BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF046I06

Length=699
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|NP_001234196.1|  FtsH-like protein precursor                        285   9e-88   
ref|XP_006342112.1|  PREDICTED: ATP-dependent zinc metalloproteas...    275   8e-84   Solanum tuberosum [potatoes]
sp|Q39444.1|FTSH_CAPAN  RecName: Full=ATP-dependent zinc metallop...    257   2e-77   Capsicum annuum
ref|XP_009767982.1|  PREDICTED: ATP-dependent zinc metalloproteas...    255   2e-76   Nicotiana sylvestris
ref|XP_011101039.1|  PREDICTED: ATP-dependent zinc metalloproteas...    253   2e-75   Sesamum indicum [beniseed]
ref|XP_009606853.1|  PREDICTED: ATP-dependent zinc metalloproteas...    252   6e-75   Nicotiana tomentosiformis
gb|KDP36832.1|  hypothetical protein JCGZ_08123                         249   4e-74   Jatropha curcas
ref|XP_009618840.1|  PREDICTED: ATP-dependent zinc metalloproteas...    246   6e-73   Nicotiana tomentosiformis
ref|XP_002510649.1|  Cell division protease ftsH, putative              245   1e-72   
gb|KJB14312.1|  hypothetical protein B456_002G118800                    242   3e-72   Gossypium raimondii
sp|O82150.2|FTSH_TOBAC  RecName: Full=ATP-dependent zinc metallop...    244   3e-72   Nicotiana tabacum [American tobacco]
gb|KJB14313.1|  hypothetical protein B456_002G118800                    242   4e-72   Gossypium raimondii
gb|KJB14314.1|  hypothetical protein B456_002G118800                    243   6e-72   Gossypium raimondii
gb|KJB14315.1|  hypothetical protein B456_002G118800                    243   9e-72   Gossypium raimondii
emb|CDP03477.1|  unnamed protein product                                231   1e-71   Coffea canephora [robusta coffee]
gb|KHG10496.1|  ATP-dependent zinc metalloprotease FTSH, chloropl...    243   1e-71   Gossypium arboreum [tree cotton]
emb|CDP07308.1|  unnamed protein product                                242   2e-71   Coffea canephora [robusta coffee]
ref|XP_007017988.1|  FTSH protease 1 isoform 2                          238   6e-71   
ref|XP_009777632.1|  PREDICTED: ATP-dependent zinc metalloproteas...    241   7e-71   Nicotiana sylvestris
ref|XP_007017987.1|  FtsH extracellular protease family isoform 1       239   2e-70   
emb|CDP18582.1|  unnamed protein product                                226   6e-70   Coffea canephora [robusta coffee]
gb|EPS73399.1|  precursor of protein cell division protease ftsh-...    238   8e-70   Genlisea aurea
ref|XP_010242853.1|  PREDICTED: ATP-dependent zinc metalloproteas...    238   1e-69   Nelumbo nucifera [Indian lotus]
gb|KHG14732.1|  ATP-dependent zinc metalloprotease FTSH, chloropl...    234   1e-68   Gossypium arboreum [tree cotton]
ref|XP_011074733.1|  PREDICTED: ATP-dependent zinc metalloproteas...    233   7e-68   Sesamum indicum [beniseed]
gb|KDO85047.1|  hypothetical protein CISIN_1g004921mg                   229   2e-67   Citrus sinensis [apfelsine]
gb|KJB57986.1|  hypothetical protein B456_009G188700                    228   2e-67   Gossypium raimondii
gb|EYU17514.1|  hypothetical protein MIMGU_mgv1a004291mg                228   2e-67   Erythranthe guttata [common monkey flower]
ref|XP_006435323.1|  hypothetical protein CICLE_v10000422mg             231   4e-67   Citrus clementina [clementine]
ref|XP_006473758.1|  PREDICTED: ATP-dependent zinc metalloproteas...    231   4e-67   Citrus sinensis [apfelsine]
ref|XP_004145531.1|  PREDICTED: ATP-dependent zinc metalloproteas...    230   6e-67   Cucumis sativus [cucumbers]
emb|CAN74077.1|  hypothetical protein VITISV_000978                     228   3e-66   Vitis vinifera
gb|KJB57987.1|  hypothetical protein B456_009G188700                    228   3e-66   Gossypium raimondii
ref|XP_009334282.1|  PREDICTED: ATP-dependent zinc metalloproteas...    228   3e-66   
ref|XP_008452941.1|  PREDICTED: ATP-dependent zinc metalloproteas...    228   3e-66   Cucumis melo [Oriental melon]
ref|XP_009334277.1|  PREDICTED: ATP-dependent zinc metalloproteas...    228   4e-66   Pyrus x bretschneideri [bai li]
ref|XP_002285925.1|  PREDICTED: ATP-dependent zinc metalloproteas...    226   2e-65   Vitis vinifera
ref|XP_004291222.1|  PREDICTED: ATP-dependent zinc metalloproteas...    226   2e-65   Fragaria vesca subsp. vesca
ref|XP_010527682.1|  PREDICTED: ATP-dependent zinc metalloproteas...    226   3e-65   Tarenaya hassleriana [spider flower]
ref|XP_008377091.1|  PREDICTED: ATP-dependent zinc metalloproteas...    225   5e-65   
ref|XP_010060660.1|  PREDICTED: ATP-dependent zinc metalloproteas...    224   2e-64   Eucalyptus grandis [rose gum]
ref|XP_007221904.1|  hypothetical protein PRUPE_ppa002083mg             224   2e-64   Prunus persica
ref|XP_008221155.1|  PREDICTED: ATP-dependent zinc metalloproteas...    223   3e-64   Prunus mume [ume]
ref|XP_011034903.1|  PREDICTED: LOW QUALITY PROTEIN: ATP-dependen...    218   2e-62   Populus euphratica
ref|XP_002301927.1|  Cell division protein ftsH                         218   2e-62   Populus trichocarpa [western balsam poplar]
dbj|BAH56755.1|  AT5G42270                                              214   1e-61   Arabidopsis thaliana [mouse-ear cress]
ref|NP_568604.1|  ATP-dependent zinc metalloprotease FTSH 5             215   2e-61   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010094593.1|  ATP-dependent zinc metalloprotease FTSH            214   5e-61   Morus notabilis
ref|XP_002865544.1|  hypothetical protein ARALYDRAFT_494803             213   9e-61   
gb|EYU36827.1|  hypothetical protein MIMGU_mgv1a002176mg                211   9e-60   Erythranthe guttata [common monkey flower]
gb|EYU36826.1|  hypothetical protein MIMGU_mgv1a002176mg                210   1e-59   Erythranthe guttata [common monkey flower]
gb|KEH36288.1|  ATP-dependent zinc metalloprotease FTSH protein         204   8e-59   Medicago truncatula
ref|XP_010494162.1|  PREDICTED: ATP-dependent zinc metalloproteas...    207   2e-58   Camelina sativa [gold-of-pleasure]
ref|XP_006279579.1|  hypothetical protein CARUB_v10025980mg             206   5e-58   Capsella rubella
gb|KEH36287.1|  ATP-dependent zinc metalloprotease FTSH protein         205   1e-57   Medicago truncatula
ref|XP_011041264.1|  PREDICTED: ATP-dependent zinc metalloproteas...    203   4e-57   Populus euphratica
ref|XP_010692838.1|  PREDICTED: ATP-dependent zinc metalloproteas...    203   4e-57   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002306970.2|  Cell division protein ftsH                         202   8e-57   Populus trichocarpa [western balsam poplar]
sp|Q9BAE0.1|FTSH_MEDSA  RecName: Full=ATP-dependent zinc metallop...    199   2e-55   Medicago sativa [alfalfa]
emb|CDY01840.1|  BnaC06g28800D                                          197   9e-55   
ref|XP_010442152.1|  PREDICTED: ATP-dependent zinc metalloproteas...    196   1e-54   Camelina sativa [gold-of-pleasure]
ref|XP_003527434.1|  PREDICTED: ATP-dependent zinc metalloproteas...    194   1e-53   Glycine max [soybeans]
ref|XP_003523186.1|  PREDICTED: ATP-dependent zinc metalloproteas...    192   4e-53   
ref|XP_006409314.1|  hypothetical protein EUTSA_v10022579mg             192   6e-53   Eutrema salsugineum [saltwater cress]
gb|KFK31340.1|  hypothetical protein AALP_AA6G099600                    191   8e-53   Arabis alpina [alpine rockcress]
ref|XP_006391231.1|  hypothetical protein EUTSA_v10018191mg             191   1e-52   Eutrema salsugineum [saltwater cress]
ref|XP_009105314.1|  PREDICTED: ATP-dependent zinc metalloproteas...    191   2e-52   Brassica rapa
ref|XP_010479476.1|  PREDICTED: ATP-dependent zinc metalloproteas...    189   5e-52   Camelina sativa [gold-of-pleasure]
ref|XP_010479477.1|  PREDICTED: ATP-dependent zinc metalloproteas...    189   6e-52   Camelina sativa [gold-of-pleasure]
ref|XP_002894238.1|  hypothetical protein ARALYDRAFT_891950             189   7e-52   Arabidopsis lyrata subsp. lyrata
ref|XP_010500575.1|  PREDICTED: ATP-dependent zinc metalloproteas...    189   8e-52   Camelina sativa [gold-of-pleasure]
ref|XP_007136141.1|  hypothetical protein PHAVU_009G021400g             187   3e-51   Phaseolus vulgaris [French bean]
ref|XP_004500893.1|  PREDICTED: ATP-dependent zinc metalloproteas...    187   3e-51   Cicer arietinum [garbanzo]
ref|XP_008812082.1|  PREDICTED: ATP-dependent zinc metalloproteas...    187   3e-51   Phoenix dactylifera
emb|CDX96068.1|  BnaA07g26630D                                          185   1e-50   
ref|XP_010941398.1|  PREDICTED: ATP-dependent zinc metalloproteas...    184   3e-50   Elaeis guineensis
ref|XP_010482002.1|  PREDICTED: ATP-dependent zinc metalloproteas...    182   2e-49   Camelina sativa [gold-of-pleasure]
ref|XP_006306893.1|  hypothetical protein CARUB_v10008446mg             179   1e-48   Capsella rubella
dbj|BAN33747.1|  ATP-dependent metalloprotease FtsH                     177   7e-48   Chrysanthemum x morifolium [florist's chrysanthemum]
ref|XP_009395377.1|  PREDICTED: ATP-dependent zinc metalloproteas...    177   8e-48   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009418681.1|  PREDICTED: ATP-dependent zinc metalloproteas...    172   4e-46   Musa acuminata subsp. malaccensis [pisang utan]
gb|AFW75732.1|  hypothetical protein ZEAMMB73_601488                    167   1e-45   
ref|NP_564563.1|  ATP-dependent zinc metalloprotease FTSH 1             171   2e-45   Arabidopsis thaliana [mouse-ear cress]
emb|CAA68141.1|  chloroplast FtsH protease                              171   2e-45   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006828956.1|  hypothetical protein AMTR_s00001p00232760          171   2e-45   Amborella trichopoda
gb|AFW75733.1|  hypothetical protein ZEAMMB73_601488                    167   2e-44   
ref|NP_001058625.1|  Os06g0725900                                       166   8e-44   
gb|EAZ38336.1|  hypothetical protein OsJ_22711                          166   8e-44   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004966506.1|  PREDICTED: ATP-dependent zinc metalloproteas...    166   1e-43   Setaria italica
ref|XP_002960384.1|  hypothetical protein SELMODRAFT_139726             162   2e-42   
ref|XP_003563253.1|  PREDICTED: ATP-dependent zinc metalloproteas...    155   6e-40   Brachypodium distachyon [annual false brome]
gb|KIZ07525.1|  cell division protease FtsH                             135   2e-36   Monoraphidium neglectum
ref|XP_001760664.1|  predicted protein                                  142   2e-35   
ref|XP_001753657.1|  predicted protein                                  140   1e-34   
emb|CEF99105.1|  P-loop containing nucleoside triphosphate hydrolase    137   1e-33   Ostreococcus tauri
ref|XP_003057154.1|  predicted protein                                  137   2e-33   Micromonas pusilla CCMP1545
ref|XP_001690889.1|  membrane AAA-metalloprotease                       137   2e-33   Chlamydomonas reinhardtii
gb|KIZ03250.1|  cell division protease FtsH                             137   2e-33   Monoraphidium neglectum
ref|XP_002948337.1|  hypothetical protein VOLCADRAFT_80122              137   3e-33   Volvox carteri f. nagariensis
ref|XP_003081278.1|  FTSH_MEDSA Cell division protein ftsH homolo...    135   6e-33   
emb|CAA73318.1|  ATPase                                                 135   1e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_005843263.1|  hypothetical protein CHLNCDRAFT_141387             129   2e-32   Chlorella variabilis
ref|XP_007510744.1|  cell division protein FtsH2                        132   1e-31   Bathycoccus prasinos
ref|XP_005650371.1|  membrane AAA-metalloprotease                       129   2e-30   Coccomyxa subellipsoidea C-169
ref|XP_001419590.1|  predicted protein                                  127   4e-30   Ostreococcus lucimarinus CCE9901
ref|XP_002505995.1|  hypothetical protein MICPUN_106506                 124   1e-28   Micromonas commoda
ref|XP_011396167.1|  ATP-dependent zinc metalloprotease FTSH 5, c...    118   1e-26   Auxenochlorella protothecoides
gb|EEC81336.1|  hypothetical protein OsI_24516                          115   8e-26   Oryza sativa Indica Group [Indian rice]
gb|AFW63099.1|  hypothetical protein ZEAMMB73_047704                  97.4    2e-20   
ref|WP_015220601.1|  membrane protease FtsH catalytic subunit         77.0    1e-12   Cyanobacterium aponinum
ref|WP_015955558.1|  cell division protein FtsH                       72.4    3e-11   Cyanothece sp. PCC 7424
ref|WP_015230925.1|  ATP-dependent metalloprotease FtsH               72.0    5e-11   Dactylococcopsis salina
ref|WP_015227551.1|  membrane protease FtsH catalytic subunit         71.6    6e-11   Halothece sp. PCC 7418
ref|WP_013320241.1|  cell division protein FtsH                       70.9    1e-10   Cyanothece sp. PCC 7822
ref|WP_009630197.1|  ATP-dependent metalloprotease FtsH               70.9    1e-10   Synechocystis sp. PCC 7509
ref|WP_015204207.1|  membrane protease FtsH catalytic subunit         69.7    2e-10   Crinalium epipsammum
ref|WP_015188582.1|  membrane protease FtsH catalytic subunit         69.3    3e-10   Cyanobacteria [blue-green bacteria]
ref|WP_036001623.1|  cell division protein FtsH                       68.6    6e-10   [Leptolyngbya] sp. JSC-1
ref|WP_015224048.1|  membrane protease FtsH catalytic subunit         67.8    1e-09   
ref|WP_026794256.1|  MULTISPECIES: cell division protein FtsH         67.4    2e-09   Planktothrix
ref|WP_027255466.1|  cell division protein FtsH                       67.4    2e-09   Planktothrix agardhii
ref|WP_027249137.1|  cell division protein FtsH                       67.0    2e-09   Planktothrix agardhii
ref|WP_042152619.1|  cell division protein FtsH                       67.0    2e-09   Planktothrix agardhii
ref|WP_026786321.1|  cell division protein FtsH                       67.0    2e-09   Planktothrix rubescens
ref|WP_017293936.1|  cell division protein FtsH                       66.6    3e-09   Geminocystis herdmanii
ref|WP_012627305.1|  cell division protein FtsH                       65.5    5e-09   Cyanothece sp. PCC 7425
ref|WP_015129349.1|  membrane protease FtsH catalytic subunit         65.5    5e-09   Calothrix sp. PCC 7507
ref|XP_005834056.1|  hypothetical protein GUITHDRAFT_86435            65.1    7e-09   Guillardia theta CCMP2712
gb|EGJ33321.1|  membrane protease FtsH catalytic subunit              65.1    7e-09   Moorea producens 3L
ref|XP_005713345.1|  cell division protein FtsH                       65.1    7e-09   Chondrus crispus [carageen]
ref|WP_002793446.1|  cell division protein FtsH                       65.1    8e-09   Microcystis aeruginosa
ref|WP_002784350.1|  Cell division protein FtsH; ATP-dependent zi...  65.1    8e-09   Microcystis aeruginosa
ref|WP_002742170.1|  cell division protein FtsH                       65.1    8e-09   Microcystis
ref|WP_044492620.1|  cell division protein FtsH                       65.1    8e-09   Moorea producens
ref|WP_002797753.1|  cell division protein FtsH                       65.1    8e-09   Microcystis aeruginosa
ref|WP_002801795.1|  cell division protein FtsH                       65.1    9e-09   Microcystis aeruginosa
ref|WP_012264056.1|  cell division protein FtsH                       64.7    9e-09   Microcystis aeruginosa
dbj|GAL91410.1|  cell division protein FtsH                           64.7    1e-08   Microcystis aeruginosa NIES-44
ref|WP_002737367.1|  ATP-dependent zinc metalloprotease FtsH 3        64.7    1e-08   Microcystis aeruginosa
ref|WP_002763074.1|  MULTISPECIES: cell division protein FtsH         64.7    1e-08   Microcystis
ref|WP_017303138.1|  cell division protein FtsH                       64.3    1e-08   Spirulina subsalsa
ref|WP_006623490.1|  cell division protein FtsH                       63.9    2e-08   
ref|WP_006618677.1|  FtsH peptidase                                   63.9    2e-08   Arthrospira platensis
ref|WP_006669335.1|  MULTISPECIES: cell division protein FtsH         63.9    2e-08   Arthrospira
ref|WP_002771354.1|  cell division protein FtsH                       63.2    3e-08   Microcystis aeruginosa
ref|WP_007356988.1|  MULTISPECIES: cell division protein FtsH         62.4    5e-08   Kamptonema
ref|WP_015173051.1|  membrane protease FtsH catalytic subunit         62.4    7e-08   Geitlerinema sp. PCC 7407
ref|WP_035174132.1|  cell division protein FtsH                       57.8    8e-08   
ref|WP_008316727.1|  ATP-dependent metalloprotease FtsH               62.0    8e-08   Leptolyngbya sp. PCC 6406
ref|WP_015177320.1|  membrane protease FtsH catalytic subunit         61.6    1e-07   Oscillatoria nigro-viridis
ref|WP_006633639.1|  cell division protein FtsH                       61.6    1e-07   Microcoleus vaginatus
ref|WP_017653544.1|  cell division protein FtsH                       61.6    1e-07   Fortiea contorta
ref|NP_001173800.1|  Os04g0220500                                     62.0    1e-07   
ref|WP_039716361.1|  cell division protein FtsH                       61.6    1e-07   
ref|WP_015156116.1|  membrane protease FtsH catalytic subunit         61.6    1e-07   Cyanobacteria [blue-green bacteria]
ref|WP_041036156.1|  cell division protein FtsH                       61.2    1e-07   Tolypothrix campylonemoides
ref|WP_009341877.1|  cell division protein FtsH                       61.2    1e-07   Aphanizomenonaceae
ref|WP_028090468.1|  cell division protein FtsH                       61.2    1e-07   Dolichospermum circinale
ref|WP_006278775.1|  cell division protein FtsH                       61.2    2e-07   Cylindrospermopsis
ref|WP_006102026.1|  cell division protein FtsH                       60.8    2e-07   Coleofasciculus chthonoplastes
ref|WP_009782358.1|  cell division protein FtsH                       60.8    2e-07   Lyngbya sp. PCC 8106
ref|WP_006198086.1|  cell division protein FtsH                       60.8    2e-07   Nodularia spumigena
ref|WP_015214216.1|  membrane protease FtsH catalytic subunit         60.8    2e-07   Anabaena cylindrica
ref|WP_028082599.1|  cell division protein FtsH                       60.5    3e-07   Dolichospermum circinale
ref|WP_023067153.1|  ATP-dependent zinc metalloprotease FtsH 3        60.5    3e-07   Lyngbya aestuarii
ref|WP_038331075.1|  cell division protein FtsH                       60.5    3e-07   filamentous cyanobacterium ESFC-1
ref|WP_019497657.1|  hypothetical protein                             56.6    3e-07   Calothrix sp. PCC 7103
ref|XP_005708438.1|  AAA-type ATPase                                  60.5    3e-07   Galdieria sulphuraria
gb|ACN35033.1|  unknown                                               60.1    3e-07   Zea mays [maize]
gb|EWM30233.1|  atp-dependent metalloprotease                         60.1    4e-07   Nannochloropsis gaditana
ref|WP_015208761.1|  membrane protease FtsH catalytic subunit         59.7    5e-07   Cylindrospermum stagnale
ref|WP_015191439.1|  ATP-dependent metalloprotease FtsH               59.3    6e-07   Stanieria cyanosphaera
ref|WP_015143924.1|  ATP-dependent metalloprotease FtsH               59.3    6e-07   Pleurocapsa minor
emb|CBN76650.1|  FtsH protease                                        59.3    6e-07   Ectocarpus siliculosus
gb|KIJ85386.1|  cell division protein FtsH                            59.3    6e-07   Scytonema tolypothrichoides VB-61278
ref|WP_017291153.1|  cell division protein FtsH                       59.3    6e-07   Leptolyngbya boryana
ref|WP_011613138.1|  cell division protein FtsH                       59.3    7e-07   Trichodesmium erythraeum
ref|WP_039726378.1|  MULTISPECIES: cell division protein FtsH         59.3    7e-07   Lyngbya confervoides
ref|WP_015146710.1|  membrane protease FtsH catalytic subunit         58.9    7e-07   Oscillatoria acuminata
ref|WP_015079544.1|  ATP-dependent metalloprotease HflB (FtsH)        58.5    1e-06   Anabaena sp. 90
ref|WP_027401619.1|  cell division protein FtsH                       58.5    1e-06   Nostocales
ref|WP_016949229.1|  cell division protein FtsH                       58.5    1e-06   Anabaena sp. PCC 7108
ref|WP_026099187.1|  cell division protein FtsH                       58.2    1e-06   Prochlorothrix hollandica
ref|WP_016876546.1|  cell division protein FtsH                       58.2    2e-06   Chlorogloeopsis fritschii
gb|EEE60537.1|  hypothetical protein OsJ_13877                        58.2    2e-06   Oryza sativa Japonica Group [Japonica rice]
ref|WP_015116388.1|  membrane protease FtsH catalytic subunit         57.8    2e-06   Rivularia sp. PCC 7116
ref|WP_013189950.1|  cell division protein FtsH                       57.8    2e-06   Trichormus azollae
ref|WP_006528450.1|  ATP-dependent metalloprotease FtsH               57.4    2e-06   Gloeocapsa sp. PCC 73106
ref|WP_022606782.1|  ATP-dependent metalloprotease FtsH               57.4    3e-06   Rubidibacter lacunae
ref|WP_036531425.1|  cell division protein FtsH                       57.4    3e-06   Neosynechococcus sphagnicola
ref|WP_015139560.1|  ATP-dependent metalloprotease FtsH               57.4    3e-06   Nostoc sp. PCC 7524
ref|WP_010995433.1|  cell division protein FtsH                       57.0    4e-06   Nostocaceae
ref|WP_015180805.1|  ATP-dependent metalloprotease FtsH               57.0    4e-06   Microcoleus sp. PCC 7113
ref|WP_011317448.1|  cell division protein FtsH                       57.0    4e-06   Trichormus variabilis
ref|WP_017291152.1|  hypothetical protein                             53.5    5e-06   Leptolyngbya boryana
ref|XP_002177215.1|  predicted protein                                56.2    6e-06   Phaeodactylum tricornutum CCAP 1055/1
ref|WP_011055986.1|  cell division protein FtsH                       56.2    6e-06   Thermosynechococcus
ref|WP_026730933.1|  cell division protein FtsH                       56.2    8e-06   Fischerella sp. PCC 9605
ref|WP_011243527.1|  MULTISPECIES: cell division protein FtsH         55.8    1e-05   Synechococcus
ref|WP_024125602.1|  ATP-dependent metalloprotease FtsH3              55.8    1e-05   Thermosynechococcus sp. NK55a
gb|KIE06858.1|  cell division protein FtsH                            55.8    1e-05   Tolypothrix bouteillei VB521301
ref|WP_012411183.1|  cell division protein FtsH                       55.5    1e-05   Nostoc
ref|WP_035992112.1|  cell division protein FtsH                       55.5    1e-05   Leptolyngbya sp. KIOST-1
ref|WP_017320405.1|  cell division protein FtsH                       55.5    1e-05   cyanobacterium PCC 7702
ref|WP_027841867.1|  cell division protein FtsH                       55.5    1e-05   Mastigocoleus testarum
ref|WP_006511599.1|  ATP-dependent metalloprotease FtsH               55.5    1e-05   Xenococcus sp. PCC 7305
ref|WP_017715041.1|  cell division protein FtsH                       55.5    1e-05   Oscillatoria sp. PCC 10802
ref|WP_015114520.1|  membrane protease FtsH catalytic subunit         55.5    1e-05   Nostoc sp. PCC 7107
ref|WP_019506377.1|  cell division protein FtsH                       55.1    1e-05   Pleurocapsa sp. PCC 7319
ref|WP_015124055.1|  membrane protease FtsH catalytic subunit         55.1    2e-05   Synechococcus sp. PCC 6312
ref|WP_006518079.1|  membrane protease FtsH catalytic subunit         54.7    2e-05   Leptolyngbya sp. PCC 7375
ref|WP_017297226.1|  cell division protein FtsH                       54.3    3e-05   Nodosilinea nodulosa
ref|WP_029633975.1|  cell division protein FtsH [                     54.3    4e-05   [Scytonema hofmanni] UTEX B 1581
ref|WP_006453661.1|  cell division protein FtsH                       53.9    4e-05   Synechococcus sp. PCC 7335
ref|XP_005708136.1|  AAA-type ATPase                                  53.9    4e-05   Galdieria sulphuraria
gb|EJK55379.1|  hypothetical protein THAOC_24887                      53.9    4e-05   Thalassiosira oceanica
ref|WP_017315070.1|  cell division protein FtsH                       53.5    6e-05   Mastigocladopsis repens
ref|WP_036486108.1|  cell division protein FtsH                       53.1    8e-05   Myxosarcina sp. GI1
ref|XP_002287516.1|  metalloprotease                                  53.1    8e-05   Thalassiosira pseudonana CCMP1335
ref|WP_015133797.1|  membrane protease FtsH catalytic subunit         52.8    9e-05   Leptolyngbya sp. PCC 7376
ref|WP_032525350.1|  hypothetical protein                             49.7    9e-05   
ref|WP_024546675.1|  cell division protein FtsH                       52.8    1e-04   Synechococcus
ref|WP_036972775.1|  cell division protein FtsH                       51.6    1e-04   
ref|WP_017743955.1|  cell division protein FtsH                       52.4    1e-04   Scytonema hofmannii
ref|WP_023072541.1|  membrane protease catalytic subunit              52.0    2e-04   Leptolyngbya sp. Heron Island J
ref|WP_011363329.1|  cell division protein FtsH                       52.0    2e-04   Synechococcus sp. CC9605
gb|AHF62715.1|  ATP-dependent metalloprotease FtsH                    51.6    2e-04   Synechococcus sp. WH 8109
ref|WP_012305681.1|  MULTISPECIES: cell division protein FtsH         51.6    3e-04   Synechococcus
ref|WP_035155002.1|  cell division protein FtsH                       51.6    3e-04   Calothrix sp. 336/3
ref|WP_035262561.1|  cell division protein FtsH                       51.6    3e-04   Actibacterium mucosum
ref|WP_025913223.1|  hypothetical protein                             49.3    3e-04   
ref|WP_036913475.1|  MULTISPECIES: cell division protein FtsH         51.2    4e-04   Prochlorococcus
ref|WP_013506914.1|  ATP-dependent metalloprotease                    51.2    4e-04   Desulfurispirillum indicum
ref|WP_011131165.1|  cell division protein FtsH                       51.2    4e-04   Prochlorococcus marinus
ref|WP_011826974.1|  cell division protein FtsH                       51.2    4e-04   Prochlorococcus sp. MIT 1306
ref|WP_019494535.1|  cell division protein FtsH                       50.8    4e-04   Calothrix sp. PCC 7103
ref|WP_009455956.1|  MULTISPECIES: cell division protein FtsH         50.8    5e-04   Fischerella thermalis
ref|WP_016867387.1|  cell division protein FtsH                       50.8    5e-04   Fischerella muscicola
ref|WP_026723275.1|  cell division protein FtsH                       50.8    5e-04   Hapalosiphonaceae
ref|WP_009545257.1|  MULTISPECIES: cell division protein FtsH         50.4    6e-04   Cyanothece
ref|WP_017312914.1|  cell division protein FtsH                       50.4    6e-04   Fischerella sp. PCC 9339
ref|WP_016862523.1|  cell division protein FtsH                       50.4    6e-04   Fischerella muscicola
gb|ADD94882.1|  FtsH peptidase                                        50.4    6e-04   uncultured marine bacterium MedDCM-OCT-S09-C166
ref|WP_029981286.1|  cell division protein FtsH                       48.9    6e-04   
ref|WP_010468934.1|  cell division protein FtsH                       50.1    8e-04   Acaryochloris sp. CCMEE 5410
ref|WP_040935720.1|  cell division protein FtsH                       50.1    0.001   
gb|AII47735.1|  cell division protein FtsH                            49.7    0.001   Synechococcus sp. KORDI-52
ref|WP_038551333.1|  cell division protein FtsH                       49.7    0.001   Synechococcus sp. KORDI-52



>ref|NP_001234196.1| FtsH-like protein precursor [Solanum lycopersicum]
 gb|AAQ93011.1| FtsH-like protein precursor [Solanum lycopersicum]
Length=708

 Score =   285 bits (730),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 139/171 (81%), Positives = 154/171 (90%), Gaps = 1/171 (1%)
 Frame = +3

Query  138  SRRRFLAPQS-LTKNSNPDSFKGLSSKATLAALLFSSIAPQAIALDNATPAAPPTEIQAE  314
            SRR+++ PQS L+K SN D+FK + SKA +AALLFSSI PQA ALDN TPAAPP  I+AE
Sbjct  32   SRRKYIVPQSILSKKSNSDNFKNVPSKAAIAALLFSSITPQAFALDNTTPAAPPQVIEAE  91

Query  315  APQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDG  494
            AP+P+ASN+ PF+QN++LNAPK QAQPASDLPEG+QWRYSEFLNAVKKGKVERVRFSKDG
Sbjct  92   APKPSASNSLPFAQNIILNAPKTQAQPASDLPEGTQWRYSEFLNAVKKGKVERVRFSKDG  151

Query  495  SALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGEGGNGLFSFIGN  647
            S LQLTAVDGRRA VIVPNDPDLIDILAMNGVDISVSEGEGGNGLFS IGN
Sbjct  152  STLQLTAVDGRRANVIVPNDPDLIDILAMNGVDISVSEGEGGNGLFSVIGN  202



>ref|XP_006342112.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic-like 
[Solanum tuberosum]
Length=708

 Score =   275 bits (703),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 136/171 (80%), Positives = 149/171 (87%), Gaps = 1/171 (1%)
 Frame = +3

Query  138  SRRRFLAPQS-LTKNSNPDSFKGLSSKATLAALLFSSIAPQAIALDNATPAAPPTEIQAE  314
            S+R+ + PQS L K  N D+FK + SKA LAALLFSSI P A ALDN TPAAPP  I+AE
Sbjct  32   SKRKCIVPQSILNKKPNSDNFKNVPSKAALAALLFSSITPHAFALDNTTPAAPPQVIEAE  91

Query  315  APQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDG  494
            A +P+ASN+ PF+QN++LNAPK QAQPASDLPEG+QWRYSEFLNAVKKGKVERVRFSKDG
Sbjct  92   ALKPSASNSLPFAQNIILNAPKTQAQPASDLPEGTQWRYSEFLNAVKKGKVERVRFSKDG  151

Query  495  SALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGEGGNGLFSFIGN  647
            S LQLTAVDGRRA VIVPNDPDLIDILAMNGVDISVSEGEGGNGLFS IGN
Sbjct  152  STLQLTAVDGRRANVIVPNDPDLIDILAMNGVDISVSEGEGGNGLFSVIGN  202



>sp|Q39444.1|FTSH_CAPAN RecName: Full=ATP-dependent zinc metalloprotease FTSH, chloroplastic; 
Flags: Precursor, partial [Capsicum annuum]
 emb|CAA62084.1| ATPase [Capsicum annuum]
Length=662

 Score =   257 bits (657),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 132/172 (77%), Positives = 142/172 (83%), Gaps = 2/172 (1%)
 Frame = +3

Query  138  SRRRFLAPQS-LTKNSNPDSFKGLSSKATLAALLFSSIAPQAIALDNATP-AAPPTEIQA  311
            S+R+ +  QS L K  N D+FK   SKA LAALLFSSI P AIALD+A P A+PP  ++ 
Sbjct  7    SKRKCIITQSTLNKKPNSDNFKNAQSKAALAALLFSSITPHAIALDDAAPIASPPQVMEV  66

Query  312  EAPQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKD  491
            EAP P  SN  PFSQN+VLNAPK QA P SDLPE +QWRYSEFLNAVKKGKVERVRFSKD
Sbjct  67   EAPNPNTSNPLPFSQNLVLNAPKTQASPVSDLPESTQWRYSEFLNAVKKGKVERVRFSKD  126

Query  492  GSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGEGGNGLFSFIGN  647
            GSALQLTAVDGRRA VIVPNDPDLIDILAMNGVDISVSEGEGGNGLFS IGN
Sbjct  127  GSALQLTAVDGRRANVIVPNDPDLIDILAMNGVDISVSEGEGGNGLFSVIGN  178



>ref|XP_009767982.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic 
[Nicotiana sylvestris]
Length=710

 Score =   255 bits (652),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 131/171 (77%), Positives = 140/171 (82%), Gaps = 2/171 (1%)
 Frame = +3

Query  141  RRRFLAPQS-LTKNSNPDSFKGLSSKATLAALLFSSIAPQAIALDNATPAAPP-TEIQAE  314
            R+ F  PQS L K  N D  K   S+A LAALLFSSI PQA ALDN TP APP + +QAE
Sbjct  34   RKFFPVPQSILNKKPNSDKVKNFPSEAALAALLFSSITPQAFALDNTTPTAPPPSVVQAE  93

Query  315  APQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDG  494
             P+P   N S FSQN++LNAPKPQAQ  SD+P+GSQWRYSEFLNAVKKGKVERVRFSKDG
Sbjct  94   TPKPNPLNPSSFSQNLILNAPKPQAQSTSDIPDGSQWRYSEFLNAVKKGKVERVRFSKDG  153

Query  495  SALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGEGGNGLFSFIGN  647
            S LQLTAVDGRRA VIVPNDPDLIDILAMNGVDISVSEGEGGNGLFS IGN
Sbjct  154  SVLQLTAVDGRRANVIVPNDPDLIDILAMNGVDISVSEGEGGNGLFSVIGN  204



>ref|XP_011101039.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic 
[Sesamum indicum]
Length=703

 Score =   253 bits (645),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 128/169 (76%), Positives = 143/169 (85%), Gaps = 3/169 (2%)
 Frame = +3

Query  144  RRFLAPQSLTKNSNPDSFKGLSSKATLAALLFSSIAPQAIALDNATPAAP-PTEIQAEAP  320
            R+F+ PQS+  N N +  K +SS   LAALLFSSIAPQA+ALDN  P AP P  I+ EA 
Sbjct  31   RKFIVPQSILNNKNSNKSKVVSSHGALAALLFSSIAPQALALDNTPPPAPAPQVIEIEAQ  90

Query  321  QPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSA  500
            +   S +SPF+QN++LNAPKPQAQ  SDLPEGSQWRYSEFLNAVKKGKVERVRFSK+GSA
Sbjct  91   K--TSQSSPFAQNLILNAPKPQAQSTSDLPEGSQWRYSEFLNAVKKGKVERVRFSKEGSA  148

Query  501  LQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGEGGNGLFSFIGN  647
            LQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEG+ GNGLF+FIGN
Sbjct  149  LQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGDSGNGLFNFIGN  197



>ref|XP_009606853.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic 
[Nicotiana tomentosiformis]
Length=715

 Score =   252 bits (643),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 130/172 (76%), Positives = 141/172 (82%), Gaps = 3/172 (2%)
 Frame = +3

Query  141  RRRFLAPQS-LTKNSNPDSFKGLSSKATLAALLFSSIAPQAIALDNATPAAPP-TEIQAE  314
            R+ F  PQS L K  N D  K   S+A LAAL FSSI PQA ALDN TP APP + +QAE
Sbjct  38   RKFFPVPQSILNKKPNSDKVKNFPSEAALAALFFSSITPQAFALDNTTPTAPPPSVVQAE  97

Query  315  APQPTASNASPFSQNVVLNAPKPQA-QPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKD  491
             P+P   N SPFSQN++LNAPKPQA Q +SD+P+GSQWRYSEFLNAVKKGKVERVRFSKD
Sbjct  98   TPKPNPLNPSPFSQNLILNAPKPQAAQSSSDIPDGSQWRYSEFLNAVKKGKVERVRFSKD  157

Query  492  GSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGEGGNGLFSFIGN  647
            G+ LQLTAVDGRRA VIVPNDPDLIDILAMNGVDISVSEGEGGNGLFS IGN
Sbjct  158  GTVLQLTAVDGRRANVIVPNDPDLIDILAMNGVDISVSEGEGGNGLFSVIGN  209



>gb|KDP36832.1| hypothetical protein JCGZ_08123 [Jatropha curcas]
Length=715

 Score =   249 bits (637),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 121/153 (79%), Positives = 138/153 (90%), Gaps = 0/153 (0%)
 Frame = +3

Query  189  DSFKGLSSKATLAALLFSSIAPQAIALDNATPAAPPTEIQAEAPQPTASNASPFSQNVVL  368
            DS K + S+ATLAALLFSS+ PQA+ALDN+T   PP  I+A+  +P+ASN+SPFSQN++L
Sbjct  57   DSLKSIPSQATLAALLFSSLTPQALALDNSTVPTPPPVIEAQPTKPSASNSSPFSQNLLL  116

Query  369  NAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVP  548
             APKPQ+Q  +DLPEG+QWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVP
Sbjct  117  TAPKPQSQSTTDLPEGTQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVP  176

Query  549  NDPDLIDILAMNGVDISVSEGEGGNGLFSFIGN  647
            NDPDLIDILAMNGVDISVSEG+ GNGLF+FIGN
Sbjct  177  NDPDLIDILAMNGVDISVSEGDSGNGLFNFIGN  209



>ref|XP_009618840.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic 
[Nicotiana tomentosiformis]
Length=707

 Score =   246 bits (628),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 131/173 (76%), Positives = 141/173 (82%), Gaps = 5/173 (3%)
 Frame = +3

Query  138  SRRRFLAPQS-LTKNSNPDSFKGLSSKATLAALLFSSIAPQAIALDNATPAAP-PTEIQA  311
            S+R+ L PQS L K  N D+ K + SKA LAALLFSSI P A ALDN TP  P P  IQA
Sbjct  32   SKRKSLIPQSILNKKPNSDNLKNIPSKAALAALLFSSITPHAFALDNTTPTVPTPQVIQA  91

Query  312  EAPQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKD  491
            EA  P+ SN  PFSQN++LNAPKPQAQ   +LPE SQWRYSEFLNAVKKGKVERVRFSKD
Sbjct  92   EAANPSTSN--PFSQNIILNAPKPQAQTNPELPEVSQWRYSEFLNAVKKGKVERVRFSKD  149

Query  492  GSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGE-GGNGLFSFIGN  647
            GSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEG+  GNGLF+ IGN
Sbjct  150  GSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGDSAGNGLFNLIGN  202



>ref|XP_002510649.1| Cell division protease ftsH, putative [Ricinus communis]
 gb|EEF52836.1| Cell division protease ftsH, putative [Ricinus communis]
Length=692

 Score =   245 bits (625),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 120/158 (76%), Positives = 138/158 (87%), Gaps = 1/158 (1%)
 Frame = +3

Query  174  KNSNPDSFKGLSSKATLAALLFSSIAPQAIALDNATPAAPPTEIQAEAPQPTASNASPFS  353
            K  + DS K + ++ATLA LLFSS++PQA ALDN TP+ PP  ++A+  +P  SN+SPFS
Sbjct  57   KQPSSDSLKSIQTQATLATLLFSSLSPQAFALDNPTPSPPPV-LEAQPTKPNPSNSSPFS  115

Query  354  QNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRA  533
            QN++L APKPQ+Q  SDLPEG+QWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRA
Sbjct  116  QNLLLTAPKPQSQSTSDLPEGTQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRA  175

Query  534  TVIVPNDPDLIDILAMNGVDISVSEGEGGNGLFSFIGN  647
            TVIVPNDPDLIDILAMNGVDISVSEG+ GNGLF+FIGN
Sbjct  176  TVIVPNDPDLIDILAMNGVDISVSEGDSGNGLFNFIGN  213



>gb|KJB14312.1| hypothetical protein B456_002G118800 [Gossypium raimondii]
Length=588

 Score =   242 bits (617),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 126/172 (73%), Positives = 145/172 (84%), Gaps = 4/172 (2%)
 Frame = +3

Query  138  SRRRFLAPQSL--TKNSNPDSFKGLSSKATLAALLFSSIAPQAIALDNATPAAPPTEIQA  311
            + R+    QS+   K ++  S K L S AT+AALLFSS+APQA+A+DNA P  PP  I+A
Sbjct  24   TTRKLQVTQSILNKKPNSSHSVKTLQSHATIAALLFSSVAPQALAVDNAPPTPPPV-IEA  82

Query  312  EAPQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKD  491
            +  +P+ SN SPFSQN++L APKPQ+Q +SDLPEGSQWRYSEFLNAVKKGKVERVRFSKD
Sbjct  83   QPTKPSPSNQSPFSQNLLLTAPKPQSQ-SSDLPEGSQWRYSEFLNAVKKGKVERVRFSKD  141

Query  492  GSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGEGGNGLFSFIGN  647
            GSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEG+ GNGLF+FIGN
Sbjct  142  GSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGDSGNGLFNFIGN  193



>sp|O82150.2|FTSH_TOBAC RecName: Full=ATP-dependent zinc metalloprotease FTSH, chloroplastic; 
AltName: Full=DS9; Flags: Precursor [Nicotiana tabacum]
 dbj|BAA33755.2| chloroplast FtsH protease [Nicotiana tabacum]
Length=714

 Score =   244 bits (623),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 131/173 (76%), Positives = 140/173 (81%), Gaps = 5/173 (3%)
 Frame = +3

Query  138  SRRRFLAPQS-LTKNSNPDSFKGLSSKATLAALLFSSIAPQAIALDNATPAAP-PTEIQA  311
            S+R+ L PQS L K  N D+ K + SKA LAALLFSSI P A ALDN TP  P P  IQA
Sbjct  32   SKRKSLIPQSILNKKPNSDNSKNIPSKAALAALLFSSITPHAYALDNTTPTVPTPRVIQA  91

Query  312  EAPQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKD  491
            EA  PT SN  PFSQN++LNAPKPQAQ   +LPE SQWRYSEFLNAVKKGKVERVRFSKD
Sbjct  92   EAANPTTSN--PFSQNIILNAPKPQAQTNPELPEVSQWRYSEFLNAVKKGKVERVRFSKD  149

Query  492  GSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGE-GGNGLFSFIGN  647
            GSALQLTAVDGRRATV VPNDPDLIDILAMNGVDISVSEG+  GNGLF+ IGN
Sbjct  150  GSALQLTAVDGRRATVTVPNDPDLIDILAMNGVDISVSEGDSAGNGLFNLIGN  202



>gb|KJB14313.1| hypothetical protein B456_002G118800 [Gossypium raimondii]
Length=600

 Score =   242 bits (617),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 126/172 (73%), Positives = 145/172 (84%), Gaps = 4/172 (2%)
 Frame = +3

Query  138  SRRRFLAPQSL--TKNSNPDSFKGLSSKATLAALLFSSIAPQAIALDNATPAAPPTEIQA  311
            + R+    QS+   K ++  S K L S AT+AALLFSS+APQA+A+DNA P  PP  I+A
Sbjct  24   TTRKLQVTQSILNKKPNSSHSVKTLQSHATIAALLFSSVAPQALAVDNAPPTPPPV-IEA  82

Query  312  EAPQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKD  491
            +  +P+ SN SPFSQN++L APKPQ+Q +SDLPEGSQWRYSEFLNAVKKGKVERVRFSKD
Sbjct  83   QPTKPSPSNQSPFSQNLLLTAPKPQSQ-SSDLPEGSQWRYSEFLNAVKKGKVERVRFSKD  141

Query  492  GSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGEGGNGLFSFIGN  647
            GSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEG+ GNGLF+FIGN
Sbjct  142  GSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGDSGNGLFNFIGN  193



>gb|KJB14314.1| hypothetical protein B456_002G118800 [Gossypium raimondii]
Length=682

 Score =   243 bits (620),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 126/172 (73%), Positives = 145/172 (84%), Gaps = 4/172 (2%)
 Frame = +3

Query  138  SRRRFLAPQSL--TKNSNPDSFKGLSSKATLAALLFSSIAPQAIALDNATPAAPPTEIQA  311
            + R+    QS+   K ++  S K L S AT+AALLFSS+APQA+A+DNA P  PP  I+A
Sbjct  24   TTRKLQVTQSILNKKPNSSHSVKTLQSHATIAALLFSSVAPQALAVDNAPPTPPPV-IEA  82

Query  312  EAPQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKD  491
            +  +P+ SN SPFSQN++L APKPQ+Q +SDLPEGSQWRYSEFLNAVKKGKVERVRFSKD
Sbjct  83   QPTKPSPSNQSPFSQNLLLTAPKPQSQ-SSDLPEGSQWRYSEFLNAVKKGKVERVRFSKD  141

Query  492  GSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGEGGNGLFSFIGN  647
            GSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEG+ GNGLF+FIGN
Sbjct  142  GSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGDSGNGLFNFIGN  193



>gb|KJB14315.1| hypothetical protein B456_002G118800 [Gossypium raimondii]
Length=699

 Score =   243 bits (620),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 126/172 (73%), Positives = 145/172 (84%), Gaps = 4/172 (2%)
 Frame = +3

Query  138  SRRRFLAPQSL--TKNSNPDSFKGLSSKATLAALLFSSIAPQAIALDNATPAAPPTEIQA  311
            + R+    QS+   K ++  S K L S AT+AALLFSS+APQA+A+DNA P  PP  I+A
Sbjct  24   TTRKLQVTQSILNKKPNSSHSVKTLQSHATIAALLFSSVAPQALAVDNAPPTPPPV-IEA  82

Query  312  EAPQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKD  491
            +  +P+ SN SPFSQN++L APKPQ+Q +SDLPEGSQWRYSEFLNAVKKGKVERVRFSKD
Sbjct  83   QPTKPSPSNQSPFSQNLLLTAPKPQSQ-SSDLPEGSQWRYSEFLNAVKKGKVERVRFSKD  141

Query  492  GSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGEGGNGLFSFIGN  647
            GSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEG+ GNGLF+FIGN
Sbjct  142  GSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGDSGNGLFNFIGN  193



>emb|CDP03477.1| unnamed protein product [Coffea canephora]
Length=260

 Score =   231 bits (589),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 130/167 (78%), Positives = 144/167 (86%), Gaps = 1/167 (1%)
 Frame = +3

Query  150  FLAPQS-LTKNSNPDSFKGLSSKATLAALLFSSIAPQAIALDNATPAAPPTEIQAEAPQP  326
            FL+P +  T  S P  F  + SKATLAALLFSSI P+A+A+DN  P   P  IQAEAPQP
Sbjct  15   FLSPPTPKTTKSLPRKFLDIPSKATLAALLFSSINPRALAVDNTAPPTLPPVIQAEAPQP  74

Query  327  TASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQ  506
            + SN SPFSQN++LNAP+PQAQP++DLPEGSQWRYSEFLNAVKKGKVERVRF KDGSALQ
Sbjct  75   SPSNPSPFSQNLILNAPQPQAQPSTDLPEGSQWRYSEFLNAVKKGKVERVRFGKDGSALQ  134

Query  507  LTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGEGGNGLFSFIGN  647
            LTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEG+ GNGLF+FIGN
Sbjct  135  LTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGDSGNGLFNFIGN  181



>gb|KHG10496.1| ATP-dependent zinc metalloprotease FTSH, chloroplastic [Gossypium 
arboreum]
Length=699

 Score =   243 bits (619),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 127/173 (73%), Positives = 145/173 (84%), Gaps = 6/173 (3%)
 Frame = +3

Query  138  SRRRFLAPQSLTKNSNPDS---FKGLSSKATLAALLFSSIAPQAIALDNATPAAPPTEIQ  308
            + R+    QS+  N  P+S    K L S ATLAALLFS++APQA+A+DNA P  PP  I+
Sbjct  24   TTRKLQVTQSIL-NKKPNSSHTVKTLQSHATLAALLFSAVAPQALAVDNAPPTPPPV-IE  81

Query  309  AEAPQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSK  488
            A+  +P+ SN SPFSQN++L APKPQ+Q +SDLPEGSQWRYSEFLNAVKKGKVERVRFSK
Sbjct  82   AQPTKPSPSNQSPFSQNLLLTAPKPQSQ-SSDLPEGSQWRYSEFLNAVKKGKVERVRFSK  140

Query  489  DGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGEGGNGLFSFIGN  647
            DGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEG+ GNGLF+FIGN
Sbjct  141  DGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGDSGNGLFNFIGN  193



>emb|CDP07308.1| unnamed protein product [Coffea canephora]
Length=706

 Score =   242 bits (618),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 134/172 (78%), Positives = 147/172 (85%), Gaps = 4/172 (2%)
 Frame = +3

Query  144  RRFLAPQSL----TKNSNPDSFKGLSSKATLAALLFSSIAPQAIALDNATPAAPPTEIQA  311
            R+FL PQS+      NS   S K + SKATLAALLFSSI P+A+A+DN  P   P  IQA
Sbjct  29   RKFLVPQSILGGKKSNSISQSLKDIPSKATLAALLFSSINPRALAVDNTAPPTLPPVIQA  88

Query  312  EAPQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKD  491
            EAPQP+ SN SPFSQN++LNAPKPQAQP++DLPEGSQWRYSEFLNAVKKGKVERVRF KD
Sbjct  89   EAPQPSPSNPSPFSQNLILNAPKPQAQPSTDLPEGSQWRYSEFLNAVKKGKVERVRFGKD  148

Query  492  GSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGEGGNGLFSFIGN  647
            GSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEG+ GNGLF+FIGN
Sbjct  149  GSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGDSGNGLFNFIGN  200



>ref|XP_007017988.1| FTSH protease 1 isoform 2 [Theobroma cacao]
 gb|EOY15213.1| FTSH protease 1 isoform 2 [Theobroma cacao]
Length=577

 Score =   238 bits (608),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 120/152 (79%), Positives = 135/152 (89%), Gaps = 2/152 (1%)
 Frame = +3

Query  192  SFKGLSSKATLAALLFSSIAPQAIALDNATPAAPPTEIQAEAPQPTASNASPFSQNVVLN  371
            S K L S ATLAALLFSS+ PQA+A+DNA P  PP  I+A+  +P+ SN SPF+QN++L 
Sbjct  47   SLKTLQSHATLAALLFSSVTPQALAVDNAPPT-PPAVIEAQPTKPSPSNQSPFAQNLLLT  105

Query  372  APKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPN  551
            APKPQ+Q +SDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPN
Sbjct  106  APKPQSQ-SSDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPN  164

Query  552  DPDLIDILAMNGVDISVSEGEGGNGLFSFIGN  647
            DPDLIDILAMNGVDISV+EG+ GNGLF+FIGN
Sbjct  165  DPDLIDILAMNGVDISVAEGDSGNGLFNFIGN  196



>ref|XP_009777632.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic 
[Nicotiana sylvestris]
Length=707

 Score =   241 bits (614),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 128/173 (74%), Positives = 140/173 (81%), Gaps = 5/173 (3%)
 Frame = +3

Query  138  SRRRFLAPQS-LTKNSNPDSFKGLSSKATLAALLFSSIAPQAIALDNATPAAP-PTEIQA  311
            S+R+ L PQS L K  N D+ K + SKA LAALLFSSI P A ALDN TP  P P  IQA
Sbjct  32   SKRKSLIPQSILNKKPNSDNSKNIPSKAALAALLFSSITPHAYALDNTTPTVPTPQVIQA  91

Query  312  EAPQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKD  491
            EA  PT SN  PFSQN++LNAPKPQAQ   +LPE SQWRYSEFLNAVKKGKVERVRFSKD
Sbjct  92   EAANPTTSN--PFSQNIILNAPKPQAQTNPELPEVSQWRYSEFLNAVKKGKVERVRFSKD  149

Query  492  GSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGE-GGNGLFSFIGN  647
            G+ LQL AVDGRRA+VIVPNDPDLIDILAMNGVDISVSEG+ GGNGLF+ IG+
Sbjct  150  GTTLQLNAVDGRRASVIVPNDPDLIDILAMNGVDISVSEGDSGGNGLFNLIGS  202



>ref|XP_007017987.1| FtsH extracellular protease family isoform 1 [Theobroma cacao]
 gb|EOY15212.1| FtsH extracellular protease family isoform 1 [Theobroma cacao]
Length=702

 Score =   239 bits (610),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 120/152 (79%), Positives = 135/152 (89%), Gaps = 2/152 (1%)
 Frame = +3

Query  192  SFKGLSSKATLAALLFSSIAPQAIALDNATPAAPPTEIQAEAPQPTASNASPFSQNVVLN  371
            S K L S ATLAALLFSS+ PQA+A+DNA P  PP  I+A+  +P+ SN SPF+QN++L 
Sbjct  47   SLKTLQSHATLAALLFSSVTPQALAVDNA-PPTPPAVIEAQPTKPSPSNQSPFAQNLLLT  105

Query  372  APKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPN  551
            APKPQ+Q +SDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPN
Sbjct  106  APKPQSQ-SSDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPN  164

Query  552  DPDLIDILAMNGVDISVSEGEGGNGLFSFIGN  647
            DPDLIDILAMNGVDISV+EG+ GNGLF+FIGN
Sbjct  165  DPDLIDILAMNGVDISVAEGDSGNGLFNFIGN  196



>emb|CDP18582.1| unnamed protein product [Coffea canephora]
Length=233

 Score =   226 bits (575),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 123/148 (83%), Positives = 135/148 (91%), Gaps = 0/148 (0%)
 Frame = +3

Query  204  LSSKATLAALLFSSIAPQAIALDNATPAAPPTEIQAEAPQPTASNASPFSQNVVLNAPKP  383
            + SKATLAALLFSSI P+A+A+DN  P   P  IQAEAPQP+ SN SPFSQN++LNAP+P
Sbjct  7    IPSKATLAALLFSSINPRALAVDNTAPPTLPPVIQAEAPQPSPSNPSPFSQNLILNAPQP  66

Query  384  QAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDL  563
            QAQP++DLPEGSQWRYSEFLNAVKKGKVERVRF KDGSALQLTAVDGRRATVIVPNDPDL
Sbjct  67   QAQPSTDLPEGSQWRYSEFLNAVKKGKVERVRFGKDGSALQLTAVDGRRATVIVPNDPDL  126

Query  564  IDILAMNGVDISVSEGEGGNGLFSFIGN  647
            IDILAMNGVDISVSEG+ GNGLF+FIGN
Sbjct  127  IDILAMNGVDISVSEGDSGNGLFNFIGN  154



>gb|EPS73399.1| precursor of protein cell division protease ftsh-like protein, 
partial [Genlisea aurea]
Length=694

 Score =   238 bits (606),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 119/168 (71%), Positives = 137/168 (82%), Gaps = 3/168 (2%)
 Frame = +3

Query  144  RRFLAPQSLTKNSNPDSFKGLSSKATLAALLFSSIAPQAIALDNATPAAPPTEIQAEAPQ  323
            R+   PQS+      +  K + + A  AA LFSS+AP A+ALDN +P AP   I+ EA +
Sbjct  27   RKLFVPQSILDGKCSNRSKCIQNHAAFAAFLFSSVAPNALALDNVSPPAPQV-IEIEAQK  85

Query  324  PTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSAL  503
             T+S  SPF+QN++LNAPKPQAQ  SDLPEGSQWRYSEFLNAVKKGKVERVRFSK+GSAL
Sbjct  86   TTSS--SPFAQNLILNAPKPQAQSNSDLPEGSQWRYSEFLNAVKKGKVERVRFSKEGSAL  143

Query  504  QLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGEGGNGLFSFIGN  647
            QLTA+DGRRATVIVPNDPDLIDILAMNGVDISVSEG+ GNGLF+FIGN
Sbjct  144  QLTAIDGRRATVIVPNDPDLIDILAMNGVDISVSEGDSGNGLFNFIGN  191



>ref|XP_010242853.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic 
[Nelumbo nucifera]
Length=720

 Score =   238 bits (606),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 126/178 (71%), Positives = 146/178 (82%), Gaps = 9/178 (5%)
 Frame = +3

Query  138  SRRRFLAPQSLTKN---SNPDSFKGLSSKATLAALLFSSIA---PQAIALDNA--TPAAP  293
            ++R+FL  +S  K    SN ++ + + S+ATLAAL+FSSIA   P A+A+DN   TP+ P
Sbjct  38   TKRKFLITKSTLKRNPISNSNTLRNIPSQATLAALIFSSIAQNPPAALAIDNNINTPSPP  97

Query  294  PTEIQAEAPQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVER  473
            P  I+AEA +   S +SPFSQN++L APKPQAQ  SDLPEGSQWRYSEFLNAVKKGKVER
Sbjct  98   PA-IEAEATKANPSASSPFSQNLLLTAPKPQAQSTSDLPEGSQWRYSEFLNAVKKGKVER  156

Query  474  VRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGEGGNGLFSFIGN  647
            VRFSKDGSALQLTAVDGRRATV VPNDPDLIDILAMNGVDISVSEG+ GNGLF+FIGN
Sbjct  157  VRFSKDGSALQLTAVDGRRATVTVPNDPDLIDILAMNGVDISVSEGDSGNGLFNFIGN  214



>gb|KHG14732.1| ATP-dependent zinc metalloprotease FTSH, chloroplastic [Gossypium 
arboreum]
Length=699

 Score =   234 bits (598),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 120/172 (70%), Positives = 141/172 (82%), Gaps = 4/172 (2%)
 Frame = +3

Query  138  SRRRFLAPQSLTKN--SNPDSFKGLSSKATLAALLFSSIAPQAIALDNATPAAPPTEIQA  311
            + R+    QS+  N  ++  +F+ L S ATLAAL FSS+ PQA+A+DNA P  PP  I+A
Sbjct  24   TTRKLQVTQSILNNKPNSNHTFRALQSHATLAALYFSSVTPQALAVDNAPPTPPPV-IEA  82

Query  312  EAPQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKD  491
            +   P+  N SPFSQ+++L APKPQ+Q +SDLPEGSQWRYSEFLNAVKKGKVERVRFSKD
Sbjct  83   QPTNPSPLNQSPFSQDLLLTAPKPQSQ-SSDLPEGSQWRYSEFLNAVKKGKVERVRFSKD  141

Query  492  GSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGEGGNGLFSFIGN  647
            GS LQL+AVDGRRA+VIVPNDPDLIDILAMNGVDISVSEGE GNGLF+FIGN
Sbjct  142  GSFLQLSAVDGRRASVIVPNDPDLIDILAMNGVDISVSEGESGNGLFNFIGN  193



>ref|XP_011074733.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic-like 
[Sesamum indicum]
Length=703

 Score =   233 bits (593),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 123/171 (72%), Positives = 139/171 (81%), Gaps = 7/171 (4%)
 Frame = +3

Query  144  RRFLAPQSLTKNSNPDSFKGLSSKATLAALLFSSIAPQAIALDNATPAAPP---TEIQAE  314
            R FL PQ++    N    K +++ A LAALLFSS+ PQA+ALD+  P AP     EI+A+
Sbjct  31   RSFLVPQAILNRKNSSKSKNVANHAALAALLFSSVTPQALALDSTPPPAPAAQVIEIEAQ  90

Query  315  APQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDG  494
             P P+    SPF+QN++LNAPKPQ+QP SDLPEGSQWRYSEFLNAVKKGKVERVRFSKDG
Sbjct  91   RPGPS----SPFAQNLILNAPKPQSQPTSDLPEGSQWRYSEFLNAVKKGKVERVRFSKDG  146

Query  495  SALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGEGGNGLFSFIGN  647
              LQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEG+ GNGLFSFIGN
Sbjct  147  GVLQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGDTGNGLFSFIGN  197



>gb|KDO85047.1| hypothetical protein CISIN_1g004921mg [Citrus sinensis]
Length=606

 Score =   229 bits (585),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 116/150 (77%), Positives = 134/150 (89%), Gaps = 1/150 (1%)
 Frame = +3

Query  198  KGLSSKATLAALLFSSIAPQAIALDNATPAAPPTEIQAEAPQPTASNASPFSQNVVLNAP  377
            + ++++AT+AALL SSIAPQA+A+DN  P  PP  +QA+  +P  SN+SPF QN++L AP
Sbjct  69   RTVTTEATMAALLLSSIAPQALAVDNTPPPPPPPLVQAQPSKPNPSNSSPFGQNLLLTAP  128

Query  378  KPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDP  557
            KPQ+Q +SDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDP
Sbjct  129  KPQSQ-SSDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDP  187

Query  558  DLIDILAMNGVDISVSEGEGGNGLFSFIGN  647
            DLIDILAMNGVDISVSEG+ GNGLFSF+GN
Sbjct  188  DLIDILAMNGVDISVSEGDSGNGLFSFVGN  217



>gb|KJB57986.1| hypothetical protein B456_009G188700 [Gossypium raimondii]
Length=531

 Score =   228 bits (581),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 117/157 (75%), Positives = 134/157 (85%), Gaps = 3/157 (2%)
 Frame = +3

Query  177  NSNPDSFKGLSSKATLAALLFSSIAPQAIALDNATPAAPPTEIQAEAPQPTASNASPFSQ  356
            NSN  +F+ L S ATLAAL FSS+ PQA+A+DN+ P  PP  I+A+   P+ SN S FSQ
Sbjct  59   NSN-HTFRALRSHATLAALFFSSVTPQALAVDNSPPTPPPV-IEAQPTNPSPSNQSHFSQ  116

Query  357  NVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRAT  536
            +++L APKPQ+Q +SDLPEGSQWRY EFLNAVKKGKVERVRFSKDGS LQL+AVDGRRA+
Sbjct  117  DLLLIAPKPQSQ-SSDLPEGSQWRYIEFLNAVKKGKVERVRFSKDGSVLQLSAVDGRRAS  175

Query  537  VIVPNDPDLIDILAMNGVDISVSEGEGGNGLFSFIGN  647
            VIVPNDPDLIDILAMNGVDISVSEGE GNGLF+FIGN
Sbjct  176  VIVPNDPDLIDILAMNGVDISVSEGESGNGLFNFIGN  212



>gb|EYU17514.1| hypothetical protein MIMGU_mgv1a004291mg [Erythranthe guttata]
Length=534

 Score =   228 bits (581),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 122/175 (70%), Positives = 136/175 (78%), Gaps = 11/175 (6%)
 Frame = +3

Query  144  RRFLAPQSL------TKNSNPDSFKGLSSKATLAALLFSSIAPQAIALDNATPAAPPT-E  302
            RRFL PQS+      +  S   +   +++ A LAALLFSSI PQA ALDN+ P AP   E
Sbjct  35   RRFLLPQSILNRRIISDKSTKSNNNNITNHAALAALLFSSITPQAFALDNSPPPAPQVIE  94

Query  303  IQAEAPQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRF  482
            I+A+     A  +SP +QN+VLNAPKPQAQ  SDLPEGSQWRYSEFLNAVKKGKVERVRF
Sbjct  95   IEAQ----KAVQSSPVAQNLVLNAPKPQAQSNSDLPEGSQWRYSEFLNAVKKGKVERVRF  150

Query  483  SKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGEGGNGLFSFIGN  647
            SK+GS LQLTAVDGRRA V+VPNDPDLIDILAMNGVDISVSEGE  NGLFS IGN
Sbjct  151  SKEGSTLQLTAVDGRRAAVVVPNDPDLIDILAMNGVDISVSEGESENGLFSIIGN  205



>ref|XP_006435323.1| hypothetical protein CICLE_v10000422mg [Citrus clementina]
 gb|ESR48563.1| hypothetical protein CICLE_v10000422mg [Citrus clementina]
 gb|KDO85046.1| hypothetical protein CISIN_1g004921mg [Citrus sinensis]
Length=723

 Score =   231 bits (589),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 116/150 (77%), Positives = 134/150 (89%), Gaps = 1/150 (1%)
 Frame = +3

Query  198  KGLSSKATLAALLFSSIAPQAIALDNATPAAPPTEIQAEAPQPTASNASPFSQNVVLNAP  377
            + ++++AT+AALL SSIAPQA+A+DN  P  PP  +QA+  +P  SN+SPF QN++L AP
Sbjct  69   RTVTTEATMAALLLSSIAPQALAVDNTPPPPPPPLVQAQPSKPNPSNSSPFGQNLLLTAP  128

Query  378  KPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDP  557
            KPQ+Q +SDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDP
Sbjct  129  KPQSQ-SSDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDP  187

Query  558  DLIDILAMNGVDISVSEGEGGNGLFSFIGN  647
            DLIDILAMNGVDISVSEG+ GNGLFSF+GN
Sbjct  188  DLIDILAMNGVDISVSEGDSGNGLFSFVGN  217



>ref|XP_006473758.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic-like 
[Citrus sinensis]
Length=723

 Score =   231 bits (589),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 116/150 (77%), Positives = 134/150 (89%), Gaps = 1/150 (1%)
 Frame = +3

Query  198  KGLSSKATLAALLFSSIAPQAIALDNATPAAPPTEIQAEAPQPTASNASPFSQNVVLNAP  377
            + ++++AT+AALL SSIAPQA+A+DN  P  PP  +QA+  +P  SN+SPF QN++L AP
Sbjct  69   RTVTTEATMAALLLSSIAPQALAVDNTPPPPPPPLVQAQPSKPNPSNSSPFGQNLLLTAP  128

Query  378  KPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDP  557
            KPQ+Q +SDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDP
Sbjct  129  KPQSQ-SSDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDP  187

Query  558  DLIDILAMNGVDISVSEGEGGNGLFSFIGN  647
            DLIDILAMNGVDISVSEG+ GNGLFSF+GN
Sbjct  188  DLIDILAMNGVDISVSEGDSGNGLFSFVGN  217



>ref|XP_004145531.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic-like 
[Cucumis sativus]
 ref|XP_004157076.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic-like 
[Cucumis sativus]
 gb|KGN55486.1| hypothetical protein Csa_4G653470 [Cucumis sativus]
Length=715

 Score =   230 bits (587),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 123/169 (73%), Positives = 145/169 (86%), Gaps = 0/169 (0%)
 Frame = +3

Query  141  RRRFLAPQSLTKNSNPDSFKGLSSKATLAALLFSSIAPQAIALDNATPAAPPTEIQAEAP  320
            R+ FL    L++  N + +K + S+A LAAL+FSSIAPQA+A+D+A+P  PP  I+A+A 
Sbjct  41   RKSFLTRSVLSEKPNFEPYKSIPSQAALAALIFSSIAPQALAVDDASPPPPPPVIEAQAV  100

Query  321  QPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSA  500
             P+ S +SPFSQN++L APKPQ+Q  SDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSA
Sbjct  101  SPSTSTSSPFSQNLLLTAPKPQSQSVSDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSA  160

Query  501  LQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGEGGNGLFSFIGN  647
            LQLTA+DGRRATVIVPNDPDLIDILAMNGVDISVSEG+ GNGLF+FIGN
Sbjct  161  LQLTAIDGRRATVIVPNDPDLIDILAMNGVDISVSEGDAGNGLFNFIGN  209



>emb|CAN74077.1| hypothetical protein VITISV_000978 [Vitis vinifera]
Length=663

 Score =   228 bits (580),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 127/170 (75%), Positives = 144/170 (85%), Gaps = 5/170 (3%)
 Frame = +3

Query  138  SRRRFLAPQSLTKNSNPDSFKGLSSKATLAALLFSSIAPQAIALDNATPAAPPTEIQAEA  317
            SRRRF   +S+  N  P S   L SKA LAA++ SS+APQA+A+DNATP  PP  I+A+ 
Sbjct  36   SRRRFEVTRSIL-NGKPRS--ELPSKAALAAIIASSLAPQALAVDNATPPVPPPVIEAQP  92

Query  318  PQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGS  497
             +P+ SN+SPF+QN++L APKPQ Q  SDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGS
Sbjct  93   TKPSPSNSSPFAQNLLLTAPKPQTQ--SDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGS  150

Query  498  ALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGEGGNGLFSFIGN  647
            ALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEG+ GNGLF+FIGN
Sbjct  151  ALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGDSGNGLFNFIGN  200



>gb|KJB57987.1| hypothetical protein B456_009G188700 [Gossypium raimondii]
Length=694

 Score =   228 bits (582),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 117/157 (75%), Positives = 134/157 (85%), Gaps = 3/157 (2%)
 Frame = +3

Query  177  NSNPDSFKGLSSKATLAALLFSSIAPQAIALDNATPAAPPTEIQAEAPQPTASNASPFSQ  356
            NSN  +F+ L S ATLAAL FSS+ PQA+A+DN+ P  PP  I+A+   P+ SN S FSQ
Sbjct  59   NSN-HTFRALRSHATLAALFFSSVTPQALAVDNSPPTPPPV-IEAQPTNPSPSNQSHFSQ  116

Query  357  NVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRAT  536
            +++L APKPQ+Q +SDLPEGSQWRY EFLNAVKKGKVERVRFSKDGS LQL+AVDGRRA+
Sbjct  117  DLLLIAPKPQSQ-SSDLPEGSQWRYIEFLNAVKKGKVERVRFSKDGSVLQLSAVDGRRAS  175

Query  537  VIVPNDPDLIDILAMNGVDISVSEGEGGNGLFSFIGN  647
            VIVPNDPDLIDILAMNGVDISVSEGE GNGLF+FIGN
Sbjct  176  VIVPNDPDLIDILAMNGVDISVSEGESGNGLFNFIGN  212



>ref|XP_009334282.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic 
isoform X2 [Pyrus x bretschneideri]
Length=721

 Score =   228 bits (582),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 122/174 (70%), Positives = 143/174 (82%), Gaps = 6/174 (3%)
 Frame = +3

Query  138  SRRRFLAPQSLTKNSNPDS--FKGLSSKATLAALLFSSIAPQ-AIALDNATPAAPPTEIQ  308
            S+R+  A +++  NS PDS  FK  +S+ATLAALLFSS+ PQ A+A+DN     P   + 
Sbjct  44   SQRKLFATKNIF-NSKPDSQPFKSATSQATLAALLFSSLTPQPALAIDNTPTPTPTPPLV  102

Query  309  AEAPQPTASNAS-PFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFS  485
             +A QP+  NAS PFSQN++LNAPKPQ+Q  +DLPEGSQWRYSEFLNAVKKGKVERVRF 
Sbjct  103  LQA-QPSKPNASSPFSQNLLLNAPKPQSQVTTDLPEGSQWRYSEFLNAVKKGKVERVRFV  161

Query  486  KDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGEGGNGLFSFIGN  647
            KDGSALQLTAVDGRRA+V+VPNDPDLIDILAMNGVDISVSEG+ G GLF+FIGN
Sbjct  162  KDGSALQLTAVDGRRASVVVPNDPDLIDILAMNGVDISVSEGDSGGGLFNFIGN  215



>ref|XP_008452941.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic 
[Cucumis melo]
Length=715

 Score =   228 bits (582),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 124/171 (73%), Positives = 148/171 (87%), Gaps = 1/171 (1%)
 Frame = +3

Query  138  SRRRFLAPQS-LTKNSNPDSFKGLSSKATLAALLFSSIAPQAIALDNATPAAPPTEIQAE  314
            S+R+ +  QS L++  N + +K + S+A LAAL+FSSIAPQA+A+D+A+P  PP  I+A+
Sbjct  39   SKRKSVLTQSVLSEKPNSEPYKSIPSQAALAALIFSSIAPQALAVDDASPPPPPPVIEAQ  98

Query  315  APQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDG  494
            A  P+ S +SPFSQN++L APKPQ+Q  SDLPEGSQWRYSEFLNAVKKGKVERVRFSKDG
Sbjct  99   AVSPSTSTSSPFSQNLLLTAPKPQSQSVSDLPEGSQWRYSEFLNAVKKGKVERVRFSKDG  158

Query  495  SALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGEGGNGLFSFIGN  647
            SALQLTA+DGRRATVIVPNDPDLIDILAMNGVDISVSEG+ GNGLF+FIGN
Sbjct  159  SALQLTAIDGRRATVIVPNDPDLIDILAMNGVDISVSEGDTGNGLFNFIGN  209



>ref|XP_009334277.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic 
isoform X1 [Pyrus x bretschneideri]
Length=721

 Score =   228 bits (582),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 122/174 (70%), Positives = 143/174 (82%), Gaps = 6/174 (3%)
 Frame = +3

Query  138  SRRRFLAPQSLTKNSNPDS--FKGLSSKATLAALLFSSIAPQ-AIALDNATPAAPPTEIQ  308
            S+R+  A +++  NS PDS  FK  +S+ATLAALLFSS+ PQ A+A+DN     P   + 
Sbjct  44   SQRKLFATKNIF-NSKPDSQPFKSATSQATLAALLFSSLTPQPALAIDNTPTPTPTPPLV  102

Query  309  AEAPQPTASNAS-PFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFS  485
             +A QP+  NAS PFSQN++LNAPKPQ+Q  +DLPEGSQWRYSEFLNAVKKGKVERVRF 
Sbjct  103  LQA-QPSKPNASSPFSQNLLLNAPKPQSQVTTDLPEGSQWRYSEFLNAVKKGKVERVRFV  161

Query  486  KDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGEGGNGLFSFIGN  647
            KDGSALQLTAVDGRRA+V+VPNDPDLIDILAMNGVDISVSEG+ G GLF+FIGN
Sbjct  162  KDGSALQLTAVDGRRASVVVPNDPDLIDILAMNGVDISVSEGDSGGGLFNFIGN  215



>ref|XP_002285925.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic 
[Vitis vinifera]
Length=706

 Score =   226 bits (577),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 126/170 (74%), Positives = 144/170 (85%), Gaps = 5/170 (3%)
 Frame = +3

Query  138  SRRRFLAPQSLTKNSNPDSFKGLSSKATLAALLFSSIAPQAIALDNATPAAPPTEIQAEA  317
            SRRRF   +S+  N  P S   L SKA LAA++ SS+APQA+A+DNATP  PP  I+A+ 
Sbjct  36   SRRRFDVTRSIL-NGKPRS--ELPSKAALAAIIASSLAPQALAVDNATPPVPPPVIEAQP  92

Query  318  PQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGS  497
             +P+ SN+SPF+QN++L APKPQ Q  SDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGS
Sbjct  93   TKPSPSNSSPFAQNLLLTAPKPQTQ--SDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGS  150

Query  498  ALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGEGGNGLFSFIGN  647
            ALQLTAVDGRRATVIVPNDPDLIDILAMNGVDI+VSEG+ GNGLF+FIGN
Sbjct  151  ALQLTAVDGRRATVIVPNDPDLIDILAMNGVDITVSEGDSGNGLFNFIGN  200



>ref|XP_004291222.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic 
[Fragaria vesca subsp. vesca]
Length=711

 Score =   226 bits (577),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 118/163 (72%), Positives = 136/163 (83%), Gaps = 5/163 (3%)
 Frame = +3

Query  168  LTKNSNP--DSFKGLSSKATLAALLFSSIAPQ-AIALDNATPAAPPTEIQAEAPQPTASN  338
              KN  P  DS K ++S+ATLAALLFSS+  Q A+A+DN TP + P  +  EA QPT  N
Sbjct  45   FAKNEKPNSDSIKSITSQATLAALLFSSLTTQPALAVDNVTPPSQPAPV-LEA-QPTKPN  102

Query  339  ASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAV  518
            +SPFSQ + L APKPQ+Q A+DLPEGSQWRYSEFLNAVKKGKVERVRFSK+GSALQLTAV
Sbjct  103  SSPFSQALNLTAPKPQSQAATDLPEGSQWRYSEFLNAVKKGKVERVRFSKEGSALQLTAV  162

Query  519  DGRRATVIVPNDPDLIDILAMNGVDISVSEGEGGNGLFSFIGN  647
            DGRRA+V+VPNDPDLIDILAMNGVDISVSEG+ G G+F+FIGN
Sbjct  163  DGRRASVVVPNDPDLIDILAMNGVDISVSEGDSGGGIFNFIGN  205



>ref|XP_010527682.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic 
[Tarenaya hassleriana]
Length=715

 Score =   226 bits (576),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 122/175 (70%), Positives = 141/175 (81%), Gaps = 8/175 (5%)
 Frame = +3

Query  138  SRRRFLAPQSLT----KNSNPDSFKGLSSKATLAALLFSSIAPQAIALDN-ATPAAPPTE  302
            SRRR+   +S       +S+    K LSS+A LAALLFSS++P+A ALD  AT + PP  
Sbjct  38   SRRRYQITRSALGRKPNSSDAKPMKSLSSQAALAALLFSSVSPRASALDEPATVSPPPMV  97

Query  303  IQAEAPQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRF  482
            ++A+A +P+ + AS F QN+V+ APKPQAQ  SDLP+GSQWRYSEFLNAVKKGKVERVRF
Sbjct  98   VEAQAAKPSPT-ASSFGQNLVMTAPKPQAQ--SDLPDGSQWRYSEFLNAVKKGKVERVRF  154

Query  483  SKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGEGGNGLFSFIGN  647
            SKDGSALQLTAVDGRRA V VPNDPDLIDILAMNGVDISVSEGE GNGLF+FIGN
Sbjct  155  SKDGSALQLTAVDGRRANVTVPNDPDLIDILAMNGVDISVSEGESGNGLFNFIGN  209



>ref|XP_008377091.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic 
[Malus domestica]
Length=718

 Score =   225 bits (574),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 120/172 (70%), Positives = 141/172 (82%), Gaps = 5/172 (3%)
 Frame = +3

Query  138  SRRRFLAPQSLTKNSNPDS--FKGLSSKATLAALLFSSIAPQAIALDNATPAAPPTEIQA  311
            S+R+  A +++  NS PDS   K  +S+ATLAALLFSS+ PQA+A+DN     PP  +Q 
Sbjct  44   SKRKLFATKNIF-NSQPDSEPLKSAASQATLAALLFSSLTPQALAIDNTPTPTPPPVLQP  102

Query  312  EAPQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKD  491
            +  +  A  ASPFSQN++LNAPKPQ+Q A+DLPEGSQWRYSEFLNAVKKGKVERVRF KD
Sbjct  103  QPSKSNA--ASPFSQNLLLNAPKPQSQVATDLPEGSQWRYSEFLNAVKKGKVERVRFMKD  160

Query  492  GSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGEGGNGLFSFIGN  647
            GSALQLTAVDGRRA+V+VPNDPDLIDILAMNGVDISVSEG+ G GLF+ IGN
Sbjct  161  GSALQLTAVDGRRASVVVPNDPDLIDILAMNGVDISVSEGDSGGGLFNXIGN  212



>ref|XP_010060660.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic 
[Eucalyptus grandis]
 gb|KCW67463.1| hypothetical protein EUGRSUZ_F01206 [Eucalyptus grandis]
Length=713

 Score =   224 bits (570),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 120/172 (70%), Positives = 138/172 (80%), Gaps = 5/172 (3%)
 Frame = +3

Query  141  RRRFLAPQSLTKNSNP--DSFKGLSSKATLAALLF-SSIAPQAIALDNATPAAPPTEIQA  311
            RR+  A +S+  N  P  +  K   SKA+LAALLF SSI PQA A D      PP  IQA
Sbjct  38   RRKLRATRSVLNNDVPNFERLKSAQSKASLAALLFASSIVPQAQAADAPNLPTPPPVIQA  97

Query  312  EAPQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKD  491
            +  +P+ S++SPF+QN++L APKP A  +SDLPEGSQWRYSEFL+AVKKGKVERVRFSKD
Sbjct  98   QPTKPSPSDSSPFAQNLLLTAPKPSA--SSDLPEGSQWRYSEFLSAVKKGKVERVRFSKD  155

Query  492  GSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGEGGNGLFSFIGN  647
            GSALQLTAVDGRRA+VIVPNDPDLIDILAMNGVDISVSEG+ GNGLF+FIGN
Sbjct  156  GSALQLTAVDGRRASVIVPNDPDLIDILAMNGVDISVSEGDSGNGLFAFIGN  207



>ref|XP_007221904.1| hypothetical protein PRUPE_ppa002083mg [Prunus persica]
 gb|EMJ23103.1| hypothetical protein PRUPE_ppa002083mg [Prunus persica]
Length=719

 Score =   224 bits (570),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 118/172 (69%), Positives = 135/172 (78%), Gaps = 5/172 (3%)
 Frame = +3

Query  141  RRRFLAPQSLTKNSNPDSFKGLSSKATLAALLFSSIA---PQAIALDNATPAAPPTEIQA  311
            R  F       +  N +  K  +S+ATLAALLFSS+    PQA+ALD      PP  +QA
Sbjct  44   RNLFTTKNIFNQKPNSEPVKSAASQATLAALLFSSVTSLTPQALALDATPTPTPPPVLQA  103

Query  312  EAPQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKD  491
            +  +P AS  SPFSQN+++ APKPQ+Q A+DLPEGSQWRYSEFLNAVKKGKVERVRFSKD
Sbjct  104  QPTKPNAS--SPFSQNLLVTAPKPQSQVATDLPEGSQWRYSEFLNAVKKGKVERVRFSKD  161

Query  492  GSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGEGGNGLFSFIGN  647
            GS LQLTAVDGRRA+VIVPNDPDLIDILAMNGVDISVSEG+ GNGLF+FIGN
Sbjct  162  GSGLQLTAVDGRRASVIVPNDPDLIDILAMNGVDISVSEGDSGNGLFNFIGN  213



>ref|XP_008221155.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic 
[Prunus mume]
Length=719

 Score =   223 bits (569),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 117/172 (68%), Positives = 135/172 (78%), Gaps = 5/172 (3%)
 Frame = +3

Query  141  RRRFLAPQSLTKNSNPDSFKGLSSKATLAALLFSSIA---PQAIALDNATPAAPPTEIQA  311
            R  F       +  N +  K  +S+ATLAALLFSS+    PQA+ALD      PP  +QA
Sbjct  44   RNLFTTKNIFNQKPNSEPLKSATSQATLAALLFSSVTSLTPQALALDATPTPTPPPVLQA  103

Query  312  EAPQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKD  491
            +  +P AS  SPFSQN+++ APKPQ+Q A+DLPEGSQWRYS+FLNAVKKGKVERVRFSKD
Sbjct  104  QPTKPNAS--SPFSQNLLVTAPKPQSQAATDLPEGSQWRYSDFLNAVKKGKVERVRFSKD  161

Query  492  GSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGEGGNGLFSFIGN  647
            GS LQLTAVDGRRA+VIVPNDPDLIDILAMNGVDISVSEG+ GNGLF+FIGN
Sbjct  162  GSGLQLTAVDGRRASVIVPNDPDLIDILAMNGVDISVSEGDSGNGLFNFIGN  213



>ref|XP_011034903.1| PREDICTED: LOW QUALITY PROTEIN: ATP-dependent zinc metalloprotease 
FTSH, chloroplastic [Populus euphratica]
Length=704

 Score =   218 bits (556),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 117/171 (68%), Positives = 136/171 (80%), Gaps = 9/171 (5%)
 Frame = +3

Query  150  FLAP---QSLTKNSNPDSFKGLSSKATLA-ALLFSSIAPQAIALDNATPAAPPTE-IQAE  314
            FL P   Q +    N +S K L S+AT+A AL+FSS+ PQA+A+DN TP   P   I+A+
Sbjct  32   FLLPKNFQKIVNEKNHESLKSLQSQATIATALIFSSLTPQALAIDNPTPPPTPPPVIEAQ  91

Query  315  APQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDG  494
              +P+    S  +QN++L APKPQ+Q  SDLPEGS WRYSEFLNAVKKGKVERVRFSKDG
Sbjct  92   PTRPS----STLAQNLLLTAPKPQSQSTSDLPEGSXWRYSEFLNAVKKGKVERVRFSKDG  147

Query  495  SALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGEGGNGLFSFIGN  647
            SALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISV+EG+ GNGLF+FIGN
Sbjct  148  SALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVAEGDSGNGLFNFIGN  198



>ref|XP_002301927.1| Cell division protein ftsH [Populus trichocarpa]
 gb|EEE81200.1| Cell division protein ftsH [Populus trichocarpa]
Length=704

 Score =   218 bits (554),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 117/171 (68%), Positives = 137/171 (80%), Gaps = 9/171 (5%)
 Frame = +3

Query  150  FLAP---QSLTKNSNPDSFKGLSSKATLA-ALLFSSIAPQAIALDNATPAAPPTE-IQAE  314
            FL P   Q +    N +S K L S+AT+A AL+FSS+ PQA+A+DN TP   P   I+A+
Sbjct  32   FLLPKKFQKIVNEKNYESLKSLQSQATIATALIFSSLTPQALAIDNPTPPPTPPPVIEAQ  91

Query  315  APQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDG  494
              +P+++ A    QN++L APKPQ+Q  SDLPEGSQWRYSEFLNAVKKGKVERVRFSKDG
Sbjct  92   PTRPSSTVA----QNLLLTAPKPQSQSTSDLPEGSQWRYSEFLNAVKKGKVERVRFSKDG  147

Query  495  SALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGEGGNGLFSFIGN  647
            SALQLTAVDGRRA VIVPNDPDLIDILAMNGVDISV+EG+ GNGLF+FIGN
Sbjct  148  SALQLTAVDGRRAAVIVPNDPDLIDILAMNGVDISVAEGDSGNGLFNFIGN  198



>dbj|BAH56755.1| AT5G42270 [Arabidopsis thaliana]
Length=574

 Score =   214 bits (544),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 118/171 (69%), Positives = 131/171 (77%), Gaps = 13/171 (8%)
 Frame = +3

Query  138  SRRRFLAPQSLTKNSNPDSFKGLSSKATLAALLFSSIAPQAIALDNATPAAPPT-EIQAE  314
            SR+R+   QS          K L S+A LAALLFSS +PQA+A++   P  PP   I AE
Sbjct  40   SRKRYQISQS------EKLMKSLPSQAALAALLFSSSSPQALAVNE--PVQPPAPTITAE  91

Query  315  APQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDG  494
            A  P   N S F QNV++ AP PQAQ +SDLP+G+QWRYSEFLNAVKKGKVERV+FSKDG
Sbjct  92   AQSP---NLSTFGQNVLMTAPNPQAQ-SSDLPDGTQWRYSEFLNAVKKGKVERVKFSKDG  147

Query  495  SALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGEGGNGLFSFIGN  647
            S LQLTAVD RRATVIVPNDPDLIDILAMNGVDISVSEGEGGNGLF FIGN
Sbjct  148  SVLQLTAVDNRRATVIVPNDPDLIDILAMNGVDISVSEGEGGNGLFDFIGN  198



>ref|NP_568604.1| ATP-dependent zinc metalloprotease FTSH 5 [Arabidopsis thaliana]
 sp|Q9FH02.1|FTSH5_ARATH RecName: Full=ATP-dependent zinc metalloprotease FTSH 5, chloroplastic; 
Short=AtFTSH5; AltName: Full=Protein VARIEGATED 1; 
Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB10200.1| cell division protein FtsH [Arabidopsis thaliana]
 gb|AAM83215.1| AT5g42270/K5J14_7 [Arabidopsis thaliana]
 gb|AED94790.1| ATP-dependent zinc metalloprotease FTSH 5 [Arabidopsis thaliana]
Length=704

 Score =   215 bits (547),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 118/171 (69%), Positives = 131/171 (77%), Gaps = 13/171 (8%)
 Frame = +3

Query  138  SRRRFLAPQSLTKNSNPDSFKGLSSKATLAALLFSSIAPQAIALDNATPAAPPT-EIQAE  314
            SR+R+   QS          K L S+A LAALLFSS +PQA+A++   P  PP   I AE
Sbjct  40   SRKRYQISQS------EKLMKSLPSQAALAALLFSSSSPQALAVNE--PVQPPAPTITAE  91

Query  315  APQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDG  494
            A  P   N S F QNV++ AP PQAQ +SDLP+G+QWRYSEFLNAVKKGKVERV+FSKDG
Sbjct  92   AQSP---NLSTFGQNVLMTAPNPQAQ-SSDLPDGTQWRYSEFLNAVKKGKVERVKFSKDG  147

Query  495  SALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGEGGNGLFSFIGN  647
            S LQLTAVD RRATVIVPNDPDLIDILAMNGVDISVSEGEGGNGLF FIGN
Sbjct  148  SVLQLTAVDNRRATVIVPNDPDLIDILAMNGVDISVSEGEGGNGLFDFIGN  198



>ref|XP_010094593.1| ATP-dependent zinc metalloprotease FTSH [Morus notabilis]
 gb|EXB56347.1| ATP-dependent zinc metalloprotease FTSH [Morus notabilis]
Length=710

 Score =   214 bits (545),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 118/176 (67%), Positives = 139/176 (79%), Gaps = 8/176 (5%)
 Frame = +3

Query  138  SRRRFLAPQSLTKNSNPDSF---KGLSSKATLAALLFSSIAPQAIALDNATPAAPPTE--  302
            S R+FL  +++  +  PDS      + +KATLA LLFSS+APQA+ALD   P    T   
Sbjct  31   STRKFLIARNVL-DKKPDSKPSKNSIQTKATLATLLFSSLAPQALALDAPNPPPQTTTPP  89

Query  303  -IQAEAPQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVR  479
             +QA  P  + S++SPF QN++L APKP+++  SDLPEGSQWRYSEFL+AVKKGKVERVR
Sbjct  90   VLQAR-PSQSESSSSPFGQNLLLTAPKPESRNVSDLPEGSQWRYSEFLSAVKKGKVERVR  148

Query  480  FSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGEGGNGLFSFIGN  647
            FSKDGS LQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEG+ GNGLF+FIGN
Sbjct  149  FSKDGSGLQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGDSGNGLFNFIGN  204



>ref|XP_002865544.1| hypothetical protein ARALYDRAFT_494803 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41803.1| hypothetical protein ARALYDRAFT_494803 [Arabidopsis lyrata subsp. 
lyrata]
Length=701

 Score =   213 bits (543),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 113/171 (66%), Positives = 132/171 (77%), Gaps = 16/171 (9%)
 Frame = +3

Query  138  SRRRFLAPQSLTKNSNPDSFKGLSSKATLAALLFSSIAPQAIALDN-ATPAAPPTEIQAE  314
            SRRR+ + + +         K L S+A LAALLFSS +PQA+A++    P AP   ++A+
Sbjct  40   SRRRYQSEKLM---------KSLPSQAALAALLFSSTSPQALAVNEPVQPPAPTVTVEAQ  90

Query  315  APQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDG  494
            +P     N S F QNV++ AP PQAQ +SDLP+G+QWRYSEFLNAVKKGKVERV+FSKDG
Sbjct  91   SP-----NLSTFGQNVLMTAPNPQAQ-SSDLPDGTQWRYSEFLNAVKKGKVERVKFSKDG  144

Query  495  SALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGEGGNGLFSFIGN  647
            S LQLTAVD RRATVIVPNDPDLIDILAMNGVDISVSEGE GNGLF FIGN
Sbjct  145  SVLQLTAVDNRRATVIVPNDPDLIDILAMNGVDISVSEGESGNGLFDFIGN  195



>gb|EYU36827.1| hypothetical protein MIMGU_mgv1a002176mg [Erythranthe guttata]
Length=705

 Score =   211 bits (536),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 106/169 (63%), Positives = 127/169 (75%), Gaps = 1/169 (1%)
 Frame = +3

Query  144  RRFLA-PQSLTKNSNPDSFKGLSSKATLAALLFSSIAPQAIALDNATPAAPPTEIQAEAP  320
            +RF A P+SL  + N +  +   ++A LAA +FSSI PQA ALDN  P   P     E  
Sbjct  31   KRFAAVPKSLLNHKNSNKSQNAINRAALAAFIFSSITPQAFALDNNIPPPSPAPQVIEIE  90

Query  321  QPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSA  500
               +   SP +QN+ LNAP PQAQPA D+P+G+QWRYSEFLNAVKKGKVERVRF+K+G  
Sbjct  91   AQKSPLQSPVAQNLTLNAPNPQAQPAPDIPDGTQWRYSEFLNAVKKGKVERVRFNKEGGI  150

Query  501  LQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGEGGNGLFSFIGN  647
            LQLTAVDGR+A V+VPNDPDLIDILAMNGVDI+VSEG+ GNGLF F+GN
Sbjct  151  LQLTAVDGRKAAVVVPNDPDLIDILAMNGVDITVSEGDSGNGLFGFLGN  199



>gb|EYU36826.1| hypothetical protein MIMGU_mgv1a002176mg [Erythranthe guttata]
Length=656

 Score =   210 bits (534),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 106/169 (63%), Positives = 127/169 (75%), Gaps = 1/169 (1%)
 Frame = +3

Query  144  RRFLA-PQSLTKNSNPDSFKGLSSKATLAALLFSSIAPQAIALDNATPAAPPTEIQAEAP  320
            +RF A P+SL  + N +  +   ++A LAA +FSSI PQA ALDN  P   P     E  
Sbjct  31   KRFAAVPKSLLNHKNSNKSQNAINRAALAAFIFSSITPQAFALDNNIPPPSPAPQVIEIE  90

Query  321  QPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSA  500
               +   SP +QN+ LNAP PQAQPA D+P+G+QWRYSEFLNAVKKGKVERVRF+K+G  
Sbjct  91   AQKSPLQSPVAQNLTLNAPNPQAQPAPDIPDGTQWRYSEFLNAVKKGKVERVRFNKEGGI  150

Query  501  LQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGEGGNGLFSFIGN  647
            LQLTAVDGR+A V+VPNDPDLIDILAMNGVDI+VSEG+ GNGLF F+GN
Sbjct  151  LQLTAVDGRKAAVVVPNDPDLIDILAMNGVDITVSEGDSGNGLFGFLGN  199



>gb|KEH36288.1| ATP-dependent zinc metalloprotease FTSH protein [Medicago truncatula]
Length=499

 Score =   204 bits (520),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 105/148 (71%), Positives = 117/148 (79%), Gaps = 1/148 (1%)
 Frame = +3

Query  204  LSSKATLAALLFSSIAPQAIALDNATPAAPPTEIQAEAPQPTASNASPFSQNVVLNAPKP  383
            + S A  A +L S   P A+A DN  P  P  E Q     P A++ SPFSQN+ L APKP
Sbjct  54   IKSAAVSALILSSMFTPAALAADNLPPPPPVLEAQPNQLNP-ANSTSPFSQNISLTAPKP  112

Query  384  QAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDL  563
            Q+Q ++DLP+GSQWRYSEFLNAVKKGKVERVRFSKDGS LQLTAVDGRRA VIVPNDPDL
Sbjct  113  QSQSSTDLPDGSQWRYSEFLNAVKKGKVERVRFSKDGSVLQLTAVDGRRANVIVPNDPDL  172

Query  564  IDILAMNGVDISVSEGEGGNGLFSFIGN  647
            IDILAMNGVDISVSEGE GNGLFSF+G+
Sbjct  173  IDILAMNGVDISVSEGEQGNGLFSFVGS  200



>ref|XP_010494162.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 5, chloroplastic 
[Camelina sativa]
Length=708

 Score =   207 bits (526),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 115/171 (67%), Positives = 127/171 (74%), Gaps = 9/171 (5%)
 Frame = +3

Query  138  SRRRFLAPQSLTKNSNPDSFKGLSSKATLAALLFSSIAPQAIALDN-ATPAAPPTEIQAE  314
            SRRR    QS          K L S+A LAALLFSS +PQA+A++    P AP   I  E
Sbjct  40   SRRRCQISQS------EKLMKSLPSQAALAALLFSSSSPQALAVNEPVQPLAPAPTITVE  93

Query  315  APQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDG  494
            A Q T  N S F QNV++ AP PQ   +SDLP+G+QWRYSEFLNAVKKGKVERV+FSKDG
Sbjct  94   A-QATNPNLS-FGQNVMMTAPNPQQAQSSDLPDGTQWRYSEFLNAVKKGKVERVKFSKDG  151

Query  495  SALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGEGGNGLFSFIGN  647
            S LQLTAVD RRA+VIVPNDPDLIDILAMNGVDISVSEGE GNGLF FIGN
Sbjct  152  SVLQLTAVDNRRASVIVPNDPDLIDILAMNGVDISVSEGESGNGLFDFIGN  202



>ref|XP_006279579.1| hypothetical protein CARUB_v10025980mg [Capsella rubella]
 gb|EOA12477.1| hypothetical protein CARUB_v10025980mg [Capsella rubella]
Length=709

 Score =   206 bits (524),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 114/175 (65%), Positives = 129/175 (74%), Gaps = 16/175 (9%)
 Frame = +3

Query  138  SRRRFLAPQSLTKNSNPDSFKGLSSKATLAALLFSSIAPQAIALDN-----ATPAAPPTE  302
            SRRR    QS          K L S+A LAALLFSS +PQA+A++      A   AP   
Sbjct  40   SRRRCQISQS------EKLMKSLPSQAALAALLFSSASPQALAVNEPVQPQAPVPAPTMT  93

Query  303  IQAEAPQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRF  482
            ++A+A  P  S    F QNV++ AP PQAQ +SDLP+G+QWRYSEFLNAVKKGKVERV+F
Sbjct  94   VEAQATSPNLS----FGQNVLMTAPNPQAQ-SSDLPDGTQWRYSEFLNAVKKGKVERVKF  148

Query  483  SKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGEGGNGLFSFIGN  647
            SKDGS LQLTAVD RRA+VIVPNDPDLIDILAMNGVDISVSEGE GNGLF FIGN
Sbjct  149  SKDGSVLQLTAVDNRRASVIVPNDPDLIDILAMNGVDISVSEGESGNGLFDFIGN  203



>gb|KEH36287.1| ATP-dependent zinc metalloprotease FTSH protein [Medicago truncatula]
Length=706

 Score =   205 bits (521),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 105/148 (71%), Positives = 117/148 (79%), Gaps = 1/148 (1%)
 Frame = +3

Query  204  LSSKATLAALLFSSIAPQAIALDNATPAAPPTEIQAEAPQPTASNASPFSQNVVLNAPKP  383
            + S A  A +L S   P A+A DN  P  P  E Q     P A++ SPFSQN+ L APKP
Sbjct  54   IKSAAVSALILSSMFTPAALAADNLPPPPPVLEAQPNQLNP-ANSTSPFSQNISLTAPKP  112

Query  384  QAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDL  563
            Q+Q ++DLP+GSQWRYSEFLNAVKKGKVERVRFSKDGS LQLTAVDGRRA VIVPNDPDL
Sbjct  113  QSQSSTDLPDGSQWRYSEFLNAVKKGKVERVRFSKDGSVLQLTAVDGRRANVIVPNDPDL  172

Query  564  IDILAMNGVDISVSEGEGGNGLFSFIGN  647
            IDILAMNGVDISVSEGE GNGLFSF+G+
Sbjct  173  IDILAMNGVDISVSEGEQGNGLFSFVGS  200



>ref|XP_011041264.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic-like 
[Populus euphratica]
Length=705

 Score =   203 bits (517),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 110/175 (63%), Positives = 134/175 (77%), Gaps = 9/175 (5%)
 Frame = +3

Query  138  SRRRFLAPQSLTKNSNPD---SFKGLSSKATLAA-LLFSSIAPQAIALDNATPAAPPTE-  302
            ++  FL  ++L K  N     SFK L S+AT+AA LLFSS+ PQA+ALDN      P   
Sbjct  29   TKSSFLLSKNLLKIVNKKKSGSFKSLQSQATIAAALLFSSLTPQALALDNPALPPTPPPV  88

Query  303  IQAEAPQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRF  482
            I+A   +P+    SPF+QN+++ APKPQ++  SDLPEGSQWRYSEFLNAVKKGKVERVRF
Sbjct  89   IEALPTKPS----SPFAQNLLVTAPKPQSESTSDLPEGSQWRYSEFLNAVKKGKVERVRF  144

Query  483  SKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGEGGNGLFSFIGN  647
            SKDGS LQL+AVDGRRA+V+V NDPDLIDILA +GVDISVSEG+ GNG F+ IG+
Sbjct  145  SKDGSTLQLSAVDGRRASVVVLNDPDLIDILARSGVDISVSEGDSGNGFFNVIGS  199



>ref|XP_010692838.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic 
[Beta vulgaris subsp. vulgaris]
Length=705

 Score =   203 bits (517),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 112/174 (64%), Positives = 131/174 (75%), Gaps = 10/174 (6%)
 Frame = +3

Query  138  SRRRFLAPQSLTKNSNPDSFKGLSSKATLAALLFSSI--APQAIALDNATPAAPPTE--I  305
            SR++F+  QS   + N    K  S+ A   AL+ SS   + QA+A+DN  P        I
Sbjct  32   SRKKFVITQSFPNSQN---LKFPSNSALTTALILSSTLGSQQALAVDNLPPPQSQPPQVI  88

Query  306  QAEAPQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFS  485
            +A+   P   N+SPFSQN++LNAPKP + P  DLPEG+QWRYSEFL AVKKGKVERVRFS
Sbjct  89   EAQPNNPNLPNSSPFSQNLILNAPKP-SNP--DLPEGAQWRYSEFLTAVKKGKVERVRFS  145

Query  486  KDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGEGGNGLFSFIGN  647
            KDGS LQLTA+DGRRA+V+VPNDPDLIDILAMNGVDISVSEGEGGNGLFSFIGN
Sbjct  146  KDGSVLQLTAIDGRRASVVVPNDPDLIDILAMNGVDISVSEGEGGNGLFSFIGN  199



>ref|XP_002306970.2| Cell division protein ftsH [Populus trichocarpa]
 gb|EEE93966.2| Cell division protein ftsH [Populus trichocarpa]
Length=705

 Score =   202 bits (515),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 110/175 (63%), Positives = 135/175 (77%), Gaps = 9/175 (5%)
 Frame = +3

Query  138  SRRRFLAPQSLTKNSNPD---SFKGLSSKATLAA-LLFSSIAPQAIALDNATPAAPPTE-  302
            ++  FL  ++L K  N     SFK L S+AT+AA LLFSS+ PQA+A+DN  P   P   
Sbjct  29   TKSSFLLSKNLLKIVNKKKSGSFKSLQSQATIAAALLFSSLTPQALAIDNPAPPPTPPPV  88

Query  303  IQAEAPQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRF  482
            I+A   +P+    SPF+QN+++ APKPQ++  SDLPEGSQWRYSEFLNAVKKGKVERVRF
Sbjct  89   IEALPTKPS----SPFAQNLLVTAPKPQSESTSDLPEGSQWRYSEFLNAVKKGKVERVRF  144

Query  483  SKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGEGGNGLFSFIGN  647
            SKDGS LQL+AVDGRRA+V+V NDPDLIDILA +GVDISVSEG+ GNG F+ IG+
Sbjct  145  SKDGSTLQLSAVDGRRASVVVLNDPDLIDILARSGVDISVSEGDSGNGFFNVIGS  199



>sp|Q9BAE0.1|FTSH_MEDSA RecName: Full=ATP-dependent zinc metalloprotease FTSH, chloroplastic; 
Flags: Precursor [Medicago sativa]
 gb|AAK15322.1|AF332134_1 FtsH protease [Medicago sativa]
Length=706

 Score =   199 bits (505),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 107/149 (72%), Positives = 118/149 (79%), Gaps = 2/149 (1%)
 Frame = +3

Query  204  LSSKATLAALLFSSIAPQAIALDNATPAAPPT-EIQAEAPQPTASNASPFSQNVVLNAPK  380
            + S A  A +L S   P A+A DN  P  PP  E Q     P A++ SPFSQN+ L APK
Sbjct  54   IKSAAVSALILSSMFTPAALAADNLPPPPPPVLEAQPNQLNP-ANSTSPFSQNISLTAPK  112

Query  381  PQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPD  560
            PQAQ ++DLP+GSQWRYSEFLNAVKKGKVERVRFSKDGS LQLTAVDGRRA VIVPNDPD
Sbjct  113  PQAQSSTDLPDGSQWRYSEFLNAVKKGKVERVRFSKDGSVLQLTAVDGRRANVIVPNDPD  172

Query  561  LIDILAMNGVDISVSEGEGGNGLFSFIGN  647
            LIDILAMNGVDISVSEGE GNGLFSF+G+
Sbjct  173  LIDILAMNGVDISVSEGEQGNGLFSFVGS  201



>emb|CDY01840.1| BnaC06g28800D [Brassica napus]
Length=702

 Score =   197 bits (500),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 109/166 (66%), Positives = 129/166 (78%), Gaps = 5/166 (3%)
 Frame = +3

Query  165  SLTKNSNPDS-FKGLSSKATLAALLFSSIA----PQAIALDNATPAAPPTEIQAEAPQPT  329
             +T++S  D   K L S+A LAA+LFSS      P+A+ALD       P  I+A++  P+
Sbjct  31   HITRSSLDDKPIKSLPSRAALAAILFSSSISSQSPKALALDEPLTPTQPIVIEAQSLSPS  90

Query  330  ASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQL  509
             S+ SPF+QN V+ AP P+AQ +SDLP+GSQWRYSEFLNAVKKGKVERVRFSKDGS LQL
Sbjct  91   PSSLSPFAQNQVITAPNPKAQSSSDLPDGSQWRYSEFLNAVKKGKVERVRFSKDGSVLQL  150

Query  510  TAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGEGGNGLFSFIGN  647
            TAVD RRA+V+VPNDPDLIDILAMNGVDISVSEGE GN LF+ IGN
Sbjct  151  TAVDNRRASVVVPNDPDLIDILAMNGVDISVSEGESGNDLFTIIGN  196



>ref|XP_010442152.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 5, chloroplastic-like 
[Camelina sativa]
Length=707

 Score =   196 bits (499),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 112/171 (65%), Positives = 126/171 (74%), Gaps = 10/171 (6%)
 Frame = +3

Query  138  SRRRFLAPQSLTKNSNPDSFKGLSSKATLAALLFSSIAPQAIALDN-ATPAAPPTEIQAE  314
            SRRR+   QS          K L S+A LAA+LFSS + QA+A++    P AP   I  E
Sbjct  40   SRRRYQISQS------EKLMKSLPSQAALAAVLFSSSSLQALAVNEPVQPPAPAPTIAVE  93

Query  315  APQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDG  494
            A Q T  N S F QNV++ AP PQ   +SDLP+G+QWRYSEFLNAVKKGKVERV+FSKDG
Sbjct  94   A-QATNPNLS-FGQNVLMTAPNPQQAQSSDLPDGTQWRYSEFLNAVKKGKVERVKFSKDG  151

Query  495  SALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGEGGNGLFSFIGN  647
            S LQLTAVD RRA+VIVPNDPDLIDILAMNGVDISVS GE GNGLF FIGN
Sbjct  152  SVLQLTAVDNRRASVIVPNDPDLIDILAMNGVDISVS-GESGNGLFDFIGN  201



>ref|XP_003527434.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic-like 
[Glycine max]
Length=696

 Score =   194 bits (492),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 112/170 (66%), Positives = 133/170 (78%), Gaps = 13/170 (8%)
 Frame = +3

Query  150  FLAPQSLTKNSNPDSFKGLSSKATLAALLFSS----IAPQAIALDNATPAAPPTEIQAEA  317
            FL  +S+ K  N +  K  SS+A LAAL+ SS    + P+A+A DN TP  PP  I+A+ 
Sbjct  30   FLFKRSILKAQNSEQVKSASSRAALAALIVSSASLSVTPEALAADNLTP--PPV-IEAQQ  86

Query  318  PQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGS  497
             QP+    SPFSQN++L APKPQ+  +SDLPEG+ WRYS+FLNAVKKGKVERVRFSKDGS
Sbjct  87   SQPS----SPFSQNLLLTAPKPQS--SSDLPEGTNWRYSDFLNAVKKGKVERVRFSKDGS  140

Query  498  ALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGEGGNGLFSFIGN  647
            ALQLTAVDGRRA+VIVPNDPDLIDILAMNGVDISV+EGE  N LF+ +GN
Sbjct  141  ALQLTAVDGRRASVIVPNDPDLIDILAMNGVDISVAEGESPNSLFNIVGN  190



>ref|XP_003523186.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic-like 
[Glycine max]
Length=694

 Score =   192 bits (488),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 113/171 (66%), Positives = 133/171 (78%), Gaps = 17/171 (10%)
 Frame = +3

Query  171  TKNSNPDSF-------KGLSSKATLAALLFSS----IAPQAIALDNATPAAPPTEIQAEA  317
            TK+S P  F          +S+A LAAL+FSS    + PQA+A DN TP  PP  I+A+ 
Sbjct  23   TKSSTPLQFLFKRSILNAHNSQAALAALIFSSASLSVTPQALAADNVTP--PPV-IEAQQ  79

Query  318  PQ-PTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDG  494
             Q   ++++SPFSQN++L APKPQA  +SDLPEG+ WRYSEFLNAVKKGKVERVRFSKDG
Sbjct  80   SQLNPSNSSSPFSQNLLLTAPKPQA--SSDLPEGTNWRYSEFLNAVKKGKVERVRFSKDG  137

Query  495  SALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGEGGNGLFSFIGN  647
            SALQLTA+DGRRA+VIVPNDPDLIDILAMNGVDISV+EGE  N LF+ IGN
Sbjct  138  SALQLTAIDGRRASVIVPNDPDLIDILAMNGVDISVAEGESPNSLFNIIGN  188



>ref|XP_006409314.1| hypothetical protein EUTSA_v10022579mg [Eutrema salsugineum]
 gb|ESQ50767.1| hypothetical protein EUTSA_v10022579mg [Eutrema salsugineum]
Length=706

 Score =   192 bits (487),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 106/150 (71%), Positives = 116/150 (77%), Gaps = 5/150 (3%)
 Frame = +3

Query  204  LSSKATLAALLFSSIAPQAIA--LDNATPAAPPTEIQAEAPQPTASNASPFSQNVVLNAP  377
            L S+A LA LLFSS    AIA     A P AP   I  EA Q    +A+ F QNV+  AP
Sbjct  54   LPSQAALATLLFSS-PSLAIAEPYTVAQPPAPTDTITVEA-QAITPSATAFGQNVLQTAP  111

Query  378  KPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDP  557
             PQAQ + D+P+G+QWRYSEFLN+VKKGKVERV+FSKDGS LQLTAVDGRRATVIVPNDP
Sbjct  112  NPQAQ-SPDIPDGTQWRYSEFLNSVKKGKVERVKFSKDGSVLQLTAVDGRRATVIVPNDP  170

Query  558  DLIDILAMNGVDISVSEGEGGNGLFSFIGN  647
            DLIDILAMNGVDISVSEGE GNGLF FIGN
Sbjct  171  DLIDILAMNGVDISVSEGESGNGLFDFIGN  200



>gb|KFK31340.1| hypothetical protein AALP_AA6G099600 [Arabis alpina]
Length=705

 Score =   191 bits (486),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 96/132 (73%), Positives = 109/132 (83%), Gaps = 8/132 (6%)
 Frame = +3

Query  252  PQAIALDNATPAAPPTEIQAEAPQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRY  431
            PQA+A+D   P AP   ++A+A  P+A     F Q V++ AP PQ Q +SDLP+G+QWRY
Sbjct  76   PQALAIDE--PPAPVITVEAQAVNPSA-----FGQKVLMTAPNPQGQ-SSDLPDGTQWRY  127

Query  432  SEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEG  611
            SEFLNAVKKGKVERV+FSKDGS LQLTAVDGRRA+VIVPNDPDLIDILAMNGVDISVSEG
Sbjct  128  SEFLNAVKKGKVERVKFSKDGSVLQLTAVDGRRASVIVPNDPDLIDILAMNGVDISVSEG  187

Query  612  EGGNGLFSFIGN  647
            E GNGLF FIGN
Sbjct  188  ESGNGLFDFIGN  199



>ref|XP_006391231.1| hypothetical protein EUTSA_v10018191mg [Eutrema salsugineum]
 gb|ESQ28517.1| hypothetical protein EUTSA_v10018191mg [Eutrema salsugineum]
Length=722

 Score =   191 bits (486),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 104/163 (64%), Positives = 122/163 (75%), Gaps = 6/163 (4%)
 Frame = +3

Query  174  KNSNPDSFKGLSSKATLAALLFSSIAPQ---AIALDNATPAAPPTEIQAEAPQPTASNAS  344
            +  N    K L S+  LAA+LFSSI+     A+ALD    A     ++A+A +P+ S  S
Sbjct  55   EEDNGKPIKSLPSRVALAAILFSSISSSPRGALALDEPIAATQTVVVEAQAVKPSTS-PS  113

Query  345  PFSQNVVLNAPKPQAQPAS-DLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVD  521
            PFS+   + AP P+AQ +S DLPEG+QWRYSEFLNAVKKGKVERVRFSKDGS LQLTAVD
Sbjct  114  PFSETQTITAPNPKAQSSSSDLPEGTQWRYSEFLNAVKKGKVERVRFSKDGSVLQLTAVD  173

Query  522  GRRATVIVPNDPDLIDILAMNGVDISVSEGE-GGNGLFSFIGN  647
             RRA+V+VPNDPDLIDILAMNGVDISVSEGE  GN LF+ IGN
Sbjct  174  NRRASVVVPNDPDLIDILAMNGVDISVSEGESSGNDLFTIIGN  216



>ref|XP_009105314.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 1, chloroplastic 
[Brassica rapa]
Length=703

 Score =   191 bits (484),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 108/167 (65%), Positives = 129/167 (77%), Gaps = 6/167 (4%)
 Frame = +3

Query  165  SLTKNSNPDS-FKGLSSKATLAALLFSSIA----PQAIALDNATPAAPPTEIQAEAPQPT  329
             +T++S  D   K L S+A LAA+LFSS      P+A+ALD       P  I+A++  P+
Sbjct  31   HITRSSVDDKPLKSLPSRAALAAILFSSSISSQSPKALALDQPLTPTQPIVIEAQSLSPS  90

Query  330  ASNASPFSQNVVLNAPKPQAQPAS-DLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQ  506
             S+ SPF+Q+ V+ AP P+AQ +S DLP+GSQWRYSEFLNAVKKGKVERVRFSKDGS LQ
Sbjct  91   PSSLSPFAQSQVITAPNPKAQSSSSDLPDGSQWRYSEFLNAVKKGKVERVRFSKDGSVLQ  150

Query  507  LTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGEGGNGLFSFIGN  647
            LTAVD RRA+V+VPNDPDLIDILAMNGVDISVSEGE GN LF+ IGN
Sbjct  151  LTAVDNRRASVVVPNDPDLIDILAMNGVDISVSEGESGNDLFTIIGN  197



>ref|XP_010479476.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 1, chloroplastic-like 
isoform X1 [Camelina sativa]
Length=723

 Score =   189 bits (481),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 104/152 (68%), Positives = 120/152 (79%), Gaps = 8/152 (5%)
 Frame = +3

Query  204  LSSKATLAALLFSSIA--PQAIALDNATPAAPPTEIQAEAPQPTASNASP-FSQNVVLNA  374
            LSSK  LAA+LFSSI+  P+A+AL +  P +P   ++A+  Q    + SP F QN +L A
Sbjct  69   LSSKIALAAILFSSISSSPRALALVD-EPPSPSVVVEAQVQQAVKPSTSPLFIQNEILKA  127

Query  375  PKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPND  554
            P P++   SDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGS LQLTAVD RRA+VIVPND
Sbjct  128  PSPKS---SDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSVLQLTAVDNRRASVIVPND  184

Query  555  PDLIDILAMNGVDISVSEGE-GGNGLFSFIGN  647
            PDL+DILAMNGVDISVSEGE  GN LF+ IGN
Sbjct  185  PDLVDILAMNGVDISVSEGESSGNDLFTVIGN  216



>ref|XP_010479477.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 1, chloroplastic-like 
isoform X2 [Camelina sativa]
Length=724

 Score =   189 bits (480),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 104/152 (68%), Positives = 120/152 (79%), Gaps = 8/152 (5%)
 Frame = +3

Query  204  LSSKATLAALLFSSIA--PQAIALDNATPAAPPTEIQAEAPQPTASNASP-FSQNVVLNA  374
            LSSK  LAA+LFSSI+  P+A+AL +  P +P   ++A+  Q    + SP F QN +L A
Sbjct  69   LSSKIALAAILFSSISSSPRALALVD-EPPSPSVVVEAQVQQAVKPSTSPLFIQNEILKA  127

Query  375  PKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPND  554
            P P++   SDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGS LQLTAVD RRA+VIVPND
Sbjct  128  PSPKS---SDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSVLQLTAVDNRRASVIVPND  184

Query  555  PDLIDILAMNGVDISVSEGE-GGNGLFSFIGN  647
            PDL+DILAMNGVDISVSEGE  GN LF+ IGN
Sbjct  185  PDLVDILAMNGVDISVSEGESSGNDLFTVIGN  216



>ref|XP_002894238.1| hypothetical protein ARALYDRAFT_891950 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH70497.1| hypothetical protein ARALYDRAFT_891950 [Arabidopsis lyrata subsp. 
lyrata]
Length=720

 Score =   189 bits (480),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 109/177 (62%), Positives = 132/177 (75%), Gaps = 11/177 (6%)
 Frame = +3

Query  138  SRRRFLAPQSLTKNSNPDSFKG--LSSKATLAALLFSSIA---PQAIALDNATPAAPPTE  302
            SR ++   +S   N++P+       SS+  LAA+LFSSI+   P+A+A+ +  PA+P   
Sbjct  41   SRAKYQITRSSLDNNSPNGKPNSPFSSQVALAAILFSSISSSPPRALAVVD-EPASPSVV  99

Query  303  IQAEAPQPTASNASP-FSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVR  479
            ++A+A     S +SP F QN +L AP P++   SDLPEGSQWRYSEFLNAVKKGKVERVR
Sbjct  100  VEAQAQAVKPSTSSPLFIQNEILKAPSPKS---SDLPEGSQWRYSEFLNAVKKGKVERVR  156

Query  480  FSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGE-GGNGLFSFIGN  647
            FSKDGS LQLTAVD RRA+VIVPNDPDLIDILAMNGVDISVSEGE  GN LF+ IGN
Sbjct  157  FSKDGSVLQLTAVDNRRASVIVPNDPDLIDILAMNGVDISVSEGESSGNDLFTVIGN  213



>ref|XP_010500575.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 1, chloroplastic 
[Camelina sativa]
Length=722

 Score =   189 bits (479),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 104/151 (69%), Positives = 119/151 (79%), Gaps = 7/151 (5%)
 Frame = +3

Query  204  LSSKATLAALLFSSIA--PQAIALDNATPAAPPTEIQAEAPQPTASNASPFSQNVVLNAP  377
            LSSK  LAA+LFSSI+  P+A+AL +  P +P   ++A+A     S +  F QN +L AP
Sbjct  69   LSSKVALAAILFSSISSSPRALALVD-EPPSPSLVVEAQAQAVKPSTSPLFIQNEILKAP  127

Query  378  KPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDP  557
             P++   SDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGS LQLTAVD RRA+VIVPNDP
Sbjct  128  SPKS---SDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSVLQLTAVDNRRASVIVPNDP  184

Query  558  DLIDILAMNGVDISVSEGE-GGNGLFSFIGN  647
            DLIDILAMNGVDISVSEGE  GN LF+ IGN
Sbjct  185  DLIDILAMNGVDISVSEGESSGNDLFTVIGN  215



>ref|XP_007136141.1| hypothetical protein PHAVU_009G021400g [Phaseolus vulgaris]
 gb|ESW08135.1| hypothetical protein PHAVU_009G021400g [Phaseolus vulgaris]
Length=709

 Score =   187 bits (475),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 102/146 (70%), Positives = 113/146 (77%), Gaps = 10/146 (7%)
 Frame = +3

Query  210  SKATLAALLFSSIAPQAIALDNATPAAPPTEIQAEAPQPTASNASPFSQNVVLNAPKPQA  389
            S ATL+A       P A+A DN TP  P  E Q     P+ S +SPFS N+ L APKPQA
Sbjct  68   SSATLSA------TPHALAADNVTPP-PVIEAQQSQLNPSNSTSSPFSTNL-LTAPKPQA  119

Query  390  QPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLID  569
              +SDLPEG+ WRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRA+V+VPNDPDLID
Sbjct  120  --SSDLPEGTNWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRASVVVPNDPDLID  177

Query  570  ILAMNGVDISVSEGEGGNGLFSFIGN  647
            ILAMNGVDISV+E E  NGLF+ IGN
Sbjct  178  ILAMNGVDISVAEAESPNGLFNIIGN  203



>ref|XP_004500893.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic-like 
[Cicer arietinum]
Length=713

 Score =   187 bits (475),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 103/169 (61%), Positives = 125/169 (74%), Gaps = 2/169 (1%)
 Frame = +3

Query  141  RRRFLAPQSLTKNSNPDSFKGLSSKATLAALLFSSIAPQAIALDNATPAAPPTEIQAEAP  320
            + RF   Q    ++N +  K  +  A + + +  +I P A+A DN TP  PP        
Sbjct  41   KTRFSNSQKSINDNNSEPLKSAAVSALILSSMTLNITPVALAADNITPPPPPVLEAQPNK  100

Query  321  QPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSA  500
               ++++SPFSQN+ L APKPQ+  +SDLP+G+QWRYSEFLNAVKKGKVERVRFSKDGS 
Sbjct  101  LNPSNSSSPFSQNISLTAPKPQS--SSDLPDGNQWRYSEFLNAVKKGKVERVRFSKDGSV  158

Query  501  LQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGEGGNGLFSFIGN  647
            LQLTAVDGRRA VIVPNDPDLIDILAMNGVDISVSEGE GNGLF+F+G+
Sbjct  159  LQLTAVDGRRANVIVPNDPDLIDILAMNGVDISVSEGESGNGLFNFVGS  207



>ref|XP_008812082.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 1, chloroplastic-like 
[Phoenix dactylifera]
Length=724

 Score =   187 bits (475),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 103/152 (68%), Positives = 120/152 (79%), Gaps = 9/152 (6%)
 Frame = +3

Query  207  SSKATLAALLFSSIAPQ-----AIALDNATPAAPPTEIQAEAPQPTASNASPFSQNVVLN  371
            S  A +A+ L S++A Q     A+A D+ +P      +Q E+    ++ +SPFSQ++ L 
Sbjct  70   SVNAAVASFLLSTLAQQQPLSPALA-DDLSPPPDSPPVQLESATKPSAPSSPFSQSL-LT  127

Query  372  APKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPN  551
            APKPQ  P  DLPEGSQWRYSEFLNAVKKGKVERVRFSKDG ALQLTAVDGRRATV+VPN
Sbjct  128  APKPQTSP--DLPEGSQWRYSEFLNAVKKGKVERVRFSKDGGALQLTAVDGRRATVVVPN  185

Query  552  DPDLIDILAMNGVDISVSEGEGGNGLFSFIGN  647
            DPDLIDILAMNGVDISVSEG+GGNGLF+FIGN
Sbjct  186  DPDLIDILAMNGVDISVSEGDGGNGLFAFIGN  217



>emb|CDX96068.1| BnaA07g26630D [Brassica napus]
Length=675

 Score =   185 bits (469),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 103/153 (67%), Positives = 121/153 (79%), Gaps = 5/153 (3%)
 Frame = +3

Query  204  LSSKATLAALLFSSIA----PQAIALDNATPAAPPTEIQAEAPQPTASNASPFSQNVVLN  371
            L S+A LAA+LFSS      P+A+ALD       P  I+A++  P+ S+ SPF+Q+  + 
Sbjct  17   LPSRAALAAILFSSSISSQSPKALALDQPLTPTQPIVIEAQSLSPSPSSLSPFAQSQSIT  76

Query  372  APKPQAQPAS-DLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVP  548
            AP P+AQ +S DLP+GSQWRYSEFLNAVKKGKVERVRFSKDGS LQLTAVD RRA+V+VP
Sbjct  77   APNPKAQSSSSDLPDGSQWRYSEFLNAVKKGKVERVRFSKDGSVLQLTAVDNRRASVVVP  136

Query  549  NDPDLIDILAMNGVDISVSEGEGGNGLFSFIGN  647
            NDPDLIDILAMNGVDISVSEGE GN LF+ IGN
Sbjct  137  NDPDLIDILAMNGVDISVSEGESGNDLFTIIGN  169



>ref|XP_010941398.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 1, chloroplastic-like 
[Elaeis guineensis]
Length=723

 Score =   184 bits (467),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 100/153 (65%), Positives = 117/153 (76%), Gaps = 11/153 (7%)
 Frame = +3

Query  207  SSKATLAALLFSSIAPQ-----AIALD-NATPAAPPTEIQAEAPQPTASNASPFSQNVVL  368
            S  A +A+ L S++A Q     A+A D +  PA+PP ++++       S+        +L
Sbjct  69   SVNAAVASFLLSTLAHQQPLAPALAEDLSPPPASPPIQMESATKPSPPSSPF---SQSLL  125

Query  369  NAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVP  548
             APKPQ+ P  DLPEGSQWRYSEFLNAVKKGKVERVRFSKDG ALQLTAVDGRRATV+VP
Sbjct  126  TAPKPQSSP--DLPEGSQWRYSEFLNAVKKGKVERVRFSKDGGALQLTAVDGRRATVVVP  183

Query  549  NDPDLIDILAMNGVDISVSEGEGGNGLFSFIGN  647
            NDPDLIDILAMNGVDISVSEG+GGNGLF+FIGN
Sbjct  184  NDPDLIDILAMNGVDISVSEGDGGNGLFAFIGN  216



>ref|XP_010482002.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 5, chloroplastic-like 
[Camelina sativa]
Length=710

 Score =   182 bits (461),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 88/110 (80%), Positives = 95/110 (86%), Gaps = 1/110 (1%)
 Frame = +3

Query  318  PQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGS  497
            PQ T  N S F QNV++ AP PQ   +SDLP+G+QWRYSEFLNAVKKGKVERV+FSKDGS
Sbjct  96   PQATNPNLS-FGQNVLMTAPNPQQAQSSDLPDGTQWRYSEFLNAVKKGKVERVKFSKDGS  154

Query  498  ALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGEGGNGLFSFIGN  647
             LQLTAVD RRA+VIVPNDPDLIDILAMNGVDISVSEGE GNGLF FIGN
Sbjct  155  VLQLTAVDNRRASVIVPNDPDLIDILAMNGVDISVSEGESGNGLFDFIGN  204



>ref|XP_006306893.1| hypothetical protein CARUB_v10008446mg [Capsella rubella]
 gb|EOA39791.1| hypothetical protein CARUB_v10008446mg [Capsella rubella]
Length=718

 Score =   179 bits (455),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 105/162 (65%), Positives = 125/162 (77%), Gaps = 13/162 (8%)
 Frame = +3

Query  177  NSNPDSFKGLSSKATLAALLFSSIA----PQAIALDNATPAAPPTEIQAEAPQPTASNAS  344
            N+ P+S    SSK  LAA+LFSS++    P+A+A+ +  P +P   ++A+A +P+ S   
Sbjct  58   NAKPNS--PFSSKVALAAILFSSMSSSSPPRALAVVD-EPPSPSVVVEAQAVKPSTSPL-  113

Query  345  PFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDG  524
             F QN +L AP P++   SDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGS LQLTAVD 
Sbjct  114  -FIQNEILKAPSPKS---SDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSVLQLTAVDN  169

Query  525  RRATVIVPNDPDLIDILAMNGVDISVSEGEG-GNGLFSFIGN  647
            RRA+VIVPNDPDLIDILAMNGVDISVSEGE  GN LF+ IGN
Sbjct  170  RRASVIVPNDPDLIDILAMNGVDISVSEGESTGNDLFTVIGN  211



>dbj|BAN33747.1| ATP-dependent metalloprotease FtsH [Chrysanthemum x morifolium]
Length=698

 Score =   177 bits (450),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 85/100 (85%), Positives = 89/100 (89%), Gaps = 2/100 (2%)
 Frame = +3

Query  348  FSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGR  527
             +QN VL APKPQA P  D+PEGSQWRYSEFLNAVKKGKVERVRFSKDG  LQLTAVDGR
Sbjct  95   LTQNNVLTAPKPQANP--DIPEGSQWRYSEFLNAVKKGKVERVRFSKDGGVLQLTAVDGR  152

Query  528  RATVIVPNDPDLIDILAMNGVDISVSEGEGGNGLFSFIGN  647
            RA+V+VPNDPDLIDILAMNGVDISVSEGE  NGLF FIGN
Sbjct  153  RASVVVPNDPDLIDILAMNGVDISVSEGEASNGLFGFIGN  192



>ref|XP_009395377.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 1, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=706

 Score =   177 bits (450),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 102/158 (65%), Positives = 117/158 (74%), Gaps = 4/158 (3%)
 Frame = +3

Query  174  KNSNPDSFKGLSSKATLAALLFSSIAPQAIALDNATPAAPPTEIQAEAPQPTASNASPFS  353
            KNSN +      S A  AA L SS+ P AIA D A    P +    +    +  + +PF+
Sbjct  46   KNSNDNRLTLSPSVAAAAAFLLSSLPPVAIAEDVAPVPPPTSPPAVQFDAASKPD-NPFA  104

Query  354  QNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRA  533
            Q++ L AP+PQ   +SDLPEGSQWRYSEFL+AVKKGKVERVRFSKDG  LQLTAVDGRRA
Sbjct  105  QSL-LTAPRPQT--SSDLPEGSQWRYSEFLDAVKKGKVERVRFSKDGGVLQLTAVDGRRA  161

Query  534  TVIVPNDPDLIDILAMNGVDISVSEGEGGNGLFSFIGN  647
             VIVPNDPDLIDILAMNGVDISVSEG+ GNGLF+FIGN
Sbjct  162  AVIVPNDPDLIDILAMNGVDISVSEGDAGNGLFNFIGN  199



>ref|XP_009418681.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 1, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=715

 Score =   172 bits (437),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 87/113 (77%), Positives = 98/113 (87%), Gaps = 4/113 (4%)
 Frame = +3

Query  309  AEAPQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSK  488
            A  P P AS+ +PFSQ++ L AP+PQA P  DL +GSQWRYSEFLNAVK+GKVERVRFSK
Sbjct  100  ASKPAPPASS-NPFSQSL-LTAPRPQASP--DLLDGSQWRYSEFLNAVKRGKVERVRFSK  155

Query  489  DGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGEGGNGLFSFIGN  647
            DG  LQLTA+DGRRA V+VPNDPDLIDILAMNGVDISVSEG+GGNGLF+ IGN
Sbjct  156  DGGLLQLTAIDGRRAAVVVPNDPDLIDILAMNGVDISVSEGDGGNGLFNLIGN  208



>gb|AFW75732.1| hypothetical protein ZEAMMB73_601488 [Zea mays]
Length=378

 Score =   167 bits (423),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 88/118 (75%), Positives = 98/118 (83%), Gaps = 7/118 (6%)
 Frame = +3

Query  300  EIQAEAPQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVR  479
            E+QAEAP PT +   PFS ++ L APKP A  ASDLPEG+QWRYSEFL+AVK+GKVERVR
Sbjct  69   ELQAEAPTPTVN---PFSSSL-LTAPKPSAA-ASDLPEGAQWRYSEFLSAVKRGKVERVR  123

Query  480  FSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGE--GGNGLFSFIGN  647
            FSKDG  LQLTAVDGRRATV+VPNDPDLIDILA NGVDISVSEGE  G  G  +F+GN
Sbjct  124  FSKDGGLLQLTAVDGRRATVVVPNDPDLIDILATNGVDISVSEGESAGPGGFVAFVGN  181



>ref|NP_564563.1| ATP-dependent zinc metalloprotease FTSH 1 [Arabidopsis thaliana]
 sp|Q39102.2|FTSH1_ARATH RecName: Full=ATP-dependent zinc metalloprotease FTSH 1, chloroplastic; 
Short=AtFTSH1; Flags: Precursor [Arabidopsis thaliana]
 gb|AAD50055.1|AC007980_20 ATP-dependent metalloprotease [Arabidopsis thaliana]
 gb|AAM14046.1| putative chloroplast FtsH protease [Arabidopsis thaliana]
 gb|AAM67567.1| putative chloroplast FtsH protease [Arabidopsis thaliana]
 gb|AEE32528.1| ATP-dependent zinc metalloprotease FTSH 1 [Arabidopsis thaliana]
Length=716

 Score =   171 bits (433),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 91/124 (73%), Positives = 102/124 (82%), Gaps = 7/124 (6%)
 Frame = +3

Query  282  PAAPPTEIQAEAPQPTASNASP-FSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKK  458
            PA+P   I+++A +P  S  SP F QN +L AP P++   SDLPEGSQWRYSEFLNAVKK
Sbjct  91   PASPSVVIESQAVKP--STPSPLFIQNEILKAPSPKS---SDLPEGSQWRYSEFLNAVKK  145

Query  459  GKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGE-GGNGLFS  635
            GKVERVRFSKDGS +QLTAVD RRA+VIVPNDPDLIDILAMNGVDISVSEGE  GN LF+
Sbjct  146  GKVERVRFSKDGSVVQLTAVDNRRASVIVPNDPDLIDILAMNGVDISVSEGESSGNDLFT  205

Query  636  FIGN  647
             IGN
Sbjct  206  VIGN  209



>emb|CAA68141.1| chloroplast FtsH protease [Arabidopsis thaliana]
Length=709

 Score =   171 bits (432),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 91/124 (73%), Positives = 102/124 (82%), Gaps = 7/124 (6%)
 Frame = +3

Query  282  PAAPPTEIQAEAPQPTASNASP-FSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKK  458
            PA+P   I+++A +P  S  SP F QN +L AP P++   SDLPEGSQWRYSEFLNAVKK
Sbjct  91   PASPSVVIESQAVKP--STPSPLFIQNEILKAPSPKS---SDLPEGSQWRYSEFLNAVKK  145

Query  459  GKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGE-GGNGLFS  635
            GKVERVRFSKDGS +QLTAVD RRA+VIVPNDPDLIDILAMNGVDISVSEGE  GN LF+
Sbjct  146  GKVERVRFSKDGSVVQLTAVDNRRASVIVPNDPDLIDILAMNGVDISVSEGESSGNDLFT  205

Query  636  FIGN  647
             IGN
Sbjct  206  VIGN  209



>ref|XP_006828956.1| hypothetical protein AMTR_s00001p00232760 [Amborella trichopoda]
 gb|ERM96372.1| hypothetical protein AMTR_s00001p00232760 [Amborella trichopoda]
Length=713

 Score =   171 bits (432),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 84/103 (82%), Positives = 94/103 (91%), Gaps = 2/103 (2%)
 Frame = +3

Query  339  ASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAV  518
            ASPF+ N +L+APKPQ+  + D+P+GSQWRYSEFLNAVKKGKVERVRFSKDG  LQLTAV
Sbjct  107  ASPFA-NSLLSAPKPQSS-SPDIPDGSQWRYSEFLNAVKKGKVERVRFSKDGGVLQLTAV  164

Query  519  DGRRATVIVPNDPDLIDILAMNGVDISVSEGEGGNGLFSFIGN  647
             GRRATVIVPNDPDLIDILAMNGVDISV+EG+ GNGLF+FIGN
Sbjct  165  GGRRATVIVPNDPDLIDILAMNGVDISVAEGDSGNGLFNFIGN  207



>gb|AFW75733.1| hypothetical protein ZEAMMB73_601488 [Zea mays]
 gb|AFW75734.1| hypothetical protein ZEAMMB73_601488 [Zea mays]
Length=688

 Score =   167 bits (424),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 88/118 (75%), Positives = 98/118 (83%), Gaps = 7/118 (6%)
 Frame = +3

Query  300  EIQAEAPQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVR  479
            E+QAEAP PT +   PFS ++ L APKP A  ASDLPEG+QWRYSEFL+AVK+GKVERVR
Sbjct  69   ELQAEAPTPTVN---PFSSSL-LTAPKPSA-AASDLPEGAQWRYSEFLSAVKRGKVERVR  123

Query  480  FSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGE--GGNGLFSFIGN  647
            FSKDG  LQLTAVDGRRATV+VPNDPDLIDILA NGVDISVSEGE  G  G  +F+GN
Sbjct  124  FSKDGGLLQLTAVDGRRATVVVPNDPDLIDILATNGVDISVSEGESAGPGGFVAFVGN  181



>ref|NP_001058625.1| Os06g0725900 [Oryza sativa Japonica Group]
 sp|Q5Z974.1|FTSH1_ORYSJ RecName: Full=ATP-dependent zinc metalloprotease FTSH 1, chloroplastic; 
Short=OsFTSH1; Flags: Precursor [Oryza sativa Japonica 
Group]
 dbj|BAD61706.1| putative chloroplast FtsH protease [Oryza sativa Japonica Group]
 dbj|BAF20539.1| Os06g0725900 [Oryza sativa Japonica Group]
 dbj|BAG89328.1| unnamed protein product [Oryza sativa Japonica Group]
Length=686

 Score =   166 bits (420),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 87/129 (67%), Positives = 100/129 (78%), Gaps = 10/129 (8%)
 Frame = +3

Query  279  TPAAPPTEIQ----AEAPQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLN  446
             PA PP+  Q     EAP P A+   PFS N +L APKP +  A+DLPEG+QWRYSEFL+
Sbjct  55   VPAPPPSPTQDVQVLEAPSPAAN---PFS-NALLTAPKPTSSAAADLPEGAQWRYSEFLS  110

Query  447  AVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGE--GG  620
            AVKKGKVERVRFSKDG  LQLTA+DGRRATV+VPNDPDLIDILA NGVDISV+EG+  G 
Sbjct  111  AVKKGKVERVRFSKDGGLLQLTAIDGRRATVVVPNDPDLIDILATNGVDISVAEGDAAGP  170

Query  621  NGLFSFIGN  647
             G  +F+GN
Sbjct  171  GGFLAFVGN  179



>gb|EAZ38336.1| hypothetical protein OsJ_22711 [Oryza sativa Japonica Group]
Length=686

 Score =   166 bits (420),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 87/129 (67%), Positives = 100/129 (78%), Gaps = 10/129 (8%)
 Frame = +3

Query  279  TPAAPPTEIQ----AEAPQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLN  446
             PA PP+  Q     EAP P A+   PFS N +L APKP +  A+DLPEG+QWRYSEFL+
Sbjct  55   VPAPPPSPTQDVQVLEAPSPAAN---PFS-NALLTAPKPTSSAAADLPEGAQWRYSEFLS  110

Query  447  AVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGE--GG  620
            AVKKGKVERVRFSKDG  LQLTA+DGRRATV+VPNDPDLIDILA NGVDISV+EG+  G 
Sbjct  111  AVKKGKVERVRFSKDGGLLQLTAIDGRRATVVVPNDPDLIDILATNGVDISVAEGDPAGP  170

Query  621  NGLFSFIGN  647
             G  +F+GN
Sbjct  171  GGFLAFVGN  179



>ref|XP_004966506.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 1, chloroplastic-like 
[Setaria italica]
Length=685

 Score =   166 bits (419),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 87/118 (74%), Positives = 98/118 (83%), Gaps = 8/118 (7%)
 Frame = +3

Query  300  EIQAEAPQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVR  479
            E+QAEA  PTA+   PF+ N +L APKP A  A+DLPEG+QWRYSEFL+AVK+GKVERVR
Sbjct  67   ELQAEATTPTAN---PFA-NSLLTAPKPSA--AADLPEGAQWRYSEFLSAVKRGKVERVR  120

Query  480  FSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGE--GGNGLFSFIGN  647
            FSKDG  LQLTAVDGRRATV+VPNDPDLIDILA NGVDISVSEGE  G  G  +F+GN
Sbjct  121  FSKDGGLLQLTAVDGRRATVVVPNDPDLIDILATNGVDISVSEGEAAGPGGFIAFVGN  178



>ref|XP_002960384.1| hypothetical protein SELMODRAFT_139726 [Selaginella moellendorffii]
 ref|XP_002967332.1| hypothetical protein SELMODRAFT_144519 [Selaginella moellendorffii]
 gb|EFJ31931.1| hypothetical protein SELMODRAFT_144519 [Selaginella moellendorffii]
 gb|EFJ37923.1| hypothetical protein SELMODRAFT_139726 [Selaginella moellendorffii]
Length=628

 Score =   162 bits (410),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 79/109 (72%), Positives = 90/109 (83%), Gaps = 3/109 (3%)
 Frame = +3

Query  321  QPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSA  500
            + T +  SPFS   ++ AP  +A+   DLPEG+QWRYSEFLNAVK GKVERVRFS+DGS 
Sbjct  17   EQTPAAGSPFS---LMEAPPVEARKKLDLPEGNQWRYSEFLNAVKGGKVERVRFSRDGSV  73

Query  501  LQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGEGGNGLFSFIGN  647
            LQLTAVDGRRA VIVPNDPDL+DILAMNGVDISVSEGE GN LF+ +GN
Sbjct  74   LQLTAVDGRRAAVIVPNDPDLVDILAMNGVDISVSEGESGNNLFNILGN  122



>ref|XP_003563253.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 1, chloroplastic 
[Brachypodium distachyon]
Length=681

 Score =   155 bits (392),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 80/115 (70%), Positives = 92/115 (80%), Gaps = 10/115 (9%)
 Frame = +3

Query  309  AEAPQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSK  488
            AEAP P A+   PF+ + +L AP    QP+SD+P+G QWRYSEFL AVKKGKVERVRFSK
Sbjct  68   AEAPTPAAN---PFA-DTLLTAP----QPSSDIPDGGQWRYSEFLGAVKKGKVERVRFSK  119

Query  489  DGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGE--GGNGLFSFIGN  647
            DG  LQLTAVDGRRATV+VPNDPDLIDILA NGVDISV+EG+  G  G  +F+GN
Sbjct  120  DGGVLQLTAVDGRRATVVVPNDPDLIDILATNGVDISVAEGDAAGPGGFLAFVGN  174



>gb|KIZ07525.1| cell division protease FtsH [Monoraphidium neglectum]
Length=129

 Score =   135 bits (341),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 64/81 (79%), Positives = 72/81 (89%), Gaps = 0/81 (0%)
 Frame = +3

Query  372  APKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPN  551
            AP  +   AS LPEG+QWRYSEF+NAV+ GKVERVRFSKDGS LQLTA+DGRRATV++PN
Sbjct  44   APALRDDAASGLPEGNQWRYSEFINAVQGGKVERVRFSKDGSMLQLTAIDGRRATVVLPN  103

Query  552  DPDLIDILAMNGVDISVSEGE  614
            DPDL+DILA NGVDISVSEGE
Sbjct  104  DPDLVDILARNGVDISVSEGE  124



>ref|XP_001760664.1| predicted protein [Physcomitrella patens]
 gb|EDQ74403.1| predicted protein [Physcomitrella patens]
Length=634

 Score =   142 bits (358),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 65/83 (78%), Positives = 72/83 (87%), Gaps = 0/83 (0%)
 Frame = +3

Query  399  SDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILA  578
            SDLPEG+ WRYSEFLNAVK GKVERVRF+KDG+ LQLTAVDGRRA V +PNDPDL+DILA
Sbjct  46   SDLPEGANWRYSEFLNAVKAGKVERVRFAKDGTTLQLTAVDGRRANVTLPNDPDLVDILA  105

Query  579  MNGVDISVSEGEGGNGLFSFIGN  647
            MNGVDISVSEGE  N   + +GN
Sbjct  106  MNGVDISVSEGEAANNYINVLGN  128



>ref|XP_001753657.1| predicted protein [Physcomitrella patens]
 gb|EDQ81409.1| predicted protein [Physcomitrella patens]
Length=647

 Score =   140 bits (352),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 63/83 (76%), Positives = 72/83 (87%), Gaps = 0/83 (0%)
 Frame = +3

Query  399  SDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILA  578
            SDLPEG+ WRYSEFLNAVK GKVERVRF+KDG+ LQLTA+DG+RA V +PNDPDL+DILA
Sbjct  59   SDLPEGTNWRYSEFLNAVKGGKVERVRFAKDGTTLQLTAIDGKRANVTLPNDPDLVDILA  118

Query  579  MNGVDISVSEGEGGNGLFSFIGN  647
            MNGVDISVSEGE  N   + +GN
Sbjct  119  MNGVDISVSEGEATNSYINVLGN  141



>emb|CEF99105.1| P-loop containing nucleoside triphosphate hydrolase [Ostreococcus 
tauri]
Length=572

 Score =   137 bits (344),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 83/146 (57%), Positives = 96/146 (66%), Gaps = 8/146 (5%)
 Frame = +3

Query  216  ATLAALLFS--SIAPQAIALDNATPAAPPTEIQAEAPQPTASNASPFSQNVVLNAPKPQA  389
            +T+AA L +  ++A    A  +  PA  PT  QA A Q   SN+   SQ+       P  
Sbjct  34   STVAATLMAVATLASAGAAKADFAPAPEPT--QAVAEQRGESNSIFASQS----QEAPAV  87

Query  390  QPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLID  569
              A  LPEG  WRYSEF+ AV  GKVERVRFSKDGSALQLTAV+G RATVI+PNDPDL+D
Sbjct  88   TNADGLPEGINWRYSEFIRAVTSGKVERVRFSKDGSALQLTAVNGARATVILPNDPDLVD  147

Query  570  ILAMNGVDISVSEGEGGNGLFSFIGN  647
            ILA NGVDISVSEGE    + S IGN
Sbjct  148  ILAKNGVDISVSEGEQQGNVASLIGN  173



>ref|XP_003057154.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH58799.1| predicted protein [Micromonas pusilla CCMP1545]
Length=731

 Score =   137 bits (346),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 82/152 (54%), Positives = 97/152 (64%), Gaps = 9/152 (6%)
 Frame = +3

Query  207  SSKATLAALLFSSIAPQAIALDNATPAAPPTEIQAEAP-----QPTASNASPFSQNVVLN  371
            ++ A+  A L +S A   +A+  A   APP    AEAP     Q   S  S FS      
Sbjct  57   TTAASFMAFLAASGATSLVAM--ADDFAPPA--TAEAPTSALAQFQQSAKSAFSDADSQT  112

Query  372  APKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPN  551
            AP       + LPEG+ WRYSEF+NAV+KGKVERVRF+KDGS+LQLTAVDGRRA V +PN
Sbjct  113  APSTAVADPNALPEGNTWRYSEFINAVQKGKVERVRFAKDGSSLQLTAVDGRRAAVTLPN  172

Query  552  DPDLIDILAMNGVDISVSEGEGGNGLFSFIGN  647
            DP+L+DILA NGVDISVSEGE      S  GN
Sbjct  173  DPELVDILAKNGVDISVSEGEQQGNFASLAGN  204



>ref|XP_001690889.1| membrane AAA-metalloprotease [Chlamydomonas reinhardtii]
 gb|EDP05335.1| membrane AAA-metalloprotease [Chlamydomonas reinhardtii]
Length=727

 Score =   137 bits (346),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 67/101 (66%), Positives = 79/101 (78%), Gaps = 2/101 (2%)
 Frame = +3

Query  351  SQNVVLNAP--KPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDG  524
            S N   +AP   P+ +    LPEG+QWRYSEF+NAV+ GKVERVRFSKDGS LQLTAVDG
Sbjct  105  SMNFASSAPLAAPEVRSEYTLPEGNQWRYSEFVNAVEAGKVERVRFSKDGSQLQLTAVDG  164

Query  525  RRATVIVPNDPDLIDILAMNGVDISVSEGEGGNGLFSFIGN  647
            RRATV++PNDPDL+DILA NGVDISVSEG+      + +GN
Sbjct  165  RRATVVLPNDPDLVDILAKNGVDISVSEGDQQGNYVALLGN  205



>gb|KIZ03250.1| cell division protease FtsH [Monoraphidium neglectum]
Length=732

 Score =   137 bits (345),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 79/151 (52%), Positives = 99/151 (66%), Gaps = 8/151 (5%)
 Frame = +3

Query  207  SSKATLAALLFSSIAPQAIALDNATP--AAPPTEIQAE--APQPTASNASPFSQNVVLNA  374
            ++ A L A L ++    A+A D   P   A  T   AE  APQ  A   +   Q     A
Sbjct  63   TAMAGLVAFLMAATPNAAVAADTFAPPEGATTTTTFAERPAPQSLALGGASAGQQ----A  118

Query  375  PKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPND  554
            P  + +  + LPEG+QWRYSEF+NAV+ GKVERVRFSKDG+ LQLTA+DGRRATV++PND
Sbjct  119  PALRDEATAGLPEGNQWRYSEFINAVQSGKVERVRFSKDGTMLQLTAIDGRRATVVLPND  178

Query  555  PDLIDILAMNGVDISVSEGEGGNGLFSFIGN  647
            P+L+DILA NGVDISVSEGE      + +GN
Sbjct  179  PELVDILARNGVDISVSEGEQQGNFAALLGN  209



>ref|XP_002948337.1| hypothetical protein VOLCADRAFT_80122 [Volvox carteri f. nagariensis]
 gb|EFJ50744.1| hypothetical protein VOLCADRAFT_80122 [Volvox carteri f. nagariensis]
Length=722

 Score =   137 bits (345),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 72/122 (59%), Positives = 86/122 (70%), Gaps = 7/122 (6%)
 Frame = +3

Query  288  APPTEIQAEAPQPTASNASPFSQNVVLNAP--KPQAQPASDLPEGSQWRYSEFLNAVKKG  461
            APP E        T  N +P S     +AP   P+ +    LPEG+QWRYS+F+NAV+ G
Sbjct  85   APPPETNT-----TTINQAPQSVQFGASAPLTAPEVRSEYQLPEGNQWRYSDFVNAVEAG  139

Query  462  KVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGEGGNGLFSFI  641
            KVERVRFSKDGS LQLTAVDGRRATV++PNDPDL+DILA NGVDISVSEG+      + +
Sbjct  140  KVERVRFSKDGSQLQLTAVDGRRATVVLPNDPDLVDILAKNGVDISVSEGDQQGNYVALL  199

Query  642  GN  647
            GN
Sbjct  200  GN  201



>ref|XP_003081278.1| FTSH_MEDSA Cell division protein ftsH homolog, chloroplast precursor 
(ISS) [Ostreococcus tauri]
Length=662

 Score =   135 bits (341),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 73/117 (62%), Positives = 84/117 (72%), Gaps = 4/117 (3%)
 Frame = +3

Query  309  AEAPQPTASNASPFSQNVVLNAPKPQAQPA----SDLPEGSQWRYSEFLNAVKKGKVERV  476
            A AP+PT + A    ++  + A + Q  PA      LPEG  WRYSEF+ AV  GKVERV
Sbjct  17   APAPEPTQAVAEQRGESNSIFASQSQEAPAVTNADGLPEGINWRYSEFIRAVTSGKVERV  76

Query  477  RFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGEGGNGLFSFIGN  647
            RFSKDGSALQLTAV+G RATVI+PNDPDL+DILA NGVDISVSEGE    + S IGN
Sbjct  77   RFSKDGSALQLTAVNGARATVILPNDPDLVDILAKNGVDISVSEGEQQGNVASLIGN  133



>emb|CAA73318.1| ATPase [Arabidopsis thaliana]
Length=634

 Score =   135 bits (339),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 79/128 (62%), Positives = 90/128 (70%), Gaps = 14/128 (11%)
 Frame = +3

Query  282  PAAPPTEIQAEAPQPTASNASP-FSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKK  458
            PA+P   I+++A +P  S  SP F QN +L AP P++   SDLPEGSQWRYSEFLNAVKK
Sbjct  22   PASPSVVIESQAVKP--STPSPLFIQNEILKAPSPKS---SDLPEGSQWRYSEFLNAVKK  76

Query  459  GKVERVRFSKDGSALQLTAVDGRRATVIVPN----DPDLIDILAMNGVDISVSEGE-GGN  623
            GKVERVRFSKDGS         RR +    +    DPDLIDILAMNGVDISVSEGE  GN
Sbjct  77   GKVERVRFSKDGSVCSAYC---RRQSPCFSHRPLTDPDLIDILAMNGVDISVSEGESSGN  133

Query  624  GLFSFIGN  647
             LF+ IGN
Sbjct  134  DLFTVIGN  141



>ref|XP_005843263.1| hypothetical protein CHLNCDRAFT_141387 [Chlorella variabilis]
 gb|EFN51161.1| hypothetical protein CHLNCDRAFT_141387 [Chlorella variabilis]
Length=259

 Score =   129 bits (325),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 59/81 (73%), Positives = 70/81 (86%), Gaps = 0/81 (0%)
 Frame = +3

Query  405  LPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMN  584
            LPEG+QWRYSEF+NAV+ GKVERVRFSKDG+ LQLTAVDGRRA V++PNDP+L+DILA N
Sbjct  82   LPEGTQWRYSEFINAVQSGKVERVRFSKDGTQLQLTAVDGRRALVVLPNDPELVDILARN  141

Query  585  GVDISVSEGEGGNGLFSFIGN  647
            GVDISVSEG+      + +GN
Sbjct  142  GVDISVSEGDQQGNYVALLGN  162



>ref|XP_007510744.1| cell division protein FtsH2 [Bathycoccus prasinos]
 emb|CCO18277.1| cell division protein FtsH2 [Bathycoccus prasinos]
Length=719

 Score =   132 bits (333),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 79/147 (54%), Positives = 93/147 (63%), Gaps = 12/147 (8%)
 Frame = +3

Query  216  ATLAALLFSSIAPQAIALDNATPAAPPTEIQAEAPQPTASNASPFSQNVVLNAPKPQAQP  395
            ATL A      A  A A+D   PA P  E Q  A Q T +  S       L+AP      
Sbjct  55   ATLTAFATLQNAQMASAID--FPAMPAVEQQQSAEQTTEAFPS-------LSAPSTTVAS  105

Query  396  ASD---LPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLI  566
             +D   LPEG+ WRYSEF+ AV  GKVERVRF+KDGS+LQLTAV+G RATV++PNDP+L+
Sbjct  106  TTDASGLPEGATWRYSEFIKAVLGGKVERVRFAKDGSSLQLTAVNGNRATVVLPNDPELV  165

Query  567  DILAMNGVDISVSEGEGGNGLFSFIGN  647
            DILA NGVDISVSEGE      S +GN
Sbjct  166  DILAKNGVDISVSEGEQQGNAASLLGN  192



>ref|XP_005650371.1| membrane AAA-metalloprotease [Coccomyxa subellipsoidea C-169]
 gb|EIE25827.1| membrane AAA-metalloprotease [Coccomyxa subellipsoidea C-169]
Length=736

 Score =   129 bits (324),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 59/81 (73%), Positives = 69/81 (85%), Gaps = 0/81 (0%)
 Frame = +3

Query  405  LPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMN  584
            LPEG+QWRYSEF+NAV+ GKVERVRFSK+G  LQLTAVDGRRA V++PNDP+L+DILA N
Sbjct  131  LPEGNQWRYSEFINAVQNGKVERVRFSKEGGQLQLTAVDGRRAFVVLPNDPELVDILAKN  190

Query  585  GVDISVSEGEGGNGLFSFIGN  647
            GVDISVSEG+      S +GN
Sbjct  191  GVDISVSEGDQQGNYVSLLGN  211



>ref|XP_001419590.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO97883.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=651

 Score =   127 bits (320),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 62/84 (74%), Positives = 69/84 (82%), Gaps = 0/84 (0%)
 Frame = +3

Query  396  ASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDIL  575
            A  LPEG+ WRYSEF+ AV  GKVERVRFSKDGSALQLTAV+G RATVI+PNDP+L+DIL
Sbjct  46   ADGLPEGNNWRYSEFIKAVMSGKVERVRFSKDGSALQLTAVNGARATVILPNDPELVDIL  105

Query  576  AMNGVDISVSEGEGGNGLFSFIGN  647
            A NGVDISVSEGE      S +GN
Sbjct  106  AKNGVDISVSEGEQQGNAASLVGN  129



>ref|XP_002505995.1| hypothetical protein MICPUN_106506 [Micromonas sp. RCC299]
 gb|ACO67253.1| hypothetical protein MICPUN_106506 [Micromonas sp. RCC299]
Length=718

 Score =   124 bits (310),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 60/94 (64%), Positives = 71/94 (76%), Gaps = 0/94 (0%)
 Frame = +3

Query  366  LNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIV  545
            L AP  +    + LPEG+ WRYSEF+ AV  GKVERVRF+KDG++LQLTAVDGRRA V +
Sbjct  102  LTAPDTKVVDPNALPEGNTWRYSEFIRAVMGGKVERVRFAKDGTSLQLTAVDGRRAQVTL  161

Query  546  PNDPDLIDILAMNGVDISVSEGEGGNGLFSFIGN  647
            PNDP+L+DILA NGVDISVSEG+      S  GN
Sbjct  162  PNDPELVDILAKNGVDISVSEGDQQGNYASLFGN  195



>ref|XP_011396167.1| ATP-dependent zinc metalloprotease FTSH 5, chloroplastic [Auxenochlorella 
protothecoides]
 gb|KFM23297.1| ATP-dependent zinc metalloprotease FTSH 5, chloroplastic [Auxenochlorella 
protothecoides]
Length=726

 Score =   118 bits (295),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 55/77 (71%), Positives = 64/77 (83%), Gaps = 0/77 (0%)
 Frame = +3

Query  405  LPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMN  584
            LPEG+QWRYS+F+NAV+ GK+ERVRFSKDG+ LQLTA+DGRRA V   NDP+L+D LA N
Sbjct  120  LPEGTQWRYSDFINAVESGKIERVRFSKDGTQLQLTAIDGRRALVNAVNDPELVDRLAKN  179

Query  585  GVDISVSEGEGGNGLFS  635
            GVDISVSEGE   G  S
Sbjct  180  GVDISVSEGEQQGGFVS  196



>gb|EEC81336.1| hypothetical protein OsI_24516 [Oryza sativa Indica Group]
Length=630

 Score =   115 bits (288),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 60/90 (67%), Positives = 71/90 (79%), Gaps = 5/90 (6%)
 Frame = +3

Query  276  ATPAAPPTEIQA-EAPQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAV  452
            A P +P  ++Q  EAP P A+   PFS N +L APKP +  A+DLPEG+QWRYSEFL+AV
Sbjct  57   APPPSPTQDVQVLEAPSPAAN---PFS-NALLTAPKPTSSAAADLPEGAQWRYSEFLSAV  112

Query  453  KKGKVERVRFSKDGSALQLTAVDGRRATVI  542
            KKGKVERVRFSKDG  LQLTA+DGRRATV+
Sbjct  113  KKGKVERVRFSKDGGLLQLTAIDGRRATVV  142



>gb|AFW63099.1| hypothetical protein ZEAMMB73_047704 [Zea mays]
Length=321

 Score = 97.4 bits (241),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 64/113 (57%), Positives = 76/113 (67%), Gaps = 11/113 (10%)
 Frame = +3

Query  258  AIALDNA--TPA---APPTEIQAEAPQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQ  422
            A+A D +  TPA    P  ++Q EAP PTA+   PFS N +L A KP A  A DLPEG+ 
Sbjct  88   ALATDTSATTPAPLSVPAPKLQIEAPAPTAN---PFS-NSLLTALKPSAS-AYDLPEGAD  142

Query  423  WRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAM  581
             R+  F + +K+GK E VRFSKDG  LQL AVDG   TV+VPNDPDLIDILAM
Sbjct  143  NRHIVFPSVIKRGK-EPVRFSKDGGLLQLAAVDGCHTTVVVPNDPDLIDILAM  194



>ref|WP_015220601.1| membrane protease FtsH catalytic subunit [Cyanobacterium aponinum]
 gb|AFZ54879.1| membrane protease FtsH catalytic subunit [Cyanobacterium aponinum 
PCC 10605]
Length=615

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 40/69 (58%), Positives = 50/69 (72%), Gaps = 2/69 (3%)
 Frame = +3

Query  402  DLPEGSQ--WRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDIL  575
            D P+ SQ  W+YS+F++ V+  KVERV  S D S    TA DG+R TV +PNDP+LIDIL
Sbjct  30   DRPQNSQLSWKYSQFIDEVQGDKVERVNLSADRSVAIATARDGQRYTVNLPNDPELIDIL  89

Query  576  AMNGVDISV  602
            + NGVDISV
Sbjct  90   SNNGVDISV  98



>ref|WP_015955558.1| cell division protein FtsH [Cyanothece sp. PCC 7424]
 gb|ACK71965.1| ATP-dependent metalloprotease FtsH [Cyanothece sp. PCC 7424]
Length=616

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = +3

Query  417  SQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDI  596
            + W+YSEFL+ V++GKVERV+ S D S  ++   DG+  TV +PNDP L++ILA NGVDI
Sbjct  38   TTWKYSEFLDQVRQGKVERVQLSADRSEARVPTQDGQYVTVNLPNDPQLVNILADNGVDI  97

Query  597  SV  602
             V
Sbjct  98   VV  99



>ref|WP_015230925.1| ATP-dependent metalloprotease FtsH [Dactylococcopsis salina]
 gb|AFZ51951.1| ATP-dependent metalloprotease FtsH [Dactylococcopsis salina PCC 
8305]
Length=617

 Score = 72.0 bits (175),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 42/60 (70%), Gaps = 0/60 (0%)
 Frame = +3

Query  423  WRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISV  602
            WRYSEF+N V+ G VE VR + D S +  TA DG++  V +PNDP LIDIL  N VDISV
Sbjct  41   WRYSEFVNRVENGNVESVRLNSDRSKVIATAQDGQQVQVSLPNDPQLIDILTENNVDISV  100



>ref|WP_015227551.1| membrane protease FtsH catalytic subunit [Halothece sp. PCC 7418]
 gb|AFZ45679.1| membrane protease FtsH catalytic subunit [Halothece sp. PCC 7418]
Length=617

 Score = 71.6 bits (174),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 41/60 (68%), Gaps = 0/60 (0%)
 Frame = +3

Query  423  WRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISV  602
            WRYSEF+N V+ G VE VR + D S    TA DG++  V +PNDP LIDIL  N VDISV
Sbjct  41   WRYSEFVNRVENGNVESVRLNSDRSKAIATAQDGQQVQVTLPNDPQLIDILTENNVDISV  100



>ref|WP_013320241.1| cell division protein FtsH [Cyanothece sp. PCC 7822]
 gb|ADN12131.1| ATP-dependent metalloprotease FtsH [Cyanothece sp. PCC 7822]
Length=616

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = +3

Query  417  SQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDI  596
            S W+YSEFL+ V++GKVERV+ S D +  ++   +G+  TV +PNDP L++ILA NGVDI
Sbjct  38   STWKYSEFLDQVRQGKVERVQLSADRAEARVPTQNGQYVTVNLPNDPQLVNILAENGVDI  97

Query  597  SV  602
             V
Sbjct  98   VV  99



>ref|WP_009630197.1| ATP-dependent metalloprotease FtsH [Synechocystis sp. PCC 7509]
Length=612

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/61 (56%), Positives = 43/61 (70%), Gaps = 0/61 (0%)
 Frame = +3

Query  423  WRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISV  602
            WRYS+F+  V++GKVERV  S D +  Q+T  DG +  V + NDPDLIDIL+ N VDI V
Sbjct  36   WRYSQFIQEVQQGKVERVSLSADRTRAQVTPQDGEKKIVNLLNDPDLIDILSKNNVDIVV  95

Query  603  S  605
            S
Sbjct  96   S  96



>ref|WP_015204207.1| membrane protease FtsH catalytic subunit [Crinalium epipsammum]
 gb|AFZ14101.1| membrane protease FtsH catalytic subunit [Crinalium epipsammum 
PCC 9333]
Length=613

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 42/60 (70%), Gaps = 0/60 (0%)
 Frame = +3

Query  423  WRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISV  602
            W+YSEF+  V+ GKVERV  S D +   +TA DG +  V +PNDPDL++IL   GVDI+V
Sbjct  37   WKYSEFIQEVESGKVERVGLSSDRTKALVTAQDGNKVIVNLPNDPDLVNILTSKGVDIAV  96



>ref|WP_015188582.1| membrane protease FtsH catalytic subunit [Gloeocapsa sp. PCC 
7428]
 gb|AFZ30709.1| membrane protease FtsH catalytic subunit [Gloeocapsa sp. PCC 
7428]
Length=612

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 43/60 (72%), Gaps = 0/60 (0%)
 Frame = +3

Query  423  WRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISV  602
            WRYS+F+  V++G+VERV  S D +   +T +DG +  V +PNDPDLI+IL  N VDISV
Sbjct  36   WRYSQFIQEVEQGRVERVSLSADRTRALVTPLDGEKRVVNLPNDPDLINILTRNQVDISV  95



>ref|WP_036001623.1| cell division protein FtsH [Leptolyngbya sp. JSC-1]
Length=612

 Score = 68.6 bits (166),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 32/61 (52%), Positives = 44/61 (72%), Gaps = 0/61 (0%)
 Frame = +3

Query  423  WRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISV  602
            WRYS+F++ V+ G+VE+V  S D S   +T  DG+R  V +P DP+L++IL  NGVDISV
Sbjct  36   WRYSQFIDRVETGQVEKVNISADRSRALVTTSDGQRVAVNLPADPELLNILQTNGVDISV  95

Query  603  S  605
            S
Sbjct  96   S  96



>ref|WP_015224048.1| membrane protease FtsH catalytic subunit [Cyanobacterium stanieri]
 gb|AFZ48735.1| membrane protease FtsH catalytic subunit [Cyanobacterium stanieri 
PCC 7202]
Length=615

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 49/75 (65%), Gaps = 7/75 (9%)
 Frame = +3

Query  378  KPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDP  557
            +PQ Q +S       W+YS+F++ V+  +VERV+ S D S    TA DG+R  V +PNDP
Sbjct  31   RPQEQQSS-------WKYSQFIDEVQTNRVERVQLSADRSQAIATARDGQRFLVNLPNDP  83

Query  558  DLIDILAMNGVDISV  602
             L+DIL+ N VDISV
Sbjct  84   QLVDILSDNQVDISV  98



>ref|WP_026794256.1| MULTISPECIES: cell division protein FtsH [Planktothrix]
Length=612

 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 39/60 (65%), Gaps = 0/60 (0%)
 Frame = +3

Query  423  WRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISV  602
            W+YS F+  VK  KVERV  S D S   +TA DG +  V +PNDP LIDIL  N VDISV
Sbjct  36   WKYSTFIQEVKSNKVERVSLSSDRSRALVTAQDGNKVIVNLPNDPALIDILTENNVDISV  95



>ref|WP_027255466.1| cell division protein FtsH [Planktothrix agardhii]
Length=612

 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 39/60 (65%), Gaps = 0/60 (0%)
 Frame = +3

Query  423  WRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISV  602
            W+YS F+  VK  KVERV  S D S   +TA DG +  V +PNDP LIDIL  N VDISV
Sbjct  36   WKYSTFIQEVKSNKVERVSLSSDRSRALVTAQDGNKVIVNLPNDPALIDILTENNVDISV  95



>ref|WP_027249137.1| cell division protein FtsH [Planktothrix agardhii]
Length=612

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 39/60 (65%), Gaps = 0/60 (0%)
 Frame = +3

Query  423  WRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISV  602
            W+YS F+  VK  KVERV  S D S   +TA DG +  V +PNDP LIDIL  N VDISV
Sbjct  36   WKYSTFIQEVKSNKVERVSLSSDRSRALVTAQDGNKVIVNLPNDPALIDILTENNVDISV  95



>ref|WP_042152619.1| cell division protein FtsH [Planktothrix agardhii]
 gb|KEI66190.1| FtsH [Planktothrix agardhii NIVA-CYA 126/8]
Length=612

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 39/60 (65%), Gaps = 0/60 (0%)
 Frame = +3

Query  423  WRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISV  602
            W+YS F+  VK  KVERV  S D S   +TA DG +  V +PNDP LIDIL  N VDISV
Sbjct  36   WKYSTFIQEVKSNKVERVSLSSDRSRALVTAQDGNKVIVNLPNDPALIDILTENNVDISV  95



>ref|WP_026786321.1| cell division protein FtsH [Planktothrix rubescens]
Length=612

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 39/60 (65%), Gaps = 0/60 (0%)
 Frame = +3

Query  423  WRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISV  602
            W+YS F+  VK  KVERV  S D S   +TA DG +  V +PNDP LIDIL  N VDISV
Sbjct  36   WKYSTFIQEVKSNKVERVSLSSDRSRALVTAQDGSKVIVNLPNDPALIDILTENNVDISV  95



>ref|WP_017293936.1| cell division protein FtsH [Geminocystis herdmanii]
Length=615

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 48/69 (70%), Gaps = 2/69 (3%)
 Frame = +3

Query  402  DLPEGSQ--WRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDIL  575
            D P+ +Q  W+YS+F++ V+  KVERV+ S D +    TA DG+R  V +PNDP LIDIL
Sbjct  30   DRPQTNQLSWKYSQFIDEVQTDKVERVQLSADRTQAIATARDGQRFLVNLPNDPQLIDIL  89

Query  576  AMNGVDISV  602
            + N VDI+V
Sbjct  90   SDNKVDIAV  98



>ref|WP_012627305.1| cell division protein FtsH [Cyanothece sp. PCC 7425]
 gb|ACL44219.1| ATP-dependent metalloprotease FtsH [Cyanothece sp. PCC 7425]
Length=612

 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = +3

Query  408  PEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNG  587
            P    WRYS+F+ AV+  +V +V  S D +  Q+T  DG R  V +PNDP+LIDIL  N 
Sbjct  31   PTRQVWRYSQFIQAVENRQVAKVSISPDRTQAQVTVQDGSRVMVNLPNDPELIDILTNNK  90

Query  588  VDISV  602
            VDISV
Sbjct  91   VDISV  95



>ref|WP_015129349.1| membrane protease FtsH catalytic subunit [Calothrix sp. PCC 7507]
 gb|AFY33539.1| membrane protease FtsH catalytic subunit [Calothrix sp. PCC 7507]
Length=612

 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 41/60 (68%), Gaps = 0/60 (0%)
 Frame = +3

Query  423  WRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISV  602
            WRYS+F+  V+KG+V++V  S D S   +T+ DG +  V + NDPDLI+ L   GVDISV
Sbjct  36   WRYSQFIQEVEKGRVDKVSLSADRSTALVTSRDGNKKVVTLVNDPDLINTLTAKGVDISV  95



>ref|XP_005834056.1| hypothetical protein GUITHDRAFT_86435 [Guillardia theta CCMP2712]
 gb|EKX47076.1| hypothetical protein GUITHDRAFT_86435 [Guillardia theta CCMP2712]
Length=695

 Score = 65.1 bits (157),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 36/78 (46%), Positives = 48/78 (62%), Gaps = 5/78 (6%)
 Frame = +3

Query  423  WRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATV-IVPNDPDLIDILAMNGVDIS  599
            WRYSEF+NAV+  KVE+V FS DG  +    VDG R  +  +PNDP L+D L  + VD++
Sbjct  106  WRYSEFMNAVEGDKVEKVTFSADGRRVLAVDVDGNRYKLDALPNDPTLLDTLTKHKVDVT  165

Query  600  V----SEGEGGNGLFSFI  641
            V      G GG+ + S I
Sbjct  166  VLPAQQPGGGGDLIRSLI  183



>gb|EGJ33321.1| membrane protease FtsH catalytic subunit [Moorea producens 3L]
Length=597

 Score = 65.1 bits (157),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 41/65 (63%), Gaps = 0/65 (0%)
 Frame = +3

Query  408  PEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNG  587
            P    WRY + ++ V+ GKVE VR S D S     A DGR+  V +PNDP LI++L  NG
Sbjct  15   PSRDTWRYDQLISQVESGKVETVRISADRSKAIAIAQDGRQVEVNLPNDPQLINLLNNNG  74

Query  588  VDISV  602
            VDISV
Sbjct  75   VDISV  79



>ref|XP_005713345.1| cell division protein FtsH [Chondrus crispus]
 emb|CDF33542.1| cell division protein FtsH [Chondrus crispus]
Length=711

 Score = 65.1 bits (157),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 35/73 (48%), Positives = 47/73 (64%), Gaps = 3/73 (4%)
 Frame = +3

Query  423  WRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATV-IVPNDPDLIDILAMNGVDIS  599
            WRYSEF+NAV+K +VE+V FS DG  L     +G R  +  +PNDPDL+  L  + VD++
Sbjct  125  WRYSEFINAVEKDQVEKVTFSADGQRLLAVDTEGNRFKLDALPNDPDLLKTLTGHKVDVT  184

Query  600  V--SEGEGGNGLF  632
            V  S+ E G G F
Sbjct  185  VLPSQPESGAGDF  197



>ref|WP_002793446.1| cell division protein FtsH [Microcystis aeruginosa]
 emb|CCI24284.1| Cell division protein FtsH; ATP-dependent zinc-metallo protease 
[Microcystis aeruginosa PCC 9808]
Length=617

 Score = 65.1 bits (157),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 39/60 (65%), Gaps = 0/60 (0%)
 Frame = +3

Query  423  WRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISV  602
            W+YSEFL  V++GKVE VR S D     +   DG    V +PNDP LI+ILA N VDISV
Sbjct  41   WKYSEFLQEVREGKVETVRLSADRQRAIVPTQDGTNVLVNLPNDPQLINILAENNVDISV  100



>ref|WP_002784350.1| Cell division protein FtsH; ATP-dependent zinc-metallo protease 
[Microcystis aeruginosa]
 emb|CCI13887.1| Cell division protein FtsH; ATP-dependent zinc-metallo protease 
[Microcystis aeruginosa PCC 9806]
Length=617

 Score = 65.1 bits (157),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 39/60 (65%), Gaps = 0/60 (0%)
 Frame = +3

Query  423  WRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISV  602
            W+YSEFL  V++GKVE VR S D     +   DG    V +PNDP LI+ILA N VDISV
Sbjct  41   WKYSEFLQEVREGKVETVRLSADRQRAIVPTQDGTNVLVNLPNDPQLINILAENNVDISV  100



>ref|WP_002742170.1| cell division protein FtsH [Microcystis aeruginosa]
 emb|CAO87142.1| unnamed protein product [Microcystis aeruginosa PCC 7806]
 emb|CCH94297.1| Cell division protein FtsH; ATP-dependent zinc-metallo protease 
[Microcystis aeruginosa PCC 9432]
 emb|CCI05461.1| Cell division protein FtsH; ATP-dependent zinc-metallo protease 
[Microcystis aeruginosa PCC 7941]
 emb|CCI18127.1| Cell division protein FtsH; ATP-dependent zinc-metallo protease 
[Microcystis aeruginosa PCC 9807]
 gb|ELS49082.1| ATP-dependent zinc metalloprotease FtsH 3 [Microcystis aeruginosa 
DIANCHI905]
 gb|EPF21392.1| ATP-dependent zinc metalloprotease FtsH 3 [Microcystis aeruginosa 
SPC777]
Length=617

 Score = 65.1 bits (157),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 39/60 (65%), Gaps = 0/60 (0%)
 Frame = +3

Query  423  WRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISV  602
            W+YSEFL  V++GKVE VR S D     +   DG    V +PNDP LI+ILA N VDISV
Sbjct  41   WKYSEFLQEVREGKVETVRLSADRQRAIVPTQDGTNVLVNLPNDPQLINILAENNVDISV  100



>ref|WP_044492620.1| cell division protein FtsH [Moorea producens]
Length=613

 Score = 65.1 bits (157),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 41/65 (63%), Gaps = 0/65 (0%)
 Frame = +3

Query  408  PEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNG  587
            P    WRY + ++ V+ GKVE VR S D S     A DGR+  V +PNDP LI++L  NG
Sbjct  31   PSRDTWRYDQLISQVESGKVETVRISADRSKAIAIAQDGRQVEVNLPNDPQLINLLNNNG  90

Query  588  VDISV  602
            VDISV
Sbjct  91   VDISV  95



>ref|WP_002797753.1| cell division protein FtsH [Microcystis aeruginosa]
 emb|CCI26104.1| Cell division protein FtsH; ATP-dependent zinc-metallo protease 
[Microcystis aeruginosa PCC 9809]
Length=617

 Score = 65.1 bits (157),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 39/60 (65%), Gaps = 0/60 (0%)
 Frame = +3

Query  423  WRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISV  602
            W+YSEFL  V++GKVE VR S D     +   DG    V +PNDP LI+ILA N VDISV
Sbjct  41   WKYSEFLQEVREGKVETVRLSADRQRAIVPTQDGTNVLVNLPNDPQLINILAENNVDISV  100



>ref|WP_002801795.1| cell division protein FtsH [Microcystis aeruginosa]
 emb|CCI35504.1| Cell division protein FtsH; ATP-dependent zinc-metallo protease 
[Microcystis aeruginosa PCC 9701]
Length=617

 Score = 65.1 bits (157),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 39/60 (65%), Gaps = 0/60 (0%)
 Frame = +3

Query  423  WRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISV  602
            W+YSEFL  V++GKVE VR S D     +   DG    V +PNDP LI+ILA N VDISV
Sbjct  41   WKYSEFLQEVREGKVETVRLSADRQRAIVPTQDGTNVLVNLPNDPQLINILAENNVDISV  100



>ref|WP_012264056.1| cell division protein FtsH [Microcystis aeruginosa]
 dbj|BAG00204.1| cell division protein [Microcystis aeruginosa NIES-843]
Length=617

 Score = 64.7 bits (156),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 39/60 (65%), Gaps = 0/60 (0%)
 Frame = +3

Query  423  WRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISV  602
            W+YSEFL  V++GKVE VR S D     +   DG    V +PNDP LI+ILA N VDISV
Sbjct  41   WKYSEFLQEVREGKVETVRLSADRQRAIVPTQDGANVLVNLPNDPQLINILAENNVDISV  100



>dbj|GAL91410.1| cell division protein FtsH [Microcystis aeruginosa NIES-44]
Length=617

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 39/60 (65%), Gaps = 0/60 (0%)
 Frame = +3

Query  423  WRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISV  602
            W+YSEFL  V++GKVE VR S D     +   DG    V +PNDP LI+ILA N VDISV
Sbjct  41   WKYSEFLQEVREGKVETVRLSADRQRAIVPTQDGANVLVNLPNDPQLINILAENNVDISV  100



>ref|WP_002737367.1| ATP-dependent zinc metalloprotease FtsH 3 [Microcystis aeruginosa]
 gb|ELP54710.1| ATP-dependent zinc metalloprotease FtsH 3 [Microcystis aeruginosa 
TAIHU98]
Length=617

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 39/60 (65%), Gaps = 0/60 (0%)
 Frame = +3

Query  423  WRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISV  602
            W+YSEFL  V++GKVE VR S D     +   DG    V +PNDP LI+ILA N VDISV
Sbjct  41   WKYSEFLQEVREGKVETVRLSADRQRAIVPTQDGANVLVNLPNDPQLINILAENNVDISV  100



>ref|WP_002763074.1| MULTISPECIES: cell division protein FtsH [Microcystis]
 emb|CCH99625.1| Cell division protein FtsH; ATP-dependent zinc-metallo protease 
[Microcystis aeruginosa PCC 9717]
 emb|CCI33922.1| Cell division protein FtsH; ATP-dependent zinc-metallo protease 
[Microcystis sp. T1-4]
Length=617

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 39/60 (65%), Gaps = 0/60 (0%)
 Frame = +3

Query  423  WRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISV  602
            W+YSEFL  V++GKVE VR S D     +   DG    V +PNDP LI+ILA N VDISV
Sbjct  41   WKYSEFLQEVREGKVETVRLSADRQRAIVPTQDGANVLVNLPNDPQLINILAENNVDISV  100



>ref|WP_017303138.1| cell division protein FtsH [Spirulina subsalsa]
Length=616

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 40/60 (67%), Gaps = 0/60 (0%)
 Frame = +3

Query  423  WRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISV  602
            W+YS+ +  V+ G++E +R + D S   +T  DG +  V +PNDP+LIDIL  N VDISV
Sbjct  40   WKYSQLIQEVESGRIETIRLTADRSQASVTTQDGTQVLVNLPNDPELIDILTTNNVDISV  99



>ref|WP_006623490.1| cell division protein FtsH [Arthrospira sp. PCC 8005]
 emb|CCE19163.1| ATP-dependent zinc-metalloprotease [Arthrospira sp. PCC 8005]
 gb|EKD09489.1| ATP-dependent metalloprotease FtsH [Arthrospira platensis C1]
 emb|CDM97762.1| ATP-dependent zinc-metalloprotease [Arthrospira sp. PCC 8005]
Length=600

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 42/60 (70%), Gaps = 0/60 (0%)
 Frame = +3

Query  423  WRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISV  602
            W+YS F+  V++ +VERV  S D +   +TA DG +  V +PNDPDLI+IL+ N VDI+V
Sbjct  24   WKYSTFVQEVQQNRVERVSISADRTKALVTAQDGSKILVNLPNDPDLINILSENNVDIAV  83



>ref|WP_006618677.1| FtsH peptidase [Arthrospira platensis]
 dbj|BAI92105.1| cell division protein FtsH [Arthrospira platensis NIES-39]
 gb|KDR55786.1| cell division protein FtsH [Arthrospira platensis str. Paraca]
Length=612

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 42/60 (70%), Gaps = 0/60 (0%)
 Frame = +3

Query  423  WRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISV  602
            W+YS F+  V++ +VERV  S D +   +TA DG +  V +PNDPDLI+IL+ N VDI+V
Sbjct  36   WKYSTFVQEVQQNRVERVSISADRTKALVTAQDGSKILVNLPNDPDLINILSENNVDIAV  95



>ref|WP_006669335.1| MULTISPECIES: cell division protein FtsH [Arthrospira]
 gb|EDZ94639.1| ATP-dependent metalloprotease FtsH [Arthrospira maxima CS-328]
Length=612

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 42/60 (70%), Gaps = 0/60 (0%)
 Frame = +3

Query  423  WRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISV  602
            W+YS F+  V++ +VERV  S D +   +TA DG +  V +PNDPDLI+IL+ N VDI+V
Sbjct  36   WKYSTFVQEVQQNRVERVSISADRTKALVTAQDGSKILVNLPNDPDLINILSENNVDIAV  95



>ref|WP_002771354.1| cell division protein FtsH [Microcystis aeruginosa]
 emb|CCI04533.1| Cell division protein FtsH; ATP-dependent zinc-metallo protease 
[Microcystis aeruginosa PCC 9443]
Length=617

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 39/60 (65%), Gaps = 0/60 (0%)
 Frame = +3

Query  423  WRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISV  602
            W+YSEFL  V++GKVE VR S D     +   +G    V +PNDP LI+ILA N VDISV
Sbjct  41   WKYSEFLQEVREGKVETVRLSADRQRAIVPTQEGTNVLVNLPNDPQLINILAENNVDISV  100



>ref|WP_007356988.1| MULTISPECIES: cell division protein FtsH [Kamptonema]
 emb|CBN57796.1| FtsH peptidase [ [[Oscillatoria] sp. PCC 6506]
Length=612

 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +3

Query  408  PEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNG  587
            P    W+YSEF+  V+  +V++V  + D +   +T+ DG +  V +PNDP+LI+IL  NG
Sbjct  31   PSRQLWKYSEFIEQVQSKRVDKVSINADRTRALVTSQDGTKVLVNLPNDPELINILTTNG  90

Query  588  VDISV  602
            VDISV
Sbjct  91   VDISV  95



>ref|WP_015173051.1| membrane protease FtsH catalytic subunit [Geitlerinema sp. PCC 
7407]
 gb|AFY67487.1| membrane protease FtsH catalytic subunit [Geitlerinema sp. PCC 
7407]
Length=613

 Score = 62.4 bits (150),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 42/61 (69%), Gaps = 1/61 (2%)
 Frame = +3

Query  423  WRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATV-IVPNDPDLIDILAMNGVDIS  599
            WRYS+F+ +V+  KVE+V  S D +   +T+ DG +  V I PNDPDLI+IL  N +DIS
Sbjct  36   WRYSQFIQSVENNKVEKVSISADRTRALVTSFDGSKILVNIPPNDPDLINILTANNIDIS  95

Query  600  V  602
            V
Sbjct  96   V  96



>ref|WP_035174132.1| cell division protein FtsH, partial [Calothrix sp. PCC 7103]
Length=69

 Score = 57.8 bits (138),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 28/62 (45%), Positives = 42/62 (68%), Gaps = 1/62 (2%)
 Frame = +3

Query  420  QWRYSEFLNAVKKGKVERVRFSKDGSALQLTAV-DGRRATVIVPNDPDLIDILAMNGVDI  596
            QWRYS+F+  V+KG +E+V F +DG+   +T+  D ++  V + NDP+LI IL    VDI
Sbjct  6    QWRYSKFIQEVEKGNIEKVSFYRDGTTAIVTSKNDAKQKRVNLVNDPELIKILINKDVDI  65

Query  597  SV  602
            +V
Sbjct  66   NV  67



>ref|WP_008316727.1| ATP-dependent metalloprotease FtsH [Leptolyngbya sp. PCC 6406]
Length=613

 Score = 62.0 bits (149),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 41/65 (63%), Gaps = 1/65 (2%)
 Frame = +3

Query  411  EGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGR-RATVIVPNDPDLIDILAMNG  587
            E   WRYS FLNAV+   +ERV  S D +  + TA DG  + TV +PNDP+LI +L  N 
Sbjct  32   ETQSWRYSRFLNAVESNTIERVSISADRARARFTAPDGSGQVTVNLPNDPELIGLLEQNN  91

Query  588  VDISV  602
            VDI V
Sbjct  92   VDIVV  96



>ref|WP_015177320.1| membrane protease FtsH catalytic subunit [Oscillatoria nigro-viridis]
 gb|AFZ08063.1| membrane protease FtsH catalytic subunit [Oscillatoria nigro-viridis 
PCC 7112]
Length=612

 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = +3

Query  408  PEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNG  587
            P    W+YS+F+  V+  +V+++  S D S   +TA DG +  V +PNDP+LI+IL  N 
Sbjct  31   PSREVWKYSQFIQEVEGKRVDKINISSDRSKALVTAQDGNKVLVNLPNDPELINILTKNN  90

Query  588  VDISV  602
            VDISV
Sbjct  91   VDISV  95



>ref|WP_006633639.1| cell division protein FtsH [Microcoleus vaginatus]
 gb|EGK87327.1| ATP-dependent metalloprotease FtsH [Microcoleus vaginatus FGP-2]
Length=612

 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = +3

Query  408  PEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNG  587
            P    W+YS+F+  V+  +V+++  S D S   +TA DG +  V +PNDP+LI+IL  N 
Sbjct  31   PSREVWKYSQFIQEVEGKRVDKINISSDRSKALVTAQDGNKVLVNLPNDPELINILTKNN  90

Query  588  VDISV  602
            VDISV
Sbjct  91   VDISV  95



>ref|WP_017653544.1| cell division protein FtsH [Microchaete sp. PCC 7126]
Length=612

 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 44/66 (67%), Gaps = 1/66 (2%)
 Frame = +3

Query  408  PEGSQ-WRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMN  584
            P+G +  RYS+F+  V+KG+V++V  S D S   +T+ DG +  V + NDPDLI+ L   
Sbjct  30   PQGREPLRYSQFIQEVEKGRVDKVSLSADRSTALVTSRDGNKKVVTLVNDPDLINTLTAK  89

Query  585  GVDISV  602
            GVDISV
Sbjct  90   GVDISV  95



>ref|NP_001173800.1| Os04g0220500 [Oryza sativa Japonica Group]
 dbj|BAH92528.1| Os04g0220500 [Oryza sativa Japonica Group]
Length=1510

 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 40/60 (67%), Gaps = 2/60 (3%)
 Frame = +3

Query  474  VRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGE-GGNGLF-SFIGN  647
            VR   D     LTA+DGR   V++PN PDLIDILA N VDISV EG+  G G F +F+GN
Sbjct  244  VRTESDDLGNDLTAIDGRYTIVVIPNAPDLIDILATNDVDISVVEGDAAGLGEFLAFVGN  303



>ref|WP_039716361.1| cell division protein FtsH [Scytonema millei]
 gb|KIF18854.1| cell division protein FtsH [Scytonema millei VB511283]
Length=612

 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 41/60 (68%), Gaps = 0/60 (0%)
 Frame = +3

Query  423  WRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISV  602
            WRYS+F+ AV+KG+V +VR S D +   +   DG +  V +P+DP+LI IL   GVDI+V
Sbjct  36   WRYSDFIQAVEKGRVAQVRLSADRTRALVKPQDGSQVIVNLPDDPELISILTERGVDIAV  95



>ref|WP_015156116.1| membrane protease FtsH catalytic subunit [Chroococcidiopsis thermalis]
 gb|AFY89574.1| membrane protease FtsH catalytic subunit [Chroococcidiopsis thermalis 
PCC 7203]
Length=612

 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 41/60 (68%), Gaps = 0/60 (0%)
 Frame = +3

Query  423  WRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISV  602
            WRYS+F+ AV+KG+V +VR S D +   +   DG +  V +P+DP+LI IL   GVDI+V
Sbjct  36   WRYSDFIQAVEKGRVAQVRLSADRTRALVKPQDGSQVIVNLPDDPELISILTERGVDIAV  95



>ref|WP_041036156.1| cell division protein FtsH [Tolypothrix campylonemoides]
 gb|KIJ75867.1| cell division protein FtsH [Tolypothrix campylonemoides VB511288]
Length=613

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 39/60 (65%), Gaps = 0/60 (0%)
 Frame = +3

Query  423  WRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISV  602
            WRYS+F+  V+ G+V +V  S D S   +T  DG +  V + NDPDLI+ L  +GVDISV
Sbjct  37   WRYSQFIQEVQNGRVAKVSLSADRSTALVTPGDGSKKLVTLVNDPDLINTLTQHGVDISV  96



>ref|WP_009341877.1| cell division protein FtsH [Raphidiopsis brookii]
 gb|EFA73959.1| Peptidase M41, FtsH [Raphidiopsis brookii D9]
Length=613

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 43/66 (65%), Gaps = 1/66 (2%)
 Frame = +3

Query  408  PEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLT-AVDGRRATVIVPNDPDLIDILAMN  584
            P+   WRYSEF+  V++G+VERV  S D +   +T   D  +  VI+ NDPDLI+ L+  
Sbjct  31   PQVETWRYSEFIQQVEQGRVERVSLSSDRTTAVVTPKYDPNKKRVILVNDPDLINTLSSK  90

Query  585  GVDISV  602
            GVDI+V
Sbjct  91   GVDIAV  96



>ref|WP_028090468.1| cell division protein FtsH [Dolichospermum circinale]
Length=614

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 40/61 (66%), Gaps = 1/61 (2%)
 Frame = +3

Query  423  WRYSEFLNAVKKGKVERVRFSKDGSALQLT-AVDGRRATVIVPNDPDLIDILAMNGVDIS  599
            WRYS+F+  V++G+VERV  S D S   +T   D ++  V + NDPDLI+ L   GVDIS
Sbjct  37   WRYSQFIQEVERGRVERVSLSSDRSTALVTPKYDEKKKIVTLVNDPDLINTLTAKGVDIS  96

Query  600  V  602
            V
Sbjct  97   V  97



>ref|WP_006278775.1| cell division protein FtsH [Cylindrospermopsis raciborskii]
 gb|EFA68434.1| Peptidase M41, FtsH [Cylindrospermopsis raciborskii CS-505]
Length=613

 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 43/66 (65%), Gaps = 1/66 (2%)
 Frame = +3

Query  408  PEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLT-AVDGRRATVIVPNDPDLIDILAMN  584
            P+   WRYSEF+  V++G+VERV  S D +   +T   D  +  VI+ NDPDLI+ L+  
Sbjct  31   PQVETWRYSEFIQQVEQGRVERVSLSSDRTTAVVTPKYDPNKKRVILVNDPDLINTLSNK  90

Query  585  GVDISV  602
            GVDI+V
Sbjct  91   GVDIAV  96



>ref|WP_006102026.1| cell division protein FtsH [Coleofasciculus chthonoplastes]
 gb|EDX74695.1| ATP-dependent metallopeptidase HflB subfamily [Coleofasciculus 
chthonoplastes PCC 7420]
Length=612

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 39/60 (65%), Gaps = 0/60 (0%)
 Frame = +3

Query  423  WRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISV  602
            WRY +F++ VK  KVE V+ S D +   +TA DG +  V +PNDP+LI IL  N VDI V
Sbjct  36   WRYDQFIDNVKSKKVEIVQLSSDRTQAMVTAQDGTQYQVNLPNDPELISILTNNNVDIKV  95



>ref|WP_009782358.1| cell division protein FtsH [Lyngbya sp. PCC 8106]
 gb|EAW38903.1| cell division protein [Lyngbya sp. PCC 8106]
Length=612

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/60 (52%), Positives = 39/60 (65%), Gaps = 0/60 (0%)
 Frame = +3

Query  423  WRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISV  602
            W+YS F+  V+  +VERV  S D S   +TA DG +  V +P DP LIDIL+ N VDISV
Sbjct  36   WKYSTFIQEVENNQVERVSLSADRSKALVTAEDGAKIMVNLPPDPGLIDILSQNNVDISV  95



>ref|WP_006198086.1| cell division protein FtsH [Nodularia spumigena]
 gb|EAW43768.1| cell division protein [Nodularia spumigena CCY9414]
 gb|AHJ29621.1| Cell division protein FtsH [Nodularia spumigena CCY9414]
Length=612

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = +3

Query  408  PEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNG  587
            P    WRYS+F+  V +G+V+RV  S D S   +T+ DG +  V + NDP+LI+ L+  G
Sbjct  31   PTRETWRYSQFIQEVDQGRVDRVNLSADRSIAYVTSRDGDKKVVNLVNDPELINNLSDKG  90

Query  588  VDISV  602
            VDISV
Sbjct  91   VDISV  95



>ref|WP_015214216.1| membrane protease FtsH catalytic subunit [Anabaena cylindrica]
 gb|AFZ57570.1| membrane protease FtsH catalytic subunit [Anabaena cylindrica 
PCC 7122]
Length=613

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 40/66 (61%), Gaps = 1/66 (2%)
 Frame = +3

Query  408  PEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLT-AVDGRRATVIVPNDPDLIDILAMN  584
            P+   WRYSEF+  V KG+VE+V  S D S   +T   D  +  V + NDPDLI+ L   
Sbjct  31   PQVETWRYSEFIQEVDKGRVEKVSLSSDRSTAMVTPKYDLNKKRVTLVNDPDLINTLTAK  90

Query  585  GVDISV  602
            GVDI+V
Sbjct  91   GVDIAV  96



>ref|WP_028082599.1| cell division protein FtsH [Dolichospermum circinale]
Length=614

 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 40/61 (66%), Gaps = 1/61 (2%)
 Frame = +3

Query  423  WRYSEFLNAVKKGKVERVRFSKDGSALQLT-AVDGRRATVIVPNDPDLIDILAMNGVDIS  599
            WRYS+F+  V++G+VERV  S D S   +T   D ++  V + NDPDLI+ L   GVDIS
Sbjct  37   WRYSQFIQEVQRGRVERVSLSSDRSTALVTPKYDEKKKIVTLVNDPDLINTLTDKGVDIS  96

Query  600  V  602
            V
Sbjct  97   V  97



>ref|WP_023067153.1| ATP-dependent zinc metalloprotease FtsH 3 [Lyngbya aestuarii]
 gb|ERT06646.1| ATP-dependent zinc metalloprotease FtsH 3 [Lyngbya aestuarii 
BL J]
Length=612

 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 31/60 (52%), Positives = 39/60 (65%), Gaps = 0/60 (0%)
 Frame = +3

Query  423  WRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISV  602
            W+YS F+  V+  +VERV  S D S   +TA DG +  V +P DP LIDIL+ N VDISV
Sbjct  36   WKYSTFIQEVENNQVERVSLSADRSKALVTAEDGAKIMVNLPPDPGLIDILSENNVDISV  95



>ref|WP_038331075.1| cell division protein FtsH [filamentous cyanobacterium ESFC-1]
Length=618

 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 42/63 (67%), Gaps = 1/63 (2%)
 Frame = +3

Query  417  SQWRYSEFLNAVKKGKVER-VRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVD  593
            + W+YS F+N V+ G+V+  V+ S D S   +TA DG +  V +PNDP LIDIL  N VD
Sbjct  39   TTWKYSRFINEVESGRVQGIVKLSADRSQALVTAQDGTQVEVNLPNDPQLIDILTDNNVD  98

Query  594  ISV  602
            I+V
Sbjct  99   IAV  101



>ref|WP_019497657.1| hypothetical protein [Calothrix sp. PCC 7103]
Length=91

 Score = 56.6 bits (135),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 40/61 (66%), Gaps = 1/61 (2%)
 Frame = +3

Query  423  WRYSEFLNAVKKGKVERVRFSKDGS-ALQLTAVDGRRATVIVPNDPDLIDILAMNGVDIS  599
            W YS+F+ +VK G+VERV  S D + A+    +D  R  V + NDP+LI+IL  N VDIS
Sbjct  27   WEYSKFIQSVKDGRVERVSLSADRTIAIVKVKLDPNRKKVNLSNDPNLINILTENQVDIS  86

Query  600  V  602
            V
Sbjct  87   V  87



>ref|XP_005708438.1| AAA-type ATPase [Galdieria sulphuraria]
 gb|EME31918.1| AAA-type ATPase [Galdieria sulphuraria]
Length=767

 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 46/75 (61%), Gaps = 1/75 (1%)
 Frame = +3

Query  420  QWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATV-IVPNDPDLIDILAMNGVDI  596
            +WRYSE ++AVK+ +VE+V FS DG+ L    VDG R  +  +PND +L+ +L  + VDI
Sbjct  172  KWRYSELIHAVKEDQVEKVTFSPDGNQLLAIDVDGNRHKLDALPNDSNLLKLLTEHNVDI  231

Query  597  SVSEGEGGNGLFSFI  641
             V       G F F+
Sbjct  232  RVLPQRQEGGPFDFL  246



>gb|ACN35033.1| unknown [Zea mays]
Length=463

 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 29/39 (74%), Positives = 32/39 (82%), Gaps = 2/39 (5%)
 Frame = +3

Query  537  VIVPNDPDLIDILAMNGVDISVSEGE--GGNGLFSFIGN  647
            V+VPNDPDLIDILA NGVDISVSEGE  G  G  +F+GN
Sbjct  125  VVVPNDPDLIDILATNGVDISVSEGESAGPGGFVAFVGN  163



>gb|EWM30233.1| atp-dependent metalloprotease [Nannochloropsis gaditana]
Length=794

 Score = 60.1 bits (144),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 41/60 (68%), Gaps = 1/60 (2%)
 Frame = +3

Query  426  RYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATV-IVPNDPDLIDILAMNGVDISV  602
            RYS+FL+ V+KG++E+V FS DG  L  T  DG+R  +  +PNDPDL+  L    VD++V
Sbjct  129  RYSDFLDMVEKGQIEKVTFSADGQKLVATDTDGQRYRLDALPNDPDLLATLTQKMVDVTV  188



>ref|WP_015208761.1| membrane protease FtsH catalytic subunit [Cylindrospermum stagnale]
 gb|AFZ25513.1| membrane protease FtsH catalytic subunit [Cylindrospermum stagnale 
PCC 7417]
Length=613

 Score = 59.7 bits (143),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 44/70 (63%), Gaps = 3/70 (4%)
 Frame = +3

Query  402  DLPEGSQ--WRYSEFLNAVKKGKVERVRFSKDGSALQLT-AVDGRRATVIVPNDPDLIDI  572
            D P+ S+  WRYS+F+  V+KG+VE+V  S D S   +T   D  +  V + NDPDLI+ 
Sbjct  27   DKPQSSRETWRYSQFIQEVEKGRVEKVSLSSDRSTALVTPKYDPNKKLVTLVNDPDLINT  86

Query  573  LAMNGVDISV  602
            L   GVDISV
Sbjct  87   LTTKGVDISV  96



>ref|WP_015191439.1| ATP-dependent metalloprotease FtsH [Stanieria cyanosphaera]
 gb|AFZ33766.1| ATP-dependent metalloprotease FtsH [Stanieria cyanosphaera PCC 
7437]
Length=616

 Score = 59.3 bits (142),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 39/60 (65%), Gaps = 0/60 (0%)
 Frame = +3

Query  423  WRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISV  602
            W+YS+F+N V+ G VE V+ S D +   +   +G    V +PNDP LIDIL+  GVDI+V
Sbjct  40   WKYSKFINEVETGNVESVKISADRTRAVVIGQEGNPIVVNLPNDPQLIDILSQKGVDIAV  99



>ref|WP_015143924.1| ATP-dependent metalloprotease FtsH [Pleurocapsa minor]
 gb|AFY77621.1| ATP-dependent metalloprotease FtsH [Pleurocapsa sp. PCC 7327]
Length=618

 Score = 59.3 bits (142),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 46/76 (61%), Gaps = 9/76 (12%)
 Frame = +3

Query  378  KPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATV-IVPND  554
            +PQ+Q        + WRY +F++ V  G+VE V+ + D +   + A DG +  V ++PND
Sbjct  34   QPQSQ--------ATWRYDKFISEVTSGRVESVKLTADRTKAIVPAQDGTQVLVNLLPND  85

Query  555  PDLIDILAMNGVDISV  602
            P LID L  NGVDISV
Sbjct  86   PQLIDFLTKNGVDISV  101



>emb|CBN76650.1| FtsH protease [Ectocarpus siliculosus]
Length=738

 Score = 59.3 bits (142),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 52/89 (58%), Gaps = 4/89 (4%)
 Frame = +3

Query  339  ASPFSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAV  518
            ASPF+ N    AP    Q +    E    RYS+F+NAV+K ++E+V FS DG  L     
Sbjct  104  ASPFA-NAGGQAPPAMMQRSVQTVE--NIRYSDFVNAVEKDEIEKVSFSYDGKKLVAVDT  160

Query  519  DGRRATV-IVPNDPDLIDILAMNGVDISV  602
            DG R  +  +PNDP+L+ IL  + VD++V
Sbjct  161  DGVRVKLDSIPNDPELLTILTKHKVDVTV  189



>gb|KIJ85386.1| cell division protein FtsH [Scytonema tolypothrichoides VB-61278]
Length=613

 Score = 59.3 bits (142),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 39/65 (60%), Gaps = 0/65 (0%)
 Frame = +3

Query  408  PEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNG  587
            P    WRYS+F+  V+  +V++V  S D S   +T  DG +  V + NDPDLI+ L  N 
Sbjct  32   PSRETWRYSQFIQEVQNRRVDKVSLSADRSTALVTPKDGNKKLVTLVNDPDLINTLTQNN  91

Query  588  VDISV  602
            VDISV
Sbjct  92   VDISV  96



>ref|WP_017291153.1| cell division protein FtsH [Leptolyngbya boryana]
Length=613

 Score = 59.3 bits (142),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 30/70 (43%), Positives = 40/70 (57%), Gaps = 0/70 (0%)
 Frame = +3

Query  423  WRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISV  602
            WRYS+F+  V+K  V +V  S D +   + + DG R  V +P DP+LI IL  N VDISV
Sbjct  36   WRYSQFIQEVEKNNVNKVSLSADRTRALVQSEDGNRVLVNLPTDPELISILTRNNVDISV  95

Query  603  SEGEGGNGLF  632
                 GN  +
Sbjct  96   LPATDGNDFW  105



>ref|WP_011613138.1| cell division protein FtsH [Trichodesmium erythraeum]
 gb|ABG52807.1| FtsH peptidase homologue, chloroplast. Metallo peptidase. MEROPS 
family M41 [Trichodesmium erythraeum IMS101]
Length=613

 Score = 59.3 bits (142),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 38/60 (63%), Gaps = 0/60 (0%)
 Frame = +3

Query  423  WRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISV  602
            W+YS+F+  V+   VE+V  S D +  ++   DG    V +PNDPDLI+IL  N +DISV
Sbjct  37   WKYSQFIQQVENKNVEKVDISADRTVARVKVADGSVVRVNLPNDPDLINILTQNNIDISV  96



>ref|WP_039726378.1| MULTISPECIES: cell division protein FtsH [Oscillatoriophycideae]
 gb|KIF14597.1| cell division protein FtsH [Aphanocapsa montana BDHKU210001]
 gb|KIF39523.1| cell division protein FtsH [Lyngbya confervoides BDU141951]
Length=613

 Score = 59.3 bits (142),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 41/65 (63%), Gaps = 1/65 (2%)
 Frame = +3

Query  411  EGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTA-VDGRRATVIVPNDPDLIDILAMNG  587
            E   WRYS+FL+AV+  +VERV  S D S  + T    G + TV +PNDP+LI  L  N 
Sbjct  32   ESQTWRYSQFLDAVENNQVERVSISADRSQARFTDPAGGGQITVNLPNDPELISTLETNN  91

Query  588  VDISV  602
            VDI+V
Sbjct  92   VDIAV  96



>ref|WP_015146710.1| membrane protease FtsH catalytic subunit [Oscillatoria acuminata]
 gb|AFY80060.1| membrane protease FtsH catalytic subunit [Oscillatoria acuminata 
PCC 6304]
Length=612

 Score = 58.9 bits (141),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 47/67 (70%), Gaps = 1/67 (1%)
 Frame = +3

Query  423  WRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISV  602
            WRYS+F+  V+  ++++V  + D S  ++TA DG++  V +PNDP+L++IL  + V+I V
Sbjct  36   WRYSQFIQEVQNDRIDKVVITSDRSRAKVTAQDGKKVVVNLPNDPELLNILTEHRVNIEV  95

Query  603  S-EGEGG  620
            S +G+ G
Sbjct  96   SPQGDEG  102



>ref|WP_015079544.1| ATP-dependent metalloprotease HflB (FtsH) [Anabaena sp. 90]
 gb|AFW94382.1| ATP-dependent metalloprotease HflB (FtsH) [Anabaena sp. 90]
Length=614

 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 39/61 (64%), Gaps = 1/61 (2%)
 Frame = +3

Query  423  WRYSEFLNAVKKGKVERVRFSKDGSALQLT-AVDGRRATVIVPNDPDLIDILAMNGVDIS  599
            WRYS+F+  VK+G+VERV  S D S   +T   D  +  V + NDPDLI+ L   GVDI+
Sbjct  37   WRYSQFIQEVKQGRVERVSLSSDRSTALVTPKYDPNKKIVTLVNDPDLINTLTNKGVDIA  96

Query  600  V  602
            V
Sbjct  97   V  97



>ref|WP_027401619.1| cell division protein FtsH [Aphanizomenon flos-aquae]
 gb|KHG38940.1| cell division protein FtsH [Aphanizomenon flos-aquae 2012/KM1/D3]
Length=614

 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 39/61 (64%), Gaps = 1/61 (2%)
 Frame = +3

Query  423  WRYSEFLNAVKKGKVERVRFSKDGSALQLT-AVDGRRATVIVPNDPDLIDILAMNGVDIS  599
            WRYS+F+  V+KG+VERV  S D S   +T   D  +  V + NDPDLI+ L   GVDI+
Sbjct  37   WRYSQFIQEVEKGRVERVSLSSDRSTALVTPKYDPNKKIVTLVNDPDLINTLTNKGVDIA  96

Query  600  V  602
            V
Sbjct  97   V  97



>ref|WP_016949229.1| cell division protein FtsH [Anabaena sp. PCC 7108]
Length=613

 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 40/66 (61%), Gaps = 1/66 (2%)
 Frame = +3

Query  408  PEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLT-AVDGRRATVIVPNDPDLIDILAMN  584
            P+   WRYS+F+  V+ GKVE+V  S D S   +T   D  +  V + NDPDLI+ L   
Sbjct  31   PQVETWRYSQFIQEVETGKVEKVSLSSDRSTAMVTPKYDPNKKRVTLVNDPDLINTLTAK  90

Query  585  GVDISV  602
            GVDI+V
Sbjct  91   GVDIAV  96



>ref|WP_026099187.1| cell division protein FtsH [Prochlorothrix hollandica]
Length=612

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 41/66 (62%), Gaps = 0/66 (0%)
 Frame = +3

Query  408  PEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNG  587
            P    WRYS F+   +  +V +V  S D +A ++T  DG +  V +P+DPDL++IL  + 
Sbjct  31   PTQEVWRYSRFIEEAQSNQVAKVEISPDRTAAKVTVNDGAKVYVNLPDDPDLLNILTRHN  90

Query  588  VDISVS  605
            VDISVS
Sbjct  91   VDISVS  96



>ref|WP_016876546.1| cell division protein FtsH [Chlorogloeopsis fritschii]
Length=614

 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 39/61 (64%), Gaps = 1/61 (2%)
 Frame = +3

Query  423  WRYSEFLNAVKKGKVERVRFSKDGSALQLT-AVDGRRATVIVPNDPDLIDILAMNGVDIS  599
            WRYS+F+  V+KG+VE+V  S D S   +T   D  +  V + NDPDLI+ L  N VDIS
Sbjct  37   WRYSQFIQEVEKGRVEKVSLSSDRSTAVVTPKYDPNKKLVTLVNDPDLINTLTKNNVDIS  96

Query  600  V  602
            V
Sbjct  97   V  97



>gb|EEE60537.1| hypothetical protein OsJ_13877 [Oryza sativa Japonica Group]
Length=869

 Score = 58.2 bits (139),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 31/50 (62%), Positives = 38/50 (76%), Gaps = 2/50 (4%)
 Frame = +3

Query  504  QLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGE-GGNGLF-SFIGN  647
            +LTA+DGR   V++PN PDLIDILA N VDISV EG+  G G F +F+GN
Sbjct  141  KLTAIDGRYTIVVIPNAPDLIDILATNDVDISVVEGDAAGLGEFLAFVGN  190



>ref|WP_015116388.1| membrane protease FtsH catalytic subunit [Rivularia sp. PCC 7116]
 gb|AFY52810.1| membrane protease FtsH catalytic subunit [Rivularia sp. PCC 7116]
Length=615

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 39/61 (64%), Gaps = 1/61 (2%)
 Frame = +3

Query  423  WRYSEFLNAVKKGKVERVRFSKDGSALQLT-AVDGRRATVIVPNDPDLIDILAMNGVDIS  599
            WRYSEF+ AV+KGKVE+V  S D S   +T   +  +  V + ND DLI+ L  N VDIS
Sbjct  38   WRYSEFIQAVEKGKVEKVSLSSDRSTALVTPKFEPSKRVVTLVNDSDLINTLTKNNVDIS  97

Query  600  V  602
            V
Sbjct  98   V  98



>ref|WP_013189950.1| cell division protein FtsH [Trichormus azollae]
 gb|ADI62930.1| ATP-dependent metalloprotease FtsH ['Nostoc azollae' 0708]
Length=613

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/66 (44%), Positives = 40/66 (61%), Gaps = 1/66 (2%)
 Frame = +3

Query  408  PEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLT-AVDGRRATVIVPNDPDLIDILAMN  584
            P+   WRYS+F+  V+ G+VE+V  S D S   +T   D  +  V + NDPDLI+ L   
Sbjct  31   PQVETWRYSQFIQEVESGRVEKVSLSSDRSTAMVTPKYDPNKKRVTLVNDPDLINTLTTK  90

Query  585  GVDISV  602
            GVDI+V
Sbjct  91   GVDIAV  96



>ref|WP_006528450.1| ATP-dependent metalloprotease FtsH [Gloeocapsa sp. PCC 73106]
 gb|ELR98719.1| ATP-dependent metalloprotease FtsH [Gloeocapsa sp. PCC 73106]
Length=615

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 38/60 (63%), Gaps = 0/60 (0%)
 Frame = +3

Query  423  WRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISV  602
            W+YS F+  V+  +VE V+ + D S   +T+ DG    V +PNDP L+DIL  N VDISV
Sbjct  39   WKYSTFIREVENNRVESVKLTPDRSQALVTSQDGTPVIVNLPNDPGLLDILTQNNVDISV  98



>ref|WP_022606782.1| ATP-dependent metalloprotease FtsH [Rubidibacter lacunae]
 gb|ERN41527.1| ATP-dependent metalloprotease FtsH [Rubidibacter lacunae KORDI 
51-2]
Length=616

 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 37/60 (62%), Gaps = 0/60 (0%)
 Frame = +3

Query  423  WRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISV  602
            W+YSEF+N +K  +VE+V+ S D S    TA DG +  V + NDP L  IL  N VDI V
Sbjct  40   WKYSEFINNIKNDRVEQVQLSSDRSEAIATAEDGSKVRVTLVNDPQLDQILLENKVDIDV  99



>ref|WP_036531425.1| cell division protein FtsH [Neosynechococcus sphagnicola]
 gb|KGF73398.1| cell division protein FtsH [Neosynechococcus sphagnicola sy1]
Length=613

 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 41/66 (62%), Gaps = 1/66 (2%)
 Frame = +3

Query  408  PEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATV-IVPNDPDLIDILAMN  584
            P    W+YS+F+  V+  KVE+VR S D +   + A DG    V + P+DPDLI+IL  N
Sbjct  31   PSRETWKYSQFIQEVEGKKVEKVRISADRTRAIVKAQDGSDVLVNLPPSDPDLINILTRN  90

Query  585  GVDISV  602
             VDISV
Sbjct  91   NVDISV  96



>ref|WP_015139560.1| ATP-dependent metalloprotease FtsH [Nostoc sp. PCC 7524]
 gb|AFY49129.1| ATP-dependent metalloprotease FtsH [Nostoc sp. PCC 7524]
Length=613

 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 39/61 (64%), Gaps = 1/61 (2%)
 Frame = +3

Query  423  WRYSEFLNAVKKGKVERVRFSKDGSALQLT-AVDGRRATVIVPNDPDLIDILAMNGVDIS  599
            WRYS+F+  V+KG+VE+V  S D S   +T   D  +  V + NDPDL++ L   GVDIS
Sbjct  36   WRYSQFIQEVEKGRVEKVSLSADRSTALVTPKYDPSKKLVTLVNDPDLVNTLTSKGVDIS  95

Query  600  V  602
            V
Sbjct  96   V  96



>ref|WP_010995433.1| cell division protein FtsH [Nostoc sp. PCC 7120]
 dbj|BAB73218.1| cell division protein [Nostoc sp. PCC 7120]
Length=613

 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 39/61 (64%), Gaps = 1/61 (2%)
 Frame = +3

Query  423  WRYSEFLNAVKKGKVERVRFSKDGSALQLT-AVDGRRATVIVPNDPDLIDILAMNGVDIS  599
            WRYS+F+  V+KG+VERV  S D S   +T   D  +  V + NDP+LI+ L   GVDI+
Sbjct  36   WRYSQFIQEVEKGRVERVSLSADRSTALVTPKYDPSKKLVTLVNDPELINTLTARGVDIT  95

Query  600  V  602
            V
Sbjct  96   V  96



>ref|WP_015180805.1| ATP-dependent metalloprotease FtsH [Microcoleus sp. PCC 7113]
 gb|AFZ16642.1| ATP-dependent metalloprotease FtsH [Microcoleus sp. PCC 7113]
Length=612

 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 38/60 (63%), Gaps = 0/60 (0%)
 Frame = +3

Query  423  WRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISV  602
            W+YS  +  V+ GK+E V+ S D +   +TA DG++  V +PNDP LI ILA    DISV
Sbjct  36   WKYSRLIQEVQDGKIETVKLSADRTRALVTAQDGKQVLVNLPNDPQLISILAEKVDDISV  95



>ref|WP_011317448.1| cell division protein FtsH [Anabaena variabilis]
 gb|ABA20199.1| membrane protease FtsH catalytic subunit [Anabaena variabilis 
ATCC 29413]
Length=613

 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 39/61 (64%), Gaps = 1/61 (2%)
 Frame = +3

Query  423  WRYSEFLNAVKKGKVERVRFSKDGSALQLT-AVDGRRATVIVPNDPDLIDILAMNGVDIS  599
            WRYS+F+  V+KG+VERV  S D S   +T   D  +  V + NDP+LI+ L   GVDI+
Sbjct  36   WRYSQFIQEVEKGRVERVSLSADRSTALVTPKYDPSKKLVTLVNDPELINTLTARGVDIT  95

Query  600  V  602
            V
Sbjct  96   V  96



>ref|WP_017291152.1| hypothetical protein [Leptolyngbya boryana]
Length=104

 Score = 53.5 bits (127),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 38/60 (63%), Gaps = 0/60 (0%)
 Frame = +3

Query  423  WRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISV  602
            W YS+F+  V+K  V +V  + D + +   + DG+R  V +P+DP+LI+ L  N VDIS+
Sbjct  36   WEYSQFIQEVEKDNVNKVSLTADRTRILAQSEDGKRFLVNLPDDPELINTLVRNQVDISI  95



>ref|XP_002177215.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gb|EEC51678.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
Length=673

 Score = 56.2 bits (134),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 39/113 (35%), Positives = 60/113 (53%), Gaps = 11/113 (10%)
 Frame = +3

Query  318  PQPTASNASPFSQNVVLNAPKPQAQPASDLPEGSQ--------WRYSEFLNAVKKGKVER  473
            P  T+   +  ++ + ++AP P +   +DLP   Q         RYS+FL  V   +VE+
Sbjct  26   PSRTSRRTNNSARYMAVDAPPPASN--NDLPVIQQNSYGQPTDVRYSDFLRLVNADRVEK  83

Query  474  VRFSKDGSALQLTAVDGRRATV-IVPNDPDLIDILAMNGVDISVSEGEGGNGL  629
            V FS DG+ L    VDG R  +  +PNDPDL+  L  + VD++V   +  +GL
Sbjct  84   VTFSADGTQLLGVDVDGARVKIEALPNDPDLLTSLTTHKVDVTVLPAQEASGL  136



>ref|WP_011055986.1| cell division protein FtsH [Thermosynechococcus elongatus]
 ref|NP_680922.1| cell division protein [Thermosynechococcus elongatus BP-1]
 dbj|BAC07684.1| cell division protein [Thermosynechococcus elongatus BP-1]
Length=612

 Score = 56.2 bits (134),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 37/60 (62%), Gaps = 0/60 (0%)
 Frame = +3

Query  423  WRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISV  602
            W YSEF+  V+  ++ +V  + D S  Q    DG R  V +PNDP+L+DIL  N VDI+V
Sbjct  36   WPYSEFIQQVESKQITKVSITPDRSQAQAITQDGTRVLVNLPNDPELLDILTTNNVDIAV  95



>ref|WP_026730933.1| cell division protein FtsH [Fischerella sp. PCC 9605]
Length=613

 Score = 56.2 bits (134),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 37/60 (62%), Gaps = 0/60 (0%)
 Frame = +3

Query  423  WRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISV  602
            WRYS+F+  V+ G+V++V  S D S   +T   G +  V + NDPDLI+ L   GVDI V
Sbjct  37   WRYSQFIQEVQNGRVDKVSISADRSTAIVTPTSGDKKLVTLVNDPDLINTLNAKGVDIIV  96



>ref|WP_011243527.1| MULTISPECIES: cell division protein FtsH [Synechococcus]
 dbj|BAD79405.1| ATP-dependent Zn protease [Synechococcus elongatus PCC 6301]
 gb|ABB56329.1| FtsH peptidase homologue, chloroplast. Metallo peptidase. MEROPS 
family M41 [Synechococcus elongatus PCC 7942]
 gb|AJD56622.1| cell division protein FtsH [Synechococcus sp. UTEX 2973]
Length=613

 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 38/60 (63%), Gaps = 0/60 (0%)
 Frame = +3

Query  423  WRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISV  602
            WRYSEF+  V+  +V +V  S D S+  + A DG +  V +PNDP L+ IL  N VDISV
Sbjct  37   WRYSEFVQRVENKQVAKVILSPDRSSALVQAEDGDKVQVNLPNDPQLLKILTDNNVDISV  96



>ref|WP_024125602.1| ATP-dependent metalloprotease FtsH3 [Thermosynechococcus sp. 
NK55a]
 gb|AHB89224.1| ATP-dependent metalloprotease FtsH3 [Thermosynechococcus sp. 
NK55a]
Length=612

 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 37/60 (62%), Gaps = 0/60 (0%)
 Frame = +3

Query  423  WRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISV  602
            W YSEF+  V+  ++ +V  + D S  Q    DG R  V +PNDP+L+DIL  N VDI+V
Sbjct  36   WPYSEFIQQVESKQITKVSITPDRSQAQAITQDGTRVLVNLPNDPELLDILTSNNVDIAV  95



>gb|KIE06858.1| cell division protein FtsH [Tolypothrix bouteillei VB521301]
Length=614

 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 38/61 (62%), Gaps = 1/61 (2%)
 Frame = +3

Query  423  WRYSEFLNAVKKGKVERVRFSKDGS-ALQLTAVDGRRATVIVPNDPDLIDILAMNGVDIS  599
            WRYS+F+  V+ G VE+V  S D S AL +T  D  +  V + NDPDLI+ L    VDI+
Sbjct  37   WRYSQFIQEVQNGNVEKVSLSADRSTALVMTKNDTNKKLVTLVNDPDLINTLTQYKVDIT  96

Query  600  V  602
            V
Sbjct  97   V  97



>ref|WP_012411183.1| cell division protein FtsH [Nostoc punctiforme]
 gb|ACC83227.1| ATP-dependent metalloprotease FtsH [Nostoc punctiforme PCC 73102]
Length=613

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 38/61 (62%), Gaps = 1/61 (2%)
 Frame = +3

Query  423  WRYSEFLNAVKKGKVERVRFSKDGSALQLT-AVDGRRATVIVPNDPDLIDILAMNGVDIS  599
            WRYS F+  V++G+VE+V  S D S   +T   D  +  V + NDPDLI+ L   GVDIS
Sbjct  36   WRYSRFIQEVQQGRVEKVSLSADRSTALVTPKYDPAKRIVTLVNDPDLINTLTSKGVDIS  95

Query  600  V  602
            V
Sbjct  96   V  96



>ref|WP_035992112.1| cell division protein FtsH [Leptolyngbya sp. KIOST-1]
Length=613

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 40/66 (61%), Gaps = 1/66 (2%)
 Frame = +3

Query  408  PEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVI-VPNDPDLIDILAMN  584
            PE   WRYS+FL+AV+  ++ERV  S D +  + T  +G    ++ +PND +LI  L  N
Sbjct  31   PETQTWRYSQFLDAVQNNQIERVSISADRTRARFTDPEGNGQVIVNLPNDQELISTLETN  90

Query  585  GVDISV  602
             VDI V
Sbjct  91   NVDIVV  96



>ref|WP_017320405.1| cell division protein FtsH [cyanobacterium PCC 7702]
Length=614

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 39/61 (64%), Gaps = 1/61 (2%)
 Frame = +3

Query  423  WRYSEFLNAVKKGKVERVRFSKDGSALQLT-AVDGRRATVIVPNDPDLIDILAMNGVDIS  599
            WRYS+F+  V+KG+VE+V  S D S   +T   +  +  V + NDPDLI+ L  N VDI+
Sbjct  37   WRYSQFIQEVEKGRVEKVSLSSDRSTAIVTPKYEPNKKLVTLVNDPDLINTLTKNNVDIT  96

Query  600  V  602
            V
Sbjct  97   V  97



>ref|WP_027841867.1| cell division protein FtsH [Mastigocoleus testarum]
Length=613

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 43/67 (64%), Gaps = 2/67 (3%)
 Frame = +3

Query  408  PEGSQ-WRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVI-VPNDPDLIDILAM  581
            P+G + WRYS+F+  V++GKVE+V  S D +   +T  D     ++ + NDP LI+ L+ 
Sbjct  30   PQGKETWRYSQFIQKVEEGKVEKVSISSDRTTAVVTPSDDTEKRIVNLVNDPQLINTLSA  89

Query  582  NGVDISV  602
             GVDISV
Sbjct  90   KGVDISV  96



>ref|WP_006511599.1| ATP-dependent metalloprotease FtsH [Xenococcus sp. PCC 7305]
 gb|ELS01218.1| ATP-dependent metalloprotease FtsH [Xenococcus sp. PCC 7305]
Length=616

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 45/75 (60%), Gaps = 8/75 (11%)
 Frame = +3

Query  378  KPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDP  557
            KPQ+Q         +W YS+ ++ V+  KVE V+ S D +  ++T + G    V +PNDP
Sbjct  33   KPQSQ--------QRWAYSKLIDEVQNNKVEIVQISADRTKARVTDLMGNPILVNLPNDP  84

Query  558  DLIDILAMNGVDISV  602
            +LIDIL  N VDI+V
Sbjct  85   ELIDILMKNDVDIAV  99



>ref|WP_017715041.1| cell division protein FtsH [Oscillatoria sp. PCC 10802]
Length=613

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 39/61 (64%), Gaps = 1/61 (2%)
 Frame = +3

Query  423  WRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATV-IVPNDPDLIDILAMNGVDIS  599
            WRYS+F+  V+  KVE+V  S D +   + A DG +  V + PNDPDLI+IL  N V+I 
Sbjct  36   WRYSQFIQEVEGKKVEKVSISADRTRALVQASDGNKVMVNLPPNDPDLINILTENRVNIE  95

Query  600  V  602
            V
Sbjct  96   V  96



>ref|WP_015114520.1| membrane protease FtsH catalytic subunit [Nostoc sp. PCC 7107]
 gb|AFY44316.1| membrane protease FtsH catalytic subunit [Nostoc sp. PCC 7107]
Length=612

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/66 (44%), Positives = 39/66 (59%), Gaps = 1/66 (2%)
 Frame = +3

Query  408  PEGSQ-WRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMN  584
            P+ +Q WRYS+F+  V  G V +VR S D S   + + DG +  V + NDPDLI+ L   
Sbjct  30   PQNTQTWRYSQFIQEVNNGGVAQVRLSADRSTALVKSKDGTQIKVTLVNDPDLINTLTSK  89

Query  585  GVDISV  602
             VD SV
Sbjct  90   NVDFSV  95



>ref|WP_019506377.1| cell division protein FtsH [Pleurocapsa sp. PCC 7319]
Length=616

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 42/66 (64%), Gaps = 1/66 (2%)
 Frame = +3

Query  408  PEGSQ-WRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMN  584
            P+  Q W YS+ ++ V+  K+E V+ S D +  Q+   +G    V +PNDP LIDIL+ N
Sbjct  34   PQARQTWAYSKLIDEVQSNKIETVKISADRTKAQVIDREGTPILVNLPNDPQLIDILSDN  93

Query  585  GVDISV  602
            GVDI++
Sbjct  94   GVDIAI  99



>ref|WP_015124055.1| membrane protease FtsH catalytic subunit [Synechococcus sp. PCC 
6312]
 gb|AFY60511.1| membrane protease FtsH catalytic subunit [Synechococcus sp. PCC 
6312]
Length=612

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 35/60 (58%), Gaps = 0/60 (0%)
 Frame = +3

Query  423  WRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISV  602
            WRYSE +  V+  +V ++  S D +  Q    DG R  V +P DP LIDIL  N VDISV
Sbjct  36   WRYSELIQEVENHQVAKLNISPDRTQAQAVTQDGTRVLVNLPPDPQLIDILTANNVDISV  95



>ref|WP_006518079.1| membrane protease FtsH catalytic subunit [Leptolyngbya sp. PCC 
7375]
 gb|EKV03719.1| membrane protease FtsH catalytic subunit [Leptolyngbya sp. PCC 
7375]
Length=614

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/66 (44%), Positives = 38/66 (58%), Gaps = 2/66 (3%)
 Frame = +3

Query  411  EGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDG--RRATVIVPNDPDLIDILAMN  584
            E   WRYS F+N V+ G +E+V  S D +  +     G  RR  V +P+DP L+DIL  N
Sbjct  32   ETDAWRYSRFINQVESGAIEKVYISADRTQARFPDPTGEERRIVVNLPSDPGLVDILTEN  91

Query  585  GVDISV  602
             VDI V
Sbjct  92   SVDIEV  97



>ref|WP_017297226.1| cell division protein FtsH [Nodosilinea nodulosa]
Length=613

 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 40/66 (61%), Gaps = 1/66 (2%)
 Frame = +3

Query  408  PEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVI-VPNDPDLIDILAMN  584
            PE   WRYS+FL+AV+  ++ERV  S D +  + T  +G    ++ +PND +LI  L  N
Sbjct  31   PETKTWRYSQFLDAVQNNQIERVSISADRTRARFTDPEGNGQVIVNLPNDQELISTLEDN  90

Query  585  GVDISV  602
             VDI V
Sbjct  91   NVDIVV  96



>ref|WP_029633975.1| cell division protein FtsH [[Scytonema hofmanni] UTEX B 1581]
Length=612

 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 37/60 (62%), Gaps = 0/60 (0%)
 Frame = +3

Query  423  WRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISV  602
            WRYS+F+  V+K  V +V  S D S   + +  G +  V + NDPDLI+ L+  GVDISV
Sbjct  36   WRYSQFIQEVEKNNVAKVSLSADRSTALVKSNQGTQFIVTLVNDPDLINTLSAKGVDISV  95



>ref|WP_006453661.1| cell division protein FtsH [Synechococcus sp. PCC 7335]
 gb|EDX83917.1| ATP-dependent metallopeptidase HflB subfamily [Synechococcus 
sp. PCC 7335]
Length=613

 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 40/65 (62%), Gaps = 1/65 (2%)
 Frame = +3

Query  411  EGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGR-RATVIVPNDPDLIDILAMNG  587
            E    RYS+F+N V++G+VE V  + D S  +  + DG  R  V +P DP L+D+L  N 
Sbjct  32   ETQSQRYSQFINDVQQGRVESVSITSDKSQARFASPDGTGRVVVNLPQDPGLVDLLTENN  91

Query  588  VDISV  602
            VDI+V
Sbjct  92   VDITV  96



>ref|XP_005708136.1| AAA-type ATPase [Galdieria sulphuraria]
 gb|EME31616.1| AAA-type ATPase [Galdieria sulphuraria]
Length=775

 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 45/160 (28%), Positives = 66/160 (41%), Gaps = 23/160 (14%)
 Frame = +3

Query  168  LTKNSNPDSFKGLSSKATLAALLFSSIAPQAIALDNATPAAPPTEIQAEAPQPTASNASP  347
            L +N+  + +K    +   A +L  S+AP    +  A P               A N +P
Sbjct  89   LERNTLLEKWKATLKRIVFAIVLCLSVAPFQTTMTYAAPLRQSRSF-IHTRNTHAKNNTP  147

Query  348  FSQNVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGR  527
            FS                       WRYS+ L AVK+G+V RV FS D S L     DG 
Sbjct  148  FSV--------------------WSWRYSQLLKAVKQGQVLRVIFSADQSQLIAITKDGG  187

Query  528  RATV--IVPNDPDLIDILAMNGVDISVSEGEGGNGLFSFI  641
            R  +  + P+  +LI  L+ + VDI +      +GL  F+
Sbjct  188  RYKLRALPPHSSNLIAYLSKHKVDIVILPKYKESGLVYFL  227



>gb|EJK55379.1| hypothetical protein THAOC_24887 [Thalassiosira oceanica]
Length=672

 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 42/71 (59%), Gaps = 4/71 (6%)
 Frame = +3

Query  426  RYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATV-IVPNDPDLIDILAMNGVDISV  602
            RYS+FL  V   K+E+V FS DG+ L     DG R  +  +PNDPDL+  L  + VD++V
Sbjct  64   RYSDFLKLVNGDKIEKVTFSADGTQLLGVDTDGTRIKLEALPNDPDLLTQLTTHKVDVTV  123

Query  603  ---SEGEGGNG  626
               +E  GG G
Sbjct  124  LPSNEAAGGLG  134



>ref|WP_017315070.1| cell division protein FtsH [Mastigocladopsis repens]
Length=614

 Score = 53.5 bits (127),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 38/61 (62%), Gaps = 1/61 (2%)
 Frame = +3

Query  423  WRYSEFLNAVKKGKVERVRFSKDGS-ALQLTAVDGRRATVIVPNDPDLIDILAMNGVDIS  599
            WRYS+F+  V+   VE+V  S D S AL +   D  +  V + NDPDLI+ L  +GVDIS
Sbjct  37   WRYSQFIREVQSDNVEKVSLSADRSTALVMPKNDPNKKLVTLVNDPDLINTLTQHGVDIS  96

Query  600  V  602
            V
Sbjct  97   V  97



>ref|WP_036486108.1| cell division protein FtsH [Myxosarcina sp. GI1]
Length=616

 Score = 53.1 bits (126),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 25/60 (42%), Positives = 38/60 (63%), Gaps = 0/60 (0%)
 Frame = +3

Query  423  WRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISV  602
            W YS+ +N V+ G+VE V+ + D +  Q+   +G    V +P D + IDIL+ NGVDI+V
Sbjct  40   WAYSKLINEVENGRVETVKITADRTKAQVIDSEGTPILVNLPQDREFIDILSENGVDIAV  99



>ref|XP_002287516.1| metalloprotease [Thalassiosira pseudonana CCMP1335]
 gb|EED94959.1| metalloprotease, partial [Thalassiosira pseudonana CCMP1335]
Length=581

 Score = 53.1 bits (126),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 42/71 (59%), Gaps = 4/71 (6%)
 Frame = +3

Query  426  RYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATV-IVPNDPDLIDILAMNGVDISV  602
            RYS+FL  V   K+E+V FS DG+ L     DG R  +  +PNDPDL+  L  + VD++V
Sbjct  1    RYSDFLKLVNGDKIEKVTFSADGTQLLGVDTDGTRIKLEALPNDPDLLTQLTSHKVDVTV  60

Query  603  ---SEGEGGNG  626
               +E  GG G
Sbjct  61   LPSNEAAGGLG  71



>ref|WP_015133797.1| membrane protease FtsH catalytic subunit [Leptolyngbya sp. PCC 
7376]
 gb|AFY38027.1| membrane protease FtsH catalytic subunit [Leptolyngbya sp. PCC 
7376]
Length=620

 Score = 52.8 bits (125),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 38/61 (62%), Gaps = 1/61 (2%)
 Frame = +3

Query  423  WRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATV-IVPNDPDLIDILAMNGVDIS  599
            WRYSEFL  V+ G +E V+ S D S   + A DG    V + P D +LIDIL+ N VDI+
Sbjct  39   WRYSEFLEQVQSGNIESVKISSDRSQAFVPAQDGTPILVNLPPGDTELIDILSNNSVDIA  98

Query  600  V  602
            V
Sbjct  99   V  99



>ref|WP_032525350.1| hypothetical protein, partial [Prochlorococcus sp. scB241_526K3]
Length=89

 Score = 49.7 bits (117),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 39/66 (59%), Gaps = 0/66 (0%)
 Frame = +3

Query  426  RYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVS  605
            RYS+F+ AV+  ++ RV  S D +  Q+   DG R+ V +  D DL+ IL  N VDI+V+
Sbjct  22   RYSDFIEAVQDKEISRVLISPDNATAQVVENDGSRSEVNLAPDKDLLKILTENNVDIAVT  81

Query  606  EGEGGN  623
              +  N
Sbjct  82   PTKLAN  87



>ref|WP_024546675.1| cell division protein FtsH [Synechococcus sp. NKBG15041c]
Length=620

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 42/71 (59%), Gaps = 1/71 (1%)
 Frame = +3

Query  423  WRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATV-IVPNDPDLIDILAMNGVDIS  599
            WRYS+FL  V++G VE VR S D +   + A DG    V + P D +LIDIL+ N VDI+
Sbjct  39   WRYSQFLQEVQQGNVESVRISGDRTKAFVPAPDGTPILVNLPPGDTELIDILSENNVDIA  98

Query  600  VSEGEGGNGLF  632
            V      N +F
Sbjct  99   VLPQSDDNWIF  109



>ref|WP_036972775.1| cell division protein FtsH, partial [Prochlorococcus sp. MIT 
0703]
Length=240

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/59 (46%), Positives = 37/59 (63%), Gaps = 0/59 (0%)
 Frame = +3

Query  426  RYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISV  602
            RYSEF+ AV+  +V RV  S D +  Q+   DGRRA V +  D DL+ +L  + VDI+V
Sbjct  38   RYSEFVEAVQDNQVSRVLISPDQATAQVVESDGRRADVNLAPDKDLLKLLTDHNVDIAV  96



>ref|WP_017743955.1| cell division protein FtsH [Scytonema hofmanni]
Length=614

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 37/61 (61%), Gaps = 1/61 (2%)
 Frame = +3

Query  423  WRYSEFLNAVKKGKVERVRFSKDGS-ALQLTAVDGRRATVIVPNDPDLIDILAMNGVDIS  599
            WRYS+F+  V+ G VE+V  S D S AL +   D  +  V + NDPDLI+ L    VDI+
Sbjct  37   WRYSQFIQEVQNGNVEKVSLSADRSTALVMPKNDTNKKLVTLVNDPDLINTLTQYQVDIT  96

Query  600  V  602
            V
Sbjct  97   V  97



>ref|WP_023072541.1| membrane protease catalytic subunit [Leptolyngbya sp. Heron Island 
J]
 gb|ESA36713.1| membrane protease catalytic subunit [Leptolyngbya sp. Heron Island 
J]
Length=614

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 37/66 (56%), Gaps = 2/66 (3%)
 Frame = +3

Query  411  EGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDG--RRATVIVPNDPDLIDILAMN  584
            E   WRYS F+N V+   +E+V  S D +  +     G  RR  V +P+DP L+DIL  N
Sbjct  32   ETETWRYSRFINQVESRAIEKVYISADRTQARFPDPSGEERRVVVNLPSDPGLVDILTEN  91

Query  585  GVDISV  602
             VDI V
Sbjct  92   SVDIEV  97



>ref|WP_011363329.1| cell division protein FtsH [Synechococcus sp. CC9605]
 gb|ABB34077.1| ATP-dependent metalloprotease FtsH [Synechococcus sp. CC9605]
Length=616

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 45/82 (55%), Gaps = 0/82 (0%)
 Frame = +3

Query  357  NVVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRAT  536
            ++V+ AP          P+ +  RYSEF+ AVK  ++ RV  S D    Q+   DGRRA 
Sbjct  17   SIVVIAPAFFGGGGGSQPQVNTIRYSEFVEAVKDDQISRVLISPDQGTAQVVENDGRRAQ  76

Query  537  VIVPNDPDLIDILAMNGVDISV  602
            V +  D +L+ +L  + VDI+V
Sbjct  77   VNLAPDRELLGLLTEHSVDIAV  98



>gb|AHF62715.1| ATP-dependent metalloprotease FtsH [Synechococcus sp. WH 8109]
Length=616

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 44/81 (54%), Gaps = 0/81 (0%)
 Frame = +3

Query  360  VVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATV  539
            +V+ AP          P+ +  RYSEF+ AVK  ++ RV  S D    Q+   DGRRA V
Sbjct  18   IVVIAPAFFGGGGGSQPQVNTIRYSEFVEAVKDDQISRVLISPDQGTAQVVENDGRRAQV  77

Query  540  IVPNDPDLIDILAMNGVDISV  602
             +  D +L+ +L  + VDI+V
Sbjct  78   NLAPDRELLGLLTEHSVDIAV  98



>ref|WP_012305681.1| MULTISPECIES: cell division protein FtsH [Synechococcus]
 gb|ACA98057.1| ATP-dependent metalloprotease FtsH subfamily [Synechococcus sp. 
PCC 7002]
Length=620

 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 42/71 (59%), Gaps = 1/71 (1%)
 Frame = +3

Query  423  WRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATV-IVPNDPDLIDILAMNGVDIS  599
            WRYS+FL  V++G +E V+ S D +   + A DG    V + P D +LIDIL+ N VDI+
Sbjct  39   WRYSQFLQEVQQGNIESVKISGDRTKAFVPAQDGTPILVNLPPGDTELIDILSENNVDIA  98

Query  600  VSEGEGGNGLF  632
            V      N +F
Sbjct  99   VLPQSDDNWIF  109



>ref|WP_035155002.1| cell division protein FtsH [Calothrix sp. 336/3]
 gb|KFB84628.1| cell division protein FtsH [Calothrix sp. 336/3]
Length=613

 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 36/60 (60%), Gaps = 0/60 (0%)
 Frame = +3

Query  423  WRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISV  602
            WRYS+F+  V+  +VE+V  S D +   +T   G +  V + +DPDLI+ L  + VDI V
Sbjct  37   WRYSQFIQEVENDRVEKVSLSSDRTTALVTPTSGEKKLVTLVSDPDLINTLTKHNVDIIV  96



>ref|WP_035262561.1| cell division protein FtsH [Actibacterium mucosum]
 gb|KAJ54100.1| cell division protein FtsH [Actibacterium mucosum KCTC 23349]
Length=639

 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 44/75 (59%), Gaps = 3/75 (4%)
 Frame = +3

Query  423  WRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISV  602
            + YS+FL+ V+ GKV  V  + DG    +T  DGR++T IVP+  DL D L    V+++ 
Sbjct  36   YSYSDFLDDVEAGKVSAV--TIDGEKAVITGTDGRQSTTIVPDGVDLTDRLVEADVEVTA  93

Query  603  SEGEGGNGLFSFIGN  647
               E  NGL ++IG 
Sbjct  94   RAQE-RNGLLAYIGT  107



>ref|WP_025913223.1| hypothetical protein [Prochlorococcus sp. scB245a_520D2]
Length=149

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/60 (42%), Positives = 37/60 (62%), Gaps = 0/60 (0%)
 Frame = +3

Query  426  RYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVS  605
            RYS+F+ AV+  ++ RV  S D +  Q+   DG R+ V +  D DL+ IL  N VDI+V+
Sbjct  39   RYSDFIEAVQDKEISRVLISPDNATAQVVENDGSRSEVNLAPDKDLLKILTENNVDIAVT  98



>ref|WP_036913475.1| MULTISPECIES: cell division protein FtsH [Prochlorococcus]
 gb|KGG26507.1| cell division protein FtsH2 [Prochlorococcus sp. MIT 0701]
 gb|KGG29359.1| cell division protein FtsH2 [Prochlorococcus sp. MIT 0702]
Length=615

 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 28/64 (44%), Positives = 38/64 (59%), Gaps = 0/64 (0%)
 Frame = +3

Query  411  EGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGV  590
            E    RYSEF+ AV+  +V RV  S D +  Q+   DGRRA V +  D DL+ +L  + V
Sbjct  33   ERETLRYSEFVEAVQDNQVSRVLISPDQATAQVVESDGRRADVNLAPDKDLLKLLTDHNV  92

Query  591  DISV  602
            DI+V
Sbjct  93   DIAV  96



>ref|WP_013506914.1| ATP-dependent metalloprotease [Desulfurispirillum indicum]
 gb|ADU67040.1| ATP-dependent metalloprotease FtsH [Desulfurispirillum indicum 
S5]
Length=651

 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 37/63 (59%), Gaps = 2/63 (3%)
 Frame = +3

Query  429  YSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSE  608
            YSEF++ V +G + +V+    G  +  + +DGRR   I P+DPDLI  L   G+ I V E
Sbjct  38   YSEFISMVDRGTISQVQIQ--GKKVTASGMDGRRIETIAPDDPDLIPTLKARGLRIEVKE  95

Query  609  GEG  617
             EG
Sbjct  96   PEG  98



>ref|WP_011131165.1| cell division protein FtsH [Prochlorococcus marinus]
 emb|CAE21973.1| cell division protein FtsH2 [Prochlorococcus marinus str. MIT 
9313]
Length=615

 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 28/64 (44%), Positives = 38/64 (59%), Gaps = 0/64 (0%)
 Frame = +3

Query  411  EGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGV  590
            E    RYSEF+ AV+  +V RV  S D +  Q+   DGRRA V +  D DL+ +L  + V
Sbjct  33   ERETLRYSEFVEAVQDNQVSRVLISPDQATAQVVESDGRRADVNLAPDKDLLKLLTDHNV  92

Query  591  DISV  602
            DI+V
Sbjct  93   DIAV  96



>ref|WP_011826974.1| cell division protein FtsH [Prochlorococcus marinus]
 gb|ABM79116.1| cell division protein FtsH2 [Prochlorococcus marinus str. MIT 
9303]
Length=615

 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 28/64 (44%), Positives = 38/64 (59%), Gaps = 0/64 (0%)
 Frame = +3

Query  411  EGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGV  590
            E    RYSEF+ AV+  +V RV  S D +  Q+   DGRRA V +  D DL+ +L  + V
Sbjct  33   ERETLRYSEFVEAVQDNQVSRVLISPDQATAQVVESDGRRADVNLAPDKDLLKLLTDHNV  92

Query  591  DISV  602
            DI+V
Sbjct  93   DIAV  96



>ref|WP_019494535.1| cell division protein FtsH [Calothrix sp. PCC 7103]
Length=620

 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 25/60 (42%), Positives = 36/60 (60%), Gaps = 0/60 (0%)
 Frame = +3

Query  423  WRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISV  602
            WRYS+F+  V+KG V +VR S D +   + +  G +  V + +DP LI+ L    VDISV
Sbjct  44   WRYSQFIQEVEKGNVAQVRLSADRTQAIVKSQSGNQVLVTLVDDPQLINTLTEKNVDISV  103



>ref|WP_009455956.1| MULTISPECIES: cell division protein FtsH [Fischerella]
 gb|EHC16019.1| ATP-dependent metalloprotease FtsH [Fischerella sp. JSC-11]
Length=614

 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 37/61 (61%), Gaps = 1/61 (2%)
 Frame = +3

Query  423  WRYSEFLNAVKKGKVERVRFSKDGSALQLT-AVDGRRATVIVPNDPDLIDILAMNGVDIS  599
            WRYS+F+  V+ GKVE+V  S D S   +T   D ++  V + NDP+LI+ L    VDI 
Sbjct  37   WRYSQFIQEVRAGKVEKVSISADRSTAVVTPKFDSKKKLVTLVNDPNLINELNEQNVDII  96

Query  600  V  602
            V
Sbjct  97   V  97



>ref|WP_016867387.1| cell division protein FtsH [Fischerella muscicola]
Length=614

 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 37/61 (61%), Gaps = 1/61 (2%)
 Frame = +3

Query  423  WRYSEFLNAVKKGKVERVRFSKDGSALQLT-AVDGRRATVIVPNDPDLIDILAMNGVDIS  599
            WRYS+F+  V+ GKVE+V  S D S   +T   D ++  V + NDP+LI+ L    VDI 
Sbjct  37   WRYSQFIQEVRAGKVEKVSISADRSTAVVTPKFDSKKKLVTLVNDPNLINELNEQNVDII  96

Query  600  V  602
            V
Sbjct  97   V  97



>ref|WP_026723275.1| cell division protein FtsH [Fischerella sp. PCC 9431]
Length=614

 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 37/61 (61%), Gaps = 1/61 (2%)
 Frame = +3

Query  423  WRYSEFLNAVKKGKVERVRFSKDGSALQLT-AVDGRRATVIVPNDPDLIDILAMNGVDIS  599
            WRYS+F+  V+  KVE+V  S D S   +T   D ++  V + NDP+LI+ L   GVDI 
Sbjct  37   WRYSQFIQEVRNNKVEKVSISADRSTAIVTPKFDSKKKLVTLVNDPNLINELNEKGVDII  96

Query  600  V  602
            V
Sbjct  97   V  97



>ref|WP_009545257.1| MULTISPECIES: cell division protein FtsH [Cyanothece]
 gb|ACB52927.1| cell division protein [Cyanothece sp. ATCC 51142]
Length=617

 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 27/59 (46%), Positives = 40/59 (68%), Gaps = 1/59 (2%)
 Frame = +3

Query  429  YSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVI-VPNDPDLIDILAMNGVDISV  602
            YSEF+  V+  KV+RV  S D +  ++   +G    ++ +PNDPDLI+IL+ NGVDI+V
Sbjct  42   YSEFIERVESNKVDRVTLSSDRTQAKVPNPEGGAPLLVNLPNDPDLINILSQNGVDIAV  100



>ref|WP_017312914.1| cell division protein FtsH [Fischerella sp. PCC 9339]
Length=614

 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 37/61 (61%), Gaps = 1/61 (2%)
 Frame = +3

Query  423  WRYSEFLNAVKKGKVERVRFSKDGSALQLT-AVDGRRATVIVPNDPDLIDILAMNGVDIS  599
            WRYS+F+  V+ GKVE+V  S D S   +T   D ++  V + NDP+LI+ L    VDI 
Sbjct  37   WRYSQFIQEVRAGKVEKVSISADRSTAIVTPKFDSKKKLVTLVNDPNLINELNEQSVDII  96

Query  600  V  602
            V
Sbjct  97   V  97



>ref|WP_016862523.1| cell division protein FtsH [Fischerella muscicola]
Length=614

 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 37/61 (61%), Gaps = 1/61 (2%)
 Frame = +3

Query  423  WRYSEFLNAVKKGKVERVRFSKDGSALQLT-AVDGRRATVIVPNDPDLIDILAMNGVDIS  599
            WRYS+F+  V+ GKVE+V  S D S   +T   D ++  V + NDP+LI+ L    VDI 
Sbjct  37   WRYSQFIQEVRAGKVEKVSISADRSTAIVTPKFDSKKKLVTLVNDPNLINELNEQSVDII  96

Query  600  V  602
            V
Sbjct  97   V  97



>gb|ADD94882.1| FtsH peptidase [uncultured marine bacterium MedDCM-OCT-S09-C166]
Length=616

 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 44/81 (54%), Gaps = 0/81 (0%)
 Frame = +3

Query  360  VVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATV  539
            +V+ AP          P+ +  RYSEF+ AVK  ++ RV  S D    Q+   DGRRA V
Sbjct  18   IVVIAPAFIGGGGGSQPQVNTIRYSEFVEAVKDDQISRVLISPDQGTAQVVENDGRRAQV  77

Query  540  IVPNDPDLIDILAMNGVDISV  602
             +  D +L+ +L  + VDI+V
Sbjct  78   NLAPDRELLGLLTEHSVDIAV  98



>ref|WP_029981286.1| cell division protein FtsH, partial [Prochlorococcus sp. scB243_498C16]
Length=182

 Score = 48.9 bits (115),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 25/60 (42%), Positives = 37/60 (62%), Gaps = 0/60 (0%)
 Frame = +3

Query  426  RYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVS  605
            RYS+F+ AV+  ++ RV  S D +  Q+   DG R+ V +  D DL+ IL  N VDI+V+
Sbjct  39   RYSDFIEAVQDKEISRVLISPDNATAQVVENDGSRSEVNLAPDKDLLKILTENNVDIAVT  98



>ref|WP_010468934.1| cell division protein FtsH [Acaryochloris sp. CCMEE 5410]
Length=608

 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 25/60 (42%), Positives = 37/60 (62%), Gaps = 1/60 (2%)
 Frame = +3

Query  423  WRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISV  602
            WRYS+ +  V+   VE++R S D +  ++ + +G   TV +P DPD IDIL    VDI+V
Sbjct  36   WRYSKLIEEVENNNVEKIRISADRTMAEVKSGEG-TITVNLPPDPDFIDILTKQDVDIAV  94



>ref|WP_040935720.1| cell division protein FtsH [Prochloron didemni]
Length=616

 Score = 50.1 bits (118),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 41/60 (68%), Gaps = 1/60 (2%)
 Frame = +3

Query  426  RYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVI-VPNDPDLIDILAMNGVDISV  602
            +YSEF+N V+  +++RV  S D S  Q+    G +  ++ +PNDP+LI+IL+  GVDI+V
Sbjct  40   KYSEFINQVENNQIDRVSISADRSEAQIPNPQGGQPLLVNLPNDPELINILSEKGVDIAV  99



>gb|AII47735.1| cell division protein FtsH [Synechococcus sp. KORDI-52]
Length=603

 Score = 49.7 bits (117),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 44/81 (54%), Gaps = 0/81 (0%)
 Frame = +3

Query  360  VVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATV  539
            +V+ AP          P+ +  RYSEF+ AVK  ++ RV  S D    Q+   DGRRA V
Sbjct  5    IVVIAPAFIGGGGGSQPQVNTIRYSEFVEAVKDDQISRVLISPDQGTAQVVENDGRRAQV  64

Query  540  IVPNDPDLIDILAMNGVDISV  602
             +  D +L+ +L  + VDI+V
Sbjct  65   NLAPDRELLGLLTDHNVDIAV  85



>ref|WP_038551333.1| cell division protein FtsH [Synechococcus sp. KORDI-52]
Length=616

 Score = 49.7 bits (117),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 44/81 (54%), Gaps = 0/81 (0%)
 Frame = +3

Query  360  VVLNAPKPQAQPASDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATV  539
            +V+ AP          P+ +  RYSEF+ AVK  ++ RV  S D    Q+   DGRRA V
Sbjct  18   IVVIAPAFIGGGGGSQPQVNTIRYSEFVEAVKDDQISRVLISPDQGTAQVVENDGRRAQV  77

Query  540  IVPNDPDLIDILAMNGVDISV  602
             +  D +L+ +L  + VDI+V
Sbjct  78   NLAPDRELLGLLTDHNVDIAV  98



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1179751321320