matrix adjust.
 Identities = 221/226 (98%), Positives = 224/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLL+ALD I EP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDQISEP  226



>gb|KHG01531.1| Elongation factor 1-alpha [Gossypium arboreum]
 gb|KJB63252.1| hypothetical protein B456_010G2044001 [Gossypium raimondii]
Length=447

 Score =   466 bits (1198),  Expect = 8e-161, Method: Compositional matrix adjust.
 Identities = 221/226 (98%), Positives = 225/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNP+KIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I+EP
Sbjct  181  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEP  226



>gb|EYU36203.1| hypothetical protein MIMGU_mgv1a006301mg [Erythranthe guttata]
Length=449

 Score =   466 bits (1198),  Expect = 8e-161, Method: Compositional matrix adjust.
 Identities = 221/226 (98%), Positives = 225/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLL+ALD+I EP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDMISEP  226



>ref|XP_004512426.1| PREDICTED: elongation factor 1-alpha-like [Cicer arietinum]
 ref|XP_004512427.1| PREDICTED: elongation factor 1-alpha-like [Cicer arietinum]
Length=448

 Score =   466 bits (1198),  Expect = 8e-161, Method: Compositional matrix adjust.
 Identities = 221/226 (98%), Positives = 225/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNP+KIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I+EP
Sbjct  181  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEP  226



>gb|AAD27590.1|AF121261_1 elongation factor 1-alpha 1 [Lilium longiflorum]
Length=447

 Score =   466 bits (1198),  Expect = 9e-161, Method: Compositional matrix adjust.
 Identities = 220/226 (97%), Positives = 225/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETT+YYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTRYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEI+KEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERS NLDWYKGPTLLEALDLI+EP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSNNLDWYKGPTLLEALDLINEP  226



>gb|KEH43536.1| GTP-binding elongation factor Tu family protein [Medicago truncatula]
Length=448

 Score =   466 bits (1198),  Expect = 9e-161, Method: Compositional matrix adjust.
 Identities = 221/226 (98%), Positives = 224/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSK RYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKGRYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I+EP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEP  226



>gb|AES62210.2| GTP-binding elongation factor Tu family protein [Medicago truncatula]
 gb|KEH43534.1| GTP-binding elongation factor Tu family protein [Medicago truncatula]
Length=448

 Score =   466 bits (1198),  Expect = 9e-161, Method: Compositional matrix adjust.
 Identities = 221/226 (98%), Positives = 224/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSK RYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKGRYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I+EP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEP  226



>gb|KJB09231.1| hypothetical protein B456_001G130700 [Gossypium raimondii]
 gb|KJB09232.1| hypothetical protein B456_001G130700 [Gossypium raimondii]
Length=447

 Score =   465 bits (1197),  Expect = 9e-161, Method: Compositional matrix adjust.
 Identities = 221/226 (98%), Positives = 224/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I+EP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEP  226



>dbj|BAA23658.1| EF-1 alpha [Oryza sativa]
Length=447

 Score =   465 bits (1197),  Expect = 9e-161, Method: Compositional matrix adjust.
 Identities = 221/226 (98%), Positives = 224/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I+EP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEP  226



>ref|XP_006646939.1| PREDICTED: elongation factor 1-alpha-like [Oryza brachyantha]
Length=447

 Score =   465 bits (1197),  Expect = 9e-161, Method: Compositional matrix adjust.
 Identities = 221/226 (98%), Positives = 224/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I+EP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEP  226



>gb|ADR70874.1| eukaryotic translation elongation factor 1-alpha [Hevea brasiliensis]
Length=449

 Score =   466 bits (1198),  Expect = 9e-161, Method: Compositional matrix adjust.
 Identities = 221/226 (98%), Positives = 224/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNP+KIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I EP
Sbjct  181  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQIQEP  226



>ref|XP_004489551.1| PREDICTED: elongation factor 1-alpha-like [Cicer arietinum]
 ref|XP_004489552.1| PREDICTED: elongation factor 1-alpha-like [Cicer arietinum]
Length=447

 Score =   465 bits (1197),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 221/226 (98%), Positives = 224/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I+EP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEP  226



>gb|AEK98799.1| translation elongation factor 1 alfa [Carthamus tinctorius]
Length=248

 Score =   457 bits (1177),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 218/226 (96%), Positives = 223/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFET KYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDS T
Sbjct  61   DKLKAERERGITIDIALWKFETNKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSAT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEI+KEV+SY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIIKEVASYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD ++EP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQLNEP  226



>ref|NP_001077483.1| elongation factor 1-alpha 2 [Arabidopsis thaliana]
 gb|AEE28214.1| Elongation factor 1-alpha [Arabidopsis thaliana]
Length=372

 Score =   462 bits (1190),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 220/226 (97%), Positives = 224/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEI+KEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I+EP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEP  226



>ref|XP_003558459.1| PREDICTED: elongation factor 1-alpha [Brachypodium distachyon]
 ref|XP_003577316.1| PREDICTED: elongation factor 1-alpha [Brachypodium distachyon]
 ref|XP_003581689.1| PREDICTED: elongation factor 1-alpha [Brachypodium distachyon]
 ref|XP_010228997.1| PREDICTED: elongation factor 1-alpha [Brachypodium distachyon]
 ref|XP_010228998.1| PREDICTED: elongation factor 1-alpha [Brachypodium distachyon]
Length=447

 Score =   465 bits (1197),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 220/226 (97%), Positives = 224/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDK+PFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I+EP
Sbjct  181  VGYNPDKVPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEP  226



>gb|KCW65375.1| hypothetical protein EUGRSUZ_G02807 [Eucalyptus grandis]
Length=428

 Score =   464 bits (1195),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 221/226 (98%), Positives = 224/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLL+ALD I EP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDQISEP  226



>gb|AAC15413.1| translation elongation factor-1 alpha [Oryza sativa Japonica 
Group]
Length=447

 Score =   465 bits (1197),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 221/226 (98%), Positives = 224/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I+EP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEP  226



>ref|XP_007015466.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
 gb|EOY33085.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
Length=449

 Score =   465 bits (1197),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 221/226 (98%), Positives = 225/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I+EP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEP  226



>ref|XP_007015463.1| GTP binding Elongation factor Tu family protein [Theobroma cacao]
 gb|EOY33082.1| GTP binding Elongation factor Tu family protein [Theobroma cacao]
Length=449

 Score =   465 bits (1197),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 221/226 (98%), Positives = 225/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I+EP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEP  226



>gb|AFW90638.1| elongation factor 1-alpha-like protein [Solanum tuberosum]
Length=309

 Score =   460 bits (1183),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 219/226 (97%), Positives = 225/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEK+HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKIHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLL+ALD I+EP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDQINEP  226



>ref|XP_009793830.1| PREDICTED: elongation factor 1-alpha-like [Nicotiana sylvestris]
Length=447

 Score =   465 bits (1197),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 221/226 (98%), Positives = 224/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I+EP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEP  226



>gb|AGI15328.1| elongation factor 1 [Aegiceras corniculatum]
Length=449

 Score =   465 bits (1197),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 220/226 (97%), Positives = 224/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEV+SY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVASYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD + EP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQVTEP  226



>ref|XP_009380678.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009380679.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009380680.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
Length=447

 Score =   465 bits (1196),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 220/226 (97%), Positives = 225/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNP+KIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD+I EP
Sbjct  181  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMIQEP  226



>ref|XP_010669658.1| PREDICTED: elongation factor 1-alpha-like [Beta vulgaris subsp. 
vulgaris]
Length=447

 Score =   465 bits (1196),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 219/226 (97%), Positives = 225/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEK+HI++VVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKIHISLVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFET KYYCTVIDAPGHRDFIKNMITGTSQADCA+LIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETNKYYCTVIDAPGHRDFIKNMITGTSQADCAILIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI+EP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLINEP  226



>ref|XP_009126611.1| PREDICTED: elongation factor 1-alpha 1-like [Brassica rapa]
 ref|XP_009126612.1| PREDICTED: elongation factor 1-alpha 1-like [Brassica rapa]
Length=449

 Score =   465 bits (1197),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 220/226 (97%), Positives = 224/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEI+KEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I+EP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEP  226



>ref|XP_009148045.1| PREDICTED: elongation factor 1-alpha 1 [Brassica rapa]
 ref|XP_009110915.1| PREDICTED: elongation factor 1-alpha 1 [Brassica rapa]
 ref|XP_009118409.1| PREDICTED: elongation factor 1-alpha 1 isoform X1 [Brassica rapa]
 ref|XP_009118410.1| PREDICTED: elongation factor 1-alpha 1 isoform X2 [Brassica rapa]
 ref|XP_009118411.1| PREDICTED: elongation factor 1-alpha 1 isoform X3 [Brassica rapa]
 ref|XP_009120571.1| PREDICTED: elongation factor 1-alpha 1 [Brassica rapa]
 gb|ACS68201.1| elongation factor 1 alpha [Brassica napus]
 gb|AGK07381.1| elongation factor 1-alpha protein [Brassica oleracea var. botrytis]
Length=449

 Score =   465 bits (1196),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 220/226 (97%), Positives = 224/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEI+KEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I+EP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEP  226



>ref|XP_008349743.1| PREDICTED: elongation factor 1-alpha isoform X2 [Malus domestica]
Length=397

 Score =   463 bits (1191),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 220/226 (97%), Positives = 224/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCA+LIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAILIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYS+ARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSRARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I+EP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEP  226



>ref|XP_007143679.1| hypothetical protein PHAVU_007G092500g [Phaseolus vulgaris]
 gb|ESW15673.1| hypothetical protein PHAVU_007G092500g [Phaseolus vulgaris]
Length=448

 Score =   465 bits (1196),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 221/226 (98%), Positives = 224/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTP YSKARYDEIVKEVSSYMKK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPNYSKARYDEIVKEVSSYMKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNP+KIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I+EP
Sbjct  181  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEP  226



>ref|XP_007218005.1| hypothetical protein PRUPE_ppa005706mg [Prunus persica]
 gb|EMJ19204.1| hypothetical protein PRUPE_ppa005706mg [Prunus persica]
Length=447

 Score =   465 bits (1196),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 219/226 (97%), Positives = 225/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEK+HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKIHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFET KYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETNKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEI+KEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERS+NLDWYKGPTLLEALDLI+EP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSSNLDWYKGPTLLEALDLINEP  226



>ref|XP_006436251.1| hypothetical protein CICLE_v10033471mg [Citrus clementina]
 ref|XP_006485903.1| PREDICTED: elongation factor 1-alpha 1-like [Citrus sinensis]
 gb|ESR49491.1| hypothetical protein CICLE_v10033471mg [Citrus clementina]
Length=447

 Score =   465 bits (1196),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 221/226 (98%), Positives = 224/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I+EP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEP  226



>ref|XP_009358244.1| PREDICTED: elongation factor 1-alpha-like [Pyrus x bretschneideri]
 ref|XP_009338285.1| PREDICTED: elongation factor 1-alpha-like [Pyrus x bretschneideri]
Length=447

 Score =   465 bits (1196),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 221/226 (98%), Positives = 225/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKI FVPISGFEGDNMIERSTNL+WYKGPTLLEALDLI+EP
Sbjct  181  VGYNPDKIAFVPISGFEGDNMIERSTNLEWYKGPTLLEALDLINEP  226



>gb|KHG20498.1| Elongation factor 1-alpha [Gossypium arboreum]
Length=447

 Score =   465 bits (1196),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 221/226 (98%), Positives = 224/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKSHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I+EP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEP  226



>gb|KDO48480.1| hypothetical protein CISIN_1g0132372mg [Citrus sinensis]
Length=447

 Score =   465 bits (1196),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 221/226 (98%), Positives = 224/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I+EP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEP  226



>ref|XP_011026992.1| PREDICTED: elongation factor 1-alpha isoform X2 [Populus euphratica]
 ref|XP_011026993.1| PREDICTED: elongation factor 1-alpha isoform X2 [Populus euphratica]
 ref|XP_011026995.1| PREDICTED: elongation factor 1-alpha isoform X2 [Populus euphratica]
 ref|XP_011026996.1| PREDICTED: elongation factor 1-alpha isoform X3 [Populus euphratica]
Length=449

 Score =   465 bits (1196),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 221/226 (98%), Positives = 223/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKSHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLL+ALD I EP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDQIQEP  226



>gb|KDP29083.1| hypothetical protein JCGZ_16472 [Jatropha curcas]
Length=447

 Score =   465 bits (1196),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 221/226 (98%), Positives = 224/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEV SY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVCSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDL +EP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLSNEP  226



>ref|XP_002518073.1| elongation factor 1-alpha, putative [Ricinus communis]
 ref|XP_002518074.1| elongation factor 1-alpha, putative [Ricinus communis]
 gb|EEF44206.1| elongation factor 1-alpha, putative [Ricinus communis]
 gb|EEF44207.1| elongation factor 1-alpha, putative [Ricinus communis]
Length=449

 Score =   465 bits (1196),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 220/226 (97%), Positives = 225/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEK+HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKIHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I+EP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEP  226



>gb|ACS68200.1| elongation factor 1 alpha [Brassica napus]
Length=449

 Score =   465 bits (1196),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 220/226 (97%), Positives = 224/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEI+KEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I+EP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEP  226



>gb|AAL32631.1| putative elongation factor 1-a [Arabidopsis thaliana]
 gb|AAM47970.1| putative elongation factor 1-a [Arabidopsis thaliana]
Length=449

 Score =   465 bits (1196),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 220/226 (97%), Positives = 224/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEI+KEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I+EP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEP  226



>emb|CDO98621.1| unnamed protein product [Coffea canephora]
Length=355

 Score =   461 bits (1186),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 220/226 (97%), Positives = 223/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEI+KEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKI FVPISGFEGDNMIERSTNLDWYKGPTLLEALD I EP
Sbjct  181  VGYNPDKINFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQIQEP  226



>ref|NP_001234035.1| elongation factor 1-alpha [Solanum lycopersicum]
 ref|XP_004240579.1| PREDICTED: elongation factor 1-alpha [Solanum lycopersicum]
 sp|P17786.1|EF1A_SOLLC RecName: Full=Elongation factor 1-alpha; Short=EF-1-alpha [Solanum 
lycopersicum]
 emb|CAA32618.1| unnamed protein product [Solanum lycopersicum]
 emb|CAA37212.1| elongation factor 1-alpha [Solanum lycopersicum]
Length=448

 Score =   465 bits (1196),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 220/226 (97%), Positives = 225/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEK+HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKIHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I+EP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEP  226



>ref|XP_006378755.1| hypothetical protein POPTR_0010s22560g [Populus trichocarpa]
 gb|ERP56552.1| hypothetical protein POPTR_0010s22560g [Populus trichocarpa]
Length=449

 Score =   465 bits (1196),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 221/226 (98%), Positives = 223/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKSHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLL+ALD I EP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDQIQEP  226



>ref|XP_010542596.1| PREDICTED: elongation factor 1-alpha-like [Tarenaya hassleriana]
Length=449

 Score =   465 bits (1196),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 221/226 (98%), Positives = 224/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKAR DEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARSDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I+EP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEP  226



>dbj|BAM13874.1| elongation factor 1 alpha [Symplocarpus renifolius]
Length=447

 Score =   464 bits (1195),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 219/226 (97%), Positives = 226/226 (100%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEK+HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKIHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNP+KIPFVPISGFEGDNMIERSTNLDWYKGPTLL+ALD+IHEP
Sbjct  181  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDMIHEP  226



>ref|NP_001280807.1| elongation factor 1-alpha-like [Malus domestica]
 ref|XP_008349742.1| PREDICTED: elongation factor 1-alpha isoform X1 [Malus domestica]
 ref|XP_008366354.1| PREDICTED: elongation factor 1-alpha [Malus domestica]
 emb|CAA11705.1| elongation factor 1 alpha subunit [Malus domestica]
Length=447

 Score =   464 bits (1195),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 220/226 (97%), Positives = 224/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCA+LIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAILIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYS+ARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSRARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I+EP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEP  226



>gb|AAN31833.1| putative translation elongation factor eEF-1 alpha chain (gene 
A4) [Arabidopsis thaliana]
Length=449

 Score =   464 bits (1195),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 220/226 (97%), Positives = 224/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEI+KEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I+EP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEP  226



>ref|XP_008358325.1| PREDICTED: elongation factor 1-alpha [Malus domestica]
 ref|XP_008385282.1| PREDICTED: elongation factor 1-alpha [Malus domestica]
Length=447

 Score =   464 bits (1195),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 221/226 (98%), Positives = 224/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKI FVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI+EP
Sbjct  181  VGYNPDKIAFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLINEP  226



>ref|XP_006387491.1| hypothetical protein POPTR_0966s00200g [Populus trichocarpa]
 ref|XP_006387492.1| hypothetical protein POPTR_0966s00200g [Populus trichocarpa]
 gb|ABK94386.1| unknown [Populus trichocarpa]
 gb|ERP46405.1| hypothetical protein POPTR_0966s00200g [Populus trichocarpa]
 gb|ERP46406.1| hypothetical protein POPTR_0966s00200g [Populus trichocarpa]
Length=449

 Score =   464 bits (1195),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 221/226 (98%), Positives = 223/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKSHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLL+ALD I EP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDQIQEP  226



>ref|NP_200847.1| elongation factor 1-alpha 4 [Arabidopsis thaliana]
 ref|NP_563799.1| elongation factor 1-alpha 3 [Arabidopsis thaliana]
 ref|NP_563800.1| elongation factor 1-alpha 2 [Arabidopsis thaliana]
 ref|NP_563801.1| elongation factor 1-alpha 1 [Arabidopsis thaliana]
 ref|NP_001030993.1| elongation factor 1-alpha 1 [Arabidopsis thaliana]
 ref|NP_001119464.1| elongation factor 1-alpha 4 [Arabidopsis thaliana]
 ref|XP_002864684.1| elongation factor 1-alpha [Arabidopsis lyrata subsp. lyrata]
 ref|XP_002889674.1| elongation factor 1-alpha [Arabidopsis lyrata subsp. lyrata]
 sp|P0DH99.1|EF1A1_ARATH RecName: Full=Elongation factor 1-alpha 1; Short=EF-1-alpha 1; 
AltName: Full=eEF-1A1 [Arabidopsis thaliana]
 sp|Q8W4H7.2|EF1A2_ARATH RecName: Full=Elongation factor 1-alpha 2; Short=EF-1-alpha 2; 
AltName: Full=eEF-1A2 [Arabidopsis thaliana]
 sp|Q0WL56.2|EF1A3_ARATH RecName: Full=Elongation factor 1-alpha 3; Short=EF-1-alpha 3; 
AltName: Full=eEF-1A3 [Arabidopsis thaliana]
 sp|Q8GTY0.2|EF1A4_ARATH RecName: Full=Elongation factor 1-alpha 4; Short=EF-1-alpha 4; 
AltName: Full=eEF-1A4 [Arabidopsis thaliana]
 gb|AAF79847.1|AC026875_27 T6D22.3 [Arabidopsis thaliana]
 gb|AAL31918.1|AF419586_1 AT5g60390/muf9_40 [Arabidopsis thaliana]
 emb|CAA34453.1| elongation factor 1-alpha [Arabidopsis thaliana]
 emb|CAA34454.1| elongation factor 1-alpha [Arabidopsis thaliana]
 emb|CAA34455.1| elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AAB07882.1| EF-1alpha-A1 [Arabidopsis thaliana]
 gb|AAB07883.1| EF-1alpha-A2 [Arabidopsis thaliana]
 gb|AAB07884.1| EF-1alpha-A3 [Arabidopsis thaliana]
 dbj|BAB08224.1| elongation factor 1-alpha (EF-1-alpha) [Arabidopsis thaliana]
 gb|AAK62638.1| At1g07940/T6D22_14 [Arabidopsis thaliana]
 gb|AAL24386.1| elongation factor 1-alpha (EF-1-alpha) [Arabidopsis thaliana]
 gb|AAL31193.1| AT5g60390/muf9_40 [Arabidopsis thaliana]
 gb|AAL86336.1| putative elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AAM65897.1| elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AAM67562.1| putative elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AAM91202.1| elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AAM91362.1| At5g60390/muf9_40 [Arabidopsis thaliana]
 gb|AAM98236.1| unknown protein [Arabidopsis thaliana]
 gb|AAM98240.1| unknown protein [Arabidopsis thaliana]
 gb|AAN18164.1| At1g07940/T6D22_14 [Arabidopsis thaliana]
 gb|AAO00783.1| elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AAO00802.1| elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AAO00870.1| Unknown protein [Arabidopsis thaliana]
 gb|AAO29944.1| Unknown protein [Arabidopsis thaliana]
 gb|AAP21177.1| At5g60390/muf9_40 [Arabidopsis thaliana]
 dbj|BAE99963.1| elongation factor 1-alpha [Arabidopsis thaliana]
 dbj|BAE98497.1| translation elongation factor eEF-1 alpha chain [Arabidopsis 
thaliana]
 dbj|BAE98750.1| translation elongation factor eEF-1 alpha chain [Arabidopsis 
thaliana]
 gb|EFH40943.1| elongation factor 1-alpha [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65933.1| elongation factor 1-alpha [Arabidopsis lyrata subsp. lyrata]
 gb|AED97318.1| elongation factor 1-alpha 4 [Arabidopsis thaliana]
 gb|AED97320.1| elongation factor 1-alpha 4 [Arabidopsis thaliana]
 gb|AEE28212.1| elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AEE28213.1| Elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AEE28215.1| Elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AEE28216.1| Elongation factor 1-alpha [Arabidopsis thaliana]
Length=449

 Score =   464 bits (1195),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 220/226 (97%), Positives = 224/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEI+KEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I+EP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEP  226



>ref|NP_001105587.1| elongation factor 1-alpha [Zea mays]
 gb|AAB64207.1| elongation factor 1-alpha [Zea mays]
 gb|ACG32939.1| elongation factor 1-alpha [Zea mays]
 gb|AFW87114.1| LOW QUALITY PROTEIN: putative translation elongation factor Tu 
family protein [Zea mays]
Length=447

 Score =   464 bits (1195),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 221/226 (98%), Positives = 224/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKI FVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI+EP
Sbjct  181  VGYNPDKIHFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLINEP  226



>dbj|BAH19898.1| AT1G07930 [Arabidopsis thaliana]
Length=449

 Score =   464 bits (1195),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 220/226 (97%), Positives = 224/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEI+KEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I+EP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEP  226



>ref|XP_006280459.1| hypothetical protein CARUB_v10026391mg [Capsella rubella]
 ref|XP_006304491.1| hypothetical protein CARUB_v10011249mg [Capsella rubella]
 ref|XP_010456336.1| PREDICTED: elongation factor 1-alpha 1 isoform X1 [Camelina sativa]
 ref|XP_010456344.1| PREDICTED: elongation factor 1-alpha 1 isoform X2 [Camelina sativa]
 ref|XP_010456350.1| PREDICTED: elongation factor 1-alpha 1 isoform X3 [Camelina sativa]
 ref|XP_010456355.1| PREDICTED: elongation factor 1-alpha 1 isoform X4 [Camelina sativa]
 ref|XP_010456361.1| PREDICTED: elongation factor 1-alpha 1 isoform X5 [Camelina sativa]
 ref|XP_010456369.1| PREDICTED: elongation factor 1-alpha 1 isoform X6 [Camelina sativa]
 ref|XP_010488164.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010488173.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010505603.1| PREDICTED: elongation factor 1-alpha 1 isoform X1 [Camelina sativa]
 ref|XP_010505604.1| PREDICTED: elongation factor 1-alpha 1 isoform X2 [Camelina sativa]
 ref|XP_010509026.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010517279.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010443836.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010443839.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010458006.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010458008.1| PREDICTED: elongation factor 1-alpha 1 isoform X1 [Camelina sativa]
 ref|XP_010458009.1| PREDICTED: elongation factor 1-alpha 1 isoform X1 [Camelina sativa]
 ref|XP_010475572.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010475573.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010475574.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010483684.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010483687.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 gb|EOA13357.1| hypothetical protein CARUB_v10026391mg [Capsella rubella]
 gb|EOA37389.1| hypothetical protein CARUB_v10011249mg [Capsella rubella]
Length=449

 Score =   464 bits (1195),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 220/226 (97%), Positives = 224/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEI+KEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I+EP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEP  226



>ref|XP_007205199.1| hypothetical protein PRUPE_ppa005718mg [Prunus persica]
 gb|EMJ06398.1| hypothetical protein PRUPE_ppa005718mg [Prunus persica]
Length=447

 Score =   464 bits (1195),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 221/226 (98%), Positives = 224/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKI FVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI+EP
Sbjct  181  VGYNPDKIAFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLINEP  226



>ref|XP_010032225.1| PREDICTED: elongation factor 1-alpha-like [Eucalyptus grandis]
Length=448

 Score =   464 bits (1195),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 220/226 (97%), Positives = 225/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLL+ALD I+EP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDQINEP  226



>ref|XP_009131916.1| PREDICTED: elongation factor 1-alpha 1-like [Brassica rapa]
Length=449

 Score =   464 bits (1195),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 220/226 (97%), Positives = 224/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEI+KEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I+EP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEP  226



>gb|ADI24333.1| elongation factor 1-alpha [Miscanthus sinensis]
Length=447

 Score =   464 bits (1194),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 221/226 (98%), Positives = 224/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKI FVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI+EP
Sbjct  181  VGYNPDKIHFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLINEP  226



>ref|XP_010248287.1| PREDICTED: elongation factor 1-alpha, partial [Nelumbo nucifera]
Length=382

 Score =   462 bits (1188),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 220/226 (97%), Positives = 223/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNP KIPFVPISGFEGDNMIERSTNLDWYKGPTLL+ALD I EP
Sbjct  181  VGYNPXKIPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDQIQEP  226



>gb|AIZ68131.1| translation elongation factor 1-alpha [Ornithogalum saundersiae]
Length=447

 Score =   464 bits (1194),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 218/226 (96%), Positives = 225/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKAR+DEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARFDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDK+PFVPISGFEGDNMIERSTNLDWYKGPTLL+ALD+I+EP
Sbjct  181  VGYNPDKVPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDMINEP  226



>sp|Q41803.1|EF1A_MAIZE RecName: Full=Elongation factor 1-alpha; Short=EF-1-alpha [Zea 
mays]
 dbj|BAA08249.1| alpha subunit of tlanslation elongation factor 1 [Zea mays]
Length=447

 Score =   464 bits (1194),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 221/226 (98%), Positives = 224/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKI FVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI+EP
Sbjct  181  VGYNPDKIHFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLINEP  226



>ref|NP_001152668.1| LOC100286309 [Zea mays]
 ref|XP_008647989.1| PREDICTED: LOC100286309 isoform X1 [Zea mays]
 gb|ACG48827.1| elongation factor 1-alpha [Zea mays]
 gb|AFW76430.1| putative translation elongation factor Tu family protein isoform 
1 [Zea mays]
 gb|AFW76431.1| putative translation elongation factor Tu family protein isoform 
2 [Zea mays]
 gb|AFW76432.1| putative translation elongation factor Tu family protein isoform 
3 [Zea mays]
Length=447

 Score =   464 bits (1194),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 221/226 (98%), Positives = 224/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKI FVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI+EP
Sbjct  181  VGYNPDKIHFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLINEP  226



>gb|ABU63160.1| elongation factor [Saccharum officinarum]
 gb|AGT15989.1| elongation factor 1-alpha [Saccharum hybrid cultivar R570]
 gb|AGT15990.1| elongation factor 1-alpha [Saccharum hybrid cultivar R570]
 gb|AGT16629.1| elongation factor 1 alpha [Saccharum hybrid cultivar R570]
Length=447

 Score =   464 bits (1194),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 221/226 (98%), Positives = 224/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKI FVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI+EP
Sbjct  181  VGYNPDKIHFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLINEP  226



>ref|XP_011026991.1| PREDICTED: elongation factor 1-alpha isoform X1 [Populus euphratica]
 ref|XP_011026997.1| PREDICTED: elongation factor 1-alpha [Populus euphratica]
 ref|XP_011040951.1| PREDICTED: elongation factor 1-alpha [Populus euphratica]
Length=449

 Score =   464 bits (1194),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 220/226 (97%), Positives = 223/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLL+ALD I EP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDQIQEP  226



>ref|XP_008224543.1| PREDICTED: elongation factor 1-alpha [Prunus mume]
Length=447

 Score =   464 bits (1194),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 221/226 (98%), Positives = 224/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKI FVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI+EP
Sbjct  181  VGYNPDKIAFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLINEP  226



>gb|ABA12222.1| translation elongation factor 1A-6 [Gossypium hirsutum]
 gb|KHG08414.1| Elongation factor 1-alpha [Gossypium arboreum]
 gb|KJB16823.1| hypothetical protein B456_002G249600 [Gossypium raimondii]
 gb|KJB16824.1| hypothetical protein B456_002G249600 [Gossypium raimondii]
 gb|KJB16825.1| hypothetical protein B456_002G249600 [Gossypium raimondii]
Length=447

 Score =   464 bits (1194),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 220/226 (97%), Positives = 224/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEKVHIN+VVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINLVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKAR+DEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARFDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNP+KIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I EP
Sbjct  181  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQITEP  226



>gb|KHG27341.1| Elongation factor 1-alpha [Gossypium arboreum]
Length=449

 Score =   464 bits (1193),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 220/226 (97%), Positives = 224/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNP+KIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I+EP
Sbjct  181  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEP  226



>gb|KJB76528.1| hypothetical protein B456_012G093800 [Gossypium raimondii]
Length=449

 Score =   464 bits (1193),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 220/226 (97%), Positives = 224/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNP+KIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I+EP
Sbjct  181  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEP  226



>ref|XP_007222129.1| hypothetical protein PRUPE_ppa005702mg [Prunus persica]
 ref|XP_008224523.1| PREDICTED: elongation factor 1-alpha-like [Prunus mume]
 gb|EMJ23328.1| hypothetical protein PRUPE_ppa005702mg [Prunus persica]
Length=447

 Score =   464 bits (1193),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 221/226 (98%), Positives = 224/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKI FVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI+EP
Sbjct  181  VGYNPDKIAFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLINEP  226



>gb|AEQ94148.1| elongation factor 1 [Elaeis guineensis]
Length=221

 Score =   455 bits (1171),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 218/221 (99%), Positives = 221/221 (100%), Gaps = 0/221 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD  721
            VGYNP+KIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD
Sbjct  181  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD  221



>ref|XP_006856244.1| hypothetical protein AMTR_s00059p00216110 [Amborella trichopoda]
 gb|ERN17711.1| hypothetical protein AMTR_s00059p00216110 [Amborella trichopoda]
Length=447

 Score =   464 bits (1193),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 220/226 (97%), Positives = 225/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEI+KEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIMKEVSSYIKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIE+STNLDWYKGPTLLEALD+I EP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIEKSTNLDWYKGPTLLEALDMILEP  226



>gb|ACI96243.1| elongation factor 1-alpha [Prunus persica]
Length=447

 Score =   464 bits (1193),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 221/226 (98%), Positives = 224/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKI FVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI+EP
Sbjct  181  VGYNPDKIAFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLINEP  226



>ref|NP_001032107.1| elongation factor 1-alpha 4 [Arabidopsis thaliana]
 gb|AED97319.1| elongation factor 1-alpha 4 [Arabidopsis thaliana]
Length=400

 Score =   462 bits (1188),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 220/226 (97%), Positives = 224/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEI+KEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I+EP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEP  226



>gb|ACN40740.1| unknown [Picea sitchensis]
 gb|ACN41072.1| unknown [Picea sitchensis]
Length=448

 Score =   464 bits (1193),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 219/226 (97%), Positives = 223/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCA+LIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAILIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARY+EIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYEEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD + EP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQVSEP  226



>gb|KHG15275.1| Elongation factor 1-alpha [Gossypium arboreum]
Length=431

 Score =   463 bits (1191),  Expect = 5e-160, Method: Compositional matrix adjust.
 Identities = 220/226 (97%), Positives = 224/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNP+KIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I+EP
Sbjct  181  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEP  226



>gb|ABR17675.1| unknown [Picea sitchensis]
Length=448

 Score =   464 bits (1193),  Expect = 5e-160, Method: Compositional matrix adjust.
 Identities = 219/226 (97%), Positives = 223/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCA+LIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAILIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARY+EIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYEEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD + EP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQVSEP  226



>gb|ABB16977.1| elongation factor 1-alpha-like protein [Solanum tuberosum]
Length=319

 Score =   459 bits (1180),  Expect = 5e-160, Method: Compositional matrix adjust.
 Identities = 219/226 (97%), Positives = 225/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEK+HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKIHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLL+ALD I+EP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDQINEP  226



>gb|AFO67216.1| putative elongation factor 1-alpha, partial [Aralia elata]
Length=287

 Score =   457 bits (1177),  Expect = 5e-160, Method: Compositional matrix adjust.
 Identities = 219/226 (97%), Positives = 224/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARY+EIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYEEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNP+KI FVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI+EP
Sbjct  181  VGYNPEKIAFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLINEP  226



>emb|CDX95108.1| BnaC05g05630D [Brassica napus]
Length=487

 Score =   465 bits (1196),  Expect = 5e-160, Method: Compositional matrix adjust.
 Identities = 220/226 (97%), Positives = 224/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  22   MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  81

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  82   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  141

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEI+KEVSSY+KK
Sbjct  142  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  201

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I+EP
Sbjct  202  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEP  247



>ref|XP_011031783.1| PREDICTED: elongation factor 1-alpha-like [Populus euphratica]
 ref|XP_011040944.1| PREDICTED: elongation factor 1-alpha-like isoform X1 [Populus 
euphratica]
 ref|XP_011040945.1| PREDICTED: elongation factor 1-alpha-like isoform X1 [Populus 
euphratica]
Length=449

 Score =   464 bits (1193),  Expect = 5e-160, Method: Compositional matrix adjust.
 Identities = 220/226 (97%), Positives = 223/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKSHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLL+ALD I EP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDQIQEP  226



>gb|EYU18863.1| hypothetical protein MIMGU_mgv1a006280mg [Erythranthe guttata]
 gb|EYU18864.1| hypothetical protein MIMGU_mgv1a006280mg [Erythranthe guttata]
 gb|EYU18866.1| hypothetical protein MIMGU_mgv11b005172mg [Erythranthe guttata]
 gb|EYU18867.1| hypothetical protein MIMGU_mgv1a006307mg [Erythranthe guttata]
Length=449

 Score =   464 bits (1193),  Expect = 5e-160, Method: Compositional matrix adjust.
 Identities = 220/226 (97%), Positives = 223/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSK RY+EIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKGRYEEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI EP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLISEP  226



>gb|AAK32834.1|AF361822_1 At1g07930/T6D22_3 [Arabidopsis thaliana]
 gb|AAL15385.1| At1g07930/T6D22_3 [Arabidopsis thaliana]
Length=449

 Score =   464 bits (1193),  Expect = 5e-160, Method: Compositional matrix adjust.
 Identities = 219/226 (97%), Positives = 224/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKR+IERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRLIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEI+KEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I+EP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEP  226



>dbj|BAC22125.1| eukaryotic elongation factor 1A [Bruguiera sexangula]
Length=449

 Score =   464 bits (1193),  Expect = 5e-160, Method: Compositional matrix adjust.
 Identities = 219/226 (97%), Positives = 224/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEK+HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKIHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATT KYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTSKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNP+KIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD+I EP
Sbjct  181  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMIQEP  226



>ref|XP_009126609.1| PREDICTED: elongation factor 1-alpha 1-like [Brassica rapa]
Length=449

 Score =   463 bits (1192),  Expect = 6e-160, Method: Compositional matrix adjust.
 Identities = 219/226 (97%), Positives = 224/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVI+RFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIDRFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEI+KEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I+EP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEP  226



>gb|ABA12224.1| translation elongation factor 1A-8 [Gossypium hirsutum]
Length=449

 Score =   463 bits (1192),  Expect = 6e-160, Method: Compositional matrix adjust.
 Identities = 220/226 (97%), Positives = 224/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEV SY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVYSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNP+KIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I+EP
Sbjct  181  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEP  226



>ref|XP_004984833.1| PREDICTED: elongation factor 1-alpha-like [Setaria italica]
 ref|XP_004984834.1| PREDICTED: elongation factor 1-alpha-like [Setaria italica]
Length=447

 Score =   463 bits (1192),  Expect = 6e-160, Method: Compositional matrix adjust.
 Identities = 221/226 (98%), Positives = 224/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKSHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKI FVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI+EP
Sbjct  181  VGYNPDKIHFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLINEP  226



>gb|ADR70875.1| eukaryotic translation elongation factor 1-alpha [Hevea brasiliensis]
Length=449

 Score =   463 bits (1192),  Expect = 6e-160, Method: Compositional matrix adjust.
 Identities = 220/226 (97%), Positives = 224/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEV+ Y+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVALYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNP+KIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI EP
Sbjct  181  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLILEP  226



>ref|XP_010456376.1| PREDICTED: elongation factor 1-alpha 1 isoform X7 [Camelina sativa]
Length=400

 Score =   461 bits (1187),  Expect = 6e-160, Method: Compositional matrix adjust.
 Identities = 220/226 (97%), Positives = 224/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEI+KEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I+EP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEP  226



>sp|Q03033.1|EF1A_WHEAT RecName: Full=Elongation factor 1-alpha; Short=EF-1-alpha [Triticum 
aestivum]
 gb|AAA34306.1| translation elongation factor 1 alpha-subunit [Triticum aestivum]
 emb|CAA90651.1| elongation factor 1-alpha [Hordeum vulgare subsp. vulgare]
 dbj|BAJ85443.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ87634.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gb|EMT04563.1| Elongation factor 1-alpha [Aegilops tauschii]
 gb|EMT21642.1| Elongation factor 1-alpha [Aegilops tauschii]
 gb|EMT30905.1| Elongation factor 1-alpha [Aegilops tauschii]
Length=447

 Score =   463 bits (1192),  Expect = 6e-160, Method: Compositional matrix adjust.
 Identities = 219/226 (97%), Positives = 224/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARY+EIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYEEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDK+PFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I+EP
Sbjct  181  VGYNPDKVPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEP  226



>gb|AGI78242.1| elongation factor 1 alpha [Caragana korshinskii]
Length=447

 Score =   463 bits (1192),  Expect = 7e-160, Method: Compositional matrix adjust.
 Identities = 219/226 (97%), Positives = 223/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEKVHINIVVIGHVDSGKSTTTGHLIY LGGIDKRV ERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYNLGGIDKRVFERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDK+PFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I+EP
Sbjct  181  VGYNPDKVPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEP  226



>ref|XP_010032227.1| PREDICTED: elongation factor 1-alpha-like [Eucalyptus grandis]
 gb|KCW51630.1| hypothetical protein EUGRSUZ_J01121 [Eucalyptus grandis]
Length=447

 Score =   463 bits (1192),  Expect = 7e-160, Method: Compositional matrix adjust.
 Identities = 219/226 (97%), Positives = 224/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCA+LIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAILIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSK+R+DEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKSRFDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I EP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQILEP  226



>ref|NP_001274875.1| elongation factor 1-alpha-like protein [Solanum tuberosum]
 gb|ABC01896.1| elongation factor 1-alpha-like protein [Solanum tuberosum]
Length=448

 Score =   463 bits (1191),  Expect = 8e-160, Method: Compositional matrix adjust.
 Identities = 219/226 (97%), Positives = 225/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEK+HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKIHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLL+ALD I+EP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDQINEP  226



>gb|ABB72813.1| elongation factor 1-alpha-like protein [Solanum tuberosum]
Length=448

 Score =   463 bits (1191),  Expect = 8e-160, Method: Compositional matrix adjust.
 Identities = 219/226 (97%), Positives = 225/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEK+HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKIHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLL+ALD I+EP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDQINEP  226



>gb|EYU18869.1| hypothetical protein MIMGU_mgv1a010191mg [Erythranthe guttata]
 gb|EYU18870.1| hypothetical protein MIMGU_mgv1a010191mg [Erythranthe guttata]
Length=319

 Score =   458 bits (1179),  Expect = 8e-160, Method: Compositional matrix adjust.
 Identities = 220/226 (97%), Positives = 223/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSK RY+EIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKGRYEEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI EP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLISEP  226



>emb|CDP08919.1| unnamed protein product [Coffea canephora]
Length=432

 Score =   462 bits (1190),  Expect = 8e-160, Method: Compositional matrix adjust.
 Identities = 221/226 (98%), Positives = 223/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKI FVPISGFEGDNMIERSTNLDWYKGPTLLEALD + EP
Sbjct  181  VGYNPDKINFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQVQEP  226



>dbj|BAC23049.1| Elongation factor 1-alpha [Solanum tuberosum]
 gb|AHL27103.1| eukaryotic elongation factor 1A protein [Solanum chacoense]
Length=448

 Score =   463 bits (1191),  Expect = 8e-160, Method: Compositional matrix adjust.
 Identities = 219/226 (97%), Positives = 225/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEK+HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKIHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLL+ALD I+EP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDQINEP  226



>emb|CAA34456.1| elongation factor 1-alpha [Arabidopsis thaliana]
Length=449

 Score =   463 bits (1191),  Expect = 8e-160, Method: Compositional matrix adjust.
 Identities = 219/226 (97%), Positives = 224/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAER+RGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERDRGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEI+KEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I+EP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEP  226



>ref|XP_008380545.1| PREDICTED: elongation factor 1-alpha-like [Malus domestica]
 ref|XP_008365661.1| PREDICTED: elongation factor 1-alpha [Malus domestica]
 ref|XP_009374568.1| PREDICTED: elongation factor 1-alpha-like [Pyrus x bretschneideri]
 ref|XP_009374577.1| PREDICTED: elongation factor 1-alpha-like [Pyrus x bretschneideri]
Length=447

 Score =   463 bits (1191),  Expect = 8e-160, Method: Compositional matrix adjust.
 Identities = 220/226 (97%), Positives = 224/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARY+EIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYEEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKI FVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI+EP
Sbjct  181  VGYNPDKIAFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLINEP  226



>gb|ABB86283.1| elongation factor-1 alpha-like [Solanum tuberosum]
Length=447

 Score =   463 bits (1191),  Expect = 8e-160, Method: Compositional matrix adjust.
 Identities = 219/226 (97%), Positives = 225/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEK+HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKIHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLL+ALD I+EP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDQINEP  226



>gb|AAN77897.1| elongation factor 1 alpha [Stevia rebaudiana]
Length=449

 Score =   463 bits (1191),  Expect = 9e-160, Method: Compositional matrix adjust.
 Identities = 219/226 (97%), Positives = 225/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEK+HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKIHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARY+EIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYEEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I+EP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEP  226



>gb|AAK25877.1|AF360167_1 putative translation elongation factor eEF-1 alpha chain A4 [Arabidopsis 
thaliana]
Length=449

 Score =   463 bits (1191),  Expect = 9e-160, Method: Compositional matrix adjust.
 Identities = 219/226 (97%), Positives = 223/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHA LAFTLGV+QMICCCNKMDATTPKYSKARYDEI+KEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHAFLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I+EP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEP  226



>ref|XP_006343452.1| PREDICTED: elongation factor 1-alpha-like [Solanum tuberosum]
 ref|XP_006343454.1| PREDICTED: elongation factor 1-alpha-like isoform X2 [Solanum 
tuberosum]
 ref|XP_006343455.1| PREDICTED: elongation factor 1-alpha-like [Solanum tuberosum]
 gb|ABB55388.1| elongation factor 1-alpha-like [Solanum tuberosum]
Length=448

 Score =   463 bits (1191),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 219/226 (97%), Positives = 225/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEK+HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKIHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLL+ALD I+EP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDQINEP  226



>dbj|BAM13877.1| elongation factor 1 alpha [Arum maculatum]
Length=447

 Score =   462 bits (1190),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 220/226 (97%), Positives = 225/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARY+EIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYEEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLL+ALDLI EP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDLILEP  226



>ref|XP_008385284.1| PREDICTED: elongation factor 1-alpha-like [Malus domestica]
 ref|XP_009338279.1| PREDICTED: elongation factor 1-alpha-like [Pyrus x bretschneideri]
Length=447

 Score =   462 bits (1190),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 219/226 (97%), Positives = 224/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCA+LIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAILIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARY+EIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYEEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I+EP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEP  226



>gb|AFC88830.1| putative elongation factor 1-alpha [Miscanthus sinensis]
Length=447

 Score =   462 bits (1190),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 220/226 (97%), Positives = 224/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKI FVPISGFEGDNMIERSTNLDWYKGPTLL+ALDLI+EP
Sbjct  181  VGYNPDKIHFVPISGFEGDNMIERSTNLDWYKGPTLLDALDLINEP  226



>ref|XP_002315287.1| hypothetical protein POPTR_0010s22620g [Populus trichocarpa]
 ref|XP_002315285.2| hypothetical protein POPTR_0010s22570g [Populus trichocarpa]
 ref|XP_002316351.2| hypothetical protein POPTR_0010s22620g [Populus trichocarpa]
 gb|ABK95341.1| unknown [Populus trichocarpa]
 gb|ABK95876.1| unknown [Populus trichocarpa]
 gb|EEF01458.1| hypothetical protein POPTR_0010s22620g [Populus trichocarpa]
 gb|EEF01456.2| hypothetical protein POPTR_0010s22570g [Populus trichocarpa]
 gb|EEF02522.2| hypothetical protein POPTR_0010s22620g [Populus trichocarpa]
Length=449

 Score =   462 bits (1190),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 219/226 (97%), Positives = 223/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETT+YYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTRYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLL+ALD I EP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDQIQEP  226



>ref|XP_007151789.1| hypothetical protein PHAVU_004G075100g [Phaseolus vulgaris]
 gb|ESW23783.1| hypothetical protein PHAVU_004G075100g [Phaseolus vulgaris]
Length=447

 Score =   462 bits (1190),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 219/226 (97%), Positives = 224/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALL+FTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLSFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLL+ALD I EP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDQISEP  226



>ref|XP_004309883.1| PREDICTED: elongation factor 1-alpha-like [Fragaria vesca subsp. 
vesca]
Length=447

 Score =   462 bits (1190),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 221/226 (98%), Positives = 223/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKI FVPISGFEGDNMIERSTNLDWYKGPTLLEALD I+EP
Sbjct  181  VGYNPDKIAFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEP  226



>emb|CDP07148.1| unnamed protein product [Coffea canephora]
Length=413

 Score =   461 bits (1186),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 221/226 (98%), Positives = 223/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKI FVPISGFEGDNMIERSTNLDWYKGPTLLEALD I EP
Sbjct  181  VGYNPDKINFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQIQEP  226



>ref|XP_009144204.1| PREDICTED: elongation factor 1-alpha 1-like [Brassica rapa]
Length=449

 Score =   462 bits (1190),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 219/226 (97%), Positives = 223/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEI+KEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERST LDWYKGPTLLEALD I+EP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTTLDWYKGPTLLEALDQINEP  226



>ref|XP_006858667.1| hypothetical protein AMTR_s00066p00072310 [Amborella trichopoda]
 gb|ERN20134.1| hypothetical protein AMTR_s00066p00072310 [Amborella trichopoda]
Length=447

 Score =   462 bits (1190),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 220/226 (97%), Positives = 223/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSK RY+EIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKGRYEEIVKEVSSYIKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI EP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIVEP  226



>dbj|BAC66180.1| elongation factor 1A [Avicennia marina]
Length=449

 Score =   462 bits (1190),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 217/226 (96%), Positives = 224/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEK HIN+VVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKSHINLVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALL+FTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLSFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYIKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNP+KIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD++ EP
Sbjct  181  VGYNPEKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMVQEP  226



>gb|AFP44110.1| elongation factor 1-alpha [Lycoris longituba]
Length=447

 Score =   462 bits (1189),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 219/226 (97%), Positives = 222/226 (98%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNP+KIPFVPISGFEGDNMIERS NLDWYKGP LLEALDLI EP
Sbjct  181  VGYNPEKIPFVPISGFEGDNMIERSNNLDWYKGPNLLEALDLISEP  226



>gb|KHN18669.1| Elongation factor 1-alpha [Glycine soja]
Length=447

 Score =   462 bits (1189),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 219/226 (97%), Positives = 224/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALL+FTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLSFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLL+ALD I EP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDQISEP  226



>ref|XP_002311106.1| ADR12-2 family protein [Populus trichocarpa]
 gb|ABK93897.1| unknown [Populus trichocarpa]
 gb|EEE88473.1| ADR12-2 family protein [Populus trichocarpa]
Length=449

 Score =   462 bits (1189),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 218/226 (96%), Positives = 223/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKSHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETT+YYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTRYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEI+KEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLL+ALD I EP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDQIQEP  226



>gb|AGV54713.1| elongation factor 1-alpha [Phaseolus vulgaris]
Length=447

 Score =   462 bits (1189),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 219/226 (97%), Positives = 224/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALL+FTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLSFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLL+ALD I EP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDQISEP  226



>gb|AEQ75495.1| elongation factor 1-alpha [Rosa multiflora]
Length=447

 Score =   462 bits (1189),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 220/226 (97%), Positives = 223/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKI FVPISGFEGDNMIERSTNLDWYKGPTLLEALD I+EP
Sbjct  181  VGYNPDKIAFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEP  226



>ref|XP_004962249.1| PREDICTED: elongation factor 1-alpha-like [Setaria italica]
 ref|XP_004962250.1| PREDICTED: elongation factor 1-alpha-like [Setaria italica]
 ref|XP_004962268.1| PREDICTED: elongation factor 1-alpha-like [Setaria italica]
 ref|XP_004962269.1| PREDICTED: elongation factor 1-alpha-like [Setaria italica]
 ref|XP_004962270.1| PREDICTED: elongation factor 1-alpha-like isoform X1 [Setaria 
italica]
 ref|XP_004962271.1| PREDICTED: elongation factor 1-alpha-like isoform X2 [Setaria 
italica]
Length=447

 Score =   462 bits (1189),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 220/226 (97%), Positives = 223/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKSHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKI FVPISGFEGDNMIERSTNLDWYKGPTLLEALD I+EP
Sbjct  181  VGYNPDKIAFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEP  226



>ref|XP_004962277.1| PREDICTED: elongation factor 1-alpha-like isoform X1 [Setaria 
italica]
 ref|XP_004962278.1| PREDICTED: elongation factor 1-alpha-like isoform X2 [Setaria 
italica]
 ref|XP_004962279.1| PREDICTED: elongation factor 1-alpha-like [Setaria italica]
Length=447

 Score =   462 bits (1188),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 220/226 (97%), Positives = 223/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKSHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKI FVPISGFEGDNMIERSTNLDWYKGPTLLEALD I+EP
Sbjct  181  VGYNPDKIAFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEP  226



>ref|XP_006417745.1| hypothetical protein EUTSA_v10007619mg [Eutrema salsugineum]
 ref|XP_006417746.1| hypothetical protein EUTSA_v10007619mg [Eutrema salsugineum]
 ref|XP_006417749.1| hypothetical protein EUTSA_v10007620mg [Eutrema salsugineum]
 ref|XP_006417750.1| hypothetical protein EUTSA_v10007618mg [Eutrema salsugineum]
 ref|XP_006417751.1| hypothetical protein EUTSA_v10007618mg [Eutrema salsugineum]
 ref|XP_006400853.1| hypothetical protein EUTSA_v10013526mg [Eutrema salsugineum]
 dbj|BAJ33644.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ36098.1| hypothetical protein EUTSA_v10007619mg [Eutrema salsugineum]
 gb|ESQ36099.1| hypothetical protein EUTSA_v10007619mg [Eutrema salsugineum]
 gb|ESQ36102.1| hypothetical protein EUTSA_v10007620mg [Eutrema salsugineum]
 gb|ESQ36103.1| hypothetical protein EUTSA_v10007618mg [Eutrema salsugineum]
 gb|ESQ36104.1| hypothetical protein EUTSA_v10007618mg [Eutrema salsugineum]
 gb|ESQ42306.1| hypothetical protein EUTSA_v10013526mg [Eutrema salsugineum]
Length=449

 Score =   462 bits (1189),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 219/226 (97%), Positives = 223/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSK RY+EIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKGRYEEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I+EP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEP  226



>gb|AHB86963.1| elongation factor 1-alpha [Sedum alfredii]
Length=447

 Score =   462 bits (1188),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 218/226 (96%), Positives = 225/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEK+HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKIHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNK+DATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKIDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLL+ALD+I EP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDMISEP  226



>gb|AFQ37422.1| translation elongation factor-1 alpha 1 [Larix kaempferi]
Length=447

 Score =   462 bits (1188),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 218/226 (96%), Positives = 223/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCA+LIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAILIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSK+RY+EIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKSRYEEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD + EP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQVSEP  226



>gb|EMS52529.1| Elongation factor 1-alpha [Triticum urartu]
 gb|EMS55225.1| Elongation factor 1-alpha [Triticum urartu]
Length=447

 Score =   462 bits (1188),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 218/226 (96%), Positives = 224/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARY+EIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYEEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNP+K+PFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I+EP
Sbjct  181  VGYNPEKVPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEP  226



>gb|AIZ74328.1| translation elongation factor 1-alpha [Pinus massoniana]
Length=448

 Score =   462 bits (1188),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 218/226 (96%), Positives = 223/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDAT+PKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATSPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            +GYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLL+ALD + EP
Sbjct  181  IGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDQVSEP  226



>sp|P25698.2|EF1A_SOYBN RecName: Full=Elongation factor 1-alpha; Short=EF-1-alpha [Glycine 
max]
 emb|CAA40182.1| eEF-1a [Glycine max]
Length=447

 Score =   462 bits (1188),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 219/226 (97%), Positives = 224/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALL+FTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLSFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLL+ALD I EP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDQISEP  226



>ref|XP_006600131.1| PREDICTED: elongation factor-1A isoform X1 [Glycine max]
 gb|KHN40184.1| Elongation factor 1-alpha [Glycine soja]
Length=447

 Score =   462 bits (1188),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 219/226 (97%), Positives = 224/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALL+FTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLSFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLL+ALD I EP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDQISEP  226



>ref|NP_001237425.1| elongation factor-1A [Glycine max]
 gb|ACI42861.1| elongation factor-1A [Glycine max]
Length=447

 Score =   462 bits (1188),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 219/226 (97%), Positives = 224/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALL+FTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLSFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLL+ALD I EP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDQISEP  226



>ref|XP_008380544.1| PREDICTED: elongation factor 1-alpha-like [Malus domestica]
Length=447

 Score =   462 bits (1188),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 219/226 (97%), Positives = 223/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETT+YYCTVIDAPGHRDFIKNMITGTSQADCA+LIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTRYYCTVIDAPGHRDFIKNMITGTSQADCAILIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKI FVPISGFEGDNMIERSTNLDWYKGPTLLEALD I+EP
Sbjct  181  VGYNPDKIAFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEP  226



>ref|XP_002312029.1| ADR12-2 family protein [Populus trichocarpa]
 gb|EEE89396.1| ADR12-2 family protein [Populus trichocarpa]
Length=449

 Score =   462 bits (1188),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 218/226 (96%), Positives = 223/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKSHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETT+YYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTRYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEI+KEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLL+ALD I EP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDQIQEP  226



>ref|XP_010669657.1| PREDICTED: elongation factor 1-alpha [Beta vulgaris subsp. vulgaris]
 ref|XP_010669662.1| PREDICTED: elongation factor 1-alpha [Beta vulgaris subsp. vulgaris]
Length=447

 Score =   462 bits (1188),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 217/226 (96%), Positives = 225/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEK+HI++VVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKIHISLVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFET KYYCTVIDAPGHRDFIKNMITGTSQADCA+LIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETNKYYCTVIDAPGHRDFIKNMITGTSQADCAILIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARY+EIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYEEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI+EP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLINEP  226



>ref|XP_010669660.1| PREDICTED: elongation factor 1-alpha-like [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010669661.1| PREDICTED: elongation factor 1-alpha-like [Beta vulgaris subsp. 
vulgaris]
Length=447

 Score =   462 bits (1188),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 217/226 (96%), Positives = 225/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEK+HI++VVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKIHISLVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFET KYYCTVIDAPGHRDFIKNMITGTSQADCA+LIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETNKYYCTVIDAPGHRDFIKNMITGTSQADCAILIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARY+EIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYEEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLI+EP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLINEP  226



>dbj|BAF02151.1| elongation factor 1-alpha [Arabidopsis thaliana]
Length=449

 Score =   462 bits (1188),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 219/226 (97%), Positives = 223/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEK HINIVVIGHV SGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVGSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEI+KEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I+EP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEP  226



>gb|ABV26710.1| elongation factor 1 alpha [Gerbera hybrid cultivar]
Length=449

 Score =   462 bits (1188),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 218/226 (96%), Positives = 225/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEK+HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKIHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSK+RY+EIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKSRYEEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I+EP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEP  226



>ref|XP_006424633.1| hypothetical protein CICLE_v10028443mg [Citrus clementina]
 ref|XP_006488149.1| PREDICTED: elongation factor 1-alpha-like [Citrus sinensis]
 gb|ESR37873.1| hypothetical protein CICLE_v10028443mg [Citrus clementina]
Length=447

 Score =   461 bits (1187),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 218/226 (96%), Positives = 224/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNP+K+PFVPISGFEGDNMIERSTNLDWYKGPTLL+ALD I+EP
Sbjct  181  VGYNPEKVPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDNINEP  226



>ref|XP_008656153.1| PREDICTED: elongation factor 1-alpha-like [Zea mays]
 ref|XP_008656154.1| PREDICTED: elongation factor 1-alpha-like [Zea mays]
 gb|AFW81463.1| putative translation elongation factor Tu family protein isoform 
1 [Zea mays]
 gb|AFW81464.1| putative translation elongation factor Tu family protein isoform 
2 [Zea mays]
 gb|AFW81465.1| putative translation elongation factor Tu family protein isoform 
3 [Zea mays]
Length=447

 Score =   461 bits (1187),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 220/226 (97%), Positives = 222/226 (98%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKSHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKI FVPISGFEGDNMIERSTNLDWYKGPTLLEALD I EP
Sbjct  181  VGYNPDKIAFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQITEP  226



>ref|XP_008656156.1| PREDICTED: elongation factor 1-alpha-like isoform X2 [Zea mays]
 gb|AFW81467.1| putative translation elongation factor Tu family protein isoform 
1 [Zea mays]
 gb|AFW81468.1| putative translation elongation factor Tu family protein isoform 
2 [Zea mays]
 gb|AFW81469.1| putative translation elongation factor Tu family protein isoform 
3 [Zea mays]
Length=447

 Score =   461 bits (1187),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 220/226 (97%), Positives = 222/226 (98%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKSHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKI FVPISGFEGDNMIERSTNLDWYKGPTLLEALD I EP
Sbjct  181  VGYNPDKIAFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQITEP  226



>ref|XP_002311107.1| ADR12-2 family protein [Populus trichocarpa]
 gb|ABK93463.1| unknown [Populus trichocarpa]
 gb|EEE88474.1| ADR12-2 family protein [Populus trichocarpa]
Length=449

 Score =   461 bits (1187),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 218/226 (96%), Positives = 223/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKSHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETT+YYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTRYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEI+KEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLL+ALD I EP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDQIQEP  226



>ref|NP_001105617.1| elongation factor alpha3 [Zea mays]
 gb|AAF42977.1| elongation factor 1 alpha [Zea mays]
Length=447

 Score =   461 bits (1187),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 220/226 (97%), Positives = 222/226 (98%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKSHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKI FVPISGFEGDNMIERSTNLDWYKGPTLLEALD I EP
Sbjct  181  VGYNPDKIAFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQITEP  226



>gb|AGT16893.1| elongation factor 1-alpha [Saccharum hybrid cultivar R570]
Length=447

 Score =   461 bits (1187),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 220/226 (97%), Positives = 222/226 (98%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKSHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKI FVPISGFEGDNMIERSTNLDWYKGPTLLEALD I EP
Sbjct  181  VGYNPDKIAFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQITEP  226



>ref|XP_006424629.1| hypothetical protein CICLE_v10028446mg [Citrus clementina]
 ref|XP_006424632.1| hypothetical protein CICLE_v10028445mg [Citrus clementina]
 ref|XP_006488147.1| PREDICTED: elongation factor 1-alpha isoform X1 [Citrus sinensis]
 ref|XP_006488148.1| PREDICTED: elongation factor 1-alpha-like [Citrus sinensis]
 gb|ESR37869.1| hypothetical protein CICLE_v10028446mg [Citrus clementina]
 gb|ESR37872.1| hypothetical protein CICLE_v10028445mg [Citrus clementina]
Length=447

 Score =   461 bits (1187),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 218/226 (96%), Positives = 224/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNP+K+PFVPISGFEGDNMIERSTNLDWYKGPTLL+ALD I+EP
Sbjct  181  VGYNPEKVPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDNINEP  226



>gb|AID52924.1| elongation factor 1-alpha [Carthamus tinctorius]
Length=449

 Score =   461 bits (1187),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 218/226 (96%), Positives = 224/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEK+HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKIHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSK+RY+EIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKSRYEEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I EP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQISEP  226



>ref|NP_001288407.1| elongation factor 1-alpha-like [Zea mays]
 gb|ACF87009.1| unknown [Zea mays]
Length=447

 Score =   461 bits (1187),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 220/226 (97%), Positives = 222/226 (98%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKSHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKI FVPISGFEGDNMIERSTNLDWYKGPTLLEALD I EP
Sbjct  181  VGYNPDKIAFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQITEP  226



>ref|NP_001105565.1| elongation factor alpha5 [Zea mays]
 gb|AAF42979.1| elongation factor 1 alpha [Zea mays]
Length=447

 Score =   461 bits (1186),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 220/226 (97%), Positives = 222/226 (98%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKSHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKI FVPISGFEGDNMIERSTNLDWYKGPTLLEALD I EP
Sbjct  181  VGYNPDKIAFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQITEP  226



>gb|AHZ58493.1| translation elongation factor alpha [Syntrichia caninervis]
Length=447

 Score =   461 bits (1186),  Expect = 5e-159, Method: Compositional matrix adjust.
 Identities = 218/226 (96%), Positives = 223/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARY+EI KEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYEEITKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERS+NLDWYKGPTLL+ALD + EP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSSNLDWYKGPTLLDALDSVSEP  226



>gb|AFW77593.1| putative translation elongation factor Tu family protein isoform 
1 [Zea mays]
 gb|AFW77594.1| putative translation elongation factor Tu family protein isoform 
2 [Zea mays]
Length=447

 Score =   461 bits (1186),  Expect = 5e-159, Method: Compositional matrix adjust.
 Identities = 220/226 (97%), Positives = 222/226 (98%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKSHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKI FVPISGFEGDNMIERSTNLDWYKGPTLLEALD I EP
Sbjct  181  VGYNPDKIAFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQITEP  226



>gb|AAL57653.1| At1g07930/T6D22_3 [Arabidopsis thaliana]
Length=449

 Score =   461 bits (1186),  Expect = 5e-159, Method: Compositional matrix adjust.
 Identities = 218/226 (96%), Positives = 223/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCN +DATTPKYSKARYDEI+KEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNNIDATTPKYSKARYDEIIKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I+EP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEP  226



>gb|ACR38047.1| unknown [Zea mays]
 gb|AFW77623.1| elongation factor alpha1 [Zea mays]
Length=447

 Score =   461 bits (1186),  Expect = 5e-159, Method: Compositional matrix adjust.
 Identities = 220/226 (97%), Positives = 222/226 (98%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKSHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKI FVPISGFEGDNMIERSTNLDWYKGPTLLEALD I EP
Sbjct  181  VGYNPDKIAFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQITEP  226



>ref|XP_006381487.1| hypothetical protein POPTR_0006s13310g [Populus trichocarpa]
 gb|ABK95720.1| unknown [Populus trichocarpa]
 gb|ERP59284.1| hypothetical protein POPTR_0006s13310g [Populus trichocarpa]
Length=447

 Score =   461 bits (1186),  Expect = 5e-159, Method: Compositional matrix adjust.
 Identities = 218/226 (96%), Positives = 224/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETT+YYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTRYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSK+R+DEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKSRFDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLL+ALD I EP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDQISEP  226



>sp|P43643.1|EF1A_TOBAC RecName: Full=Elongation factor 1-alpha; Short=EF-1-alpha; AltName: 
Full=Vitronectin-like adhesion protein 1; Short=PVN1 
[Nicotiana tabacum]
 gb|AAA20836.1| vitronectin-like adhesion protein [Nicotiana tabacum]
Length=447

 Score =   461 bits (1186),  Expect = 5e-159, Method: Compositional matrix adjust.
 Identities = 219/225 (97%), Positives = 223/225 (99%), Gaps = 0/225 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGV+QMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHE  733
            VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD I++
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQIND  225



>ref|XP_002968422.1| hypothetical protein SELMODRAFT_169717 [Selaginella moellendorffii]
 gb|EFJ30676.1| hypothetical protein SELMODRAFT_169717 [Selaginella moellendorffii]
Length=447

 Score =   461 bits (1186),  Expect = 5e-159, Method: Compositional matrix adjust.
 Identities = 218/226 (96%), Positives = 221/226 (98%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKR IERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKAHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRTIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFET KYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETNKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARY+EIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYEEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALD + EP
Sbjct  181  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQVTEP  226



>dbj|BAC22126.1| eukaryotic elongation factor 1A [Suaeda japonica]
Length=447

 Score =   461 bits (1186),  Expect = 5e-159, Method: Compositional matrix adjust.
 Identities = 215/226 (95%), Positives = 225/226 (99%), Gaps = 0/226 (0%)
 Frame = +2

Query  59   MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  238
            MGKEK+HI++VVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKIHISLVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  239  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT  418
            DKLKAERERGITIDIALWKFET KYYCTVIDAPGHRDFIKNMITGTSQADCA+LIIDSTT
Sbjct  61   DKLKAERERGITIDIALWKFETNKYYCTVIDAPGHRDFIKNMITGTSQADCAILIIDSTT  120

Query  419  GGFEAGISKDGQTREHALLAFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYMKK  598
            GGFEAGISKDGQTREHALL+FTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSY+KK
Sbjct  121  GGFEAGISKDGQTREHALLSFTLGVRQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK  180

Query  599  VGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLIHEP  736
            VGYNP+K+PFVPISGFEGDNMIERSTNLDWYKGPTLLEALD+I+EP
Sbjct  181  VGYNPEKVPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDMINEP  226



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1340626501500