BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF046D18

Length=758
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP07208.1|  unnamed protein product                                440   1e-148   Coffea canephora [robusta coffee]
ref|XP_009770922.1|  PREDICTED: ABC transporter E family member 2       438   1e-147   Nicotiana sylvestris
ref|XP_009602236.1|  PREDICTED: ABC transporter E family member 2...    438   1e-147   Nicotiana tomentosiformis
ref|XP_008377063.1|  PREDICTED: ABC transporter E family member 2...    427   4e-147   
ref|XP_011082187.1|  PREDICTED: ABC transporter E family member 2       434   2e-146   Sesamum indicum [beniseed]
ref|XP_007040863.1|  RNAse l inhibitor protein 2 isoform 2              430   9e-146   
gb|KJB25122.1|  hypothetical protein B456_004G177600                    427   1e-145   Gossypium raimondii
ref|XP_002271392.1|  PREDICTED: ABC transporter E family member 2       432   2e-145   Vitis vinifera
emb|CBI29193.3|  unnamed protein product                                433   2e-145   Vitis vinifera
ref|XP_010915915.1|  PREDICTED: ABC transporter E family member 2...    432   2e-145   Elaeis guineensis
ref|XP_008783223.1|  PREDICTED: ABC transporter E family member 2...    432   3e-145   Phoenix dactylifera
ref|XP_007040862.1|  RNAse l inhibitor protein 2 isoform 1              432   4e-145   
ref|XP_008221272.1|  PREDICTED: ABC transporter E family member 2       431   5e-145   Prunus mume [ume]
ref|XP_006430899.1|  hypothetical protein CICLE_v10011325mg             431   6e-145   Citrus clementina [clementine]
gb|KDO72263.1|  hypothetical protein CISIN_1g040300mg                   431   6e-145   Citrus sinensis [apfelsine]
ref|XP_007222049.1|  hypothetical protein PRUPE_ppa003094mg             431   7e-145   Prunus persica
ref|XP_008387873.1|  PREDICTED: ABC transporter E family member 2...    431   8e-145   Malus domestica [apple tree]
ref|XP_006430901.1|  hypothetical protein CICLE_v10011325mg             430   9e-145   
ref|XP_004150248.1|  PREDICTED: ABC transporter E family member 2...    431   1e-144   Cucumis sativus [cucumbers]
ref|XP_010925920.1|  PREDICTED: ABC transporter E family member 2...    431   1e-144   
gb|KJB25123.1|  hypothetical protein B456_004G177600                    429   1e-144   Gossypium raimondii
ref|XP_008387874.1|  PREDICTED: ABC transporter E family member 2...    430   1e-144   
ref|XP_010272250.1|  PREDICTED: ABC transporter E family member 2       430   2e-144   Nelumbo nucifera [Indian lotus]
gb|KJB25124.1|  hypothetical protein B456_004G177600                    429   2e-144   Gossypium raimondii
gb|KJB25125.1|  hypothetical protein B456_004G177600                    430   2e-144   Gossypium raimondii
gb|KJB25121.1|  hypothetical protein B456_004G177600                    429   2e-144   Gossypium raimondii
ref|XP_010536040.1|  PREDICTED: ABC transporter E family member 2       429   2e-144   Tarenaya hassleriana [spider flower]
ref|XP_008444234.1|  PREDICTED: ABC transporter E family member 2       429   3e-144   Cucumis melo [Oriental melon]
ref|XP_009409466.1|  PREDICTED: ABC transporter E family member 2...    429   3e-144   Musa acuminata subsp. malaccensis [pisang utan]
gb|AIU41641.1|  ABC transporter family protein                          429   4e-144   Hevea brasiliensis [jebe]
ref|XP_006858622.1|  hypothetical protein AMTR_s00066p00025940          429   6e-144   Amborella trichopoda
ref|XP_010099717.1|  ABC transporter E family member 2                  428   9e-144   
ref|XP_003577489.1|  PREDICTED: ABC transporter E family member 2       428   9e-144   Brachypodium distachyon [annual false brome]
gb|KDP42075.1|  hypothetical protein JCGZ_01863                         427   1e-143   Jatropha curcas
dbj|BAJ90466.1|  predicted protein                                      427   1e-143   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_011028506.1|  PREDICTED: ABC transporter E family member 2       427   2e-143   Populus euphratica
ref|XP_008801480.1|  PREDICTED: ABC transporter E family member 2       427   3e-143   
ref|XP_009409469.1|  PREDICTED: ABC transporter E family member 2...    426   6e-143   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAL26702.1|  68 kDa protein HP68                                     426   6e-143   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010275149.1|  PREDICTED: ABC transporter E family member 2...    426   7e-143   Nelumbo nucifera [Indian lotus]
ref|XP_010323314.1|  PREDICTED: ABC transporter E family member 2       426   9e-143   
gb|EPS64099.1|  hypothetical protein M569_10682                         426   1e-142   Genlisea aurea
ref|XP_010529268.1|  PREDICTED: ABC transporter E family member 2...    425   1e-142   Tarenaya hassleriana [spider flower]
ref|XP_008655346.1|  PREDICTED: ABC transporter E family member 2...    425   1e-142   Zea mays [maize]
ref|XP_009380578.1|  PREDICTED: ABC transporter E family member 2       425   1e-142   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008660181.1|  PREDICTED: ABC transporter E family member 2...    425   1e-142   Zea mays [maize]
ref|XP_002468219.1|  hypothetical protein SORBIDRAFT_01g042020          425   1e-142   Sorghum bicolor [broomcorn]
ref|XP_004979432.1|  PREDICTED: ABC transporter E family member 2...    425   2e-142   Setaria italica
ref|XP_010917851.1|  PREDICTED: ABC transporter E family member 2       425   2e-142   Elaeis guineensis
gb|ABR18176.1|  unknown                                                 424   2e-142   Picea sitchensis
ref|XP_010054013.1|  PREDICTED: ABC transporter E family member 2       424   2e-142   Eucalyptus grandis [rose gum]
ref|XP_006662991.1|  PREDICTED: ABC transporter E family member 2...    424   3e-142   Oryza brachyantha
ref|XP_006366958.1|  PREDICTED: ABC transporter E family member 2...    424   4e-142   Solanum tuberosum [potatoes]
ref|XP_010690817.1|  PREDICTED: ABC transporter E family member 2       424   4e-142   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004512327.1|  PREDICTED: ABC transporter E family member 2...    424   4e-142   Cicer arietinum [garbanzo]
gb|EAZ18673.1|  hypothetical protein OsJ_34194                          424   4e-142   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008805333.1|  PREDICTED: ABC transporter E family member 2...    423   6e-142   Phoenix dactylifera
ref|XP_007158074.1|  hypothetical protein PHAVU_002G121800g             423   7e-142   Phaseolus vulgaris [French bean]
ref|XP_003579496.1|  PREDICTED: ABC transporter E family member 2...    422   2e-141   Brachypodium distachyon [annual false brome]
gb|AAM19067.1|  RNase L inhibitor-like protein                          422   3e-141   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009349643.1|  PREDICTED: ABC transporter E family member 2...    421   3e-141   Pyrus x bretschneideri [bai li]
ref|NP_001068062.1|  Os11g0546000                                       421   4e-141   
dbj|BAJ93642.1|  predicted protein                                      420   1e-140   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003537713.1|  PREDICTED: ABC transporter E family member 2...    420   2e-140   Glycine max [soybeans]
ref|XP_009333973.1|  PREDICTED: ABC transporter E family member 2       420   2e-140   Pyrus x bretschneideri [bai li]
ref|XP_007216970.1|  hypothetical protein PRUPE_ppa003087mg             419   2e-140   Prunus persica
gb|EYU37486.1|  hypothetical protein MIMGU_mgv1a003146mg                419   2e-140   Erythranthe guttata [common monkey flower]
ref|XP_003580843.1|  PREDICTED: ABC transporter E family member 2...    419   3e-140   Brachypodium distachyon [annual false brome]
ref|XP_006385159.1|  RNase L inhibitor family protein                   419   4e-140   
gb|AGV54379.1|  ABC transporter E family member 2-like protein          418   8e-140   Phaseolus vulgaris [French bean]
ref|XP_006385402.1|  hypothetical protein POPTR_0003s03960g             417   1e-139   Populus trichocarpa [western balsam poplar]
ref|XP_008783221.1|  PREDICTED: ABC transporter E family member 2...    418   1e-139   Phoenix dactylifera
ref|XP_011013966.1|  PREDICTED: ABC transporter E family member 2...    417   1e-139   Populus euphratica
ref|XP_008783222.1|  PREDICTED: ABC transporter E family member 2...    418   1e-139   
ref|XP_008380283.1|  PREDICTED: ABC transporter E family member 2...    416   3e-139   
ref|XP_003592706.1|  RNase L inhibitor-like protein                     416   4e-139   Medicago truncatula
gb|KHN05542.1|  ABC transporter E family member 2                       418   9e-139   Glycine soja [wild soybean]
ref|XP_004291224.1|  PREDICTED: ABC transporter E family member 2       415   1e-138   Fragaria vesca subsp. vesca
ref|XP_010692184.1|  PREDICTED: ABC transporter E family member 2...    414   3e-138   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004246016.1|  PREDICTED: ABC transporter E family member 2       412   1e-137   Solanum lycopersicum
emb|CDX99388.1|  BnaC01g11640D                                          412   2e-137   
gb|AGC70150.1|  ABC transporter E family member 2 protein               412   2e-137   Cardamine hirsuta
gb|KEH40227.1|  RNase L inhibitor ABC superfamily protein, putative     412   3e-137   Medicago truncatula
ref|XP_006359955.1|  PREDICTED: ABC transporter E family member 2...    411   3e-137   Solanum tuberosum [potatoes]
gb|EAY81246.1|  hypothetical protein OsI_36424                          406   5e-137   Oryza sativa Indica Group [Indian rice]
emb|CDY05197.1|  BnaC05g46060D                                          410   6e-137   
emb|CAN65893.1|  hypothetical protein VITISV_021090                     410   7e-137   Vitis vinifera
ref|XP_010925922.1|  PREDICTED: ABC transporter E family member 2...    408   6e-136   
ref|XP_006413992.1|  hypothetical protein EUTSA_v10024707mg             407   9e-136   Eutrema salsugineum [saltwater cress]
emb|CDX98609.1|  BnaA03g43940D                                          407   1e-135   
emb|CDY01588.1|  BnaC07g35780D                                          407   1e-135   
ref|XP_006286029.1|  hypothetical protein CARUB_v10007560mg             407   2e-135   Capsella rubella
emb|CDX76485.1|  BnaA08g09150D                                          407   2e-135   
ref|XP_009108421.1|  PREDICTED: ABC transporter E family member 2       406   3e-135   
ref|XP_010436484.1|  PREDICTED: ABC transporter E family member 2...    405   3e-135   
emb|CAA16710.1|  RNase L inhibitor-like protein                         405   5e-135   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009137000.1|  PREDICTED: ABC transporter E family member 2...    405   6e-135   Brassica rapa
ref|XP_010439735.1|  PREDICTED: ABC transporter E family member 2...    405   8e-135   Camelina sativa [gold-of-pleasure]
ref|NP_193656.2|  RNAse l inhibitor protein 2                           404   2e-134   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003589457.1|  RNase L inhibitor protein-like protein             402   5e-133   
ref|XP_006836109.1|  hypothetical protein AMTR_s00226p00014390          397   9e-132   Amborella trichopoda
ref|XP_002528281.1|  rnase l inhibitor, putative                        391   1e-129   
ref|XP_002303221.1|  RNase L inhibitor family protein                   390   9e-129   
ref|XP_006430898.1|  hypothetical protein CICLE_v10011325mg             375   1e-123   
emb|CDY09282.1|  BnaC03g63120D                                          374   1e-122   Brassica napus [oilseed rape]
ref|XP_003572083.1|  PREDICTED: ABC transporter E family member 2...    371   1e-121   Brachypodium distachyon [annual false brome]
ref|XP_008227933.1|  PREDICTED: ABC transporter E family member 2...    366   1e-119   Prunus mume [ume]
ref|XP_007217624.1|  hypothetical protein PRUPE_ppa015638mg             365   2e-119   Prunus persica
ref|XP_009117623.1|  PREDICTED: ABC transporter E family member 1       363   1e-118   Brassica rapa
emb|CDY60809.1|  BnaA01g37290D                                          363   1e-118   Brassica napus [oilseed rape]
ref|XP_011395697.1|  ABC transporter E family member 2                  364   2e-118   Auxenochlorella protothecoides
ref|XP_010500834.1|  PREDICTED: ABC transporter E family member 1...    362   5e-118   Camelina sativa [gold-of-pleasure]
ref|XP_006296689.1|  hypothetical protein CARUB_v10013264mg             362   7e-118   Capsella rubella
ref|XP_006299795.1|  hypothetical protein CARUB_v10015991mg             361   9e-118   Capsella rubella
ref|XP_010487122.1|  PREDICTED: ABC transporter E family member 1...    361   1e-117   Camelina sativa [gold-of-pleasure]
ref|NP_187973.1|  ABC transporter E family member 1                     360   2e-117   Arabidopsis thaliana [mouse-ear cress]
gb|KEH28590.1|  RNase L inhibitor ABC domain protein                    359   6e-117   Medicago truncatula
gb|EMS57600.1|  ABC transporter E family member 2                       360   8e-117   Triticum urartu
ref|XP_008227934.1|  PREDICTED: ABC transporter E family member 2...    358   2e-116   Prunus mume [ume]
gb|KDD74545.1|  hypothetical protein H632_c1239p0                       357   7e-116   Helicosporidium sp. ATCC 50920
ref|XP_010465207.1|  PREDICTED: ABC transporter E family member 1...    356   8e-116   Camelina sativa [gold-of-pleasure]
ref|XP_006815890.1|  PREDICTED: ATP-binding cassette sub-family E...    352   1e-115   Saccoglossus kowalevskii
ref|XP_003746536.1|  PREDICTED: ATP-binding cassette sub-family E...    355   2e-115   Galendromus occidentalis
ref|XP_002184067.1|  phosphatase                                        355   3e-115   Phaeodactylum tricornutum CCAP 1055/1
ref|XP_002153953.1|  PREDICTED: ATP-binding cassette sub-family E...    354   4e-115   Hydra vulgaris
gb|AAX26766.2|  SJCHGC05773 protein                                     341   8e-115   Schistosoma japonicum
gb|EMT04752.1|  ABC transporter E family member 2                       358   9e-115   
ref|XP_006418725.1|  hypothetical protein EUTSA_v10002453mg             353   1e-114   Eutrema salsugineum [saltwater cress]
ref|XP_005704280.1|  ABC transporter, sub-family E, substrate-bin...    353   1e-114   Galdieria sulphuraria
gb|EWM23870.1|  rnase l inhibitor-like protein                          350   2e-114   Nannochloropsis gaditana
ref|XP_008042284.1|  RNAse L inhibitor-type ATP binding cassette ...    352   2e-114   Trametes versicolor FP-101664 SS1
ref|XP_011449756.1|  PREDICTED: ATP-binding cassette sub-family E...    352   4e-114   Crassostrea gigas
emb|CCD59622.1|  ATP-binding cassette, sub-family E (oabp),member...    350   5e-114   Schistosoma mansoni
emb|CCM04394.1|  predicted protein                                      351   6e-114   Fibroporia radiculosa
ref|XP_002009032.1|  GI11489                                            351   1e-113   Drosophila mojavensis
ref|XP_002047872.1|  GJ13683                                            350   2e-113   Drosophila virilis
ref|XP_001984558.1|  GH14962                                            350   2e-113   Drosophila grimshawi
emb|CDO70981.1|  hypothetical protein BN946_scf184830.g13               350   3e-113   Trametes cinnabarina
ref|XP_011300503.1|  PREDICTED: ATP-binding cassette sub-family E...    350   4e-113   Fopius arisanus
gb|EWM23869.1|  rnase l inhibitor-like protein                          351   4e-113   Nannochloropsis gaditana
ref|XP_968009.1|  PREDICTED: ATP-binding cassette sub-family E me...    349   5e-113   Tribolium castaneum [rust-red flour beetle]
gb|EMT25832.1|  ABC transporter E family member 2                       347   7e-113   
gb|EMS47523.1|  ABC transporter E family member 2                       347   8e-113   Triticum urartu
gb|EIE87499.1|  translation initiation factor RLI1                      348   1e-112   Rhizopus delemar RA 99-880
ref|XP_001956850.1|  GF10137                                            348   1e-112   Drosophila ananassae
gb|KFH72616.1|  ABC transporter E family member 2                       347   2e-112   Mortierella verticillata NRRL 6337
ref|XP_002093378.1|  GE21271                                            348   2e-112   Drosophila yakuba
ref|XP_007852143.1|  rnase l inhibitor-type atp binding cassette ...    347   3e-112   
ref|XP_004990715.1|  ABC transporter ABCE1                              347   3e-112   Salpingoeca rosetta
gb|EMS65569.1|  ABC transporter E family member 2                       348   3e-112   Triticum urartu
dbj|GAA55212.1|  ATP-binding cassette sub-family E member 1             351   4e-112   Clonorchis sinensis [oriental liver fluke]
gb|AAP80847.1|  68 kDa protein HP68                                     334   4e-112   Griffithsia japonica
ref|XP_001832405.2|  RNAse L inhibitor-type ATP binding cassette ...    346   5e-112   Coprinopsis cinerea okayama7#130
ref|XP_010500812.1|  PREDICTED: ABC transporter E family member 1...    347   6e-112   Camelina sativa [gold-of-pleasure]
emb|CEG63656.1|  Putative YALI0A17941p                                  346   6e-112   Rhizopus microsporus
ref|XP_001182876.2|  PREDICTED: ATP-binding cassette sub-family E...    346   7e-112   
gb|EMT26323.1|  ABC transporter E family member 2                       346   7e-112   
ref|XP_005105420.1|  PREDICTED: ATP-binding cassette sub-family E...    346   8e-112   Aplysia californica
ref|NP_648272.1|  pixie, isoform A                                      346   9e-112   Drosophila melanogaster
gb|EPB83194.1|  translation initiation factor RLI1                      345   1e-111   Mucor circinelloides f. circinelloides 1006PhL
ref|XP_005105418.1|  PREDICTED: ATP-binding cassette sub-family E...    347   1e-111   
gb|KFG32440.1|  putative ATP-binding cassette sub-family E member 1     339   1e-111   Toxoplasma gondii GAB2-2007-GAL-DOM2
ref|XP_008560191.1|  PREDICTED: ATP-binding cassette sub-family E...    347   1e-111   
ref|XP_009518050.1|  abc transporter                                    346   1e-111   Phytophthora sojae
gb|EKC18713.1|  ATP-binding cassette sub-family E member 1              349   2e-111   Crassostrea gigas
emb|CCA19671.1|  hypothetical protein ALNC14_058140                     345   2e-111   Albugo laibachii Nc14
emb|CDX82529.1|  BnaA03g32920D                                          343   3e-111   
gb|KDR23332.1|  ATP-binding cassette sub-family E member 1              344   3e-111   Zootermopsis nevadensis
ref|XP_003487517.1|  PREDICTED: ATP-binding cassette sub-family E...    344   3e-111   
ref|XP_002424051.1|  ATP-binding cassette subfamily E, member 1         345   3e-111   Pediculus humanus corporis [human body lice]
emb|CEP07445.1|  hypothetical protein                                   344   4e-111   Parasitella parasitica
ref|XP_002028023.1|  GL15045                                            343   4e-111   
ref|XP_003773214.1|  PREDICTED: ATP-binding cassette sub-family E...    340   4e-111   
ref|XP_009135315.1|  PREDICTED: ABC transporter E family member 1...    344   4e-111   Brassica rapa
ref|XP_003394142.1|  PREDICTED: ATP-binding cassette sub-family E...    343   4e-111   
emb|CDS10188.1|  Putative Translation initiation factor RLI1            344   5e-111   Lichtheimia ramosa
ref|XP_007782779.1|  translation initiation factor RLI1                 344   5e-111   Coniosporium apollinis CBS 100218
ref|XP_004831360.1|  ABC transporter, ATP-binding protein domain-...    344   5e-111   Theileria equi strain WA
emb|CDH54417.1|  translation initiation factor rli1                     343   5e-111   Lichtheimia corymbifera JMRC:FSU:9682
ref|XP_004347570.2|  ATP-binding cassette sub-family E member 1         344   5e-111   Capsaspora owczarzaki ATCC 30864
dbj|GAN01144.1|  translation initiation factor RLI1                     343   6e-111   Mucor ambiguus
ref|XP_011196211.1|  PREDICTED: ATP-binding cassette sub-family E...    344   7e-111   Zeugodacus cucurbitae [melon fruit fly]
ref|XP_008301422.1|  PREDICTED: ATP-binding cassette sub-family E...    338   7e-111   Stegastes partitus
ref|XP_001354175.2|  GA19033                                            343   7e-111   Drosophila pseudoobscura pseudoobscura
ref|XP_007070201.1|  PREDICTED: ATP-binding cassette sub-family E...    343   8e-111   Chelonia mydas [green seaturtle]
ref|XP_011163484.1|  PREDICTED: ATP-binding cassette sub-family E...    343   8e-111   Solenopsis invicta [imported red fire ant]
gb|EHJ73926.1|  ribonuclease L inhibitor-like protein                   343   8e-111   
ref|XP_008614115.1|  ABC transporter E family member 2                  344   8e-111   Saprolegnia diclina VS20
gb|KFM79460.1|  ATP-binding cassette sub-family E member 1              343   9e-111   Stegodyphus mimosarum
ref|XP_005284350.1|  PREDICTED: ATP-binding cassette sub-family E...    343   1e-110   Chrysemys picta bellii
ref|XP_002506706.1|  predicted protein                                  343   1e-110   Micromonas commoda
gb|KDO32655.1|  ABC transporter E family member 2                       343   1e-110   Saprolegnia parasitica CBS 223.65
ref|XP_011201626.1|  PREDICTED: ATP-binding cassette sub-family E...    343   1e-110   Bactrocera dorsalis [papaya fruit fly]
ref|XP_007897363.1|  PREDICTED: ATP-binding cassette sub-family E...    343   1e-110   Callorhinchus milii [Australian ghost shark]
ref|NP_001080761.1|  ATP-binding cassette, sub-family E (OABP), m...    343   1e-110   Xenopus laevis [clawed frog]
ref|XP_005327610.1|  PREDICTED: ATP-binding cassette sub-family E...    345   1e-110   Ictidomys tridecemlineatus
ref|XP_004708755.1|  PREDICTED: ATP-binding cassette sub-family E...    342   2e-110   Echinops telfairi [lesser hedgehog tenrec]
ref|XP_004525604.1|  PREDICTED: ATP-binding cassette sub-family E...    343   2e-110   Ceratitis capitata [medfly]
gb|KIK68603.1|  hypothetical protein GYMLUDRAFT_106711                  342   2e-110   Gymnopus luxurians FD-317 M1
gb|ELK17524.1|  ATP-binding cassette sub-family E member 1              344   2e-110   Pteropus alecto
ref|XP_005183309.1|  PREDICTED: ATP-binding cassette sub-family E...    342   2e-110   Musca domestica
ref|XP_002121964.1|  PREDICTED: ATP-binding cassette sub-family E...    342   2e-110   Ciona intestinalis [sea vase]
ref|XP_011498090.1|  PREDICTED: ATP-binding cassette sub-family E...    342   2e-110   Ceratosolen solmsi marchali
emb|CDX75723.1|  BnaC03g38060D                                          342   3e-110   
gb|ETK89054.1|  ABC transporter E family member 2                       343   3e-110   Phytophthora parasitica
ref|XP_008903480.1|  ABC transporter E family member 2                  343   3e-110   Phytophthora parasitica INRA-310
gb|ADO33033.1|  pixie                                                   342   3e-110   Biston betularia [peppered moth]
ref|XP_009205905.1|  PREDICTED: ATP-binding cassette sub-family E...    340   3e-110   
gb|EMS24018.1|  ATP-binding cassette, sub-family E, member 1            342   3e-110   Rhodotorula toruloides NP11
ref|XP_003690922.1|  PREDICTED: ATP-binding cassette sub-family E...    342   3e-110   Apis florea [dwarf honeybee]
ref|XP_003701716.1|  PREDICTED: ATP-binding cassette sub-family E...    341   3e-110   
ref|XP_004336916.1|  ribonuclease L inhibitor family protein            342   4e-110   Acanthamoeba castellanii str. Neff
ref|XP_003885554.1|  RNase L inhibitor, related                         342   4e-110   Neospora caninum Liverpool
ref|XP_010159708.1|  PREDICTED: ATP-binding cassette sub-family E...    337   4e-110   Eurypyga helias
ref|XP_006887102.1|  PREDICTED: ATP-binding cassette sub-family E...    341   4e-110   Elephantulus edwardii [Cape long-eared elephant shrew]
gb|EFB29665.1|  hypothetical protein PANDA_004343                       341   4e-110   Ailuropoda melanoleuca
emb|CAJ15800.1|  RNase L inhibitor                                      337   4e-110   Gallus gallus [bantam]
ref|XP_002997210.1|  ATP-binding cassette sub-family E member 1         342   4e-110   Phytophthora infestans T30-4
ref|XP_002370987.1|  ABC transporter, putative                          342   5e-110   Toxoplasma gondii ME49
ref|XP_008183576.1|  PREDICTED: LOW QUALITY PROTEIN: ATP-binding ...    342   5e-110   Acyrthosiphon pisum
dbj|BAE89880.1|  unnamed protein product                                341   5e-110   Macaca fascicularis [crab eating macaque]
dbj|BAM18097.1|  pixie                                                  342   5e-110   Papilio xuthus [Chinese swallowtail]
ref|XP_008886417.1|  ATP-binding cassette sub-family E member 1, ...    342   5e-110   
ref|XP_010419025.1|  PREDICTED: putative F-box protein At3g13624        343   6e-110   
ref|XP_003205467.1|  PREDICTED: ATP-binding cassette sub-family E...    341   6e-110   Meleagris gallopavo [common turkey]
ref|XP_007666625.1|  PREDICTED: ATP-binding cassette sub-family E...    341   6e-110   Ornithorhynchus anatinus [duck-billed platypus]
ref|XP_003129218.3|  PREDICTED: ATP-binding cassette sub-family E...    341   6e-110   
ref|XP_004420936.1|  PREDICTED: ATP-binding cassette sub-family E...    341   7e-110   Ceratotherium simum simum [southern square-lipped rhinoceros]
ref|NP_001101916.1|  ATP-binding cassette sub-family E member 1         341   7e-110   Rattus norvegicus [brown rat]
ref|XP_003500814.1|  PREDICTED: ATP-binding cassette sub-family E...    341   7e-110   Cricetulus griseus [Chinese hamsters]
ref|XP_003773213.1|  PREDICTED: ATP-binding cassette sub-family E...    341   7e-110   Sarcophilus harrisii
ref|XP_005995611.1|  PREDICTED: ATP-binding cassette sub-family E...    340   7e-110   
ref|XP_002069035.1|  GK12286                                            341   7e-110   Drosophila willistoni
ref|XP_006872330.1|  PREDICTED: ATP-binding cassette sub-family E...    341   8e-110   Chrysochloris asiatica
ref|XP_004655905.1|  PREDICTED: ATP-binding cassette sub-family E...    341   8e-110   Jaculus jaculus
ref|XP_001501999.1|  PREDICTED: ATP-binding cassette sub-family E...    341   8e-110   Equus caballus [domestic horse]
ref|XP_008142077.1|  PREDICTED: ATP-binding cassette sub-family E...    341   8e-110   Eptesicus fuscus
ref|XP_004485045.1|  PREDICTED: LOW QUALITY PROTEIN: ATP-binding ...    341   8e-110   Dasypus novemcinctus
ref|XP_011350337.1|  PREDICTED: ATP-binding cassette sub-family E...    341   8e-110   
ref|XP_006169559.1|  PREDICTED: ATP-binding cassette sub-family E...    341   8e-110   
gb|KFO20588.1|  ATP-binding cassette sub-family E member 1              342   8e-110   Fukomys damarensis [Damara mole rat]
ref|XP_005666905.1|  PREDICTED: ATP-binding cassette sub-family E...    340   8e-110   
dbj|BAE01051.1|  unnamed protein product                                341   8e-110   Macaca fascicularis [crab eating macaque]
emb|CAF92703.1|  unnamed protein product                                341   8e-110   Tetraodon nigroviridis
ref|XP_002916281.1|  PREDICTED: ATP-binding cassette sub-family E...    340   8e-110   Ailuropoda melanoleuca
dbj|BAE39466.1|  unnamed protein product                                340   8e-110   Mus musculus [mouse]
ref|XP_011350339.1|  PREDICTED: ATP-binding cassette sub-family E...    341   8e-110   
ref|XP_003417547.1|  PREDICTED: ATP-binding cassette sub-family E...    340   8e-110   Loxodonta africana [African bush elephant]
ref|XP_004606253.1|  PREDICTED: ATP-binding cassette sub-family E...    340   9e-110   Sorex araneus [Eurasian shrew]
ref|NP_002931.2|  ATP-binding cassette sub-family E member 1            340   9e-110   Homo sapiens [man]
ref|XP_004645502.1|  PREDICTED: ATP-binding cassette sub-family E...    340   9e-110   
gb|KEP55020.1|  translation initiation factor RLI1                      340   1e-109   Rhizoctonia solani 123E
ref|XP_011263099.1|  PREDICTED: ATP-binding cassette sub-family E...    341   1e-109   Camponotus floridanus
dbj|BAE39748.1|  unnamed protein product                                340   1e-109   Mus musculus [mouse]
gb|AAZ06362.1|  ATP-binding cassette sub-family E member 1              341   1e-109   Toxoplasma gondii
gb|EUC65514.1|  translation initiation factor RLI1                      340   1e-109   Rhizoctonia solani AG-3 Rhs1AP
ref|XP_011066035.1|  PREDICTED: ATP-binding cassette sub-family E...    340   1e-109   Acromyrmex echinatior
gb|EGI58223.1|  ATP-binding cassette sub-family E member 1              340   1e-109   Acromyrmex echinatior
ref|XP_006131844.1|  PREDICTED: ATP-binding cassette sub-family E...    340   1e-109   Pelodiscus sinensis [Chinese softshell turtle]
ref|XP_001608142.1|  PREDICTED: ATP-binding cassette sub-family E...    340   1e-109   
gb|KFQ10304.1|  ATP-binding cassette sub-family E member 1              340   2e-109   Haliaeetus albicilla
ref|XP_003336598.2|  ABC transporter E family member 2                  340   2e-109   Puccinia graminis f. sp. tritici CRL 75-36-700-3
gb|AAS07031.1|  RNase L inhibitor                                       340   2e-109   Chlorocebus aethiops [African green monkey]
gb|KFU86169.1|  ATP-binding cassette sub-family E member 1              340   2e-109   Chaetura pelagica
ref|XP_006906351.1|  PREDICTED: ATP-binding cassette sub-family E...    340   2e-109   Pteropus alecto
gb|KFO64898.1|  ATP-binding cassette sub-family E member 1              340   2e-109   Corvus brachyrhynchos
gb|KIP04509.1|  hypothetical protein PHLGIDRAFT_129467                  340   2e-109   Phlebiopsis gigantea 11061_1 CR5-6
ref|XP_003456493.1|  PREDICTED: ATP-binding cassette sub-family E...    339   3e-109   Oreochromis niloticus
ref|XP_006756018.1|  PREDICTED: ATP-binding cassette sub-family E...    339   3e-109   Myotis davidii
ref|XP_006023793.1|  PREDICTED: ATP-binding cassette sub-family E...    339   3e-109   Alligator sinensis
gb|ERE79301.1|  ATP-binding cassette sub-family E member 1              341   3e-109   Cricetulus griseus [Chinese hamsters]
gb|KGL97849.1|  ATP-binding cassette sub-family E member 1              339   3e-109   Charadrius vociferus
gb|KFP79450.1|  ATP-binding cassette sub-family E member 1              339   3e-109   Apaloderma vittatum
ref|XP_004575910.1|  PREDICTED: ATP-binding cassette sub-family E...    339   3e-109   Maylandia zebra
gb|KFV99662.1|  ATP-binding cassette sub-family E member 1              339   3e-109   Eurypyga helias
gb|KFV08643.1|  ATP-binding cassette sub-family E member 1              339   3e-109   Pterocles gutturalis
ref|XP_009327022.1|  PREDICTED: ATP-binding cassette sub-family E...    339   3e-109   Pygoscelis adeliae
gb|KFP68620.1|  ATP-binding cassette sub-family E member 1              339   4e-109   Cariama cristata
gb|KFW96353.1|  ATP-binding cassette sub-family E member 1              339   4e-109   Phalacrocorax carbo [common cormorant]
emb|CCI47858.1|  unnamed protein product                                345   4e-109   
gb|EOB04954.1|  ATP-binding cassette sub-family E member 1              339   4e-109   
ref|XP_010007234.1|  PREDICTED: ATP-binding cassette sub-family E...    339   4e-109   
gb|KFO03636.1|  ATP-binding cassette sub-family E member 1              339   4e-109   
gb|KFQ26608.1|  ATP-binding cassette sub-family E member 1              339   4e-109   
gb|KFV64493.1|  ATP-binding cassette sub-family E member 1              339   4e-109   
ref|XP_008499007.1|  PREDICTED: ATP-binding cassette sub-family E...    339   4e-109   
gb|KFP19938.1|  ATP-binding cassette sub-family E member 1              339   4e-109   
ref|XP_764492.1|  RNAse L inhibitor                                     340   5e-109   
ref|XP_009278535.1|  PREDICTED: ATP-binding cassette sub-family E...    338   5e-109   
ref|NP_001005628.1|  ATP-binding cassette, sub-family E (OABP), m...    338   5e-109   
ref|XP_005811478.1|  PREDICTED: ATP-binding cassette sub-family E...    338   5e-109   
gb|EXX58362.1|  Rli1p                                                   338   6e-109   
ref|XP_004079653.1|  PREDICTED: ATP-binding cassette sub-family E...    338   6e-109   
gb|KFM08216.1|  ATP-binding cassette sub-family E member 1              338   6e-109   
ref|XP_010749699.1|  PREDICTED: ATP-binding cassette sub-family E...    338   6e-109   
ref|XP_008434241.1|  PREDICTED: ATP-binding cassette sub-family E...    330   7e-109   
ref|XP_005327611.1|  PREDICTED: ATP-binding cassette sub-family E...    341   7e-109   
ref|XP_011135124.1|  PREDICTED: ATP-binding cassette sub-family E...    338   7e-109   
gb|KFP06257.1|  ATP-binding cassette sub-family E member 1              338   7e-109   
ref|XP_009977160.1|  PREDICTED: ATP-binding cassette sub-family E...    338   8e-109   
ref|XP_009889030.1|  PREDICTED: ATP-binding cassette sub-family E...    338   8e-109   
emb|CAJ18353.1|  RNase L inhibitor                                      338   8e-109   
ref|XP_006262799.1|  PREDICTED: ATP-binding cassette sub-family E...    338   8e-109   
ref|XP_009501163.1|  PREDICTED: ATP-binding cassette sub-family E...    338   8e-109   
ref|XP_002188739.1|  PREDICTED: ATP-binding cassette sub-family E...    338   8e-109   
ref|NP_001006440.1|  ATP-binding cassette sub-family E member 1         338   8e-109   
ref|XP_005864932.1|  PREDICTED: ATP-binding cassette sub-family E...    338   1e-108   
gb|ETS59925.1|  hypothetical protein PaG_05898                          338   1e-108   
dbj|GAC75056.1|  RNAse L inhibitor                                      338   1e-108   
gb|AAC24730.1|  RNAse L inhibitor                                       338   1e-108   
gb|KFO91191.1|  ATP-binding cassette sub-family E member 1              338   1e-108   
ref|NP_001077154.1|  ATP-binding cassette sub-family E member 1         338   1e-108   
ref|XP_010291764.1|  PREDICTED: ATP-binding cassette sub-family E...    338   1e-108   
ref|XP_005146619.1|  PREDICTED: ATP-binding cassette sub-family E...    338   1e-108   
gb|KFV40051.1|  ATP-binding cassette sub-family E member 1              338   1e-108   
gb|KGL74311.1|  ATP-binding cassette sub-family E member 1              338   1e-108   
dbj|GAK64634.1|  RNAse l inhibitor-type atp binding cassette protein    338   1e-108   
gb|EMC81758.1|  ATP-binding cassette sub-family E member 1              338   1e-108   
gb|KFV91778.1|  ATP-binding cassette sub-family E member 1              338   1e-108   
gb|KFV04283.1|  ATP-binding cassette sub-family E member 1              338   1e-108   
ref|XP_005864931.1|  PREDICTED: ATP-binding cassette sub-family E...    338   1e-108   
ref|XP_001660605.1|  AAEL010059-PA                                      338   2e-108   
gb|KFP36487.1|  ATP-binding cassette sub-family E member 1              338   2e-108   
gb|KFP70085.1|  ATP-binding cassette sub-family E member 1              338   2e-108   
ref|XP_003978457.1|  PREDICTED: ATP-binding cassette sub-family E...    337   2e-108   
gb|KFQ81264.1|  ATP-binding cassette sub-family E member 1              338   2e-108   
ref|XP_010136758.1|  PREDICTED: ATP-binding cassette sub-family E...    337   2e-108   
gb|KFP52898.1|  ATP-binding cassette sub-family E member 1              337   2e-108   
emb|CDR38495.1|  CYFA0S02e02322g1_1                                     338   2e-108   
gb|KEY76156.1|  RNase L inhibitor of the ABC                            340   2e-108   
dbj|GAM87745.1|  hypothetical protein ANO11243_057720                   337   2e-108   
gb|KFZ65502.1|  ATP-binding cassette sub-family E member 1              337   2e-108   
ref|XP_009817785.1|  PREDICTED: ATP-binding cassette sub-family E...    337   2e-108   
ref|XP_009834701.1|  ABC transporter E family member 2                  338   2e-108   
ref|XP_009574946.1|  PREDICTED: ATP-binding cassette sub-family E...    337   2e-108   
emb|CBQ73757.1|  probable RLI1-Protein promoting preinitiation co...    337   3e-108   
ref|XP_007428690.1|  PREDICTED: ATP-binding cassette sub-family E...    337   3e-108   
ref|XP_008864766.1|  ABC transporter E family member 2                  338   3e-108   
ref|XP_005485380.1|  PREDICTED: ATP-binding cassette sub-family E...    337   3e-108   
ref|XP_009568558.1|  PREDICTED: ATP-binding cassette sub-family E...    337   3e-108   
gb|KFO70694.1|  ATP-binding cassette sub-family E member 1              337   3e-108   
ref|XP_004378910.1|  PREDICTED: ATP-binding cassette sub-family E...    337   3e-108   
emb|CDI54172.1|  probable RLI1-Protein promoting preinitiation co...    337   3e-108   
ref|XP_009956414.1|  PREDICTED: ATP-binding cassette sub-family E...    337   4e-108   
ref|XP_003221699.1|  PREDICTED: ATP-binding cassette sub-family E...    337   4e-108   
ref|XP_001612069.1|  ABC transporter, ATP-binding domain containi...    337   4e-108   
ref|XP_010011879.1|  PREDICTED: ATP-binding cassette sub-family E...    336   4e-108   
gb|KFP27294.1|  ATP-binding cassette sub-family E member 1              337   4e-108   
ref|XP_006187279.1|  PREDICTED: ATP-binding cassette sub-family E...    336   4e-108   
ref|XP_007127461.1|  PREDICTED: ATP-binding cassette sub-family E...    336   4e-108   
gb|EPS32191.1|  hypothetical protein PDE_07151                          336   4e-108   
gb|EQL30489.1|  translation initiation factor RLI1                      336   5e-108   
gb|EFW19199.1|  ABC transporter                                         336   5e-108   
gb|AAS07030.1|  RNase L inhibitor                                       336   5e-108   
ref|XP_009687570.1|  PREDICTED: LOW QUALITY PROTEIN: ATP-binding ...    336   5e-108   
gb|EAS27709.3|  translation initiation factor RLI1                      336   5e-108   
ref|XP_003367607.1|  putative ABC transporter, ATP-binding protein      335   5e-108   
ref|XP_008323898.1|  PREDICTED: ATP-binding cassette sub-family E...    336   5e-108   
ref|XP_002380500.1|  RNase L inhibitor of the ABC superfamily, pu...    336   5e-108   
gb|KFQ15564.1|  ATP-binding cassette sub-family E member 1              336   6e-108   
ref|XP_003004835.1|  ATP-binding cassette sub-family E member 1         327   6e-108   
gb|KFQ42390.1|  ATP-binding cassette sub-family E member 1              336   6e-108   
ref|XP_003370646.1|  putative ABC transporter, ATP-binding protein      336   7e-108   
gb|AHK05659.1|  ATP-binding cassette transporter sub-family E mem...    336   7e-108   
gb|EST04914.1|  RNAse L inhibitor                                       336   7e-108   
gb|EPQ06893.1|  ATP-binding cassette sub-family E member 1              338   7e-108   
ref|NP_001036911.1|  ribonuclease L inhibitor homolog                   336   9e-108   
emb|CDJ05529.1|  ATP binding cassette sub family E                      335   1e-107   
gb|EHH53998.1|  hypothetical protein EGM_14727                          335   1e-107   
ref|XP_002795389.1|  translation initiation factor RLI1                 335   1e-107   
dbj|GAC99212.1|  RNase L inhibitor                                      335   1e-107   
emb|CDS17762.1|  ATP binding cassette sub family E                      335   2e-107   
gb|AEE62378.1|  unknown                                                 335   2e-107   
dbj|GAD96595.1|  ATP-binding cassette sub-family E member 1             337   2e-107   
ref|XP_008227935.1|  PREDICTED: ABC transporter E family member 2...    334   2e-107   
ref|NP_998216.2|  ATP-binding cassette sub-family E member 1            334   2e-107   
gb|KFB42639.1|  AGAP002182-PA-like protein                              335   2e-107   
ref|XP_007882292.1|  hypothetical protein PFL1_06558                    335   2e-107   
ref|XP_011389740.1|  putative protein promoting preinitiation com...    334   2e-107   
gb|AAH45882.1|  ATP-binding cassette, sub-family E (OABP), member 1     334   2e-107   
ref|XP_308004.3|  AGAP002182-PA                                         334   3e-107   
gb|AAH95592.1|  ATP-binding cassette, sub-family E (OABP), member 1     334   3e-107   
ref|XP_004263650.1|  PREDICTED: ATP-binding cassette sub-family E...    334   3e-107   
ref|NP_001046567.1|  Os02g0282900                                       334   4e-107   
ref|XP_001848687.1|  ATP-binding cassette sub-family E member 1         334   4e-107   
gb|EEC72923.1|  hypothetical protein OsI_06764                          336   4e-107   
emb|CCO27826.1|  ATP-binding cassette sub-family E member 1 AltNa...    333   5e-107   
ref|XP_007189424.1|  PREDICTED: ATP-binding cassette sub-family E...    333   5e-107   
gb|EZA47104.1|  ATP-binding cassette sub-family E member                333   6e-107   
gb|EGE80736.1|  ATP-binding cassette sub-family E member 1              336   8e-107   
gb|KIV79017.1|  translation initiation factor RLI1                      333   1e-106   
dbj|GAM26905.1|  hypothetical protein SAMD00019534_100800               333   1e-106   
ref|XP_002623806.1|  ATP-binding cassette sub-family E member 1         335   1e-106   
ref|XP_006629561.1|  PREDICTED: ATP-binding cassette sub-family E...    332   2e-106   
gb|EFA85500.1|  RNaseL inhibitor-like protein                           332   2e-106   
ref|XP_953484.1|  RNAse L inhibitor protein                             333   3e-106   
gb|ETN57992.1|  ATP-binding cassette sub-family E member 1              333   3e-106   
emb|CDR97412.1|  ABC transporter, ATP-binding domain containing p...    332   3e-106   
emb|CCF52067.1|  probable RLI1-Protein promoting preinitiation co...    332   3e-106   
ref|XP_005713641.1|  ATP-binding cassette, sub-family E (RLI), me...    332   3e-106   
ref|XP_002174795.1|  iron-sulfur protein                                331   3e-106   
gb|EEH21097.2|  translation initiation factor RLI1                      334   4e-106   
gb|EWC48374.1|  translation initiation factor RLI1                      331   4e-106   
ref|XP_007922289.1|  ABC transporter domain-containing protein          331   4e-106   
gb|KFG80922.1|  translation initiation factor RLI1                      331   4e-106   
ref|XP_011271910.1|  Translation initiation factor RLI1                 331   5e-106   
ref|XP_006299034.1|  hypothetical protein CARUB_v10015171mg             331   6e-106   
gb|EFX66734.1|  hypothetical protein DAPPUDRAFT_189585                  331   6e-106   
emb|CCA67966.1|  probable RLI1-protein promoting preinitiation co...    331   6e-106   
gb|EHH26220.1|  hypothetical protein EGK_16133                          330   8e-106   
gb|KFY14130.1|  hypothetical protein V492_02841                         332   1e-105   
emb|CDQ86105.1|  unnamed protein product                                330   1e-105   
gb|EZF23483.1|  translation initiation factor RLI1                      330   1e-105   
emb|CEG00217.1|  ABC transporter, ABCE                                  330   1e-105   
gb|KIX95155.1|  translation initiation factor RLI1                      330   1e-105   
gb|KIV88308.1|  translation initiation factor RLI1                      330   1e-105   
gb|EZF74246.1|  translation initiation factor RLI1                      330   1e-105   
emb|CCK71712.1|  hypothetical protein KNAG_0H02970                      330   2e-105   
gb|KIE03457.1|  translation initiation factor RLI1                      331   2e-105   
gb|KID90356.1|  translation initiation factor RLI1                      331   2e-105   
ref|XP_007820587.2|  ABC transporter, ABCE                              331   2e-105   
gb|KIW31282.1|  translation initiation factor RLI1                      329   2e-105   
gb|KID66435.1|  translation initiation factor RLI1                      331   2e-105   
ref|XP_010757114.1|  translation initiation factor RLI1                 333   2e-105   
emb|CCE40837.1|  hypothetical protein CPAR2_108760                      330   3e-105   
ref|XP_002848303.1|  translation initiation factor RLI1                 329   3e-105   
dbj|GAM41412.1|  iron-sulfur protein                                    329   3e-105   
ref|XP_002151573.1|  RNase L inhibitor of the ABC superfamily, pu...    329   3e-105   
ref|XP_007272504.1|  translation initiation factor rli1                 329   3e-105   
ref|NP_001133240.1|  ATP-binding cassette sub-family E member 1         328   4e-105   
gb|KID76816.1|  translation initiation factor RLI1                      331   4e-105   
gb|KIW82669.1|  translation initiation factor RLI1                      328   5e-105   
ref|XP_003385847.1|  PREDICTED: ATP-binding cassette sub-family E...    328   5e-105   
ref|XP_007727229.1|  translation initiation factor RLI1                 328   5e-105   
ref|XP_009649388.1|  translation initiation factor RLI1                 328   5e-105   
ref|XP_002560831.1|  Pc16g04800                                         332   5e-105   
gb|KIW18553.1|  translation initiation factor RLI1                      328   5e-105   
ref|XP_010886612.1|  PREDICTED: ATP-binding cassette sub-family E...    328   5e-105   
gb|KIW01313.1|  translation initiation factor RLI1                      328   6e-105   
ref|XP_007596669.1|  translation initiation factor RLI1                 328   7e-105   
gb|ENH77045.1|  translation initiation factor rli1                      328   7e-105   
gb|KFX92752.1|  hypothetical protein O988_07144                         329   7e-105   
ref|XP_004359361.1|  RNaseL inhibitor-like protein                      328   8e-105   
ref|XP_002555663.1|  KLTH0G14520p                                       328   8e-105   
ref|XP_001421010.1|  predicted protein                                  328   9e-105   
ref|XP_009692002.1|  RNase L inhibitor protein                          338   9e-105   
gb|EMR81784.1|  putative translation initiation factor rli1 protein     328   9e-105   
gb|KIW91070.1|  translation initiation factor RLI1                      328   9e-105   
ref|XP_009156620.1|  translation initiation factor RLI1                 328   1e-104   
gb|KGO78102.1|  ABC transporter, ABCE                                   331   1e-104   
gb|EPY50378.1|  iron-sulfur protein                                     327   1e-104   
emb|CCE33376.1|  probable RNase L inhibitor                             327   1e-104   
ref|XP_008728415.1|  translation initiation factor RLI1                 327   1e-104   
ref|XP_002786412.1|  68 kDa protein, putative                           328   1e-104   
gb|KFX90037.1|  hypothetical protein V490_06681                         328   1e-104   
gb|KIW67851.1|  translation initiation factor RLI1                      327   1e-104   
gb|EZF29954.1|  translation initiation factor RLI1                      329   2e-104   
emb|CCJ28163.1|  unnamed protein product                                317   2e-104   
emb|CAA53972.1|  RNase L inhibitor                                      327   2e-104   
gb|KFY94314.1|  hypothetical protein V500_03330                         328   2e-104   
gb|ELR07755.1|  translation initiation factor RLI1                      327   2e-104   
emb|CCJ29670.1|  unnamed protein product                                327   2e-104   
ref|XP_008080558.1|  P-loop containing nucleoside triphosphate hy...    328   2e-104   
gb|KFY22932.1|  hypothetical protein V493_06226                         328   2e-104   
dbj|BAO39596.1|  translation initiation factor RLI1                     327   2e-104   
gb|KIW99622.1|  translation initiation factor RLI1                      327   3e-104   
ref|XP_452984.1|  hypothetical protein                                  327   3e-104   
emb|CEJ95089.1|  Putative ATP-binding cassette sub-family E member 1    327   3e-104   
ref|XP_007758868.1|  translation initiation factor RLI1                 327   3e-104   
gb|KIW52261.1|  translation initiation factor RLI1                      327   3e-104   
emb|CDS33919.1|  ATP binding cassette sub family E                      327   3e-104   
emb|CDM30323.1|  Translation initiation factor RLI1                     328   3e-104   
gb|ESX03551.1|  Translation initiation factor RLI1                      327   3e-104   
ref|XP_003868123.1|  Rli1 protein                                       327   3e-104   
ref|XP_752397.1|  RNase L inhibitor of the ABC superfamily              329   3e-104   
ref|XP_007216670.1|  hypothetical protein PRUPE_ppa1027195mg            326   3e-104   
gb|EZG06784.1|  translation initiation factor RLI1                      329   3e-104   
gb|EZF95736.1|  translation initiation factor RLI1                      329   4e-104   
gb|KIW46344.1|  translation initiation factor RLI1                      326   4e-104   
ref|XP_002773331.1|  68 kDa protein, putative                           326   4e-104   
gb|KGO47620.1|  ABC transporter, ABCE                                   329   4e-104   
gb|EQK98827.1|  translation initiation factor RLI1                      326   4e-104   
gb|KGO54733.1|  ABC transporter, ABCE                                   329   5e-104   
gb|KDN69856.1|  putative ABC transporter                                326   5e-104   
ref|XP_003674860.1|  hypothetical protein NCAS_0B04030                  326   6e-104   
ref|XP_003683714.1|  hypothetical protein TPHA_0A01980                  326   6e-104   
ref|XP_011117798.1|  hypothetical protein AOL_s00006g187                326   7e-104   
gb|KHC40377.1|  translation initiation factor RLI1                      326   8e-104   
ref|XP_001646312.1|  hypothetical protein Kpol_1032p48                  325   9e-104   
ref|XP_635627.1|  RNaseL inhibitor-like protein                         325   9e-104   
ref|XP_002416987.1|  ABC-family memebr, APTPase, iron-sulfur prot...    326   9e-104   
gb|KIA75717.1|  RNase L inhibitor of the ABC superfamily                327   9e-104   
ref|XP_500182.1|  YALI0A17941p                                          325   1e-103   
gb|EGA83587.1|  Rli1p                                                   324   1e-103   
gb|KHJ43844.1|  ABC transporter, ATP-binding protein                    325   1e-103   
ref|XP_011326803.1|  translation initiation factor RLI1                 325   1e-103   
emb|CCF38800.1|  translation initiation factor RLI1                     325   2e-103   
gb|EFQ28814.1|  ABC transporter                                         325   2e-103   
gb|KEZ44645.1|  hypothetical protein SAPIO_CDS3689                      325   2e-103   
ref|XP_721532.1|  RNAse L inhibitor-type ATP binding cassette pro...    325   2e-103   



>emb|CDP07208.1| unnamed protein product [Coffea canephora]
Length=606

 Score =   440 bits (1132),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 210/216 (97%), Positives = 213/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPA+KIAFISEELCIGCG
Sbjct  1    MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPASKIAFISEELCIGCG  60

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA
Sbjct  61   ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  120

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            LKVLAGKLKPNLGRF NPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA
Sbjct  121  LKVLAGKLKPNLGRFNNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  180

Query  638  VQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNVG  745
            VQGNVGQVLDQKDERDMK++LC DLELNQVLD NVG
Sbjct  181  VQGNVGQVLDQKDERDMKQDLCEDLELNQVLDRNVG  216



>ref|XP_009770922.1| PREDICTED: ABC transporter E family member 2 [Nicotiana sylvestris]
 ref|XP_009770923.1| PREDICTED: ABC transporter E family member 2 [Nicotiana sylvestris]
Length=606

 Score =   438 bits (1126),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 209/216 (97%), Positives = 213/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            MSDQRLTRIAIVS+DKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG
Sbjct  1    MSDQRLTRIAIVSADKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  60

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA
Sbjct  61   ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  120

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            LKVLAGKLKPNLGRF NPPDWQEILT+FRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA
Sbjct  121  LKVLAGKLKPNLGRFSNPPDWQEILTHFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  180

Query  638  VQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNVG  745
            VQGNVGQVLDQKDERD+K +LCVDLELNQVLD NVG
Sbjct  181  VQGNVGQVLDQKDERDVKAQLCVDLELNQVLDRNVG  216



>ref|XP_009602236.1| PREDICTED: ABC transporter E family member 2 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009602237.1| PREDICTED: ABC transporter E family member 2 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009602238.1| PREDICTED: ABC transporter E family member 2 isoform X2 [Nicotiana 
tomentosiformis]
Length=606

 Score =   438 bits (1126),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 209/216 (97%), Positives = 213/216 (99%), Gaps = 0/216 (0%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            MSDQRLTRIAIVS+DKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG
Sbjct  1    MSDQRLTRIAIVSADKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  60

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA
Sbjct  61   ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  120

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            LKVLAGKLKPNLGRF NPPDWQEILT+FRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA
Sbjct  121  LKVLAGKLKPNLGRFSNPPDWQEILTHFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  180

Query  638  VQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNVG  745
            VQGNVGQVLDQKDERD+K +LCVDLELNQVLD NVG
Sbjct  181  VQGNVGQVLDQKDERDVKAQLCVDLELNQVLDRNVG  216



>ref|XP_008377063.1| PREDICTED: ABC transporter E family member 2-like [Malus domestica]
 ref|XP_008377064.1| PREDICTED: ABC transporter E family member 2-like [Malus domestica]
Length=335

 Score =   427 bits (1097),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 206/216 (95%), Positives = 213/216 (99%), Gaps = 1/216 (0%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            M+D RLTRIAIVSSD+CKPKKCRQECKKSCPVVKTGKLCIEVTPA+KIAFISEELCIGCG
Sbjct  1    MAD-RLTRIAIVSSDRCKPKKCRQECKKSCPVVKTGKLCIEVTPASKIAFISEELCIGCG  59

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA
Sbjct  60   ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  119

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA
Sbjct  120  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  179

Query  638  VQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNVG  745
            VQGNVG+VL+QKDERDMKEELC DLELNQV++ NVG
Sbjct  180  VQGNVGEVLNQKDERDMKEELCADLELNQVIERNVG  215



>ref|XP_011082187.1| PREDICTED: ABC transporter E family member 2 [Sesamum indicum]
Length=606

 Score =   434 bits (1117),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 207/216 (96%), Positives = 212/216 (98%), Gaps = 0/216 (0%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            M+DQ+LTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPA+KIAFISEELCIGCG
Sbjct  1    MADQKLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPASKIAFISEELCIGCG  60

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA
Sbjct  61   ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  120

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            LKVLAGKLKPNLGRF NPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA
Sbjct  121  LKVLAGKLKPNLGRFNNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  180

Query  638  VQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNVG  745
            VQGNVGQVL+QKDERDMK EL VDLELNQV+D NVG
Sbjct  181  VQGNVGQVLEQKDERDMKGELGVDLELNQVMDRNVG  216



>ref|XP_007040863.1| RNAse l inhibitor protein 2 isoform 2 [Theobroma cacao]
 gb|EOY25364.1| RNAse l inhibitor protein 2 isoform 2 [Theobroma cacao]
Length=515

 Score =   430 bits (1105),  Expect = 9e-146, Method: Compositional matrix adjust.
 Identities = 206/216 (95%), Positives = 212/216 (98%), Gaps = 1/216 (0%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            M+D RLTRIAIVSSD+CKPKKCRQECKKSCPVVKTGKLCIEVTPA+KIAFISEELCIGCG
Sbjct  1    MAD-RLTRIAIVSSDRCKPKKCRQECKKSCPVVKTGKLCIEVTPASKIAFISEELCIGCG  59

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            ICVKKCPFEAIQIINLP+DLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA
Sbjct  60   ICVKKCPFEAIQIINLPRDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  119

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            LKVLAGKLKPNLGRF NPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA
Sbjct  120  LKVLAGKLKPNLGRFNNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  179

Query  638  VQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNVG  745
            VQGNVGQVLDQKDER+MK ELCVDLELNQV+D NVG
Sbjct  180  VQGNVGQVLDQKDEREMKSELCVDLELNQVIDRNVG  215



>gb|KJB25122.1| hypothetical protein B456_004G177600 [Gossypium raimondii]
Length=439

 Score =   427 bits (1097),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 205/216 (95%), Positives = 211/216 (98%), Gaps = 1/216 (0%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            M+D RLTRIAIVSSD+CKPKKCRQECKKSCPVVKTGKLCIEVTPA+KIAFISEELCIGCG
Sbjct  1    MAD-RLTRIAIVSSDRCKPKKCRQECKKSCPVVKTGKLCIEVTPASKIAFISEELCIGCG  59

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            ICVKKCPFEAIQIINLP+DLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA
Sbjct  60   ICVKKCPFEAIQIINLPRDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  119

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            LKVLAGKLKPNLGRF NPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA
Sbjct  120  LKVLAGKLKPNLGRFNNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  179

Query  638  VQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNVG  745
            VQGNVGQVLDQKDER+MK ELC DLELNQV+D NVG
Sbjct  180  VQGNVGQVLDQKDEREMKAELCADLELNQVIDRNVG  215



>ref|XP_002271392.1| PREDICTED: ABC transporter E family member 2 [Vitis vinifera]
Length=605

 Score =   432 bits (1112),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 207/216 (96%), Positives = 212/216 (98%), Gaps = 1/216 (0%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            M+D RLTRIAIVSSD+CKPKKCRQECKKSCPVVKTGKLCIEVTPA+KIAFISEELCIGCG
Sbjct  1    MAD-RLTRIAIVSSDRCKPKKCRQECKKSCPVVKTGKLCIEVTPASKIAFISEELCIGCG  59

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA
Sbjct  60   ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  119

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            LKVLAGKLKPNLGRF NPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA
Sbjct  120  LKVLAGKLKPNLGRFNNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  179

Query  638  VQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNVG  745
            VQGNVGQVLDQKDERDMKEELC DL+LNQV+D NVG
Sbjct  180  VQGNVGQVLDQKDERDMKEELCFDLDLNQVIDRNVG  215



>emb|CBI29193.3| unnamed protein product [Vitis vinifera]
Length=625

 Score =   433 bits (1113),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 207/216 (96%), Positives = 212/216 (98%), Gaps = 1/216 (0%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            M+D RLTRIAIVSSD+CKPKKCRQECKKSCPVVKTGKLCIEVTPA+KIAFISEELCIGCG
Sbjct  21   MAD-RLTRIAIVSSDRCKPKKCRQECKKSCPVVKTGKLCIEVTPASKIAFISEELCIGCG  79

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA
Sbjct  80   ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  139

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            LKVLAGKLKPNLGRF NPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA
Sbjct  140  LKVLAGKLKPNLGRFNNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  199

Query  638  VQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNVG  745
            VQGNVGQVLDQKDERDMKEELC DL+LNQV+D NVG
Sbjct  200  VQGNVGQVLDQKDERDMKEELCFDLDLNQVIDRNVG  235



>ref|XP_010915915.1| PREDICTED: ABC transporter E family member 2-like [Elaeis guineensis]
Length=605

 Score =   432 bits (1111),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 206/216 (95%), Positives = 212/216 (98%), Gaps = 1/216 (0%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            M+D RLTRIAIVSSD+CKPKKCRQECKKSCPVVKTGKLCIEVTPA+KIAFISEELCIGCG
Sbjct  1    MAD-RLTRIAIVSSDRCKPKKCRQECKKSCPVVKTGKLCIEVTPASKIAFISEELCIGCG  59

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA
Sbjct  60   ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  119

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            LKVLAGKLKPNLGR+ NPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA
Sbjct  120  LKVLAGKLKPNLGRYNNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  179

Query  638  VQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNVG  745
            VQGNVGQVLDQKDERDMK ELC+DLELNQV+D NVG
Sbjct  180  VQGNVGQVLDQKDERDMKAELCIDLELNQVIDRNVG  215



>ref|XP_008783223.1| PREDICTED: ABC transporter E family member 2-like isoform X3 
[Phoenix dactylifera]
Length=605

 Score =   432 bits (1110),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 206/216 (95%), Positives = 212/216 (98%), Gaps = 1/216 (0%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            M+D RLTRIAIVSSD+CKPKKCRQECKKSCPVVKTGKLCIEVTPA+KIAFISEELCIGCG
Sbjct  1    MAD-RLTRIAIVSSDRCKPKKCRQECKKSCPVVKTGKLCIEVTPASKIAFISEELCIGCG  59

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA
Sbjct  60   ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  119

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            LKVLAGKLKPNLGR+ NPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA
Sbjct  120  LKVLAGKLKPNLGRYNNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  179

Query  638  VQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNVG  745
            VQGNVGQVLDQKDERDMK ELC+DLELNQV+D NVG
Sbjct  180  VQGNVGQVLDQKDERDMKAELCIDLELNQVIDRNVG  215



>ref|XP_007040862.1| RNAse l inhibitor protein 2 isoform 1 [Theobroma cacao]
 gb|EOY25363.1| RNAse l inhibitor protein 2 isoform 1 [Theobroma cacao]
Length=605

 Score =   432 bits (1110),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 206/216 (95%), Positives = 212/216 (98%), Gaps = 1/216 (0%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            M+D RLTRIAIVSSD+CKPKKCRQECKKSCPVVKTGKLCIEVTPA+KIAFISEELCIGCG
Sbjct  1    MAD-RLTRIAIVSSDRCKPKKCRQECKKSCPVVKTGKLCIEVTPASKIAFISEELCIGCG  59

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            ICVKKCPFEAIQIINLP+DLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA
Sbjct  60   ICVKKCPFEAIQIINLPRDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  119

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            LKVLAGKLKPNLGRF NPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA
Sbjct  120  LKVLAGKLKPNLGRFNNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  179

Query  638  VQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNVG  745
            VQGNVGQVLDQKDER+MK ELCVDLELNQV+D NVG
Sbjct  180  VQGNVGQVLDQKDEREMKSELCVDLELNQVIDRNVG  215



>ref|XP_008221272.1| PREDICTED: ABC transporter E family member 2 [Prunus mume]
 ref|XP_008221273.1| PREDICTED: ABC transporter E family member 2 [Prunus mume]
 ref|XP_008221274.1| PREDICTED: ABC transporter E family member 2 [Prunus mume]
Length=605

 Score =   431 bits (1109),  Expect = 5e-145, Method: Compositional matrix adjust.
 Identities = 206/216 (95%), Positives = 212/216 (98%), Gaps = 1/216 (0%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            M+D RLTRIAIVSSD+CKPKKCRQECKKSCPVVKTGKLCIEVTPA+KIAFISEELCIGCG
Sbjct  1    MAD-RLTRIAIVSSDRCKPKKCRQECKKSCPVVKTGKLCIEVTPASKIAFISEELCIGCG  59

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA
Sbjct  60   ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  119

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            LKVLAGKLKPNLGRF NPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA
Sbjct  120  LKVLAGKLKPNLGRFNNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  179

Query  638  VQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNVG  745
            VQGNVG+VL+QKDERDMKEELC DLELNQV+D NVG
Sbjct  180  VQGNVGEVLNQKDERDMKEELCADLELNQVIDRNVG  215



>ref|XP_006430899.1| hypothetical protein CICLE_v10011325mg [Citrus clementina]
 ref|XP_006430900.1| hypothetical protein CICLE_v10011325mg [Citrus clementina]
 ref|XP_006482353.1| PREDICTED: ABC transporter E family member 2-like [Citrus sinensis]
 gb|ESR44139.1| hypothetical protein CICLE_v10011325mg [Citrus clementina]
 gb|ESR44140.1| hypothetical protein CICLE_v10011325mg [Citrus clementina]
Length=605

 Score =   431 bits (1108),  Expect = 6e-145, Method: Compositional matrix adjust.
 Identities = 206/216 (95%), Positives = 211/216 (98%), Gaps = 1/216 (0%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            MSD RLTRIAIVSSD+CKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG
Sbjct  1    MSD-RLTRIAIVSSDRCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  59

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA
Sbjct  60   ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  119

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            LK+LAGKLKPNLGRF NPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA
Sbjct  120  LKILAGKLKPNLGRFNNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  179

Query  638  VQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNVG  745
            VQGNVGQVLDQKDERDMK +LC DL+LNQV+D NVG
Sbjct  180  VQGNVGQVLDQKDERDMKADLCADLDLNQVIDRNVG  215



>gb|KDO72263.1| hypothetical protein CISIN_1g040300mg [Citrus sinensis]
Length=605

 Score =   431 bits (1108),  Expect = 6e-145, Method: Compositional matrix adjust.
 Identities = 206/216 (95%), Positives = 211/216 (98%), Gaps = 1/216 (0%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            MSD RLTRIAIVSSD+CKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG
Sbjct  1    MSD-RLTRIAIVSSDRCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  59

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA
Sbjct  60   ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  119

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            LK+LAGKLKPNLGRF NPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA
Sbjct  120  LKILAGKLKPNLGRFNNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  179

Query  638  VQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNVG  745
            VQGNVGQVLDQKDERDMK +LC DL+LNQV+D NVG
Sbjct  180  VQGNVGQVLDQKDERDMKADLCTDLDLNQVIDRNVG  215



>ref|XP_007222049.1| hypothetical protein PRUPE_ppa003094mg [Prunus persica]
 gb|EMJ23248.1| hypothetical protein PRUPE_ppa003094mg [Prunus persica]
Length=605

 Score =   431 bits (1107),  Expect = 7e-145, Method: Compositional matrix adjust.
 Identities = 206/216 (95%), Positives = 211/216 (98%), Gaps = 1/216 (0%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            M+D RLTRIAIVSSD+CKPKKCRQECKKSCPVVKTGKLCIEVTPA+KIAFISEELCIGCG
Sbjct  1    MAD-RLTRIAIVSSDRCKPKKCRQECKKSCPVVKTGKLCIEVTPASKIAFISEELCIGCG  59

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA
Sbjct  60   ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  119

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            LKVLAGKLKPNLGRF NPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA
Sbjct  120  LKVLAGKLKPNLGRFNNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  179

Query  638  VQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNVG  745
            VQGNVG+VL QKDERDMKEELC DLELNQV+D NVG
Sbjct  180  VQGNVGEVLSQKDERDMKEELCADLELNQVIDRNVG  215



>ref|XP_008387873.1| PREDICTED: ABC transporter E family member 2 isoform X1 [Malus 
domestica]
Length=622

 Score =   431 bits (1109),  Expect = 8e-145, Method: Compositional matrix adjust.
 Identities = 206/216 (95%), Positives = 213/216 (99%), Gaps = 1/216 (0%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            M+D RLTRIAIVSSD+CKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG
Sbjct  1    MAD-RLTRIAIVSSDRCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  59

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            ICVKKCPFEAIQIINLPKDL+KDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA
Sbjct  60   ICVKKCPFEAIQIINLPKDLNKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  119

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA
Sbjct  120  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  179

Query  638  VQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNVG  745
            VQGNVG+VL+QKDERDMKEELC DLELNQV++ NVG
Sbjct  180  VQGNVGEVLNQKDERDMKEELCADLELNQVIERNVG  215



>ref|XP_006430901.1| hypothetical protein CICLE_v10011325mg [Citrus clementina]
 gb|ESR44141.1| hypothetical protein CICLE_v10011325mg [Citrus clementina]
Length=583

 Score =   430 bits (1105),  Expect = 9e-145, Method: Compositional matrix adjust.
 Identities = 206/216 (95%), Positives = 211/216 (98%), Gaps = 1/216 (0%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            MSD RLTRIAIVSSD+CKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG
Sbjct  1    MSD-RLTRIAIVSSDRCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  59

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA
Sbjct  60   ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  119

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            LK+LAGKLKPNLGRF NPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA
Sbjct  120  LKILAGKLKPNLGRFNNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  179

Query  638  VQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNVG  745
            VQGNVGQVLDQKDERDMK +LC DL+LNQV+D NVG
Sbjct  180  VQGNVGQVLDQKDERDMKADLCADLDLNQVIDRNVG  215



>ref|XP_004150248.1| PREDICTED: ABC transporter E family member 2-like [Cucumis sativus]
 ref|XP_004162070.1| PREDICTED: ABC transporter E family member 2-like [Cucumis sativus]
 gb|KGN54000.1| hypothetical protein Csa_4G252930 [Cucumis sativus]
Length=605

 Score =   431 bits (1107),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 207/216 (96%), Positives = 212/216 (98%), Gaps = 1/216 (0%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            M+D RLTRIAIVSSD+CKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG
Sbjct  1    MAD-RLTRIAIVSSDRCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  59

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA
Sbjct  60   ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  119

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            LKVLAGKLKPNLGRF NPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA
Sbjct  120  LKVLAGKLKPNLGRFNNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  179

Query  638  VQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNVG  745
            VQGNVGQVL+QKDERDMK+ELC DLELNQV+D NVG
Sbjct  180  VQGNVGQVLEQKDERDMKQELCHDLELNQVIDRNVG  215



>ref|XP_010925920.1| PREDICTED: ABC transporter E family member 2-like isoform X1 
[Elaeis guineensis]
 ref|XP_010925921.1| PREDICTED: ABC transporter E family member 2-like isoform X1 
[Elaeis guineensis]
Length=605

 Score =   431 bits (1107),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 205/216 (95%), Positives = 212/216 (98%), Gaps = 1/216 (0%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            M+D RLTRIAIVSSD+CKPKKCRQECKKSCPVVKTGKLCIEVTPA+KIAFISEELCIGCG
Sbjct  1    MAD-RLTRIAIVSSDRCKPKKCRQECKKSCPVVKTGKLCIEVTPASKIAFISEELCIGCG  59

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA
Sbjct  60   ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  119

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            LKVLAGKLKPNLGR+ NPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA
Sbjct  120  LKVLAGKLKPNLGRYNNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  179

Query  638  VQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNVG  745
            VQGNVGQVLDQKDERDMK +LC+DLELNQV+D NVG
Sbjct  180  VQGNVGQVLDQKDERDMKAKLCIDLELNQVIDRNVG  215



>gb|KJB25123.1| hypothetical protein B456_004G177600 [Gossypium raimondii]
Length=573

 Score =   429 bits (1104),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 205/216 (95%), Positives = 211/216 (98%), Gaps = 1/216 (0%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            M+D RLTRIAIVSSD+CKPKKCRQECKKSCPVVKTGKLCIEVTPA+KIAFISEELCIGCG
Sbjct  1    MAD-RLTRIAIVSSDRCKPKKCRQECKKSCPVVKTGKLCIEVTPASKIAFISEELCIGCG  59

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            ICVKKCPFEAIQIINLP+DLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA
Sbjct  60   ICVKKCPFEAIQIINLPRDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  119

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            LKVLAGKLKPNLGRF NPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA
Sbjct  120  LKVLAGKLKPNLGRFNNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  179

Query  638  VQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNVG  745
            VQGNVGQVLDQKDER+MK ELC DLELNQV+D NVG
Sbjct  180  VQGNVGQVLDQKDEREMKAELCADLELNQVIDRNVG  215



>ref|XP_008387874.1| PREDICTED: ABC transporter E family member 2 isoform X2 [Malus 
domestica]
Length=605

 Score =   430 bits (1106),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 206/216 (95%), Positives = 213/216 (99%), Gaps = 1/216 (0%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            M+D RLTRIAIVSSD+CKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG
Sbjct  1    MAD-RLTRIAIVSSDRCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  59

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            ICVKKCPFEAIQIINLPKDL+KDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA
Sbjct  60   ICVKKCPFEAIQIINLPKDLNKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  119

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA
Sbjct  120  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  179

Query  638  VQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNVG  745
            VQGNVG+VL+QKDERDMKEELC DLELNQV++ NVG
Sbjct  180  VQGNVGEVLNQKDERDMKEELCADLELNQVIERNVG  215



>ref|XP_010272250.1| PREDICTED: ABC transporter E family member 2 [Nelumbo nucifera]
 ref|XP_010272251.1| PREDICTED: ABC transporter E family member 2 [Nelumbo nucifera]
Length=605

 Score =   430 bits (1105),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 206/216 (95%), Positives = 212/216 (98%), Gaps = 1/216 (0%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            M+D RLTRIAIVSSD+CKPKKCRQECKKSCPVVKTGKLCIEVTPA+KIAFISEELCIGCG
Sbjct  1    MAD-RLTRIAIVSSDRCKPKKCRQECKKSCPVVKTGKLCIEVTPASKIAFISEELCIGCG  59

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA
Sbjct  60   ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  119

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            LKVLAGKLKPNLGRF NPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA
Sbjct  120  LKVLAGKLKPNLGRFNNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  179

Query  638  VQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNVG  745
            VQGNVGQVLDQKDER+MK ELC+DLELNQV+D NVG
Sbjct  180  VQGNVGQVLDQKDEREMKAELCLDLELNQVIDRNVG  215



>gb|KJB25124.1| hypothetical protein B456_004G177600 [Gossypium raimondii]
Length=588

 Score =   429 bits (1103),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 205/216 (95%), Positives = 211/216 (98%), Gaps = 1/216 (0%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            M+D RLTRIAIVSSD+CKPKKCRQECKKSCPVVKTGKLCIEVTPA+KIAFISEELCIGCG
Sbjct  1    MAD-RLTRIAIVSSDRCKPKKCRQECKKSCPVVKTGKLCIEVTPASKIAFISEELCIGCG  59

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            ICVKKCPFEAIQIINLP+DLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA
Sbjct  60   ICVKKCPFEAIQIINLPRDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  119

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            LKVLAGKLKPNLGRF NPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA
Sbjct  120  LKVLAGKLKPNLGRFNNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  179

Query  638  VQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNVG  745
            VQGNVGQVLDQKDER+MK ELC DLELNQV+D NVG
Sbjct  180  VQGNVGQVLDQKDEREMKAELCADLELNQVIDRNVG  215



>gb|KJB25125.1| hypothetical protein B456_004G177600 [Gossypium raimondii]
Length=614

 Score =   430 bits (1105),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 205/216 (95%), Positives = 211/216 (98%), Gaps = 1/216 (0%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            M+D RLTRIAIVSSD+CKPKKCRQECKKSCPVVKTGKLCIEVTPA+KIAFISEELCIGCG
Sbjct  1    MAD-RLTRIAIVSSDRCKPKKCRQECKKSCPVVKTGKLCIEVTPASKIAFISEELCIGCG  59

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            ICVKKCPFEAIQIINLP+DLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA
Sbjct  60   ICVKKCPFEAIQIINLPRDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  119

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            LKVLAGKLKPNLGRF NPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA
Sbjct  120  LKVLAGKLKPNLGRFNNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  179

Query  638  VQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNVG  745
            VQGNVGQVLDQKDER+MK ELC DLELNQV+D NVG
Sbjct  180  VQGNVGQVLDQKDEREMKAELCADLELNQVIDRNVG  215



>gb|KJB25121.1| hypothetical protein B456_004G177600 [Gossypium raimondii]
Length=605

 Score =   429 bits (1104),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 205/216 (95%), Positives = 211/216 (98%), Gaps = 1/216 (0%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            M+D RLTRIAIVSSD+CKPKKCRQECKKSCPVVKTGKLCIEVTPA+KIAFISEELCIGCG
Sbjct  1    MAD-RLTRIAIVSSDRCKPKKCRQECKKSCPVVKTGKLCIEVTPASKIAFISEELCIGCG  59

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            ICVKKCPFEAIQIINLP+DLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA
Sbjct  60   ICVKKCPFEAIQIINLPRDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  119

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            LKVLAGKLKPNLGRF NPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA
Sbjct  120  LKVLAGKLKPNLGRFNNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  179

Query  638  VQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNVG  745
            VQGNVGQVLDQKDER+MK ELC DLELNQV+D NVG
Sbjct  180  VQGNVGQVLDQKDEREMKAELCADLELNQVIDRNVG  215



>ref|XP_010536040.1| PREDICTED: ABC transporter E family member 2 [Tarenaya hassleriana]
 ref|XP_010536048.1| PREDICTED: ABC transporter E family member 2 [Tarenaya hassleriana]
Length=605

 Score =   429 bits (1104),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 203/216 (94%), Positives = 212/216 (98%), Gaps = 1/216 (0%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            M+D RLTRIAIVSSD+CKPKKCRQEC+KSCPVVKTGKLCIEVTPA+KIAFISEELCIGCG
Sbjct  1    MAD-RLTRIAIVSSDRCKPKKCRQECRKSCPVVKTGKLCIEVTPASKIAFISEELCIGCG  59

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            ICVKKCPFEAIQIINLP+DLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA
Sbjct  60   ICVKKCPFEAIQIINLPRDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  119

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            LK+LAGKLKPNLGRF NPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIP+A
Sbjct  120  LKILAGKLKPNLGRFSNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPRA  179

Query  638  VQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNVG  745
            VQGNVGQVLDQKDERDMK+ELC DLELNQV+D NVG
Sbjct  180  VQGNVGQVLDQKDERDMKKELCRDLELNQVIDRNVG  215



>ref|XP_008444234.1| PREDICTED: ABC transporter E family member 2 [Cucumis melo]
 ref|XP_008444235.1| PREDICTED: ABC transporter E family member 2 [Cucumis melo]
Length=605

 Score =   429 bits (1104),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 206/216 (95%), Positives = 212/216 (98%), Gaps = 1/216 (0%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            M+D RLTRIAIVSSD+CKPKKCRQECKKSCPVVKTGKLCIEVTPA+KIAFISEELCIGCG
Sbjct  1    MAD-RLTRIAIVSSDRCKPKKCRQECKKSCPVVKTGKLCIEVTPASKIAFISEELCIGCG  59

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA
Sbjct  60   ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  119

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            LKVLAGKLKPNLGRF NPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA
Sbjct  120  LKVLAGKLKPNLGRFNNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  179

Query  638  VQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNVG  745
            VQGNVGQVL+QKDERDMK+ELC DLELNQV+D NVG
Sbjct  180  VQGNVGQVLEQKDERDMKQELCHDLELNQVIDRNVG  215



>ref|XP_009409466.1| PREDICTED: ABC transporter E family member 2-like isoform X1 
[Musa acuminata subsp. malaccensis]
Length=605

 Score =   429 bits (1103),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 206/216 (95%), Positives = 211/216 (98%), Gaps = 1/216 (0%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            M+D RLTRIAIVSSD+CKPKKCRQECKKSCPVVKTGKLCIEVTPA+KIAFISEELCIGCG
Sbjct  1    MAD-RLTRIAIVSSDRCKPKKCRQECKKSCPVVKTGKLCIEVTPASKIAFISEELCIGCG  59

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA
Sbjct  60   ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  119

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            LKVLAGKLKPNLGRF NPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA
Sbjct  120  LKVLAGKLKPNLGRFNNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  179

Query  638  VQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNVG  745
            VQGNVGQVLDQKDER+MK ELC DLELNQV+D NVG
Sbjct  180  VQGNVGQVLDQKDEREMKAELCNDLELNQVIDRNVG  215



>gb|AIU41641.1| ABC transporter family protein [Hevea brasiliensis]
Length=605

 Score =   429 bits (1102),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 206/216 (95%), Positives = 211/216 (98%), Gaps = 1/216 (0%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            M+D RLTRIAIVSSD+CKPKKCRQECKKSCPVVKTGKLCIEVTPA+KIAFISEELCIGCG
Sbjct  1    MAD-RLTRIAIVSSDRCKPKKCRQECKKSCPVVKTGKLCIEVTPASKIAFISEELCIGCG  59

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA
Sbjct  60   ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  119

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            LKVLAGKLKPNLGRF NPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA
Sbjct  120  LKVLAGKLKPNLGRFNNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  179

Query  638  VQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNVG  745
            VQGNVGQVLDQKDER+MK ELC DLELNQV+D NVG
Sbjct  180  VQGNVGQVLDQKDEREMKAELCDDLELNQVIDRNVG  215



>ref|XP_006858622.1| hypothetical protein AMTR_s00066p00025940 [Amborella trichopoda]
 gb|ERN20089.1| hypothetical protein AMTR_s00066p00025940 [Amborella trichopoda]
Length=606

 Score =   429 bits (1102),  Expect = 6e-144, Method: Compositional matrix adjust.
 Identities = 202/216 (94%), Positives = 212/216 (98%), Gaps = 0/216 (0%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            M+DQRLTRIAIV+SD+CKPKKCRQECKKSCPVVKTGKLCIEV+PA+KIA+ISEELCIGCG
Sbjct  1    MADQRLTRIAIVNSDRCKPKKCRQECKKSCPVVKTGKLCIEVSPASKIAYISEELCIGCG  60

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            ICVKKCPF+AIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA
Sbjct  61   ICVKKCPFDAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  120

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            LKVLAGKLKPNLGR+ NPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA
Sbjct  121  LKVLAGKLKPNLGRYNNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  180

Query  638  VQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNVG  745
            VQGNVGQVLDQKDER+MK ELC DLELNQV+D NVG
Sbjct  181  VQGNVGQVLDQKDEREMKAELCHDLELNQVIDRNVG  216



>ref|XP_010099717.1| ABC transporter E family member 2 [Morus notabilis]
 gb|EXB80294.1| ABC transporter E family member 2 [Morus notabilis]
Length=605

 Score =   428 bits (1100),  Expect = 9e-144, Method: Compositional matrix adjust.
 Identities = 205/216 (95%), Positives = 211/216 (98%), Gaps = 1/216 (0%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            M+D RLTRIAIVSSD+CKPKKCRQECKKSCPVVKTGKLCIEVTPA+KIAFISEELCIGCG
Sbjct  1    MAD-RLTRIAIVSSDRCKPKKCRQECKKSCPVVKTGKLCIEVTPASKIAFISEELCIGCG  59

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA
Sbjct  60   ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  119

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            LKVLAGKLKPNLGRF NPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA
Sbjct  120  LKVLAGKLKPNLGRFNNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  179

Query  638  VQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNVG  745
            VQGNVGQVLDQKDER++K ELC DLELNQV+D NVG
Sbjct  180  VQGNVGQVLDQKDEREVKSELCADLELNQVIDRNVG  215



>ref|XP_003577489.1| PREDICTED: ABC transporter E family member 2 [Brachypodium distachyon]
Length=604

 Score =   428 bits (1100),  Expect = 9e-144, Method: Compositional matrix adjust.
 Identities = 204/216 (94%), Positives = 212/216 (98%), Gaps = 1/216 (0%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            M+D RLTRIAIVS DKCKPKKCRQECKKSCPVVKTGKLCIEV+PAAK+AFISEELCIGCG
Sbjct  1    MAD-RLTRIAIVSEDKCKPKKCRQECKKSCPVVKTGKLCIEVSPAAKLAFISEELCIGCG  59

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            ICVKKCPF+AI+IINLPKDL+KDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA
Sbjct  60   ICVKKCPFDAIEIINLPKDLEKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  119

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA
Sbjct  120  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  179

Query  638  VQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNVG  745
            VQGNVGQVL+QKDERDMK ELCVDLELNQV+D NVG
Sbjct  180  VQGNVGQVLEQKDERDMKNELCVDLELNQVIDRNVG  215



>gb|KDP42075.1| hypothetical protein JCGZ_01863 [Jatropha curcas]
Length=605

 Score =   427 bits (1099),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 205/216 (95%), Positives = 211/216 (98%), Gaps = 1/216 (0%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            M+D RLTRIAIVSSD+CKPKKCRQECKKSCPVVKTGKLCIEVTPA+KIAFISEELCIGCG
Sbjct  1    MAD-RLTRIAIVSSDRCKPKKCRQECKKSCPVVKTGKLCIEVTPASKIAFISEELCIGCG  59

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA
Sbjct  60   ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  119

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            LKVLAGKLKPNLGRF NPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA
Sbjct  120  LKVLAGKLKPNLGRFNNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  179

Query  638  VQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNVG  745
            VQGNVGQVLDQKDER+MK +LC DLELNQV+D NVG
Sbjct  180  VQGNVGQVLDQKDEREMKADLCRDLELNQVIDRNVG  215



>dbj|BAJ90466.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ91099.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ86517.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=604

 Score =   427 bits (1099),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 204/216 (94%), Positives = 212/216 (98%), Gaps = 1/216 (0%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            M+D RLTRIAIVS DKCKPKKCRQECKKSCPVVKTGKLCIEV+PAAK+AFISEELCIGCG
Sbjct  1    MAD-RLTRIAIVSEDKCKPKKCRQECKKSCPVVKTGKLCIEVSPAAKLAFISEELCIGCG  59

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            ICVKKCPF+AI+IINLPKDL+KDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA
Sbjct  60   ICVKKCPFDAIEIINLPKDLEKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  119

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA
Sbjct  120  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  179

Query  638  VQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNVG  745
            VQGNVGQVL+QKDERDMK ELCVDLELNQV+D NVG
Sbjct  180  VQGNVGQVLEQKDERDMKNELCVDLELNQVIDRNVG  215



>ref|XP_011028506.1| PREDICTED: ABC transporter E family member 2 [Populus euphratica]
Length=605

 Score =   427 bits (1099),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 205/216 (95%), Positives = 210/216 (97%), Gaps = 1/216 (0%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            MSD RLTRIAIV+SD+CKPKKCRQECKKSCPVVKTGKLCIEVTPA+KIAFISEELCIGCG
Sbjct  1    MSD-RLTRIAIVTSDRCKPKKCRQECKKSCPVVKTGKLCIEVTPASKIAFISEELCIGCG  59

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA
Sbjct  60   ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  119

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            LKVLAGKLKPNLGRF NPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIP+A
Sbjct  120  LKVLAGKLKPNLGRFNNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPRA  179

Query  638  VQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNVG  745
            VQGNVGQVLDQKDERD K ELC DLELNQV+D NVG
Sbjct  180  VQGNVGQVLDQKDERDKKAELCRDLELNQVIDRNVG  215



>ref|XP_008801480.1| PREDICTED: ABC transporter E family member 2 [Phoenix dactylifera]
 ref|XP_008801482.1| PREDICTED: ABC transporter E family member 2 [Phoenix dactylifera]
 ref|XP_008801483.1| PREDICTED: ABC transporter E family member 2 [Phoenix dactylifera]
 ref|XP_008801484.1| PREDICTED: ABC transporter E family member 2 [Phoenix dactylifera]
Length=605

 Score =   427 bits (1097),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 204/216 (94%), Positives = 210/216 (97%), Gaps = 1/216 (0%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            M+D RLTRIAIVSSD+CKPKKCRQECKKSCPVVKTGKLCIEVTPA+KIAFISEELCIGCG
Sbjct  1    MAD-RLTRIAIVSSDRCKPKKCRQECKKSCPVVKTGKLCIEVTPASKIAFISEELCIGCG  59

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            ICVKKCPFEAIQIINLPKDL KDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA
Sbjct  60   ICVKKCPFEAIQIINLPKDLAKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  119

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            LKVLAGKLKPNLGR+ NPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA
Sbjct  120  LKVLAGKLKPNLGRYNNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  179

Query  638  VQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNVG  745
            VQGNVGQVLDQKDER+MK ELC DLELNQV+D NVG
Sbjct  180  VQGNVGQVLDQKDEREMKAELCADLELNQVIDRNVG  215



>ref|XP_009409469.1| PREDICTED: ABC transporter E family member 2-like [Musa acuminata 
subsp. malaccensis]
Length=605

 Score =   426 bits (1095),  Expect = 6e-143, Method: Compositional matrix adjust.
 Identities = 205/216 (95%), Positives = 210/216 (97%), Gaps = 1/216 (0%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            M+D RLTRIAIVSSD+CKPKKCRQECKKSCPVVKTGKLCIEVTPA+KIAFISEELCIGCG
Sbjct  1    MAD-RLTRIAIVSSDRCKPKKCRQECKKSCPVVKTGKLCIEVTPASKIAFISEELCIGCG  59

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA
Sbjct  60   ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  119

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            LKVLAGKLKPNLGRF NPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA
Sbjct  120  LKVLAGKLKPNLGRFNNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  179

Query  638  VQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNVG  745
            VQGNVGQVLDQKDER+MK ELC  LELNQV+D NVG
Sbjct  180  VQGNVGQVLDQKDEREMKAELCNGLELNQVIDRNVG  215



>gb|AAL26702.1| 68 kDa protein HP68 [Triticum aestivum]
Length=604

 Score =   426 bits (1095),  Expect = 6e-143, Method: Compositional matrix adjust.
 Identities = 203/216 (94%), Positives = 211/216 (98%), Gaps = 1/216 (0%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            M+D RLTRIAIVS DKCKPKKCRQECKKSCPVVKTGKLCIEV+P AK+AFISEELCIGCG
Sbjct  1    MAD-RLTRIAIVSEDKCKPKKCRQECKKSCPVVKTGKLCIEVSPVAKLAFISEELCIGCG  59

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            ICVKKCPF+AI+IINLPKDL+KDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA
Sbjct  60   ICVKKCPFDAIEIINLPKDLEKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  119

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA
Sbjct  120  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  179

Query  638  VQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNVG  745
            VQGNVGQVL+QKDERDMK ELCVDLELNQV+D NVG
Sbjct  180  VQGNVGQVLEQKDERDMKNELCVDLELNQVIDRNVG  215



>ref|XP_010275149.1| PREDICTED: ABC transporter E family member 2-like [Nelumbo nucifera]
 ref|XP_010275150.1| PREDICTED: ABC transporter E family member 2-like [Nelumbo nucifera]
 ref|XP_010275151.1| PREDICTED: ABC transporter E family member 2-like [Nelumbo nucifera]
Length=605

 Score =   426 bits (1094),  Expect = 7e-143, Method: Compositional matrix adjust.
 Identities = 204/216 (94%), Positives = 211/216 (98%), Gaps = 1/216 (0%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            M+D RLTRIAIVSSD+CKPKKCRQECKKSCPVVKTGKLCIEVTPA+KIAFISEELCIGCG
Sbjct  1    MAD-RLTRIAIVSSDRCKPKKCRQECKKSCPVVKTGKLCIEVTPASKIAFISEELCIGCG  59

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA
Sbjct  60   ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  119

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            LKVLAGKLKPNLGRF NPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA
Sbjct  120  LKVLAGKLKPNLGRFNNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  179

Query  638  VQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNVG  745
            VQGNVGQVLDQKDER+MK ELC +L+LNQV+D NVG
Sbjct  180  VQGNVGQVLDQKDEREMKSELCEELDLNQVIDRNVG  215



>ref|XP_010323314.1| PREDICTED: ABC transporter E family member 2 [Solanum lycopersicum]
 ref|XP_010323315.1| PREDICTED: ABC transporter E family member 2 [Solanum lycopersicum]
Length=605

 Score =   426 bits (1094),  Expect = 9e-143, Method: Compositional matrix adjust.
 Identities = 206/216 (95%), Positives = 210/216 (97%), Gaps = 1/216 (0%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            MSD RLTRIAIVS DKCKPKKCRQECKKSCPVVKTGKLCIEVT  +KIAFISEELCIGCG
Sbjct  1    MSD-RLTRIAIVSDDKCKPKKCRQECKKSCPVVKTGKLCIEVTVGSKIAFISEELCIGCG  59

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA
Sbjct  60   ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  119

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            LKVLAGKLKPNLGRF NPPDWQEILT+FRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA
Sbjct  120  LKVLAGKLKPNLGRFTNPPDWQEILTHFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  179

Query  638  VQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNVG  745
            VQGNVGQVLDQKDERD+KE+LCVDLELNQVLD NVG
Sbjct  180  VQGNVGQVLDQKDERDVKEKLCVDLELNQVLDRNVG  215



>gb|EPS64099.1| hypothetical protein M569_10682, partial [Genlisea aurea]
Length=608

 Score =   426 bits (1094),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 203/216 (94%), Positives = 210/216 (97%), Gaps = 0/216 (0%)
 Frame = +2

Query  95   EMSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGC  274
            +M+DQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVT A KIAFISEELCIGC
Sbjct  2    KMADQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTAADKIAFISEELCIGC  61

Query  275  GICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKST  454
            GICVKKCPFEAIQIINLPKDL+KDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKST
Sbjct  62   GICVKKCPFEAIQIINLPKDLEKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKST  121

Query  455  ALKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPK  634
            ALKVLAGKLKPNLGRF NPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPK
Sbjct  122  ALKVLAGKLKPNLGRFNNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPK  181

Query  635  AVQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNV  742
            AVQGNVGQVL QKDER+MKEEL VDL+LNQV+D +V
Sbjct  182  AVQGNVGQVLSQKDERNMKEELGVDLQLNQVMDRSV  217



>ref|XP_010529268.1| PREDICTED: ABC transporter E family member 2-like [Tarenaya hassleriana]
Length=605

 Score =   425 bits (1093),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 201/216 (93%), Positives = 211/216 (98%), Gaps = 1/216 (0%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            M+D RLTRIAIVSSD+CKPKKCRQEC+KSCPVVKTGKLCIEVTPA+KIAFISEELCIGCG
Sbjct  1    MAD-RLTRIAIVSSDRCKPKKCRQECRKSCPVVKTGKLCIEVTPASKIAFISEELCIGCG  59

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            ICVKKCPFEAIQIINLP+DLDKDTTHRYGPN FKLHRLPVPRPGQVLGLVGTNGIGKSTA
Sbjct  60   ICVKKCPFEAIQIINLPRDLDKDTTHRYGPNAFKLHRLPVPRPGQVLGLVGTNGIGKSTA  119

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            LK+LAGKLKPNLGRF NPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIP+A
Sbjct  120  LKILAGKLKPNLGRFNNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPRA  179

Query  638  VQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNVG  745
            VQGNVGQVLDQKDER+MK+ELC DLELNQV+D NVG
Sbjct  180  VQGNVGQVLDQKDEREMKKELCHDLELNQVIDRNVG  215



>ref|XP_008655346.1| PREDICTED: ABC transporter E family member 2 isoform X1 [Zea 
mays]
 tpg|DAA45212.1| TPA: hypothetical protein ZEAMMB73_266266 [Zea mays]
 tpg|DAA45213.1| TPA: hypothetical protein ZEAMMB73_266266 [Zea mays]
Length=604

 Score =   425 bits (1093),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 201/213 (94%), Positives = 209/213 (98%), Gaps = 0/213 (0%)
 Frame = +2

Query  107  QRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCGICV  286
            +RLTRIAIVS DKCKPKKCRQECKKSCPVVKTGKLCIEVT A+K+AFISEELCIGCGICV
Sbjct  3    ERLTRIAIVSEDKCKPKKCRQECKKSCPVVKTGKLCIEVTSASKLAFISEELCIGCGICV  62

Query  287  KKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTALKV  466
            KKCPF+AI+IINLPKDL+KDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTALKV
Sbjct  63   KKCPFDAIEIINLPKDLEKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTALKV  122

Query  467  LAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKAVQG  646
            LAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKAVQG
Sbjct  123  LAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKAVQG  182

Query  647  NVGQVLDQKDERDMKEELCVDLELNQVLDHNVG  745
            NVGQVL+QKDERDMK ELCVDLELNQV+D NVG
Sbjct  183  NVGQVLEQKDERDMKSELCVDLELNQVIDRNVG  215



>ref|XP_009380578.1| PREDICTED: ABC transporter E family member 2 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009380579.1| PREDICTED: ABC transporter E family member 2 [Musa acuminata 
subsp. malaccensis]
Length=605

 Score =   425 bits (1093),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 203/216 (94%), Positives = 210/216 (97%), Gaps = 1/216 (0%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            M+D RLTRIAIVSSD+CKPKKCRQECKKSCPVVKTGKLCIEVTPA+K+AFISEELCIGCG
Sbjct  1    MAD-RLTRIAIVSSDRCKPKKCRQECKKSCPVVKTGKLCIEVTPASKLAFISEELCIGCG  59

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA
Sbjct  60   ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  119

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            LKVLAGKLKPNLGRF NPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA
Sbjct  120  LKVLAGKLKPNLGRFNNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  179

Query  638  VQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNVG  745
            VQGNVGQVLDQKDER+ K +LC DLELNQV+D NVG
Sbjct  180  VQGNVGQVLDQKDEREKKAQLCADLELNQVIDRNVG  215



>ref|XP_008660181.1| PREDICTED: ABC transporter E family member 2-like [Zea mays]
 gb|AFW88470.1| hypothetical protein ZEAMMB73_854523 [Zea mays]
Length=604

 Score =   425 bits (1092),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 201/213 (94%), Positives = 209/213 (98%), Gaps = 0/213 (0%)
 Frame = +2

Query  107  QRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCGICV  286
            +RLTRIAIVS DKCKPKKCRQECKKSCPVVKTGKLCIEVT A+K+AFISEELCIGCGICV
Sbjct  3    ERLTRIAIVSEDKCKPKKCRQECKKSCPVVKTGKLCIEVTSASKLAFISEELCIGCGICV  62

Query  287  KKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTALKV  466
            KKCPF+AI+IINLPKDL+KDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTALKV
Sbjct  63   KKCPFDAIEIINLPKDLEKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTALKV  122

Query  467  LAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKAVQG  646
            LAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKAVQG
Sbjct  123  LAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKAVQG  182

Query  647  NVGQVLDQKDERDMKEELCVDLELNQVLDHNVG  745
            NVGQVL+QKDERDMK ELCVDLELNQV+D NVG
Sbjct  183  NVGQVLEQKDERDMKAELCVDLELNQVIDRNVG  215



>ref|XP_002468219.1| hypothetical protein SORBIDRAFT_01g042020 [Sorghum bicolor]
 gb|EER95217.1| hypothetical protein SORBIDRAFT_01g042020 [Sorghum bicolor]
Length=604

 Score =   425 bits (1092),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 201/213 (94%), Positives = 209/213 (98%), Gaps = 0/213 (0%)
 Frame = +2

Query  107  QRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCGICV  286
            +RLTRIAIVS DKCKPKKCRQECKKSCPVVKTGKLCIEVT A+K+AFISEELCIGCGICV
Sbjct  3    ERLTRIAIVSEDKCKPKKCRQECKKSCPVVKTGKLCIEVTSASKLAFISEELCIGCGICV  62

Query  287  KKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTALKV  466
            KKCPF+AI+IINLPKDL+KDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTALKV
Sbjct  63   KKCPFDAIEIINLPKDLEKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTALKV  122

Query  467  LAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKAVQG  646
            LAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKAVQG
Sbjct  123  LAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKAVQG  182

Query  647  NVGQVLDQKDERDMKEELCVDLELNQVLDHNVG  745
            NVGQVL+QKDERDMK ELCVDLELNQV+D NVG
Sbjct  183  NVGQVLEQKDERDMKAELCVDLELNQVIDRNVG  215



>ref|XP_004979432.1| PREDICTED: ABC transporter E family member 2-like [Setaria italica]
Length=604

 Score =   425 bits (1092),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 201/213 (94%), Positives = 209/213 (98%), Gaps = 0/213 (0%)
 Frame = +2

Query  107  QRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCGICV  286
            +RLTRIAIVS DKCKPKKCRQECKKSCPVVKTGKLCIEVT A+K+AFISEELCIGCGICV
Sbjct  3    ERLTRIAIVSEDKCKPKKCRQECKKSCPVVKTGKLCIEVTSASKLAFISEELCIGCGICV  62

Query  287  KKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTALKV  466
            KKCPF+AI+IINLPKDL+KDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTALKV
Sbjct  63   KKCPFDAIEIINLPKDLEKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTALKV  122

Query  467  LAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKAVQG  646
            LAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKAVQG
Sbjct  123  LAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKAVQG  182

Query  647  NVGQVLDQKDERDMKEELCVDLELNQVLDHNVG  745
            NVGQVL+QKDERDMK ELCVDLELNQV+D NVG
Sbjct  183  NVGQVLEQKDERDMKAELCVDLELNQVIDRNVG  215



>ref|XP_010917851.1| PREDICTED: ABC transporter E family member 2 [Elaeis guineensis]
Length=605

 Score =   425 bits (1092),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 203/216 (94%), Positives = 210/216 (97%), Gaps = 1/216 (0%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            M+D RLTRIAIVSSD+CKPKKCRQECKKSCPVVKTGKLCIEVTPA+KIAFISEELCIGCG
Sbjct  1    MAD-RLTRIAIVSSDRCKPKKCRQECKKSCPVVKTGKLCIEVTPASKIAFISEELCIGCG  59

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA
Sbjct  60   ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  119

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            LKVLAGKLKPNLGR+ NPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA
Sbjct  120  LKVLAGKLKPNLGRYDNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  179

Query  638  VQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNVG  745
            VQGNVGQVLDQKDER+MK ELC DL+LN V+D NVG
Sbjct  180  VQGNVGQVLDQKDEREMKAELCADLDLNLVIDRNVG  215



>gb|ABR18176.1| unknown [Picea sitchensis]
Length=605

 Score =   424 bits (1091),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 203/216 (94%), Positives = 210/216 (97%), Gaps = 1/216 (0%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            MSD RLTRIAIVSSD+CKPKKCRQECKKSCPVVKTGKLCIEV+ A+KIAFISEELCIGCG
Sbjct  1    MSD-RLTRIAIVSSDRCKPKKCRQECKKSCPVVKTGKLCIEVSSASKIAFISEELCIGCG  59

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA
Sbjct  60   ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  119

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            LKVLAGKLKPNLGRF NPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA
Sbjct  120  LKVLAGKLKPNLGRFHNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  179

Query  638  VQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNVG  745
            VQGNVGQVL+QKDERD+K ELC DL+LNQV+D NVG
Sbjct  180  VQGNVGQVLEQKDERDIKSELCTDLDLNQVMDRNVG  215



>ref|XP_010054013.1| PREDICTED: ABC transporter E family member 2 [Eucalyptus grandis]
 gb|KCW78398.1| hypothetical protein EUGRSUZ_D02563 [Eucalyptus grandis]
Length=605

 Score =   424 bits (1091),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 204/216 (94%), Positives = 210/216 (97%), Gaps = 1/216 (0%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            M+D RLTRIAIVSSD+CKPKKCRQECKKSCPVVKTGKLCIEVT  ++IAFISEELCIGCG
Sbjct  1    MAD-RLTRIAIVSSDRCKPKKCRQECKKSCPVVKTGKLCIEVTTQSRIAFISEELCIGCG  59

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA
Sbjct  60   ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  119

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            LK+LAGKLKPNLGRF NPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA
Sbjct  120  LKILAGKLKPNLGRFDNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  179

Query  638  VQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNVG  745
            VQGNVGQVL+QKDERDMKEELCVDLELNQV D NVG
Sbjct  180  VQGNVGQVLEQKDERDMKEELCVDLELNQVKDRNVG  215



>ref|XP_006662991.1| PREDICTED: ABC transporter E family member 2-like [Oryza brachyantha]
Length=604

 Score =   424 bits (1090),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 201/213 (94%), Positives = 209/213 (98%), Gaps = 0/213 (0%)
 Frame = +2

Query  107  QRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCGICV  286
            +RLTRIAIVS DKCKPKKCRQECKKSCPVVKTGKLCIEVTPA+K+AFISEELCIGCGICV
Sbjct  3    ERLTRIAIVSEDKCKPKKCRQECKKSCPVVKTGKLCIEVTPASKLAFISEELCIGCGICV  62

Query  287  KKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTALKV  466
            KKCPF+AI+IINLPKDL+KDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTALKV
Sbjct  63   KKCPFDAIEIINLPKDLEKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTALKV  122

Query  467  LAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKAVQG  646
            LAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKAVQG
Sbjct  123  LAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKAVQG  182

Query  647  NVGQVLDQKDERDMKEELCVDLELNQVLDHNVG  745
            NVGQVLDQKDER +K ELCVDLELNQV+D NVG
Sbjct  183  NVGQVLDQKDERGVKAELCVDLELNQVIDRNVG  215



>ref|XP_006366958.1| PREDICTED: ABC transporter E family member 2-like isoform X1 
[Solanum tuberosum]
 ref|XP_006366959.1| PREDICTED: ABC transporter E family member 2-like isoform X2 
[Solanum tuberosum]
 ref|XP_006366960.1| PREDICTED: ABC transporter E family member 2-like isoform X3 
[Solanum tuberosum]
Length=605

 Score =   424 bits (1090),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 205/216 (95%), Positives = 210/216 (97%), Gaps = 1/216 (0%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            MSD RLTRIAIVS+DKCKPKKCRQECKKSCPVVKTGKLCIEVT  +KIAFISEELCIGCG
Sbjct  1    MSD-RLTRIAIVSADKCKPKKCRQECKKSCPVVKTGKLCIEVTVGSKIAFISEELCIGCG  59

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA
Sbjct  60   ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  119

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            LKVLAGKLKPNLGRF NPPDWQEILT+FRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA
Sbjct  120  LKVLAGKLKPNLGRFTNPPDWQEILTHFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  179

Query  638  VQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNVG  745
            VQGNVGQVLDQKDERD+KE+LC DLELNQVLD NVG
Sbjct  180  VQGNVGQVLDQKDERDVKEKLCFDLELNQVLDRNVG  215



>ref|XP_010690817.1| PREDICTED: ABC transporter E family member 2 [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010690818.1| PREDICTED: ABC transporter E family member 2 [Beta vulgaris subsp. 
vulgaris]
Length=605

 Score =   424 bits (1089),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 205/216 (95%), Positives = 209/216 (97%), Gaps = 1/216 (0%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            MSD RLTRIAIVSSD+CKPKKCRQECKKSCPVVKTGKLCIEVT AAK+AFISEELCIGCG
Sbjct  1    MSD-RLTRIAIVSSDRCKPKKCRQECKKSCPVVKTGKLCIEVTSAAKLAFISEELCIGCG  59

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA
Sbjct  60   ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  119

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            LKVLAGKLKPNLGRF NPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA
Sbjct  120  LKVLAGKLKPNLGRFNNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  179

Query  638  VQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNVG  745
            VQGNVGQVL+QK+ERDMK ELC DLELN VLD NVG
Sbjct  180  VQGNVGQVLEQKNERDMKAELCNDLELNVVLDRNVG  215



>ref|XP_004512327.1| PREDICTED: ABC transporter E family member 2-like [Cicer arietinum]
Length=606

 Score =   424 bits (1089),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 202/216 (94%), Positives = 211/216 (98%), Gaps = 1/216 (0%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            MSD RLTRIAIVS+D+CKPKKCRQECKKSCPVV+TG+LCIEVT A+KIA+ISEELCIGCG
Sbjct  1    MSD-RLTRIAIVSNDRCKPKKCRQECKKSCPVVRTGRLCIEVTSASKIAYISEELCIGCG  59

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA
Sbjct  60   ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  119

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            LKVLAGKLKPNLGRF NPPDWQEILTYFRGSELQNYFTRILED+LKAIIKPQYVDHIPKA
Sbjct  120  LKVLAGKLKPNLGRFTNPPDWQEILTYFRGSELQNYFTRILEDDLKAIIKPQYVDHIPKA  179

Query  638  VQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNVG  745
            VQGNVGQVLDQK+ERDMKEELC DLELNQV+D NVG
Sbjct  180  VQGNVGQVLDQKNERDMKEELCADLELNQVIDRNVG  215



>gb|EAZ18673.1| hypothetical protein OsJ_34194 [Oryza sativa Japonica Group]
Length=628

 Score =   424 bits (1091),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 201/213 (94%), Positives = 209/213 (98%), Gaps = 0/213 (0%)
 Frame = +2

Query  107  QRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCGICV  286
            +RLTRIAIVS DKCKPKKCRQECKKSCPVVKTGKLCIEVTPA+K+AFISEELCIGCGICV
Sbjct  3    ERLTRIAIVSEDKCKPKKCRQECKKSCPVVKTGKLCIEVTPASKLAFISEELCIGCGICV  62

Query  287  KKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTALKV  466
            KKCPF+AI+IINLPKDL+KDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTALKV
Sbjct  63   KKCPFDAIEIINLPKDLEKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTALKV  122

Query  467  LAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKAVQG  646
            LAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKAVQG
Sbjct  123  LAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKAVQG  182

Query  647  NVGQVLDQKDERDMKEELCVDLELNQVLDHNVG  745
            NVGQVLDQKDER +K ELCVDLELNQV+D NVG
Sbjct  183  NVGQVLDQKDERGVKAELCVDLELNQVIDRNVG  215



>ref|XP_008805333.1| PREDICTED: ABC transporter E family member 2-like [Phoenix dactylifera]
 ref|XP_008805406.1| PREDICTED: ABC transporter E family member 2-like [Phoenix dactylifera]
Length=605

 Score =   423 bits (1088),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 203/216 (94%), Positives = 210/216 (97%), Gaps = 1/216 (0%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            M+D RLTRIAIVSSD+CKPKKCRQECKKSCPVVKTGKLCIEVTPA+KIAFISEELCIGCG
Sbjct  1    MAD-RLTRIAIVSSDRCKPKKCRQECKKSCPVVKTGKLCIEVTPASKIAFISEELCIGCG  59

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            ICVKKCPFEAIQIINLPKDL KDTTHRYGPNTFKLHRLPVPRPG+VLGLVGTNGIGKSTA
Sbjct  60   ICVKKCPFEAIQIINLPKDLVKDTTHRYGPNTFKLHRLPVPRPGRVLGLVGTNGIGKSTA  119

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            LKVLAGKLKPNLGR+ NPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA
Sbjct  120  LKVLAGKLKPNLGRYNNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  179

Query  638  VQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNVG  745
            VQGNVGQVLDQKDERDMK ELC+DLELN V+D NVG
Sbjct  180  VQGNVGQVLDQKDERDMKAELCIDLELNLVIDRNVG  215



>ref|XP_007158074.1| hypothetical protein PHAVU_002G121800g [Phaseolus vulgaris]
 gb|ESW30068.1| hypothetical protein PHAVU_002G121800g [Phaseolus vulgaris]
Length=606

 Score =   423 bits (1088),  Expect = 7e-142, Method: Compositional matrix adjust.
 Identities = 201/216 (93%), Positives = 210/216 (97%), Gaps = 1/216 (0%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            M+D RLTRIAIVS+D+CKPKKCRQECKKSCPVV+TG+LCIEVT A+KIA+ISEELCIGCG
Sbjct  1    MAD-RLTRIAIVSNDRCKPKKCRQECKKSCPVVRTGRLCIEVTSASKIAYISEELCIGCG  59

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA
Sbjct  60   ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  119

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            LKVLAGKLKPNLGRF NPPDWQEILTYFRGSELQNYFTRILED+LKAIIKPQYVDHIPKA
Sbjct  120  LKVLAGKLKPNLGRFTNPPDWQEILTYFRGSELQNYFTRILEDDLKAIIKPQYVDHIPKA  179

Query  638  VQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNVG  745
            VQGNVGQVLDQKDERDMK ELC DLELNQV+D NVG
Sbjct  180  VQGNVGQVLDQKDERDMKAELCADLELNQVIDRNVG  215



>ref|XP_003579496.1| PREDICTED: ABC transporter E family member 2-like [Brachypodium 
distachyon]
Length=604

 Score =   422 bits (1085),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 197/216 (91%), Positives = 210/216 (97%), Gaps = 0/216 (0%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            M+ +RLTRIAIV+ D+CKPKKCRQECKKSCPVVKTG+LCIEV+PA+K+AFISEELCIGCG
Sbjct  1    MAAERLTRIAIVNEDRCKPKKCRQECKKSCPVVKTGRLCIEVSPASKVAFISEELCIGCG  60

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            ICVKKCPF+AI+IINLPKDL+KDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA
Sbjct  61   ICVKKCPFDAIEIINLPKDLEKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  120

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            LKVLAGK+KPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA
Sbjct  121  LKVLAGKVKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  180

Query  638  VQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNVG  745
            VQGNVGQVLDQKDER MK ELCVDLELNQV+D NV 
Sbjct  181  VQGNVGQVLDQKDERGMKAELCVDLELNQVIDRNVA  216



>gb|AAM19067.1| RNase L inhibitor-like protein [Oryza sativa Japonica Group]
Length=604

 Score =   422 bits (1084),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 200/213 (94%), Positives = 209/213 (98%), Gaps = 0/213 (0%)
 Frame = +2

Query  107  QRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCGICV  286
            +RLTRIAIVS DKCKPKKCRQECKKSCPVVKTGKLCIEVTPA+K+AFISEELCIGCGICV
Sbjct  3    ERLTRIAIVSEDKCKPKKCRQECKKSCPVVKTGKLCIEVTPASKLAFISEELCIGCGICV  62

Query  287  KKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTALKV  466
            KKCPF+AI+IINLPKDL+KDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTALKV
Sbjct  63   KKCPFDAIEIINLPKDLEKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTALKV  122

Query  467  LAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKAVQG  646
            LAGKLKPNLGRFKNPPDWQEILTYFRGSELQ+YFTRILEDNLKAIIKPQYVDHIPKAVQG
Sbjct  123  LAGKLKPNLGRFKNPPDWQEILTYFRGSELQHYFTRILEDNLKAIIKPQYVDHIPKAVQG  182

Query  647  NVGQVLDQKDERDMKEELCVDLELNQVLDHNVG  745
            NVGQVLDQKDER +K ELCVDLELNQV+D NVG
Sbjct  183  NVGQVLDQKDERGVKAELCVDLELNQVIDRNVG  215



>ref|XP_009349643.1| PREDICTED: ABC transporter E family member 2-like [Pyrus x bretschneideri]
 ref|XP_009349644.1| PREDICTED: ABC transporter E family member 2-like [Pyrus x bretschneideri]
 ref|XP_009349645.1| PREDICTED: ABC transporter E family member 2-like [Pyrus x bretschneideri]
 ref|XP_009349646.1| PREDICTED: ABC transporter E family member 2-like [Pyrus x bretschneideri]
Length=605

 Score =   421 bits (1083),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 201/216 (93%), Positives = 209/216 (97%), Gaps = 1/216 (0%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            MSD RLTRIAIVSSD+CKPKKCRQECK+SCPVV TGKLCIEVTPA+KIAFISEELCIGCG
Sbjct  1    MSD-RLTRIAIVSSDRCKPKKCRQECKRSCPVVITGKLCIEVTPASKIAFISEELCIGCG  59

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA
Sbjct  60   ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  119

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            LKVL GKLKPNLGRFKNPPDWQEILTYFRGSELQN+FTRILEDNLKAIIKPQYVDHIPKA
Sbjct  120  LKVLGGKLKPNLGRFKNPPDWQEILTYFRGSELQNFFTRILEDNLKAIIKPQYVDHIPKA  179

Query  638  VQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNVG  745
            VQGNVG+VL QKDERDMKE+LC DLELNQV++  VG
Sbjct  180  VQGNVGEVLSQKDERDMKEKLCADLELNQVIERKVG  215



>ref|NP_001068062.1| Os11g0546000 [Oryza sativa Japonica Group]
 gb|ABA94220.1| ATP-binding cassette sub-family E member 1, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF28425.1| Os11g0546000 [Oryza sativa Japonica Group]
Length=604

 Score =   421 bits (1083),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 200/213 (94%), Positives = 208/213 (98%), Gaps = 0/213 (0%)
 Frame = +2

Query  107  QRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCGICV  286
            +RLTRIAIVS DKCKPKKCRQECKKSCPVVKTGKLCIEVTPA+K+AFISEELCIGCGICV
Sbjct  3    ERLTRIAIVSEDKCKPKKCRQECKKSCPVVKTGKLCIEVTPASKLAFISEELCIGCGICV  62

Query  287  KKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTALKV  466
            KKCPF+AI+IINLPKDL+KDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTALKV
Sbjct  63   KKCPFDAIEIINLPKDLEKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTALKV  122

Query  467  LAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKAVQG  646
            LAGKLKPNLGRFKNPPDWQEILTYFRG ELQNYFTRILEDNLKAIIKPQYVDHIPKAVQG
Sbjct  123  LAGKLKPNLGRFKNPPDWQEILTYFRGCELQNYFTRILEDNLKAIIKPQYVDHIPKAVQG  182

Query  647  NVGQVLDQKDERDMKEELCVDLELNQVLDHNVG  745
            NVGQVLDQKDER +K ELCVDLELNQV+D NVG
Sbjct  183  NVGQVLDQKDERGVKAELCVDLELNQVIDRNVG  215



>dbj|BAJ93642.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=604

 Score =   420 bits (1080),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 199/218 (91%), Positives = 211/218 (97%), Gaps = 1/218 (0%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            M+D RLTRIAIV+ D+CKPKKCRQECKKSCPVVKTGKLCIEV PA+K++FISEELCIGCG
Sbjct  1    MAD-RLTRIAIVNEDRCKPKKCRQECKKSCPVVKTGKLCIEVGPASKVSFISEELCIGCG  59

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            ICVKKCPF+AI+IINLPKDL+KDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA
Sbjct  60   ICVKKCPFDAIEIINLPKDLEKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  119

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTR+LEDNLKAIIKPQYVDHIPKA
Sbjct  120  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRLLEDNLKAIIKPQYVDHIPKA  179

Query  638  VQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNVGRF  751
            VQGNVGQVL+QKDERDMK ELCVDLELNQV+D NVG  
Sbjct  180  VQGNVGQVLEQKDERDMKAELCVDLELNQVIDRNVGEL  217



>ref|XP_003537713.1| PREDICTED: ABC transporter E family member 2-like [Glycine max]
Length=606

 Score =   420 bits (1079),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 199/216 (92%), Positives = 210/216 (97%), Gaps = 1/216 (0%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            M+D RLTRIAIVS+D+CKPKKCRQECKKSCPVV+TG+LCIEVT ++KIAFISEELCIGCG
Sbjct  1    MAD-RLTRIAIVSNDRCKPKKCRQECKKSCPVVRTGRLCIEVTSSSKIAFISEELCIGCG  59

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            ICVKKCPFEAIQIINLPKDLD+DTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA
Sbjct  60   ICVKKCPFEAIQIINLPKDLDRDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  119

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            LKVLAGKLKPNLGRF NPPDWQEILTYFRGSELQNYFTRILED+LKAIIKPQYVDHIPKA
Sbjct  120  LKVLAGKLKPNLGRFTNPPDWQEILTYFRGSELQNYFTRILEDDLKAIIKPQYVDHIPKA  179

Query  638  VQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNVG  745
            VQGNVGQVLDQKDER+ KEELC DLELNQV+D NVG
Sbjct  180  VQGNVGQVLDQKDEREKKEELCADLELNQVIDRNVG  215



>ref|XP_009333973.1| PREDICTED: ABC transporter E family member 2 [Pyrus x bretschneideri]
 ref|XP_009333974.1| PREDICTED: ABC transporter E family member 2 [Pyrus x bretschneideri]
Length=605

 Score =   420 bits (1079),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 199/216 (92%), Positives = 209/216 (97%), Gaps = 1/216 (0%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            M+D RLTRIAIVSSD+CKPKKCRQECK+SCPVV TGKLC+EVTPA+KIAFISEELCIGCG
Sbjct  1    MTD-RLTRIAIVSSDRCKPKKCRQECKRSCPVVITGKLCVEVTPASKIAFISEELCIGCG  59

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA
Sbjct  60   ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  119

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            LKVL GKLKPNLGRFKNPPDWQEILTYFRGSELQN+FTRILEDNLKAIIKPQYVDHIPKA
Sbjct  120  LKVLGGKLKPNLGRFKNPPDWQEILTYFRGSELQNFFTRILEDNLKAIIKPQYVDHIPKA  179

Query  638  VQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNVG  745
            VQGNVG+VL QKDERDMKE+LC DLELNQV++  VG
Sbjct  180  VQGNVGEVLSQKDERDMKEKLCADLELNQVIERKVG  215



>ref|XP_007216970.1| hypothetical protein PRUPE_ppa003087mg [Prunus persica]
 ref|XP_008227942.1| PREDICTED: ABC transporter E family member 2-like [Prunus mume]
 ref|XP_008227943.1| PREDICTED: ABC transporter E family member 2-like [Prunus mume]
 gb|EMJ18169.1| hypothetical protein PRUPE_ppa003087mg [Prunus persica]
Length=605

 Score =   419 bits (1078),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 198/216 (92%), Positives = 211/216 (98%), Gaps = 1/216 (0%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            M+D RLTRIAIVSSD+CKPKKCRQECKKSCPVV TG+LCIEVTPA+KIA+ISEELCIGCG
Sbjct  1    MAD-RLTRIAIVSSDRCKPKKCRQECKKSCPVVMTGRLCIEVTPASKIAYISEELCIGCG  59

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            ICVKKCPFEAIQIINLPKDLD+DTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA
Sbjct  60   ICVKKCPFEAIQIINLPKDLDRDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  119

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            LKVLAGKLKPNLGRF NPPDWQEILT+FRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA
Sbjct  120  LKVLAGKLKPNLGRFNNPPDWQEILTHFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  179

Query  638  VQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNVG  745
            VQGNVG+VL+QKDERDMKE+LC DL+LNQV++ NVG
Sbjct  180  VQGNVGEVLNQKDERDMKEKLCADLDLNQVIERNVG  215



>gb|EYU37486.1| hypothetical protein MIMGU_mgv1a003146mg [Erythranthe guttata]
Length=605

 Score =   419 bits (1078),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 198/213 (93%), Positives = 208/213 (98%), Gaps = 0/213 (0%)
 Frame = +2

Query  107  QRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCGICV  286
            ++LTRIAIVSSDKCKPKKCRQECKKSCPVV+TGKLCIEVTP +KIAFISEELCIGCGICV
Sbjct  3    EKLTRIAIVSSDKCKPKKCRQECKKSCPVVRTGKLCIEVTPLSKIAFISEELCIGCGICV  62

Query  287  KKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTALKV  466
            KKCPFEAIQIINLPKDL+KDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTALKV
Sbjct  63   KKCPFEAIQIINLPKDLEKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTALKV  122

Query  467  LAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKAVQG  646
            LAGKLKPNLG+FK+PPDWQEILT FRGSELQNYFTRILEDNLKAIIKPQYVDHIPKAVQG
Sbjct  123  LAGKLKPNLGKFKSPPDWQEILTNFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKAVQG  182

Query  647  NVGQVLDQKDERDMKEELCVDLELNQVLDHNVG  745
            NVGQVL QKDERD+KEE+C DLELNQV+D NVG
Sbjct  183  NVGQVLSQKDERDIKEEICFDLELNQVMDRNVG  215



>ref|XP_003580843.1| PREDICTED: ABC transporter E family member 2-like isoform X1 
[Brachypodium distachyon]
Length=604

 Score =   419 bits (1076),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 199/216 (92%), Positives = 210/216 (97%), Gaps = 1/216 (0%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            M+D RLTRIAIV+ D+CKPKKCRQECKKSCPVVKTGKLCIEV+ A+K+AFISEELCIGCG
Sbjct  1    MAD-RLTRIAIVNEDRCKPKKCRQECKKSCPVVKTGKLCIEVSSASKVAFISEELCIGCG  59

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            ICVKKCPF+AI+IINLPKDL+KDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA
Sbjct  60   ICVKKCPFDAIEIINLPKDLEKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  119

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA
Sbjct  120  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  179

Query  638  VQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNVG  745
            VQGNVGQVLDQKDER +K ELCVDLELNQV+D NVG
Sbjct  180  VQGNVGQVLDQKDERGIKAELCVDLELNQVIDRNVG  215



>ref|XP_006385159.1| RNase L inhibitor family protein [Populus trichocarpa]
 gb|ERP62956.1| RNase L inhibitor family protein [Populus trichocarpa]
Length=603

 Score =   419 bits (1076),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 203/216 (94%), Positives = 208/216 (96%), Gaps = 3/216 (1%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            MSD RLTRIAIV+SD+CKPKKCRQECKKSCPVVKTGKLCIEVTPA+KIAFISEELCIGCG
Sbjct  1    MSD-RLTRIAIVTSDRCKPKKCRQECKKSCPVVKTGKLCIEVTPASKIAFISEELCIGCG  59

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            IC  KCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA
Sbjct  60   IC--KCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  117

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            LKVLAGKLKPNLGRF NPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIP+A
Sbjct  118  LKVLAGKLKPNLGRFNNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPRA  177

Query  638  VQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNVG  745
            VQGNVGQVLDQKDERD K ELC DLELNQV+D NVG
Sbjct  178  VQGNVGQVLDQKDERDKKAELCRDLELNQVIDRNVG  213



>gb|AGV54379.1| ABC transporter E family member 2-like protein [Phaseolus vulgaris]
Length=606

 Score =   418 bits (1074),  Expect = 8e-140, Method: Compositional matrix adjust.
 Identities = 201/216 (93%), Positives = 210/216 (97%), Gaps = 1/216 (0%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            M+D RLTRIAIVS+D+CKPKKCRQECKKSCPVV+TG+LCIEVT A+KIA+ISEELCIGCG
Sbjct  1    MAD-RLTRIAIVSNDRCKPKKCRQECKKSCPVVRTGRLCIEVTSASKIAYISEELCIGCG  59

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA
Sbjct  60   ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  119

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            LKVLAGKLKPNLGRF NPPDWQEILTYFRGSELQNYFTRILED+LKAIIKPQYVDHIPKA
Sbjct  120  LKVLAGKLKPNLGRFTNPPDWQEILTYFRGSELQNYFTRILEDDLKAIIKPQYVDHIPKA  179

Query  638  VQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNVG  745
            VQGNVGQVLDQKDERDMK ELC DLELNQV+D NVG
Sbjct  180  VQGNVGQVLDQKDERDMKAELCADLELNQVIDRNVG  215



>ref|XP_006385402.1| hypothetical protein POPTR_0003s03960g [Populus trichocarpa]
 gb|ERP63199.1| hypothetical protein POPTR_0003s03960g [Populus trichocarpa]
Length=605

 Score =   417 bits (1073),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 200/216 (93%), Positives = 207/216 (96%), Gaps = 1/216 (0%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            M+D RLTRIAIV+SD+CKPKKCRQECKKSCPVVKTGKLCIEVTP +KIAFISEELCIGCG
Sbjct  1    MAD-RLTRIAIVTSDRCKPKKCRQECKKSCPVVKTGKLCIEVTPISKIAFISEELCIGCG  59

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA
Sbjct  60   ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  119

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            LKVLAGKLKPNLGRF NPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIP+A
Sbjct  120  LKVLAGKLKPNLGRFNNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPRA  179

Query  638  VQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNVG  745
            VQGNVGQVLDQKDE   K ELC DL+LNQV+D NVG
Sbjct  180  VQGNVGQVLDQKDESHRKAELCRDLDLNQVIDRNVG  215



>ref|XP_008783221.1| PREDICTED: ABC transporter E family member 2-like isoform X1 
[Phoenix dactylifera]
Length=632

 Score =   418 bits (1075),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 206/243 (85%), Positives = 213/243 (88%), Gaps = 28/243 (12%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            M+D RLTRIAIVSSD+CKPKKCRQECKKSCPVVKTGKLCIEVTPA+KIAFISEELCIGCG
Sbjct  1    MAD-RLTRIAIVSSDRCKPKKCRQECKKSCPVVKTGKLCIEVTPASKIAFISEELCIGCG  59

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA
Sbjct  60   ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  119

Query  458  LKVLAGKLKPNLGRF---------------------------KNPPDWQEILTYFRGSEL  556
            LKVLAGKLKPNLGR+                           +NPPDWQEILTYFRGSEL
Sbjct  120  LKVLAGKLKPNLGRYNVMPIRPIHLYMFLDLFMYTTLFFLSLQNPPDWQEILTYFRGSEL  179

Query  557  QNYFTRILEDNLKAIIKPQYVDHIPKAVQGNVGQVLDQKDERDMKEELCVDLELNQVLDH  736
            QNYFTRILEDNLKAIIKPQYVDHIPKAVQGNVGQVLDQKDERDMK ELC+DLELNQV+D 
Sbjct  180  QNYFTRILEDNLKAIIKPQYVDHIPKAVQGNVGQVLDQKDERDMKAELCIDLELNQVIDR  239

Query  737  NVG  745
            NVG
Sbjct  240  NVG  242



>ref|XP_011013966.1| PREDICTED: ABC transporter E family member 2-like [Populus euphratica]
 ref|XP_011013967.1| PREDICTED: ABC transporter E family member 2-like [Populus euphratica]
Length=605

 Score =   417 bits (1072),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 200/216 (93%), Positives = 207/216 (96%), Gaps = 1/216 (0%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            M+D RLTRIAIV+SD+CKPKKCRQECKKSCPVVKTGKLCIEVTP +KIAFISEELCIGCG
Sbjct  1    MAD-RLTRIAIVTSDRCKPKKCRQECKKSCPVVKTGKLCIEVTPVSKIAFISEELCIGCG  59

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA
Sbjct  60   ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  119

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            LKVLAGKLKPNLGRF NPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIP+A
Sbjct  120  LKVLAGKLKPNLGRFINPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPRA  179

Query  638  VQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNVG  745
            VQGNVGQVLDQKDE   K ELC DL+LNQV+D NVG
Sbjct  180  VQGNVGQVLDQKDESHKKAELCRDLDLNQVIDRNVG  215



>ref|XP_008783222.1| PREDICTED: ABC transporter E family member 2-like isoform X2 
[Phoenix dactylifera]
Length=628

 Score =   418 bits (1074),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 206/243 (85%), Positives = 213/243 (88%), Gaps = 28/243 (12%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            M+D RLTRIAIVSSD+CKPKKCRQECKKSCPVVKTGKLCIEVTPA+KIAFISEELCIGCG
Sbjct  1    MAD-RLTRIAIVSSDRCKPKKCRQECKKSCPVVKTGKLCIEVTPASKIAFISEELCIGCG  59

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA
Sbjct  60   ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  119

Query  458  LKVLAGKLKPNLGRF---------------------------KNPPDWQEILTYFRGSEL  556
            LKVLAGKLKPNLGR+                           +NPPDWQEILTYFRGSEL
Sbjct  120  LKVLAGKLKPNLGRYNVMPIRPIHLYMFLDLFMYTTLFFLSLQNPPDWQEILTYFRGSEL  179

Query  557  QNYFTRILEDNLKAIIKPQYVDHIPKAVQGNVGQVLDQKDERDMKEELCVDLELNQVLDH  736
            QNYFTRILEDNLKAIIKPQYVDHIPKAVQGNVGQVLDQKDERDMK ELC+DLELNQV+D 
Sbjct  180  QNYFTRILEDNLKAIIKPQYVDHIPKAVQGNVGQVLDQKDERDMKAELCIDLELNQVIDR  239

Query  737  NVG  745
            NVG
Sbjct  240  NVG  242



>ref|XP_008380283.1| PREDICTED: ABC transporter E family member 2-like [Malus domestica]
 ref|XP_008380284.1| PREDICTED: ABC transporter E family member 2-like [Malus domestica]
Length=605

 Score =   416 bits (1070),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 198/216 (92%), Positives = 208/216 (96%), Gaps = 1/216 (0%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            M+D RLTRIAIVSSD+CKPKKCRQECK+SCPVV TGKLC+EVT A+KIAFISEELCIGCG
Sbjct  1    MTD-RLTRIAIVSSDRCKPKKCRQECKRSCPVVITGKLCVEVTXASKIAFISEELCIGCG  59

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA
Sbjct  60   ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  119

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            LKVL GKLKPNLGRFKNPPDWQEILTYFRGSELQN+FTRILEDNLKAIIKPQYVDHIPKA
Sbjct  120  LKVLGGKLKPNLGRFKNPPDWQEILTYFRGSELQNFFTRILEDNLKAIIKPQYVDHIPKA  179

Query  638  VQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNVG  745
            VQGNVG+VL QKDERDMKE+LC DLELNQV++  VG
Sbjct  180  VQGNVGEVLSQKDERDMKEKLCADLELNQVIERKVG  215



>ref|XP_003592706.1| RNase L inhibitor-like protein [Medicago truncatula]
 ref|XP_003636730.1| RNase L inhibitor-like protein [Medicago truncatula]
 gb|AES62957.1| RNase L inhibitor ABC domain protein [Medicago truncatula]
Length=606

 Score =   416 bits (1070),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 198/216 (92%), Positives = 209/216 (97%), Gaps = 1/216 (0%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            MSD RLTRIAIVS+D+CKPKKCRQECKKSCPVV+TG+LC+EVT A+KIA+ISEELCIGCG
Sbjct  1    MSD-RLTRIAIVSNDRCKPKKCRQECKKSCPVVRTGRLCVEVTSASKIAYISEELCIGCG  59

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA
Sbjct  60   ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  119

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            LKVLAGKLKPNLGRF  PPDWQEILT+FRGSELQNYFTRILED+LKAIIKPQYVDHIPKA
Sbjct  120  LKVLAGKLKPNLGRFTEPPDWQEILTHFRGSELQNYFTRILEDDLKAIIKPQYVDHIPKA  179

Query  638  VQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNVG  745
            VQGNVGQVLDQK+ERDMKE LC DLELNQV+D NVG
Sbjct  180  VQGNVGQVLDQKNERDMKERLCADLELNQVIDRNVG  215



>gb|KHN05542.1| ABC transporter E family member 2 [Glycine soja]
Length=684

 Score =   418 bits (1074),  Expect = 9e-139, Method: Compositional matrix adjust.
 Identities = 199/216 (92%), Positives = 210/216 (97%), Gaps = 1/216 (0%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            M+D RLTRIAIVS+D+CKPKKCRQECKKSCPVV+TG+LCIEVT ++KIAFISEELCIGCG
Sbjct  1    MAD-RLTRIAIVSNDRCKPKKCRQECKKSCPVVRTGRLCIEVTSSSKIAFISEELCIGCG  59

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            ICVKKCPFEAIQIINLPKDLD+DTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA
Sbjct  60   ICVKKCPFEAIQIINLPKDLDRDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  119

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            LKVLAGKLKPNLGRF NPPDWQEILTYFRGSELQNYFTRILED+LKAIIKPQYVDHIPKA
Sbjct  120  LKVLAGKLKPNLGRFTNPPDWQEILTYFRGSELQNYFTRILEDDLKAIIKPQYVDHIPKA  179

Query  638  VQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNVG  745
            VQGNVGQVLDQKDER+ KEELC DLELNQV+D NVG
Sbjct  180  VQGNVGQVLDQKDEREKKEELCADLELNQVIDRNVG  215



>ref|XP_004291224.1| PREDICTED: ABC transporter E family member 2 [Fragaria vesca 
subsp. vesca]
Length=604

 Score =   415 bits (1067),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 201/216 (93%), Positives = 208/216 (96%), Gaps = 1/216 (0%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            MSD RLTRIAIVSSD+CKPKKCRQECKKSCPVVKTGKLCIEVT A+KIAFISEELCIGCG
Sbjct  1    MSD-RLTRIAIVSSDRCKPKKCRQECKKSCPVVKTGKLCIEVTTASKIAFISEELCIGCG  59

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA
Sbjct  60   ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  119

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            LKVLAGKLKPNLGRF NPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA
Sbjct  120  LKVLAGKLKPNLGRFNNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  179

Query  638  VQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNVG  745
            V GNVG+VL+QK+ER +KE LC DLELNQV+D NVG
Sbjct  180  VHGNVGEVLNQKNERGVKEVLCHDLELNQVIDRNVG  215



>ref|XP_010692184.1| PREDICTED: ABC transporter E family member 2-like [Beta vulgaris 
subsp. vulgaris]
Length=605

 Score =   414 bits (1063),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 200/216 (93%), Positives = 207/216 (96%), Gaps = 1/216 (0%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            MSD RLTRIAIVSSD+CKPKKCRQECKKSCPVVKTGKLCIEV+ AAK+AFISEELCIGCG
Sbjct  1    MSD-RLTRIAIVSSDRCKPKKCRQECKKSCPVVKTGKLCIEVSSAAKLAFISEELCIGCG  59

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA
Sbjct  60   ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  119

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            LKVLAGKLKPNLGRF NPPDWQEILTYFRGSELQNYFTRILEDNLKA IKPQYVD+IPKA
Sbjct  120  LKVLAGKLKPNLGRFNNPPDWQEILTYFRGSELQNYFTRILEDNLKANIKPQYVDNIPKA  179

Query  638  VQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNVG  745
            VQGNVG+VLD+KDERDMK  LC DLELN+V D NVG
Sbjct  180  VQGNVGEVLDKKDERDMKASLCDDLELNKVQDRNVG  215



>ref|XP_004246016.1| PREDICTED: ABC transporter E family member 2 [Solanum lycopersicum]
 ref|XP_010325625.1| PREDICTED: ABC transporter E family member 2 [Solanum lycopersicum]
Length=606

 Score =   412 bits (1060),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 197/216 (91%), Positives = 207/216 (96%), Gaps = 0/216 (0%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            MS+QRL+RIAI++SDKCKPKKC  +CKK CPVVKTGKLCIEVT  +KIAFISEELCIGCG
Sbjct  1    MSNQRLSRIAILNSDKCKPKKCGLQCKKCCPVVKTGKLCIEVTATSKIAFISEELCIGCG  60

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            ICVKKCPFEAI IINLPKDLDKDTTHRYG NTFKLHRLPVPRPGQVLGLVGTNGIGKSTA
Sbjct  61   ICVKKCPFEAIMIINLPKDLDKDTTHRYGANTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  120

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            LKVLAGKLKPNLGRF NPPDWQEILT+FRGSELQNYFTRILEDNLKAIIKPQYVDHIP+A
Sbjct  121  LKVLAGKLKPNLGRFSNPPDWQEILTHFRGSELQNYFTRILEDNLKAIIKPQYVDHIPRA  180

Query  638  VQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNVG  745
            VQGNVGQVLDQKDERD+KE+LCVDLELNQVLD NVG
Sbjct  181  VQGNVGQVLDQKDERDIKEKLCVDLELNQVLDRNVG  216



>emb|CDX99388.1| BnaC01g11640D [Brassica napus]
Length=605

 Score =   412 bits (1058),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 195/215 (91%), Positives = 208/215 (97%), Gaps = 1/215 (0%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            M+D RLTRIAIVSSD+CKPKKCRQECKKSCPVVKTGKLCIEVT  +K+AFISEELCIGCG
Sbjct  1    MAD-RLTRIAIVSSDRCKPKKCRQECKKSCPVVKTGKLCIEVTVGSKVAFISEELCIGCG  59

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            ICVKKCPFEAIQIINLP+DL+KDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA
Sbjct  60   ICVKKCPFEAIQIINLPRDLEKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  119

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            LK+LAGKLKPNLGRF NPPDWQEILT+FRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA
Sbjct  120  LKILAGKLKPNLGRFTNPPDWQEILTHFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  179

Query  638  VQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNV  742
            V+GNVG+VLDQKDER+MK ELC DLELNQV+D +V
Sbjct  180  VRGNVGEVLDQKDERNMKAELCADLELNQVIDRDV  214



>gb|AGC70150.1| ABC transporter E family member 2 protein [Cardamine hirsuta]
Length=605

 Score =   412 bits (1058),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 197/215 (92%), Positives = 208/215 (97%), Gaps = 1/215 (0%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            M+D RLTRIAIVSSD+CKPKKCRQECKKSCPVVKTGKLCIEVT A+KIAFISEELCIGCG
Sbjct  1    MAD-RLTRIAIVSSDRCKPKKCRQECKKSCPVVKTGKLCIEVTVASKIAFISEELCIGCG  59

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            ICVKKCPFEAIQIINLP+DL+KDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA
Sbjct  60   ICVKKCPFEAIQIINLPRDLEKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  119

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            LKVLAGKLKPNLGRF NPPDWQEILT+FRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA
Sbjct  120  LKVLAGKLKPNLGRFTNPPDWQEILTHFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  179

Query  638  VQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNV  742
            V+GNVG+VLDQKDER+ K ELC DLELNQV+D +V
Sbjct  180  VRGNVGEVLDQKDERNKKAELCADLELNQVIDRDV  214



>gb|KEH40227.1| RNase L inhibitor ABC superfamily protein, putative [Medicago 
truncatula]
Length=607

 Score =   412 bits (1058),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 194/216 (90%), Positives = 207/216 (96%), Gaps = 0/216 (0%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            MSD+RLTRIAIV++DKCKPKKCRQECKKSCPVV TGKLC+EVT A+KIA+ISEELCIGCG
Sbjct  1    MSDERLTRIAIVNNDKCKPKKCRQECKKSCPVVGTGKLCVEVTSASKIAYISEELCIGCG  60

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            ICVKKCPF AI+IINLPK+LDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA
Sbjct  61   ICVKKCPFGAIEIINLPKNLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  120

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            LKVLAGKLKPNLGRF  PPDWQEILT+FRGSELQNYFTRILED+LKAIIKPQYVDHIPKA
Sbjct  121  LKVLAGKLKPNLGRFTEPPDWQEILTHFRGSELQNYFTRILEDDLKAIIKPQYVDHIPKA  180

Query  638  VQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNVG  745
            VQGNVGQ LD K+ERDMKE+LC DLELNQV+D NVG
Sbjct  181  VQGNVGQTLDSKNERDMKEKLCADLELNQVIDRNVG  216



>ref|XP_006359955.1| PREDICTED: ABC transporter E family member 2-like [Solanum tuberosum]
Length=606

 Score =   411 bits (1057),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 195/216 (90%), Positives = 206/216 (95%), Gaps = 0/216 (0%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            MSDQRL+RIA+++SD+CKPKKC   CKK CPVVKTGKLCIEVT  +KIAFISEELCIGCG
Sbjct  1    MSDQRLSRIAVLNSDRCKPKKCGLLCKKCCPVVKTGKLCIEVTATSKIAFISEELCIGCG  60

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            ICVKKCPFEAI IINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA
Sbjct  61   ICVKKCPFEAIMIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  120

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            LK+LAGKLKPNLGRF NPPDWQEILT+FRGSELQNYFTRILEDNLKAIIKPQYVDHIP+A
Sbjct  121  LKILAGKLKPNLGRFSNPPDWQEILTHFRGSELQNYFTRILEDNLKAIIKPQYVDHIPRA  180

Query  638  VQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNVG  745
            VQGNVGQVLDQKDER +KE+LCVDLELNQVLD NVG
Sbjct  181  VQGNVGQVLDQKDERGVKEKLCVDLELNQVLDRNVG  216



>gb|EAY81246.1| hypothetical protein OsI_36424 [Oryza sativa Indica Group]
Length=474

 Score =   406 bits (1044),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 201/243 (83%), Positives = 209/243 (86%), Gaps = 30/243 (12%)
 Frame = +2

Query  107  QRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCGICV  286
            +RLTRIAIVS DKCKPKKCRQECKKSCPVVKTGKLCIEVTPA+K+AFISEELCIGCGICV
Sbjct  3    ERLTRIAIVSEDKCKPKKCRQECKKSCPVVKTGKLCIEVTPASKLAFISEELCIGCGICV  62

Query  287  KKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTALKV  466
            KKCPF+AI+IINLPKDL+KDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTALKV
Sbjct  63   KKCPFDAIEIINLPKDLEKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTALKV  122

Query  467  LAGKLKPNLGRF------------------------------KNPPDWQEILTYFRGSEL  556
            LAGKLKPNLGRF                              KNPPDWQEILTYFRGSEL
Sbjct  123  LAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKNPPDWQEILTYFRGSEL  182

Query  557  QNYFTRILEDNLKAIIKPQYVDHIPKAVQGNVGQVLDQKDERDMKEELCVDLELNQVLDH  736
            QNYFTRILEDNLKAIIKPQYVDHIPKAVQGNVGQVLDQKDER +K ELCVDLELNQV+D 
Sbjct  183  QNYFTRILEDNLKAIIKPQYVDHIPKAVQGNVGQVLDQKDERGVKAELCVDLELNQVIDR  242

Query  737  NVG  745
            NVG
Sbjct  243  NVG  245



>emb|CDY05197.1| BnaC05g46060D [Brassica napus]
 emb|CDX78930.1| BnaA01g09970D [Brassica napus]
Length=605

 Score =   410 bits (1055),  Expect = 6e-137, Method: Compositional matrix adjust.
 Identities = 194/215 (90%), Positives = 208/215 (97%), Gaps = 1/215 (0%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            M+D RLTRIAIVS+D+CKPKKCRQECKKSCPVVKTGKLCIEVT  +K+AFISEELCIGCG
Sbjct  1    MAD-RLTRIAIVSADRCKPKKCRQECKKSCPVVKTGKLCIEVTVGSKVAFISEELCIGCG  59

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            ICVKKCPFEAIQIINLP+DL+KDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA
Sbjct  60   ICVKKCPFEAIQIINLPRDLEKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  119

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            LK+LAGKLKPNLGRF NPPDWQEILT+FRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA
Sbjct  120  LKILAGKLKPNLGRFTNPPDWQEILTHFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  179

Query  638  VQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNV  742
            V+GNVG+VLDQKDER+MK ELC DLELNQV+D +V
Sbjct  180  VRGNVGEVLDQKDERNMKAELCADLELNQVIDRDV  214



>emb|CAN65893.1| hypothetical protein VITISV_021090 [Vitis vinifera]
Length=599

 Score =   410 bits (1054),  Expect = 7e-137, Method: Compositional matrix adjust.
 Identities = 201/216 (93%), Positives = 206/216 (95%), Gaps = 7/216 (3%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            M+D RLTRIAIVSSD+CKPKKCRQECKKSCPVVKTGKLCIEVTPA+KIAFISEELCIGCG
Sbjct  1    MAD-RLTRIAIVSSDRCKPKKCRQECKKSCPVVKTGKLCIEVTPASKIAFISEELCIGCG  59

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA
Sbjct  60   ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  119

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            LKVLAGKLKPNLGRF       EILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA
Sbjct  120  LKVLAGKLKPNLGRF------NEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  173

Query  638  VQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNVG  745
            VQGNVGQVLDQKDERDMKEELC DL+LNQV+D NVG
Sbjct  174  VQGNVGQVLDQKDERDMKEELCFDLDLNQVIDRNVG  209



>ref|XP_010925922.1| PREDICTED: ABC transporter E family member 2-like isoform X2 
[Elaeis guineensis]
 ref|XP_010925923.1| PREDICTED: ABC transporter E family member 2-like isoform X2 
[Elaeis guineensis]
Length=599

 Score =   408 bits (1048),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 199/216 (92%), Positives = 206/216 (95%), Gaps = 7/216 (3%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            M+D RLTRIAIVSSD+CKPKKCRQECKKSCPVVKTGKLCIEVTPA+KIAFISEELCIGCG
Sbjct  1    MAD-RLTRIAIVSSDRCKPKKCRQECKKSCPVVKTGKLCIEVTPASKIAFISEELCIGCG  59

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA
Sbjct  60   ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  119

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            LKVLAGKLKPNLGR      + EILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA
Sbjct  120  LKVLAGKLKPNLGR------YNEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  173

Query  638  VQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNVG  745
            VQGNVGQVLDQKDERDMK +LC+DLELNQV+D NVG
Sbjct  174  VQGNVGQVLDQKDERDMKAKLCIDLELNQVIDRNVG  209



>ref|XP_006413992.1| hypothetical protein EUTSA_v10024707mg [Eutrema salsugineum]
 gb|ESQ55445.1| hypothetical protein EUTSA_v10024707mg [Eutrema salsugineum]
Length=605

 Score =   407 bits (1047),  Expect = 9e-136, Method: Compositional matrix adjust.
 Identities = 194/215 (90%), Positives = 206/215 (96%), Gaps = 1/215 (0%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            M+D RLTRIAIVS D+CKPKKCRQECKKSCPVVKTGKLCIEVT  +KIAFISEELCIGCG
Sbjct  1    MAD-RLTRIAIVSQDRCKPKKCRQECKKSCPVVKTGKLCIEVTVGSKIAFISEELCIGCG  59

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            ICVKKCPFEAIQIINLP+DL+KDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA
Sbjct  60   ICVKKCPFEAIQIINLPRDLEKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  119

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            LK+LAGKLKPNLGRF NPPDWQEILT+FRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA
Sbjct  120  LKILAGKLKPNLGRFTNPPDWQEILTHFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  179

Query  638  VQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNV  742
            V+GNVG+VLDQKDER+ K ELC DLELNQV+D +V
Sbjct  180  VRGNVGEVLDQKDERNKKAELCADLELNQVIDRDV  214



>emb|CDX98609.1| BnaA03g43940D [Brassica napus]
Length=605

 Score =   407 bits (1047),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 194/215 (90%), Positives = 206/215 (96%), Gaps = 1/215 (0%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            M+D RLTRIAIVSSD+CKPKKCRQECKKSCPVVKTGKLCIEVT  +K+AFISEELCIGCG
Sbjct  1    MAD-RLTRIAIVSSDRCKPKKCRQECKKSCPVVKTGKLCIEVTVGSKLAFISEELCIGCG  59

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            ICVKKCPFEAIQIINLP+DL+KDTTHRYG NTFKLHRLPVPRPGQVLGLVGTNGIGKSTA
Sbjct  60   ICVKKCPFEAIQIINLPRDLEKDTTHRYGANTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  119

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            LK+LAGKLKPNLGRF NPPDWQEILT+FRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA
Sbjct  120  LKILAGKLKPNLGRFTNPPDWQEILTHFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  179

Query  638  VQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNV  742
            V+GNVG+VLDQKDERD K ELC DLELNQV+D +V
Sbjct  180  VRGNVGEVLDQKDERDKKAELCADLELNQVIDRDV  214



>emb|CDY01588.1| BnaC07g35780D [Brassica napus]
Length=605

 Score =   407 bits (1047),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 194/215 (90%), Positives = 206/215 (96%), Gaps = 1/215 (0%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            M+D RLTRIAIVSSD+CKPKKCRQECKKSCPVVKTGKLCIEVT  +K+AFISEELCIGCG
Sbjct  1    MAD-RLTRIAIVSSDRCKPKKCRQECKKSCPVVKTGKLCIEVTVGSKLAFISEELCIGCG  59

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            ICVKKCPFEAIQIINLP+DL+KDTTHRYG NTFKLHRLPVPRPGQVLGLVGTNGIGKSTA
Sbjct  60   ICVKKCPFEAIQIINLPRDLEKDTTHRYGANTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  119

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            LK+LAGKLKPNLGRF NPPDWQEILT+FRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA
Sbjct  120  LKILAGKLKPNLGRFTNPPDWQEILTHFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  179

Query  638  VQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNV  742
            V+GNVG+VLDQKDERD K ELC DLELNQV+D +V
Sbjct  180  VRGNVGEVLDQKDERDKKAELCADLELNQVIDRDV  214



>ref|XP_006286029.1| hypothetical protein CARUB_v10007560mg [Capsella rubella]
 gb|EOA18927.1| hypothetical protein CARUB_v10007560mg [Capsella rubella]
Length=605

 Score =   407 bits (1046),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 194/215 (90%), Positives = 206/215 (96%), Gaps = 1/215 (0%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            M+D RLTRIAIVSSD+CKPKKCRQECKKSCPVVKTGKLCIEVT  +K+AFISEELCIGCG
Sbjct  1    MAD-RLTRIAIVSSDRCKPKKCRQECKKSCPVVKTGKLCIEVTVGSKLAFISEELCIGCG  59

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            ICVKKCPFEAIQIINLP+DL+KDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA
Sbjct  60   ICVKKCPFEAIQIINLPRDLEKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  119

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            LK+LAGKLKPNLGRF +PPDWQEILT+FRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA
Sbjct  120  LKILAGKLKPNLGRFTSPPDWQEILTHFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  179

Query  638  VQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNV  742
            V+GNVG+VLDQKDERD K ELC DLELNQV+D  V
Sbjct  180  VRGNVGEVLDQKDERDKKAELCADLELNQVIDRAV  214



>emb|CDX76485.1| BnaA08g09150D [Brassica napus]
Length=605

 Score =   407 bits (1045),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 194/215 (90%), Positives = 205/215 (95%), Gaps = 1/215 (0%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            M+D RLTRIAIVSSD+CKPKKCRQECKKSCPVVKTGKLCIEVT  +K+AFISEELCIGCG
Sbjct  1    MAD-RLTRIAIVSSDRCKPKKCRQECKKSCPVVKTGKLCIEVTVGSKLAFISEELCIGCG  59

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            ICVKKCPFEAIQIINLP+DL+KDTTHRYG NTFKLHRLPVPRPGQVLGLVGTNGIGKSTA
Sbjct  60   ICVKKCPFEAIQIINLPRDLEKDTTHRYGANTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  119

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            LK+LAGKLKPNLGRF NPPDWQEILT+FRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA
Sbjct  120  LKILAGKLKPNLGRFTNPPDWQEILTHFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  179

Query  638  VQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNV  742
            V+GNVG+VLDQKDERD K ELC DLELNQV+D  V
Sbjct  180  VRGNVGEVLDQKDERDKKAELCADLELNQVIDRAV  214



>ref|XP_009108421.1| PREDICTED: ABC transporter E family member 2 [Brassica rapa]
 ref|XP_009108422.1| PREDICTED: ABC transporter E family member 2 [Brassica rapa]
 ref|XP_009108424.1| PREDICTED: ABC transporter E family member 2 [Brassica rapa]
Length=605

 Score =   406 bits (1044),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 194/215 (90%), Positives = 205/215 (95%), Gaps = 1/215 (0%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            M+D RLTRIAIVSSD+CKPKKCRQECKKSCPVVKTGKLCIEVT  +K+AFISEELCIGCG
Sbjct  1    MAD-RLTRIAIVSSDRCKPKKCRQECKKSCPVVKTGKLCIEVTVGSKLAFISEELCIGCG  59

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            ICVKKCPFEAIQIINLP+DL+KDTTHRYG NTFKLHRLPVPRPGQVLGLVGTNGIGKSTA
Sbjct  60   ICVKKCPFEAIQIINLPRDLEKDTTHRYGANTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  119

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            LK+LAGKLKPNLGRF NPPDWQEILT+FRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA
Sbjct  120  LKILAGKLKPNLGRFTNPPDWQEILTHFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  179

Query  638  VQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNV  742
            V+GNVG+VLDQKDERD K ELC DLELNQV+D  V
Sbjct  180  VRGNVGEVLDQKDERDKKAELCADLELNQVIDRAV  214



>ref|XP_010436484.1| PREDICTED: ABC transporter E family member 2-like [Camelina sativa]
Length=566

 Score =   405 bits (1040),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 193/215 (90%), Positives = 206/215 (96%), Gaps = 1/215 (0%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            M+D RLTRIAIVSSD+CKPKKCRQECKKSCPVVKTGKLCIEVT  +K+AFISEELCIGCG
Sbjct  1    MAD-RLTRIAIVSSDRCKPKKCRQECKKSCPVVKTGKLCIEVTVGSKLAFISEELCIGCG  59

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            ICVKKCPFEAIQIINLP+DL+KDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA
Sbjct  60   ICVKKCPFEAIQIINLPRDLEKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  119

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            LK+LAGKLKPNLGRF +PPDWQEILT+FRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA
Sbjct  120  LKILAGKLKPNLGRFTSPPDWQEILTHFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  179

Query  638  VQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNV  742
            V+GNVG+VLDQKDER  K ELC DLELNQV+D +V
Sbjct  180  VRGNVGEVLDQKDERGKKAELCADLELNQVIDRDV  214



>emb|CAA16710.1| RNase L inhibitor-like protein [Arabidopsis thaliana]
 emb|CAB78923.1| RNase L inhibitor-like protein [Arabidopsis thaliana]
Length=600

 Score =   405 bits (1042),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 192/215 (89%), Positives = 206/215 (96%), Gaps = 1/215 (0%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            M+D RLTRIAIVSSD+CKPKKCRQECKKSCPVVKTGKLCIEVT  +K+AFISEELCIGCG
Sbjct  1    MAD-RLTRIAIVSSDRCKPKKCRQECKKSCPVVKTGKLCIEVTVGSKLAFISEELCIGCG  59

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            ICVKKCPFEAIQIINLP+DL+KDTTHRYG NTFKLHRLPVPRPGQVLGLVGTNGIGKSTA
Sbjct  60   ICVKKCPFEAIQIINLPRDLEKDTTHRYGANTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  119

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            LK+LAGKLKPNLGRF +PPDWQEILT+FRGSELQNYFTRILEDNLKAIIKPQYVDHIP+A
Sbjct  120  LKILAGKLKPNLGRFTSPPDWQEILTHFRGSELQNYFTRILEDNLKAIIKPQYVDHIPRA  179

Query  638  VQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNV  742
            V+GNVG+VLDQKDERD K ELC DLELNQV+D +V
Sbjct  180  VKGNVGEVLDQKDERDKKAELCADLELNQVIDRDV  214



>ref|XP_009137000.1| PREDICTED: ABC transporter E family member 2-like [Brassica rapa]
 ref|XP_009137001.1| PREDICTED: ABC transporter E family member 2-like [Brassica rapa]
 ref|XP_009137002.1| PREDICTED: ABC transporter E family member 2-like [Brassica rapa]
 ref|XP_009137003.1| PREDICTED: ABC transporter E family member 2-like [Brassica rapa]
Length=605

 Score =   405 bits (1042),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 193/215 (90%), Positives = 206/215 (96%), Gaps = 1/215 (0%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            M+D RLTRIAIVSSD+CKPKKCRQECKKSCPVVKTGKLCIEVT  +K+AFISEELCIGCG
Sbjct  1    MAD-RLTRIAIVSSDRCKPKKCRQECKKSCPVVKTGKLCIEVTVGSKLAFISEELCIGCG  59

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            ICVKKCPFEAIQIINLP+DL+KDTTHRYG NTFKLHRLPVPRPGQVLGLVGTNGIG+STA
Sbjct  60   ICVKKCPFEAIQIINLPRDLEKDTTHRYGVNTFKLHRLPVPRPGQVLGLVGTNGIGQSTA  119

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            LK+LAGKLKPNLGRF NPPDWQEILT+FRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA
Sbjct  120  LKILAGKLKPNLGRFTNPPDWQEILTHFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  179

Query  638  VQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNV  742
            V+GNVG+VLDQKDERD K ELC DLELNQV+D +V
Sbjct  180  VRGNVGEVLDQKDERDKKAELCADLELNQVIDRDV  214



>ref|XP_010439735.1| PREDICTED: ABC transporter E family member 2 isoform X1 [Camelina 
sativa]
 ref|XP_010439736.1| PREDICTED: ABC transporter E family member 2 isoform X2 [Camelina 
sativa]
 ref|XP_010449372.1| PREDICTED: ABC transporter E family member 2 isoform X1 [Camelina 
sativa]
 ref|XP_010449373.1| PREDICTED: ABC transporter E family member 2 isoform X2 [Camelina 
sativa]
 ref|XP_010449374.1| PREDICTED: ABC transporter E family member 2 isoform X1 [Camelina 
sativa]
Length=605

 Score =   405 bits (1041),  Expect = 8e-135, Method: Compositional matrix adjust.
 Identities = 193/215 (90%), Positives = 206/215 (96%), Gaps = 1/215 (0%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            M+D RLTRIAIVSSD+CKPKKCRQECKKSCPVVKTGKLCIEVT  +K+AFISEELCIGCG
Sbjct  1    MAD-RLTRIAIVSSDRCKPKKCRQECKKSCPVVKTGKLCIEVTVGSKLAFISEELCIGCG  59

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            ICVKKCPFEAIQIINLP+DL+KDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA
Sbjct  60   ICVKKCPFEAIQIINLPRDLEKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  119

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            LK+LAGKLKPNLGRF +PPDWQEILT+FRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA
Sbjct  120  LKILAGKLKPNLGRFTSPPDWQEILTHFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  179

Query  638  VQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNV  742
            V+GNVG+VLDQKDER  K ELC DLELNQV+D +V
Sbjct  180  VRGNVGEVLDQKDERGKKAELCADLELNQVIDRDV  214



>ref|NP_193656.2| RNAse l inhibitor protein 2 [Arabidopsis thaliana]
 sp|Q8LPJ4.1|AB2E_ARATH RecName: Full=ABC transporter E family member 2; Short=ABC transporter 
ABCE.2; Short=AtABCE2; AltName: Full=RNase L inhibitor-like 
protein 2; Short=AtRLI2; Short=AthaRLI2 [Arabidopsis 
thaliana]
 gb|AAM20548.1| RNase L inhibitor-like protein [Arabidopsis thaliana]
 gb|AAN15617.1| RNase L inhibitor-like protein [Arabidopsis thaliana]
 dbj|BAE99009.1| RNase L inhibitor-like protein [Arabidopsis thaliana]
 gb|AEE84160.1| RNAse l inhibitor protein 2 [Arabidopsis thaliana]
Length=605

 Score =   404 bits (1038),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 192/215 (89%), Positives = 206/215 (96%), Gaps = 1/215 (0%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            M+D RLTRIAIVSSD+CKPKKCRQECKKSCPVVKTGKLCIEVT  +K+AFISEELCIGCG
Sbjct  1    MAD-RLTRIAIVSSDRCKPKKCRQECKKSCPVVKTGKLCIEVTVGSKLAFISEELCIGCG  59

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            ICVKKCPFEAIQIINLP+DL+KDTTHRYG NTFKLHRLPVPRPGQVLGLVGTNGIGKSTA
Sbjct  60   ICVKKCPFEAIQIINLPRDLEKDTTHRYGANTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  119

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            LK+LAGKLKPNLGRF +PPDWQEILT+FRGSELQNYFTRILEDNLKAIIKPQYVDHIP+A
Sbjct  120  LKILAGKLKPNLGRFTSPPDWQEILTHFRGSELQNYFTRILEDNLKAIIKPQYVDHIPRA  179

Query  638  VQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNV  742
            V+GNVG+VLDQKDERD K ELC DLELNQV+D +V
Sbjct  180  VKGNVGEVLDQKDERDKKAELCADLELNQVIDRDV  214



>ref|XP_003589457.1| RNase L inhibitor protein-like protein, partial [Medicago truncatula]
Length=670

 Score =   402 bits (1034),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 194/229 (85%), Positives = 207/229 (90%), Gaps = 13/229 (6%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            MSD+RLTRIAIV++DKCKPKKCRQECKKSCPVV TGKLC+EVT A+KIA+ISEELCIGCG
Sbjct  1    MSDERLTRIAIVNNDKCKPKKCRQECKKSCPVVGTGKLCVEVTSASKIAYISEELCIGCG  60

Query  278  ICVK-------------KCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVL  418
            ICVK             KCPF AI+IINLPK+LDKDTTHRYGPNTFKLHRLPVPRPGQVL
Sbjct  61   ICVKVLLFYSFTFLKMLKCPFGAIEIINLPKNLDKDTTHRYGPNTFKLHRLPVPRPGQVL  120

Query  419  GLVGTNGIGKSTALKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKA  598
            GLVGTNGIGKSTALKVLAGKLKPNLGRF  PPDWQEILT+FRGSELQNYFTRILED+LKA
Sbjct  121  GLVGTNGIGKSTALKVLAGKLKPNLGRFTEPPDWQEILTHFRGSELQNYFTRILEDDLKA  180

Query  599  IIKPQYVDHIPKAVQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNVG  745
            IIKPQYVDHIPKAVQGNVGQ LD K+ERDMKE+LC DLELNQV+D NVG
Sbjct  181  IIKPQYVDHIPKAVQGNVGQTLDSKNERDMKEKLCADLELNQVIDRNVG  229



>ref|XP_006836109.1| hypothetical protein AMTR_s00226p00014390 [Amborella trichopoda]
 gb|ERM98962.1| hypothetical protein AMTR_s00226p00014390 [Amborella trichopoda]
Length=605

 Score =   397 bits (1020),  Expect = 9e-132, Method: Compositional matrix adjust.
 Identities = 182/216 (84%), Positives = 204/216 (94%), Gaps = 0/216 (0%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            M+DQRL RIAIV++D+CKPK+CRQECKKSCPVV+TGKLCIEV+PA+KIA+ISEELCIGCG
Sbjct  1    MADQRLNRIAIVNADRCKPKECRQECKKSCPVVRTGKLCIEVSPASKIAYISEELCIGCG  60

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            ICVKKCPF+AIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA
Sbjct  61   ICVKKCPFDAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  120

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            LKVLAG+LKPNLGRF+NPPDW+EILTYFRGSELQ+YF R+LEDNLK  IKPQYVDHIPKA
Sbjct  121  LKVLAGRLKPNLGRFRNPPDWEEILTYFRGSELQDYFIRLLEDNLKPAIKPQYVDHIPKA  180

Query  638  VQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNVG  745
             +G V +VL QKDER M  E+C DLELN+V+DH++G
Sbjct  181  ARGTVREVLAQKDERGMMTEICCDLELNEVMDHDIG  216



>ref|XP_002528281.1| rnase l inhibitor, putative [Ricinus communis]
 gb|EEF34119.1| rnase l inhibitor, putative [Ricinus communis]
Length=591

 Score =   391 bits (1005),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 191/216 (88%), Positives = 198/216 (92%), Gaps = 15/216 (7%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            M+D RLTRIAIVSSD+CKPKKCRQECKKSCPVVKTG+LCIEVTPA+KIAFISEELCIGCG
Sbjct  1    MAD-RLTRIAIVSSDRCKPKKCRQECKKSCPVVKTGRLCIEVTPASKIAFISEELCIGCG  59

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA
Sbjct  60   ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  119

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            L              KNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA
Sbjct  120  L--------------KNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  165

Query  638  VQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNVG  745
            VQGNVGQVLDQKDER+MK ELC DL+LNQV+D NVG
Sbjct  166  VQGNVGQVLDQKDEREMKAELCHDLQLNQVIDRNVG  201



>ref|XP_002303221.1| RNase L inhibitor family protein [Populus trichocarpa]
 gb|EEE78200.1| RNase L inhibitor family protein [Populus trichocarpa]
Length=611

 Score =   390 bits (1001),  Expect = 9e-129, Method: Compositional matrix adjust.
 Identities = 196/222 (88%), Positives = 206/222 (93%), Gaps = 7/222 (3%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            M+D RLTRIAIV+SD+CKPKKCRQECKKSCPVVKTGKLCIEVTP +KIAFISEELCIGCG
Sbjct  1    MAD-RLTRIAIVTSDRCKPKKCRQECKKSCPVVKTGKLCIEVTPISKIAFISEELCIGCG  59

Query  278  ------ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNG  439
                  + ++KCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNG
Sbjct  60   ICGIIYLLMQKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNG  119

Query  440  IGKSTALKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYV  619
            IGKSTALKVLAGKLKPNLGRF NPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYV
Sbjct  120  IGKSTALKVLAGKLKPNLGRFNNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYV  179

Query  620  DHIPKAVQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNVG  745
            DHIP+AVQGNVGQVLDQKDE   K ELC DL+LNQV+D NVG
Sbjct  180  DHIPRAVQGNVGQVLDQKDESHRKAELCRDLDLNQVIDRNVG  221



>ref|XP_006430898.1| hypothetical protein CICLE_v10011325mg [Citrus clementina]
 gb|ESR44138.1| hypothetical protein CICLE_v10011325mg [Citrus clementina]
Length=584

 Score =   375 bits (964),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 185/216 (86%), Positives = 190/216 (88%), Gaps = 22/216 (10%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            MSD RLTRIAIVSSD+CKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG
Sbjct  1    MSD-RLTRIAIVSSDRCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  59

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA
Sbjct  60   ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  119

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            LK+LAGKLKPNLGRF NPPDWQEILTYFRGSELQNYFTRILEDNLK              
Sbjct  120  LKILAGKLKPNLGRFNNPPDWQEILTYFRGSELQNYFTRILEDNLK--------------  165

Query  638  VQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNVG  745
                   VLDQKDERDMK +LC DL+LNQV+D NVG
Sbjct  166  -------VLDQKDERDMKADLCADLDLNQVIDRNVG  194



>emb|CDY09282.1| BnaC03g63120D [Brassica napus]
Length=595

 Score =   374 bits (959),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 182/215 (85%), Positives = 194/215 (90%), Gaps = 11/215 (5%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            M+D RLTRIAIVSSD+CKPKKCRQECKKSCPVVKTGKLCIEVT  +K+AFISEELCIGC 
Sbjct  1    MAD-RLTRIAIVSSDRCKPKKCRQECKKSCPVVKTGKLCIEVTVGSKLAFISEELCIGC-  58

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
                     AIQIINLP+DL+KDTTHRYG NTFKLHRLPVPRPGQVLG VGTNGIGKSTA
Sbjct  59   ---------AIQIINLPRDLEKDTTHRYGANTFKLHRLPVPRPGQVLGFVGTNGIGKSTA  109

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            LK+LAGKLKPNLGRF NPPDWQEILT+FRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA
Sbjct  110  LKILAGKLKPNLGRFTNPPDWQEILTHFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  169

Query  638  VQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNV  742
            V+GNVG+VLDQKDER+ K ELC DLELNQV+D  V
Sbjct  170  VRGNVGEVLDQKDERNKKAELCADLELNQVIDRAV  204



>ref|XP_003572083.1| PREDICTED: ABC transporter E family member 2-like isoform X1 
[Brachypodium distachyon]
Length=600

 Score =   371 bits (953),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 173/209 (83%), Positives = 193/209 (92%), Gaps = 0/209 (0%)
 Frame = +2

Query  116  TRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCGICVKKC  295
            TRIAI++ D+CKPKKCRQECKKSCPVVKTGK CIEV P +K AFISEELCIGCGICVKKC
Sbjct  4    TRIAILNEDRCKPKKCRQECKKSCPVVKTGKHCIEVNPTSKSAFISEELCIGCGICVKKC  63

Query  296  PFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTALKVLAG  475
            PF+AIQIINLPKDLDKDTTHRYG NTFKLHRLPVPRPGQVLGL+G NGIGKSTALKVL G
Sbjct  64   PFDAIQIINLPKDLDKDTTHRYGANTFKLHRLPVPRPGQVLGLIGANGIGKSTALKVLQG  123

Query  476  KLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKAVQGNVG  655
            K+KPNLGRFKNPPDWQEILTYFRGSELQNYFTR+LEDNLKAIIK Q V+ IP+ VQGNVG
Sbjct  124  KIKPNLGRFKNPPDWQEILTYFRGSELQNYFTRMLEDNLKAIIKRQDVERIPEKVQGNVG  183

Query  656  QVLDQKDERDMKEELCVDLELNQVLDHNV  742
            ++L++ D+R M ++LC+DLELNQ+LD N+
Sbjct  184  KLLERLDQRGMIDQLCIDLELNQLLDRNI  212



>ref|XP_008227933.1| PREDICTED: ABC transporter E family member 2-like isoform X1 
[Prunus mume]
Length=601

 Score =   366 bits (939),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 171/213 (80%), Positives = 192/213 (90%), Gaps = 0/213 (0%)
 Frame = +2

Query  104  DQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCGIC  283
            + R TRIAIV+ DKCKPKKC QECK++CPVV+TGKLCIEV P +K+A ISEELCIGCGIC
Sbjct  2    ENRSTRIAIVNIDKCKPKKCNQECKRTCPVVRTGKLCIEVKPVSKVARISEELCIGCGIC  61

Query  284  VKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTALK  463
            VKKCPF AI+IINLPK LDKDTT+RYG N+FKLHRLPVPRPG+VLGLVGTNGIGKSTALK
Sbjct  62   VKKCPFGAIEIINLPKALDKDTTYRYGSNSFKLHRLPVPRPGEVLGLVGTNGIGKSTALK  121

Query  464  VLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKAVQ  643
            +LAGKLKPNLGRF NPP+WQEILTYFRGSELQ+YF R+LED LKA+IKPQYVDHIPK  +
Sbjct  122  ILAGKLKPNLGRFNNPPNWQEILTYFRGSELQSYFIRLLEDKLKAVIKPQYVDHIPKVAE  181

Query  644  GNVGQVLDQKDERDMKEELCVDLELNQVLDHNV  742
            GNVG++L QKDER + EE+ VDLELNQVLD  V
Sbjct  182  GNVGELLKQKDERGVMEEVIVDLELNQVLDRKV  214



>ref|XP_007217624.1| hypothetical protein PRUPE_ppa015638mg [Prunus persica]
 gb|EMJ18823.1| hypothetical protein PRUPE_ppa015638mg [Prunus persica]
Length=601

 Score =   365 bits (937),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 170/213 (80%), Positives = 193/213 (91%), Gaps = 0/213 (0%)
 Frame = +2

Query  104  DQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCGIC  283
            + R TRIAIV++DKCKPKKC QECK++CPVV+TGKLCIEV P +K+A ISEELCIGCGIC
Sbjct  2    ENRSTRIAIVNTDKCKPKKCNQECKRTCPVVRTGKLCIEVKPVSKVARISEELCIGCGIC  61

Query  284  VKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTALK  463
            VKKCPF AI+IINLPK LDKDTT+RYG N+FKLHRLPVPRPG+VLGLVGTNGIGKSTALK
Sbjct  62   VKKCPFGAIEIINLPKALDKDTTYRYGSNSFKLHRLPVPRPGEVLGLVGTNGIGKSTALK  121

Query  464  VLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKAVQ  643
            +LAGKLKPNLGRF NPP+WQEILTYFRGSELQ+YF R+LED LKA+IKPQYVD+IPK  +
Sbjct  122  ILAGKLKPNLGRFNNPPNWQEILTYFRGSELQSYFIRLLEDKLKAVIKPQYVDYIPKVAE  181

Query  644  GNVGQVLDQKDERDMKEELCVDLELNQVLDHNV  742
            GNVG++L QKDER + EE+ VDLELNQVLD  V
Sbjct  182  GNVGELLKQKDERGVMEEVIVDLELNQVLDRKV  214



>ref|XP_009117623.1| PREDICTED: ABC transporter E family member 1 [Brassica rapa]
Length=603

 Score =   363 bits (932),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 171/212 (81%), Positives = 192/212 (91%), Gaps = 1/212 (0%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            M+D RLTRIAIVS D+CKPKKCRQECKKSCPVVKTG+LCIEVTP +K AF+SEELCIGCG
Sbjct  1    MAD-RLTRIAIVSEDRCKPKKCRQECKKSCPVVKTGRLCIEVTPTSKTAFLSEELCIGCG  59

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            ICVKKCPFEAIQIINLPKDL+KDTTHRY  N FKLHRLPVPRPGQVLGLVGTNGIGKSTA
Sbjct  60   ICVKKCPFEAIQIINLPKDLEKDTTHRYRSNAFKLHRLPVPRPGQVLGLVGTNGIGKSTA  119

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            LK+LAGKLKPNLGRF NPPDWQEIL +FRGSELQ+YFTR++E+NLK  IKPQ+VD I K 
Sbjct  120  LKILAGKLKPNLGRFDNPPDWQEILAHFRGSELQSYFTRVVEENLKTAIKPQHVDQIKKI  179

Query  638  VQGNVGQVLDQKDERDMKEELCVDLELNQVLD  733
            VQG++G++L++ DER M E++  DLELN VLD
Sbjct  180  VQGDLGKMLEKLDERGMMEQIVADLELNPVLD  211



>emb|CDY60809.1| BnaA01g37290D [Brassica napus]
Length=603

 Score =   363 bits (932),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 171/212 (81%), Positives = 192/212 (91%), Gaps = 1/212 (0%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            M+D RLTRIAIVS D+CKPKKCRQECKKSCPVVKTG+LCIEVTP +K AF+SEELCIGCG
Sbjct  1    MAD-RLTRIAIVSEDRCKPKKCRQECKKSCPVVKTGRLCIEVTPTSKTAFLSEELCIGCG  59

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            ICVKKCPFEAIQIINLPKDL+KDTTHRY  N FKLHRLPVPRPGQVLGLVGTNGIGKSTA
Sbjct  60   ICVKKCPFEAIQIINLPKDLEKDTTHRYRSNAFKLHRLPVPRPGQVLGLVGTNGIGKSTA  119

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            LK+LAGKLKPNLGRF NPPDWQEIL +FRGSELQ+YFTR++E+NLK  IKPQ+VD I K 
Sbjct  120  LKILAGKLKPNLGRFDNPPDWQEILAHFRGSELQSYFTRVVEENLKTAIKPQHVDQIKKI  179

Query  638  VQGNVGQVLDQKDERDMKEELCVDLELNQVLD  733
            VQG++G++L++ DER M E++  DLELN VLD
Sbjct  180  VQGDLGKMLEKLDERGMMEQIVADLELNPVLD  211



>ref|XP_011395697.1| ABC transporter E family member 2 [Auxenochlorella protothecoides]
 gb|KFM22831.1| ABC transporter E family member 2 [Auxenochlorella protothecoides]
Length=631

 Score =   364 bits (934),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 176/231 (76%), Positives = 196/231 (85%), Gaps = 17/231 (7%)
 Frame = +2

Query  101  SDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCGI  280
            S+Q LTRIAIVSSDKCKPKKCRQECKKSCPVVK GKLC+EV P +KIA+ISEELCIGCGI
Sbjct  12   SEQTLTRIAIVSSDKCKPKKCRQECKKSCPVVKVGKLCVEVVPTSKIAWISEELCIGCGI  71

Query  281  CVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTAL  460
            CVKKCPF+AI IINLPKDL+K+TTHRYG NTFKLHRLPVPRPGQVLGLVG+NG GKSTAL
Sbjct  72   CVKKCPFDAIMIINLPKDLEKETTHRYGANTFKLHRLPVPRPGQVLGLVGSNGTGKSTAL  131

Query  461  KVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIP---  631
            K+LAGKLKPNLG+F +PPDW +ILT+FRGSELQNYFTRILED++KAIIKPQYVDHIP   
Sbjct  132  KILAGKLKPNLGKFNSPPDWADILTHFRGSELQNYFTRILEDDVKAIIKPQYVDHIPKAR  191

Query  632  --------------KAVQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNV  742
                          KAV+GNVG VL++KD+R  KE L  DL+L QV D NV
Sbjct  192  QGAGQWSRLHLAVLKAVRGNVGVVLEEKDQRGQKEALLRDLDLEQVTDRNV  242



>ref|XP_010500834.1| PREDICTED: ABC transporter E family member 1 isoform X2 [Camelina 
sativa]
 ref|XP_010500842.1| PREDICTED: ABC transporter E family member 1 isoform X2 [Camelina 
sativa]
Length=603

 Score =   362 bits (929),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 168/215 (78%), Positives = 193/215 (90%), Gaps = 1/215 (0%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            M+D RLTRIAI+S D+CKPKKCRQECKKSCPVVKTGKLCIEV P +K AF+SEELCIGCG
Sbjct  1    MAD-RLTRIAIISEDRCKPKKCRQECKKSCPVVKTGKLCIEVAPTSKTAFLSEELCIGCG  59

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            ICVKKCPFEAIQIINLPKDL+KDTTHRYG N FKLHRLPVPRPGQVLGLVGTNGIGKSTA
Sbjct  60   ICVKKCPFEAIQIINLPKDLEKDTTHRYGANGFKLHRLPVPRPGQVLGLVGTNGIGKSTA  119

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            LK+LAGKLKPNLG+F NPPDW++ILT FRGSELQ+YF R++E+NLK  IKPQ+VDHI + 
Sbjct  120  LKILAGKLKPNLGKFNNPPDWEDILTRFRGSELQSYFIRVVEENLKTAIKPQHVDHIKEV  179

Query  638  VQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNV  742
            V+ N+G+VL++ DER M EE+C D+ELNQ+L+   
Sbjct  180  VRDNLGKVLEKLDERGMVEEICADMELNQILEREA  214



>ref|XP_006296689.1| hypothetical protein CARUB_v10013264mg [Capsella rubella]
 gb|EOA29587.1| hypothetical protein CARUB_v10013264mg [Capsella rubella]
Length=603

 Score =   362 bits (928),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 167/215 (78%), Positives = 194/215 (90%), Gaps = 1/215 (0%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            M+D RLTRIAIVS D+CKPKKCRQECKKSCPVVKTGKLCIEV P +K AF+SE LCIGCG
Sbjct  1    MAD-RLTRIAIVSEDRCKPKKCRQECKKSCPVVKTGKLCIEVAPTSKTAFLSEALCIGCG  59

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            ICVKKCPFEAIQIINLPKDL+KDTTHRYG N FKLHRLPVPRPGQVLGLVGTNGIGKSTA
Sbjct  60   ICVKKCPFEAIQIINLPKDLEKDTTHRYGANGFKLHRLPVPRPGQVLGLVGTNGIGKSTA  119

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            LK+LAGKLKPNLG+F NPPDW++ILT+FRGSELQ+YF R++E+NLK  IKPQ+VDHI + 
Sbjct  120  LKILAGKLKPNLGKFNNPPDWEDILTHFRGSELQSYFIRVVEENLKTAIKPQHVDHIKEV  179

Query  638  VQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNV  742
            V+GN+G++L++ DER + EE+C D+ELNQ+L+   
Sbjct  180  VRGNLGKMLEKLDERGLMEEICDDMELNQILEREA  214



>ref|XP_006299795.1| hypothetical protein CARUB_v10015991mg [Capsella rubella]
 gb|EOA32693.1| hypothetical protein CARUB_v10015991mg [Capsella rubella]
Length=603

 Score =   361 bits (927),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 167/215 (78%), Positives = 194/215 (90%), Gaps = 1/215 (0%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            M+D RLTRIAIVS D+CKPKKCRQECKKSCPVVKTGKLCIEV P +K AF+SE LCIGCG
Sbjct  1    MAD-RLTRIAIVSEDRCKPKKCRQECKKSCPVVKTGKLCIEVAPTSKTAFLSEALCIGCG  59

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            ICVKKCPFEAIQIINLPKDL+KDTTHRYG N FKLHRLPVPRPGQVLGLVGTNGIGKSTA
Sbjct  60   ICVKKCPFEAIQIINLPKDLEKDTTHRYGANGFKLHRLPVPRPGQVLGLVGTNGIGKSTA  119

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            LK+LAGKLKPNLG+F NPPDW++ILT+FRGSELQ+YF R++E+NLK  IKPQ+VDHI + 
Sbjct  120  LKILAGKLKPNLGKFNNPPDWEDILTHFRGSELQSYFIRVVEENLKTAIKPQHVDHIKEV  179

Query  638  VQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNV  742
            V+GN+G++L++ DER + EE+C D+ELNQ+L+   
Sbjct  180  VRGNLGKMLEKLDERGLMEEICDDMELNQILEREA  214



>ref|XP_010487122.1| PREDICTED: ABC transporter E family member 1-like [Camelina sativa]
 ref|XP_010487123.1| PREDICTED: ABC transporter E family member 1-like [Camelina sativa]
Length=603

 Score =   361 bits (926),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 168/215 (78%), Positives = 192/215 (89%), Gaps = 1/215 (0%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            M+D RLTRIAI+S D+CKPKKCRQECKKSCPVVKTGKLCIEV P +K AF+SEELCIGCG
Sbjct  1    MAD-RLTRIAIISEDRCKPKKCRQECKKSCPVVKTGKLCIEVAPTSKTAFLSEELCIGCG  59

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            ICVKKCPFEAIQIINLPKDL+KDTTHRY  N FKLHRLPVPRPGQVLGLVGTNGIGKSTA
Sbjct  60   ICVKKCPFEAIQIINLPKDLEKDTTHRYNANGFKLHRLPVPRPGQVLGLVGTNGIGKSTA  119

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            LK+LAGKLKPNLG+F NPPDW+EILT FRGSELQ+YF R++E+NLK  IKPQ+VDHI + 
Sbjct  120  LKILAGKLKPNLGKFNNPPDWEEILTRFRGSELQSYFIRVVEENLKTAIKPQHVDHIKEV  179

Query  638  VQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNV  742
            V+ N+G+VL++ DER M EE+C D+ELNQ+L+   
Sbjct  180  VRDNLGKVLEKLDERGMVEEICADMELNQILEREA  214



>ref|NP_187973.1| ABC transporter E family member 1 [Arabidopsis thaliana]
 sp|Q9LID6.1|AB1E_ARATH RecName: Full=ABC transporter E family member 1; Short=ABC transporter 
ABCE.1; Short=AtABCE1; AltName: Full=RNase L inhibitor-like 
protein 1; Short=AtRLI1; Short=AthaRLI1 [Arabidopsis 
thaliana]
 dbj|BAB01911.1| RNase L inhibitor [Arabidopsis thaliana]
 gb|AAO41992.1| putative RNase L inhibitor protein [Arabidopsis thaliana]
 gb|AAO50575.1| putative RNase L inhibitor protein [Arabidopsis thaliana]
 gb|AEE75386.1| ABC transporter E family member 1 [Arabidopsis thaliana]
Length=603

 Score =   360 bits (924),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 169/215 (79%), Positives = 192/215 (89%), Gaps = 1/215 (0%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            MSD RLTRIAIVS D+CKPKKCRQECKKSCPVVKTGKLCIEV   +K AFISEELCIGCG
Sbjct  1    MSD-RLTRIAIVSEDRCKPKKCRQECKKSCPVVKTGKLCIEVGSTSKSAFISEELCIGCG  59

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            ICVKKCPFEAIQIINLPKDL KDTTHRYG N FKLHRLP+PRPGQVLGLVGTNGIGKSTA
Sbjct  60   ICVKKCPFEAIQIINLPKDLAKDTTHRYGANGFKLHRLPIPRPGQVLGLVGTNGIGKSTA  119

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            LK+LAGKLKPNLGRF  PPDW+EILT+FRGSELQ+YF R++E+NLK  IKPQ+VD+I + 
Sbjct  120  LKILAGKLKPNLGRFNTPPDWEEILTHFRGSELQSYFIRVVEENLKTAIKPQHVDYIKEV  179

Query  638  VQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNV  742
            V+GN+G++L++ DER + EE+C D+ELNQVL+   
Sbjct  180  VRGNLGKMLEKLDERGLMEEICADMELNQVLEREA  214



>gb|KEH28590.1| RNase L inhibitor ABC domain protein [Medicago truncatula]
Length=600

 Score =   359 bits (921),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 169/210 (80%), Positives = 188/210 (90%), Gaps = 0/210 (0%)
 Frame = +2

Query  113  LTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCGICVKK  292
            +TRIAIV+ D+CKPKKCRQECKKSCPVVKTGKLCIEV  A+KIA++SEELC GCGICVKK
Sbjct  1    MTRIAIVNEDRCKPKKCRQECKKSCPVVKTGKLCIEVNSASKIAYLSEELCNGCGICVKK  60

Query  293  CPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTALKVLA  472
            CPFEAI+IINLP++LDK+TTHRYGPNTFKLHRLP+PRPG+VLGLVG NGIGKSTALKVLA
Sbjct  61   CPFEAIKIINLPENLDKETTHRYGPNTFKLHRLPIPRPGKVLGLVGKNGIGKSTALKVLA  120

Query  473  GKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKAVQGNV  652
            G+L+PNLGRF NPP W EILT+FRGSELQNYFTR   + LKAIIKPQYVD   +  Q NV
Sbjct  121  GELEPNLGRFTNPPKWPEILTFFRGSELQNYFTRFRGEGLKAIIKPQYVDDFRRKEQVNV  180

Query  653  GQVLDQKDERDMKEELCVDLELNQVLDHNV  742
            GQ LDQK+ERDMKEELC  LELNQV+D NV
Sbjct  181  GQALDQKNERDMKEELCAALELNQVIDRNV  210



>gb|EMS57600.1| ABC transporter E family member 2 [Triticum urartu]
Length=632

 Score =   360 bits (923),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 172/200 (86%), Positives = 181/200 (91%), Gaps = 6/200 (3%)
 Frame = +2

Query  146  CKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCGICVKKCPFEAIQIINL  325
            C PK        S  V   GKLCIEV PA+K++FISEELCIGCGICVKKCPF+AI+IINL
Sbjct  21   CPPKTV------SAAVADKGKLCIEVGPASKVSFISEELCIGCGICVKKCPFDAIEIINL  74

Query  326  PKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTALKVLAGKLKPNLGRFK  505
            PKDL+KDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTALKVLAGKLKPNLGRFK
Sbjct  75   PKDLEKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTALKVLAGKLKPNLGRFK  134

Query  506  NPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKAVQGNVGQVLDQKDERD  685
            NPPDWQEILTYFRGSELQNYFTR+LEDNLKAIIKPQYVDHIPKAV GNVGQVL+ KDERD
Sbjct  135  NPPDWQEILTYFRGSELQNYFTRLLEDNLKAIIKPQYVDHIPKAVHGNVGQVLELKDERD  194

Query  686  MKEELCVDLELNQVLDHNVG  745
            MK ELCVDLELNQV+D NVG
Sbjct  195  MKAELCVDLELNQVIDRNVG  214



>ref|XP_008227934.1| PREDICTED: ABC transporter E family member 2-like isoform X2 
[Prunus mume]
Length=599

 Score =   358 bits (918),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 169/213 (79%), Positives = 190/213 (89%), Gaps = 2/213 (1%)
 Frame = +2

Query  104  DQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCGIC  283
            + R TRIAIV+ DKCKPKKC QECK++CPVV+TGKLCIEV P +K+A ISEELCIGCGIC
Sbjct  2    ENRSTRIAIVNIDKCKPKKCNQECKRTCPVVRTGKLCIEVKPVSKVARISEELCIGCGIC  61

Query  284  VKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTALK  463
              KCPF AI+IINLPK LDKDTT+RYG N+FKLHRLPVPRPG+VLGLVGTNGIGKSTALK
Sbjct  62   --KCPFGAIEIINLPKALDKDTTYRYGSNSFKLHRLPVPRPGEVLGLVGTNGIGKSTALK  119

Query  464  VLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKAVQ  643
            +LAGKLKPNLGRF NPP+WQEILTYFRGSELQ+YF R+LED LKA+IKPQYVDHIPK  +
Sbjct  120  ILAGKLKPNLGRFNNPPNWQEILTYFRGSELQSYFIRLLEDKLKAVIKPQYVDHIPKVAE  179

Query  644  GNVGQVLDQKDERDMKEELCVDLELNQVLDHNV  742
            GNVG++L QKDER + EE+ VDLELNQVLD  V
Sbjct  180  GNVGELLKQKDERGVMEEVIVDLELNQVLDRKV  212



>gb|KDD74545.1| hypothetical protein H632_c1239p0 [Helicosporidium sp. ATCC 50920]
Length=612

 Score =   357 bits (915),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 167/214 (78%), Positives = 188/214 (88%), Gaps = 0/214 (0%)
 Frame = +2

Query  101  SDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCGI  280
            SD+  TRIAIVS+DKCKPKKC+QECKKSCPVVK GKLCIEVTP +K +FISEELCIGCGI
Sbjct  11   SDETPTRIAIVSADKCKPKKCKQECKKSCPVVKIGKLCIEVTPTSKSSFISEELCIGCGI  70

Query  281  CVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTAL  460
            CVKKCPF+AI IINLPKDL + TTHRYGPN+FKLHRLP PRPGQVLGLVG+NG GKSTAL
Sbjct  71   CVKKCPFDAIAIINLPKDLARQTTHRYGPNSFKLHRLPSPRPGQVLGLVGSNGTGKSTAL  130

Query  461  KVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKAV  640
            K+LAG+LKPNLG+F +PPDW +ILTYFRGSELQNYFTR+LED ++AIIKPQYVDHIPKAV
Sbjct  131  KILAGRLKPNLGQFGSPPDWNDILTYFRGSELQNYFTRLLEDGVRAIIKPQYVDHIPKAV  190

Query  641  QGNVGQVLDQKDERDMKEELCVDLELNQVLDHNV  742
            +GNV  +L +KD R +  EL   LEL QV D NV
Sbjct  191  RGNVLTLLKEKDSRGVMAELLDSLELRQVTDRNV  224



>ref|XP_010465207.1| PREDICTED: ABC transporter E family member 1-like [Camelina sativa]
 ref|XP_010465208.1| PREDICTED: ABC transporter E family member 1-like [Camelina sativa]
Length=603

 Score =   356 bits (914),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 166/215 (77%), Positives = 191/215 (89%), Gaps = 1/215 (0%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            M+D RLTRIAI+S D+C+PKKCRQE KKSCPVVKTGKLCIEV P +K AF+SEELCIGCG
Sbjct  1    MAD-RLTRIAIISEDRCQPKKCRQERKKSCPVVKTGKLCIEVAPTSKTAFLSEELCIGCG  59

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            ICVKKCPFEAIQIINLPKDL+KDTTHRY  N FKLHRLPVPRPGQVLGLVGTNGIGKSTA
Sbjct  60   ICVKKCPFEAIQIINLPKDLEKDTTHRYNANGFKLHRLPVPRPGQVLGLVGTNGIGKSTA  119

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            LK+LAGKLKPNLG+F NPPDW+EILT FRGSELQ+YF R++E+NLK  IKPQ+VDHI + 
Sbjct  120  LKILAGKLKPNLGKFNNPPDWEEILTRFRGSELQSYFIRVVEENLKTAIKPQHVDHIKQV  179

Query  638  VQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNV  742
            V+ N+G+VL++ DER M EE+C D+ELNQ+L+   
Sbjct  180  VKDNLGEVLEKLDERGMVEEICADMELNQILEREA  214



>ref|XP_006815890.1| PREDICTED: ATP-binding cassette sub-family E member 1-like [Saccoglossus 
kowalevskii]
Length=493

 Score =   352 bits (904),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 162/215 (75%), Positives = 184/215 (86%), Gaps = 0/215 (0%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            MS  +LTRIAIVS+DKCKPK+CRQECKKSCPVV+ GKLCIEVT   KIA+ISEELCIGCG
Sbjct  1    MSQDKLTRIAIVSTDKCKPKRCRQECKKSCPVVRMGKLCIEVTSNDKIAYISEELCIGCG  60

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            IC KKCPFEAI IINLP +L++DTTHRY  N+FKLHRLP+PRPG+VLGLVGTNGIGKSTA
Sbjct  61   ICAKKCPFEAISIINLPSNLERDTTHRYSANSFKLHRLPMPRPGEVLGLVGTNGIGKSTA  120

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            LK+LAGK KPNLGRF  PPDW +ILTYFRGSELQNYFT+ILED+LKAIIKPQYVD IPKA
Sbjct  121  LKILAGKQKPNLGRFNEPPDWTDILTYFRGSELQNYFTKILEDDLKAIIKPQYVDQIPKA  180

Query  638  VQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNV  742
            V G V  +LD+KD+   +  +C  L+L  + D NV
Sbjct  181  VTGTVQSLLDRKDDTKTQVPVCKQLDLLHIRDRNV  215



>ref|XP_003746536.1| PREDICTED: ATP-binding cassette sub-family E member 1-like [Metaseiulus 
occidentalis]
Length=608

 Score =   355 bits (912),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 168/222 (76%), Positives = 190/222 (86%), Gaps = 0/222 (0%)
 Frame = +2

Query  80   RLVKREMSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEE  259
            R +K+E    +LTRIAIVS+DKCKPK+CRQECKKSCPVV+ GKLCIEVTP  KIA ISE 
Sbjct  3    RNLKKEDLQDKLTRIAIVSTDKCKPKRCRQECKKSCPVVRMGKLCIEVTPNDKIAEISEN  62

Query  260  LCIGCGICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNG  439
            LCIGCGIC+KKCPFEAI IINLP +L+KDTTHRY  N+FKLHRLP PRPG+VLGLVGTNG
Sbjct  63   LCIGCGICIKKCPFEAIMIINLPSNLEKDTTHRYSANSFKLHRLPTPRPGEVLGLVGTNG  122

Query  440  IGKSTALKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYV  619
            IGKSTALK+LAGKLKPNLGR+ +PPDW EIL YFRGSELQNYFTRILED+L+A+IKPQYV
Sbjct  123  IGKSTALKILAGKLKPNLGRYNDPPDWTEILAYFRGSELQNYFTRILEDDLRAVIKPQYV  182

Query  620  DHIPKAVQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNVG  745
            D IPKAV+G V Q+LD+KDE   K  L   LELN V+D  +G
Sbjct  183  DQIPKAVKGTVRQLLDKKDEMGKKTHLADILELNSVMDRQIG  224



>ref|XP_002184067.1| phosphatase [Phaeodactylum tricornutum CCAP 1055/1]
 gb|EEC44245.1| phosphatase, partial [Phaeodactylum tricornutum CCAP 1055/1]
Length=623

 Score =   355 bits (912),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 166/214 (78%), Positives = 187/214 (87%), Gaps = 6/214 (3%)
 Frame = +2

Query  119  RIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCGICVKKCP  298
            RIAI+SS++C+PKKCRQECKKSCPVVK GKLCIEVTP +K+AFISE LCIGCGICVKKCP
Sbjct  1    RIAIISSERCRPKKCRQECKKSCPVVKLGKLCIEVTPKSKLAFISEPLCIGCGICVKKCP  60

Query  299  FEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTALKVLAGK  478
            FEAI IINLPKDL K+TTHRYGPN+FKLHRLP+PRPGQVLGLVGTNGIGKSTALK+LAGK
Sbjct  61   FEAIAIINLPKDLSKNTTHRYGPNSFKLHRLPMPRPGQVLGLVGTNGIGKSTALKILAGK  120

Query  479  LKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKAVQGNVGQ  658
            +KPNLGRF NPPDW+EIL +FRGSELQNYFT+ILED +KA IKPQYVDHIP+A++G VG 
Sbjct  121  MKPNLGRFDNPPDWEEILVHFRGSELQNYFTKILEDTMKATIKPQYVDHIPRAIKGKVGD  180

Query  659  VLDQKDERDMKEELCV------DLELNQVLDHNV  742
            +L QKDER   EE  V        ELN +LD +V
Sbjct  181  ILKQKDERSEAEEWDVLNWATTQAELNHLLDRDV  214



>ref|XP_002153953.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Hydra 
vulgaris]
Length=605

 Score =   354 bits (909),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 162/214 (76%), Positives = 190/214 (89%), Gaps = 0/214 (0%)
 Frame = +2

Query  101  SDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCGI  280
            +  +LTRIAIV+SD+CKPKKCRQECK+SCPVV+ GKLCIEV P +K+A+ISE+LCIGCGI
Sbjct  6    TQDKLTRIAIVNSDRCKPKKCRQECKRSCPVVRQGKLCIEVVPTSKLAYISEQLCIGCGI  65

Query  281  CVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTAL  460
            CVKKCPFEAI IINLP +L+KDTTHRY  N+FKLHRLP+PRPG+VLGLVGTNGIGKSTAL
Sbjct  66   CVKKCPFEAITIINLPSNLEKDTTHRYNANSFKLHRLPMPRPGEVLGLVGTNGIGKSTAL  125

Query  461  KVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKAV  640
            K+LAGKLKPNLGRF NPPDWQEIL YFRGSELQNYFT++LED+LKAIIKPQYVD IPKA+
Sbjct  126  KILAGKLKPNLGRFSNPPDWQEILQYFRGSELQNYFTKVLEDDLKAIIKPQYVDQIPKAI  185

Query  641  QGNVGQVLDQKDERDMKEELCVDLELNQVLDHNV  742
            +GNV + L++KDE + K+  C + +L  VL  NV
Sbjct  186  KGNVIEFLNKKDETNTKDLYCDEFDLQHVLTRNV  219



>gb|AAX26766.2| SJCHGC05773 protein [Schistosoma japonicum]
Length=229

 Score =   341 bits (874),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 159/200 (80%), Positives = 182/200 (91%), Gaps = 0/200 (0%)
 Frame = +2

Query  101  SDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCGI  280
            + ++LTRIAIVSSDKCKPKKCRQECK+SCPVV+ GKLCIEVTP  KIAF+SEELCIGCGI
Sbjct  15   TQEKLTRIAIVSSDKCKPKKCRQECKRSCPVVRMGKLCIEVTPNDKIAFLSEELCIGCGI  74

Query  281  CVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTAL  460
            C KKCPFEAI IINLP +L+K+ THRYGPN+FKLHRLP+PRPG+VLGLVGTNGIGKS+AL
Sbjct  75   CCKKCPFEAISIINLPSNLEKEVTHRYGPNSFKLHRLPMPRPGEVLGLVGTNGIGKSSAL  134

Query  461  KVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKAV  640
            K+LAGKLKPNLGRFKNPPDW EILTYFRGSELQNYFT+ILEDNLKA+IKPQYVD IPK V
Sbjct  135  KILAGKLKPNLGRFKNPPDWTEILTYFRGSELQNYFTKILEDNLKAVIKPQYVDQIPKIV  194

Query  641  QGNVGQVLDQKDERDMKEEL  700
             G V  +L++KD+R  ++ +
Sbjct  195  SGEVRTLLNRKDDRGNQDHV  214



>gb|EMT04752.1| ABC transporter E family member 2 [Aegilops tauschii]
Length=755

 Score =   358 bits (918),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 168/181 (93%), Positives = 177/181 (98%), Gaps = 0/181 (0%)
 Frame = +2

Query  203  GKLCIEVTPAAKIAFISEELCIGCGICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKL  382
            GKLCIEV PA+K++FISEELCIGCGICVKKCPF+AI+IINLPKDL+KDTTHRYGPNTFKL
Sbjct  186  GKLCIEVGPASKVSFISEELCIGCGICVKKCPFDAIEIINLPKDLEKDTTHRYGPNTFKL  245

Query  383  HRLPVPRPGQVLGLVGTNGIGKSTALKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQN  562
            HRLPVPRPGQVLGLVGTNGIGKSTALKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQN
Sbjct  246  HRLPVPRPGQVLGLVGTNGIGKSTALKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQN  305

Query  563  YFTRILEDNLKAIIKPQYVDHIPKAVQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNV  742
            YFTR+LEDNLKAIIKPQYVDHIPKAVQGNVGQVL+ KDERDMK ELCVDLELNQV+D NV
Sbjct  306  YFTRLLEDNLKAIIKPQYVDHIPKAVQGNVGQVLELKDERDMKAELCVDLELNQVIDRNV  365

Query  743  G  745
            G
Sbjct  366  G  366



>ref|XP_006418725.1| hypothetical protein EUTSA_v10002453mg [Eutrema salsugineum]
 gb|ESQ37161.1| hypothetical protein EUTSA_v10002453mg [Eutrema salsugineum]
Length=599

 Score =   353 bits (906),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 161/215 (75%), Positives = 193/215 (90%), Gaps = 1/215 (0%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            M+D RLTRIAIV++D+CKPKKCRQECKKSCPVVKTG+LCIEVTP +K AF+SEELCIGCG
Sbjct  1    MAD-RLTRIAIVNNDRCKPKKCRQECKKSCPVVKTGRLCIEVTPTSKTAFLSEELCIGCG  59

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            ICVKKCPF AIQI+NLPKDL+KDT HRYG N+FKLHRLPVPRPGQVLGLVGTNGIGKSTA
Sbjct  60   ICVKKCPFGAIQIVNLPKDLEKDTIHRYGENSFKLHRLPVPRPGQVLGLVGTNGIGKSTA  119

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            LK+LA KLKPNLGR++NPPDWQEIL +FRGSELQ+YFTR++E++L A+IKPQ+VD I K 
Sbjct  120  LKILANKLKPNLGRYRNPPDWQEILNHFRGSELQSYFTRLVEEDLTAVIKPQHVDQIKKV  179

Query  638  VQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNV  742
             +G +G+ L++ DER M EE+C ++EL ++L+  V
Sbjct  180  ARGKIGEALEKLDERGMMEEICAEMELTKILEREV  214



>ref|XP_005704280.1| ABC transporter, sub-family E, substrate-binding protein [Galdieria 
sulphuraria]
 gb|EME27760.1| ABC transporter, sub-family E, substrate-binding protein [Galdieria 
sulphuraria]
Length=605

 Score =   353 bits (906),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 161/212 (76%), Positives = 190/212 (90%), Gaps = 0/212 (0%)
 Frame = +2

Query  107  QRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCGICV  286
            ++LTRIAIVS DKCKPK+C+QECKKSCPV + GKLCI+VTP +K+A+ISEELCIGCGICV
Sbjct  3    EKLTRIAIVSEDKCKPKRCQQECKKSCPVNRMGKLCIDVTPKSKVAYISEELCIGCGICV  62

Query  287  KKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTALKV  466
            KKCPF+AIQIINLPK+L+KDT HRYGPN+FKLHRLP PRPGQVLGLVGTNGIGKSTALK+
Sbjct  63   KKCPFDAIQIINLPKNLEKDTVHRYGPNSFKLHRLPTPRPGQVLGLVGTNGIGKSTALKI  122

Query  467  LAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKAVQG  646
            L+ KLKPNLGR++NPPDWQEIL YFRGSELQNYF  ILEDNLKAIIKPQYVD IP+AV G
Sbjct  123  LSAKLKPNLGRWENPPDWQEILQYFRGSELQNYFVMILEDNLKAIIKPQYVDQIPRAVSG  182

Query  647  NVGQVLDQKDERDMKEELCVDLELNQVLDHNV  742
             VG +L++K++R + +E+   L+L  +LD +V
Sbjct  183  TVGNLLEKKNDRGVMDEIVEALDLKSILDRDV  214



>gb|EWM23870.1| rnase l inhibitor-like protein [Nannochloropsis gaditana]
Length=518

 Score =   350 bits (898),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 159/211 (75%), Positives = 186/211 (88%), Gaps = 0/211 (0%)
 Frame = +2

Query  110  RLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCGICVK  289
            RLTRIAIV+ DKCKPKKCRQECK++CPVV+ GKLCIEVTP +KIAF+SEELCIGCGICVK
Sbjct  14   RLTRIAIVNKDKCKPKKCRQECKRNCPVVRQGKLCIEVTPTSKIAFLSEELCIGCGICVK  73

Query  290  KCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTALKVL  469
            KCPFEAI IINLPK L+   THRYGPN+FKLHRLP+PRPGQVLGLVG NG GKSTALK+L
Sbjct  74   KCPFEAINIINLPKSLEGSQTHRYGPNSFKLHRLPMPRPGQVLGLVGQNGTGKSTALKIL  133

Query  470  AGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKAVQGN  649
            AGKLKPNLGRF NPPDW E+L YFRGSELQNYF+RILE+NLKA++KPQYVDHIPKAV+G 
Sbjct  134  AGKLKPNLGRFDNPPDWTEVLAYFRGSELQNYFSRILENNLKALVKPQYVDHIPKAVKGK  193

Query  650  VGQVLDQKDERDMKEELCVDLELNQVLDHNV  742
            VG +  +KD+R+  E +  +++L  ++D +V
Sbjct  194  VGPLFREKDQRERAEIMLGEMDLKHLVDRSV  224



>ref|XP_008042284.1| RNAse L inhibitor-type ATP binding cassette protein [Trametes 
versicolor FP-101664 SS1]
 gb|EIW54997.1| RNAse L inhibitor-type ATP binding cassette protein [Trametes 
versicolor FP-101664 SS1]
Length=601

 Score =   352 bits (904),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 166/220 (75%), Positives = 190/220 (86%), Gaps = 3/220 (1%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            M+D ++TRIAIV S++CKPK+C QECKKSCPVVK GKLCIEV P  KIA+ISE LCIGCG
Sbjct  1    MAD-KITRIAIVDSNRCKPKRCAQECKKSCPVVKMGKLCIEVKPTDKIAYISEFLCIGCG  59

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            ICVKKCPFEAI IINLP +LD + THRY  N FKLHRLP PRPGQVLGLVGTNGIGKSTA
Sbjct  60   ICVKKCPFEAIAIINLPTNLDSEVTHRYTANAFKLHRLPTPRPGQVLGLVGTNGIGKSTA  119

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            LK+LAGKLKPNLGR+ +PPDWQEIL YFRGSELQNYFT++LEDNLKA+IKPQYVDHIP+A
Sbjct  120  LKILAGKLKPNLGRYDDPPDWQEILKYFRGSELQNYFTKVLEDNLKALIKPQYVDHIPRA  179

Query  638  VQG--NVGQVLDQKDERDMKEELCVDLELNQVLDHNVGRF  751
            ++G   V Q+LD K ERD K+++C DLELN+VL   VG+ 
Sbjct  180  IKGVMTVSQMLDGKLERDNKQKMCDDLELNEVLTREVGQL  219



>ref|XP_011449756.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Crassostrea 
gigas]
 ref|XP_011449757.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Crassostrea 
gigas]
Length=611

 Score =   352 bits (903),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 165/211 (78%), Positives = 190/211 (90%), Gaps = 0/211 (0%)
 Frame = +2

Query  110  RLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCGICVK  289
            +LTRIAIVS+DKCKPK+CRQECKKSCPVV+ GKLCIEV+PA KIAFISEELCIGCGIC K
Sbjct  16   KLTRIAIVSNDKCKPKRCRQECKKSCPVVRMGKLCIEVSPADKIAFISEELCIGCGICSK  75

Query  290  KCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTALKVL  469
            KCPFEAI IINLP +L+KDTTHRY  N+FKLHRLP+PRPG+VLGLVGTNGIGKSTALK+L
Sbjct  76   KCPFEAISIINLPSNLEKDTTHRYSANSFKLHRLPIPRPGEVLGLVGTNGIGKSTALKIL  135

Query  470  AGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKAVQGN  649
            AGK KPNLGRF++PPDW EILTYFRGSELQN+FT+ILED+LKAIIKPQYVD IPKAV+G+
Sbjct  136  AGKQKPNLGRFEDPPDWTEILTYFRGSELQNFFTKILEDDLKAIIKPQYVDQIPKAVKGS  195

Query  650  VGQVLDQKDERDMKEELCVDLELNQVLDHNV  742
            V Q+LD+KD+   + ++C  L+L  V D NV
Sbjct  196  VQQLLDKKDDLSNQMDVCEQLDLINVRDRNV  226



>emb|CCD59622.1| ATP-binding cassette, sub-family E (oabp),member, putative [Schistosoma 
mansoni]
Length=552

 Score =   350 bits (898),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 163/215 (76%), Positives = 189/215 (88%), Gaps = 0/215 (0%)
 Frame = +2

Query  101  SDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCGI  280
            + ++LTRIAIVSSDKCKPKKCRQECK+SCPVV+ GKLCIEVTP  KIAF+SEELCIGCGI
Sbjct  6    TQEKLTRIAIVSSDKCKPKKCRQECKRSCPVVRMGKLCIEVTPNDKIAFLSEELCIGCGI  65

Query  281  CVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTAL  460
            C KKCPFEAI IINLP +L+K+ THRYGPN+FKLHRLP+PRPG+VLGLVGTNGIGKS+AL
Sbjct  66   CSKKCPFEAISIINLPSNLEKEVTHRYGPNSFKLHRLPMPRPGEVLGLVGTNGIGKSSAL  125

Query  461  KVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKAV  640
            K+LAGKLKPNLGRFKNPPDW EILTYFRGSELQNYFT+ILEDNL+A+IKPQYVD IPK V
Sbjct  126  KILAGKLKPNLGRFKNPPDWTEILTYFRGSELQNYFTKILEDNLRAVIKPQYVDQIPKIV  185

Query  641  QGNVGQVLDQKDERDMKEELCVDLELNQVLDHNVG  745
             G V  +L++KD+R  ++ +   L+L  V +  VG
Sbjct  186  SGEVKTLLNRKDDRGNQDHVLEMLDLQVVTERMVG  220



>emb|CCM04394.1| predicted protein [Fibroporia radiculosa]
Length=601

 Score =   351 bits (901),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 166/220 (75%), Positives = 189/220 (86%), Gaps = 3/220 (1%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            M+D ++TRIAIV S++CKPK+C QECKKSCPVVK GKLCIEV P  KIAFISE LCIGCG
Sbjct  1    MAD-KITRIAIVDSNRCKPKRCAQECKKSCPVVKMGKLCIEVKPTDKIAFISEFLCIGCG  59

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            ICVKKCPFEAI IINLP +LD   THRY  N+FKLHRLP PRPGQVLGLVGTNGIGKSTA
Sbjct  60   ICVKKCPFEAIAIINLPTNLDSQVTHRYTANSFKLHRLPTPRPGQVLGLVGTNGIGKSTA  119

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            LK+LAGKLKPNLGR+ +PPDWQEIL YFRGSELQNYFT++LEDNLKA+IKPQYVDHIP+A
Sbjct  120  LKILAGKLKPNLGRYDDPPDWQEILKYFRGSELQNYFTKVLEDNLKALIKPQYVDHIPRA  179

Query  638  VQG--NVGQVLDQKDERDMKEELCVDLELNQVLDHNVGRF  751
            ++G   V Q+LD K ERD K+++C DLELN+VL   V + 
Sbjct  180  IKGKLTVSQMLDSKLERDNKQKMCDDLELNEVLTREVSQL  219



>ref|XP_002009032.1| GI11489 [Drosophila mojavensis]
 gb|EDW19508.1| GI11489 [Drosophila mojavensis]
Length=610

 Score =   351 bits (900),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 163/224 (73%), Positives = 193/224 (86%), Gaps = 1/224 (0%)
 Frame = +2

Query  80   RLVKREMSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEE  259
            R  + E +D++ TRIAIVS DKCKPK+CRQECKKSCPVV+ GKLCIEVTP +KIA +SEE
Sbjct  3    RRKENEETDKQ-TRIAIVSDDKCKPKRCRQECKKSCPVVRMGKLCIEVTPTSKIASLSEE  61

Query  260  LCIGCGICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNG  439
            LCIGCGICVKKCPFEAI IINLP +LDK TTHRY  N+FKLHRLP+PRPG+VLGLVG NG
Sbjct  62   LCIGCGICVKKCPFEAITIINLPSNLDKHTTHRYSKNSFKLHRLPIPRPGEVLGLVGQNG  121

Query  440  IGKSTALKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYV  619
            IGKSTALK+LAGK KPNLG++ NPPDW EIL YFRGSELQNYFT+ILEDNLKA++KPQYV
Sbjct  122  IGKSTALKILAGKQKPNLGKYANPPDWTEILAYFRGSELQNYFTKILEDNLKALVKPQYV  181

Query  620  DHIPKAVQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNVGRF  751
            D IPKAV+G VG +LD+KDERD++ ++C  L+L+ + D  + + 
Sbjct  182  DQIPKAVRGTVGDLLDKKDERDLQTKICDMLDLSHIRDREIAQL  225



>ref|XP_002047872.1| GJ13683 [Drosophila virilis]
 ref|XP_002060434.1| GJ14590 [Drosophila virilis]
 gb|EDW70214.1| GJ13683 [Drosophila virilis]
 gb|EDW71527.1| GJ14590 [Drosophila virilis]
Length=610

 Score =   350 bits (899),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 163/224 (73%), Positives = 194/224 (87%), Gaps = 1/224 (0%)
 Frame = +2

Query  80   RLVKREMSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEE  259
            R  + E +D++ TRIAIVS DKCKPK+CRQECKKSCPVV+ GKLCIEVTP +KIA +SEE
Sbjct  3    RRKEHEETDKQ-TRIAIVSDDKCKPKRCRQECKKSCPVVRMGKLCIEVTPTSKIASLSEE  61

Query  260  LCIGCGICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNG  439
            LCIGCGICVKKCPFEAI IINLP +LDK TTHRY  N+FKLHRLP+PRPG+VLGLVG NG
Sbjct  62   LCIGCGICVKKCPFEAITIINLPSNLDKHTTHRYSKNSFKLHRLPIPRPGEVLGLVGQNG  121

Query  440  IGKSTALKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYV  619
            IGKSTALK+LAGK KPNLG++ NPPDW EIL YFRGSELQNYFT+ILEDNLKA++KPQYV
Sbjct  122  IGKSTALKILAGKQKPNLGKYANPPDWTEILAYFRGSELQNYFTKILEDNLKALVKPQYV  181

Query  620  DHIPKAVQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNVGRF  751
            D IPKAV+G VG++LD+KDERD++ ++C  L+L+ + D  + + 
Sbjct  182  DQIPKAVRGAVGELLDKKDERDLQTKICNMLDLSHIRDREISQL  225



>ref|XP_001984558.1| GH14962 [Drosophila grimshawi]
 gb|EDV96906.1| GH14962 [Drosophila grimshawi]
Length=611

 Score =   350 bits (899),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 163/224 (73%), Positives = 194/224 (87%), Gaps = 1/224 (0%)
 Frame = +2

Query  80   RLVKREMSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEE  259
            R  + E +D++ TRIAIVS DKCKPK+CRQECKKSCPVV+ GKLCIEVTP +KIA +SEE
Sbjct  3    RRRENEETDKQ-TRIAIVSDDKCKPKRCRQECKKSCPVVRMGKLCIEVTPTSKIASLSEE  61

Query  260  LCIGCGICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNG  439
            LCIGCGICVKKCPFEAI IINLP +L+K TTHRY  N+FKLHRLP+PRPG+VLGLVG NG
Sbjct  62   LCIGCGICVKKCPFEAITIINLPSNLEKHTTHRYSKNSFKLHRLPIPRPGEVLGLVGQNG  121

Query  440  IGKSTALKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYV  619
            IGKSTALK+LAGK KPNLG++ NPPDW EILTYFRGSELQNYFT+ILEDNLKA++KPQYV
Sbjct  122  IGKSTALKILAGKQKPNLGKYANPPDWTEILTYFRGSELQNYFTKILEDNLKALVKPQYV  181

Query  620  DHIPKAVQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNVGRF  751
            D IPKAV+G VG +LD+KDERD++ ++C  L+L+ + D  + + 
Sbjct  182  DQIPKAVRGTVGDLLDKKDERDLQTKICDMLDLSHIRDREISQL  225



>emb|CDO70981.1| hypothetical protein BN946_scf184830.g13 [Trametes cinnabarina]
Length=601

 Score =   350 bits (897),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 165/217 (76%), Positives = 188/217 (87%), Gaps = 3/217 (1%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            M+D ++TRIAIV +++CKPK+C QECKKSCPVVK GKLCIEV P+ KIAFISE LCIGCG
Sbjct  1    MAD-KITRIAIVDANRCKPKRCAQECKKSCPVVKMGKLCIEVKPSDKIAFISEFLCIGCG  59

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            ICVKKCPFEAI IINLP +LD + THRY  N FKLHRLP PRPGQVLGLVGTNGIGKSTA
Sbjct  60   ICVKKCPFEAIAIINLPTNLDSEVTHRYSANAFKLHRLPTPRPGQVLGLVGTNGIGKSTA  119

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            LK+LAGKLKPNLGR+ +PPDWQEIL YFRGSELQNYFT++LEDNLKA+IKPQYVDHIP+A
Sbjct  120  LKILAGKLKPNLGRYDDPPDWQEILKYFRGSELQNYFTKVLEDNLKALIKPQYVDHIPRA  179

Query  638  VQGN--VGQVLDQKDERDMKEELCVDLELNQVLDHNV  742
            ++GN  V  +LD K ERD K+++C DLELN VL   V
Sbjct  180  IKGNMKVSDMLDGKLERDNKQKMCDDLELNDVLSREV  216



>ref|XP_011300503.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Fopius 
arisanus]
Length=608

 Score =   350 bits (897),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 165/219 (75%), Positives = 193/219 (88%), Gaps = 1/219 (0%)
 Frame = +2

Query  89   KREMSD-QRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELC  265
            KR M +  RLTRIAIV+SDKCKPK+CRQECK+SCPVV+ GKLCIEVTP +KIA ISEELC
Sbjct  4    KRAMEETDRLTRIAIVNSDKCKPKRCRQECKRSCPVVRMGKLCIEVTPNSKIASISEELC  63

Query  266  IGCGICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIG  445
            IGCGICVKKCPFEAI IINLP +L+K+TTHRY  N+FKLHRLP+PRPG+VLGLVGTNGIG
Sbjct  64   IGCGICVKKCPFEAISIINLPSNLEKETTHRYSKNSFKLHRLPIPRPGEVLGLVGTNGIG  123

Query  446  KSTALKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDH  625
            KSTALK+LAGK KPNLGRF +PPDW EIL++FRGSELQNYFT+ILED+LKA+IKPQYVD 
Sbjct  124  KSTALKILAGKQKPNLGRFTDPPDWTEILSHFRGSELQNYFTKILEDDLKALIKPQYVDQ  183

Query  626  IPKAVQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNV  742
            IPKAV+G V Q+LD+KDE D ++E+C  L+L  + D  +
Sbjct  184  IPKAVKGTVQQLLDKKDECDKQQEICRMLDLTHIRDREI  222



>gb|EWM23869.1| rnase l inhibitor-like protein [Nannochloropsis gaditana]
Length=657

 Score =   351 bits (900),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 159/211 (75%), Positives = 186/211 (88%), Gaps = 0/211 (0%)
 Frame = +2

Query  110  RLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCGICVK  289
            RLTRIAIV+ DKCKPKKCRQECK++CPVV+ GKLCIEVTP +KIAF+SEELCIGCGICVK
Sbjct  14   RLTRIAIVNKDKCKPKKCRQECKRNCPVVRQGKLCIEVTPTSKIAFLSEELCIGCGICVK  73

Query  290  KCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTALKVL  469
            KCPFEAI IINLPK L+   THRYGPN+FKLHRLP+PRPGQVLGLVG NG GKSTALK+L
Sbjct  74   KCPFEAINIINLPKSLEGSQTHRYGPNSFKLHRLPMPRPGQVLGLVGQNGTGKSTALKIL  133

Query  470  AGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKAVQGN  649
            AGKLKPNLGRF NPPDW E+L YFRGSELQNYF+RILE+NLKA++KPQYVDHIPKAV+G 
Sbjct  134  AGKLKPNLGRFDNPPDWTEVLAYFRGSELQNYFSRILENNLKALVKPQYVDHIPKAVKGK  193

Query  650  VGQVLDQKDERDMKEELCVDLELNQVLDHNV  742
            VG +  +KD+R+  E +  +++L  ++D +V
Sbjct  194  VGPLFREKDQRERAEIMLGEMDLKHLVDRSV  224



>ref|XP_968009.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Tribolium 
castaneum]
 ref|XP_008199227.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Tribolium 
castaneum]
 gb|EFA01192.1| hypothetical protein TcasGA2_TC010519 [Tribolium castaneum]
Length=608

 Score =   349 bits (896),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 160/211 (76%), Positives = 190/211 (90%), Gaps = 0/211 (0%)
 Frame = +2

Query  110  RLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCGICVK  289
            +LTRIAIV++DKCKPK+CRQECKKSCPVV+ GKLCIEVTP +K+A ISEELCIGCGICVK
Sbjct  12   KLTRIAIVNADKCKPKRCRQECKKSCPVVRMGKLCIEVTPNSKMAAISEELCIGCGICVK  71

Query  290  KCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTALKVL  469
            KCPFEAI IINLP +L++DTTHRYG N+FKLHRLP+PRPG+VLGLVGTNGIGKSTALK+L
Sbjct  72   KCPFEAITIINLPSNLERDTTHRYGKNSFKLHRLPIPRPGEVLGLVGTNGIGKSTALKIL  131

Query  470  AGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKAVQGN  649
            AGK KPNLGR+ +PPDW EIL++FRGSELQNYFT+ILED+LKA+IKPQYVD IPKAV+G 
Sbjct  132  AGKQKPNLGRYSDPPDWTEILSHFRGSELQNYFTKILEDDLKALIKPQYVDQIPKAVKGT  191

Query  650  VGQVLDQKDERDMKEELCVDLELNQVLDHNV  742
            VGQ+LD+K E D +E++C  L+L  + D  +
Sbjct  192  VGQLLDKKTELDNQEQICEMLDLKHIRDRAI  222



>gb|EMT25832.1| ABC transporter E family member 2 [Aegilops tauschii]
Length=539

 Score =   347 bits (889),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 174/216 (81%), Positives = 182/216 (84%), Gaps = 31/216 (14%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            M+D RLTRIAIVS DKCKPKKCRQECKKSCPVVKTGKLCIEV+PAAK+AFISEELCIGCG
Sbjct  1    MAD-RLTRIAIVSEDKCKPKKCRQECKKSCPVVKTGKLCIEVSPAAKLAFISEELCIGCG  59

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            ICVKKCPF+AI+IINLPKDL+KDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA
Sbjct  60   ICVKKCPFDAIEIINLPKDLEKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  119

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            LKVLAGKLKPNLGRF                              KAIIKPQYVDHIPKA
Sbjct  120  LKVLAGKLKPNLGRF------------------------------KAIIKPQYVDHIPKA  149

Query  638  VQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNVG  745
            VQGNVGQVL+QKDERDMK ELCVDLELNQV+D NVG
Sbjct  150  VQGNVGQVLEQKDERDMKNELCVDLELNQVIDRNVG  185



>gb|EMS47523.1| ABC transporter E family member 2 [Triticum urartu]
Length=552

 Score =   347 bits (890),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 174/216 (81%), Positives = 182/216 (84%), Gaps = 31/216 (14%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            M+D RLTRIAIVS DKCKPKKCRQECKKSCPVVKTGKLCIEV+PAAK+AFISEELCIGCG
Sbjct  1    MAD-RLTRIAIVSEDKCKPKKCRQECKKSCPVVKTGKLCIEVSPAAKLAFISEELCIGCG  59

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            ICVKKCPF+AI+IINLPKDL+KDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA
Sbjct  60   ICVKKCPFDAIEIINLPKDLEKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  119

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            LKVLAGKLKPNLGRF                              KAIIKPQYVDHIPKA
Sbjct  120  LKVLAGKLKPNLGRF------------------------------KAIIKPQYVDHIPKA  149

Query  638  VQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNVG  745
            VQGNVGQVL+QKDERDMK ELCVDLELNQV+D NVG
Sbjct  150  VQGNVGQVLEQKDERDMKNELCVDLELNQVIDRNVG  185



>gb|EIE87499.1| translation initiation factor RLI1 [Rhizopus delemar RA 99-880]
Length=599

 Score =   348 bits (893),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 164/218 (75%), Positives = 187/218 (86%), Gaps = 1/218 (0%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            MSD +LTRIAIVS+DKCKPKKCRQECK+SCPV + GKLCIEV   +KI++ISEELCIGCG
Sbjct  1    MSD-KLTRIAIVSADKCKPKKCRQECKRSCPVNRMGKLCIEVESTSKISWISEELCIGCG  59

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            IC KKCPF AI IINLP +LD + THRY  N+FKLHRLPVPRPGQVLGLVGTNGIGKSTA
Sbjct  60   ICAKKCPFGAIHIINLPTNLDSEVTHRYSANSFKLHRLPVPRPGQVLGLVGTNGIGKSTA  119

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            LK+L+GK+KPNLG+F+NPPDWQ+IL YFRGSELQNYFT+ILEDNLKAIIKPQYVDHIPK 
Sbjct  120  LKILSGKMKPNLGKFENPPDWQDILKYFRGSELQNYFTKILEDNLKAIIKPQYVDHIPKV  179

Query  638  VQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNVGRF  751
            V G VGQ+L+ K ER+  EE+   L+L  VL   VG+ 
Sbjct  180  VNGKVGQLLEDKHERNNMEEMIDMLDLKDVLTREVGQL  217



>ref|XP_001956850.1| GF10137 [Drosophila ananassae]
 gb|EDV39656.1| GF10137 [Drosophila ananassae]
Length=611

 Score =   348 bits (893),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 161/219 (74%), Positives = 191/219 (87%), Gaps = 1/219 (0%)
 Frame = +2

Query  95   EMSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGC  274
            E +D++ TRIAIVS DKCKPK+CRQECKKSCPVV+ GKLCIEVTP +KIA +SEELCIGC
Sbjct  8    EETDKQ-TRIAIVSDDKCKPKRCRQECKKSCPVVRMGKLCIEVTPTSKIASLSEELCIGC  66

Query  275  GICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKST  454
            GICVKKCPFEAI IINLP +LDK TTHRY  N+FKLHRLP+PRPG+VLGLVG NGIGKST
Sbjct  67   GICVKKCPFEAITIINLPSNLDKHTTHRYSKNSFKLHRLPIPRPGEVLGLVGQNGIGKST  126

Query  455  ALKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPK  634
            ALK+LAGK KPNLG++ NPPDW EIL+YFRGSELQNYFT+ILEDNLKA++KPQYVD IPK
Sbjct  127  ALKILAGKQKPNLGKYANPPDWTEILSYFRGSELQNYFTKILEDNLKALVKPQYVDQIPK  186

Query  635  AVQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNVGRF  751
            AV+G VG +LD+KDER+++  +C  L+L+ + D  + + 
Sbjct  187  AVRGAVGDLLDKKDERELQTTICDMLDLSHIRDREIAQL  225



>gb|KFH72616.1| ABC transporter E family member 2 [Mortierella verticillata NRRL 
6337]
Length=600

 Score =   347 bits (891),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 164/218 (75%), Positives = 191/218 (88%), Gaps = 1/218 (0%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            MSD  LTRIAIV+SDKCKPKKCRQECKKSCPVVK GK+CIEV+PA+KIAFISE+LCIGCG
Sbjct  1    MSDD-LTRIAIVNSDKCKPKKCRQECKKSCPVVKMGKMCIEVSPASKIAFISEDLCIGCG  59

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            ICVK+CPF AI IINLP +L+K+ THRY  N+FKLHRLPVPRPGQVLGLVGTNGIGKSTA
Sbjct  60   ICVKRCPFGAIHIINLPTNLEKEVTHRYSANSFKLHRLPVPRPGQVLGLVGTNGIGKSTA  119

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            LK+LAGKLKPNLGRF+N PDWQ+IL +FRGSELQNYFT+ILED+LKAIIKPQYVDH+PKA
Sbjct  120  LKILAGKLKPNLGRFENVPDWQDILKHFRGSELQNYFTKILEDDLKAIIKPQYVDHLPKA  179

Query  638  VQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNVGRF  751
            V G VG +L+ K E + ++ +   L+L ++L   VG+ 
Sbjct  180  VSGKVGDLLEAKQELENRQMMIDHLDLKEILQREVGQL  217



>ref|XP_002093378.1| GE21271 [Drosophila yakuba]
 gb|EDW93090.1| GE21271 [Drosophila yakuba]
Length=611

 Score =   348 bits (892),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 158/212 (75%), Positives = 187/212 (88%), Gaps = 0/212 (0%)
 Frame = +2

Query  116  TRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCGICVKKC  295
            TRIAIVS DKCKPK+CRQECKK+CPVV+ GKLCIEVTP +KIA +SEELCIGCGICVKKC
Sbjct  14   TRIAIVSDDKCKPKRCRQECKKTCPVVRMGKLCIEVTPTSKIASLSEELCIGCGICVKKC  73

Query  296  PFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTALKVLAG  475
            PFEAI IINLP +L+K TTHRY  N+FKLHRLP+PRPG+VLGLVG NGIGKSTALK+LAG
Sbjct  74   PFEAITIINLPSNLEKHTTHRYSKNSFKLHRLPIPRPGEVLGLVGQNGIGKSTALKILAG  133

Query  476  KLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKAVQGNVG  655
            K KPNLG++ NPPDW EIL+YFRGSELQNYFT+ILEDNLKA++KPQYVD IPKAV+G VG
Sbjct  134  KQKPNLGKYANPPDWTEILSYFRGSELQNYFTKILEDNLKALVKPQYVDQIPKAVRGAVG  193

Query  656  QVLDQKDERDMKEELCVDLELNQVLDHNVGRF  751
             +LD+KDERD++ ++C  L+L+ + D  + + 
Sbjct  194  DLLDKKDERDLQTKICEMLDLSHIRDREIAQL  225



>ref|XP_007852143.1| rnase l inhibitor-type atp binding cassette protein [Moniliophthora 
roreri MCA 2997]
 gb|ESK88550.1| rnase l inhibitor-type atp binding cassette protein [Moniliophthora 
roreri MCA 2997]
Length=601

 Score =   347 bits (890),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 163/220 (74%), Positives = 190/220 (86%), Gaps = 3/220 (1%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            M+D ++TRIAIV S++CKPK+C QECKKSCPVV+ GKLCIEV P  KIAFISE LCIGCG
Sbjct  1    MAD-KITRIAIVDSNRCKPKRCAQECKKSCPVVRMGKLCIEVKPTDKIAFISEILCIGCG  59

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            ICVKKCPFEAI IINLP +L+ + THRY  N+FKLHRLP PRPGQVLGLVGTNGIGKSTA
Sbjct  60   ICVKKCPFEAIAIINLPTNLESEVTHRYTANSFKLHRLPTPRPGQVLGLVGTNGIGKSTA  119

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            LK+LAGKLKPNLGR+ +PPDWQEIL YFRGSELQNYFT++LEDNLKA+IKPQYVDHIP+A
Sbjct  120  LKILAGKLKPNLGRYDDPPDWQEILKYFRGSELQNYFTKVLEDNLKALIKPQYVDHIPRA  179

Query  638  VQGN--VGQVLDQKDERDMKEELCVDLELNQVLDHNVGRF  751
            ++G+  V Q+LD K E D K+++C DLELN VL  +V + 
Sbjct  180  IKGDMTVSQMLDSKLELDNKQKMCDDLELNNVLQRDVSQL  219



>ref|XP_004990715.1| ABC transporter ABCE1 [Salpingoeca rosetta]
 gb|EGD77371.1| ABC transporter ABCE1 [Salpingoeca rosetta]
Length=602

 Score =   347 bits (890),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 163/215 (76%), Positives = 188/215 (87%), Gaps = 1/215 (0%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            MSD +LTRIAIV+ DKCKPK+CRQECK+SCPVV+ GK+CIEVTP +KIA ISE LCIGCG
Sbjct  1    MSD-KLTRIAIVNHDKCKPKRCRQECKRSCPVVRMGKMCIEVTPTSKIANISEVLCIGCG  59

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            ICVKKCPF AI IINLPK+LDKDTTHRYGPN+FKLHRLP+PRPG+VLGLVGTNGIGKSTA
Sbjct  60   ICVKKCPFGAINIINLPKNLDKDTTHRYGPNSFKLHRLPMPRPGEVLGLVGTNGIGKSTA  119

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            LK+L+ KLKPNLGRF  PP+WQEIL YFRGSELQNYFTRILED+LKA+IKPQYVD + K 
Sbjct  120  LKILSNKLKPNLGRFDKPPEWQEILKYFRGSELQNYFTRILEDDLKAVIKPQYVDKVAKV  179

Query  638  VQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNV  742
            V+G+V  ++D+KDER M++  C   ELN + D  V
Sbjct  180  VKGSVQDMMDRKDERKMQDHYCDMFELNNLRDREV  214



>gb|EMS65569.1| ABC transporter E family member 2 [Triticum urartu]
Length=636

 Score =   348 bits (892),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 169/209 (81%), Positives = 182/209 (87%), Gaps = 14/209 (7%)
 Frame = +2

Query  116  TRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCGICVKKC  295
             RIAI++ D+CKPKKCRQEC+KSCPVVKTGK CIEVTPA+K AFISEELCIGCGICVKKC
Sbjct  3    ARIAIINEDRCKPKKCRQECRKSCPVVKTGKHCIEVTPASKSAFISEELCIGCGICVKKC  62

Query  296  PFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTALKVLAG  475
            PF AIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVG NGIGKSTAL     
Sbjct  63   PFGAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGANGIGKSTAL-----  117

Query  476  KLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKAVQGNVG  655
                     KNPPDWQEILTYFRGSELQNYFTR+LEDNLKAIIK Q V+ IPKAVQGNVG
Sbjct  118  ---------KNPPDWQEILTYFRGSELQNYFTRLLEDNLKAIIKRQDVESIPKAVQGNVG  168

Query  656  QVLDQKDERDMKEELCVDLELNQVLDHNV  742
            Q+LD+ D+R +K +LC+DLELNQVLD NV
Sbjct  169  QLLDKLDQRGVKAQLCIDLELNQVLDRNV  197



>dbj|GAA55212.1| ATP-binding cassette sub-family E member 1 [Clonorchis sinensis]
Length=752

 Score =   351 bits (900),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 165/223 (74%), Positives = 189/223 (85%), Gaps = 0/223 (0%)
 Frame = +2

Query  77   YRLVKREMSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISE  256
            Y  + +  +  RLTRIAIVS+DKCKPKKCRQECKKSCPVV+ G++CIEVTP  KIAFISE
Sbjct  146  YNTMSKPPTQDRLTRIAIVSNDKCKPKKCRQECKKSCPVVRMGRMCIEVTPNDKIAFISE  205

Query  257  ELCIGCGICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTN  436
            ELCIGCGICVKKCPFEAIQIINLP +L+K+ THRY  N FKLHRLP+PRPG+VLGLVGTN
Sbjct  206  ELCIGCGICVKKCPFEAIQIINLPSNLEKEVTHRYSANAFKLHRLPMPRPGEVLGLVGTN  265

Query  437  GIGKSTALKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQY  616
            GIGKSTALK+LAGKLKPNLGRFKNPPDW EILTYFRGSELQNYFT++LEDNLKA+IKPQY
Sbjct  266  GIGKSTALKILAGKLKPNLGRFKNPPDWTEILTYFRGSELQNYFTKVLEDNLKAVIKPQY  325

Query  617  VDHIPKAVQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNVG  745
            VD IPK V G V  +LD+KD+R  ++ +   L+L  V +  V 
Sbjct  326  VDQIPKLVSGGVKTLLDRKDDRGNQDHILNLLDLKVVTERLVS  368



>gb|AAP80847.1| 68 kDa protein HP68 [Griffithsia japonica]
Length=232

 Score =   334 bits (856),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 156/217 (72%), Positives = 188/217 (87%), Gaps = 2/217 (1%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKL-CIEVTPAAKIAFISEELCIGC  274
            M+D +L RIAIV+ ++CKPK+C  ECK+SCPVV+ GK+ C+EVT  +K+A ISE LC+GC
Sbjct  1    MTD-KLIRIAIVNGERCKPKRCSLECKRSCPVVRMGKIGCLEVTSKSKVALISEVLCVGC  59

Query  275  GICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKST  454
            GICVKKCPF+AIQIINLPK+LDK+T HRYGPN+FKLHRLPVPRPGQ+LGLVGTNGIGKST
Sbjct  60   GICVKKCPFDAIQIINLPKELDKETVHRYGPNSFKLHRLPVPRPGQILGLVGTNGIGKST  119

Query  455  ALKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPK  634
            ALKVLA KLKPNLG +K PPDW EIL +FRGSELQNYFTR+LEDN+KAIIKPQYVD IP+
Sbjct  120  ALKVLAAKLKPNLGEWKTPPDWTEILNHFRGSELQNYFTRVLEDNIKAIIKPQYVDAIPR  179

Query  635  AVQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNVG  745
            A++G V  VL +KDERD  +++  DL+L +VLD  +G
Sbjct  180  AIKGTVADVLSRKDERDAMDKMTTDLQLREVLDREIG  216



>ref|XP_001832405.2| RNAse L inhibitor-type ATP binding cassette protein [Coprinopsis 
cinerea okayama7#130]
 gb|EAU89439.2| RNAse L inhibitor-type ATP binding cassette protein [Coprinopsis 
cinerea okayama7#130]
Length=589

 Score =   346 bits (888),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 164/217 (76%), Positives = 188/217 (87%), Gaps = 3/217 (1%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            M+D ++TRIAIV S++CKPK+C QECKKSCPVVK GKLCIEV P+ KIAFISE LCIGCG
Sbjct  1    MAD-KITRIAIVDSNRCKPKRCAQECKKSCPVVKMGKLCIEVKPSDKIAFISEFLCIGCG  59

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            ICVKKCPFEAI IINLP +L+   THRY  N FKLHRLP PRPGQVLGLVGTNGIGKSTA
Sbjct  60   ICVKKCPFEAIAIINLPTNLESQVTHRYTANAFKLHRLPTPRPGQVLGLVGTNGIGKSTA  119

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            LK+LAGKLKPNLGR+ +PPDWQEIL YFRGSELQNYFT++LEDNLKA+IKPQYVDHIPKA
Sbjct  120  LKILAGKLKPNLGRYDDPPDWQEILKYFRGSELQNYFTKVLEDNLKALIKPQYVDHIPKA  179

Query  638  VQG--NVGQVLDQKDERDMKEELCVDLELNQVLDHNV  742
            ++G   V ++LD K ER+ K+++C DLELN VLD  +
Sbjct  180  IKGEMTVEKMLDNKLERNNKQKMCDDLELNHVLDRQI  216



>ref|XP_010500812.1| PREDICTED: ABC transporter E family member 1 isoform X1 [Camelina 
sativa]
 ref|XP_010500818.1| PREDICTED: ABC transporter E family member 1 isoform X1 [Camelina 
sativa]
 ref|XP_010500826.1| PREDICTED: ABC transporter E family member 1 isoform X1 [Camelina 
sativa]
Length=629

 Score =   347 bits (890),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 168/241 (70%), Positives = 193/241 (80%), Gaps = 27/241 (11%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            M+D RLTRIAI+S D+CKPKKCRQECKKSCPVVKTGKLCIEV P +K AF+SEELCIGCG
Sbjct  1    MAD-RLTRIAIISEDRCKPKKCRQECKKSCPVVKTGKLCIEVAPTSKTAFLSEELCIGCG  59

Query  278  ICVK--------------------------KCPFEAIQIINLPKDLDKDTTHRYGPNTFK  379
            ICVK                          KCPFEAIQIINLPKDL+KDTTHRYG N FK
Sbjct  60   ICVKVLTPRLYLFSTLNDFVSLICWCTILQKCPFEAIQIINLPKDLEKDTTHRYGANGFK  119

Query  380  LHRLPVPRPGQVLGLVGTNGIGKSTALKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQ  559
            LHRLPVPRPGQVLGLVGTNGIGKSTALK+LAGKLKPNLG+F NPPDW++ILT FRGSELQ
Sbjct  120  LHRLPVPRPGQVLGLVGTNGIGKSTALKILAGKLKPNLGKFNNPPDWEDILTRFRGSELQ  179

Query  560  NYFTRILEDNLKAIIKPQYVDHIPKAVQGNVGQVLDQKDERDMKEELCVDLELNQVLDHN  739
            +YF R++E+NLK  IKPQ+VDHI + V+ N+G+VL++ DER M EE+C D+ELNQ+L+  
Sbjct  180  SYFIRVVEENLKTAIKPQHVDHIKEVVRDNLGKVLEKLDERGMVEEICADMELNQILERE  239

Query  740  V  742
             
Sbjct  240  A  240



>emb|CEG63656.1| Putative YALI0A17941p [Rhizopus microsporus]
Length=599

 Score =   346 bits (888),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 163/218 (75%), Positives = 185/218 (85%), Gaps = 1/218 (0%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            MSD RLTRIAIVS+DKCKPKKCRQECK+SCPV + GKLCIEV P +KI++ISEELCIGCG
Sbjct  1    MSD-RLTRIAIVSADKCKPKKCRQECKRSCPVNRMGKLCIEVEPTSKISWISEELCIGCG  59

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            IC KKCPF AI IINLP +L+ + THRY  N+FKLHRLPVPRPGQVLGLVGTNGIGKSTA
Sbjct  60   ICAKKCPFGAIHIINLPTNLESEVTHRYSANSFKLHRLPVPRPGQVLGLVGTNGIGKSTA  119

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            LK+L+GK+KPNLG+F NPPDWQ+IL YFRGSELQNYFT+ILEDNLKAIIKPQYVDHIPK 
Sbjct  120  LKILSGKMKPNLGKFDNPPDWQDILKYFRGSELQNYFTKILEDNLKAIIKPQYVDHIPKV  179

Query  638  VQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNVGRF  751
            V G V Q+L  K ER+  E++   L+L  VL   VG+ 
Sbjct  180  VSGKVAQLLQDKHERNNMEDIIDALDLKDVLTREVGQL  217



>ref|XP_001182876.2| PREDICTED: ATP-binding cassette sub-family E member 1-like [Strongylocentrotus 
purpuratus]
Length=602

 Score =   346 bits (888),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 159/214 (74%), Positives = 190/214 (89%), Gaps = 0/214 (0%)
 Frame = +2

Query  101  SDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCGI  280
            + ++LTRIAIV++DKCKPKKCRQEC+KSCPVV+ GKLCIEVTPA+KIA+ISE+LCIGCGI
Sbjct  3    TSEKLTRIAIVNADKCKPKKCRQECRKSCPVVRMGKLCIEVTPASKIAYISEQLCIGCGI  62

Query  281  CVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTAL  460
            CVKKCPFEAI IINLP +L+KDTTHRY  N+FKLHRLP PRPG+VLGLVG   IGKSTAL
Sbjct  63   CVKKCPFEAIHIINLPSNLEKDTTHRYNANSFKLHRLPTPRPGEVLGLVGPKRIGKSTAL  122

Query  461  KVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKAV  640
            K+LAGKLKPNLG+F  PPDWQ+IL YFRGSELQNYFT+ILED+LKAIIKPQYVD IP+AV
Sbjct  123  KILAGKLKPNLGKFLAPPDWQQILVYFRGSELQNYFTKILEDDLKAIIKPQYVDQIPRAV  182

Query  641  QGNVGQVLDQKDERDMKEELCVDLELNQVLDHNV  742
            +G V  +LD+KDE + ++++C+ L+L +V D  V
Sbjct  183  KGTVQVLLDKKDETETQDDICIRLDLTKVKDRKV  216



>gb|EMT26323.1| ABC transporter E family member 2 [Aegilops tauschii]
Length=614

 Score =   346 bits (888),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 168/209 (80%), Positives = 181/209 (87%), Gaps = 14/209 (7%)
 Frame = +2

Query  116  TRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCGICVKKC  295
             RIAI++ D+CKPKKCRQEC+KSCPVVKTGK CIEVTP +K AFISEELCIGCGICVKKC
Sbjct  3    ARIAIINEDRCKPKKCRQECRKSCPVVKTGKHCIEVTPESKTAFISEELCIGCGICVKKC  62

Query  296  PFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTALKVLAG  475
            PF AIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVG NGIGKSTAL     
Sbjct  63   PFGAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGANGIGKSTAL-----  117

Query  476  KLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKAVQGNVG  655
                     KNPPDWQEILTYFRGSELQNYFTR+LEDNLKAIIK Q V+ IPKAVQGNVG
Sbjct  118  ---------KNPPDWQEILTYFRGSELQNYFTRLLEDNLKAIIKRQDVESIPKAVQGNVG  168

Query  656  QVLDQKDERDMKEELCVDLELNQVLDHNV  742
            Q+LD+ D+R +K +LC+DLELNQVLD NV
Sbjct  169  QLLDKLDQRGVKAQLCIDLELNQVLDRNV  197



>ref|XP_005105420.1| PREDICTED: ATP-binding cassette sub-family E member 1-like isoform 
X3 [Aplysia californica]
Length=610

 Score =   346 bits (888),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 165/218 (76%), Positives = 186/218 (85%), Gaps = 0/218 (0%)
 Frame = +2

Query  89   KREMSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCI  268
            K E ++  LTRIAIVS+DKCKPK+CRQECKK CPVV+ GKLCIEVTP  KIAFISEELCI
Sbjct  8    KTEEANDVLTRIAIVSTDKCKPKRCRQECKKFCPVVRMGKLCIEVTPTDKIAFISEELCI  67

Query  269  GCGICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGK  448
            GCGIC KKCPFEAI IINLP +L +DTTHRY  N+FKLHRLP PRPG+VLGLVGTNGIGK
Sbjct  68   GCGICSKKCPFEAITIINLPSNLQRDTTHRYSANSFKLHRLPTPRPGEVLGLVGTNGIGK  127

Query  449  STALKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHI  628
            STALK+LAGK KPNLGRF +PPDW EIL YFRGSELQN+FT+ILED+LKA+IKPQYVD I
Sbjct  128  STALKILAGKQKPNLGRFTDPPDWTEILAYFRGSELQNFFTKILEDDLKALIKPQYVDQI  187

Query  629  PKAVQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNV  742
            PKAV+G V Q+LD+KDE   + E+C  L+L  V D NV
Sbjct  188  PKAVKGAVQQLLDKKDELKNQMEVCRQLDLLNVRDRNV  225



>ref|NP_648272.1| pixie, isoform A [Drosophila melanogaster]
 ref|NP_729435.1| pixie, isoform B [Drosophila melanogaster]
 ref|XP_001971580.1| GG15047 [Drosophila erecta]
 ref|XP_002029807.1| GM24901 [Drosophila sechellia]
 ref|XP_002084203.1| GD12951 [Drosophila simulans]
 gb|AAF50342.1| pixie, isoform A [Drosophila melanogaster]
 gb|AAL90382.1| RE71924p [Drosophila melanogaster]
 gb|AAN11979.1| pixie, isoform B [Drosophila melanogaster]
 gb|EDV50606.1| GG15047 [Drosophila erecta]
 gb|EDW40793.1| GM24901 [Drosophila sechellia]
 gb|EDX09788.1| GD12951 [Drosophila simulans]
 gb|ACL86928.1| pix-PA, partial [synthetic construct]
Length=611

 Score =   346 bits (888),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 157/212 (74%), Positives = 187/212 (88%), Gaps = 0/212 (0%)
 Frame = +2

Query  116  TRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCGICVKKC  295
            TRIAIVS DKCKPK+CRQECKK+CPVV+ GKLCIEVTP +KIA +SEELCIGCGICVKKC
Sbjct  14   TRIAIVSDDKCKPKRCRQECKKTCPVVRMGKLCIEVTPTSKIASLSEELCIGCGICVKKC  73

Query  296  PFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTALKVLAG  475
            PFEAI IINLP +L+K TTHRY  N+FKLHRLP+PRPG+VLGLVG NGIGKSTALK+LAG
Sbjct  74   PFEAITIINLPSNLEKHTTHRYSKNSFKLHRLPIPRPGEVLGLVGQNGIGKSTALKILAG  133

Query  476  KLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKAVQGNVG  655
            K KPNLG++ NPPDW EIL+YFRGSELQNYFT+ILEDNLKA++KPQYVD IPKAV+G VG
Sbjct  134  KQKPNLGKYANPPDWTEILSYFRGSELQNYFTKILEDNLKALVKPQYVDQIPKAVRGAVG  193

Query  656  QVLDQKDERDMKEELCVDLELNQVLDHNVGRF  751
             +LD+KDER+++ ++C  L+L+ + D  + + 
Sbjct  194  DLLDKKDERELQTKICEMLDLSHIRDREIAQL  225



>gb|EPB83194.1| translation initiation factor RLI1 [Mucor circinelloides f. circinelloides 
1006PhL]
Length=599

 Score =   345 bits (886),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 164/218 (75%), Positives = 187/218 (86%), Gaps = 1/218 (0%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            MSD +LTRIAIVS+DKCKPKKCRQECK+SCPV + GKLCIEV P +KIAFISEELCIGCG
Sbjct  1    MSD-KLTRIAIVSADKCKPKKCRQECKRSCPVNRMGKLCIEVEPTSKIAFISEELCIGCG  59

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            ICVKKCPF AI IINLP +L+ + THRY  N+FKLHRLPVPRPGQVLGLVGTNGIGKSTA
Sbjct  60   ICVKKCPFGAIHIINLPTNLEGEVTHRYSANSFKLHRLPVPRPGQVLGLVGTNGIGKSTA  119

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            LK+L+GK+KPNLG+F+ PPDWQ+IL YFRGSELQNYFT+ILEDNLKAIIKPQYVDHIPK 
Sbjct  120  LKILSGKMKPNLGKFEAPPDWQDILKYFRGSELQNYFTKILEDNLKAIIKPQYVDHIPKV  179

Query  638  VQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNVGRF  751
            V G V ++L+ K ER+  EE+   L+L  VL   VG+ 
Sbjct  180  VSGQVHKLLEDKHERNNLEEMIDYLDLKDVLQREVGQL  217



>ref|XP_005105418.1| PREDICTED: ATP-binding cassette sub-family E member 1-like isoform 
X1 [Aplysia californica]
 ref|XP_005105419.1| PREDICTED: ATP-binding cassette sub-family E member 1-like isoform 
X2 [Aplysia californica]
Length=650

 Score =   347 bits (890),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 165/218 (76%), Positives = 186/218 (85%), Gaps = 0/218 (0%)
 Frame = +2

Query  89   KREMSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCI  268
            K E ++  LTRIAIVS+DKCKPK+CRQECKK CPVV+ GKLCIEVTP  KIAFISEELCI
Sbjct  8    KTEEANDVLTRIAIVSTDKCKPKRCRQECKKFCPVVRMGKLCIEVTPTDKIAFISEELCI  67

Query  269  GCGICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGK  448
            GCGIC KKCPFEAI IINLP +L +DTTHRY  N+FKLHRLP PRPG+VLGLVGTNGIGK
Sbjct  68   GCGICSKKCPFEAITIINLPSNLQRDTTHRYSANSFKLHRLPTPRPGEVLGLVGTNGIGK  127

Query  449  STALKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHI  628
            STALK+LAGK KPNLGRF +PPDW EIL YFRGSELQN+FT+ILED+LKA+IKPQYVD I
Sbjct  128  STALKILAGKQKPNLGRFTDPPDWTEILAYFRGSELQNFFTKILEDDLKALIKPQYVDQI  187

Query  629  PKAVQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNV  742
            PKAV+G V Q+LD+KDE   + E+C  L+L  V D NV
Sbjct  188  PKAVKGAVQQLLDKKDELKNQMEVCRQLDLLNVRDRNV  225



>gb|KFG32440.1| putative ATP-binding cassette sub-family E member 1, partial 
[Toxoplasma gondii GAB2-2007-GAL-DOM2]
Length=403

 Score =   339 bits (869),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 157/217 (72%), Positives = 184/217 (85%), Gaps = 0/217 (0%)
 Frame = +2

Query  95   EMSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGC  274
            E  D    RIAIV++D+CKPKKCRQECK++CPVV+TGKLCIE    +KIAFISE LCIGC
Sbjct  10   EAVDDARLRIAIVNADRCKPKKCRQECKRNCPVVRTGKLCIEADATSKIAFISEPLCIGC  69

Query  275  GICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKST  454
            GICVKKCPFEAI IINLP+DL KD THR+G N+FKLHRLPVPRPGQVLGLVGTNGIGKST
Sbjct  70   GICVKKCPFEAIAIINLPRDLGKDVTHRFGANSFKLHRLPVPRPGQVLGLVGTNGIGKST  129

Query  455  ALKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPK  634
            ALK+L+ KLKPNLG++ NPPDWQEIL +FRGSELQN+FTR+LE++LKA IKPQYVDH+PK
Sbjct  130  ALKILSAKLKPNLGKYSNPPDWQEILAFFRGSELQNFFTRMLEEDLKASIKPQYVDHVPK  189

Query  635  AVQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNVG  745
             V+G VGQV+  KDE     EL  D+EL+ ++D  +G
Sbjct  190  QVKGTVGQVIQLKDETGRGAELMKDMELDHLVDREIG  226



>ref|XP_008560191.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Microplitis 
demolitor]
Length=657

 Score =   347 bits (890),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 167/238 (70%), Positives = 196/238 (82%), Gaps = 0/238 (0%)
 Frame = +2

Query  29   VHHTLHNLLFFNRNLCYRLVKREMSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGK  208
            V  + + LL   R++     K      +LTRIAIV+SDKCKPK+CRQECK+SCPVV+ GK
Sbjct  34   VFTSFYFLLTTERSVTMPPKKSMEETDKLTRIAIVNSDKCKPKRCRQECKRSCPVVRMGK  93

Query  209  LCIEVTPAAKIAFISEELCIGCGICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHR  388
            LCIEVTP  KIA ISEELCIGCGICVKKCPFEAI IINLP +L+K+TTHRY  N+FKLHR
Sbjct  94   LCIEVTPNTKIASISEELCIGCGICVKKCPFEAISIINLPSNLEKETTHRYSKNSFKLHR  153

Query  389  LPVPRPGQVLGLVGTNGIGKSTALKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYF  568
            LP+PRPG+VLGLVGTNGIGKSTALK+LAGK KPNLGRF +PPDW EIL+YFRGSELQNYF
Sbjct  154  LPIPRPGEVLGLVGTNGIGKSTALKILAGKQKPNLGRFTDPPDWTEILSYFRGSELQNYF  213

Query  569  TRILEDNLKAIIKPQYVDHIPKAVQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNV  742
            T+ILED+LKA+IKPQYVD IPKAV+G V Q+LD+KDE   +EE+C  L+L  + D  +
Sbjct  214  TKILEDDLKALIKPQYVDQIPKAVKGTVQQLLDKKDECGKQEEICKMLDLLHIRDRGI  271



>ref|XP_009518050.1| abc transporter, partial [Phytophthora sojae]
 gb|EGZ30775.1| abc transporter [Phytophthora sojae]
Length=626

 Score =   346 bits (887),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 165/216 (76%), Positives = 190/216 (88%), Gaps = 2/216 (1%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            MSD +LTRIAIVS+DKCKPKKCRQECKKSCPVV+ GKLCIEV+P +K+AFISE+LCIGCG
Sbjct  1    MSD-KLTRIAIVSTDKCKPKKCRQECKKSCPVVRMGKLCIEVSPKSKVAFISEQLCIGCG  59

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            ICVKKCPFEAI IINLPKDL+ +TTHRYG NTFKLHRLP+PRPGQVLGLVGTNGIGKSTA
Sbjct  60   ICVKKCPFEAINIINLPKDLESNTTHRYGANTFKLHRLPMPRPGQVLGLVGTNGIGKSTA  119

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            L++LAGKLKPNLG+F  PP+WQEILT+FRGSELQNYFTRILEDNLKAI KPQYVD IPKA
Sbjct  120  LRILAGKLKPNLGKFDAPPEWQEILTHFRGSELQNYFTRILEDNLKAITKPQYVDKIPKA  179

Query  638  VQGNVGQVLDQKDERDMK-EELCVDLELNQVLDHNV  742
            V+G V ++L  + E++ K      +L+L+ V D  +
Sbjct  180  VKGTVHEILSARCEKEEKLTHFLNELDLSHVQDREI  215



>gb|EKC18713.1| ATP-binding cassette sub-family E member 1 [Crassostrea gigas]
Length=751

 Score =   349 bits (896),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 174/260 (67%), Positives = 207/260 (80%), Gaps = 13/260 (5%)
 Frame = +2

Query  2    VFTVHSLSCVHH----TLHNLLFFNRNLCYR---LVKREMSDQ------RLTRIAIVSSD  142
            +F     +CVH      L       ++ C+R   +  R  +D+      +LTRIAIVS+D
Sbjct  107  IFCCEDEACVHKLSFPYLSGFRQERKSECHRSIWMSSRSRNDKSTAPTDKLTRIAIVSND  166

Query  143  KCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCGICVKKCPFEAIQIIN  322
            KCKPK+CRQECKKSCPVV+ GKLCIEV+PA KIAFISEELCIGCGIC KKCPFEAI IIN
Sbjct  167  KCKPKRCRQECKKSCPVVRMGKLCIEVSPADKIAFISEELCIGCGICSKKCPFEAISIIN  226

Query  323  LPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTALKVLAGKLKPNLGRF  502
            LP +L+KDTTHRY  N+FKLHRLP+PRPG+VLGLVGTNGIGKSTALK+LAGK KPNLGRF
Sbjct  227  LPSNLEKDTTHRYSANSFKLHRLPIPRPGEVLGLVGTNGIGKSTALKILAGKQKPNLGRF  286

Query  503  KNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKAVQGNVGQVLDQKDER  682
            ++PPDW EILTYFRGSELQN+FT+ILED+LKAIIKPQYVD IPKAV+G+V Q+LD+KD+ 
Sbjct  287  EDPPDWTEILTYFRGSELQNFFTKILEDDLKAIIKPQYVDQIPKAVKGSVQQLLDKKDDL  346

Query  683  DMKEELCVDLELNQVLDHNV  742
              + ++C  L+L  V D NV
Sbjct  347  SNQMDVCEQLDLINVRDRNV  366



>emb|CCA19671.1| hypothetical protein ALNC14_058140 [Albugo laibachii Nc14]
Length=627

 Score =   345 bits (886),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 162/194 (84%), Positives = 180/194 (93%), Gaps = 0/194 (0%)
 Frame = +2

Query  110  RLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCGICVK  289
            +LTRIA+VSSDKCKPKKCRQECKKSCPVV+ G LCIEVTP +K+AFISE+LCIGCGICVK
Sbjct  4    KLTRIALVSSDKCKPKKCRQECKKSCPVVRMGNLCIEVTPKSKLAFISEDLCIGCGICVK  63

Query  290  KCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTALKVL  469
            KCPFEAI IINLPKDL+ +TTHRYGPNTFKLHRLP+PRPGQVLGLVGTNGIGKSTAL++L
Sbjct  64   KCPFEAINIINLPKDLESNTTHRYGPNTFKLHRLPMPRPGQVLGLVGTNGIGKSTALRIL  123

Query  470  AGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKAVQGN  649
            AGKLKPNLG F +PP+WQEILT+FRGSELQNYFTRILEDNLKAIIKPQYVD+IPKAVQG 
Sbjct  124  AGKLKPNLGNFISPPEWQEILTHFRGSELQNYFTRILEDNLKAIIKPQYVDNIPKAVQGT  183

Query  650  VGQVLDQKDERDMK  691
            V  +L  K E++ K
Sbjct  184  VRSMLMDKCEKEEK  197



>emb|CDX82529.1| BnaA03g32920D [Brassica napus]
Length=556

 Score =   343 bits (880),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 160/215 (74%), Positives = 185/215 (86%), Gaps = 1/215 (0%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            MSD RLTRIAIV+SD+CKPKKCRQECKKSCPVVKTGKLCIEVTPA+K AF+SEELCIGCG
Sbjct  1    MSD-RLTRIAIVNSDRCKPKKCRQECKKSCPVVKTGKLCIEVTPASKTAFLSEELCIGCG  59

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            ICVKKCPFEAIQIINLPKDL+KDT HRY  N FKLHRLPVPRPGQVLGLVGTNGIGKSTA
Sbjct  60   ICVKKCPFEAIQIINLPKDLEKDTIHRYNSNGFKLHRLPVPRPGQVLGLVGTNGIGKSTA  119

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            L++LAGK+KPN GR+ NPPDW EIL +FRGSELQ+YF R++E+ LK  +KPQ+VD I K 
Sbjct  120  LQILAGKIKPNFGRYNNPPDWHEILAHFRGSELQSYFIRLVEEKLKTAMKPQHVDAIKKV  179

Query  638  VQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNV  742
             +G +G VL++ DE+ M  E+C  ++LN +LD   
Sbjct  180  AKGTLGTVLEKLDEKGMMAEICDAMDLNHLLDREA  214



>gb|KDR23332.1| ATP-binding cassette sub-family E member 1 [Zootermopsis nevadensis]
Length=590

 Score =   344 bits (883),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 160/211 (76%), Positives = 188/211 (89%), Gaps = 0/211 (0%)
 Frame = +2

Query  110  RLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCGICVK  289
            +LTRIAIV++DKCKPK+CRQECKKSCPVV+ GKLCIEVTP  KIA ISEELCIGCGICVK
Sbjct  12   KLTRIAIVNADKCKPKRCRQECKKSCPVVRMGKLCIEVTPNDKIASISEELCIGCGICVK  71

Query  290  KCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTALKVL  469
            KCPFEAI IINLP +L+KDTTHRY  N+FKLHRLP+PRPG+VLGLVGTNGIGKSTALK+L
Sbjct  72   KCPFEAITIINLPSNLEKDTTHRYSQNSFKLHRLPIPRPGEVLGLVGTNGIGKSTALKIL  131

Query  470  AGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKAVQGN  649
            AGK KPNLGR+ +PPDW EIL++FRGSELQNYFT+ILED+LKA+IKPQYVD IPKAV+G 
Sbjct  132  AGKQKPNLGRYTDPPDWSEILSHFRGSELQNYFTKILEDDLKALIKPQYVDQIPKAVKGT  191

Query  650  VGQVLDQKDERDMKEELCVDLELNQVLDHNV  742
            V Q+LD+KDER  + E+C  L+L  + + ++
Sbjct  192  VQQLLDKKDERKNQNEICQLLDLENIRNRSI  222



>ref|XP_003487517.1| PREDICTED: ATP-binding cassette sub-family E member 1-like [Bombus 
impatiens]
Length=583

 Score =   344 bits (882),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 163/219 (74%), Positives = 191/219 (87%), Gaps = 1/219 (0%)
 Frame = +2

Query  89   KREMSD-QRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELC  265
            K+ M +  RLTRIAIV+SDKCKPK+CRQECK+SCPVV+ GKLCIEVTP +KIA ISEELC
Sbjct  4    KKSMEETDRLTRIAIVNSDKCKPKRCRQECKRSCPVVRMGKLCIEVTPNSKIASISEELC  63

Query  266  IGCGICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIG  445
            IGCGICVKKCPFEAI IINLP +L+K+TTHRY  N+FKLHRLP+PRPG+VLGLVGTNGIG
Sbjct  64   IGCGICVKKCPFEAISIINLPSNLEKETTHRYSKNSFKLHRLPIPRPGEVLGLVGTNGIG  123

Query  446  KSTALKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDH  625
            KSTALK+LAGK KPNLGRF +PPDW EIL++FRGSELQNYFT+ILED+LKA+IKPQYVD 
Sbjct  124  KSTALKILAGKQKPNLGRFSDPPDWTEILSHFRGSELQNYFTKILEDDLKALIKPQYVDQ  183

Query  626  IPKAVQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNV  742
            IPKAV+G V Q+LD+KDE   + E+C  L+L  + D  +
Sbjct  184  IPKAVKGTVQQLLDKKDECKNQMEICKMLDLMHIRDRGI  222



>ref|XP_002424051.1| ATP-binding cassette subfamily E, member 1 [Pediculus humanus 
corporis]
 gb|EEB11313.1| ATP-binding cassette subfamily E, member 1 [Pediculus humanus 
corporis]
Length=608

 Score =   345 bits (884),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 160/211 (76%), Positives = 186/211 (88%), Gaps = 0/211 (0%)
 Frame = +2

Query  110  RLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCGICVK  289
            +LTRIAIV+SDKCKPK+C+QECKKSCPVV+ GKLCIEV P  KIA ISEELCIGCGICVK
Sbjct  12   KLTRIAIVNSDKCKPKRCKQECKKSCPVVRMGKLCIEVVPNDKIATISEELCIGCGICVK  71

Query  290  KCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTALKVL  469
            KCPFEAI IINLP +L+KDTTHRY  N+FKLHRLP+PRPG+VLGLVGTNGIGKSTALK+L
Sbjct  72   KCPFEAITIINLPSNLEKDTTHRYSQNSFKLHRLPIPRPGEVLGLVGTNGIGKSTALKIL  131

Query  470  AGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKAVQGN  649
            AGK KPNLGR+  PPDW EIL++FRGSELQNYFT+ILED+LKA+IKPQYVD IPKAV+G 
Sbjct  132  AGKQKPNLGRYSEPPDWTEILSHFRGSELQNYFTKILEDDLKALIKPQYVDQIPKAVKGT  191

Query  650  VGQVLDQKDERDMKEELCVDLELNQVLDHNV  742
            V Q+LD+KDER  + ++C  LEL  + D ++
Sbjct  192  VQQLLDKKDERKNQADICKRLELENIRDRSI  222



>emb|CEP07445.1| hypothetical protein [Parasitella parasitica]
Length=599

 Score =   344 bits (882),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 163/218 (75%), Positives = 185/218 (85%), Gaps = 1/218 (0%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            MSD +LTRIAIVS+DKCKPKKCRQECK+SCPV + GKLCIEV   +KIAFISE LCIGCG
Sbjct  1    MSD-KLTRIAIVSADKCKPKKCRQECKRSCPVNRMGKLCIEVEATSKIAFISETLCIGCG  59

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            ICVKKCPF AI IINLP +LD + THRY  N+FKLHRLPVPRPGQVLGLVGTNGIGKSTA
Sbjct  60   ICVKKCPFGAIHIINLPTNLDGEVTHRYSANSFKLHRLPVPRPGQVLGLVGTNGIGKSTA  119

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            LK+L+GK+KPNLG+F+NPPDWQ+IL YFRGSELQNYFT+ILEDNLKAIIKPQYVDHIPK 
Sbjct  120  LKILSGKMKPNLGKFENPPDWQDILKYFRGSELQNYFTKILEDNLKAIIKPQYVDHIPKV  179

Query  638  VQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNVGRF  751
            V G V  +L+ K ER+  E +  +L+L  VL   VG+ 
Sbjct  180  VSGEVHNLLEDKHERNNLENMIDELDLKDVLKREVGQL  217



>ref|XP_002028023.1| GL15045 [Drosophila persimilis]
 gb|EDW37788.1| GL15045 [Drosophila persimilis]
Length=578

 Score =   343 bits (881),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 155/212 (73%), Positives = 186/212 (88%), Gaps = 0/212 (0%)
 Frame = +2

Query  116  TRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCGICVKKC  295
            TRIAIVS DKCKPK+CRQECKK+CPVV+ GKLCIEV+P +KIA +SEELCIGCGICVKKC
Sbjct  14   TRIAIVSDDKCKPKRCRQECKKTCPVVRMGKLCIEVSPTSKIASLSEELCIGCGICVKKC  73

Query  296  PFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTALKVLAG  475
            PFEAI IINLP +L+K TTHRY  N+FKLHRLP+PRPG+VLGLVG NGIGKSTALK+LAG
Sbjct  74   PFEAITIINLPSNLEKHTTHRYSKNSFKLHRLPIPRPGEVLGLVGQNGIGKSTALKILAG  133

Query  476  KLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKAVQGNVG  655
            K KPNLG++ NPPDW +IL+YFRGSELQNYFT+ILEDNLKA++KPQYVD IPKAV+G VG
Sbjct  134  KQKPNLGKYANPPDWTDILSYFRGSELQNYFTKILEDNLKALVKPQYVDQIPKAVRGTVG  193

Query  656  QVLDQKDERDMKEELCVDLELNQVLDHNVGRF  751
             +LD+KDER+++  +C  L+L+ + D  + + 
Sbjct  194  DLLDKKDERELQTSICNMLDLSHIRDREISQL  225



>ref|XP_003773214.1| PREDICTED: ATP-binding cassette sub-family E member 1 isoform 
2 [Sarcophilus harrisii]
Length=476

 Score =   340 bits (872),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 159/215 (74%), Positives = 187/215 (87%), Gaps = 1/215 (0%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            M+D +LTRIAIV+ DKCKPKKCRQECKKSCPVV+ GKLCIEVTP +KIA+ISE LCIGCG
Sbjct  1    MAD-KLTRIAIVNHDKCKPKKCRQECKKSCPVVRMGKLCIEVTPQSKIAWISETLCIGCG  59

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            IC+KKCPF A+ I+NLP +L+K+TTHRY  N FKLHRLP+PRPG+VLGLVGTNGIGKSTA
Sbjct  60   ICIKKCPFGALSIVNLPSNLEKETTHRYCANAFKLHRLPIPRPGEVLGLVGTNGIGKSTA  119

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            LK+LAGK KPNLG++ +PPDWQEILTYFRGSELQNYFT+ILED+LKAIIKPQYVD IPKA
Sbjct  120  LKILAGKQKPNLGKYDDPPDWQEILTYFRGSELQNYFTKILEDDLKAIIKPQYVDQIPKA  179

Query  638  VQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNV  742
             +G VG +LD+KDE   +  +C  L+L  + + NV
Sbjct  180  AKGTVGSILDRKDETKTQAIVCQQLDLTHLKERNV  214



>ref|XP_009135315.1| PREDICTED: ABC transporter E family member 1-like [Brassica rapa]
Length=603

 Score =   344 bits (882),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 161/212 (76%), Positives = 185/212 (87%), Gaps = 1/212 (0%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            MSD RLTRIAIV+SD+CKPKKCRQECKKSCPVVKTGKLCIEVTPA+K AF+SEELCIGCG
Sbjct  1    MSD-RLTRIAIVNSDRCKPKKCRQECKKSCPVVKTGKLCIEVTPASKTAFLSEELCIGCG  59

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            ICVKKCPFEAIQIINLPKDL+KDT HRY  N FKLHRLPVPRPGQVLGLVGTNGIGKSTA
Sbjct  60   ICVKKCPFEAIQIINLPKDLEKDTIHRYNSNGFKLHRLPVPRPGQVLGLVGTNGIGKSTA  119

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            L++LAGK+KPN GR+ NPPDW EIL +FRGSELQ+YF R++E+ LK  +KPQ+VD I K 
Sbjct  120  LQILAGKIKPNFGRYNNPPDWHEILAHFRGSELQSYFIRLVEEKLKTAMKPQHVDAIKKV  179

Query  638  VQGNVGQVLDQKDERDMKEELCVDLELNQVLD  733
             +G +G VL++ DER M  E+C  ++LN +LD
Sbjct  180  AKGTLGTVLEKLDERGMMAEICDAMDLNHLLD  211



>ref|XP_003394142.1| PREDICTED: ATP-binding cassette sub-family E member 1-like [Bombus 
terrestris]
Length=583

 Score =   343 bits (881),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 163/219 (74%), Positives = 191/219 (87%), Gaps = 1/219 (0%)
 Frame = +2

Query  89   KREMSD-QRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELC  265
            K+ M +  RLTRIAIV+SDKCKPK+CRQECK+SCPVV+ GKLCIEVTP +KIA ISEELC
Sbjct  4    KKSMEETDRLTRIAIVNSDKCKPKRCRQECKRSCPVVRMGKLCIEVTPNSKIASISEELC  63

Query  266  IGCGICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIG  445
            IGCGICVKKCPFEAI IINLP +L+K+TTHRY  N+FKLHRLP+PRPG+VLGLVGTNGIG
Sbjct  64   IGCGICVKKCPFEAISIINLPSNLEKETTHRYSKNSFKLHRLPIPRPGEVLGLVGTNGIG  123

Query  446  KSTALKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDH  625
            KSTALK+LAGK KPNLGRF +PPDW EIL++FRGSELQNYFT+ILED+LKA+IKPQYVD 
Sbjct  124  KSTALKILAGKQKPNLGRFSDPPDWTEILSHFRGSELQNYFTKILEDDLKALIKPQYVDQ  183

Query  626  IPKAVQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNV  742
            IPKAV+G V Q+LD+KDE   + E+C  L+L  + D  +
Sbjct  184  IPKAVKGTVQQLLDKKDECKNQIEICKMLDLMHIRDRGI  222



>emb|CDS10188.1| Putative Translation initiation factor RLI1 [Absidia idahoensis 
var. thermophila]
Length=599

 Score =   344 bits (882),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 159/218 (73%), Positives = 187/218 (86%), Gaps = 1/218 (0%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            MSD +LTRIAI+++DKCKPKKCRQECKKSCPV + GK CIEV+P +KIAFISE LCIGCG
Sbjct  1    MSD-KLTRIAIINADKCKPKKCRQECKKSCPVNRMGKFCIEVSPTSKIAFISETLCIGCG  59

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            IC KKCPF AI IINLP +L+ + THRY  N+FKLHRLPVPRPGQVLGLVGTNGIGKSTA
Sbjct  60   ICPKKCPFGAINIINLPTNLESEVTHRYSANSFKLHRLPVPRPGQVLGLVGTNGIGKSTA  119

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            LK+L+GK+KPNLG+F NPPDW++IL YFRGSELQNYFT+ILEDNLKAI KPQYVDHIPK 
Sbjct  120  LKILSGKMKPNLGQFDNPPDWEDILKYFRGSELQNYFTKILEDNLKAITKPQYVDHIPKV  179

Query  638  VQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNVGRF  751
            V G VGQ+L+ K ER+  +E+  +LEL  +++  VG+ 
Sbjct  180  VNGKVGQLLEDKMERNNLDEMIDELELKGIMNREVGQL  217



>ref|XP_007782779.1| translation initiation factor RLI1 [Coniosporium apollinis CBS 
100218]
 gb|EON67462.1| translation initiation factor RLI1 [Coniosporium apollinis CBS 
100218]
Length=604

 Score =   344 bits (882),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 165/218 (76%), Positives = 188/218 (86%), Gaps = 4/218 (2%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            M+D RLTRIAIV+SDKCKPKKCRQECKKSCPVV+TGKLCIEVTP +KIAFISE LCIGCG
Sbjct  1    MAD-RLTRIAIVNSDKCKPKKCRQECKKSCPVVRTGKLCIEVTPESKIAFISERLCIGCG  59

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            IC KKCPF+AI IINLP +L+   THRY  N+FKLHRLP+PRPGQVLGLVGTNGIGKSTA
Sbjct  60   ICPKKCPFDAINIINLPTNLETQVTHRYSANSFKLHRLPMPRPGQVLGLVGTNGIGKSTA  119

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            LKVL+GKLKPNLGR+ NPPDW+EIL YFRGSELQNYFT++LEDNLKAIIKPQYVD IPKA
Sbjct  120  LKVLSGKLKPNLGRYDNPPDWEEILRYFRGSELQNYFTKVLEDNLKAIIKPQYVDQIPKA  179

Query  638  VQG---NVGQVLDQKDERDMKEELCVDLELNQVLDHNV  742
            V+G    VG ++  + + D  +E+   LEL QVLD ++
Sbjct  180  VKGTDKTVGALMKGRSQMDNMDEILDVLELRQVLDRDI  217



>ref|XP_004831360.1| ABC transporter, ATP-binding protein domain-containing protein 
[Babesia equi]
 gb|AFZ81694.1| ABC transporter, ATP-binding protein domain-containing protein 
[Babesia equi strain WA]
Length=615

 Score =   344 bits (883),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 159/215 (74%), Positives = 185/215 (86%), Gaps = 1/215 (0%)
 Frame = +2

Query  101  SDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCGI  280
            +D +L RIAIVS+DKCKPKKCRQEC+++CPV KTGK CI V P +KIA+ISE LCIGCGI
Sbjct  15   TDSKL-RIAIVSTDKCKPKKCRQECRRNCPVTKTGKQCIMVEPTSKIAYISETLCIGCGI  73

Query  281  CVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTAL  460
            CVKKCPFEAI IINLP+DL KDTTHR+GPNTFKLHRLPVPRPGQ+LGLVGTNGIGKSTAL
Sbjct  74   CVKKCPFEAINIINLPRDLGKDTTHRFGPNTFKLHRLPVPRPGQILGLVGTNGIGKSTAL  133

Query  461  KVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKAV  640
            KVL+GKLKPNLG+++ PPDW EIL YFRGSELQ YFTR+LEDNL   +KPQYVD+IPK V
Sbjct  134  KVLSGKLKPNLGKYEAPPDWSEILQYFRGSELQGYFTRMLEDNLTTAVKPQYVDNIPKQV  193

Query  641  QGNVGQVLDQKDERDMKEELCVDLELNQVLDHNVG  745
             G VG++LD KD++ MK++L + LEL  +L   V 
Sbjct  194  SGTVGEILDAKDKKGMKDDLIITLELAHLLSRKVS  228



>emb|CDH54417.1| translation initiation factor rli1 [Lichtheimia corymbifera JMRC:FSU:9682]
Length=599

 Score =   343 bits (881),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 159/218 (73%), Positives = 187/218 (86%), Gaps = 1/218 (0%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            MSD +LTRIAI+++DKCKPKKCRQECKKSCPV + GK CIEV+P +KIAFISE LCIGCG
Sbjct  1    MSD-KLTRIAIINADKCKPKKCRQECKKSCPVNRMGKFCIEVSPTSKIAFISETLCIGCG  59

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            IC KKCPF AI IINLP +L+ + THRY  N+FKLHRLPVPRPGQVLGLVGTNGIGKSTA
Sbjct  60   ICPKKCPFGAINIINLPTNLESEVTHRYSANSFKLHRLPVPRPGQVLGLVGTNGIGKSTA  119

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            LK+L+GK+KPNLG+F NPPDW++IL YFRGSELQNYFT+ILEDNLKAI KPQYVDHIPK 
Sbjct  120  LKILSGKMKPNLGQFDNPPDWEDILKYFRGSELQNYFTKILEDNLKAITKPQYVDHIPKV  179

Query  638  VQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNVGRF  751
            V G VGQ+L+ K ER+  +E+  +LEL  +++  VG+ 
Sbjct  180  VNGKVGQLLEDKMERNNLDEMIDELELKGIMNREVGQL  217



>ref|XP_004347570.2| ATP-binding cassette sub-family E member 1 [Capsaspora owczarzaki 
ATCC 30864]
 gb|KJE94134.1| ATP-binding cassette sub-family E member 1 [Capsaspora owczarzaki 
ATCC 30864]
Length=621

 Score =   344 bits (883),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 161/213 (76%), Positives = 185/213 (87%), Gaps = 0/213 (0%)
 Frame = +2

Query  104  DQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCGIC  283
            D+RLTRIAIVSSDKCKPKKCRQECKKSCPVV+ GKLCIEV P  KI++ISEELCIGCGIC
Sbjct  23   DERLTRIAIVSSDKCKPKKCRQECKKSCPVVRMGKLCIEVAPTDKISYISEELCIGCGIC  82

Query  284  VKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTALK  463
            VKKCPFEAI IINLP +L K+TTHRY  N+FKLHRLP PR GQVLGLVG NGIGKSTALK
Sbjct  83   VKKCPFEAISIINLPSNLSKETTHRYSANSFKLHRLPTPRAGQVLGLVGKNGIGKSTALK  142

Query  464  VLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKAVQ  643
            +LAGK KPNLGRF+NPPDW +ILT FRGSELQNYF +ILEDNLKAIIKPQYVD++PKAVQ
Sbjct  143  ILAGKQKPNLGRFENPPDWADILTRFRGSELQNYFQKILEDNLKAIIKPQYVDNLPKAVQ  202

Query  644  GNVGQVLDQKDERDMKEELCVDLELNQVLDHNV  742
            G V ++LD+KD+R  ++ +   L+L  + + N+
Sbjct  203  GKVQEILDKKDDRKNQDVVKPMLDLTNLTERNI  235



>dbj|GAN01144.1| translation initiation factor RLI1 [Mucor ambiguus]
Length=599

 Score =   343 bits (881),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 163/218 (75%), Positives = 186/218 (85%), Gaps = 1/218 (0%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            MSD +LTRIAIVS+DKCKPKKCRQECK+SCPV + GKLCIEV P +KIAFISEELCIGCG
Sbjct  1    MSD-KLTRIAIVSADKCKPKKCRQECKRSCPVNRMGKLCIEVEPTSKIAFISEELCIGCG  59

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            ICVKKCPF AI IINLP +L+ + THRY  N+FKLHRLPVPRPGQVLGLVGTNGIGKSTA
Sbjct  60   ICVKKCPFGAIHIINLPTNLEGEVTHRYSANSFKLHRLPVPRPGQVLGLVGTNGIGKSTA  119

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            LK+L+GK+KPNLG+F+ PPDWQ+IL YFRGSELQNYFT+ILEDNLKAIIKPQYVDHIPK 
Sbjct  120  LKILSGKMKPNLGKFEAPPDWQDILKYFRGSELQNYFTKILEDNLKAIIKPQYVDHIPKV  179

Query  638  VQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNVGRF  751
            V G V  +L+ K ER+  E++   L+L  VL   VG+ 
Sbjct  180  VSGKVHALLEDKHERNNLEDMIDYLDLKDVLQREVGQL  217



>ref|XP_011196211.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Bactrocera 
cucurbitae]
Length=611

 Score =   344 bits (882),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 160/219 (73%), Positives = 190/219 (87%), Gaps = 1/219 (0%)
 Frame = +2

Query  95   EMSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGC  274
            E +D++ TRIAIVS DKCKPK+CRQECKKSCPVV+ GKLCIEVTP +KIA +SEELCIGC
Sbjct  8    EETDKQ-TRIAIVSDDKCKPKRCRQECKKSCPVVRMGKLCIEVTPTSKIASLSEELCIGC  66

Query  275  GICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKST  454
            GICVKKCPFEAI IIN+P +L+K TTHRYG N+FKLHRLP+PRPG+VLGLVG NGIGKST
Sbjct  67   GICVKKCPFEAITIINVPSNLEKHTTHRYGKNSFKLHRLPIPRPGEVLGLVGQNGIGKST  126

Query  455  ALKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPK  634
            ALK+LAGK KPNLGR+ +PPDW EIL YFRGSELQNYFT+ILEDNLKA++KPQYVD IPK
Sbjct  127  ALKILAGKQKPNLGRYGDPPDWTEILAYFRGSELQNYFTKILEDNLKALVKPQYVDQIPK  186

Query  635  AVQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNVGRF  751
            AV+G V ++LD+KDER  + E+C  L+L  + D ++ + 
Sbjct  187  AVRGAVAELLDKKDERKNQHEICQMLDLLHIRDRDIAQL  225



>ref|XP_008301422.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Stegastes 
partitus]
Length=428

 Score =   338 bits (866),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 156/215 (73%), Positives = 190/215 (88%), Gaps = 1/215 (0%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            M+D+  TRIAIV+ DKCKPKKCRQECKKSCPVV+ GKLCIEVTP +KIA+ISE LCIGCG
Sbjct  1    MADKN-TRIAIVNHDKCKPKKCRQECKKSCPVVRMGKLCIEVTPQSKIAWISESLCIGCG  59

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            IC+KKCPF A+ I+NLP +L+K+TTHRY  N+FKLHRLP+PRPG+VLGLVGTNGIGKSTA
Sbjct  60   ICIKKCPFGALSIVNLPSNLEKETTHRYCANSFKLHRLPIPRPGEVLGLVGTNGIGKSTA  119

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            LK+LAGK KPNLG++ NPPDWQEILTYFRGSELQNYFT+ILED+L+AI+KPQYVD IPK 
Sbjct  120  LKILAGKQKPNLGKYDNPPDWQEILTYFRGSELQNYFTKILEDDLRAIVKPQYVDQIPKT  179

Query  638  VQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNV  742
            V+G+VG +L +KD+ D ++ +C  L+L+ + + NV
Sbjct  180  VKGSVGAILSRKDDTDTQDIVCDQLDLSHLRERNV  214



>ref|XP_001354175.2| GA19033 [Drosophila pseudoobscura pseudoobscura]
 gb|EAL31227.2| GA19033 [Drosophila pseudoobscura pseudoobscura]
Length=610

 Score =   343 bits (881),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 155/212 (73%), Positives = 186/212 (88%), Gaps = 0/212 (0%)
 Frame = +2

Query  116  TRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCGICVKKC  295
            TRIAIVS DKCKPK+CRQECKK+CPVV+ GKLCIEV+P +KIA +SEELCIGCGICVKKC
Sbjct  14   TRIAIVSDDKCKPKRCRQECKKTCPVVRMGKLCIEVSPTSKIASLSEELCIGCGICVKKC  73

Query  296  PFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTALKVLAG  475
            PFEAI IINLP +L+K TTHRY  N+FKLHRLP+PRPG+VLGLVG NGIGKSTALK+LAG
Sbjct  74   PFEAITIINLPSNLEKHTTHRYSKNSFKLHRLPIPRPGEVLGLVGQNGIGKSTALKILAG  133

Query  476  KLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKAVQGNVG  655
            K KPNLG++ NPPDW +IL+YFRGSELQNYFT+ILEDNLKA++KPQYVD IPKAV+G VG
Sbjct  134  KQKPNLGKYANPPDWTDILSYFRGSELQNYFTKILEDNLKALVKPQYVDQIPKAVRGTVG  193

Query  656  QVLDQKDERDMKEELCVDLELNQVLDHNVGRF  751
             +LD+KDER+++  +C  L+L+ + D  + + 
Sbjct  194  DLLDKKDERELQTSICNMLDLSHIRDREISQL  225



>ref|XP_007070201.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Chelonia 
mydas]
 gb|EMP25917.1| ATP-binding cassette sub-family E member 1, partial [Chelonia 
mydas]
Length=599

 Score =   343 bits (880),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 159/215 (74%), Positives = 188/215 (87%), Gaps = 1/215 (0%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            M+D +LTRIAIVS+DKCKPKKCRQECKKSCPVV+ GKLCIEV P +KIA+ISE LCIGCG
Sbjct  1    MAD-KLTRIAIVSNDKCKPKKCRQECKKSCPVVRMGKLCIEVVPQSKIAWISETLCIGCG  59

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            IC+KKCPF A+ I+NLP +L+K+TTHRY  N FKLHRLP+PRPG+VLGLVGTNGIGKSTA
Sbjct  60   ICIKKCPFGALSIVNLPSNLEKETTHRYCANAFKLHRLPIPRPGEVLGLVGTNGIGKSTA  119

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            LK+LAGK KPNLG++ +PPDWQEILTYFRGSELQNYFT+ILED+LKAIIKPQYVD IPKA
Sbjct  120  LKILAGKQKPNLGKYDDPPDWQEILTYFRGSELQNYFTKILEDDLKAIIKPQYVDQIPKA  179

Query  638  VQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNV  742
             +G VG +LD+KDE D +  +C  L+L  + + N+
Sbjct  180  AKGTVGSILDRKDETDTQTIVCKQLDLTHLRERNI  214



>ref|XP_011163484.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Solenopsis 
invicta]
 gb|EFZ15738.1| hypothetical protein SINV_11846 [Solenopsis invicta]
Length=608

 Score =   343 bits (881),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 162/219 (74%), Positives = 191/219 (87%), Gaps = 1/219 (0%)
 Frame = +2

Query  89   KREMSD-QRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELC  265
            K+ M +  RLTRIAIV+SDKCKPK+CRQECK+SCPVV+ GKLCIEVTP +KIA ISEELC
Sbjct  4    KKSMEETDRLTRIAIVNSDKCKPKRCRQECKRSCPVVRMGKLCIEVTPNSKIAAISEELC  63

Query  266  IGCGICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIG  445
            IGCGICVKKCPFEAI IINLP +L+K+TTHRY  N+FKLHRLP+PRPG+VLGLVGTNGIG
Sbjct  64   IGCGICVKKCPFEAISIINLPSNLEKETTHRYSKNSFKLHRLPIPRPGEVLGLVGTNGIG  123

Query  446  KSTALKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDH  625
            KSTALK+LAGK KPNLGR+ +PPDW EIL++FRGSELQNYFT+ILED+LKA+IKPQYVD 
Sbjct  124  KSTALKILAGKQKPNLGRYSDPPDWTEILSHFRGSELQNYFTKILEDDLKALIKPQYVDQ  183

Query  626  IPKAVQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNV  742
            IPKAV+G V Q+LD+KDE   + E+C  L+L  + D  +
Sbjct  184  IPKAVKGTVQQLLDKKDECKNQMEICAMLDLLHIRDRGI  222



>gb|EHJ73926.1| ribonuclease L inhibitor-like protein [Danaus plexippus]
Length=608

 Score =   343 bits (881),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 158/212 (75%), Positives = 188/212 (89%), Gaps = 0/212 (0%)
 Frame = +2

Query  110  RLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCGICVK  289
            +LTRIAIV++D+CKPK+CRQECKKSCPVV+ GKLCIEVTP  KIA ISEELCIGCGICVK
Sbjct  12   KLTRIAIVNADRCKPKRCRQECKKSCPVVRMGKLCIEVTPNDKIATISEELCIGCGICVK  71

Query  290  KCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTALKVL  469
            KCPF+AI IIN+P +L+K TTHRY  N+FKLHRLP+PRPG+VLGLVG NGIGKSTALK+L
Sbjct  72   KCPFDAITIINIPSNLEKHTTHRYSKNSFKLHRLPIPRPGEVLGLVGQNGIGKSTALKIL  131

Query  470  AGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKAVQGN  649
            AGK KPNLGRF +PPDWQEIL++FRGSELQNYFT+ILED+LKA+IKPQYVD IPKAV+G 
Sbjct  132  AGKQKPNLGRFADPPDWQEILSHFRGSELQNYFTKILEDDLKALIKPQYVDQIPKAVKGT  191

Query  650  VGQVLDQKDERDMKEELCVDLELNQVLDHNVG  745
            VGQ+LD+KDER  ++ +C  L+L+ + D  + 
Sbjct  192  VGQLLDKKDERKNQDVICRMLDLSHIRDREIA  223



>ref|XP_008614115.1| ABC transporter E family member 2 [Saprolegnia diclina VS20]
 gb|EQC32614.1| ABC transporter E family member 2 [Saprolegnia diclina VS20]
Length=628

 Score =   344 bits (882),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 164/217 (76%), Positives = 191/217 (88%), Gaps = 2/217 (1%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            MSD +LTRIAIVS+DKCKPKKCRQECKKSCPVV+ GK+CIE T  +KIA+ISE LCIGCG
Sbjct  1    MSD-KLTRIAIVSADKCKPKKCRQECKKSCPVVRMGKVCIEATGKSKIAYISESLCIGCG  59

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            ICVKKCPFEAI IINLPKDL+ +TTHRYG NTFKLHRLP+PRPGQVLGLVGTNGIGKSTA
Sbjct  60   ICVKKCPFEAINIINLPKDLENNTTHRYGANTFKLHRLPMPRPGQVLGLVGTNGIGKSTA  119

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            LKVLAGKLKPNLGR+ +PP+WQEILTYFRGSELQNYFT+ILEDNLKAIIKPQ+VD IPKA
Sbjct  120  LKVLAGKLKPNLGRYDSPPEWQEILTYFRGSELQNYFTKILEDNLKAIIKPQFVDRIPKA  179

Query  638  VQGNVGQVLDQKDERDMKEELCV-DLELNQVLDHNVG  745
            VQG V Q++  + +++ K +  + +L+L  + D ++ 
Sbjct  180  VQGQVRQIISDRCQKEGKLDYYMKELDLTHIKDRDLA  216



>gb|KFM79460.1| ATP-binding cassette sub-family E member 1, partial [Stegodyphus 
mimosarum]
Length=601

 Score =   343 bits (880),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 163/214 (76%), Positives = 187/214 (87%), Gaps = 0/214 (0%)
 Frame = +2

Query  101  SDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCGI  280
            +  +LTRIAIV+SDKCKPK+C+QECKKSCPVV+ GKLCIEVTP  KIA ISEELCIGCGI
Sbjct  3    TQDKLTRIAIVNSDKCKPKRCKQECKKSCPVVRMGKLCIEVTPNDKIAAISEELCIGCGI  62

Query  281  CVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTAL  460
            CVKKCPFEAI IINLP +L+KDTTHRY  N+FKLHRLP PRPG+VLGLVGTNGIGKSTAL
Sbjct  63   CVKKCPFEAISIINLPSNLEKDTTHRYSQNSFKLHRLPTPRPGEVLGLVGTNGIGKSTAL  122

Query  461  KVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKAV  640
            K+LAGKLKPNLGRF++PPDW EIL +FRGSELQNYFT+ILED+LKAIIKPQYVD IPKAV
Sbjct  123  KILAGKLKPNLGRFQDPPDWTEILAHFRGSELQNYFTKILEDDLKAIIKPQYVDQIPKAV  182

Query  641  QGNVGQVLDQKDERDMKEELCVDLELNQVLDHNV  742
            QG V Q+LD+KD+   +  +C  L+L  V + +V
Sbjct  183  QGTVQQLLDKKDDLKNQNLICEMLDLGNVRERHV  216



>ref|XP_005284350.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Chrysemys 
picta bellii]
Length=599

 Score =   343 bits (879),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 159/215 (74%), Positives = 188/215 (87%), Gaps = 1/215 (0%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            M+D +LTRIAIV+ DKCKPKKCRQECKKSCPVV+ GKLCIEVTP +KIA+ISE LCIGCG
Sbjct  1    MAD-KLTRIAIVNHDKCKPKKCRQECKKSCPVVRMGKLCIEVTPQSKIAWISETLCIGCG  59

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            IC+KKCPF A+ I+NLP +L+K+TTHRY  N FKLHRLP+PRPG+VLGLVGTNGIGKSTA
Sbjct  60   ICIKKCPFGALSIVNLPSNLEKETTHRYCANAFKLHRLPIPRPGEVLGLVGTNGIGKSTA  119

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            LK+LAGK KPNLG++ +PPDWQEILTYFRGSELQNYFT+ILED+LKAIIKPQYVD IPKA
Sbjct  120  LKILAGKQKPNLGKYDDPPDWQEILTYFRGSELQNYFTKILEDDLKAIIKPQYVDQIPKA  179

Query  638  VQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNV  742
             +G VG +LD+KDE D +  +C  L+L  + + N+
Sbjct  180  AKGTVGSILDRKDETDTQTIVCKQLDLTHLKERNI  214



>ref|XP_002506706.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO67964.1| predicted protein [Micromonas sp. RCC299]
Length=614

 Score =   343 bits (880),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 158/216 (73%), Positives = 190/216 (88%), Gaps = 0/216 (0%)
 Frame = +2

Query  95   EMSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGC  274
            E ++ +L RIAIVS+D+C+PKKC+QECKKSCPVVK GKLCIEV+ ++K+A+ISE+LCIGC
Sbjct  10   EDANDQLDRIAIVSADRCRPKKCKQECKKSCPVVKVGKLCIEVSGSSKLAYISEDLCIGC  69

Query  275  GICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKST  454
            GICVKKCPFEA+QIINLPK+L+K+TTHRYGPN FKLHRLP+PR GQVLGLVG+NG GKST
Sbjct  70   GICVKKCPFEAVQIINLPKNLEKETTHRYGPNAFKLHRLPMPRCGQVLGLVGSNGTGKST  129

Query  455  ALKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPK  634
            ALK+L+GKLKPNLG+F  PPDWQEI+ YFRGSELQNY TRILED++KA+IKPQYVDHIPK
Sbjct  130  ALKILSGKLKPNLGKFATPPDWQEIIQYFRGSELQNYLTRILEDDIKALIKPQYVDHIPK  189

Query  635  AVQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNV  742
            AV+G V Q L  +D+R    EL  +L+L  VLD +V
Sbjct  190  AVKGQVLQTLQDRDDRGKVSELIDELDLENVLDRDV  225



>gb|KDO32655.1| ABC transporter E family member 2 [Saprolegnia parasitica CBS 
223.65]
Length=628

 Score =   343 bits (881),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 163/217 (75%), Positives = 191/217 (88%), Gaps = 2/217 (1%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            MSD +LTRIAIVS+DKCKPKKCRQECKKSCPVV+ GK+CIE T  +KIA+ISE LCIGCG
Sbjct  1    MSD-KLTRIAIVSADKCKPKKCRQECKKSCPVVRMGKICIEATGKSKIAYISESLCIGCG  59

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            ICVKKCPFEAI IINLPKDL+ +TTHRYG NTFKLHRLP+PRPGQVLGLVGTNGIGKSTA
Sbjct  60   ICVKKCPFEAINIINLPKDLENNTTHRYGANTFKLHRLPMPRPGQVLGLVGTNGIGKSTA  119

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            LK+LAGKLKPNLGR+ +PP+WQEILTYFRGSELQNYFT+ILEDNLKAIIKPQ+VD IPKA
Sbjct  120  LKILAGKLKPNLGRYDSPPEWQEILTYFRGSELQNYFTKILEDNLKAIIKPQFVDRIPKA  179

Query  638  VQGNVGQVLDQKDERDMKEELCV-DLELNQVLDHNVG  745
            VQG V Q++  + +++ K +  + +L+L  + D ++ 
Sbjct  180  VQGQVRQIISDRCQKEGKLDYYMKELDLTHIKDRDLA  216



>ref|XP_011201626.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Bactrocera 
dorsalis]
Length=611

 Score =   343 bits (880),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 160/224 (71%), Positives = 192/224 (86%), Gaps = 1/224 (0%)
 Frame = +2

Query  80   RLVKREMSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEE  259
            R  + E +D++ TRIAIVS DKCKPK+CRQECKKSCPVV+ GKLCIEVTP +KIA +SEE
Sbjct  3    RRKEHEETDKQ-TRIAIVSDDKCKPKRCRQECKKSCPVVRMGKLCIEVTPTSKIASLSEE  61

Query  260  LCIGCGICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNG  439
            LCIGCGICVKKCPFEAI IIN+P +L+K TTHRYG N+FKLHRLP+PRPG+VLGLVG NG
Sbjct  62   LCIGCGICVKKCPFEAITIINIPSNLEKHTTHRYGKNSFKLHRLPIPRPGEVLGLVGQNG  121

Query  440  IGKSTALKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYV  619
            IGKSTALK+LAGK KPNLG++ +PPDW EIL YFRGSELQNYFT+ILEDNLKA++KPQYV
Sbjct  122  IGKSTALKILAGKQKPNLGKYGDPPDWTEILAYFRGSELQNYFTKILEDNLKALVKPQYV  181

Query  620  DHIPKAVQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNVGRF  751
            D IPKAV+G V ++LD+KDER  + E+C  L+L  + D ++ + 
Sbjct  182  DQIPKAVRGAVAELLDKKDERKNQHEICEMLDLLHIRDRDIAQL  225



>ref|XP_007897363.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Callorhinchus 
milii]
Length=599

 Score =   343 bits (879),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 160/215 (74%), Positives = 189/215 (88%), Gaps = 1/215 (0%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            M+D +LTRIAIVS DKCKPKKCRQECKKSCPVV+ GKLCIEVT  +KIA+ISE LCIGCG
Sbjct  1    MAD-KLTRIAIVSHDKCKPKKCRQECKKSCPVVRMGKLCIEVTAQSKIAWISETLCIGCG  59

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            IC+KKCPF A+ I+NLP +L K+TTHRY  N+FKLHRLP+PRPG+VLGLVGTNGIGKSTA
Sbjct  60   ICIKKCPFGALSIVNLPSNLAKETTHRYCANSFKLHRLPIPRPGEVLGLVGTNGIGKSTA  119

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            LK+LAGK KPNLG++ +PPDWQEILTYFRGSELQNYFT+ILED+LKAIIKPQYVD IPKA
Sbjct  120  LKILAGKQKPNLGKYDDPPDWQEILTYFRGSELQNYFTKILEDDLKAIIKPQYVDQIPKA  179

Query  638  VQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNV  742
            V+G VG +LD+KDE + ++ +C  L+L  + + NV
Sbjct  180  VKGTVGSILDRKDETNTQKTICALLDLTHLRERNV  214



>ref|NP_001080761.1| ATP-binding cassette, sub-family E (OABP), member 1 [Xenopus 
laevis]
 gb|AAH46573.1| Abce1-prov protein [Xenopus laevis]
Length=599

 Score =   343 bits (879),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 162/215 (75%), Positives = 187/215 (87%), Gaps = 1/215 (0%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            M+D +LTRIAIVS DKCKPKKCRQECKKSCPVV+ GKLCIEVTP +KIA+ISE LCIGCG
Sbjct  1    MAD-KLTRIAIVSHDKCKPKKCRQECKKSCPVVRMGKLCIEVTPQSKIAWISETLCIGCG  59

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            ICVKKCPF A+ I+NLP +L+K+TTHRY  N FKLHRLP+PRPG+VLGLVGTNGIGKSTA
Sbjct  60   ICVKKCPFVALSIVNLPSNLEKETTHRYCANAFKLHRLPIPRPGEVLGLVGTNGIGKSTA  119

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            LK+LAGK KPNLG++ +PPDWQEILTYFRGSELQNYFT+ILED+LKAIIKPQYVD IPKA
Sbjct  120  LKILAGKQKPNLGKYDDPPDWQEILTYFRGSELQNYFTKILEDDLKAIIKPQYVDQIPKA  179

Query  638  VQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNV  742
             +G VG +LD+KDE   +  +C  L+L  + D NV
Sbjct  180  AKGPVGTILDRKDETKTQITVCDQLDLTHLRDRNV  214



>ref|XP_005327610.1| PREDICTED: ATP-binding cassette sub-family E member 1 isoform 
X1 [Ictidomys tridecemlineatus]
Length=682

 Score =   345 bits (885),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 165/239 (69%), Positives = 195/239 (82%), Gaps = 3/239 (1%)
 Frame = +2

Query  26   CVHHTLHNLLFFNRNLCYRLVKREMSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTG  205
            C  H  H  + F+R   Y      M+D +LTRIAIV+ DKCKPKKCRQECKKSCPVV+ G
Sbjct  62   CTPH--HKGIAFSRRAGYSYFVTIMAD-KLTRIAIVNHDKCKPKKCRQECKKSCPVVRMG  118

Query  206  KLCIEVTPAAKIAFISEELCIGCGICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLH  385
            KLCIEVTP +KIA+ISE LCIGCGIC+KKCPF A+ I+NLP +L+K+TTHRY  N FKLH
Sbjct  119  KLCIEVTPQSKIAWISETLCIGCGICIKKCPFGALSIVNLPSNLEKETTHRYCANAFKLH  178

Query  386  RLPVPRPGQVLGLVGTNGIGKSTALKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNY  565
            RLP+PRPG+VLGLVGTNGIGKSTALK+LAGK KPNLG++ +PPDWQEILTYFRGSELQNY
Sbjct  179  RLPIPRPGEVLGLVGTNGIGKSTALKILAGKQKPNLGKYDDPPDWQEILTYFRGSELQNY  238

Query  566  FTRILEDNLKAIIKPQYVDHIPKAVQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNV  742
            FT+ILED+LKAIIKPQYVD IPKA +G VG +LD+KDE   +  +C  L+L  + + NV
Sbjct  239  FTKILEDDLKAIIKPQYVDQIPKAAKGTVGSILDRKDETKTQAIVCQQLDLTHLKERNV  297



>ref|XP_004708755.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Echinops 
telfairi]
Length=599

 Score =   342 bits (878),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 160/215 (74%), Positives = 187/215 (87%), Gaps = 1/215 (0%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            M+D +LTRIAIV+ DKCKPKKCRQECKKSCPVV+ GKLCIEVTP +KIA+ISE LCIGCG
Sbjct  1    MAD-KLTRIAIVNHDKCKPKKCRQECKKSCPVVRMGKLCIEVTPQSKIAWISETLCIGCG  59

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            IC+KKCPF A+ I+NLP +L+K+TTHRY  N FKLHRLP+PRPG+VLGLVGTNGIGKSTA
Sbjct  60   ICIKKCPFGALSIVNLPSNLEKETTHRYCANAFKLHRLPIPRPGEVLGLVGTNGIGKSTA  119

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            LK+LAGK KPNLG++ +PPDWQEILTYFRGSELQNYFT+ILED+LKAIIKPQYVD IPKA
Sbjct  120  LKILAGKQKPNLGKYDDPPDWQEILTYFRGSELQNYFTKILEDDLKAIIKPQYVDQIPKA  179

Query  638  VQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNV  742
             +G VG +LD+KDE   +  +C  L+L  + D NV
Sbjct  180  AKGTVGSILDRKDETKTQAIVCQQLDLTHLKDRNV  214



>ref|XP_004525604.1| PREDICTED: ATP-binding cassette sub-family E member 1-like [Ceratitis 
capitata]
Length=611

 Score =   343 bits (879),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 159/219 (73%), Positives = 190/219 (87%), Gaps = 1/219 (0%)
 Frame = +2

Query  95   EMSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGC  274
            E +D++ TRIAIVS DKCKPK+CRQECKKSCPVV+ GKLCIEVTP +KIA +SEELCIGC
Sbjct  8    EETDKQ-TRIAIVSDDKCKPKRCRQECKKSCPVVRMGKLCIEVTPTSKIASLSEELCIGC  66

Query  275  GICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKST  454
            GICVKKCPFEAI IIN+P +L+K TTHRYG N+FKLHRLP+PRPG+VLGLVG NGIGKST
Sbjct  67   GICVKKCPFEAITIINVPSNLEKHTTHRYGKNSFKLHRLPIPRPGEVLGLVGQNGIGKST  126

Query  455  ALKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPK  634
            ALK+LAGK KPNLGR+ +PPDW EIL YFRGSELQNYFT+ILEDNLKA++KPQYVD IPK
Sbjct  127  ALKILAGKQKPNLGRYNDPPDWTEILAYFRGSELQNYFTKILEDNLKALVKPQYVDQIPK  186

Query  635  AVQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNVGRF  751
            AV+G V ++LD+KDER  + ++C  L+L  + D ++ + 
Sbjct  187  AVRGAVAELLDKKDERKNQHKICEMLDLLHIRDRDIAQL  225



>gb|KIK68603.1| hypothetical protein GYMLUDRAFT_106711, partial [Gymnopus luxurians 
FD-317 M1]
Length=586

 Score =   342 bits (877),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 159/216 (74%), Positives = 185/216 (86%), Gaps = 2/216 (1%)
 Frame = +2

Query  110  RLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCGICVK  289
            ++TRIAIV S++CKPK+C QECKKSCPVV+ GKLCIEV P  KI+FISE LCIGCGICVK
Sbjct  3    KITRIAIVDSNRCKPKRCAQECKKSCPVVRMGKLCIEVKPTDKISFISEVLCIGCGICVK  62

Query  290  KCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTALKVL  469
            KCPFEAI IINLP +L+ + THRY  N FKLHRLPVPRPGQVLGLVGTNGIGKSTALK+L
Sbjct  63   KCPFEAIAIINLPTNLESEVTHRYTANAFKLHRLPVPRPGQVLGLVGTNGIGKSTALKIL  122

Query  470  AGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKAVQG-  646
            AGKLKPNLGR+ +PPDWQEIL YFRGSELQNYFT++LEDNLKA+IKPQYVDHIP+A++G 
Sbjct  123  AGKLKPNLGRYDDPPDWQEILKYFRGSELQNYFTKVLEDNLKALIKPQYVDHIPRAIKGT  182

Query  647  -NVGQVLDQKDERDMKEELCVDLELNQVLDHNVGRF  751
              V Q+LD K E D KE++C  L+LN +L+  V + 
Sbjct  183  MTVSQMLDSKLELDNKEKICDALDLNHLLEREVSQL  218



>gb|ELK17524.1| ATP-binding cassette sub-family E member 1 [Pteropus alecto]
Length=671

 Score =   344 bits (883),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 161/227 (71%), Positives = 192/227 (85%), Gaps = 1/227 (0%)
 Frame = +2

Query  62   NRNLCYRLVKREMSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKI  241
            +R   Y  + R M+D +LTRI+IV+ DKCKPKKCRQECKKSCPVV+ GKLCIEVTP +KI
Sbjct  61   SRRAGYSFLLRIMAD-KLTRISIVNHDKCKPKKCRQECKKSCPVVRMGKLCIEVTPQSKI  119

Query  242  AFISEELCIGCGICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLG  421
            A+ISE LCIGCGIC+KKCPF A+ I+NLP +L+K+TTHRY  N FKLHRLP+PRPG+VLG
Sbjct  120  AWISETLCIGCGICIKKCPFGALSIVNLPSNLEKETTHRYCANAFKLHRLPIPRPGEVLG  179

Query  422  LVGTNGIGKSTALKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAI  601
            LVGTNGIGKSTALK+LAGK KPNLG++ +PPDWQEILTYFRGSELQNYFT+ILED+LKAI
Sbjct  180  LVGTNGIGKSTALKILAGKQKPNLGKYDDPPDWQEILTYFRGSELQNYFTKILEDDLKAI  239

Query  602  IKPQYVDHIPKAVQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNV  742
            IKPQYVD IPKA +G VG +LD+KDE   +  +C  L+L  + + NV
Sbjct  240  IKPQYVDQIPKAAKGTVGSILDRKDETKTQAIVCQQLDLTHLKERNV  286



>ref|XP_005183309.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Musca 
domestica]
 ref|XP_005183310.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Musca 
domestica]
Length=610

 Score =   342 bits (878),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 159/217 (73%), Positives = 190/217 (88%), Gaps = 1/217 (0%)
 Frame = +2

Query  95   EMSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGC  274
            E +D++ TRIAIVS DKCKPK+CRQECKKSCPVV+ GKLCIEV PA+KIA +SEELCIGC
Sbjct  8    EETDKQ-TRIAIVSDDKCKPKRCRQECKKSCPVVRMGKLCIEVAPASKIASLSEELCIGC  66

Query  275  GICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKST  454
            GICVKKCPFEAI IIN+P +L+K TTHRYG N+FKLHRLP+PRPG+VLGLVG NGIGKST
Sbjct  67   GICVKKCPFEAITIINIPSNLEKHTTHRYGKNSFKLHRLPIPRPGEVLGLVGQNGIGKST  126

Query  455  ALKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPK  634
            ALK+LAGK KPNLGR+ +PPDW EIL YFRGSELQNYFT+ILEDNLKA++KPQYVD IPK
Sbjct  127  ALKILAGKQKPNLGRYIDPPDWTEILAYFRGSELQNYFTKILEDNLKALVKPQYVDQIPK  186

Query  635  AVQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNVG  745
            AV+G V ++L++KDER  + E+C  L+L+ + + N+ 
Sbjct  187  AVRGTVNELLNKKDERKNQTEICEMLDLSHIRERNIA  223



>ref|XP_002121964.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Ciona 
intestinalis]
Length=600

 Score =   342 bits (877),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 159/215 (74%), Positives = 186/215 (87%), Gaps = 1/215 (0%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            MSD   TRIAIV++DKCKPK+CRQEC+KSCPVV+ GKLCIEVTP +K+A+ISEELCIGCG
Sbjct  1    MSDSN-TRIAIVNNDKCKPKRCRQECRKSCPVVRMGKLCIEVTPLSKLAWISEELCIGCG  59

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            ICVKKCPFEAI IINLP +L+KDTTHRY  N+FKLHRLP+PR G+VLGLVGTNGIGKSTA
Sbjct  60   ICVKKCPFEAISIINLPSNLEKDTTHRYSANSFKLHRLPIPRAGEVLGLVGTNGIGKSTA  119

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            LK+LAGK KPNLG +  PPDW EIL+YFRGSELQNYFT+ILED++KA+IKPQYVD IPKA
Sbjct  120  LKILAGKQKPNLGSYDEPPDWTEILSYFRGSELQNYFTKILEDDMKAVIKPQYVDQIPKA  179

Query  638  VQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNV  742
            V+G V  +LD+KD+   +EE C  L+LN VL   +
Sbjct  180  VKGTVQAMLDRKDDSGTQEEFCGLLDLNHVLTRKI  214



>ref|XP_011498090.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Ceratosolen 
solmsi marchali]
Length=608

 Score =   342 bits (878),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 159/211 (75%), Positives = 188/211 (89%), Gaps = 0/211 (0%)
 Frame = +2

Query  110  RLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCGICVK  289
            RLTRIAIV++DKCKPK+CRQECK+SCPVV+ GKLCIEVTP +KIA ISEELCIGCGICVK
Sbjct  12   RLTRIAIVNTDKCKPKRCRQECKRSCPVVRMGKLCIEVTPNSKIASISEELCIGCGICVK  71

Query  290  KCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTALKVL  469
            KCPFEAI IINLP +L+K+TTHRY  N+FKLHRLP+PRPG+VLGLVGTNGIGKSTALK+L
Sbjct  72   KCPFEAISIINLPSNLEKETTHRYSKNSFKLHRLPIPRPGEVLGLVGTNGIGKSTALKIL  131

Query  470  AGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKAVQGN  649
            AGK KPNLGRF +PPDW EIL++FRGSELQNYFT+ILED+LKA+IKPQYVD IPKAV+G 
Sbjct  132  AGKQKPNLGRFSDPPDWTEILSHFRGSELQNYFTKILEDDLKALIKPQYVDQIPKAVKGT  191

Query  650  VGQVLDQKDERDMKEELCVDLELNQVLDHNV  742
            V Q+LD+KDE   + ++C  L+L  + D ++
Sbjct  192  VQQLLDKKDECKNQAKICEMLDLTHIRDRSI  222



>emb|CDX75723.1| BnaC03g38060D [Brassica napus]
Length=603

 Score =   342 bits (877),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 161/212 (76%), Positives = 184/212 (87%), Gaps = 1/212 (0%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            MSD RLTRIAIV+SD+CKPKKCRQECKKSCPVVKTGKLCIEVTPA+K AF+SEELCIGCG
Sbjct  1    MSD-RLTRIAIVNSDRCKPKKCRQECKKSCPVVKTGKLCIEVTPASKTAFLSEELCIGCG  59

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            ICV KCPFEAIQIINLPKDL+KDT HRY  N FKLHRLPVPRPGQVLGLVGTNGIGKSTA
Sbjct  60   ICVNKCPFEAIQIINLPKDLEKDTIHRYNSNGFKLHRLPVPRPGQVLGLVGTNGIGKSTA  119

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            L+VLAGK+KPN GR+ NPPDW EIL +FRGSELQ+YF R++E+ LK  +KPQ+VD I K 
Sbjct  120  LQVLAGKIKPNFGRYNNPPDWHEILAHFRGSELQSYFIRLVEEKLKTAMKPQHVDVIKKV  179

Query  638  VQGNVGQVLDQKDERDMKEELCVDLELNQVLD  733
             +G +G VL++ DER M  E+C  ++LN +LD
Sbjct  180  AKGTLGTVLEKLDERGMMAEICDAMDLNHLLD  211



>gb|ETK89054.1| ABC transporter E family member 2 [Phytophthora parasitica]
 gb|ETL42461.1| ABC transporter E family member 2 [Phytophthora parasitica]
 gb|ETP18933.1| ABC transporter E family member 2 [Phytophthora parasitica CJ01A1]
Length=626

 Score =   343 bits (879),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 165/216 (76%), Positives = 188/216 (87%), Gaps = 2/216 (1%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            MSD +LTRIAIVS+DKCKPKKCRQECKKSCPVV+ GKLCIEV P +K+AFISE+LCIGCG
Sbjct  1    MSD-KLTRIAIVSTDKCKPKKCRQECKKSCPVVRMGKLCIEVGPKSKVAFISEQLCIGCG  59

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            ICVKKCPFEAI IINLPKDL+ +TTHRYG NTFKLHRLP+PRPGQVLGLVGTNGIGKSTA
Sbjct  60   ICVKKCPFEAINIINLPKDLESNTTHRYGANTFKLHRLPMPRPGQVLGLVGTNGIGKSTA  119

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            L++LAGKLKPNLG+F  PP+WQEILT+FRGSELQNYFTRILEDNLKAI KPQYVD IPKA
Sbjct  120  LRILAGKLKPNLGKFDAPPEWQEILTHFRGSELQNYFTRILEDNLKAITKPQYVDKIPKA  179

Query  638  VQGNVGQVLDQKDERDMK-EELCVDLELNQVLDHNV  742
            V+G V  +L  + E+  K +    +L+L+ V D  +
Sbjct  180  VKGTVHGILSARCEKKEKLDHFLNELDLSHVQDREI  215



>ref|XP_008903480.1| ABC transporter E family member 2 [Phytophthora parasitica INRA-310]
 gb|ETI49163.1| ABC transporter E family member 2 [Phytophthora parasitica P1569]
 gb|ETL95633.1| ABC transporter E family member 2 [Phytophthora parasitica]
 gb|ETM48828.1| ABC transporter E family member 2 [Phytophthora parasitica]
 gb|ETN10962.1| ABC transporter E family member 2 [Phytophthora parasitica INRA-310]
 gb|ETO77898.1| ABC transporter E family member 2 [Phytophthora parasitica P1976]
 gb|ETP46880.1| ABC transporter E family member 2 [Phytophthora parasitica P10297]
Length=626

 Score =   343 bits (879),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 165/216 (76%), Positives = 188/216 (87%), Gaps = 2/216 (1%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            MSD +LTRIAIVS+DKCKPKKCRQECKKSCPVV+ GKLCIEV P +K+AFISE+LCIGCG
Sbjct  1    MSD-KLTRIAIVSTDKCKPKKCRQECKKSCPVVRMGKLCIEVGPKSKVAFISEQLCIGCG  59

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            ICVKKCPFEAI IINLPKDL+ +TTHRYG NTFKLHRLP+PRPGQVLGLVGTNGIGKSTA
Sbjct  60   ICVKKCPFEAINIINLPKDLESNTTHRYGANTFKLHRLPMPRPGQVLGLVGTNGIGKSTA  119

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            L++LAGKLKPNLG+F  PP+WQEILT+FRGSELQNYFTRILEDNLKAI KPQYVD IPKA
Sbjct  120  LRILAGKLKPNLGKFDAPPEWQEILTHFRGSELQNYFTRILEDNLKAITKPQYVDKIPKA  179

Query  638  VQGNVGQVLDQKDERDMK-EELCVDLELNQVLDHNV  742
            V+G V  +L  + E+  K +    +L+L+ V D  +
Sbjct  180  VKGTVHGILSARCEKKEKLDHFLNELDLSHVQDREI  215



>gb|ADO33033.1| pixie [Biston betularia]
Length=608

 Score =   342 bits (877),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 159/219 (73%), Positives = 188/219 (86%), Gaps = 0/219 (0%)
 Frame = +2

Query  89   KREMSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCI  268
            K+     +LTRIAIV++D+CKPK+CRQECKKSCPVV+ GKLCIEVTP  KIA ISEELCI
Sbjct  5    KQHEETDKLTRIAIVNADRCKPKRCRQECKKSCPVVRMGKLCIEVTPNDKIATISEELCI  64

Query  269  GCGICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGK  448
            GCGICVKKCPFEAI IIN+P +L+K TTHRY  N+FKLHRLP+PRPG+VLGLVG NGIGK
Sbjct  65   GCGICVKKCPFEAITIINIPSNLEKHTTHRYSKNSFKLHRLPIPRPGEVLGLVGQNGIGK  124

Query  449  STALKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHI  628
            STALK+LAGK KPNLGRF +PPDWQEIL++FRGSELQNYFT+ILED+LKA+IKPQYVD I
Sbjct  125  STALKILAGKQKPNLGRFSDPPDWQEILSHFRGSELQNYFTKILEDDLKALIKPQYVDQI  184

Query  629  PKAVQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNVG  745
            PKAV+G V Q+LD+KDE   + E+C  L+L+ + D  + 
Sbjct  185  PKAVKGTVAQLLDKKDEMKNQTEICKMLDLSHIRDREIS  223



>ref|XP_009205905.1| PREDICTED: ATP-binding cassette sub-family E member 1 isoform 
X2 [Papio anubis]
Length=558

 Score =   340 bits (873),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 159/215 (74%), Positives = 187/215 (87%), Gaps = 1/215 (0%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            M+D +LTRIAIV+ DKCKPKKCRQECKKSCPVV+ GKLCIEVTP +KIA+ISE LCIGCG
Sbjct  1    MAD-KLTRIAIVNHDKCKPKKCRQECKKSCPVVRMGKLCIEVTPQSKIAWISETLCIGCG  59

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            IC+KKCPF A+ I+NLP +L+K+TTHRY  N FKLHRLP+PRPG+VLGLVGTNGIGKSTA
Sbjct  60   ICIKKCPFGALSIVNLPSNLEKETTHRYCANAFKLHRLPIPRPGEVLGLVGTNGIGKSTA  119

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            LK+LAGK KPNLG++ +PPDWQEILTYFRGSELQNYFT+ILED+LKAIIKPQYVD IPKA
Sbjct  120  LKILAGKQKPNLGKYDDPPDWQEILTYFRGSELQNYFTKILEDDLKAIIKPQYVDQIPKA  179

Query  638  VQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNV  742
             +G VG +LD+KDE   +  +C  L+L  + + NV
Sbjct  180  AKGTVGSILDRKDETKTQAVVCQQLDLTHLKERNV  214



>gb|EMS24018.1| ATP-binding cassette, sub-family E, member 1 [Rhodosporidium 
toruloides NP11]
 emb|CDR41311.1| RHTO0S06e00584g1_1 [Rhodosporidium toruloides]
Length=603

 Score =   342 bits (877),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 161/220 (73%), Positives = 189/220 (86%), Gaps = 3/220 (1%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            MSD +LTRIA+V+ D+CKPKKCRQECKKSCPVV+ GKLCIEV P++KIAFISEELCIGCG
Sbjct  1    MSD-KLTRIALVNPDRCKPKKCRQECKKSCPVVRMGKLCIEVDPSSKIAFISEELCIGCG  59

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            IC KKCPFEAI IINLP +L+   THRY  N+FKLHRLP PRPGQVLGLVGTNGIGKSTA
Sbjct  60   ICPKKCPFEAINIINLPTNLESQVTHRYSANSFKLHRLPTPRPGQVLGLVGTNGIGKSTA  119

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            LK+L+GK+KPNLGRF NPPDWQEIL YFRGSELQNYFT++LEDNLK +IKPQYVDHIP+A
Sbjct  120  LKILSGKVKPNLGRFDNPPDWQEILRYFRGSELQNYFTKVLEDNLKPLIKPQYVDHIPRA  179

Query  638  VQGN--VGQVLDQKDERDMKEELCVDLELNQVLDHNVGRF  751
            ++G+  V Q+LD K E D  +++  DL+L+ VLD  + + 
Sbjct  180  IKGSQTVKQMLDSKLELDNLDDVIRDLDLDVVLDREISQL  219



>ref|XP_003690922.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Apis florea]
 ref|XP_006569310.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Apis mellifera]
 ref|XP_006614219.1| PREDICTED: ATP-binding cassette sub-family E member 1-like [Apis 
dorsata]
Length=608

 Score =   342 bits (877),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 162/219 (74%), Positives = 190/219 (87%), Gaps = 1/219 (0%)
 Frame = +2

Query  89   KREMSD-QRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELC  265
            K+ M +  RLTRIAIV+SDKCKPK+CRQECK+SCPVV+ GKLCIEV P +KIA ISEELC
Sbjct  4    KKSMEETDRLTRIAIVNSDKCKPKRCRQECKRSCPVVRMGKLCIEVNPNSKIASISEELC  63

Query  266  IGCGICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIG  445
            IGCGICVKKCPFEAI IINLP +L+K+TTHRY  N+FKLHRLP+PRPG+VLGLVGTNGIG
Sbjct  64   IGCGICVKKCPFEAISIINLPSNLEKETTHRYSKNSFKLHRLPIPRPGEVLGLVGTNGIG  123

Query  446  KSTALKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDH  625
            KSTALK+LAGK KPNLGRF +PPDW EIL++FRGSELQNYFT+ILED+LKA+IKPQYVD 
Sbjct  124  KSTALKILAGKQKPNLGRFSDPPDWTEILSHFRGSELQNYFTKILEDDLKALIKPQYVDQ  183

Query  626  IPKAVQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNV  742
            IPKAV+G V Q+LD+KDE   + E+C  L+L  + D  +
Sbjct  184  IPKAVKGTVQQLLDKKDECKNQLEICEMLDLMHIRDRGI  222



>ref|XP_003701716.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Megachile 
rotundata]
Length=583

 Score =   341 bits (875),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 162/219 (74%), Positives = 190/219 (87%), Gaps = 1/219 (0%)
 Frame = +2

Query  89   KREMSD-QRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELC  265
            K+ M +  RLTRIAIV+SDKCKPK+CRQECK+SCPVV+ GKLCIEV P +KIA ISEELC
Sbjct  4    KKSMEETDRLTRIAIVNSDKCKPKRCRQECKRSCPVVRMGKLCIEVNPNSKIASISEELC  63

Query  266  IGCGICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIG  445
            IGCGICVKKCPFEAI IINLP +L+K+TTHRY  N+FKLHRLP+PRPG+VLGLVGTNGIG
Sbjct  64   IGCGICVKKCPFEAISIINLPSNLEKETTHRYSKNSFKLHRLPIPRPGEVLGLVGTNGIG  123

Query  446  KSTALKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDH  625
            KSTALK+LAGK KPNLGRF +PPDW EIL++FRGSELQNYFT+ILED+LKA+IKPQYVD 
Sbjct  124  KSTALKILAGKQKPNLGRFTDPPDWTEILSHFRGSELQNYFTKILEDDLKALIKPQYVDQ  183

Query  626  IPKAVQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNV  742
            IPKAV+G V Q+LD+KDE   + E+C  L+L  + D  +
Sbjct  184  IPKAVKGTVQQLLDKKDECKNQLEICKMLDLMHIRDRGI  222



>ref|XP_004336916.1| ribonuclease L inhibitor family protein [Acanthamoeba castellanii 
str. Neff]
 gb|ELR14903.1| ribonuclease L inhibitor family protein [Acanthamoeba castellanii 
str. Neff]
Length=613

 Score =   342 bits (877),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 165/211 (78%), Positives = 186/211 (88%), Gaps = 7/211 (3%)
 Frame = +2

Query  110  RLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCGICVK  289
            +LTRIAIVSSDKCKPKKCRQECK+SCPVVK GKLCIEVT   K+A ISEELCIGCGICVK
Sbjct  12   KLTRIAIVSSDKCKPKKCRQECKRSCPVVKMGKLCIEVTEKDKLATISEELCIGCGICVK  71

Query  290  KCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTALKVL  469
            KCPF+AIQIINLPK+L+  TTHRYG N+FKLHR        VLGLVGTNGIGKSTALK+L
Sbjct  72   KCPFKAIQIINLPKNLESATTHRYGSNSFKLHR-------HVLGLVGTNGIGKSTALKIL  124

Query  470  AGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKAVQGN  649
            AGKLKPNLGR+ +PPDWQEILTYFRGSELQNYFT+ILEDNLKAIIKPQYVD IPKAV+GN
Sbjct  125  AGKLKPNLGRWNSPPDWQEILTYFRGSELQNYFTKILEDNLKAIIKPQYVDQIPKAVKGN  184

Query  650  VGQVLDQKDERDMKEELCVDLELNQVLDHNV  742
            V ++++QKDER +K+E+   L+LN VLD +V
Sbjct  185  VSKIMEQKDERSIKDEIYDQLDLNTVLDRSV  215



>ref|XP_003885554.1| RNase L inhibitor, related [Neospora caninum Liverpool]
 emb|CBZ55526.1| RNase L inhibitor, related [Neospora caninum Liverpool]
Length=613

 Score =   342 bits (877),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 158/217 (73%), Positives = 183/217 (84%), Gaps = 0/217 (0%)
 Frame = +2

Query  95   EMSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGC  274
            E  D    RIAIV+ D+CKPKKCRQECK++CPVV+TGKLCIE    +KIAFISE LCIGC
Sbjct  10   EAVDDARLRIAIVNGDRCKPKKCRQECKRNCPVVRTGKLCIEADATSKIAFISEPLCIGC  69

Query  275  GICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKST  454
            GICVKKCPFEAI IINLP+DL KD THR+GPN+FKLHRLPVPRPGQVLGLVGTNGIGKST
Sbjct  70   GICVKKCPFEAIAIINLPRDLGKDVTHRFGPNSFKLHRLPVPRPGQVLGLVGTNGIGKST  129

Query  455  ALKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPK  634
            ALK+L+ KLKPNLG++ NPPDWQEIL YFRGSELQN+FTR+LE++LKA IKPQYVDH+PK
Sbjct  130  ALKILSAKLKPNLGKYNNPPDWQEILAYFRGSELQNFFTRMLEEDLKASIKPQYVDHVPK  189

Query  635  AVQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNVG  745
             V+G VG V+  KDE     EL  D+EL+ ++D  +G
Sbjct  190  QVKGTVGAVVKLKDETGRGAELMKDMELDHLVDREIG  226



>ref|XP_010159708.1| PREDICTED: ATP-binding cassette sub-family E member 1 isoform 
X2 [Eurypyga helias]
Length=472

 Score =   337 bits (865),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 158/215 (73%), Positives = 186/215 (87%), Gaps = 1/215 (0%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            M+D +LTRIAIV+ DKCKPKKCRQECKKSCPVV+ GKLCIEVT  +KIA+ISE LCIGCG
Sbjct  1    MAD-KLTRIAIVNHDKCKPKKCRQECKKSCPVVRMGKLCIEVTSQSKIAWISETLCIGCG  59

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            IC+KKCPF A+ I+NLP +L+K+TTHRY  N FKLHRLP+PRPG+VLGLVGTNGIGKSTA
Sbjct  60   ICIKKCPFGALSIVNLPSNLEKETTHRYCANAFKLHRLPIPRPGEVLGLVGTNGIGKSTA  119

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            LK+LAGK KPNLG++ +PPDWQEILTYFRGSELQNYFT+ILED+LKAIIKPQYVD IPKA
Sbjct  120  LKILAGKQKPNLGKYDDPPDWQEILTYFRGSELQNYFTKILEDDLKAIIKPQYVDQIPKA  179

Query  638  VQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNV  742
             +G VG +LD+KDE   +  +C  L+L  + + NV
Sbjct  180  AKGTVGSILDRKDETKTQTVVCQQLDLTHLKERNV  214



>ref|XP_006887102.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Elephantulus 
edwardii]
Length=582

 Score =   341 bits (874),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 159/215 (74%), Positives = 187/215 (87%), Gaps = 1/215 (0%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            M+D +LTRIAIV+ DKCKPKKCRQECKKSCPVV+ GKLCIEVTP +KIA+ISE LCIGCG
Sbjct  1    MAD-KLTRIAIVNHDKCKPKKCRQECKKSCPVVRMGKLCIEVTPQSKIAWISETLCIGCG  59

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            IC+KKCPF A+ I+NLP +L+K+TTHRY  N FKLHRLP+PRPG+VLGLVGTNGIGKSTA
Sbjct  60   ICIKKCPFGALSIVNLPSNLEKETTHRYCANAFKLHRLPIPRPGEVLGLVGTNGIGKSTA  119

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            LK+LAGK KPNLG++ +PPDWQEILTYFRGSELQNYFT+ILED+LKAIIKPQYVD IPKA
Sbjct  120  LKILAGKQKPNLGKYDDPPDWQEILTYFRGSELQNYFTKILEDDLKAIIKPQYVDQIPKA  179

Query  638  VQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNV  742
             +G VG +LD+KDE   +  +C  L+L  + + NV
Sbjct  180  AKGTVGSILDRKDETKTQAIVCQQLDLTHLKERNV  214



>gb|EFB29665.1| hypothetical protein PANDA_004343 [Ailuropoda melanoleuca]
Length=590

 Score =   341 bits (875),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 159/215 (74%), Positives = 187/215 (87%), Gaps = 1/215 (0%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            M+D +LTRIAIV+ DKCKPKKCRQECKKSCPVV+ GKLCIEVTP +KIA+ISE LCIGCG
Sbjct  1    MAD-KLTRIAIVNHDKCKPKKCRQECKKSCPVVRMGKLCIEVTPQSKIAWISETLCIGCG  59

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            IC+KKCPF A+ I+NLP +L+K+TTHRY  N FKLHRLP+PRPG+VLGLVGTNGIGKSTA
Sbjct  60   ICIKKCPFGALSIVNLPSNLEKETTHRYCANAFKLHRLPIPRPGEVLGLVGTNGIGKSTA  119

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            LK+LAGK KPNLG++ +PPDWQEILTYFRGSELQNYFT+ILED+LKAIIKPQYVD IPKA
Sbjct  120  LKILAGKQKPNLGKYDDPPDWQEILTYFRGSELQNYFTKILEDDLKAIIKPQYVDQIPKA  179

Query  638  VQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNV  742
             +G VG +LD+KDE   +  +C  L+L  + + NV
Sbjct  180  AKGTVGSILDRKDETKTQAIVCQQLDLTHLKERNV  214



>emb|CAJ15800.1| RNase L inhibitor [Gallus gallus]
Length=472

 Score =   337 bits (865),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 158/215 (73%), Positives = 186/215 (87%), Gaps = 1/215 (0%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            M+D +LTRIAIV+ DKCKPKKCRQECKKSCPVV+ GKLCIEVT  +KIA+ISE LCIGCG
Sbjct  1    MAD-KLTRIAIVNHDKCKPKKCRQECKKSCPVVRMGKLCIEVTSQSKIAWISETLCIGCG  59

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            IC+KKCPF A+ I+NLP +L+K+TTHRY  N FKLHRLP+PRPG+VLGLVGTNGIGKSTA
Sbjct  60   ICIKKCPFGALSIVNLPSNLEKETTHRYCANAFKLHRLPIPRPGEVLGLVGTNGIGKSTA  119

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            LK+LAGK KPNLG++ +PPDWQEILTYFRGSELQNYFT+ILED+LKAIIKPQYVD IPKA
Sbjct  120  LKILAGKQKPNLGKYDDPPDWQEILTYFRGSELQNYFTKILEDDLKAIIKPQYVDQIPKA  179

Query  638  VQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNV  742
             +G VG +LD+KDE   +  +C  L+L  + + NV
Sbjct  180  AKGTVGSILDRKDETKTQTVVCQQLDLTHLKERNV  214



>ref|XP_002997210.1| ATP-binding cassette sub-family E member 1 [Phytophthora infestans 
T30-4]
 gb|EEY69572.1| ATP-binding cassette sub-family E member 1 [Phytophthora infestans 
T30-4]
Length=626

 Score =   342 bits (877),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 161/212 (76%), Positives = 186/212 (88%), Gaps = 1/212 (0%)
 Frame = +2

Query  110  RLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCGICVK  289
            +LTRIAIVS+DKCKPKKCRQECKKSCPVV+ GKLCIEV P +K+AFISE+LCIGCGICVK
Sbjct  4    KLTRIAIVSTDKCKPKKCRQECKKSCPVVRMGKLCIEVGPKSKVAFISEQLCIGCGICVK  63

Query  290  KCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTALKVL  469
            KCPFEAI IINLPKDL+ +TTHRYG NTFKLHRLP+PRPGQVLGLVGTNGIGKSTAL++L
Sbjct  64   KCPFEAINIINLPKDLESNTTHRYGANTFKLHRLPMPRPGQVLGLVGTNGIGKSTALRIL  123

Query  470  AGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKAVQGN  649
            AGKLKPNLG+F  PP+WQEILT+FRGSELQNYFTRILEDNLKAI KPQYVD IPKAV+G 
Sbjct  124  AGKLKPNLGKFDAPPEWQEILTHFRGSELQNYFTRILEDNLKAITKPQYVDKIPKAVKGT  183

Query  650  VGQVLDQK-DERDMKEELCVDLELNQVLDHNV  742
            V  +L  + +++D  +    +L+L+ V D  +
Sbjct  184  VHGILSARCEKQDKLDHFLNELDLSHVQDREI  215



>ref|XP_002370987.1| ABC transporter, putative [Toxoplasma gondii ME49]
 gb|EPR58742.1| putative ATP-binding cassette sub-family E member 1 [Toxoplasma 
gondii GT1]
 gb|EPT25587.1| ATP-binding cassette sub-family E member 1, putative [Toxoplasma 
gondii ME49]
 gb|ESS28779.1| putative ATP-binding cassette sub-family E member 1 [Toxoplasma 
gondii VEG]
 gb|KFG31534.1| putative ATP-binding cassette sub-family E member 1 [Toxoplasma 
gondii p89]
 gb|KFG41200.1| putative ATP-binding cassette sub-family E member 1 [Toxoplasma 
gondii FOU]
 gb|KFG58457.1| putative ATP-binding cassette sub-family E member 1 [Toxoplasma 
gondii RUB]
 gb|KFH01232.1| putative ATP-binding cassette sub-family E member 1 [Toxoplasma 
gondii VAND]
 gb|KFH10942.1| putative ATP-binding cassette sub-family E member 1 [Toxoplasma 
gondii MAS]
Length=613

 Score =   342 bits (876),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 157/217 (72%), Positives = 184/217 (85%), Gaps = 0/217 (0%)
 Frame = +2

Query  95   EMSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGC  274
            E  D    RIAIV++D+CKPKKCRQECK++CPVV+TGKLCIE    +KIAFISE LCIGC
Sbjct  10   EAVDDARLRIAIVNADRCKPKKCRQECKRNCPVVRTGKLCIEADATSKIAFISEPLCIGC  69

Query  275  GICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKST  454
            GICVKKCPFEAI IINLP+DL KD THR+G N+FKLHRLPVPRPGQVLGLVGTNGIGKST
Sbjct  70   GICVKKCPFEAIAIINLPRDLGKDVTHRFGANSFKLHRLPVPRPGQVLGLVGTNGIGKST  129

Query  455  ALKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPK  634
            ALK+L+ KLKPNLG++ NPPDWQEIL +FRGSELQN+FTR+LE++LKA IKPQYVDH+PK
Sbjct  130  ALKILSAKLKPNLGKYSNPPDWQEILAFFRGSELQNFFTRMLEEDLKASIKPQYVDHVPK  189

Query  635  AVQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNVG  745
             V+G VGQV+  KDE     EL  D+EL+ ++D  +G
Sbjct  190  QVKGTVGQVIQLKDETGRGAELMKDMELDHLVDREIG  226



>ref|XP_008183576.1| PREDICTED: LOW QUALITY PROTEIN: ATP-binding cassette sub-family 
E member 1 [Acyrthosiphon pisum]
Length=608

 Score =   342 bits (876),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 162/216 (75%), Positives = 191/216 (88%), Gaps = 1/216 (0%)
 Frame = +2

Query  95   EMSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGC  274
            E +D+++ RIAIV++DKCKPK+CRQECKKSCPVV+ GKLCIEVTP  KIA ISEELCIGC
Sbjct  8    EETDKQI-RIAIVNNDKCKPKRCRQECKKSCPVVRMGKLCIEVTPNDKIASISEELCIGC  66

Query  275  GICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKST  454
            GICVKKCPFEAI IINLP +L+KDTTHRY  N+FKLHRLP PR G+VLGLVGTNGIGKST
Sbjct  67   GICVKKCPFEAITIINLPSNLEKDTTHRYSKNSFKLHRLPTPRQGEVLGLVGTNGIGKST  126

Query  455  ALKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPK  634
            ALK+LAGK KPNLGRF +PPDW EIL +FRGSELQNYFT+ILED+LKA+IKPQYVD IPK
Sbjct  127  ALKILAGKQKPNLGRFSDPPDWSEILNHFRGSELQNYFTKILEDDLKAMIKPQYVDQIPK  186

Query  635  AVQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNV  742
            AV+G V Q+LD+K+ER+  EE+C  LEL+++ D ++
Sbjct  187  AVKGTVQQLLDKKNERNNIEEICDFLELDKIRDRSI  222



>dbj|BAE89880.1| unnamed protein product [Macaca fascicularis]
Length=599

 Score =   341 bits (875),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 159/215 (74%), Positives = 187/215 (87%), Gaps = 1/215 (0%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            M+D +LTRIAIV+ DKCKPKKCRQECKKSCPVV+ GKLCIEVTP +KIA+ISE LCIGCG
Sbjct  1    MAD-KLTRIAIVNHDKCKPKKCRQECKKSCPVVRMGKLCIEVTPQSKIAWISETLCIGCG  59

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            IC+KKCPF A+ I+NLP +L+K+TTHRY  N FKLHRLP+PRPG+VLGLVGTNGIGKSTA
Sbjct  60   ICIKKCPFGALSIVNLPSNLEKETTHRYCANAFKLHRLPIPRPGEVLGLVGTNGIGKSTA  119

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            LK+LAGK KPNLG++ +PPDWQEILTYFRGSELQNYFT+ILED+LKAIIKPQYVD IPKA
Sbjct  120  LKILAGKQKPNLGKYDDPPDWQEILTYFRGSELQNYFTKILEDDLKAIIKPQYVDQIPKA  179

Query  638  VQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNV  742
             +G VG +LD+KDE   +  +C  L+L  + + NV
Sbjct  180  AKGTVGSILDRKDETKTQAVVCQQLDLTHLKERNV  214



>dbj|BAM18097.1| pixie [Papilio xuthus]
Length=608

 Score =   342 bits (876),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 157/219 (72%), Positives = 190/219 (87%), Gaps = 0/219 (0%)
 Frame = +2

Query  89   KREMSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCI  268
            K+     +LTRIAIV++D+CKPK+CRQECKKSCPVV+ GKLCIEVTP  KIA ISEELCI
Sbjct  5    KQHEETDKLTRIAIVNADRCKPKRCRQECKKSCPVVRMGKLCIEVTPNDKIATISEELCI  64

Query  269  GCGICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGK  448
            GCGICVKKCPF+AI IIN+P +L+K TTHRY  N+FKLHRLP+PRPG+VLGLVG NGIGK
Sbjct  65   GCGICVKKCPFDAITIINVPSNLEKHTTHRYSKNSFKLHRLPIPRPGEVLGLVGQNGIGK  124

Query  449  STALKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHI  628
            STALK+LAGK KPNLGR+ +PPDWQEIL++FRGSELQNYFT+ILED+LKA+IKPQYVD I
Sbjct  125  STALKILAGKQKPNLGRYADPPDWQEILSHFRGSELQNYFTKILEDDLKALIKPQYVDQI  184

Query  629  PKAVQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNVG  745
            PKAV+G VGQ+L++KD+R+ + E+C  L+L  + D  + 
Sbjct  185  PKAVKGTVGQLLNKKDDRNNQAEICRMLDLTHIRDREIA  223



>ref|XP_008886417.1| ATP-binding cassette sub-family E member 1, putative [Hammondia 
hammondi]
 gb|KEP63029.1| ATP-binding cassette sub-family E member 1, putative [Hammondia 
hammondi]
Length=613

 Score =   342 bits (876),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 157/217 (72%), Positives = 184/217 (85%), Gaps = 0/217 (0%)
 Frame = +2

Query  95   EMSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGC  274
            E  D    RIAIV++D+CKPKKCRQECK++CPVV+TGKLCIE    +KIAFISE LCIGC
Sbjct  10   EAVDDARLRIAIVNADRCKPKKCRQECKRNCPVVRTGKLCIEADATSKIAFISEPLCIGC  69

Query  275  GICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKST  454
            GICVKKCPFEAI IINLP+DL KD THR+G N+FKLHRLPVPRPGQVLGLVGTNGIGKST
Sbjct  70   GICVKKCPFEAIAIINLPRDLGKDVTHRFGANSFKLHRLPVPRPGQVLGLVGTNGIGKST  129

Query  455  ALKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPK  634
            ALK+L+ KLKPNLG++ NPPDWQEIL +FRGSELQN+FTR+LE++LKA IKPQYVDH+PK
Sbjct  130  ALKILSAKLKPNLGKYSNPPDWQEILAFFRGSELQNFFTRMLEEDLKASIKPQYVDHVPK  189

Query  635  AVQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNVG  745
             V+G VGQV+  KDE     EL  D+EL+ ++D  +G
Sbjct  190  QVKGTVGQVVQLKDETGRGAELMKDMELDHLVDREIG  226



>ref|XP_010419025.1| PREDICTED: putative F-box protein At3g13624 [Camelina sativa]
Length=679

 Score =   343 bits (881),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 163/212 (77%), Positives = 191/212 (90%), Gaps = 4/212 (2%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            M+D RLTRIAIV+ D+CKPKKCRQECKKSCPVVKTG+LCIEV+P++K +F+SEELCIGCG
Sbjct  1    MAD-RLTRIAIVNEDRCKPKKCRQECKKSCPVVKTGRLCIEVSPSSKTSFLSEELCIGCG  59

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            ICVKKC   AIQIINLP DL+KDTTHRY  N FKLHRLPVPRPGQVLGLVGTNGIGKSTA
Sbjct  60   ICVKKC---AIQIINLPTDLEKDTTHRYRSNAFKLHRLPVPRPGQVLGLVGTNGIGKSTA  116

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            LK+LAGKLKPNLGR+ NPPDWQEILT+FRGSELQ+YFTR+LE+NLK +IKPQ+VD I K 
Sbjct  117  LKILAGKLKPNLGRYNNPPDWQEILTHFRGSELQSYFTRVLEENLKTVIKPQHVDQIKKL  176

Query  638  VQGNVGQVLDQKDERDMKEELCVDLELNQVLD  733
            VQG++G++L++ DER M  ++C DLEL+ +LD
Sbjct  177  VQGDLGKMLEKLDERGMMVQICADLELDPILD  208



>ref|XP_003205467.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Meleagris 
gallopavo]
Length=599

 Score =   341 bits (874),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 159/215 (74%), Positives = 187/215 (87%), Gaps = 1/215 (0%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            M+D +LTRIAIV+ DKCKPKKCRQECKKSCPVV+ GKLCIEVTP +KIA+ISE LCIGCG
Sbjct  1    MAD-KLTRIAIVNHDKCKPKKCRQECKKSCPVVRMGKLCIEVTPQSKIAWISETLCIGCG  59

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            IC+KKCPF A+ I+NLP +L+K+TTHRY  N FKLHRLP+PRPG+VLGLVGTNGIGKSTA
Sbjct  60   ICIKKCPFGALSIVNLPSNLEKETTHRYCANAFKLHRLPIPRPGEVLGLVGTNGIGKSTA  119

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            LK+LAGK KPNLG++ +PPDWQEILTYFRGSELQNYFT+ILED+LKAIIKPQYVD IPKA
Sbjct  120  LKILAGKQKPNLGKYDDPPDWQEILTYFRGSELQNYFTKILEDDLKAIIKPQYVDQIPKA  179

Query  638  VQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNV  742
             +G VG +LD+KDE   +  +C  L+L  + + NV
Sbjct  180  AKGTVGSILDRKDETKTQTVVCQQLDLTHLKERNV  214



>ref|XP_007666625.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Ornithorhynchus 
anatinus]
Length=599

 Score =   341 bits (874),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 159/215 (74%), Positives = 187/215 (87%), Gaps = 1/215 (0%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            M+D +LTRIAIV+ DKCKPKKCRQECKKSCPVV+ GKLCIEVTP +KIA+ISE LCIGCG
Sbjct  1    MAD-KLTRIAIVNHDKCKPKKCRQECKKSCPVVRMGKLCIEVTPQSKIAWISETLCIGCG  59

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            IC+KKCPF A+ I+NLP +L+K+TTHRY  N FKLHRLP+PRPG+VLGLVGTNGIGKSTA
Sbjct  60   ICIKKCPFGALSIVNLPSNLEKETTHRYCANAFKLHRLPIPRPGEVLGLVGTNGIGKSTA  119

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            LK+LAGK KPNLG++ +PPDWQEILTYFRGSELQNYFT+ILED+LKAIIKPQYVD IPKA
Sbjct  120  LKILAGKQKPNLGKYDDPPDWQEILTYFRGSELQNYFTKILEDDLKAIIKPQYVDQIPKA  179

Query  638  VQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNV  742
             +G VG +LD+KDE   +  +C  L+L  + + NV
Sbjct  180  AKGTVGSILDRKDETKTQAIVCQQLDLTHLRERNV  214



>ref|XP_003129218.3| PREDICTED: ATP-binding cassette sub-family E member 1 isoform 
X1 [Sus scrofa]
Length=599

 Score =   341 bits (874),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 159/215 (74%), Positives = 187/215 (87%), Gaps = 1/215 (0%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            M+D +LTRIAIV+ DKCKPKKCRQECKKSCPVV+ GKLCIEVTP +KIA+ISE LCIGCG
Sbjct  1    MAD-KLTRIAIVNHDKCKPKKCRQECKKSCPVVRMGKLCIEVTPQSKIAWISETLCIGCG  59

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            IC+KKCPF A+ I+NLP +L+K+TTHRY  N FKLHRLP+PRPG+VLGLVGTNGIGKSTA
Sbjct  60   ICIKKCPFGALSIVNLPSNLEKETTHRYCANAFKLHRLPIPRPGEVLGLVGTNGIGKSTA  119

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            LK+LAGK KPNLG++ +PPDWQEILTYFRGSELQNYFT+ILED+LKAIIKPQYVD IPKA
Sbjct  120  LKILAGKQKPNLGKYDDPPDWQEILTYFRGSELQNYFTKILEDDLKAIIKPQYVDQIPKA  179

Query  638  VQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNV  742
             +G VG +LD+KDE   +  +C  L+L  + + NV
Sbjct  180  AKGTVGSILDRKDETKTQAIVCQQLDLTHLKERNV  214



>ref|XP_004420936.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Ceratotherium 
simum simum]
Length=599

 Score =   341 bits (874),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 159/215 (74%), Positives = 187/215 (87%), Gaps = 1/215 (0%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            M+D +LTRIAIV+ DKCKPKKCRQECKKSCPVV+ GKLCIEVTP +KIA+ISE LCIGCG
Sbjct  1    MAD-KLTRIAIVNHDKCKPKKCRQECKKSCPVVRMGKLCIEVTPQSKIAWISETLCIGCG  59

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            IC+KKCPF A+ I+NLP +L+K+TTHRY  N FKLHRLP+PRPG+VLGLVGTNGIGKSTA
Sbjct  60   ICIKKCPFGALSIVNLPSNLEKETTHRYCANAFKLHRLPIPRPGEVLGLVGTNGIGKSTA  119

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            LK+LAGK KPNLG++ +PPDWQEILTYFRGSELQNYFT+ILED+LKAIIKPQYVD IPKA
Sbjct  120  LKILAGKQKPNLGKYDDPPDWQEILTYFRGSELQNYFTKILEDDLKAIIKPQYVDQIPKA  179

Query  638  VQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNV  742
             +G VG +LD+KDE   +  +C  L+L  + + NV
Sbjct  180  AKGTVGSILDRKDETKTQAIVCQQLDLTHLKERNV  214



>ref|NP_001101916.1| ATP-binding cassette sub-family E member 1 [Rattus norvegicus]
 ref|NP_001126534.1| ATP-binding cassette sub-family E member 1 [Pongo abelii]
 ref|XP_003257812.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Nomascus 
leucogenys]
 ref|XP_005556066.1| PREDICTED: ATP-binding cassette sub-family E member 1 isoform 
X1 [Macaca fascicularis]
 ref|XP_005556067.1| PREDICTED: ATP-binding cassette sub-family E member 1 isoform 
X2 [Macaca fascicularis]
 ref|XP_006255469.1| PREDICTED: ATP-binding cassette sub-family E member 1 isoform 
X1 [Rattus norvegicus]
 ref|XP_007998089.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Chlorocebus 
sabaeus]
 ref|XP_007998090.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Chlorocebus 
sabaeus]
 ref|XP_009205904.1| PREDICTED: ATP-binding cassette sub-family E member 1 isoform 
X1 [Papio anubis]
 ref|XP_009238619.1| PREDICTED: ATP-binding cassette sub-family E member 1 isoform 
X1 [Pongo abelii]
 ref|XP_010359515.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Rhinopithecus 
roxellana]
 ref|XP_010359524.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Rhinopithecus 
roxellana]
 emb|CAH92618.1| hypothetical protein [Pongo abelii]
 gb|EDL92306.1| ATP-binding cassette, sub-family E (OABP), member 1 [Rattus norvegicus]
Length=599

 Score =   341 bits (874),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 159/215 (74%), Positives = 187/215 (87%), Gaps = 1/215 (0%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            M+D +LTRIAIV+ DKCKPKKCRQECKKSCPVV+ GKLCIEVTP +KIA+ISE LCIGCG
Sbjct  1    MAD-KLTRIAIVNHDKCKPKKCRQECKKSCPVVRMGKLCIEVTPQSKIAWISETLCIGCG  59

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            IC+KKCPF A+ I+NLP +L+K+TTHRY  N FKLHRLP+PRPG+VLGLVGTNGIGKSTA
Sbjct  60   ICIKKCPFGALSIVNLPSNLEKETTHRYCANAFKLHRLPIPRPGEVLGLVGTNGIGKSTA  119

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            LK+LAGK KPNLG++ +PPDWQEILTYFRGSELQNYFT+ILED+LKAIIKPQYVD IPKA
Sbjct  120  LKILAGKQKPNLGKYDDPPDWQEILTYFRGSELQNYFTKILEDDLKAIIKPQYVDQIPKA  179

Query  638  VQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNV  742
             +G VG +LD+KDE   +  +C  L+L  + + NV
Sbjct  180  AKGTVGSILDRKDETKTQAVVCQQLDLTHLKERNV  214



>ref|XP_003500814.1| PREDICTED: ATP-binding cassette sub-family E member 1 isoform 
X1 [Cricetulus griseus]
 ref|XP_005077785.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Mesocricetus 
auratus]
 ref|XP_007621924.1| PREDICTED: ATP-binding cassette sub-family E member 1 isoform 
X2 [Cricetulus griseus]
 gb|EGW00215.1| ATP-binding cassette sub-family E member 1 [Cricetulus griseus]
Length=599

 Score =   341 bits (874),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 159/215 (74%), Positives = 187/215 (87%), Gaps = 1/215 (0%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            M+D +LTRIAIV+ DKCKPKKCRQECKKSCPVV+ GKLCIEVTP +KIA+ISE LCIGCG
Sbjct  1    MAD-KLTRIAIVNHDKCKPKKCRQECKKSCPVVRMGKLCIEVTPQSKIAWISETLCIGCG  59

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            IC+KKCPF A+ I+NLP +L+K+TTHRY  N FKLHRLP+PRPG+VLGLVGTNGIGKSTA
Sbjct  60   ICIKKCPFGALSIVNLPSNLEKETTHRYCANAFKLHRLPIPRPGEVLGLVGTNGIGKSTA  119

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            LK+LAGK KPNLG++ +PPDWQEILTYFRGSELQNYFT+ILED+LKAIIKPQYVD IPKA
Sbjct  120  LKILAGKQKPNLGKYDDPPDWQEILTYFRGSELQNYFTKILEDDLKAIIKPQYVDQIPKA  179

Query  638  VQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNV  742
             +G VG +LD+KDE   +  +C  L+L  + + NV
Sbjct  180  AKGTVGSILDRKDETKTQAIVCQQLDLTHLKERNV  214



>ref|XP_003773213.1| PREDICTED: ATP-binding cassette sub-family E member 1 isoform 
1 [Sarcophilus harrisii]
 ref|XP_007496336.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Monodelphis 
domestica]
Length=599

 Score =   341 bits (874),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 159/215 (74%), Positives = 187/215 (87%), Gaps = 1/215 (0%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            M+D +LTRIAIV+ DKCKPKKCRQECKKSCPVV+ GKLCIEVTP +KIA+ISE LCIGCG
Sbjct  1    MAD-KLTRIAIVNHDKCKPKKCRQECKKSCPVVRMGKLCIEVTPQSKIAWISETLCIGCG  59

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            IC+KKCPF A+ I+NLP +L+K+TTHRY  N FKLHRLP+PRPG+VLGLVGTNGIGKSTA
Sbjct  60   ICIKKCPFGALSIVNLPSNLEKETTHRYCANAFKLHRLPIPRPGEVLGLVGTNGIGKSTA  119

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            LK+LAGK KPNLG++ +PPDWQEILTYFRGSELQNYFT+ILED+LKAIIKPQYVD IPKA
Sbjct  120  LKILAGKQKPNLGKYDDPPDWQEILTYFRGSELQNYFTKILEDDLKAIIKPQYVDQIPKA  179

Query  638  VQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNV  742
             +G VG +LD+KDE   +  +C  L+L  + + NV
Sbjct  180  AKGTVGSILDRKDETKTQAIVCQQLDLTHLKERNV  214



>ref|XP_005995611.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Latimeria 
chalumnae]
Length=578

 Score =   340 bits (872),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 159/215 (74%), Positives = 188/215 (87%), Gaps = 1/215 (0%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            M+D +LTRIAIV+ DKCKPKKCRQECKKSCPVV+ GKLCIEVT  +KIA+ISE LCIGCG
Sbjct  1    MAD-KLTRIAIVNHDKCKPKKCRQECKKSCPVVRMGKLCIEVTAQSKIAWISETLCIGCG  59

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            IC+KKCPF A+ I+NLP +L+K+TTHRY  N FKLHRLP+PRPG+VLGLVGTNGIGKSTA
Sbjct  60   ICIKKCPFGALSIVNLPSNLEKETTHRYCANAFKLHRLPIPRPGEVLGLVGTNGIGKSTA  119

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            LK+LAGK KPNLG++ +PPDWQEILTYFRGSELQNYFT+ILED+LKAIIKPQYVD IPKA
Sbjct  120  LKILAGKQKPNLGKYDDPPDWQEILTYFRGSELQNYFTKILEDDLKAIIKPQYVDQIPKA  179

Query  638  VQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNV  742
             +G+VG +LD+KDE   ++ +C  L+L  + D NV
Sbjct  180  AKGSVGTILDRKDETKTQDIICEQLDLTHLKDRNV  214



>ref|XP_002069035.1| GK12286 [Drosophila willistoni]
 gb|EDW80021.1| GK12286 [Drosophila willistoni]
Length=611

 Score =   341 bits (875),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 157/219 (72%), Positives = 192/219 (88%), Gaps = 1/219 (0%)
 Frame = +2

Query  95   EMSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGC  274
            E +D++ TRIAIVS DKCKPK+CRQECKKSCPVV+ GKLCIEVTP +KIA +SEELCIGC
Sbjct  8    EETDKQ-TRIAIVSDDKCKPKRCRQECKKSCPVVRMGKLCIEVTPTSKIASLSEELCIGC  66

Query  275  GICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKST  454
            GICVKKCPFEAI IINLP +L+K TTHRY  N+FKLHRLP+PRPG+VLGLVG NGIGKST
Sbjct  67   GICVKKCPFEAITIINLPSNLEKHTTHRYNKNSFKLHRLPIPRPGEVLGLVGQNGIGKST  126

Query  455  ALKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPK  634
            ALK+LAGK KPNLG+F +PPDW EIL YFRGSELQNYFT+ILEDNLKA++KPQYVD IPK
Sbjct  127  ALKILAGKQKPNLGKFASPPDWTEILAYFRGSELQNYFTKILEDNLKALVKPQYVDQIPK  186

Query  635  AVQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNVGRF  751
            AV+G VG++LD+K++ +++ ++C  L+L+ + D ++ + 
Sbjct  187  AVRGQVGELLDKKNDLNIQTKICEMLDLSHIRDRDIAQL  225



>ref|XP_006872330.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Chrysochloris 
asiatica]
Length=599

 Score =   341 bits (874),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 159/215 (74%), Positives = 187/215 (87%), Gaps = 1/215 (0%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            M+D +LTRIAIV+ DKCKPKKCRQECKKSCPVV+ GKLCIEVTP +KIA+ISE LCIGCG
Sbjct  1    MAD-KLTRIAIVNHDKCKPKKCRQECKKSCPVVRMGKLCIEVTPQSKIAWISETLCIGCG  59

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            IC+KKCPF A+ I+NLP +L+K+TTHRY  N FKLHRLP+PRPG+VLGLVGTNGIGKSTA
Sbjct  60   ICIKKCPFGALSIVNLPSNLEKETTHRYCANAFKLHRLPIPRPGEVLGLVGTNGIGKSTA  119

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            LK+LAGK KPNLG++ +PPDWQEILTYFRGSELQNYFT+ILED+LKAIIKPQYVD IPKA
Sbjct  120  LKILAGKQKPNLGKYDDPPDWQEILTYFRGSELQNYFTKILEDDLKAIIKPQYVDQIPKA  179

Query  638  VQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNV  742
             +G VG +LD+KDE   +  +C  L+L  + + NV
Sbjct  180  AKGTVGSILDRKDETKTQAIVCQQLDLTHLKERNV  214



>ref|XP_004655905.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Jaculus 
jaculus]
Length=599

 Score =   341 bits (874),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 159/215 (74%), Positives = 187/215 (87%), Gaps = 1/215 (0%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            M+D +LTRIAIV+ DKCKPKKCRQECKKSCPVV+ GKLCIEVTP +KIA+ISE LCIGCG
Sbjct  1    MAD-KLTRIAIVNHDKCKPKKCRQECKKSCPVVRMGKLCIEVTPQSKIAWISETLCIGCG  59

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            IC+KKCPF A+ I+NLP +L+K+TTHRY  N FKLHRLP+PRPG+VLGLVGTNGIGKSTA
Sbjct  60   ICIKKCPFGALSIVNLPSNLEKETTHRYCANAFKLHRLPIPRPGEVLGLVGTNGIGKSTA  119

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            LK+LAGK KPNLG++ +PPDWQEILTYFRGSELQNYFT+ILED+LKAIIKPQYVD IPKA
Sbjct  120  LKILAGKQKPNLGKYDDPPDWQEILTYFRGSELQNYFTKILEDDLKAIIKPQYVDQIPKA  179

Query  638  VQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNV  742
             +G VG +LD+KDE   +  +C  L+L  + + NV
Sbjct  180  AKGTVGSILDRKDETKTQAIVCQQLDLTHLKERNV  214



>ref|XP_001501999.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Equus 
caballus]
 ref|XP_008513587.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Equus 
przewalskii]
Length=599

 Score =   341 bits (874),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 159/215 (74%), Positives = 187/215 (87%), Gaps = 1/215 (0%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            M+D +LTRIAIV+ DKCKPKKCRQECKKSCPVV+ GKLCIEVTP +KIA+ISE LCIGCG
Sbjct  1    MAD-KLTRIAIVNHDKCKPKKCRQECKKSCPVVRMGKLCIEVTPQSKIAWISETLCIGCG  59

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            IC+KKCPF A+ I+NLP +L+K+TTHRY  N FKLHRLP+PRPG+VLGLVGTNGIGKSTA
Sbjct  60   ICIKKCPFGALSIVNLPSNLEKETTHRYCANAFKLHRLPIPRPGEVLGLVGTNGIGKSTA  119

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            LK+LAGK KPNLG++ +PPDWQEILTYFRGSELQNYFT+ILED+LKAIIKPQYVD IPKA
Sbjct  120  LKILAGKQKPNLGKYDDPPDWQEILTYFRGSELQNYFTKILEDDLKAIIKPQYVDQIPKA  179

Query  638  VQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNV  742
             +G VG +LD+KDE   +  +C  L+L  + + NV
Sbjct  180  AKGTVGSILDRKDETKTQAIVCQQLDLTHLKERNV  214



>ref|XP_008142077.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Eptesicus 
fuscus]
Length=599

 Score =   341 bits (874),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 159/215 (74%), Positives = 187/215 (87%), Gaps = 1/215 (0%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            M+D +LTRIAIV+ DKCKPKKCRQECKKSCPVV+ GKLCIEVTP +KIA+ISE LCIGCG
Sbjct  1    MAD-KLTRIAIVNHDKCKPKKCRQECKKSCPVVRMGKLCIEVTPQSKIAWISETLCIGCG  59

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            IC+KKCPF A+ I+NLP +L+K+TTHRY  N FKLHRLP+PRPG+VLGLVGTNGIGKSTA
Sbjct  60   ICIKKCPFGALSIVNLPSNLEKETTHRYCANAFKLHRLPIPRPGEVLGLVGTNGIGKSTA  119

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            LK+LAGK KPNLG++ +PPDWQEILTYFRGSELQNYFT+ILED+LKAIIKPQYVD IPKA
Sbjct  120  LKILAGKQKPNLGKYDDPPDWQEILTYFRGSELQNYFTKILEDDLKAIIKPQYVDQIPKA  179

Query  638  VQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNV  742
             +G VG +LD+KDE   +  +C  L+L  + + NV
Sbjct  180  AKGTVGSILDRKDETKTQAIVCQQLDLTHLKERNV  214



>ref|XP_004485045.1| PREDICTED: LOW QUALITY PROTEIN: ATP-binding cassette, sub-family 
E (OABP), member 1 [Dasypus novemcinctus]
Length=599

 Score =   341 bits (874),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 159/215 (74%), Positives = 187/215 (87%), Gaps = 1/215 (0%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            M+D +LTRIAIV+ DKCKPKKCRQECKKSCPVV+ GKLCIEVTP +KIA+ISE LCIGCG
Sbjct  1    MAD-KLTRIAIVNHDKCKPKKCRQECKKSCPVVRMGKLCIEVTPQSKIAWISETLCIGCG  59

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            IC+KKCPF A+ I+NLP +L+K+TTHRY  N FKLHRLP+PRPG+VLGLVGTNGIGKSTA
Sbjct  60   ICIKKCPFGALSIVNLPSNLEKETTHRYCANAFKLHRLPIPRPGEVLGLVGTNGIGKSTA  119

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            LK+LAGK KPNLG++ +PPDWQEILTYFRGSELQNYFT+ILED+LKAIIKPQYVD IPKA
Sbjct  120  LKILAGKQKPNLGKYDDPPDWQEILTYFRGSELQNYFTKILEDDLKAIIKPQYVDQIPKA  179

Query  638  VQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNV  742
             +G VG +LD+KDE   +  +C  L+L  + + NV
Sbjct  180  AKGTVGSILDRKDETKTQAIVCQQLDLTHLKERNV  214



>ref|XP_011350337.1| PREDICTED: ATP-binding cassette sub-family E member 1 isoform 
X1 [Cerapachys biroi]
 ref|XP_011350338.1| PREDICTED: ATP-binding cassette sub-family E member 1 isoform 
X1 [Cerapachys biroi]
Length=611

 Score =   341 bits (875),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 161/219 (74%), Positives = 191/219 (87%), Gaps = 1/219 (0%)
 Frame = +2

Query  89   KREMSD-QRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELC  265
            K+ M +  RLTRIAIV+SDKCKPK+CRQECK+SCPVV+ GKLCIEV P +KIA ISEELC
Sbjct  4    KKSMEETDRLTRIAIVNSDKCKPKRCRQECKRSCPVVRMGKLCIEVNPNSKIAAISEELC  63

Query  266  IGCGICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIG  445
            IGCGICVKKCPFEAI IINLP +L+K+TTHRY  N+FKLHRLP+PRPG+VLGLVGTNGIG
Sbjct  64   IGCGICVKKCPFEAISIINLPSNLEKETTHRYSKNSFKLHRLPIPRPGEVLGLVGTNGIG  123

Query  446  KSTALKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDH  625
            KSTALK+LAGK KPNLGR+ +PPDW EIL++FRGSELQNYFT+ILED+LKA+IKPQYVD 
Sbjct  124  KSTALKILAGKQKPNLGRYSDPPDWTEILSHFRGSELQNYFTKILEDDLKALIKPQYVDQ  183

Query  626  IPKAVQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNV  742
            IPKAV+G V Q+LD+KDE   + E+C  L+L  + D ++
Sbjct  184  IPKAVKGTVQQLLDKKDECKNQMEICKMLDLLHIRDRSI  222



>ref|XP_006169559.1| PREDICTED: ATP-binding cassette sub-family E member 1-like isoform 
X1 [Tupaia chinensis]
 ref|XP_006169560.1| PREDICTED: ATP-binding cassette sub-family E member 1-like isoform 
X2 [Tupaia chinensis]
Length=600

 Score =   341 bits (874),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 159/215 (74%), Positives = 187/215 (87%), Gaps = 1/215 (0%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            M+D +LTRIAIV+ DKCKPKKCRQECKKSCPVV+ GKLCIEVTP +KIA+ISE LCIGCG
Sbjct  1    MAD-KLTRIAIVNHDKCKPKKCRQECKKSCPVVRMGKLCIEVTPQSKIAWISETLCIGCG  59

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            IC+KKCPF A+ I+NLP +L+K+TTHRY  N FKLHRLP+PRPG+VLGLVGTNGIGKSTA
Sbjct  60   ICIKKCPFGALSIVNLPSNLEKETTHRYCANAFKLHRLPIPRPGEVLGLVGTNGIGKSTA  119

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            LK+LAGK KPNLG++ +PPDWQEILTYFRGSELQNYFT+ILED+LKAIIKPQYVD IPKA
Sbjct  120  LKILAGKQKPNLGKYDDPPDWQEILTYFRGSELQNYFTKILEDDLKAIIKPQYVDQIPKA  179

Query  638  VQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNV  742
             +G VG +LD+KDE   +  +C  L+L  + + NV
Sbjct  180  AKGTVGSILDRKDETKTQAIVCQQLDLTHLKERNV  214



>gb|KFO20588.1| ATP-binding cassette sub-family E member 1 [Fukomys damarensis]
Length=631

 Score =   342 bits (876),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 158/216 (73%), Positives = 186/216 (86%), Gaps = 0/216 (0%)
 Frame = +2

Query  95   EMSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGC  274
            E+   +LTRIAIV+ DKCKPKKCRQECKKSCPVV+ GKLCIEVTP +KIA+ISE LCIGC
Sbjct  31   EVMADKLTRIAIVNHDKCKPKKCRQECKKSCPVVRMGKLCIEVTPQSKIAWISETLCIGC  90

Query  275  GICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKST  454
            GIC+KKCPF A+ I+NLP +L+K+TTHRY  N FKLHRLP+PRPG+VLGLVGTNGIGKST
Sbjct  91   GICIKKCPFGALSIVNLPSNLEKETTHRYCANAFKLHRLPIPRPGEVLGLVGTNGIGKST  150

Query  455  ALKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPK  634
            ALK+LAGK KPNLG++ +PPDWQEILTYFRGSELQNYFT+ILED+LKAIIKPQYVD IPK
Sbjct  151  ALKILAGKQKPNLGKYDDPPDWQEILTYFRGSELQNYFTKILEDDLKAIIKPQYVDQIPK  210

Query  635  AVQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNV  742
            A +G VG +LD+KDE   +  +C  L+L  + + NV
Sbjct  211  AAKGTVGSILDRKDETKTQAIVCQQLDLTHLKERNV  246



>ref|XP_005666905.1| PREDICTED: ATP-binding cassette sub-family E member 1 isoform 
X2 [Sus scrofa]
Length=589

 Score =   340 bits (873),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 159/215 (74%), Positives = 187/215 (87%), Gaps = 1/215 (0%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            M+D +LTRIAIV+ DKCKPKKCRQECKKSCPVV+ GKLCIEVTP +KIA+ISE LCIGCG
Sbjct  1    MAD-KLTRIAIVNHDKCKPKKCRQECKKSCPVVRMGKLCIEVTPQSKIAWISETLCIGCG  59

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            IC+KKCPF A+ I+NLP +L+K+TTHRY  N FKLHRLP+PRPG+VLGLVGTNGIGKSTA
Sbjct  60   ICIKKCPFGALSIVNLPSNLEKETTHRYCANAFKLHRLPIPRPGEVLGLVGTNGIGKSTA  119

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            LK+LAGK KPNLG++ +PPDWQEILTYFRGSELQNYFT+ILED+LKAIIKPQYVD IPKA
Sbjct  120  LKILAGKQKPNLGKYDDPPDWQEILTYFRGSELQNYFTKILEDDLKAIIKPQYVDQIPKA  179

Query  638  VQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNV  742
             +G VG +LD+KDE   +  +C  L+L  + + NV
Sbjct  180  AKGTVGSILDRKDETKTQAIVCQQLDLTHLKERNV  214



>dbj|BAE01051.1| unnamed protein product [Macaca fascicularis]
Length=599

 Score =   341 bits (874),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 159/215 (74%), Positives = 187/215 (87%), Gaps = 1/215 (0%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            M+D +LTRIAIV+ DKCKPKKCRQECKKSCPVV+ GKLCIEVTP +KIA+ISE LCIGCG
Sbjct  1    MAD-KLTRIAIVNHDKCKPKKCRQECKKSCPVVRMGKLCIEVTPLSKIAWISETLCIGCG  59

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            IC+KKCPF A+ I+NLP +L+K+TTHRY  N FKLHRLP+PRPG+VLGLVGTNGIGKSTA
Sbjct  60   ICIKKCPFGALSIVNLPSNLEKETTHRYCANAFKLHRLPIPRPGEVLGLVGTNGIGKSTA  119

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            LK+LAGK KPNLG++ +PPDWQEILTYFRGSELQNYFT+ILED+LKAIIKPQYVD IPKA
Sbjct  120  LKILAGKQKPNLGKYDDPPDWQEILTYFRGSELQNYFTKILEDDLKAIIKPQYVDQIPKA  179

Query  638  VQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNV  742
             +G VG +LD+KDE   +  +C  L+L  + + NV
Sbjct  180  AKGTVGSILDRKDETKTQAVVCQQLDLTHLKERNV  214



>emb|CAF92703.1| unnamed protein product [Tetraodon nigroviridis]
Length=621

 Score =   341 bits (875),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 156/215 (73%), Positives = 188/215 (87%), Gaps = 1/215 (0%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            M+D+  TRIAIV+ DKCKPKKCRQECKKSCPVV+ GKLCIEVTP +KI FISE LCIGCG
Sbjct  1    MADKN-TRIAIVNHDKCKPKKCRQECKKSCPVVRMGKLCIEVTPQSKIVFISESLCIGCG  59

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            IC+KKCPF A+ I+NLP +L+K+TTHRYG N+FKLHRLP+PRPG VLGLVGTNGIGKSTA
Sbjct  60   ICIKKCPFSALSIVNLPSNLEKETTHRYGANSFKLHRLPIPRPGGVLGLVGTNGIGKSTA  119

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            LK+LAGK KPNLG++ +PPDWQEILTYFRGSELQNYFT+ILED+L+AI+KPQYVD IPK 
Sbjct  120  LKILAGKQKPNLGKYDSPPDWQEILTYFRGSELQNYFTKILEDDLRAIVKPQYVDQIPKT  179

Query  638  VQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNV  742
            V+G+VG +L +KD+ D ++ +C  L+L  + + NV
Sbjct  180  VKGSVGAILTRKDDTDTQDIICQQLDLTHLRERNV  214



>ref|XP_002916281.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Ailuropoda 
melanoleuca]
 ref|XP_867212.2| PREDICTED: ATP-binding cassette sub-family E member 1 isoform 
4 [Canis lupus familiaris]
 ref|XP_003985024.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Felis 
catus]
 ref|XP_004411823.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Odobenus 
rosmarus divergens]
 ref|XP_004588193.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Ochotona 
princeps]
 ref|XP_004685359.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Condylura 
cristata]
 ref|XP_004802299.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Mustela 
putorius furo]
 ref|XP_004907711.1| PREDICTED: ATP-binding cassette sub-family E member 1 isoform 
X1 [Heterocephalus glaber]
 ref|XP_004907712.1| PREDICTED: ATP-binding cassette sub-family E member 1 isoform 
X2 [Heterocephalus glaber]
 ref|XP_004907713.1| PREDICTED: ATP-binding cassette sub-family E member 1 isoform 
X3 [Heterocephalus glaber]
 ref|XP_004868966.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Heterocephalus 
glaber]
 ref|XP_006744161.1| PREDICTED: ATP-binding cassette sub-family E member 1 isoform 
X1 [Leptonychotes weddellii]
 ref|XP_006744162.1| PREDICTED: ATP-binding cassette sub-family E member 1 isoform 
X2 [Leptonychotes weddellii]
 ref|XP_007091833.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Panthera 
tigris altaica]
 ref|XP_007528329.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Erinaceus 
europaeus]
 ref|XP_007942294.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Orycteropus 
afer afer]
 ref|XP_008069707.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Tarsius 
syrichta]
 ref|XP_008584155.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Galeopterus 
variegatus]
 ref|XP_008584156.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Galeopterus 
variegatus]
 ref|XP_008683663.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Ursus 
maritimus]
 gb|EHB17456.1| ATP-binding cassette sub-family E member 1 [Heterocephalus glaber]
Length=599

 Score =   340 bits (873),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 159/215 (74%), Positives = 187/215 (87%), Gaps = 1/215 (0%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            M+D +LTRIAIV+ DKCKPKKCRQECKKSCPVV+ GKLCIEVTP +KIA+ISE LCIGCG
Sbjct  1    MAD-KLTRIAIVNHDKCKPKKCRQECKKSCPVVRMGKLCIEVTPQSKIAWISETLCIGCG  59

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            IC+KKCPF A+ I+NLP +L+K+TTHRY  N FKLHRLP+PRPG+VLGLVGTNGIGKSTA
Sbjct  60   ICIKKCPFGALSIVNLPSNLEKETTHRYCANAFKLHRLPIPRPGEVLGLVGTNGIGKSTA  119

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            LK+LAGK KPNLG++ +PPDWQEILTYFRGSELQNYFT+ILED+LKAIIKPQYVD IPKA
Sbjct  120  LKILAGKQKPNLGKYDDPPDWQEILTYFRGSELQNYFTKILEDDLKAIIKPQYVDQIPKA  179

Query  638  VQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNV  742
             +G VG +LD+KDE   +  +C  L+L  + + NV
Sbjct  180  AKGTVGSILDRKDETKTQAIVCQQLDLTHLKERNV  214



>dbj|BAE39466.1| unnamed protein product [Mus musculus]
Length=599

 Score =   340 bits (873),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 159/215 (74%), Positives = 187/215 (87%), Gaps = 1/215 (0%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            M+D +LTRIAIV+ DKCKPKKCRQECKKSCPVV+ GKLCIEVTP +KIA+ISE LCIGCG
Sbjct  1    MAD-KLTRIAIVNHDKCKPKKCRQECKKSCPVVRMGKLCIEVTPQSKIAWISETLCIGCG  59

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            IC+KKCPF A+ I+NLP +L+K+TTHRY  N FKLHRLP+PRPG+VLGLVGTNGIGKSTA
Sbjct  60   ICIKKCPFGALSIVNLPSNLEKETTHRYCANAFKLHRLPIPRPGEVLGLVGTNGIGKSTA  119

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            LK+LAGK KPNLG++ +PPDWQEILTYFRGSELQNYFT+ILED+LKAIIKPQYVD IPKA
Sbjct  120  LKILAGKQKPNLGKYDDPPDWQEILTYFRGSELQNYFTKILEDDLKAIIKPQYVDQIPKA  179

Query  638  VQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNV  742
             +G VG +LD+KDE   +  +C  L+L  + + NV
Sbjct  180  AKGTVGSILDRKDETKTQAIVCQQLDLTHLKERNV  214



>ref|XP_011350339.1| PREDICTED: ATP-binding cassette sub-family E member 1 isoform 
X2 [Cerapachys biroi]
Length=608

 Score =   341 bits (874),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 161/219 (74%), Positives = 191/219 (87%), Gaps = 1/219 (0%)
 Frame = +2

Query  89   KREMSD-QRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELC  265
            K+ M +  RLTRIAIV+SDKCKPK+CRQECK+SCPVV+ GKLCIEV P +KIA ISEELC
Sbjct  4    KKSMEETDRLTRIAIVNSDKCKPKRCRQECKRSCPVVRMGKLCIEVNPNSKIAAISEELC  63

Query  266  IGCGICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIG  445
            IGCGICVKKCPFEAI IINLP +L+K+TTHRY  N+FKLHRLP+PRPG+VLGLVGTNGIG
Sbjct  64   IGCGICVKKCPFEAISIINLPSNLEKETTHRYSKNSFKLHRLPIPRPGEVLGLVGTNGIG  123

Query  446  KSTALKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDH  625
            KSTALK+LAGK KPNLGR+ +PPDW EIL++FRGSELQNYFT+ILED+LKA+IKPQYVD 
Sbjct  124  KSTALKILAGKQKPNLGRYSDPPDWTEILSHFRGSELQNYFTKILEDDLKALIKPQYVDQ  183

Query  626  IPKAVQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNV  742
            IPKAV+G V Q+LD+KDE   + E+C  L+L  + D ++
Sbjct  184  IPKAVKGTVQQLLDKKDECKNQMEICKMLDLLHIRDRSI  222



>ref|XP_003417547.1| PREDICTED: ATP-binding cassette sub-family E member 1 isoform 
X1 [Loxodonta africana]
 ref|XP_010595523.1| PREDICTED: ATP-binding cassette sub-family E member 1 isoform 
X1 [Loxodonta africana]
 ref|XP_010595524.1| PREDICTED: ATP-binding cassette sub-family E member 1 isoform 
X2 [Loxodonta africana]
Length=599

 Score =   340 bits (873),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 159/215 (74%), Positives = 187/215 (87%), Gaps = 1/215 (0%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            M+D +LTRIAIV+ DKCKPKKCRQECKKSCPVV+ GKLCIEVTP +KIA+ISE LCIGCG
Sbjct  1    MAD-KLTRIAIVNHDKCKPKKCRQECKKSCPVVRMGKLCIEVTPQSKIAWISETLCIGCG  59

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            IC+KKCPF A+ I+NLP +L+K+TTHRY  N FKLHRLP+PRPG+VLGLVGTNGIGKSTA
Sbjct  60   ICIKKCPFGALSIVNLPSNLEKETTHRYCANAFKLHRLPIPRPGEVLGLVGTNGIGKSTA  119

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            LK+LAGK KPNLG++ +PPDWQEILTYFRGSELQNYFT+ILED+LKAIIKPQYVD IPKA
Sbjct  120  LKILAGKQKPNLGKYDDPPDWQEILTYFRGSELQNYFTKILEDDLKAIIKPQYVDQIPKA  179

Query  638  VQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNV  742
             +G VG +LD+KDE   +  +C  L+L  + + NV
Sbjct  180  AKGTVGSILDRKDETKTQAIVCQQLDLTHLKERNV  214



>ref|XP_004606253.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Sorex 
araneus]
Length=599

 Score =   340 bits (873),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 159/215 (74%), Positives = 187/215 (87%), Gaps = 1/215 (0%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            M+D +LTRIAIV+ DKCKPKKCRQECKKSCPVV+ GKLCIEVTP +KIA+ISE LCIGCG
Sbjct  1    MAD-KLTRIAIVNHDKCKPKKCRQECKKSCPVVRMGKLCIEVTPQSKIAWISETLCIGCG  59

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            IC+KKCPF A+ I+NLP +L+K+TTHRY  N FKLHRLP+PRPG+VLGLVGTNGIGKSTA
Sbjct  60   ICIKKCPFGALSIVNLPSNLEKETTHRYCANAFKLHRLPIPRPGEVLGLVGTNGIGKSTA  119

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            LK+LAGK KPNLG++ +PPDWQEILTYFRGSELQNYFT+ILED+LKAIIKPQYVD IPKA
Sbjct  120  LKILAGKQKPNLGKYDDPPDWQEILTYFRGSELQNYFTKILEDDLKAIIKPQYVDQIPKA  179

Query  638  VQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNV  742
             +G VG +LD+KDE   +  +C  L+L  + + NV
Sbjct  180  AKGTVGSILDRKDETKTQTIVCQQLDLTHLKERNV  214



>ref|NP_002931.2| ATP-binding cassette sub-family E member 1 [Homo sapiens]
 ref|NP_001035809.1| ATP-binding cassette sub-family E member 1 [Homo sapiens]
 ref|NP_056566.2| ATP-binding cassette sub-family E member 1 [Mus musculus]
 ref|NP_001233538.1| ATP-binding cassette sub-family E member 1 [Pan troglodytes]
 ref|NP_001253883.1| ATP-binding cassette sub-family E member 1 [Macaca mulatta]
 ref|XP_002716973.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Oryctolagus 
cuniculus]
 ref|XP_002745362.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Callithrix 
jacchus]
 ref|XP_003476892.1| PREDICTED: ATP-binding cassette sub-family E member 1 isoform 
X1 [Cavia porcellus]
 ref|XP_005006844.1| PREDICTED: ATP-binding cassette sub-family E member 1 isoform 
X2 [Cavia porcellus]
 ref|XP_005345450.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Microtus 
ochrogaster]
 ref|XP_005386690.1| PREDICTED: ATP-binding cassette sub-family E member 1 isoform 
X1 [Chinchilla lanigera]
 ref|XP_005386691.1| PREDICTED: ATP-binding cassette sub-family E member 1 isoform 
X2 [Chinchilla lanigera]
 ref|XP_005386692.1| PREDICTED: ATP-binding cassette sub-family E member 1 isoform 
X3 [Chinchilla lanigera]
 ref|XP_006169561.1| PREDICTED: ATP-binding cassette sub-family E member 1-like isoform 
X3 [Tupaia chinensis]
 ref|XP_006971794.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Peromyscus 
maniculatus bairdii]
 ref|XP_008265616.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Oryctolagus 
cuniculus]
 ref|XP_008825705.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Nannospalax 
galili]
 ref|XP_008967104.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Pan paniscus]
 ref|XP_008967105.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Pan paniscus]
 ref|XP_009446589.1| PREDICTED: ATP-binding cassette sub-family E member 1 isoform 
X1 [Pan troglodytes]
 ref|XP_010336937.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Saimiri 
boliviensis boliviensis]
 ref|XP_010609247.1| PREDICTED: ATP-binding cassette sub-family E member 1 [Fukomys 
damarensis]
 sp|P61221.1|ABCE1_HUMAN RecName: Full=ATP-binding cassette sub-family E member 1; AltName: 
Full=2'-5'-oligoadenylate-binding protein; AltName: Full=HuHP68; 
AltName: Full=RNase L inhibitor; AltName: Full=Ribonuclease 
4 inhibitor; Short=RNS4I [Homo sapiens]
 sp|P61222.1|ABCE1_MOUSE RecName: Full=ATP-binding cassette sub-family E member 1; AltName: 
Full=RNase L inhibitor; AltName: Full=Ribonuclease 4 inhibitor; 
Short=RNS4I [Mus musculus]
 gb|AAH05422.1| ATP-binding cassette, sub-family E (OABP), member 1 [Mus musculus]
 gb|AAH16283.1| ATP-binding cassette, sub-family E (OABP), member 1 [Homo sapiens]
 dbj|BAB93476.1| ATP-binding cassette sub-family E member 1 [Homo sapiens]
 gb|AAP88781.1| ATP-binding cassette, sub-family E (OABP), member 1 [Homo sapiens]
 gb|AAX41970.1| ATP-binding cassette sub-family E member 1 [synthetic construct]
 gb|AAZ38723.1| ATP-binding cassette, sub-family E (OABP), member 1 [Homo sapiens]
 dbj|BAE27718.1| unnamed protein product [Mus musculus]
 dbj|BAE39277.1| unnamed protein product [Mus musculus]
 gb|EAX05049.1| ATP-binding cassette, sub-family E (OABP), member 1 [Homo sapiens]
 gb|EDL10876.1| ATP-binding cassette, sub-family E (OABP), member 1 [Mus musculus]
 dbj|BAI46190.1| ATP-binding cassette, sub-family E (OABP), member 1 [synthetic 
construct]
 dbj|BAK62336.1| ATP-binding cassette sub-family E member 1 [Pan troglodytes]
 gb|AIC49602.1| ABCE1, partial [synthetic construct]
 prf||2207222A RNase L inhibitor
Length=599

 Score =   340 bits (873),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 159/215 (74%), Positives = 187/215 (87%), Gaps = 1/215 (0%)
 Frame = +2

Query  98   MSDQRLTRIAIVSSDKCKPKKCRQECKKSCPVVKTGKLCIEVTPAAKIAFISEELCIGCG  277
            M+D +LTRIAIV+ DKCKPKKCRQECKKSCPVV+ GKLCIEVTP +KIA+ISE LCIGCG
Sbjct  1    MAD-KLTRIAIVNHDKCKPKKCRQECKKSCPVVRMGKLCIEVTPQSKIAWISETLCIGCG  59

Query  278  ICVKKCPFEAIQIINLPKDLDKDTTHRYGPNTFKLHRLPVPRPGQVLGLVGTNGIGKSTA  457
            IC+KKCPF A+ I+NLP +L+K+TTHRY  N FKLHRLP+PRPG+VLGLVGTNGIGKSTA
Sbjct  60   ICIKKCPFGALSIVNLPSNLEKETTHRYCANAFKLHRLPIPRPGEVLGLVGTNGIGKSTA  119

Query  458  LKVLAGKLKPNLGRFKNPPDWQEILTYFRGSELQNYFTRILEDNLKAIIKPQYVDHIPKA  637
            LK+LAGK KPNLG++ +PPDWQEILTYFRGSELQNYFT+ILED+LKAIIKPQYVD IPKA
Sbjct  120  LKILAGKQKPNLGKYDDPPDWQEILTYFRGSELQNYFTKILEDDLKAIIKPQYVDQIPKA  179

Query  638  VQGNVGQVLDQKDERDMKEELCVDLELNQVLDHNV  742
             +G VG +LD+KDE   +  +C  L+L  + + NV
Sbjct  180  AKGTVGSILDRKDETKTQAIVCQQLDLTHLKERNV  214



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1414353888260