BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF046B04

Length=661
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KJB42837.1|  hypothetical protein B456_007G169700                    278   2e-89   Gossypium raimondii
ref|XP_009804684.1|  PREDICTED: protein disulfide isomerase-like 2-3    281   5e-89   Nicotiana sylvestris
ref|XP_011085485.1|  PREDICTED: protein disulfide isomerase-like 2-3    279   2e-88   Sesamum indicum [beniseed]
gb|KJB42838.1|  hypothetical protein B456_007G169700                    279   2e-88   Gossypium raimondii
ref|XP_011003479.1|  PREDICTED: protein disulfide isomerase-like 2-3    277   1e-87   Populus euphratica
ref|XP_011016519.1|  PREDICTED: protein disulfide isomerase-like 2-3    277   1e-87   Populus euphratica
ref|XP_011100470.1|  PREDICTED: protein disulfide isomerase-like 2-3    277   1e-87   Sesamum indicum [beniseed]
ref|XP_002320494.2|  thioredoxin family protein                         277   2e-87   Populus trichocarpa [western balsam poplar]
ref|XP_010556968.1|  PREDICTED: protein disulfide-isomerase like ...    277   2e-87   Tarenaya hassleriana [spider flower]
ref|XP_010035498.1|  PREDICTED: protein disulfide isomerase-like 2-3    275   1e-86   Eucalyptus grandis [rose gum]
gb|KJB10303.1|  hypothetical protein B456_001G195100                    268   3e-86   Gossypium raimondii
gb|KJB10302.1|  hypothetical protein B456_001G195100                    268   3e-86   Gossypium raimondii
ref|XP_010522374.1|  PREDICTED: protein disulfide-isomerase 2-3-like    273   4e-86   Tarenaya hassleriana [spider flower]
ref|XP_010110229.1|  Protein disulfide-isomerase like 2-2               272   2e-85   
ref|XP_004304072.1|  PREDICTED: protein disulfide isomerase-like 2-3    271   2e-85   Fragaria vesca subsp. vesca
ref|XP_004143192.1|  PREDICTED: protein disulfide-isomerase like ...    271   3e-85   Cucumis sativus [cucumbers]
gb|KJB10305.1|  hypothetical protein B456_001G195100                    268   3e-85   Gossypium raimondii
ref|XP_006829505.1|  hypothetical protein AMTR_s00074p00124400          270   4e-85   Amborella trichopoda
ref|XP_009365136.1|  PREDICTED: protein disulfide isomerase-like 2-3    270   5e-85   Pyrus x bretschneideri [bai li]
ref|XP_008229815.1|  PREDICTED: protein disulfide isomerase-like 2-3    270   9e-85   Prunus mume [ume]
ref|XP_004165750.1|  PREDICTED: protein disulfide-isomerase like ...    270   1e-84   
ref|XP_007215346.1|  hypothetical protein PRUPE_ppa005396mg             270   1e-84   Prunus persica
emb|CDP05711.1|  unnamed protein product                                270   1e-84   Coffea canephora [robusta coffee]
ref|XP_009409222.1|  PREDICTED: protein disulfide isomerase-like ...    269   2e-84   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009409223.1|  PREDICTED: protein disulfide isomerase-like ...    269   2e-84   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008379697.1|  PREDICTED: protein disulfide isomerase-like 2-3    269   2e-84   
gb|KJB10306.1|  hypothetical protein B456_001G195100                    268   2e-84   Gossypium raimondii
gb|KHG02314.1|  Protein disulfide-isomerase like 2-2                    268   3e-84   Gossypium arboreum [tree cotton]
gb|KJB10301.1|  hypothetical protein B456_001G195100                    268   3e-84   Gossypium raimondii
ref|XP_008456396.1|  PREDICTED: protein disulfide isomerase-like 2-3    268   6e-84   Cucumis melo [Oriental melon]
ref|XP_008805603.1|  PREDICTED: protein disulfide isomerase-like 2-3    267   7e-84   Phoenix dactylifera
ref|XP_009143922.1|  PREDICTED: protein disulfide-isomerase 2-3         268   7e-84   Brassica rapa
emb|CDY52544.1|  BnaA05g35030D                                          268   8e-84   Brassica napus [oilseed rape]
emb|CDY12149.1|  BnaC04g11790D                                          267   1e-83   Brassica napus [oilseed rape]
gb|AFK43048.1|  unknown                                                 267   1e-83   Lotus japonicus
ref|XP_010252582.1|  PREDICTED: protein disulfide isomerase-like 2-3    266   2e-83   Nelumbo nucifera [Indian lotus]
ref|XP_006306333.1|  hypothetical protein CARUB_v10012209mg             265   4e-83   Capsella rubella
ref|XP_010484503.1|  PREDICTED: protein disulfide-isomerase like ...    265   6e-83   Camelina sativa [gold-of-pleasure]
ref|XP_004491086.1|  PREDICTED: protein disulfide isomerase-like ...    265   8e-83   Cicer arietinum [garbanzo]
ref|XP_006418074.1|  hypothetical protein EUTSA_v10007682mg             265   9e-83   Eutrema salsugineum [saltwater cress]
ref|XP_002892256.1|  hypothetical protein ARALYDRAFT_470488             265   9e-83   Arabidopsis lyrata subsp. lyrata
ref|XP_006410429.1|  hypothetical protein EUTSA_v10016663mg             265   1e-82   Eutrema salsugineum [saltwater cress]
gb|AAF40463.1|AC004809_21  Strong simialrity to the disulfide iso...    265   1e-82   Arabidopsis thaliana [mouse-ear cress]
ref|NP_171990.3|  protein disulfide-isomerase like 2-2                  265   1e-82   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001236576.1|  protein disulfide isomerse like protein prec...    264   1e-82   Glycine max [soybeans]
gb|KHN44746.1|  Protein disulfide isomerase-like 2-3                    265   1e-82   Glycine soja [wild soybean]
ref|XP_010475171.1|  PREDICTED: protein disulfide-isomerase like 2-2    265   1e-82   Camelina sativa [gold-of-pleasure]
gb|ACU17741.1|  unknown                                                 264   2e-82   Glycine max [soybeans]
gb|EPS59466.1|  hypothetical protein M569_15341                         256   2e-82   Genlisea aurea
ref|XP_010509948.1|  PREDICTED: protein disulfide-isomerase 2-3 i...    263   3e-82   
ref|NP_180851.1|  protein disulfide-isomerase like 2-3                  263   4e-82   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008342147.1|  PREDICTED: protein disulfide isomerase-like 2-3    263   4e-82   Malus domestica [apple tree]
ref|XP_006294195.1|  hypothetical protein CARUB_v10023191mg             263   4e-82   
ref|XP_002460311.1|  hypothetical protein SORBIDRAFT_02g026300          262   1e-81   Sorghum bicolor [broomcorn]
ref|XP_010469533.1|  PREDICTED: protein disulfide-isomerase 2-3-like    262   1e-81   Camelina sativa [gold-of-pleasure]
emb|CDY53400.1|  BnaAnng12480D                                          258   3e-81   Brassica napus [oilseed rape]
ref|NP_001105804.1|  protein disulfide isomerase8 precursor             261   3e-81   Zea mays [maize]
ref|XP_007141667.1|  hypothetical protein PHAVU_008G215100g             259   9e-81   Phaseolus vulgaris [French bean]
ref|XP_010413931.1|  PREDICTED: protein disulfide-isomerase 2-3-like    259   1e-80   Camelina sativa [gold-of-pleasure]
emb|CDX79497.1|  BnaC03g18330D                                          259   2e-80   
ref|XP_002881252.1|  hypothetical protein ARALYDRAFT_482234             258   3e-80   
ref|XP_003616851.1|  Protein disulfide isomerase family                 258   3e-80   Medicago truncatula
gb|KDP30825.1|  hypothetical protein JCGZ_13768                         258   5e-80   Jatropha curcas
emb|CDY18278.1|  BnaC05g03010D                                          257   6e-80   Brassica napus [oilseed rape]
ref|XP_009119218.1|  PREDICTED: protein disulfide-isomerase like 2-2    257   6e-80   Brassica rapa
ref|XP_009606235.1|  PREDICTED: protein disulfide isomerase-like 2-3    255   3e-79   Nicotiana tomentosiformis
ref|XP_002276520.1|  PREDICTED: protein disulfide isomerase-like 2-3    255   6e-79   Vitis vinifera
ref|XP_010270060.1|  PREDICTED: protein disulfide isomerase-like ...    253   2e-78   Nelumbo nucifera [Indian lotus]
ref|XP_003519441.1|  PREDICTED: protein disulfide isomerase-like ...    253   5e-78   Glycine max [soybeans]
ref|XP_008668262.1|  PREDICTED: uncharacterized protein LOC100381...    252   1e-77   
ref|XP_007049203.1|  PDI-like 2-2                                       251   2e-77   Theobroma cacao [chocolate]
dbj|BAD38009.1|  putative protein disulfide-isomerase A6 precursor      248   8e-77   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001063331.1|  Os09g0451500                                       248   2e-76   
gb|EEC84682.1|  hypothetical protein OsI_31602                          248   3e-76   Oryza sativa Indica Group [Indian rice]
gb|KHG30032.1|  Protein disulfide-isomerase like 2-2                    247   5e-76   Gossypium arboreum [tree cotton]
ref|XP_010688926.1|  PREDICTED: protein disulfide isomerase-like 2-3    247   6e-76   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004243508.1|  PREDICTED: protein disulfide isomerase-like 2-3    247   7e-76   Solanum lycopersicum
gb|EYU43141.1|  hypothetical protein MIMGU_mgv1a006693mg                246   2e-75   Erythranthe guttata [common monkey flower]
ref|XP_006357974.1|  PREDICTED: protein disulfide isomerase-like ...    245   3e-75   Solanum tuberosum [potatoes]
ref|XP_006447669.1|  hypothetical protein CICLE_v10015327mg             244   9e-75   Citrus clementina [clementine]
ref|XP_006469595.1|  PREDICTED: LOW QUALITY PROTEIN: protein disu...    244   1e-74   
ref|XP_002528963.1|  protein disulfide isomerase, putative              240   2e-74   
gb|KDO59568.1|  hypothetical protein CISIN_1g014216mg                   242   2e-74   Citrus sinensis [apfelsine]
gb|KDO59567.1|  hypothetical protein CISIN_1g014216mg                   242   4e-74   Citrus sinensis [apfelsine]
gb|KFK31099.1|  hypothetical protein AALP_AA6G068000                    242   4e-74   Arabis alpina [alpine rockcress]
ref|XP_010913398.1|  PREDICTED: protein disulfide isomerase-like 2-3    239   9e-73   Elaeis guineensis
dbj|BAJ84858.1|  predicted protein                                      236   9e-72   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004956980.1|  PREDICTED: protein disulfide isomerase-like ...    236   2e-71   Setaria italica
gb|EMT02125.1|  Protein disulfide-isomerase A6                          231   6e-70   
emb|CBG91909.1|  putative PDI-like protein                              229   4e-69   Triticum aestivum [Canadian hard winter wheat]
emb|CBG91908.1|  putative PDI-like protein                              228   1e-68   Triticum aestivum [Canadian hard winter wheat]
dbj|BAO79454.1|  protein disulfide isomerase family protein 5-1         227   3e-68   Triticum aestivum [Canadian hard winter wheat]
ref|XP_003578205.1|  PREDICTED: protein disulfide isomerase-like 2-3    227   4e-68   Brachypodium distachyon [annual false brome]
ref|XP_006661300.1|  PREDICTED: protein disulfide isomerase-like ...    224   2e-67   
emb|CBG91899.1|  putative PDI-like protein                              225   3e-67   Triticum aestivum [Canadian hard winter wheat]
gb|ACN39830.1|  unknown                                                 220   2e-65   Picea sitchensis
gb|KHN38504.1|  Protein disulfide isomerase-like 2-3                    217   7e-65   Glycine soja [wild soybean]
gb|EMS60416.1|  Protein disulfide isomerase-like 2-3                    213   2e-63   Triticum urartu
ref|XP_001780684.1|  predicted protein                                  205   9e-60   
ref|XP_002973288.1|  hypothetical protein SELMODRAFT_232026             194   2e-55   Selaginella moellendorffii
ref|XP_002976616.1|  hypothetical protein SELMODRAFT_232834             192   1e-54   Selaginella moellendorffii
ref|XP_006869520.1|  PREDICTED: protein disulfide-isomerase A6          179   6e-50   Chrysochloris asiatica
gb|EPQ08422.1|  Protein disulfide-isomerase A6                          176   1e-48   Myotis brandtii
ref|XP_007243763.1|  PREDICTED: protein disulfide-isomerase A6-like     169   1e-48   
gb|ELK29163.1|  Protein disulfide-isomerase A6                          177   1e-48   Myotis davidii
ref|XP_006102414.1|  PREDICTED: protein disulfide-isomerase A6          177   2e-48   
ref|XP_005803193.1|  PREDICTED: protein disulfide-isomerase A6-li...    175   2e-48   Xiphophorus maculatus
ref|XP_006765261.1|  PREDICTED: protein disulfide-isomerase A6          177   2e-48   
ref|XP_007257385.1|  PREDICTED: protein disulfide-isomerase A6          175   3e-48   Astyanax mexicanus [blind cave fish]
ref|XP_005803194.1|  PREDICTED: protein disulfide-isomerase A6-li...    175   3e-48   Xiphophorus maculatus
ref|XP_005867329.1|  PREDICTED: protein disulfide-isomerase A6          175   3e-48   
ref|XP_007546385.1|  PREDICTED: protein disulfide-isomerase A6 is...    174   4e-48   Poecilia formosa
ref|XP_011160406.1|  PREDICTED: protein disulfide-isomerase A6          174   4e-48   Solenopsis invicta [imported red fire ant]
ref|NP_922915.2|  protein disulfide-isomerase A6 precursor              174   4e-48   Danio rerio [leopard danio]
ref|XP_007529904.1|  PREDICTED: protein disulfide-isomerase A6          174   4e-48   Erinaceus europaeus [common hedgehog]
ref|XP_008287318.1|  PREDICTED: protein disulfide-isomerase A6          174   4e-48   Stegastes partitus
gb|AAK71636.1|AF387900_1  protein disulfide isomerase-related pro...    174   5e-48   Danio rerio [leopard danio]
ref|XP_007546392.1|  PREDICTED: protein disulfide-isomerase A6 is...    174   6e-48   Poecilia formosa
ref|XP_008160636.1|  PREDICTED: protein disulfide-isomerase A6          174   8e-48   Eptesicus fuscus
ref|XP_003488434.1|  PREDICTED: protein disulfide-isomerase A6-like     173   1e-47   Bombus impatiens
ref|XP_003398403.1|  PREDICTED: protein disulfide-isomerase A6-like     173   1e-47   
ref|XP_008528120.1|  PREDICTED: protein disulfide-isomerase A6          173   2e-47   Equus przewalskii [Przewalski horse]
ref|XP_006903376.1|  PREDICTED: protein disulfide-isomerase A6-like     173   3e-47   Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_011062424.1|  PREDICTED: protein disulfide-isomerase A6          172   4e-47   Acromyrmex echinatior
gb|EFN84761.1|  Protein disulfide-isomerase A6                          171   4e-47   Harpegnathos saltator
ref|XP_011139060.1|  PREDICTED: protein disulfide-isomerase A6 is...    172   4e-47   Harpegnathos saltator
ref|XP_010887778.1|  PREDICTED: protein disulfide-isomerase A6          172   5e-47   Esox lucius
emb|CDJ95511.1|  Thioredoxin domain containing protein                  171   5e-47   Haemonchus contortus [red stomach worm]
gb|EAZ44947.1|  hypothetical protein OsJ_29589                          163   7e-47   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001265732.1|  protein disulfide-isomerase A6 precursor           171   1e-46   Ictalurus punctatus
ref|XP_011139061.1|  PREDICTED: protein disulfide-isomerase A6 is...    169   2e-46   Harpegnathos saltator
ref|XP_010781928.1|  PREDICTED: protein disulfide-isomerase A6          170   2e-46   Notothenia coriiceps [yellowbelly rockcod]
ref|XP_003458276.1|  PREDICTED: protein disulfide-isomerase A6-like     170   2e-46   Oreochromis niloticus
gb|ABG81451.1|  protein disulfide isomerase-associated 6                163   4e-46   Bos taurus [bovine]
ref|XP_005731103.1|  PREDICTED: protein disulfide-isomerase A6-like     168   9e-46   Pundamilia nyererei
ref|XP_004568809.1|  PREDICTED: protein disulfide-isomerase A6-li...    168   1e-45   Maylandia zebra
gb|EGT53613.1|  hypothetical protein CAEBREN_31752                      168   1e-45   Caenorhabditis brenneri
ref|XP_010336276.1|  PREDICTED: protein disulfide-isomerase A6          171   1e-45   Saimiri boliviensis boliviensis
ref|XP_011266529.1|  PREDICTED: protein disulfide-isomerase A6          168   1e-45   Camponotus floridanus
ref|XP_004568810.1|  PREDICTED: protein disulfide-isomerase A6-li...    167   2e-45   Maylandia zebra
ref|XP_006792591.1|  PREDICTED: protein disulfide-isomerase A6-li...    167   2e-45   Neolamprologus brichardi [lyretail cichlid]
ref|XP_006197174.1|  PREDICTED: protein disulfide-isomerase A6          167   3e-45   Vicugna pacos
ref|XP_006792592.1|  PREDICTED: protein disulfide-isomerase A6-li...    167   3e-45   Neolamprologus brichardi [lyretail cichlid]
ref|XP_010962323.1|  PREDICTED: protein disulfide-isomerase A6          167   3e-45   Camelus bactrianus [camel]
ref|XP_007195772.1|  PREDICTED: protein disulfide-isomerase A6          166   3e-45   
ref|XP_006191925.1|  PREDICTED: protein disulfide-isomerase A6          167   4e-45   Camelus ferus
ref|XP_007127699.1|  PREDICTED: protein disulfide-isomerase A6          166   4e-45   
gb|ACI34364.1|  disulfide-isomerase A6 precursor                        166   4e-45   Salmo salar
gb|EHB04452.1|  Protein disulfide-isomerase A6                          166   5e-45   Heterocephalus glaber [naked mole rat]
ref|XP_004870016.1|  PREDICTED: protein disulfide-isomerase A6          166   5e-45   Heterocephalus glaber [naked mole rat]
ref|XP_003744350.1|  PREDICTED: protein disulfide-isomerase A6-like     166   5e-45   Galendromus occidentalis
emb|CDQ62935.1|  unnamed protein product                                166   5e-45   Oncorhynchus mykiss
ref|XP_003411934.1|  PREDICTED: protein disulfide-isomerase A6          166   5e-45   Loxodonta africana [African bush elephant]
ref|XP_006976688.1|  PREDICTED: protein disulfide-isomerase A6          168   6e-45   Peromyscus maniculatus bairdii
ref|XP_011489880.1|  PREDICTED: protein disulfide-isomerase A6 is...    166   7e-45   Oryzias latipes [Japanese rice fish]
gb|ELK13980.1|  Protein disulfide-isomerase A6                          166   8e-45   Pteropus alecto
emb|CAH65062.1|  hypothetical protein RCJMB04_2j3                       161   9e-45   Gallus gallus [bantam]
ref|XP_004887060.1|  PREDICTED: protein disulfide-isomerase A6          166   1e-44   
ref|XP_004436529.1|  PREDICTED: protein disulfide-isomerase A6          165   1e-44   
ref|XP_004083501.1|  PREDICTED: protein disulfide-isomerase A6 is...    165   1e-44   Oryzias latipes [Japanese rice fish]
gb|KFU90776.1|  Protein disulfide-isomerase A6                          165   1e-44   Chaetura pelagica
ref|XP_008848336.1|  PREDICTED: protein disulfide-isomerase A6          165   1e-44   Nannospalax galili
ref|XP_001502324.3|  PREDICTED: protein disulfide-isomerase A6          165   1e-44   
ref|XP_532876.2|  PREDICTED: protein disulfide-isomerase A6             165   2e-44   Canis lupus familiaris [dogs]
ref|XP_002408975.1|  protein disulfide isomerase 1, putative            165   2e-44   Ixodes scapularis [blacklegged tick]
ref|XP_009997534.1|  PREDICTED: protein disulfide-isomerase A6          165   2e-44   Chaetura pelagica
ref|XP_003971872.1|  PREDICTED: protein disulfide-isomerase A6-like     165   2e-44   
gb|EFB24563.1|  hypothetical protein PANDA_010457                       164   2e-44   Ailuropoda melanoleuca
ref|XP_004642404.1|  PREDICTED: protein disulfide-isomerase A6          166   2e-44   
ref|XP_004582660.1|  PREDICTED: protein disulfide-isomerase A6 is...    164   3e-44   Ochotona princeps [southern American pika]
ref|XP_009181940.1|  PREDICTED: protein disulfide-isomerase A6 is...    164   3e-44   
ref|XP_005404513.1|  PREDICTED: protein disulfide-isomerase A6          166   3e-44   
ref|XP_003908325.1|  PREDICTED: protein disulfide-isomerase A6 is...    164   3e-44   Papio anubis [baboon]
ref|NP_001253564.1|  protein disulfide-isomerase A6 precursor           164   3e-44   Macaca mulatta [rhesus macaque]
ref|XP_006910476.1|  PREDICTED: protein disulfide-isomerase A6          166   3e-44   
ref|NP_001182048.1|  protein disulfide-isomerase A6 precursor           164   4e-44   Sus scrofa [pigs]
ref|XP_004582659.1|  PREDICTED: protein disulfide-isomerase A6 is...    164   4e-44   Ochotona princeps [southern American pika]
emb|CDP96040.1|  Protein BM-TAG-320, isoform b                          164   4e-44   
gb|KHJ46223.1|  protein disulfide-isomerase domain protein              164   4e-44   Trichuris suis
emb|CAJ82905.1|  protein disulfide isomerase family A, member 6         164   4e-44   Xenopus tropicalis [western clawed frog]
ref|XP_006745860.1|  PREDICTED: protein disulfide-isomerase A6          164   4e-44   Leptonychotes weddellii
ref|XP_007933283.1|  PREDICTED: protein disulfide-isomerase A6          164   4e-44   Orycteropus afer afer
ref|XP_004401842.1|  PREDICTED: protein disulfide-isomerase A6          164   4e-44   Odobenus rosmarus divergens
ref|XP_011343321.1|  PREDICTED: protein disulfide-isomerase A6 is...    163   4e-44   Ooceraea biroi
ref|NP_001007974.1|  protein disulfide-isomerase A6 precursor           164   5e-44   Xenopus tropicalis [western clawed frog]
ref|NP_001193274.1|  protein disulfide-isomerase A6 precursor           163   5e-44   Bos taurus [bovine]
ref|XP_004005735.1|  PREDICTED: protein disulfide-isomerase A6 is...    163   5e-44   
gb|AAI48887.1|  PDIA6 protein                                           164   6e-44   Bos taurus [bovine]
gb|ABC75564.1|  protein disulfide isomerase-related protein P5 pr...    160   6e-44   Ictalurus punctatus
emb|CDQ71639.1|  unnamed protein product                                164   6e-44   Oncorhynchus mykiss
gb|ACI33422.1|  disulfide-isomerase A6 precursor                        164   6e-44   Salmo salar
emb|CAG03659.1|  unnamed protein product                                163   6e-44   Tetraodon nigroviridis
ref|XP_011343320.1|  PREDICTED: protein disulfide-isomerase A6 is...    163   6e-44   Ooceraea biroi
gb|ERE68285.1|  protein disulfide-isomerase A6-like protein             160   6e-44   Cricetulus griseus [Chinese hamsters]
ref|XP_011363442.1|  PREDICTED: protein disulfide-isomerase A6          166   6e-44   Pteropus vampyrus
ref|XP_008311310.1|  PREDICTED: protein disulfide-isomerase A6          163   7e-44   Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_010304195.1|  PREDICTED: protein disulfide-isomerase A6          163   7e-44   Balearica regulorum gibbericeps
ref|XP_006138598.1|  PREDICTED: protein disulfide-isomerase A6          163   7e-44   Pelodiscus sinensis [Chinese softshell turtle]
gb|ELR58675.1|  Protein disulfide-isomerase A6                          163   7e-44   Bos mutus
ref|XP_004005734.1|  PREDICTED: protein disulfide-isomerase A6 is...    163   8e-44   
gb|KFO12540.1|  Protein disulfide-isomerase A6                          163   8e-44   Balearica regulorum gibbericeps
gb|KFD51103.1|  hypothetical protein M513_08003                         163   8e-44   Trichuris suis
gb|KFV46902.1|  Protein disulfide-isomerase A6                          163   8e-44   Tyto alba [Schleiereule]
ref|XP_002586165.1|  hypothetical protein BRAFLDRAFT_289141             163   8e-44   Branchiostoma floridae
gb|EHH21891.1|  hypothetical protein EGK_05054                          164   8e-44   Macaca mulatta [rhesus macaque]
dbj|BAF63672.1|  protein disulfide isomerase-1                          163   8e-44   Haemaphysalis longicornis
ref|XP_007456979.1|  PREDICTED: protein disulfide-isomerase A6          163   9e-44   Lipotes vexillifer [baiji]
ref|XP_008248061.1|  PREDICTED: protein disulfide-isomerase A6          163   9e-44   Oryctolagus cuniculus [domestic rabbit]
ref|XP_004274932.1|  PREDICTED: protein disulfide-isomerase A6          163   9e-44   
ref|XP_004665748.1|  PREDICTED: protein disulfide-isomerase A6          163   1e-43   Jaculus jaculus
ref|XP_004686132.1|  PREDICTED: protein disulfide-isomerase A6          164   1e-43   
ref|XP_004028893.1|  PREDICTED: protein disulfide-isomerase A6 is...    163   1e-43   
ref|NP_001269636.1|  protein disulfide-isomerase A6 isoform e pre...    163   1e-43   Homo sapiens [man]
dbj|BAB24354.1|  unnamed protein product                                162   1e-43   Mus musculus [mouse]
gb|EDK98488.1|  protein disulfide isomerase associated 6, isoform...    162   1e-43   Mus musculus [mouse]
ref|XP_010377997.1|  PREDICTED: protein disulfide-isomerase A6          164   1e-43   Rhinopithecus roxellana
ref|XP_005366580.1|  PREDICTED: protein disulfide-isomerase A6          163   1e-43   Microtus ochrogaster [prairie voles]
ref|XP_008570350.1|  PREDICTED: protein disulfide-isomerase A6          163   1e-43   Galeopterus variegatus [Malayan flying lemur]
ref|XP_008686251.1|  PREDICTED: protein disulfide-isomerase A6          164   1e-43   Ursus maritimus [white bear]
ref|NP_001233576.1|  protein disulfide-isomerase A6 precursor           162   1e-43   Pan troglodytes
ref|NP_001126483.1|  protein disulfide-isomerase A6 precursor           162   1e-43   Pongo abelii [orang utan]
ref|XP_008395804.1|  PREDICTED: protein disulfide-isomerase A6 is...    162   1e-43   Poecilia reticulata
ref|XP_009961799.1|  PREDICTED: protein disulfide-isomerase A6          162   1e-43   Tyto alba [Schleiereule]
ref|NP_005733.1|  protein disulfide-isomerase A6 isoform d precursor    162   1e-43   Homo sapiens [man]
ref|XP_003215468.2|  PREDICTED: protein disulfide-isomerase A6          163   1e-43   Anolis carolinensis [Carolina anole]
ref|XP_007053233.1|  PREDICTED: protein disulfide-isomerase A6          162   1e-43   
ref|NP_001269635.1|  protein disulfide-isomerase A6 isoform c           162   1e-43   Homo sapiens [man]
ref|XP_002921563.2|  PREDICTED: protein disulfide-isomerase A6          164   1e-43   Ailuropoda melanoleuca
ref|XP_004310310.1|  PREDICTED: protein disulfide-isomerase A6 is...    162   1e-43   
ref|XP_004373116.1|  PREDICTED: protein disulfide-isomerase A6          162   1e-43   Trichechus manatus latirostris
ref|XP_005085000.1|  PREDICTED: protein disulfide-isomerase A6          162   2e-43   Mesocricetus auratus [Syrian golden hamster]
ref|XP_004746019.1|  PREDICTED: protein disulfide-isomerase A6          162   2e-43   
ref|XP_005014200.1|  PREDICTED: protein disulfide-isomerase A6          161   2e-43   
gb|EDK98487.1|  protein disulfide isomerase associated 6, isoform...    162   2e-43   Mus musculus [mouse]
ref|XP_008395805.1|  PREDICTED: protein disulfide-isomerase A6 is...    162   2e-43   Poecilia reticulata
ref|NP_001269634.1|  protein disulfide-isomerase A6 isoform b           163   2e-43   Homo sapiens [man]
dbj|BAG54757.1|  unnamed protein product                                163   2e-43   Homo sapiens [man]
ref|XP_003272792.1|  PREDICTED: LOW QUALITY PROTEIN: protein disu...    162   2e-43   
gb|EMP42001.1|  Protein disulfide-isomerase A6                          162   2e-43   Chelonia mydas [green seaturtle]
ref|XP_005246202.1|  PREDICTED: protein disulfide-isomerase A6 is...    162   2e-43   
ref|XP_009806227.1|  PREDICTED: protein disulfide-isomerase A6          162   3e-43   Gavia stellata
ref|XP_002758076.1|  PREDICTED: protein disulfide-isomerase A6          162   3e-43   Callithrix jacchus [common marmoset]
ref|XP_010850414.1|  PREDICTED: protein disulfide-isomerase A6          163   3e-43   Bison bison bison
ref|NP_082235.1|  protein disulfide-isomerase A6 precursor              162   3e-43   
gb|AAH06865.2|  Protein disulfide isomerase associated 6                162   3e-43   Mus musculus [mouse]
ref|XP_010738984.1|  PREDICTED: protein disulfide-isomerase A6          162   3e-43   
tpg|DAA24511.1|  TPA: protein disulfide isomerase family A, member 6    164   3e-43   Bos taurus [bovine]
emb|CAA55891.1|  CaBP1                                                  161   3e-43   Rattus norvegicus [brown rat]
gb|KFV41194.1|  Protein disulfide-isomerase A6                          161   3e-43   Gavia stellata
sp|Q922R8.3|PDIA6_MOUSE  RecName: Full=Protein disulfide-isomeras...    161   3e-43   Mus musculus [mouse]
ref|XP_010706217.1|  PREDICTED: protein disulfide-isomerase A6          162   3e-43   Meleagris gallopavo [common turkey]
ref|XP_009489926.1|  PREDICTED: protein disulfide-isomerase A6          162   3e-43   Pelecanus crispus
ref|NP_001004442.1|  protein disulfide-isomerase A6 precursor           162   3e-43   Rattus norvegicus [brown rat]
gb|KFQ57711.1|  Protein disulfide-isomerase A6                          161   3e-43   Pelecanus crispus
ref|XP_006073828.1|  PREDICTED: LOW QUALITY PROTEIN: protein disu...    163   3e-43   
dbj|BAC86977.1|  unnamed protein product                                162   3e-43   Homo sapiens [man]
ref|XP_009585693.1|  PREDICTED: protein disulfide-isomerase A6          161   3e-43   Fulmarus glacialis
ref|XP_003741496.1|  PREDICTED: protein disulfide-isomerase A6-like     164   3e-43   
sp|Q63081.2|PDIA6_RAT  RecName: Full=Protein disulfide-isomerase ...    161   4e-43   Rattus norvegicus [brown rat]
ref|NP_001269633.1|  protein disulfide-isomerase A6 isoform a           162   4e-43   Homo sapiens [man]
gb|KFV91574.1|  Protein disulfide-isomerase A6                          161   4e-43   Eurypyga helias
gb|KFQ39965.1|  Protein disulfide-isomerase A6                          161   4e-43   Mesitornis unicolor
ref|XP_006711919.1|  PREDICTED: protein disulfide-isomerase A6 is...    162   4e-43   
ref|XP_010145729.1|  PREDICTED: protein disulfide-isomerase A6          161   4e-43   Eurypyga helias
ref|XP_002196421.2|  PREDICTED: protein disulfide-isomerase A6          161   4e-43   
ref|XP_006012215.1|  PREDICTED: protein disulfide-isomerase A6 is...    161   4e-43   Latimeria chalumnae
ref|XP_003787439.1|  PREDICTED: protein disulfide-isomerase A6          161   4e-43   Otolemur garnettii
gb|KFV98779.1|  Protein disulfide-isomerase A6                          161   4e-43   Fulmarus glacialis
ref|XP_009940378.1|  PREDICTED: protein disulfide-isomerase A6          161   4e-43   Opisthocomus hoazin [hoatzin]
ref|XP_419952.1|  PREDICTED: protein disulfide-isomerase A6 isofo...    161   4e-43   Gallus gallus [bantam]
ref|XP_003984581.1|  PREDICTED: protein disulfide-isomerase A6          161   4e-43   
ref|XP_001438686.1|  hypothetical protein                               160   5e-43   Paramecium tetraurelia strain d4-2
ref|XP_005967905.1|  PREDICTED: protein disulfide-isomerase A6          161   5e-43   Pantholops hodgsonii [Tibetan antelope]
gb|KFV71961.1|  Protein disulfide-isomerase A6                          161   5e-43   Struthio camelus australis
gb|AAB50217.1|  protein disulfide isomerase-related protein 5           160   5e-43   Homo sapiens [man]
gb|KFQ65954.1|  Protein disulfide-isomerase A6                          161   5e-43   Phaethon lepturus
ref|XP_010189304.1|  PREDICTED: protein disulfide-isomerase A6          161   5e-43   Mesitornis unicolor
gb|KFR16570.1|  Protein disulfide-isomerase A6                          160   5e-43   Opisthocomus hoazin [hoatzin]
ref|NP_001086643.1|  protein disulfide isomerase family A, member...    161   5e-43   Xenopus laevis [clawed frog]
ref|XP_005000363.1|  PREDICTED: protein disulfide-isomerase A6 is...    161   6e-43   
ref|XP_010073176.1|  PREDICTED: protein disulfide-isomerase A6          161   6e-43   
gb|EMC90288.1|  Protein disulfide-isomerase A6                          160   6e-43   
gb|KFU96864.1|  Protein disulfide-isomerase A6                          160   6e-43   
gb|KFO95889.1|  Protein disulfide-isomerase A6                          160   6e-43   
ref|XP_003462749.1|  PREDICTED: protein disulfide-isomerase A6 is...    160   6e-43   
ref|XP_009874965.1|  PREDICTED: protein disulfide-isomerase A6          160   6e-43   
ref|XP_010130331.1|  PREDICTED: protein disulfide-isomerase A6          160   6e-43   
gb|KFP92383.1|  Protein disulfide-isomerase A6                          160   6e-43   
dbj|BAH12614.1|  unnamed protein product                                160   6e-43   
ref|XP_008493616.1|  PREDICTED: protein disulfide-isomerase A6          161   6e-43   
gb|ELW72031.1|  Protein disulfide-isomerase A6                          161   6e-43   
gb|KFQ83261.1|  Protein disulfide-isomerase A6                          160   7e-43   
ref|XP_009463744.1|  PREDICTED: LOW QUALITY PROTEIN: protein disu...    160   7e-43   
ref|XP_009702308.1|  PREDICTED: protein disulfide-isomerase A6          160   7e-43   
gb|KGL97075.1|  Protein disulfide-isomerase A6                          160   7e-43   
gb|KFZ68639.1|  Protein disulfide-isomerase A6                          160   7e-43   
gb|KFP66932.1|  Protein disulfide-isomerase A6                          160   7e-43   
gb|KFO87204.1|  Protein disulfide-isomerase A6                          160   7e-43   
gb|KGL83930.1|  Protein disulfide-isomerase A6                          160   8e-43   
gb|KFP75924.1|  Protein disulfide-isomerase A6                          160   8e-43   
ref|XP_005432317.1|  PREDICTED: protein disulfide-isomerase A6          160   8e-43   
ref|XP_005238268.1|  PREDICTED: protein disulfide-isomerase A6          160   8e-43   
ref|XP_009273886.1|  PREDICTED: protein disulfide-isomerase A6          160   9e-43   
ref|XP_009666708.1|  PREDICTED: protein disulfide-isomerase A6          160   9e-43   
ref|XP_009068583.1|  PREDICTED: protein disulfide-isomerase A6          160   9e-43   
ref|XP_007640104.1|  PREDICTED: protein disulfide-isomerase A6          160   9e-43   
ref|XP_010222649.1|  PREDICTED: protein disulfide-isomerase A6          160   9e-43   
ref|XP_005506964.1|  PREDICTED: protein disulfide-isomerase A6          160   9e-43   
ref|XP_010018621.1|  PREDICTED: protein disulfide-isomerase A6          160   9e-43   
ref|XP_010280693.1|  PREDICTED: protein disulfide-isomerase A6          160   9e-43   
sp|P38660.1|PDIA6_MESAU  RecName: Full=Protein disulfide-isomeras...    160   1e-42   
gb|KFW73081.1|  Protein disulfide-isomerase A6                          160   1e-42   
gb|KFM05020.1|  Protein disulfide-isomerase A6                          160   1e-42   
ref|XP_009330780.1|  PREDICTED: protein disulfide-isomerase A6          160   1e-42   
ref|XP_007607763.1|  PREDICTED: protein disulfide-isomerase A6          160   1e-42   
gb|KFQ00948.1|  Protein disulfide-isomerase A6                          160   1e-42   
gb|KFP35427.1|  Protein disulfide-isomerase A6                          160   1e-42   
gb|KFQ44656.1|  Protein disulfide-isomerase A6                          160   1e-42   
ref|XP_008063733.1|  PREDICTED: protein disulfide-isomerase A6          161   1e-42   
ref|XP_005687063.1|  PREDICTED: protein disulfide-isomerase A6          160   1e-42   
gb|KHN88358.1|  putative protein disulfide-isomerase A6                 160   1e-42   
gb|KFP16755.1|  Protein disulfide-isomerase A6                          160   1e-42   
ref|XP_010114738.1|  PREDICTED: protein disulfide-isomerase A6          160   1e-42   
ref|XP_009888074.1|  PREDICTED: protein disulfide-isomerase A6          160   1e-42   
ref|XP_009638086.1|  PREDICTED: protein disulfide-isomerase A6          160   1e-42   
ref|XP_005146160.1|  PREDICTED: protein disulfide-isomerase A6          160   1e-42   
ref|XP_009913272.1|  PREDICTED: protein disulfide-isomerase A6          160   1e-42   
gb|KFP27162.1|  Protein disulfide-isomerase A6                          160   1e-42   
ref|XP_010206382.1|  PREDICTED: protein disulfide-isomerase A6          160   1e-42   
ref|XP_004459385.1|  PREDICTED: protein disulfide-isomerase A6          159   2e-42   
dbj|BAE39477.1|  unnamed protein product                                159   2e-42   
ref|XP_010564977.1|  PREDICTED: protein disulfide-isomerase A6          159   2e-42   
gb|KFQ26878.1|  Protein disulfide-isomerase A6                          159   2e-42   
ref|XP_005293176.1|  PREDICTED: protein disulfide-isomerase A6          159   2e-42   
ref|XP_005044328.1|  PREDICTED: protein disulfide-isomerase A6          159   2e-42   
ref|XP_008935557.1|  PREDICTED: protein disulfide-isomerase A6          159   2e-42   
ref|XP_005420347.1|  PREDICTED: protein disulfide-isomerase A6          159   3e-42   
ref|XP_009946939.1|  PREDICTED: protein disulfide-isomerase A6          159   3e-42   
gb|KFQ08834.1|  Protein disulfide-isomerase A6                          159   3e-42   
ref|XP_009898142.1|  PREDICTED: protein disulfide-isomerase A6          159   3e-42   
ref|XP_004609467.1|  PREDICTED: protein disulfide-isomerase A6          159   3e-42   
ref|XP_007423659.1|  PREDICTED: protein disulfide-isomerase A6          159   3e-42   
ref|XP_009045951.1|  hypothetical protein LOTGIDRAFT_151365             159   3e-42   
ref|XP_005521917.1|  PREDICTED: protein disulfide-isomerase A6 is...    159   3e-42   
gb|KFV66878.1|  Protein disulfide-isomerase A6                          159   3e-42   
ref|XP_005521916.1|  PREDICTED: protein disulfide-isomerase A6 is...    159   3e-42   
ref|XP_009093512.1|  PREDICTED: protein disulfide-isomerase A6          159   4e-42   
gb|KFO75223.1|  Protein disulfide-isomerase A6                          159   4e-42   
ref|XP_001439775.1|  hypothetical protein                               158   4e-42   
ref|XP_009981655.1|  PREDICTED: protein disulfide-isomerase A6          159   4e-42   
gb|KFV15259.1|  Protein disulfide-isomerase A6                          158   4e-42   
gb|ADY90107.1|  protein disulfide isomerase A6                          158   4e-42   
gb|KHJ93089.1|  protein disulfide-isomerase domain protein              158   4e-42   
ref|XP_003706812.1|  PREDICTED: protein disulfide-isomerase A6-like     158   4e-42   
ref|XP_009557934.1|  PREDICTED: protein disulfide-isomerase A6          158   4e-42   
ref|XP_009009748.1|  hypothetical protein HELRODRAFT_63467              158   4e-42   
gb|EGT47278.1|  hypothetical protein CAEBREN_31162                      158   5e-42   
ref|XP_006612487.1|  PREDICTED: protein disulfide-isomerase A6-like     158   5e-42   
gb|AEB26317.1|  protein disulfide isomerase                             157   7e-42   
ref|XP_010391624.1|  PREDICTED: protein disulfide-isomerase A6          158   7e-42   
ref|XP_008639999.1|  PREDICTED: protein disulfide-isomerase A6          158   7e-42   
ref|XP_002587888.1|  hypothetical protein BRAFLDRAFT_124879             159   7e-42   
gb|KFO65258.1|  Protein disulfide-isomerase A6                          158   8e-42   
ref|XP_010836180.1|  PREDICTED: LOW QUALITY PROTEIN: protein disu...    157   8e-42   
ref|XP_007902471.1|  PREDICTED: protein disulfide-isomerase A6-like     157   9e-42   
gb|ADK26817.1|  protein disulfide isomerase family A, member 6          157   1e-41   
gb|ADK26725.1|  protein disulfide isomerase family A, member 6          157   1e-41   
ref|XP_003693801.1|  PREDICTED: protein disulfide-isomerase A6-like     157   1e-41   
ref|XP_005487254.1|  PREDICTED: protein disulfide-isomerase A6 is...    157   1e-41   
ref|XP_005487253.1|  PREDICTED: protein disulfide-isomerase A6 is...    157   2e-41   
gb|AIG55564.1|  secreted protein                                        157   2e-41   
gb|EFX87790.1|  hypothetical protein DAPPUDRAFT_306380                  157   2e-41   
gb|EFO25483.2|  TAG-320 protein                                         157   2e-41   
ref|XP_395981.2|  PREDICTED: protein disulfide-isomerase A6-like ...    156   2e-41   
ref|XP_011301143.1|  PREDICTED: protein disulfide-isomerase A6          156   2e-41   
ref|XP_007476199.1|  PREDICTED: protein disulfide-isomerase A6          156   2e-41   
ref|XP_008864870.1|  protein disulfide-isomerase domain                 156   3e-41   
gb|KFW88870.1|  Protein disulfide-isomerase A6                          156   3e-41   
ref|XP_008930983.1|  PREDICTED: protein disulfide-isomerase A6          156   3e-41   
ref|NP_509190.1|  Protein TAG-320                                       156   3e-41   
ref|XP_003117834.1|  CRE-TAG-320 protein                                156   3e-41   
ref|XP_009834821.1|  protein disulfide-isomerase domain                 156   4e-41   
ref|XP_005108921.1|  PREDICTED: protein disulfide-isomerase A6-like     155   5e-41   
ref|XP_005963820.1|  PREDICTED: protein disulfide-isomerase A6-like     155   6e-41   
ref|XP_006021844.1|  PREDICTED: LOW QUALITY PROTEIN: protein disu...    155   7e-41   
emb|CDW52124.1|  protein disulfide isomerase A6                         155   8e-41   
ref|XP_006257985.1|  PREDICTED: protein disulfide-isomerase A6          155   8e-41   
ref|XP_003094567.1|  hypothetical protein CRE_30155                     155   9e-41   
ref|XP_004696438.1|  PREDICTED: protein disulfide-isomerase A6          155   1e-40   
ref|XP_002644986.1|  C. briggsae CBR-TAG-320 protein                    154   1e-40   
gb|AIG56196.1|  secreted protein                                        154   2e-40   
ref|NP_001080305.1|  protein disulfide isomerase family A, member...    154   2e-40   
ref|XP_001629218.1|  predicted protein                                  154   2e-40   
ref|XP_003757912.1|  PREDICTED: protein disulfide-isomerase A6          154   2e-40   
ref|XP_010270061.1|  PREDICTED: protein disulfide isomerase-like ...    152   3e-40   
ref|XP_004518575.1|  PREDICTED: protein disulfide-isomerase A6-like     153   3e-40   
ref|XP_001602967.1|  PREDICTED: probable protein disulfide-isomer...    153   4e-40   
gb|EFA11123.1|  hypothetical protein TcasGA2_TC004723                   152   5e-40   
ref|XP_011446200.1|  PREDICTED: protein disulfide-isomerase A6-like     152   6e-40   
ref|XP_001848695.1|  disulfide-isomerase A6                             152   9e-40   
gb|KFM68865.1|  Protein disulfide-isomerase A6                          152   9e-40   
gb|EJY83204.1|  Protein disulfide-isomerase domain containing pro...    151   1e-39   
gb|ETN79262.1|  protein disulfide-isomerase domain protein              151   2e-39   
gb|EHJ66984.1|  hypothetical protein KGM_18501                          150   3e-39   
ref|NP_499613.1|  Protein Y49E10.4                                      150   3e-39   
gb|KFO31202.1|  Protein disulfide-isomerase A6                          151   3e-39   
tpg|DAA24981.1|  TPA: PDIA6 protein-like                                150   3e-39   
ref|XP_010627358.1|  PREDICTED: protein disulfide-isomerase A6          149   5e-39   
gb|EGT52939.1|  CBN-TAG-320 protein                                     149   1e-38   
ref|XP_002641016.1|  Hypothetical protein CBG11768                      149   1e-38   
ref|XP_002002212.1|  GI13846                                            149   1e-38   
gb|EYB96326.1|  hypothetical protein Y032_0151g2809                     149   2e-38   
gb|EYB96325.1|  hypothetical protein Y032_0151g2809                     148   2e-38   
ref|XP_001976216.1|  GG20128                                            148   3e-38   
ref|XP_001898144.1|  Probable protein disulfide isomerase A6 prec...    148   3e-38   
ref|XP_011206958.1|  PREDICTED: protein disulfide-isomerase A6          148   3e-38   
gb|ELT97169.1|  hypothetical protein CAPTEDRAFT_222278                  148   3e-38   
ref|XP_008200598.1|  PREDICTED: protein disulfide-isomerase A6          147   3e-38   
emb|CBY37570.1|  unnamed protein product                                147   5e-38   
emb|CBY07145.1|  unnamed protein product                                147   6e-38   
ref|XP_001356908.2|  GA19146                                            147   7e-38   
gb|KDR20898.1|  Protein disulfide-isomerase A6                          147   7e-38   
ref|XP_002015314.1|  GL18482                                            147   8e-38   
gb|ABN09749.1|  Ribonuclease T2; Thioredoxin domain 2; Thioredoxi...    145   9e-38   
ref|XP_001948267.2|  PREDICTED: protein disulfide-isomerase A6          147   9e-38   
ref|NP_609792.1|  calcium-binding protein 1, isoform A                  146   1e-37   
ref|XP_002079636.1|  GD21912                                            146   1e-37   
ref|XP_003594130.1|  Protein disulfide-isomerase A6                     145   1e-37   
ref|XP_011187125.1|  PREDICTED: probable protein disulfide-isomer...    146   1e-37   
ref|XP_002090414.1|  GE12817                                            146   1e-37   
dbj|BAJ90795.1|  predicted protein                                      146   2e-37   
ref|XP_004932411.1|  PREDICTED: protein disulfide-isomerase A6-like     145   2e-37   
ref|XP_002052260.1|  GJ17455                                            145   2e-37   
ref|XP_002038169.1|  GM17901                                            145   3e-37   
ref|XP_008543798.1|  PREDICTED: protein disulfide-isomerase A6          145   3e-37   
ref|XP_001434887.1|  hypothetical protein                               144   4e-37   
ref|XP_011505126.1|  PREDICTED: probable protein disulfide-isomer...    145   5e-37   
ref|XP_001449606.1|  hypothetical protein                               144   5e-37   
ref|XP_008907519.1|  protein disulfide-isomerase domain                 144   7e-37   
ref|XP_008883930.1|  protein disulfide isomerase-related protein ...    144   8e-37   
ref|XP_002367261.1|  thioredoxin, putative                              144   9e-37   
ref|XP_008609528.1|  hypothetical protein SDRG_05583                    144   1e-36   
ref|XP_001452252.1|  hypothetical protein                               143   1e-36   
ref|XP_002953269.1|  hypothetical protein VOLCADRAFT_105867             144   1e-36   
ref|XP_001423649.1|  hypothetical protein                               143   1e-36   
ref|XP_008487078.1|  PREDICTED: protein disulfide-isomerase A6-like     143   2e-36   
gb|ETL37147.1|  protein disulfide-isomerase domain                      142   3e-36   
ref|XP_003138581.1|  TAG-320 protein                                    142   4e-36   
ref|XP_002906746.1|  disulfide-isomerase, putative                      142   4e-36   
ref|XP_002051733.1|  GJ10673                                            142   4e-36   
gb|EPR63450.1|  putative protein disulfide isomerase-related prot...    143   4e-36   
gb|EPT25079.1|  protein disulfide isomerase-related protein (prov...    143   4e-36   
ref|XP_004037455.1|  protein disulfide isomerase family protein, ...    142   4e-36   
ref|XP_668568.1|  protein disulfide isomerase-related protein (pr...    142   5e-36   
ref|XP_004027248.1|  protein disulfide isomerase family protein, ...    140   6e-36   
gb|ADD24382.1|  Probable protein disulfide-isomerase A6                 141   9e-36   
ref|XP_006140909.1|  PREDICTED: protein disulfide-isomerase A6          142   1e-35   
ref|XP_002066865.1|  GK24326                                            140   1e-35   
ref|XP_001010336.1|  protein disulfide-isomerase domain containin...    140   2e-35   
ref|XP_003388369.1|  PREDICTED: probable protein disulfide-isomer...    140   3e-35   
ref|XP_009857523.1|  PREDICTED: protein disulfide-isomerase A6-like     139   4e-35   
emb|CDJ56301.1|  thioredoxin, putative                                  139   7e-35   
gb|ENN76828.1|  hypothetical protein YQE_06669                          139   7e-35   
gb|ERL94682.1|  hypothetical protein D910_11957                         139   8e-35   
ref|XP_628564.1|  protein disulfide isomerase, signal peptide, ER...    138   1e-34   
ref|XP_001996440.1|  GH25032                                            137   2e-34   
ref|XP_001965403.1|  GF20619                                            136   6e-34   
emb|CDI74584.1|  thioredoxin, putative                                  139   6e-34   
ref|XP_009177268.1|  hypothetical protein T265_12068                    136   7e-34   
emb|CEF61969.1|  Protein disulfide-isomerase A6                         135   9e-34   
gb|KIZ01312.1|  protein disulfide isomerase family A, member 6          137   1e-33   
ref|XP_003886147.1|  hypothetical protein NCLIV_065470                  135   2e-33   
gb|ETN58364.1|  protein disulfide-isomerase A6 precursor                134   4e-33   
ref|XP_004211312.1|  PREDICTED: protein disulfide-isomerase A6-like     132   1e-32   
emb|CCI48931.1|  unnamed protein product                                133   1e-32   
ref|XP_006626132.1|  PREDICTED: protein disulfide-isomerase A6-like     131   1e-32   
ref|XP_001660597.1|  AAEL010065-PA                                      132   2e-32   
ref|XP_790496.3|  PREDICTED: protein disulfide-isomerase A6-like        132   2e-32   
ref|XP_009515824.1|  hypothetical protein PHYSODRAFT_552293             132   2e-32   
ref|XP_001690462.1|  protein disulfide isomerase                        132   2e-32   
emb|CCA14124.1|  disulfideisomerase putative                            131   4e-32   
gb|KFB40746.1|  hypothetical protein ZHAS_00008173                      131   5e-32   
ref|XP_004994815.1|  Pdip5 protein                                      130   6e-32   
ref|XP_002141094.1|  protein disulfide-isomerase domain-containin...    128   5e-31   
emb|CDJ42845.1|  thioredoxin, putative                                  127   5e-31   
ref|XP_002788073.1|  thioredoxin, putative                              127   7e-31   
ref|XP_002001878.1|  GI17079                                            127   9e-31   
ref|XP_002769595.1|  protein disulfide-isomerase A6 precursor, pu...    127   1e-30   
ref|XP_002428877.1|  protein disulfide isomerase, putative              127   1e-30   
gb|ETE67495.1|  Protein disulfide-isomerase A6                          127   1e-30   
ref|XP_321144.3|  AGAP001919-PA                                         127   2e-30   
ref|XP_011294207.1|  PREDICTED: probable protein disulfide-isomer...    125   4e-30   
ref|XP_005645986.1|  protein disulfide isomerase                        124   7e-30   
emb|CDJ49284.1|  thioredoxin, putative                                  123   8e-30   
ref|XP_011119472.1|  hypothetical protein AOL_s00043g684                124   1e-29   
gb|EPE05781.1|  protein disulfide-isomerase erp38                       122   4e-29   
gb|EPY75602.1|  protein disulfide-isomerase A6                          123   5e-29   
gb|KDO29489.1|  hypothetical protein SPRG_06029                         122   9e-29   
gb|KIH58391.1|  protein disulfide-isomerase domain protein              116   9e-29   
pdb|3W8J|A  Chain A, Crystal Structure Of P5 A0 In A Complex With...    115   3e-28   



>gb|KJB42837.1| hypothetical protein B456_007G169700 [Gossypium raimondii]
Length=336

 Score =   278 bits (712),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 141/170 (83%), Positives = 157/170 (92%), Gaps = 0/170 (0%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            NALYGPS+PV+QL PSNFKSKVLNSNGVVLVEFFAPWCGHC+ALTPT+EK A+VLKGVAT
Sbjct  23   NALYGPSSPVVQLTPSNFKSKVLNSNGVVLVEFFAPWCGHCQALTPTWEKAANVLKGVAT  82

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDR  511
            VAALDADAH SLAQEYGI+GFPTIKVF PGK PVDYQGAR+ K + +F   Q++ LLKDR
Sbjct  83   VAALDADAHKSLAQEYGIRGFPTIKVFAPGKPPVDYQGARDVKPIAEFALKQVKALLKDR  142

Query  512  LDGKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            L GKA+GGSS+KSEPSASVELNSRNFD+LV+KSK+LWIVEFFAPWCGHCK
Sbjct  143  LAGKASGGSSEKSEPSASVELNSRNFDELVLKSKELWIVEFFAPWCGHCK  192


 Score = 83.2 bits (204),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 49/111 (44%), Positives = 66/111 (59%), Gaps = 2/111 (2%)
 Frame = +2

Query  167  PSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaald  346
            PS  V +LN  NF   VL S  + +VEFFAPWCGHCK L P +++ A+ LKG   +  +D
Sbjct  157  PSASV-ELNSRNFDELVLKSKELWIVEFFAPWCGHCKRLAPEWKRAANNLKGKVKLGHVD  215

Query  347  adahsslaQEYGIKGFPTIKVFVPGKQ-PVDYQGAREAKSMVDFVKAQIRN  496
             D+  SL   + ++GFPTI VF   K  PV Y+GAR A ++  F   Q+  
Sbjct  216  CDSEKSLMSRFNVQGFPTILVFGADKDSPVPYEGARTASAIESFALEQLET  266



>ref|XP_009804684.1| PREDICTED: protein disulfide isomerase-like 2-3 [Nicotiana sylvestris]
Length=432

 Score =   281 bits (718),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 142/170 (84%), Positives = 155/170 (91%), Gaps = 0/170 (0%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            NALYGPS+PVLQL PSNFKSKVLNSNG+VLVEFFAPWCGHCKALTP +EK A++LKGVAT
Sbjct  21   NALYGPSSPVLQLTPSNFKSKVLNSNGIVLVEFFAPWCGHCKALTPHWEKAATILKGVAT  80

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDR  511
            VAALDADAH SLAQEYGI+GFPTIKVF PGK PVDYQGAREAK + +F   QI+ LLKDR
Sbjct  81   VAALDADAHQSLAQEYGIRGFPTIKVFAPGKPPVDYQGAREAKPIAEFALQQIKALLKDR  140

Query  512  LDGKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            + GKATGGSSQ SEPSAS+ELNSRNFD+ V+KSKDLWIVEFFAPWCGHCK
Sbjct  141  VHGKATGGSSQNSEPSASIELNSRNFDEKVLKSKDLWIVEFFAPWCGHCK  190


 Score = 86.7 bits (213),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 49/106 (46%), Positives = 65/106 (61%), Gaps = 1/106 (1%)
 Frame = +2

Query  182  LQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaaldadahs  361
            ++LN  NF  KVL S  + +VEFFAPWCGHCK L P ++K A  L+G   +  +D DA  
Sbjct  159  IELNSRNFDEKVLKSKDLWIVEFFAPWCGHCKKLAPEWKKAAKNLEGKVKLGHVDCDAEK  218

Query  362  slaQEYGIKGFPTIKVFVPGKQ-PVDYQGAREAKSMVDFVKAQIRN  496
            SL   Y ++GFPTI VF   K+ PV Y+GAR A ++  F   Q+  
Sbjct  219  SLMSRYNVQGFPTILVFGADKESPVPYEGARTAAAIESFGLEQLET  264



>ref|XP_011085485.1| PREDICTED: protein disulfide isomerase-like 2-3 [Sesamum indicum]
Length=432

 Score =   279 bits (714),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 141/169 (83%), Positives = 157/169 (93%), Gaps = 0/169 (0%)
 Frame = +2

Query  155  ALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATV  334
            ALYGPS+PVLQLNP+NFKSKVLNSNGVVLVEFFAPWCGHC+ALTP +EK A+VLKGVATV
Sbjct  22   ALYGPSSPVLQLNPNNFKSKVLNSNGVVLVEFFAPWCGHCQALTPAWEKAANVLKGVATV  81

Query  335  aaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDRL  514
            AALDADAH SLAQEYGI+GFPTIKVF PGK PVDYQGAR+ K +V+F   Q++ LLK+RL
Sbjct  82   AALDADAHQSLAQEYGIRGFPTIKVFAPGKPPVDYQGARDVKPIVEFALQQVKALLKERL  141

Query  515  DGKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            DGK+ GGSSQKSEPSASVELNSRNFD+LV+KSK+LWIVEFFAPWCGHCK
Sbjct  142  DGKSAGGSSQKSEPSASVELNSRNFDELVLKSKELWIVEFFAPWCGHCK  190


 Score = 82.8 bits (203),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 50/111 (45%), Positives = 65/111 (59%), Gaps = 2/111 (2%)
 Frame = +2

Query  167  PSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaald  346
            PS  V +LN  NF   VL S  + +VEFFAPWCGHCK L P ++K A+ LKG   +  +D
Sbjct  155  PSASV-ELNSRNFDELVLKSKELWIVEFFAPWCGHCKKLAPEWKKAANNLKGQVKLGHVD  213

Query  347  adahsslaQEYGIKGFPTIKVFVPGKQ-PVDYQGAREAKSMVDFVKAQIRN  496
             DA  SL   + ++GFPTI VF   K  P  Y+GAR A ++  F   Q+  
Sbjct  214  CDAEKSLMSRFNVQGFPTILVFGADKDSPFPYEGARSASAIESFALEQLET  264



>gb|KJB42838.1| hypothetical protein B456_007G169700 [Gossypium raimondii]
Length=434

 Score =   279 bits (713),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 141/170 (83%), Positives = 157/170 (92%), Gaps = 0/170 (0%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            NALYGPS+PV+QL PSNFKSKVLNSNGVVLVEFFAPWCGHC+ALTPT+EK A+VLKGVAT
Sbjct  23   NALYGPSSPVVQLTPSNFKSKVLNSNGVVLVEFFAPWCGHCQALTPTWEKAANVLKGVAT  82

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDR  511
            VAALDADAH SLAQEYGI+GFPTIKVF PGK PVDYQGAR+ K + +F   Q++ LLKDR
Sbjct  83   VAALDADAHKSLAQEYGIRGFPTIKVFAPGKPPVDYQGARDVKPIAEFALKQVKALLKDR  142

Query  512  LDGKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            L GKA+GGSS+KSEPSASVELNSRNFD+LV+KSK+LWIVEFFAPWCGHCK
Sbjct  143  LAGKASGGSSEKSEPSASVELNSRNFDELVLKSKELWIVEFFAPWCGHCK  192


 Score = 83.2 bits (204),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 49/111 (44%), Positives = 66/111 (59%), Gaps = 2/111 (2%)
 Frame = +2

Query  167  PSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaald  346
            PS  V +LN  NF   VL S  + +VEFFAPWCGHCK L P +++ A+ LKG   +  +D
Sbjct  157  PSASV-ELNSRNFDELVLKSKELWIVEFFAPWCGHCKRLAPEWKRAANNLKGKVKLGHVD  215

Query  347  adahsslaQEYGIKGFPTIKVFVPGKQ-PVDYQGAREAKSMVDFVKAQIRN  496
             D+  SL   + ++GFPTI VF   K  PV Y+GAR A ++  F   Q+  
Sbjct  216  CDSEKSLMSRFNVQGFPTILVFGADKDSPVPYEGARTASAIESFALEQLET  266



>ref|XP_011003479.1| PREDICTED: protein disulfide isomerase-like 2-3 [Populus euphratica]
Length=434

 Score =   277 bits (709),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 141/169 (83%), Positives = 156/169 (92%), Gaps = 0/169 (0%)
 Frame = +2

Query  155  ALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATV  334
            ALYGPS+PVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPT+EK A+VLKGVATV
Sbjct  24   ALYGPSSPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTWEKAAAVLKGVATV  83

Query  335  aaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDRL  514
            AALDADAH SLAQEYGI+GFPTIKVFVPG  P+DYQGAR+ K + +F   QI+ LLKDRL
Sbjct  84   AALDADAHQSLAQEYGIRGFPTIKVFVPGNPPIDYQGARDVKPIAEFALKQIKALLKDRL  143

Query  515  DGKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            +GK+TGGSS+KSE S SVELNSRNFD+LV+KSK+LWIVEFFAPWCGHCK
Sbjct  144  NGKSTGGSSEKSETSLSVELNSRNFDELVLKSKELWIVEFFAPWCGHCK  192


 Score = 82.8 bits (203),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 45/106 (42%), Positives = 65/106 (61%), Gaps = 1/106 (1%)
 Frame = +2

Query  182  LQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaaldadahs  361
            ++LN  NF   VL S  + +VEFFAPWCGHCK L P ++K A+ L+G   +  +D D+  
Sbjct  161  VELNSRNFDELVLKSKELWIVEFFAPWCGHCKKLAPEWKKAANNLQGKVKLGHVDCDSEK  220

Query  362  slaQEYGIKGFPTIKVFVPGKQ-PVDYQGAREAKSMVDFVKAQIRN  496
            SL   + ++GFPTI VF   K  P+ Y+GAR A ++  F   Q+ +
Sbjct  221  SLMSRFNVQGFPTILVFGADKDTPIPYEGARTASAIESFALEQLES  266



>ref|XP_011016519.1| PREDICTED: protein disulfide isomerase-like 2-3 [Populus euphratica]
Length=434

 Score =   277 bits (709),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 141/169 (83%), Positives = 156/169 (92%), Gaps = 0/169 (0%)
 Frame = +2

Query  155  ALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATV  334
            ALYGPS+PVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPT+EK A+VLKGVATV
Sbjct  24   ALYGPSSPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTWEKAAAVLKGVATV  83

Query  335  aaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDRL  514
            AALDADAH SLAQEYGI+GFPTIKVFVPG  P+DYQGAR+ K + +F   QI+ LLKDRL
Sbjct  84   AALDADAHQSLAQEYGIRGFPTIKVFVPGNPPIDYQGARDVKPIAEFALKQIKALLKDRL  143

Query  515  DGKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            +GK+TGGSS+KSE S SVELNSRNFD+LV+KSK+LWIVEFFAPWCGHCK
Sbjct  144  NGKSTGGSSEKSETSLSVELNSRNFDELVLKSKELWIVEFFAPWCGHCK  192


 Score = 82.4 bits (202),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 45/104 (43%), Positives = 64/104 (62%), Gaps = 1/104 (1%)
 Frame = +2

Query  182  LQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaaldadahs  361
            ++LN  NF   VL S  + +VEFFAPWCGHCK L P ++K A+ L+G   +  +D D+  
Sbjct  161  VELNSRNFDELVLKSKELWIVEFFAPWCGHCKKLAPEWKKAANNLQGKVKLGHVDCDSEK  220

Query  362  slaQEYGIKGFPTIKVFVPGKQ-PVDYQGAREAKSMVDFVKAQI  490
            SL   + ++GFPTI VF   K  P+ Y+GAR A ++  F   Q+
Sbjct  221  SLMSRFNVQGFPTILVFGADKDTPIPYEGARTASAIESFALEQL  264



>ref|XP_011100470.1| PREDICTED: protein disulfide isomerase-like 2-3 [Sesamum indicum]
Length=438

 Score =   277 bits (708),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 139/169 (82%), Positives = 157/169 (93%), Gaps = 0/169 (0%)
 Frame = +2

Query  155  ALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATV  334
            ALYGPS+PV+QLNP+NFKSKVLNSNGVVLVEFFAPWCGHC+ALTPT+EKVA+VLKGVATV
Sbjct  28   ALYGPSSPVVQLNPNNFKSKVLNSNGVVLVEFFAPWCGHCQALTPTWEKVANVLKGVATV  87

Query  335  aaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDRL  514
            AALDADAH SLAQEYGI+GFPTIKVF PGK P+DYQGAR+ K + DF   QI+ LLK+RL
Sbjct  88   AALDADAHKSLAQEYGIRGFPTIKVFAPGKTPLDYQGARDVKPIADFAYQQIKALLKERL  147

Query  515  DGKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            +GK+  GSSQKSEPSAS+ELNSRNFD+LV+KSK+LWIVEFFAPWCGHCK
Sbjct  148  NGKSAEGSSQKSEPSASIELNSRNFDELVIKSKELWIVEFFAPWCGHCK  196


 Score = 83.2 bits (204),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 46/105 (44%), Positives = 64/105 (61%), Gaps = 1/105 (1%)
 Frame = +2

Query  182  LQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaaldadahs  361
            ++LN  NF   V+ S  + +VEFFAPWCGHCK L P ++K A+ LKG   +  +D DA  
Sbjct  165  IELNSRNFDELVIKSKELWIVEFFAPWCGHCKKLAPEWKKAANNLKGQVKLGHVDCDAEK  224

Query  362  slaQEYGIKGFPTIKVFVPGKQ-PVDYQGAREAKSMVDFVKAQIR  493
            SL   + ++GFPTI VF   K+ P  Y+GAR A ++  F   Q+ 
Sbjct  225  SLMSRFNVQGFPTILVFGANKESPFPYEGARSASAIESFALEQLE  269



>ref|XP_002320494.2| thioredoxin family protein [Populus trichocarpa]
 gb|EEE98809.2| thioredoxin family protein [Populus trichocarpa]
Length=434

 Score =   277 bits (708),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 141/169 (83%), Positives = 156/169 (92%), Gaps = 0/169 (0%)
 Frame = +2

Query  155  ALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATV  334
            ALYGPS+PVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPT+EK A+VLKGVATV
Sbjct  24   ALYGPSSPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTWEKAAAVLKGVATV  83

Query  335  aaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDRL  514
            AALDADAH SLAQEYGI+GFPTIKVFVPG  PVDYQGAR+ K + ++   QI+ LLKDRL
Sbjct  84   AALDADAHQSLAQEYGIRGFPTIKVFVPGNPPVDYQGARDVKPIAEYALKQIKALLKDRL  143

Query  515  DGKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            +GK+TGGSS+KSE S SVELNSRNFD+LV+KSK+LWIVEFFAPWCGHCK
Sbjct  144  NGKSTGGSSEKSETSLSVELNSRNFDELVLKSKELWIVEFFAPWCGHCK  192


 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 45/106 (42%), Positives = 64/106 (60%), Gaps = 1/106 (1%)
 Frame = +2

Query  182  LQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaaldadahs  361
            ++LN  NF   VL S  + +VEFFAPWCGHCK L P + K A+ L+G   +  +D D+  
Sbjct  161  VELNSRNFDELVLKSKELWIVEFFAPWCGHCKKLAPEWTKAANNLQGKVKLGHVDCDSEK  220

Query  362  slaQEYGIKGFPTIKVFVPGKQ-PVDYQGAREAKSMVDFVKAQIRN  496
            SL   + ++GFPTI VF   K  P+ Y+GAR A ++  F   Q+ +
Sbjct  221  SLMSRFNVQGFPTILVFGADKDTPIPYEGARTASAIESFALEQLES  266



>ref|XP_010556968.1| PREDICTED: protein disulfide-isomerase like 2-2-like [Tarenaya 
hassleriana]
Length=441

 Score =   277 bits (708),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 141/172 (82%), Positives = 157/172 (91%), Gaps = 2/172 (1%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            NALYGPS+PVLQL P+NFKSKVLNSNGVVLVEFFAPWCGHC+ALTPT+EKVA++LKGVAT
Sbjct  24   NALYGPSSPVLQLTPTNFKSKVLNSNGVVLVEFFAPWCGHCQALTPTWEKVANILKGVAT  83

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDR  511
            VAA+DADAH S+AQEYGI+GFPTIKVFVPGK PVDYQGAREAK + +F   QI+ LLKDR
Sbjct  84   VAAIDADAHKSVAQEYGIRGFPTIKVFVPGKAPVDYQGAREAKPIAEFALQQIKALLKDR  143

Query  512  LDGKATGG--SSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            L GKATGG  S +KSEP+ASVELNS NFD+ V+KSKDLWIVEFFAPWCGHCK
Sbjct  144  LHGKATGGGSSEKKSEPNASVELNSSNFDESVIKSKDLWIVEFFAPWCGHCK  195


 Score = 83.6 bits (205),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 45/100 (45%), Positives = 62/100 (62%), Gaps = 1/100 (1%)
 Frame = +2

Query  182  LQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaaldadahs  361
            ++LN SNF   V+ S  + +VEFFAPWCGHCK L P ++K A  LKG   +  ++ DA  
Sbjct  164  VELNSSNFDESVIKSKDLWIVEFFAPWCGHCKKLAPEWKKAAKNLKGKVNLGHVNCDAEQ  223

Query  362  slaQEYGIKGFPTIKVFVPGKQ-PVDYQGAREAKSMVDFV  478
            SL   + ++GFPTI VF   K  P+ Y+GAR A ++  F 
Sbjct  224  SLMSRFKVQGFPTILVFGSDKNSPIPYEGARSASAIESFA  263



>ref|XP_010035498.1| PREDICTED: protein disulfide isomerase-like 2-3 [Eucalyptus grandis]
 gb|KCW46917.1| hypothetical protein EUGRSUZ_K00732 [Eucalyptus grandis]
Length=436

 Score =   275 bits (703),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 137/170 (81%), Positives = 156/170 (92%), Gaps = 0/170 (0%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            +ALYGPS+PV+QL PSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPT+EK A+VLKGVAT
Sbjct  25   DALYGPSSPVVQLTPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTWEKAATVLKGVAT  84

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDR  511
            VAALDADAH SLAQEYGI+GFPTIKVFVPG+ P+DYQGARE K + +F   Q++ LLKDR
Sbjct  85   VAALDADAHQSLAQEYGIRGFPTIKVFVPGQPPIDYQGAREVKPIAEFALKQVKALLKDR  144

Query  512  LDGKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            L+GK+TGGSS+KSEPSAS EL S NFD+LV+KSK+LW+VEFFAPWCGHCK
Sbjct  145  LNGKSTGGSSEKSEPSASAELTSSNFDELVLKSKELWVVEFFAPWCGHCK  194


 Score = 82.0 bits (201),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 47/105 (45%), Positives = 62/105 (59%), Gaps = 1/105 (1%)
 Frame = +2

Query  185  QLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaaldadahss  364
            +L  SNF   VL S  + +VEFFAPWCGHCK L P ++K A  LKG   +  +D DA  S
Sbjct  164  ELTSSNFDELVLKSKELWVVEFFAPWCGHCKKLAPEWKKAAKNLKGKVKLGHVDCDAEKS  223

Query  365  laQEYGIKGFPTIKVFVPGKQ-PVDYQGAREAKSMVDFVKAQIRN  496
            L   Y ++GFPTI VF   K  P+ ++GAR A ++  F   Q+  
Sbjct  224  LMSRYNVQGFPTILVFGADKDSPIPFEGARTASAIESFALEQLET  268



>gb|KJB10303.1| hypothetical protein B456_001G195100 [Gossypium raimondii]
Length=279

 Score =   268 bits (686),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 136/170 (80%), Positives = 153/170 (90%), Gaps = 0/170 (0%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            NA YGPS+PVLQL PSNFKSKVLNSNGVVLVEFFAPWCGHC+ALTPT+EK A+VL GVAT
Sbjct  23   NAFYGPSSPVLQLTPSNFKSKVLNSNGVVLVEFFAPWCGHCQALTPTWEKAANVLNGVAT  82

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDR  511
            VAALDADAH SLA+EYGI+GFPTIKVF PGK PVDYQGAR+ K + +F   Q++ LLKDR
Sbjct  83   VAALDADAHQSLAEEYGIRGFPTIKVFAPGKPPVDYQGARDVKPIAEFALQQVKALLKDR  142

Query  512  LDGKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            L GKA+GGSS+K +PSASVELNSRNFD+LV+KSK+LWIVEFFAPWCG CK
Sbjct  143  LAGKASGGSSEKYQPSASVELNSRNFDELVLKSKELWIVEFFAPWCGRCK  192


 Score = 82.4 bits (202),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 50/113 (44%), Positives = 65/113 (58%), Gaps = 2/113 (2%)
 Frame = +2

Query  161  YGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaa  340
            Y PS  V +LN  NF   VL S  + +VEFFAPWCG CK L P ++K A+ LKG   +  
Sbjct  155  YQPSASV-ELNSRNFDELVLKSKELWIVEFFAPWCGRCKKLAPEWKKAANNLKGKVKLGH  213

Query  341  ldadahsslaQEYGIKGFPTIKVFVPGKQ-PVDYQGAREAKSMVDFVKAQIRN  496
            +D D+  SL   Y ++GFPTI  F   K  P+ Y+GAR A S+  F   Q+  
Sbjct  214  VDCDSEKSLMSRYKVQGFPTILAFGADKDGPIPYEGARNASSIESFALEQLET  266



>gb|KJB10302.1| hypothetical protein B456_001G195100 [Gossypium raimondii]
 gb|KJB10304.1| hypothetical protein B456_001G195100 [Gossypium raimondii]
Length=287

 Score =   268 bits (686),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 136/170 (80%), Positives = 153/170 (90%), Gaps = 0/170 (0%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            NA YGPS+PVLQL PSNFKSKVLNSNGVVLVEFFAPWCGHC+ALTPT+EK A+VL GVAT
Sbjct  23   NAFYGPSSPVLQLTPSNFKSKVLNSNGVVLVEFFAPWCGHCQALTPTWEKAANVLNGVAT  82

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDR  511
            VAALDADAH SLA+EYGI+GFPTIKVF PGK PVDYQGAR+ K + +F   Q++ LLKDR
Sbjct  83   VAALDADAHQSLAEEYGIRGFPTIKVFAPGKPPVDYQGARDVKPIAEFALQQVKALLKDR  142

Query  512  LDGKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            L GKA+GGSS+K +PSASVELNSRNFD+LV+KSK+LWIVEFFAPWCG CK
Sbjct  143  LAGKASGGSSEKYQPSASVELNSRNFDELVLKSKELWIVEFFAPWCGRCK  192


 Score = 82.4 bits (202),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 50/113 (44%), Positives = 65/113 (58%), Gaps = 2/113 (2%)
 Frame = +2

Query  161  YGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaa  340
            Y PS  V +LN  NF   VL S  + +VEFFAPWCG CK L P ++K A+ LKG   +  
Sbjct  155  YQPSASV-ELNSRNFDELVLKSKELWIVEFFAPWCGRCKKLAPEWKKAANNLKGKVKLGH  213

Query  341  ldadahsslaQEYGIKGFPTIKVFVPGKQ-PVDYQGAREAKSMVDFVKAQIRN  496
            +D D+  SL   Y ++GFPTI  F   K  P+ Y+GAR A S+  F   Q+  
Sbjct  214  VDCDSEKSLMSRYKVQGFPTILAFGADKDGPIPYEGARNASSIESFALEQLET  266



>ref|XP_010522374.1| PREDICTED: protein disulfide-isomerase 2-3-like [Tarenaya hassleriana]
Length=430

 Score =   273 bits (698),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 138/172 (80%), Positives = 157/172 (91%), Gaps = 2/172 (1%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            +ALYGPS+PV+QL PSNFKSKV+NSNGVVLVEFFAPWCGHC+ALTPT+EKVA++LKGVAT
Sbjct  24   SALYGPSSPVVQLTPSNFKSKVVNSNGVVLVEFFAPWCGHCQALTPTWEKVANILKGVAT  83

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDR  511
            VAA+DADAH S+AQEYGIKGFPTIKVFVPGK P+DYQGAR+AK + +F   QI+ LLKDR
Sbjct  84   VAAIDADAHKSIAQEYGIKGFPTIKVFVPGKAPIDYQGARDAKPIAEFALQQIKALLKDR  143

Query  512  LDGKATGG--SSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            L GKA GG  S +KSEPSASVELNS NFD+LV+KSK+LWIVEFFAPWCGHCK
Sbjct  144  LHGKANGGGSSEKKSEPSASVELNSSNFDELVIKSKELWIVEFFAPWCGHCK  195


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 47/104 (45%), Positives = 63/104 (61%), Gaps = 2/104 (2%)
 Frame = +2

Query  167  PSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaald  346
            PS  V +LN SNF   V+ S  + +VEFFAPWCGHCK L P ++K A  LKG   +  ++
Sbjct  160  PSASV-ELNSSNFDELVIKSKELWIVEFFAPWCGHCKKLAPEWKKAAKNLKGKVNLGHVN  218

Query  347  adahsslaQEYGIKGFPTIKVFVPGKQP-VDYQGAREAKSMVDF  475
             DA  SL   + ++GFPTI VF   K   + Y+GAR A ++  F
Sbjct  219  CDADQSLMSRFKVQGFPTILVFGADKSSHILYEGARTASAIESF  262



>ref|XP_010110229.1| Protein disulfide-isomerase like 2-2 [Morus notabilis]
 gb|EXC25526.1| Protein disulfide-isomerase like 2-2 [Morus notabilis]
Length=439

 Score =   272 bits (695),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 139/170 (82%), Positives = 153/170 (90%), Gaps = 0/170 (0%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            +ALYGPS+PV+QL PSNF SKVLNSN VVLVEFFAPWCGHCKALTP +EK A+VLKGVAT
Sbjct  25   HALYGPSSPVVQLTPSNFNSKVLNSNRVVLVEFFAPWCGHCKALTPVWEKAATVLKGVAT  84

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDR  511
            VAALDAD H SLAQEYGI+GFPTIKVFVPGK PVDYQGAR+ K +V+F   QI+ LLK+R
Sbjct  85   VAALDADEHKSLAQEYGIQGFPTIKVFVPGKPPVDYQGARDVKPIVEFALKQIKALLKER  144

Query  512  LDGKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            LDGKAT GS+ KSEPSASVELNS NFD+LV+KSKDLWIVEFFAPWCGHCK
Sbjct  145  LDGKATSGSNGKSEPSASVELNSHNFDELVIKSKDLWIVEFFAPWCGHCK  194


 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 49/111 (44%), Positives = 65/111 (59%), Gaps = 2/111 (2%)
 Frame = +2

Query  167  PSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaald  346
            PS  V +LN  NF   V+ S  + +VEFFAPWCGHCK L P ++KVA+ LKG   +  +D
Sbjct  159  PSASV-ELNSHNFDELVIKSKDLWIVEFFAPWCGHCKKLAPEWKKVANNLKGKVKLGHVD  217

Query  347  adahsslaQEYGIKGFPTIKVFVPGKQ-PVDYQGAREAKSMVDFVKAQIRN  496
             DA  SL   + ++GFPTI VF   K  P  Y+G R A ++  F   Q+  
Sbjct  218  CDAEKSLMSRFNVQGFPTILVFGADKDSPTPYEGGRTASAIESFALEQLET  268



>ref|XP_004304072.1| PREDICTED: protein disulfide isomerase-like 2-3 [Fragaria vesca 
subsp. vesca]
Length=437

 Score =   271 bits (693),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 138/170 (81%), Positives = 157/170 (92%), Gaps = 0/170 (0%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            +ALYGPS+PVLQL PSNFKSKVL+SN VVLVEFFAPWCGHC+ALTP +EKVA+VLKGVAT
Sbjct  25   DALYGPSSPVLQLTPSNFKSKVLDSNRVVLVEFFAPWCGHCRALTPIWEKVATVLKGVAT  84

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDR  511
            VAALDADAH SLAQ+YGI+GFPTIKVFVPGK PVDYQGAR+ K + +F  +QI+ LLKDR
Sbjct  85   VAALDADAHKSLAQDYGIQGFPTIKVFVPGKPPVDYQGARDVKPIAEFALSQIKALLKDR  144

Query  512  LDGKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            L GK+TGGSS+K EP+ASVELNS+NFD+LVVKSK+LWIVEFFAPWCGHCK
Sbjct  145  LSGKSTGGSSEKPEPNASVELNSKNFDELVVKSKELWIVEFFAPWCGHCK  194


 Score = 80.9 bits (198),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 46/99 (46%), Positives = 61/99 (62%), Gaps = 1/99 (1%)
 Frame = +2

Query  182  LQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaaldadahs  361
            ++LN  NF   V+ S  + +VEFFAPWCGHCK L P ++K A  LKG   +  +D DA  
Sbjct  163  VELNSKNFDELVVKSKELWIVEFFAPWCGHCKKLAPEWKKAAKNLKGKVKLGHVDCDAEQ  222

Query  362  slaQEYGIKGFPTIKVFVPGKQ-PVDYQGAREAKSMVDF  475
            SL   + ++GFPTI VF   K  PV Y+GAR A ++  F
Sbjct  223  SLMSRFNVQGFPTILVFGADKDSPVPYEGARTASAIESF  261



>ref|XP_004143192.1| PREDICTED: protein disulfide-isomerase like 2-2-like [Cucumis 
sativus]
 gb|KGN47008.1| hypothetical protein Csa_6G168250 [Cucumis sativus]
Length=438

 Score =   271 bits (693),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 138/171 (81%), Positives = 155/171 (91%), Gaps = 1/171 (1%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            NALYGPS+PVLQL PSNFKSKVLNSNG+VLVEFFAPWCGHC+ALTP +EK A+VLKGVAT
Sbjct  24   NALYGPSSPVLQLTPSNFKSKVLNSNGIVLVEFFAPWCGHCQALTPVWEKAATVLKGVAT  83

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDR  511
            VAALDADAH SLAQEYGIKGFPTIKVF PGK PVDYQGAR+ K + +F   Q++ LLK+R
Sbjct  84   VAALDADAHKSLAQEYGIKGFPTIKVFAPGKPPVDYQGARDVKPIAEFALQQVKALLKER  143

Query  512  LDGKAT-GGSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            L+GK T GGS++KSEP+AS ELNSRNFD+LV+KSKDLWIVEFFAPWCGHCK
Sbjct  144  LNGKTTGGGSNEKSEPNASEELNSRNFDELVIKSKDLWIVEFFAPWCGHCK  194


 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 46/105 (44%), Positives = 61/105 (58%), Gaps = 1/105 (1%)
 Frame = +2

Query  185  QLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaaldadahss  364
            +LN  NF   V+ S  + +VEFFAPWCGHCK L P ++K A  LKG   +  +D DA  S
Sbjct  164  ELNSRNFDELVIKSKDLWIVEFFAPWCGHCKRLAPEWKKAAKNLKGKVKLGHVDCDAEKS  223

Query  365  laQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRN  496
            L   + ++GFPTI VF   K  P+ Y+GAR A  +  F   Q+  
Sbjct  224  LMSRFNVQGFPTILVFGADKYSPITYEGARTASGIESFALDQLET  268



>gb|KJB10305.1| hypothetical protein B456_001G195100 [Gossypium raimondii]
Length=336

 Score =   268 bits (684),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 136/170 (80%), Positives = 153/170 (90%), Gaps = 0/170 (0%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            NA YGPS+PVLQL PSNFKSKVLNSNGVVLVEFFAPWCGHC+ALTPT+EK A+VL GVAT
Sbjct  23   NAFYGPSSPVLQLTPSNFKSKVLNSNGVVLVEFFAPWCGHCQALTPTWEKAANVLNGVAT  82

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDR  511
            VAALDADAH SLA+EYGI+GFPTIKVF PGK PVDYQGAR+ K + +F   Q++ LLKDR
Sbjct  83   VAALDADAHQSLAEEYGIRGFPTIKVFAPGKPPVDYQGARDVKPIAEFALQQVKALLKDR  142

Query  512  LDGKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            L GKA+GGSS+K +PSASVELNSRNFD+LV+KSK+LWIVEFFAPWCG CK
Sbjct  143  LAGKASGGSSEKYQPSASVELNSRNFDELVLKSKELWIVEFFAPWCGRCK  192


 Score = 83.2 bits (204),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 50/113 (44%), Positives = 65/113 (58%), Gaps = 2/113 (2%)
 Frame = +2

Query  161  YGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaa  340
            Y PS  V +LN  NF   VL S  + +VEFFAPWCG CK L P ++K A+ LKG   +  
Sbjct  155  YQPSASV-ELNSRNFDELVLKSKELWIVEFFAPWCGRCKKLAPEWKKAANNLKGKVKLGH  213

Query  341  ldadahsslaQEYGIKGFPTIKVFVPGKQ-PVDYQGAREAKSMVDFVKAQIRN  496
            +D D+  SL   Y ++GFPTI  F   K  P+ Y+GAR A S+  F   Q+  
Sbjct  214  VDCDSEKSLMSRYKVQGFPTILAFGADKDGPIPYEGARNASSIESFALEQLET  266



>ref|XP_006829505.1| hypothetical protein AMTR_s00074p00124400 [Amborella trichopoda]
 gb|ERM96921.1| hypothetical protein AMTR_s00074p00124400 [Amborella trichopoda]
Length=429

 Score =   270 bits (691),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 137/170 (81%), Positives = 154/170 (91%), Gaps = 0/170 (0%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            +ALYGPS+ VL LNPSNFKSKVLNSNGVVLVEFFAPWCGHC+ALTPT+EKVA+VLKGVAT
Sbjct  18   DALYGPSSDVLILNPSNFKSKVLNSNGVVLVEFFAPWCGHCQALTPTWEKVATVLKGVAT  77

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDR  511
            VAALDADAH SLAQEYGI+GFPTIKVF PGK P DYQGARE K + ++   QI+ LL+DR
Sbjct  78   VAALDADAHKSLAQEYGIRGFPTIKVFSPGKSPADYQGAREVKPIAEYAVQQIKALLRDR  137

Query  512  LDGKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            L+GKA GGS+ KSE SASVELNSRNFD++V+KSKDLWIVEF+APWCGHCK
Sbjct  138  LNGKAAGGSNTKSETSASVELNSRNFDEMVLKSKDLWIVEFYAPWCGHCK  187


 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 45/106 (42%), Positives = 62/106 (58%), Gaps = 1/106 (1%)
 Frame = +2

Query  182  LQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaaldadahs  361
            ++LN  NF   VL S  + +VEF+APWCGHCK L P ++K A+ LKG   +  +D D   
Sbjct  156  VELNSRNFDEMVLKSKDLWIVEFYAPWCGHCKKLAPEWKKAANNLKGKLKLGHVDCDTEK  215

Query  362  slaQEYGIKGFPTIKVF-VPGKQPVDYQGAREAKSMVDFVKAQIRN  496
            SL   + ++GFPTI VF V    P  Y+GAR A ++  F   Q+  
Sbjct  216  SLMSRFNVQGFPTILVFGVDKDSPYPYEGARAASAIESFALEQLET  261



>ref|XP_009365136.1| PREDICTED: protein disulfide isomerase-like 2-3 [Pyrus x bretschneideri]
Length=435

 Score =   270 bits (691),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 138/170 (81%), Positives = 155/170 (91%), Gaps = 0/170 (0%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            +ALYGPS+PVLQL PSNFKSKVL+SN VVLVEFFAPWCGHC+ALTP +EK A+VLKGVAT
Sbjct  24   DALYGPSSPVLQLTPSNFKSKVLDSNRVVLVEFFAPWCGHCQALTPIWEKAATVLKGVAT  83

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDR  511
            VAALDADAH SLAQEYGI+GFPTIKVFVPGK PVDYQGAR+ K + +F   QI+ LLKDR
Sbjct  84   VAALDADAHKSLAQEYGIRGFPTIKVFVPGKPPVDYQGARDVKPVAEFALQQIKALLKDR  143

Query  512  LDGKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            L GK TGGSS+KSEPSASVELNS+NF++LV+KSK+LWIVEFFAPWCGHCK
Sbjct  144  LSGKTTGGSSEKSEPSASVELNSQNFNELVLKSKELWIVEFFAPWCGHCK  193


 Score = 82.8 bits (203),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 49/111 (44%), Positives = 67/111 (60%), Gaps = 2/111 (2%)
 Frame = +2

Query  167  PSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaald  346
            PS  V +LN  NF   VL S  + +VEFFAPWCGHCK L P ++K A  L+G   +  +D
Sbjct  158  PSASV-ELNSQNFNELVLKSKELWIVEFFAPWCGHCKKLAPEWKKAAKNLQGKVKLGHVD  216

Query  347  adahsslaQEYGIKGFPTIKVFVPGKQ-PVDYQGAREAKSMVDFVKAQIRN  496
             DA  SL  ++ ++GFPTI VF   K+ P+ Y+GAR A ++  F   Q+  
Sbjct  217  CDAEKSLMSKFNVQGFPTILVFGADKESPLPYEGARSASAIESFALEQLET  267



>ref|XP_008229815.1| PREDICTED: protein disulfide isomerase-like 2-3 [Prunus mume]
Length=459

 Score =   270 bits (691),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 139/170 (82%), Positives = 155/170 (91%), Gaps = 0/170 (0%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            +ALYGPS+PVLQL PSNFKSKVL+SN VVLVEFFAPWCGHC+ALTP +EK A+VLKGVAT
Sbjct  46   DALYGPSSPVLQLTPSNFKSKVLDSNRVVLVEFFAPWCGHCQALTPIWEKAATVLKGVAT  105

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDR  511
            VAALDADAH SLAQEYGI+GFPTIKVFVPGK PVDYQGAR+ K + +F   QI+ LLKDR
Sbjct  106  VAALDADAHKSLAQEYGIRGFPTIKVFVPGKPPVDYQGARDVKPIAEFALQQIKVLLKDR  165

Query  512  LDGKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            L GKATGG S+KSEP+ASVELNS+NFD+LVVKSK+LWIVEFFAPWCGHCK
Sbjct  166  LSGKATGGPSEKSEPNASVELNSQNFDELVVKSKELWIVEFFAPWCGHCK  215


 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 44/106 (42%), Positives = 63/106 (59%), Gaps = 1/106 (1%)
 Frame = +2

Query  182  LQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaaldadahs  361
            ++LN  NF   V+ S  + +VEFFAPWCGHCK L P ++K A  L+G   +  +D D   
Sbjct  184  VELNSQNFDELVVKSKELWIVEFFAPWCGHCKKLAPEWKKAAKNLQGKVKLGHVDCDVEK  243

Query  362  slaQEYGIKGFPTIKVFVPGKQ-PVDYQGAREAKSMVDFVKAQIRN  496
            SL   + ++GFPTI +F   K  P+ Y+GAR AK++  F   Q+  
Sbjct  244  SLMSRFNVQGFPTILIFGADKDTPLPYEGARTAKAIESFALEQLET  289



>ref|XP_004165750.1| PREDICTED: protein disulfide-isomerase like 2-2-like [Cucumis 
sativus]
Length=438

 Score =   270 bits (689),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 137/171 (80%), Positives = 154/171 (90%), Gaps = 1/171 (1%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            NALYGPS+PVLQL PSNFKSKVLNSNG+VLVEFFAPWCGHC+ALTP +EK A+VLKGV T
Sbjct  24   NALYGPSSPVLQLTPSNFKSKVLNSNGIVLVEFFAPWCGHCQALTPVWEKAATVLKGVTT  83

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDR  511
            VAALDADAH SLAQEYGIKGFPTIKVF PGK PVDYQGAR+ K + +F   Q++ LLK+R
Sbjct  84   VAALDADAHKSLAQEYGIKGFPTIKVFAPGKPPVDYQGARDVKPIAEFALQQVKALLKER  143

Query  512  LDGKAT-GGSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            L+GK T GGS++KSEP+AS ELNSRNFD+LV+KSKDLWIVEFFAPWCGHCK
Sbjct  144  LNGKTTGGGSNEKSEPNASEELNSRNFDELVIKSKDLWIVEFFAPWCGHCK  194


 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 46/105 (44%), Positives = 61/105 (58%), Gaps = 1/105 (1%)
 Frame = +2

Query  185  QLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaaldadahss  364
            +LN  NF   V+ S  + +VEFFAPWCGHCK L P ++K A  LKG   +  +D DA  S
Sbjct  164  ELNSRNFDELVIKSKDLWIVEFFAPWCGHCKRLAPEWKKAAKNLKGKVKLGHVDCDAEKS  223

Query  365  laQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRN  496
            L   + ++GFPTI VF   K  P+ Y+GAR A  +  F   Q+  
Sbjct  224  LMSRFNVQGFPTILVFGADKYSPITYEGARTASGIESFALDQLET  268



>ref|XP_007215346.1| hypothetical protein PRUPE_ppa005396mg [Prunus persica]
 gb|EMJ16545.1| hypothetical protein PRUPE_ppa005396mg [Prunus persica]
Length=463

 Score =   270 bits (691),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 139/170 (82%), Positives = 155/170 (91%), Gaps = 0/170 (0%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            +ALYGPS+PVLQL PSNFKSKVL+SN VVLVEFFAPWCGHC+ALTP +EK A+VLKGVAT
Sbjct  50   DALYGPSSPVLQLTPSNFKSKVLDSNRVVLVEFFAPWCGHCQALTPIWEKAATVLKGVAT  109

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDR  511
            VAALDADAH SLAQEYGI+GFPTIKVFVPGK PVDYQGAR+ K + +F   QI+ LLKDR
Sbjct  110  VAALDADAHKSLAQEYGIRGFPTIKVFVPGKPPVDYQGARDVKPVAEFALQQIKVLLKDR  169

Query  512  LDGKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            L GKATGG S+KSEP+ASVELNS+NFD+LVVKSK+LWIVEFFAPWCGHCK
Sbjct  170  LSGKATGGPSEKSEPNASVELNSQNFDELVVKSKELWIVEFFAPWCGHCK  219


 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 44/106 (42%), Positives = 63/106 (59%), Gaps = 1/106 (1%)
 Frame = +2

Query  182  LQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaaldadahs  361
            ++LN  NF   V+ S  + +VEFFAPWCGHCK L P ++K A  L+G   +  +D D   
Sbjct  188  VELNSQNFDELVVKSKELWIVEFFAPWCGHCKKLAPEWKKAAKNLQGKVKLGHVDCDVEK  247

Query  362  slaQEYGIKGFPTIKVFVPGKQ-PVDYQGAREAKSMVDFVKAQIRN  496
            SL   + ++GFPTI +F   K  P+ Y+GAR AK++  F   Q+  
Sbjct  248  SLMSRFNVQGFPTILIFGADKDTPLPYEGARTAKAIESFALEQLET  293



>emb|CDP05711.1| unnamed protein product [Coffea canephora]
Length=438

 Score =   270 bits (689),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 147/193 (76%), Positives = 157/193 (81%), Gaps = 23/193 (12%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSK--------------------VLNSNGVVLVEFFAPWCGH  271
            NALYGPS+PV+QLNPSNFKSK                    VLNSNGVVLVEFFAPWCGH
Sbjct  22   NALYGPSSPVVQLNPSNFKSKPSAFSFSPVVQLNPSNFKSKVLNSNGVVLVEFFAPWCGH  81

Query  272  CKALTPTYEKVASVLKGVATVaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAR  451
            CKALTPT+EK ASVLKGVATVAALDADAH SLAQEYGIKGFPTIKVF PGK PVDYQGAR
Sbjct  82   CKALTPTWEKAASVLKGVATVAALDADAHQSLAQEYGIKGFPTIKVFAPGKSPVDYQGAR  141

Query  452  EAKSMVDFVKAQIRNLLKDRLDGKATGGS---SQKSEPSASVELNSRNFDDLVVKSKDLW  622
            + K + +F   QI+ LLKDRL+GKATGGS   S+KSEPS SVELNS NFDDLV+KSKDLW
Sbjct  142  DVKPIAEFALQQIKALLKDRLNGKATGGSSEKSEKSEPSVSVELNSHNFDDLVLKSKDLW  201

Query  623  IVEFFAPWCGHCK  661
            IVEFFAPWCGHCK
Sbjct  202  IVEFFAPWCGHCK  214


 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 50/110 (45%), Positives = 65/110 (59%), Gaps = 2/110 (2%)
 Frame = +2

Query  167  PSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaald  346
            PS  V +LN  NF   VL S  + +VEFFAPWCGHCK L P ++K A+ LKG   +  +D
Sbjct  179  PSVSV-ELNSHNFDDLVLKSKDLWIVEFFAPWCGHCKRLAPEWKKAANNLKGKVKLGHVD  237

Query  347  adahsslaQEYGIKGFPTIKVFVPGKQ-PVDYQGAREAKSMVDFVKAQIR  493
             DA  SL   + ++GFPTI VF   K  P  Y+GAR A ++  F   Q+ 
Sbjct  238  CDAEKSLMSRFNVQGFPTILVFGADKDSPSPYEGARTASAIESFALEQLE  287



>ref|XP_009409222.1| PREDICTED: protein disulfide isomerase-like 2-3 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=431

 Score =   269 bits (687),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 136/170 (80%), Positives = 154/170 (91%), Gaps = 0/170 (0%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            NALY PS+PV+QLNPSNFKSKVLNSNGVVLVEFFAPWCGHC+ALTPT+EK A+VLKGVAT
Sbjct  19   NALYSPSSPVVQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCQALTPTWEKAATVLKGVAT  78

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDR  511
            +AALDADAH SLAQEYGIKGFPTIKVF PGK PVDYQGAR+ K + +F   Q++ LLK+R
Sbjct  79   IAALDADAHKSLAQEYGIKGFPTIKVFSPGKPPVDYQGARDVKPIAEFALQQVKALLKER  138

Query  512  LDGKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            L GKA+G SS+KSEPSASV L S+NFD+LV+KSKD+WIVEFFAPWCGHCK
Sbjct  139  LSGKASGDSSEKSEPSASVVLTSQNFDELVIKSKDVWIVEFFAPWCGHCK  188


 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 45/111 (41%), Positives = 60/111 (54%), Gaps = 3/111 (3%)
 Frame = +2

Query  167  PSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKG-VATVaal  343
            PS  V+ L   NF   V+ S  V +VEFFAPWCGHCK L P ++K A+ LKG V      
Sbjct  153  PSASVV-LTSQNFDELVIKSKDVWIVEFFAPWCGHCKKLAPEWKKAANNLKGKVKLGHVD  211

Query  344  dadahsslaQEYGIKGFPTIKVF-VPGKQPVDYQGAREAKSMVDFVKAQIR  493
                  SL   + ++GFPTI VF +    P  Y+GAR A ++  +   Q+ 
Sbjct  212  CDAEKQSLMSRFNVQGFPTILVFGLDKSSPYPYEGARTALAIEAYGLEQLE  262



>ref|XP_009409223.1| PREDICTED: protein disulfide isomerase-like 2-3 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=430

 Score =   269 bits (687),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 136/170 (80%), Positives = 154/170 (91%), Gaps = 0/170 (0%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            NALY PS+PV+QLNPSNFKSKVLNSNGVVLVEFFAPWCGHC+ALTPT+EK A+VLKGVAT
Sbjct  19   NALYSPSSPVVQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCQALTPTWEKAATVLKGVAT  78

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDR  511
            +AALDADAH SLAQEYGIKGFPTIKVF PGK PVDYQGAR+ K + +F   Q++ LLK+R
Sbjct  79   IAALDADAHKSLAQEYGIKGFPTIKVFSPGKPPVDYQGARDVKPIAEFALQQVKALLKER  138

Query  512  LDGKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            L GKA+G SS+KSEPSASV L S+NFD+LV+KSKD+WIVEFFAPWCGHCK
Sbjct  139  LSGKASGDSSEKSEPSASVVLTSQNFDELVIKSKDVWIVEFFAPWCGHCK  188


 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 47/110 (43%), Positives = 64/110 (58%), Gaps = 2/110 (2%)
 Frame = +2

Query  167  PSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaald  346
            PS  V+ L   NF   V+ S  V +VEFFAPWCGHCK L P ++K A+ LKG   +  +D
Sbjct  153  PSASVV-LTSQNFDELVIKSKDVWIVEFFAPWCGHCKKLAPEWKKAANNLKGKVKLGHVD  211

Query  347  adahsslaQEYGIKGFPTIKVF-VPGKQPVDYQGAREAKSMVDFVKAQIR  493
             DA  SL   + ++GFPTI VF +    P  Y+GAR A ++  +   Q+ 
Sbjct  212  CDAEKSLMSRFNVQGFPTILVFGLDKSSPYPYEGARTALAIEAYGLEQLE  261



>ref|XP_008379697.1| PREDICTED: protein disulfide isomerase-like 2-3 [Malus domestica]
Length=435

 Score =   269 bits (687),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 138/170 (81%), Positives = 154/170 (91%), Gaps = 0/170 (0%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            +ALYGPSTPVLQL PSNFKSKVL+SN VVLVEFFAPWCGHC+ALTP +EK A+VLKGVAT
Sbjct  24   DALYGPSTPVLQLTPSNFKSKVLDSNRVVLVEFFAPWCGHCQALTPIWEKAATVLKGVAT  83

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDR  511
            VAALDADAH SLAQEYGI+G PTIKVFVPGK PVDYQGAR+ K + +F   QI+ LLKDR
Sbjct  84   VAALDADAHKSLAQEYGIRGXPTIKVFVPGKPPVDYQGARDVKPVAEFALQQIKALLKDR  143

Query  512  LDGKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            L GK TGGSS+KSEPSASVELNS+NF++LV+KSK+LWIVEFFAPWCGHCK
Sbjct  144  LSGKTTGGSSEKSEPSASVELNSQNFNELVLKSKELWIVEFFAPWCGHCK  193


 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 49/111 (44%), Positives = 66/111 (59%), Gaps = 2/111 (2%)
 Frame = +2

Query  167  PSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaald  346
            PS  V +LN  NF   VL S  + +VEFFAPWCGHCK L P ++K A  L+G   +  +D
Sbjct  158  PSASV-ELNSQNFNELVLKSKELWIVEFFAPWCGHCKKLAPEWKKAAKNLQGKVKLGHVD  216

Query  347  adahsslaQEYGIKGFPTIKVFVPGKQ-PVDYQGAREAKSMVDFVKAQIRN  496
             DA  SL  ++ ++GFPTI VF   K+ P+ Y+GAR A +   F   Q+  
Sbjct  217  CDAEKSLMSKFNVQGFPTILVFGADKESPLPYEGARSASAXESFALEQLET  267



>gb|KJB10306.1| hypothetical protein B456_001G195100 [Gossypium raimondii]
Length=428

 Score =   268 bits (686),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 136/170 (80%), Positives = 153/170 (90%), Gaps = 0/170 (0%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            NA YGPS+PVLQL PSNFKSKVLNSNGVVLVEFFAPWCGHC+ALTPT+EK A+VL GVAT
Sbjct  23   NAFYGPSSPVLQLTPSNFKSKVLNSNGVVLVEFFAPWCGHCQALTPTWEKAANVLNGVAT  82

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDR  511
            VAALDADAH SLA+EYGI+GFPTIKVF PGK PVDYQGAR+ K + +F   Q++ LLKDR
Sbjct  83   VAALDADAHQSLAEEYGIRGFPTIKVFAPGKPPVDYQGARDVKPIAEFALQQVKALLKDR  142

Query  512  LDGKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            L GKA+GGSS+K +PSASVELNSRNFD+LV+KSK+LWIVEFFAPWCG CK
Sbjct  143  LAGKASGGSSEKYQPSASVELNSRNFDELVLKSKELWIVEFFAPWCGRCK  192


 Score = 79.3 bits (194),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 49/114 (43%), Positives = 61/114 (54%), Gaps = 3/114 (3%)
 Frame = +2

Query  161  YGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKG-VATVa  337
            Y PS  V +LN  NF   VL S  + +VEFFAPWCG CK L P ++K A+ LKG V    
Sbjct  155  YQPSASV-ELNSRNFDELVLKSKELWIVEFFAPWCGRCKKLAPEWKKAANNLKGKVKLGH  213

Query  338  aldadahsslaQEYGIKGFPTIKVFVPGKQ-PVDYQGAREAKSMVDFVKAQIRN  496
                    SL   Y ++GFPTI  F   K  P+ Y+GAR A S+  F   Q+  
Sbjct  214  VDCDSEKQSLMSRYKVQGFPTILAFGADKDGPIPYEGARNASSIESFALEQLET  267



>gb|KHG02314.1| Protein disulfide-isomerase like 2-2 [Gossypium arboreum]
Length=414

 Score =   268 bits (684),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 135/170 (79%), Positives = 153/170 (90%), Gaps = 0/170 (0%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            NA YGPS+PVLQL PSNFKSKVLNSNGVVLVEFFAPWCGHC+ALTPT+EK A+VL GVAT
Sbjct  23   NAFYGPSSPVLQLTPSNFKSKVLNSNGVVLVEFFAPWCGHCQALTPTWEKAANVLNGVAT  82

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDR  511
            VAALDADAH SLA+EYGI+GFPTIKVF PGK PVDYQGAR+ K + +F   Q++ LLKDR
Sbjct  83   VAALDADAHQSLAEEYGIRGFPTIKVFAPGKPPVDYQGARDVKPIAEFALQQVKALLKDR  142

Query  512  LDGKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            L GKA+ GS +KS+PSASVELNSRNFD+LV+KSK+LW+VEFFAPWCGHCK
Sbjct  143  LAGKASEGSGEKSQPSASVELNSRNFDELVLKSKELWLVEFFAPWCGHCK  192


 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 48/112 (43%), Positives = 59/112 (53%), Gaps = 3/112 (3%)
 Frame = +2

Query  167  PSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKG-VATVaal  343
            PS  V +LN  NF   VL S  + LVEFFAPWCGHCK L P ++  A+ LKG V      
Sbjct  157  PSASV-ELNSRNFDELVLKSKELWLVEFFAPWCGHCKKLAPEWKMAANNLKGKVKLGHVD  215

Query  344  dadahsslaQEYGIKGFPTIKVFVPGKQ-PVDYQGAREAKSMVDFVKAQIRN  496
                  SL   Y ++ FPTI  F   K  P+ Y+GAR A S+  F   Q+  
Sbjct  216  CDSEKQSLMSRYKVQEFPTILAFGADKDGPILYEGARAASSIESFALEQLET  267



>gb|KJB10301.1| hypothetical protein B456_001G195100 [Gossypium raimondii]
Length=427

 Score =   268 bits (685),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 136/170 (80%), Positives = 153/170 (90%), Gaps = 0/170 (0%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            NA YGPS+PVLQL PSNFKSKVLNSNGVVLVEFFAPWCGHC+ALTPT+EK A+VL GVAT
Sbjct  23   NAFYGPSSPVLQLTPSNFKSKVLNSNGVVLVEFFAPWCGHCQALTPTWEKAANVLNGVAT  82

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDR  511
            VAALDADAH SLA+EYGI+GFPTIKVF PGK PVDYQGAR+ K + +F   Q++ LLKDR
Sbjct  83   VAALDADAHQSLAEEYGIRGFPTIKVFAPGKPPVDYQGARDVKPIAEFALQQVKALLKDR  142

Query  512  LDGKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            L GKA+GGSS+K +PSASVELNSRNFD+LV+KSK+LWIVEFFAPWCG CK
Sbjct  143  LAGKASGGSSEKYQPSASVELNSRNFDELVLKSKELWIVEFFAPWCGRCK  192


 Score = 83.2 bits (204),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 50/113 (44%), Positives = 65/113 (58%), Gaps = 2/113 (2%)
 Frame = +2

Query  161  YGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaa  340
            Y PS  V +LN  NF   VL S  + +VEFFAPWCG CK L P ++K A+ LKG   +  
Sbjct  155  YQPSASV-ELNSRNFDELVLKSKELWIVEFFAPWCGRCKKLAPEWKKAANNLKGKVKLGH  213

Query  341  ldadahsslaQEYGIKGFPTIKVFVPGKQ-PVDYQGAREAKSMVDFVKAQIRN  496
            +D D+  SL   Y ++GFPTI  F   K  P+ Y+GAR A S+  F   Q+  
Sbjct  214  VDCDSEKSLMSRYKVQGFPTILAFGADKDGPIPYEGARNASSIESFALEQLET  266



>ref|XP_008456396.1| PREDICTED: protein disulfide isomerase-like 2-3 [Cucumis melo]
Length=438

 Score =   268 bits (684),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 136/171 (80%), Positives = 154/171 (90%), Gaps = 1/171 (1%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            NALYG S+PVLQL PSNFKSKVLNSNG+VLVEFFAPWCGHC+ALTP +EK A++LKGVAT
Sbjct  24   NALYGASSPVLQLTPSNFKSKVLNSNGIVLVEFFAPWCGHCQALTPVWEKAATILKGVAT  83

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDR  511
            VAALDADAH SLAQEYGIKGFPTIKVF PGK PVDYQGAR+ K + +F   Q++ LLK+R
Sbjct  84   VAALDADAHKSLAQEYGIKGFPTIKVFAPGKPPVDYQGARDVKPIAEFALQQVKALLKER  143

Query  512  LDGKAT-GGSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            L+GK T GGS++KSEP+AS ELNSRNFD+LV+KSKDLWIVEFFAPWCGHCK
Sbjct  144  LNGKTTGGGSNEKSEPNASEELNSRNFDELVIKSKDLWIVEFFAPWCGHCK  194


 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 46/105 (44%), Positives = 62/105 (59%), Gaps = 1/105 (1%)
 Frame = +2

Query  185  QLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaaldadahss  364
            +LN  NF   V+ S  + +VEFFAPWCGHCK L P ++K A  LKG   +  +D DA  S
Sbjct  164  ELNSRNFDELVIKSKDLWIVEFFAPWCGHCKRLAPEWKKAAKNLKGKVKLGHVDCDAEKS  223

Query  365  laQEYGIKGFPTIKVFVPGKQ-PVDYQGAREAKSMVDFVKAQIRN  496
            L   + ++GFPTI VF   K  P+ Y+GAR A ++  F   Q+  
Sbjct  224  LMSRFNVQGFPTILVFGADKDSPIPYEGARTASAIESFALDQLET  268



>ref|XP_008805603.1| PREDICTED: protein disulfide isomerase-like 2-3 [Phoenix dactylifera]
Length=430

 Score =   267 bits (683),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 136/169 (80%), Positives = 154/169 (91%), Gaps = 0/169 (0%)
 Frame = +2

Query  155  ALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATV  334
            ALY PS+PV+QLNPSNFKSKVLN+NGVVLVEFFAPWCGHC+ALTPT+EK A+VLKGVATV
Sbjct  20   ALYSPSSPVVQLNPSNFKSKVLNANGVVLVEFFAPWCGHCQALTPTWEKAATVLKGVATV  79

Query  335  aaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDRL  514
            AALDADAH SLAQEYGIKGFPTIKVF PGK PVDYQGAR+ K + +F   QI+ LLK+RL
Sbjct  80   AALDADAHKSLAQEYGIKGFPTIKVFSPGKPPVDYQGARDVKPIAEFALQQIKALLKERL  139

Query  515  DGKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            +GK++ GSS+KSE SAS+EL SRNFD+LV+KSKDLWIVEFFAPWCGHCK
Sbjct  140  NGKSSRGSSEKSETSASIELTSRNFDELVLKSKDLWIVEFFAPWCGHCK  188


 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 44/106 (42%), Positives = 62/106 (58%), Gaps = 1/106 (1%)
 Frame = +2

Query  182  LQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaaldadahs  361
            ++L   NF   VL S  + +VEFFAPWCGHCK L P ++K ++ LKG   +  +D DA  
Sbjct  157  IELTSRNFDELVLKSKDLWIVEFFAPWCGHCKKLAPEWKKASNNLKGKVKLGHVDCDAEK  216

Query  362  slaQEYGIKGFPTIKVF-VPGKQPVDYQGAREAKSMVDFVKAQIRN  496
            SL   + ++GFPTI VF +    P  Y+GAR A ++  F   Q+  
Sbjct  217  SLMSRFNVQGFPTILVFGIVKDSPYPYEGARVASAIESFALEQLET  262



>ref|XP_009143922.1| PREDICTED: protein disulfide-isomerase 2-3 [Brassica rapa]
Length=443

 Score =   268 bits (684),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 140/174 (80%), Positives = 155/174 (89%), Gaps = 4/174 (2%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            NALYG S+PV+QL  SNFKSKVLNSNGVVLVEFFAPWCGHCKALTPT+EKVASVLKGVAT
Sbjct  24   NALYGSSSPVVQLTASNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTWEKVASVLKGVAT  83

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDR  511
            VAA+DADAH S AQ+YGI+GFPTIKVFVPGK PVDYQGAR+AKS+ +F   QI+ LL DR
Sbjct  84   VAAIDADAHQSAAQDYGIQGFPTIKVFVPGKPPVDYQGARDAKSIANFAYKQIKALLSDR  143

Query  512  LDGKAT---GGSSQ-KSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            L+GK+    GGSS+ KSEPSASVELNS NFD+LV+KS DLWIVEFFAPWCGHCK
Sbjct  144  LEGKSKPSGGGSSEKKSEPSASVELNSSNFDELVIKSNDLWIVEFFAPWCGHCK  197


 Score = 82.8 bits (203),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 46/104 (44%), Positives = 62/104 (60%), Gaps = 2/104 (2%)
 Frame = +2

Query  167  PSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaald  346
            PS  V +LN SNF   V+ SN + +VEFFAPWCGHCK L P +++ A  LKG   +  ++
Sbjct  162  PSASV-ELNSSNFDELVIKSNDLWIVEFFAPWCGHCKKLAPEWKRAAKNLKGKVKLGHVN  220

Query  347  adahsslaQEYGIKGFPTIKVF-VPGKQPVDYQGAREAKSMVDF  475
             D   S+   + ++GFPTI VF V    P  Y GAR A ++  F
Sbjct  221  CDVEQSIMSRFKVQGFPTIMVFGVDKSSPYAYDGARSASAIESF  264



>emb|CDY52544.1| BnaA05g35030D [Brassica napus]
Length=444

 Score =   268 bits (684),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 140/174 (80%), Positives = 155/174 (89%), Gaps = 4/174 (2%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            NALYG S+PV+QL  SNFKSKVLNSNGVVLVEFFAPWCGHCKALTPT+EKVASVLKGVAT
Sbjct  25   NALYGSSSPVVQLTASNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTWEKVASVLKGVAT  84

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDR  511
            VAA+DADAH S AQ+YGI+GFPTIKVFVPGK PVDYQGAR+AKS+ +F   QI+ LL DR
Sbjct  85   VAAIDADAHQSAAQDYGIQGFPTIKVFVPGKPPVDYQGARDAKSIANFAYKQIKALLSDR  144

Query  512  LDGKAT---GGSSQ-KSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            L+GK+    GGSS+ KSEPSASVELNS NFD+LV+KS DLWIVEFFAPWCGHCK
Sbjct  145  LEGKSKPSGGGSSEKKSEPSASVELNSSNFDELVIKSNDLWIVEFFAPWCGHCK  198


 Score = 82.8 bits (203),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 46/104 (44%), Positives = 62/104 (60%), Gaps = 2/104 (2%)
 Frame = +2

Query  167  PSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaald  346
            PS  V +LN SNF   V+ SN + +VEFFAPWCGHCK L P +++ A  LKG   +  ++
Sbjct  163  PSASV-ELNSSNFDELVIKSNDLWIVEFFAPWCGHCKKLAPEWKRAAKNLKGKVKLGHVN  221

Query  347  adahsslaQEYGIKGFPTIKVF-VPGKQPVDYQGAREAKSMVDF  475
             D   S+   + ++GFPTI VF V    P  Y GAR A ++  F
Sbjct  222  CDVEQSIMSRFKVQGFPTIMVFGVDKSSPYAYDGARSASAIESF  265



>emb|CDY12149.1| BnaC04g11790D [Brassica napus]
Length=443

 Score =   267 bits (683),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 140/174 (80%), Positives = 155/174 (89%), Gaps = 4/174 (2%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            NALYG S+PV+QL  SNFKSKVLNSNGVVLVEFFAPWCGHCKALTPT+EKVASVLKGVAT
Sbjct  24   NALYGSSSPVVQLTASNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTWEKVASVLKGVAT  83

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDR  511
            VAA+DADAH S AQ+YGI+GFPTIKVFVPGK PVDYQGAR+AKS+ +F   QI+ LL DR
Sbjct  84   VAAIDADAHQSAAQDYGIQGFPTIKVFVPGKPPVDYQGARDAKSIANFAYKQIKALLSDR  143

Query  512  LDGKAT---GGSSQ-KSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            L+GK+    GGSS+ KSEPSASVELNS NFD+LV+KS DLWIVEFFAPWCGHCK
Sbjct  144  LEGKSKPSGGGSSEKKSEPSASVELNSSNFDELVIKSNDLWIVEFFAPWCGHCK  197


 Score = 82.8 bits (203),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 46/104 (44%), Positives = 62/104 (60%), Gaps = 2/104 (2%)
 Frame = +2

Query  167  PSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaald  346
            PS  V +LN SNF   V+ SN + +VEFFAPWCGHCK L P +++ A  LKG   +  ++
Sbjct  162  PSASV-ELNSSNFDELVIKSNDLWIVEFFAPWCGHCKKLAPEWKRAAKNLKGKVKLGHVN  220

Query  347  adahsslaQEYGIKGFPTIKVF-VPGKQPVDYQGAREAKSMVDF  475
             D   S+   + ++GFPTI VF V    P  Y GAR A ++  F
Sbjct  221  CDVEQSIMSRFKVQGFPTIMVFGVDKSSPYAYDGARSASAIESF  264



>gb|AFK43048.1| unknown [Lotus japonicus]
Length=440

 Score =   267 bits (682),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 133/170 (78%), Positives = 154/170 (91%), Gaps = 0/170 (0%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            +ALYG S+PV+QLNPSNFKSKVLNS GVVLVEFFAPWCGHCKALTP +EK A+VLKGV T
Sbjct  28   HALYGASSPVVQLNPSNFKSKVLNSKGVVLVEFFAPWCGHCKALTPIWEKAATVLKGVVT  87

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDR  511
            VAALDADAH +LAQEYGI+GFPTIKVF PGK PVDYQGAR+ K + ++   Q++ LLKDR
Sbjct  88   VAALDADAHQALAQEYGIRGFPTIKVFAPGKPPVDYQGARDVKPIAEYALQQVKALLKDR  147

Query  512  LDGKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            L+GKATGGS++K+E SASVELNSRNFD+LV+KSK+LW+VEFFAPWCGHCK
Sbjct  148  LNGKATGGSNEKTETSASVELNSRNFDELVLKSKELWVVEFFAPWCGHCK  197


 Score = 85.5 bits (210),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 48/106 (45%), Positives = 65/106 (61%), Gaps = 1/106 (1%)
 Frame = +2

Query  182  LQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaaldadahs  361
            ++LN  NF   VL S  + +VEFFAPWCGHCK L P ++K ++ LKG   +  +D DA  
Sbjct  166  VELNSRNFDELVLKSKELWVVEFFAPWCGHCKKLAPEWKKASNNLKGKVKLGHVDCDADQ  225

Query  362  slaQEYGIKGFPTIKVFVPGKQ-PVDYQGAREAKSMVDFVKAQIRN  496
            SL   +G+KGFPTI VF   K  P+ Y+GAR A ++  F   Q+  
Sbjct  226  SLMSRFGVKGFPTILVFGADKDTPIPYEGARTASAIESFALEQLET  271



>ref|XP_010252582.1| PREDICTED: protein disulfide isomerase-like 2-3 [Nelumbo nucifera]
Length=434

 Score =   266 bits (681),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 133/170 (78%), Positives = 157/170 (92%), Gaps = 0/170 (0%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            +ALYGPS+PV+QL+PSNFK+KVLNSNGVVLVEFFAPWCGHC+ALTPT+EK A++LKGVAT
Sbjct  23   DALYGPSSPVVQLSPSNFKNKVLNSNGVVLVEFFAPWCGHCQALTPTWEKAATLLKGVAT  82

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDR  511
            VAALDADAH SLAQE+GI+GFPTIK FVPGK PVDYQGAR+AK++ +F   QI+ L+K+R
Sbjct  83   VAALDADAHKSLAQEHGIQGFPTIKAFVPGKPPVDYQGARDAKAIAEFALKQIKALVKER  142

Query  512  LDGKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            L+ K  GGSS+KSEPSAS+ELNS+ FDD+V+KSKDLWIVEFFAPWCGHCK
Sbjct  143  LNEKPAGGSSEKSEPSASIELNSQIFDDMVLKSKDLWIVEFFAPWCGHCK  192


 Score = 82.8 bits (203),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 45/106 (42%), Positives = 62/106 (58%), Gaps = 1/106 (1%)
 Frame = +2

Query  182  LQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaaldadahs  361
            ++LN   F   VL S  + +VEFFAPWCGHCK L P ++K A+ LKG   +  ++ D   
Sbjct  161  IELNSQIFDDMVLKSKDLWIVEFFAPWCGHCKKLAPEWKKAANNLKGKVKLGHVNCDEEK  220

Query  362  slaQEYGIKGFPTIKVFVPGKQ-PVDYQGAREAKSMVDFVKAQIRN  496
            SL   + ++GFPTI VF   K  PV Y+GAR A ++  F   Q+  
Sbjct  221  SLMSRFKVQGFPTILVFGADKDIPVSYEGARSASAIESFALEQLET  266



>ref|XP_006306333.1| hypothetical protein CARUB_v10012209mg [Capsella rubella]
 gb|EOA39231.1| hypothetical protein CARUB_v10012209mg [Capsella rubella]
Length=433

 Score =   265 bits (678),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 135/176 (77%), Positives = 156/176 (89%), Gaps = 6/176 (3%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            NALYG S+PV+QL PSNFKSKVLNSNGVVLVEFFAPWCGHCK+LTPT+EKVA+ LKG+AT
Sbjct  12   NALYGSSSPVVQLTPSNFKSKVLNSNGVVLVEFFAPWCGHCKSLTPTWEKVANTLKGIAT  71

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDR  511
            VAA+DADAH S++Q+YG++GFPTIKVFVPGK P+DYQGAR+AKS+  F   QI+ LLKDR
Sbjct  72   VAAIDADAHKSVSQDYGVRGFPTIKVFVPGKPPIDYQGARDAKSIAQFAIKQIKALLKDR  131

Query  512  LDGKAT-----GGSSQ-KSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            LDGK T     GGS+Q KSEPS SVELNS NFD+LV++SK+LWIVEFFAPWCGHCK
Sbjct  132  LDGKTTGTKNGGGSNQKKSEPSVSVELNSSNFDELVIESKELWIVEFFAPWCGHCK  187


 Score = 85.1 bits (209),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 48/111 (43%), Positives = 68/111 (61%), Gaps = 2/111 (2%)
 Frame = +2

Query  167  PSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaald  346
            PS  V +LN SNF   V+ S  + +VEFFAPWCGHCK L P ++K A+ LKG   +  ++
Sbjct  152  PSVSV-ELNSSNFDELVIESKELWIVEFFAPWCGHCKKLAPEWKKAANKLKGKVKLGHVN  210

Query  347  adahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRN  496
             DA  S+   + ++G+PTI VF   K  PV Y+GAR A ++  F   Q+ +
Sbjct  211  CDAEQSIKSRFKVQGYPTILVFAADKSSPVPYEGARSASAIESFALEQLES  261



>ref|XP_010484503.1| PREDICTED: protein disulfide-isomerase like 2-2-like [Camelina 
sativa]
Length=445

 Score =   265 bits (678),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 135/176 (77%), Positives = 157/176 (89%), Gaps = 6/176 (3%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            NALYG S+PV+QL PSNFKSKVLNSNGVVLVEFFAPWCGHCK+LTPT+EKVA+ LKG+AT
Sbjct  24   NALYGSSSPVVQLTPSNFKSKVLNSNGVVLVEFFAPWCGHCKSLTPTWEKVANTLKGIAT  83

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDR  511
            VAA+DADAH S++Q+YG++GFPTIKVFVPGK P+DYQGAR+AKS+  F   QI+ LLK+R
Sbjct  84   VAAIDADAHKSVSQDYGVRGFPTIKVFVPGKPPIDYQGARDAKSIAQFAIKQIKALLKNR  143

Query  512  LDGKAT-----GGSSQ-KSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            LDGK T     GGSS+ KSEPSASVELNS NFD+LV++SK+LWIVEFFAPWCGHCK
Sbjct  144  LDGKTTGTKNGGGSSEKKSEPSASVELNSSNFDELVIESKELWIVEFFAPWCGHCK  199


 Score = 73.6 bits (179),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 47/111 (42%), Positives = 65/111 (59%), Gaps = 2/111 (2%)
 Frame = +2

Query  167  PSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaald  346
            PS  V +LN SNF   V+ S  + +VEFFAPWCGHCK L P ++K A  LK    +  ++
Sbjct  164  PSASV-ELNSSNFDELVIESKELWIVEFFAPWCGHCKKLAPEWKKAAKKLKEKVKLGHVN  222

Query  347  adahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRN  496
             D   S+   + ++GFPTI VF   K  PV Y+GAR A ++  F   Q+ +
Sbjct  223  CDVEQSIKSRFKVQGFPTILVFGADKSSPVPYEGARSASAIESFALEQLES  273



>ref|XP_004491086.1| PREDICTED: protein disulfide isomerase-like 2-3-like [Cicer arietinum]
Length=436

 Score =   265 bits (676),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 137/171 (80%), Positives = 153/171 (89%), Gaps = 2/171 (1%)
 Frame = +2

Query  155  ALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATV  334
            ALYG S+PVLQL PSNFKSKVLNSNGVVLVEFFAPWCGHCKALTP +EK A+VLKGV TV
Sbjct  24   ALYGSSSPVLQLTPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPIWEKAATVLKGVVTV  83

Query  335  aaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDRL  514
            AALDADAH SLAQEYGI+GFPTIKVF PGK PVDYQGAR+ K + +F   Q++ LLK+R+
Sbjct  84   AALDADAHQSLAQEYGIRGFPTIKVFAPGKPPVDYQGARDVKPIAEFALQQVKALLKERI  143

Query  515  DGKATGGSSQKSE--PSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            +GKATGGS++KSE   SASVELNSRNFD+LVVKSK+LWIVEFFAPWCGHCK
Sbjct  144  NGKATGGSNEKSETSSSASVELNSRNFDELVVKSKELWIVEFFAPWCGHCK  194


 Score = 82.4 bits (202),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 46/110 (42%), Positives = 66/110 (60%), Gaps = 1/110 (1%)
 Frame = +2

Query  170  STPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaalda  349
            S+  ++LN  NF   V+ S  + +VEFFAPWCGHCK L P ++K ++ LKG   +  +D 
Sbjct  159  SSASVELNSRNFDELVVKSKELWIVEFFAPWCGHCKKLAPEWKKASNNLKGKVKLGHVDC  218

Query  350  dahsslaQEYGIKGFPTIKVFVPGKQ-PVDYQGAREAKSMVDFVKAQIRN  496
            DA  SL   + ++GFPTI VF   K  P+ Y+GAR A ++  F   Q+  
Sbjct  219  DAEKSLMSRFNVQGFPTILVFGADKDTPIPYEGARSASAIESFALEQLET  268



>ref|XP_006418074.1| hypothetical protein EUTSA_v10007682mg [Eutrema salsugineum]
 gb|ESQ36427.1| hypothetical protein EUTSA_v10007682mg [Eutrema salsugineum]
Length=434

 Score =   265 bits (676),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 135/176 (77%), Positives = 156/176 (89%), Gaps = 6/176 (3%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            NALYG S+PVLQL PSNFKSKVLNSNGVVLVEFFAPWCGHC++LTPT+EKVA+ LKGVAT
Sbjct  24   NALYGSSSPVLQLTPSNFKSKVLNSNGVVLVEFFAPWCGHCQSLTPTWEKVATTLKGVAT  83

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDR  511
            VAA+DADAH S++Q+YG++GFPTIKVFVPGK P+DYQGAR+AK++  F   QI+ LLKDR
Sbjct  84   VAAIDADAHKSVSQDYGVRGFPTIKVFVPGKPPIDYQGARDAKAISQFAIKQIKGLLKDR  143

Query  512  LDGKAT-----GGSSQ-KSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            LDGK       GGSS+ KSEPSASVELNS NFD+LV++SK+LWIVEFFAPWCGHCK
Sbjct  144  LDGKTAGTKTGGGSSEKKSEPSASVELNSSNFDELVIESKELWIVEFFAPWCGHCK  199


 Score = 85.1 bits (209),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 49/111 (44%), Positives = 68/111 (61%), Gaps = 2/111 (2%)
 Frame = +2

Query  167  PSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaald  346
            PS  V +LN SNF   V+ S  + +VEFFAPWCGHCK L P ++K A+ LKG   +  ++
Sbjct  164  PSASV-ELNSSNFDELVIESKELWIVEFFAPWCGHCKKLAPEWKKAANKLKGKVKLGHVN  222

Query  347  adahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRN  496
             DA  S+   + ++GFPTI VF   K  PV Y+GAR A ++  F   Q+ +
Sbjct  223  CDADKSIQSRFKVQGFPTILVFGADKSSPVPYEGARSASAIESFALEQLES  273



>ref|XP_002892256.1| hypothetical protein ARALYDRAFT_470488 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68515.1| hypothetical protein ARALYDRAFT_470488 [Arabidopsis lyrata subsp. 
lyrata]
Length=442

 Score =   265 bits (677),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 134/172 (78%), Positives = 152/172 (88%), Gaps = 2/172 (1%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            NALYG S+PVLQL PSNFKSKVLNSNGVVLVEFFAPWCGHC++LTPT+EKVA+ LKG+AT
Sbjct  25   NALYGSSSPVLQLTPSNFKSKVLNSNGVVLVEFFAPWCGHCQSLTPTWEKVANTLKGIAT  84

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDR  511
            VAA+DADAH S++Q+YG++GFPTIKVFVPGK P+DYQGAR+AKS+  F   QI+ LLKDR
Sbjct  85   VAAIDADAHKSVSQDYGVRGFPTIKVFVPGKPPIDYQGARDAKSISQFAIKQIKTLLKDR  144

Query  512  LDGKATG--GSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            LDGK TG      KSEPSASVELNS NFD+LVV+SK LWIVEFFAPWCGHCK
Sbjct  145  LDGKTTGTKNGGGKSEPSASVELNSSNFDELVVESKQLWIVEFFAPWCGHCK  196


 Score = 83.6 bits (205),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 48/111 (43%), Positives = 68/111 (61%), Gaps = 2/111 (2%)
 Frame = +2

Query  167  PSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaald  346
            PS  V +LN SNF   V+ S  + +VEFFAPWCGHCK L P ++K A+ L+G   +  ++
Sbjct  161  PSASV-ELNSSNFDELVVESKQLWIVEFFAPWCGHCKKLAPEWKKAANKLQGKVKLGHVN  219

Query  347  adahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRN  496
             DA  S+   + ++GFPTI VF   K  PV Y+GAR A ++  F   Q+ +
Sbjct  220  CDAEQSIKSRFKVQGFPTILVFGADKSSPVPYEGARSASAIESFALEQLES  270



>ref|XP_006410429.1| hypothetical protein EUTSA_v10016663mg [Eutrema salsugineum]
 gb|ESQ51882.1| hypothetical protein EUTSA_v10016663mg [Eutrema salsugineum]
Length=442

 Score =   265 bits (677),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 138/174 (79%), Positives = 154/174 (89%), Gaps = 4/174 (2%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            NALYG S+PV+QL  +NFKSKVLNSNGVVLVEFFAPWCGHCKALTPT+EKVAS+LKGVAT
Sbjct  23   NALYGSSSPVVQLTATNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTWEKVASILKGVAT  82

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDR  511
            VAA+DADAH S AQ+YGIKGFPTIKVFVPGK PVDYQGAR+AKS+ +F   QI+ LL DR
Sbjct  83   VAAIDADAHQSAAQDYGIKGFPTIKVFVPGKPPVDYQGARDAKSIANFAYKQIKALLSDR  142

Query  512  LDGKA--TGGSS--QKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            L+GK+  TGG S  +KSE SASVELNS NFD+LV+KS DLWIVEFFAPWCGHCK
Sbjct  143  LEGKSKPTGGGSNEKKSEASASVELNSSNFDELVIKSNDLWIVEFFAPWCGHCK  196


 Score = 82.8 bits (203),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 44/99 (44%), Positives = 60/99 (61%), Gaps = 1/99 (1%)
 Frame = +2

Query  182  LQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaaldadahs  361
            ++LN SNF   V+ SN + +VEFFAPWCGHCK L P ++K A  LKG   +  ++ D   
Sbjct  165  VELNSSNFDELVIKSNDLWIVEFFAPWCGHCKNLAPEWKKAAKNLKGKVKLGHVNCDVEQ  224

Query  362  slaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDF  475
            S+   + ++GFPTI VF   K  P  Y GAR A ++  F
Sbjct  225  SIMSRFKVQGFPTIMVFGADKSSPYAYDGARSASAIESF  263



>gb|AAF40463.1|AC004809_21 Strong simialrity to the disulfide isomerase precursor homolog 
T21L14.14 gi|2702281 from A. thaliana on BAC gb|AC003033 [Arabidopsis 
thaliana]
 gb|AAM20664.1| disulfide isomerase-related protein, putative [Arabidopsis thaliana]
Length=443

 Score =   265 bits (677),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 136/177 (77%), Positives = 156/177 (88%), Gaps = 7/177 (4%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            NALYG S+PVLQL PSNFKSKVLNSNGVVLVEFFAPWCGHC++LTPT+EKVAS LKG+AT
Sbjct  21   NALYGSSSPVLQLTPSNFKSKVLNSNGVVLVEFFAPWCGHCQSLTPTWEKVASTLKGIAT  80

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDR  511
            VAA+DADAH S++Q+YG++GFPTIKVFVPGK P+DYQGAR+AKS+  F   QI+ LLKDR
Sbjct  81   VAAIDADAHKSVSQDYGVRGFPTIKVFVPGKPPIDYQGARDAKSISQFAIKQIKALLKDR  140

Query  512  LDGKAT-----GGSSQ--KSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            LDGK +     GGSS+  KSEPSASVELNS NFD+LV +SK+LWIVEFFAPWCGHCK
Sbjct  141  LDGKTSGTKNGGGSSEKKKSEPSASVELNSSNFDELVTESKELWIVEFFAPWCGHCK  197


 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 49/111 (44%), Positives = 67/111 (60%), Gaps = 2/111 (2%)
 Frame = +2

Query  167  PSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaald  346
            PS  V +LN SNF   V  S  + +VEFFAPWCGHCK L P ++K A+ LKG   +  ++
Sbjct  162  PSASV-ELNSSNFDELVTESKELWIVEFFAPWCGHCKKLAPEWKKAANNLKGKVKLGHVN  220

Query  347  adahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRN  496
             DA  S+   + ++GFPTI VF   K  PV Y+GAR A ++  F   Q+ +
Sbjct  221  CDAEQSIKSRFKVQGFPTILVFGSDKSSPVPYEGARSASAIESFALEQLES  271



>ref|NP_171990.3| protein disulfide-isomerase like 2-2 [Arabidopsis thaliana]
 sp|Q9MAU6.2|PDI22_ARATH RecName: Full=Protein disulfide-isomerase like 2-2; Short=AtPDIL2-2; 
AltName: Full=Protein disulfide-isomerase 10; Short=PDI10; 
AltName: Full=Protein disulfide-isomerase like 5-1; Short=AtPDIL5-1; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AEE27773.1| protein disulfide-isomerase like 2-2 [Arabidopsis thaliana]
Length=447

 Score =   265 bits (677),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 136/177 (77%), Positives = 156/177 (88%), Gaps = 7/177 (4%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            NALYG S+PVLQL PSNFKSKVLNSNGVVLVEFFAPWCGHC++LTPT+EKVAS LKG+AT
Sbjct  25   NALYGSSSPVLQLTPSNFKSKVLNSNGVVLVEFFAPWCGHCQSLTPTWEKVASTLKGIAT  84

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDR  511
            VAA+DADAH S++Q+YG++GFPTIKVFVPGK P+DYQGAR+AKS+  F   QI+ LLKDR
Sbjct  85   VAAIDADAHKSVSQDYGVRGFPTIKVFVPGKPPIDYQGARDAKSISQFAIKQIKALLKDR  144

Query  512  LDGKAT-----GGSSQ--KSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            LDGK +     GGSS+  KSEPSASVELNS NFD+LV +SK+LWIVEFFAPWCGHCK
Sbjct  145  LDGKTSGTKNGGGSSEKKKSEPSASVELNSSNFDELVTESKELWIVEFFAPWCGHCK  201


 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 49/111 (44%), Positives = 67/111 (60%), Gaps = 2/111 (2%)
 Frame = +2

Query  167  PSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaald  346
            PS  V +LN SNF   V  S  + +VEFFAPWCGHCK L P ++K A+ LKG   +  ++
Sbjct  166  PSASV-ELNSSNFDELVTESKELWIVEFFAPWCGHCKKLAPEWKKAANNLKGKVKLGHVN  224

Query  347  adahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRN  496
             DA  S+   + ++GFPTI VF   K  PV Y+GAR A ++  F   Q+ +
Sbjct  225  CDAEQSIKSRFKVQGFPTILVFGSDKSSPVPYEGARSASAIESFALEQLES  275



>ref|NP_001236576.1| protein disulfide isomerse like protein precursor [Glycine max]
 dbj|BAF95902.1| protein disulfide isomerase family [Glycine max]
 dbj|BAD42856.2| protein disulfide isomerse like protein [Glycine max]
Length=438

 Score =   264 bits (675),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 134/170 (79%), Positives = 151/170 (89%), Gaps = 0/170 (0%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            +ALYG S+PVLQL PSNFKSKVLNSNGVVLVEFFAPWCGHC+ALTP +EK A+VLKGV T
Sbjct  27   HALYGASSPVLQLTPSNFKSKVLNSNGVVLVEFFAPWCGHCQALTPIWEKAATVLKGVVT  86

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDR  511
            VAA+DADAH SLAQEYGI+GFPTIKVF PGK PVDYQGAR+ K + +F   Q++ LLKDR
Sbjct  87   VAAIDADAHPSLAQEYGIRGFPTIKVFAPGKPPVDYQGARDVKPIAEFALQQVKALLKDR  146

Query  512  LDGKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            L GKATGGSS K+E S+SVELNS NFD+LV+KSK+LWIVEFFAPWCGHCK
Sbjct  147  LSGKATGGSSDKTETSSSVELNSGNFDELVIKSKELWIVEFFAPWCGHCK  196


 Score = 80.9 bits (198),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 45/106 (42%), Positives = 64/106 (60%), Gaps = 1/106 (1%)
 Frame = +2

Query  182  LQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaaldadahs  361
            ++LN  NF   V+ S  + +VEFFAPWCGHCK L P ++K ++ LKG   +  +D DA  
Sbjct  165  VELNSGNFDELVIKSKELWIVEFFAPWCGHCKKLAPEWKKASNSLKGKVKLGHVDCDAEK  224

Query  362  slaQEYGIKGFPTIKVFVPGKQ-PVDYQGAREAKSMVDFVKAQIRN  496
            SL   + ++GFPTI VF   K  P+ Y+GAR A ++  F   Q+  
Sbjct  225  SLMSRFKVQGFPTILVFGADKDSPIPYEGARTALAIESFALEQLET  270



>gb|KHN44746.1| Protein disulfide isomerase-like 2-3 [Glycine soja]
Length=442

 Score =   265 bits (676),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 134/170 (79%), Positives = 151/170 (89%), Gaps = 0/170 (0%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            +ALYG S+PVLQL PSNFKSKVLNSNGVVLVEFFAPWCGHC+ALTP +EK A+VLKGV T
Sbjct  27   HALYGASSPVLQLTPSNFKSKVLNSNGVVLVEFFAPWCGHCQALTPIWEKAATVLKGVVT  86

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDR  511
            VAA+DADAH SLAQEYGI+GFPTIKVF PGK PVDYQGAR+ K + +F   Q++ LLKDR
Sbjct  87   VAAIDADAHPSLAQEYGIRGFPTIKVFAPGKPPVDYQGARDVKPIAEFALQQVKALLKDR  146

Query  512  LDGKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            L GKATGGSS K+E S+SVELNS NFD+LV+KSK+LWIVEFFAPWCGHCK
Sbjct  147  LSGKATGGSSDKTETSSSVELNSGNFDELVIKSKELWIVEFFAPWCGHCK  196


 Score = 80.9 bits (198),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 45/106 (42%), Positives = 64/106 (60%), Gaps = 1/106 (1%)
 Frame = +2

Query  182  LQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaaldadahs  361
            ++LN  NF   V+ S  + +VEFFAPWCGHCK L P ++K ++ LKG   +  +D DA  
Sbjct  165  VELNSGNFDELVIKSKELWIVEFFAPWCGHCKKLAPEWKKASNSLKGKVKLGHVDCDAEK  224

Query  362  slaQEYGIKGFPTIKVFVPGKQ-PVDYQGAREAKSMVDFVKAQIRN  496
            SL   + ++GFPTI VF   K  P+ Y+GAR A ++  F   Q+  
Sbjct  225  SLMSRFKVQGFPTILVFGADKDSPIPYEGARTALAIESFALEQLET  270



>ref|XP_010475171.1| PREDICTED: protein disulfide-isomerase like 2-2 [Camelina sativa]
Length=448

 Score =   265 bits (676),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 135/176 (77%), Positives = 155/176 (88%), Gaps = 6/176 (3%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            NALYG S+PV+QL PSNFKSKVLNSNGVVLVEFFAPWCGHCK+LTPT+EKVA+ LKG+AT
Sbjct  27   NALYGSSSPVVQLTPSNFKSKVLNSNGVVLVEFFAPWCGHCKSLTPTWEKVANTLKGIAT  86

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDR  511
            VAA+DADAH S++Q+YG++GFPTIKVFVPGK P+DYQGAR+AKS+  F   QI+ LLKDR
Sbjct  87   VAAIDADAHKSVSQDYGVRGFPTIKVFVPGKPPIDYQGARDAKSIAQFAIKQIKALLKDR  146

Query  512  LDGKAT-----GGSSQ-KSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            LDGK T     GGSS+ KSEPS SVELNS NFD+LV +SK+LWIVEFFAPWCGHCK
Sbjct  147  LDGKTTGTKNGGGSSEKKSEPSTSVELNSSNFDELVTESKELWIVEFFAPWCGHCK  202


 Score = 74.3 bits (181),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 48/111 (43%), Positives = 65/111 (59%), Gaps = 2/111 (2%)
 Frame = +2

Query  167  PSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaald  346
            PST V +LN SNF   V  S  + +VEFFAPWCGHCK L P ++K A  LK    +  ++
Sbjct  167  PSTSV-ELNSSNFDELVTESKELWIVEFFAPWCGHCKKLAPEWKKAAKKLKEKVKLGHVN  225

Query  347  adahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRN  496
             D   S+   + ++GFPTI VF   K  PV Y+GAR A ++  F   Q+ +
Sbjct  226  CDVEQSIKSRFKVQGFPTILVFGADKSSPVPYEGARSASAIESFALEQLES  276



>gb|ACU17741.1| unknown [Glycine max]
Length=436

 Score =   264 bits (674),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 134/170 (79%), Positives = 151/170 (89%), Gaps = 0/170 (0%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            +ALYG S+PVLQL PSNFKSKVLNSNGVVLVEFFAPWCGHC+ALTP +EK A+VLKGV T
Sbjct  27   HALYGASSPVLQLTPSNFKSKVLNSNGVVLVEFFAPWCGHCQALTPIWEKAATVLKGVVT  86

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDR  511
            VAA+DADAH SLAQEYGI+GFPTIKVF PGK PVDYQGAR+ K + +F   Q++ LLKDR
Sbjct  87   VAAIDADAHPSLAQEYGIRGFPTIKVFAPGKPPVDYQGARDVKPIAEFALQQVKALLKDR  146

Query  512  LDGKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            L GKATGGSS K+E S+SVELNS NFD+LV+KSK+LWIVEFFAPWCGHCK
Sbjct  147  LSGKATGGSSDKTETSSSVELNSGNFDELVIKSKELWIVEFFAPWCGHCK  196


 Score = 80.5 bits (197),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 45/106 (42%), Positives = 64/106 (60%), Gaps = 1/106 (1%)
 Frame = +2

Query  182  LQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaaldadahs  361
            ++LN  NF   V+ S  + +VEFFAPWCGHCK L P ++K ++ LKG   +  +D DA  
Sbjct  165  VELNSGNFDELVIKSKELWIVEFFAPWCGHCKKLAPEWKKASNSLKGKVKLGHVDCDAEK  224

Query  362  slaQEYGIKGFPTIKVFVPGKQ-PVDYQGAREAKSMVDFVKAQIRN  496
            SL   + ++GFPTI VF   K  P+ Y+GAR A ++  F   Q+  
Sbjct  225  SLMSRFKVQGFPTILVFGADKDSPIPYEGARTALAIESFALEQLET  270



>gb|EPS59466.1| hypothetical protein M569_15341, partial [Genlisea aurea]
Length=197

 Score =   256 bits (653),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 135/169 (80%), Positives = 151/169 (89%), Gaps = 0/169 (0%)
 Frame = +2

Query  155  ALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATV  334
            ALYGPS+ V+QLN +NFKSKVLNSNGVVLVEFFAPWCGHC+ALTPT+EK A++LKGVATV
Sbjct  1    ALYGPSSLVVQLNSNNFKSKVLNSNGVVLVEFFAPWCGHCQALTPTWEKAANILKGVATV  60

Query  335  aaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDRL  514
            AA+DADAH SLAQEYGIKGFPTIKVF PGK PVDYQGARE K + +F   QI+ LL DRL
Sbjct  61   AAVDADAHKSLAQEYGIKGFPTIKVFAPGKPPVDYQGAREVKPIAEFAVKQIKALLSDRL  120

Query  515  DGKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            +GK   GSS+KSEPSASVELNSRNFD+LV+ SK+LWIVEFFAPWCGHCK
Sbjct  121  NGKTPEGSSEKSEPSASVELNSRNFDELVINSKELWIVEFFAPWCGHCK  169


 Score = 60.8 bits (146),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 29/52 (56%), Positives = 35/52 (67%), Gaps = 1/52 (2%)
 Frame = +2

Query  167  PSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKG  322
            PS  V +LN  NF   V+NS  + +VEFFAPWCGHCK L P ++K A  LKG
Sbjct  134  PSASV-ELNSRNFDELVINSKELWIVEFFAPWCGHCKKLAPEWKKAAKNLKG  184



>ref|XP_010509948.1| PREDICTED: protein disulfide-isomerase 2-3 isoform X1 [Camelina 
sativa]
 ref|XP_010509949.1| PREDICTED: protein disulfide-isomerase 2-3 isoform X2 [Camelina 
sativa]
Length=440

 Score =   263 bits (673),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 137/174 (79%), Positives = 155/174 (89%), Gaps = 4/174 (2%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            +ALYG S+PV+QL  SNFKSKVLNSNGVVLVEFFAPWCGHCKALTPT+EKVA++LKGVAT
Sbjct  23   SALYGSSSPVVQLTASNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTWEKVANILKGVAT  82

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDR  511
            VAA+DADAH S AQ+YGIKGFPTIKVFVPGK PVDYQGAR+AKS+ +F   QI+ LL DR
Sbjct  83   VAAIDADAHQSAAQDYGIKGFPTIKVFVPGKPPVDYQGARDAKSIANFAYKQIKGLLSDR  142

Query  512  LDGKA--TGGSS--QKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            L+GK+  TGG S  +KSEPSASVELNS NFD+LV+KS +LWIVEFFAPWCGHCK
Sbjct  143  LEGKSKPTGGGSNEKKSEPSASVELNSSNFDELVIKSNELWIVEFFAPWCGHCK  196


 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 46/111 (41%), Positives = 65/111 (59%), Gaps = 2/111 (2%)
 Frame = +2

Query  167  PSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaald  346
            PS  V +LN SNF   V+ SN + +VEFFAPWCGHCK L P ++K A  LKG   +  ++
Sbjct  161  PSASV-ELNSSNFDELVIKSNELWIVEFFAPWCGHCKKLAPEWKKAAKNLKGKVKLGHVN  219

Query  347  adahsslaQEYGIKGFPTIKVF-VPGKQPVDYQGAREAKSMVDFVKAQIRN  496
             D   S+   + ++GFPTI VF +   +P  Y GAR A ++  F    + +
Sbjct  220  CDVEQSIMSRFKVQGFPTILVFGLDKSRPNSYDGARTASAIESFASELVES  270



>ref|NP_180851.1| protein disulfide-isomerase like 2-3 [Arabidopsis thaliana]
 sp|O48773.1|PDI23_ARATH RecName: Full=Protein disulfide-isomerase 2-3; Short=AtPDIL2-3; 
AltName: Full=Protein disulfide-isomerase 5-2; Short=AtPDIL5-2; 
AltName: Full=Protein disulfide-isomerase 9; Short=PDI9; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAB91984.1| putative protein disulfide isomerase [Arabidopsis thaliana]
 gb|AAL06929.1| At2g32920/T21L14.14 [Arabidopsis thaliana]
 gb|AAL61928.1| putative protein disulfide isomerase [Arabidopsis thaliana]
 gb|AAM91128.1| putative protein disulfide isomerase [Arabidopsis thaliana]
 gb|AEC08762.1| protein disulfide-isomerase like 2-3 [Arabidopsis thaliana]
Length=440

 Score =   263 bits (672),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 135/174 (78%), Positives = 155/174 (89%), Gaps = 4/174 (2%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            +ALYG S+PV+QL  SNFKSKVLNSNGVVLVEFFAPWCGHCKALTPT+EKVA++LKGVAT
Sbjct  23   SALYGSSSPVVQLTASNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTWEKVANILKGVAT  82

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDR  511
            VAA+DADAH S AQ+YGIKGFPTIKVFVPGK P+DYQGAR+AKS+ +F   QI+ LL DR
Sbjct  83   VAAIDADAHQSAAQDYGIKGFPTIKVFVPGKAPIDYQGARDAKSIANFAYKQIKGLLSDR  142

Query  512  LDGKA--TGGSS--QKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            L+GK+  TGG S  +KSEPSASVELN+ NFDDLV++S +LWIVEFFAPWCGHCK
Sbjct  143  LEGKSKPTGGGSKEKKSEPSASVELNASNFDDLVIESNELWIVEFFAPWCGHCK  196


 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 46/111 (41%), Positives = 66/111 (59%), Gaps = 2/111 (2%)
 Frame = +2

Query  167  PSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaald  346
            PS  V +LN SNF   V+ SN + +VEFFAPWCGHCK L P +++ A  L+G   +  ++
Sbjct  161  PSASV-ELNASNFDDLVIESNELWIVEFFAPWCGHCKKLAPEWKRAAKNLQGKVKLGHVN  219

Query  347  adahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRN  496
             D   S+   + ++GFPTI VF P K  P  Y+GAR A ++  F    + +
Sbjct  220  CDVEQSIMSRFKVQGFPTILVFGPDKSSPYPYEGARSASAIESFASELVES  270



>ref|XP_008342147.1| PREDICTED: protein disulfide isomerase-like 2-3 [Malus domestica]
Length=434

 Score =   263 bits (672),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 137/170 (81%), Positives = 153/170 (90%), Gaps = 0/170 (0%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            +ALYGPS+PVLQL PSNFKSKVL+SN VVLVEFFAPWCGHC+ALTP +EK A+VLKGV  
Sbjct  23   DALYGPSSPVLQLTPSNFKSKVLDSNRVVLVEFFAPWCGHCQALTPIWEKAATVLKGVVA  82

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDR  511
            VAALDADAH SLAQEYGI+GFPTIKVFVPGK PVDYQGAR+ K + +F   QI+ LLKDR
Sbjct  83   VAALDADAHKSLAQEYGIRGFPTIKVFVPGKPPVDYQGARDVKPIAEFALQQIKALLKDR  142

Query  512  LDGKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            L GK TGGSS+KSEPSASVELNS+NF++LV+KSKDLWIVEFFAPWCGHCK
Sbjct  143  LSGKTTGGSSEKSEPSASVELNSQNFNELVLKSKDLWIVEFFAPWCGHCK  192


 Score = 82.4 bits (202),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 49/111 (44%), Positives = 66/111 (59%), Gaps = 2/111 (2%)
 Frame = +2

Query  167  PSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaald  346
            PS  V +LN  NF   VL S  + +VEFFAPWCGHCK L P ++K A  L+G   +  +D
Sbjct  157  PSASV-ELNSQNFNELVLKSKDLWIVEFFAPWCGHCKKLAPEWKKAAKNLQGKVKLGHVD  215

Query  347  adahsslaQEYGIKGFPTIKVFVPGKQ-PVDYQGAREAKSMVDFVKAQIRN  496
             DA  SL  ++ ++GFPTI VF   K  P+ Y+GAR A ++  F   Q+  
Sbjct  216  CDAEKSLMSKFNVQGFPTILVFGADKDSPLPYEGARSASAIESFALEQLET  266



>ref|XP_006294195.1| hypothetical protein CARUB_v10023191mg, partial [Capsella rubella]
 gb|EOA27093.1| hypothetical protein CARUB_v10023191mg, partial [Capsella rubella]
Length=452

 Score =   263 bits (673),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 136/174 (78%), Positives = 155/174 (89%), Gaps = 4/174 (2%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            +ALYG S+PV+QL  SNFKSKVLNSNGVVLVEFFAPWCGHCKALTPT+EKVA++LKGVAT
Sbjct  35   SALYGSSSPVVQLTASNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTWEKVANILKGVAT  94

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDR  511
            VAA+DADAH S AQ+YGIKGFPTIKVFVPGK P+DYQGAR+AKS+ +F   QI+ LL DR
Sbjct  95   VAAIDADAHQSAAQDYGIKGFPTIKVFVPGKPPIDYQGARDAKSIANFAYKQIKGLLSDR  154

Query  512  LDGKA--TGGSS--QKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            L+GK+  TGG S  +KSEPSASVELNS NFD+LV+KS +LWIVEFFAPWCGHCK
Sbjct  155  LEGKSKPTGGGSNEKKSEPSASVELNSSNFDELVIKSNELWIVEFFAPWCGHCK  208


 Score = 82.4 bits (202),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 46/111 (41%), Positives = 64/111 (58%), Gaps = 2/111 (2%)
 Frame = +2

Query  167  PSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaald  346
            PS  V +LN SNF   V+ SN + +VEFFAPWCGHCK L P ++K A  LKG   +  ++
Sbjct  173  PSASV-ELNSSNFDELVIKSNELWIVEFFAPWCGHCKKLAPEWKKAAKNLKGKVNLGHVN  231

Query  347  adahsslaQEYGIKGFPTIKVF-VPGKQPVDYQGAREAKSMVDFVKAQIRN  496
             D   S+   + ++GFPTI VF +    P  Y GAR A ++  F    + +
Sbjct  232  CDVEQSIMSRFKVQGFPTILVFGLDKSNPTPYDGARSASAIESFASELVES  282



>ref|XP_002460311.1| hypothetical protein SORBIDRAFT_02g026300 [Sorghum bicolor]
 gb|EER96832.1| hypothetical protein SORBIDRAFT_02g026300 [Sorghum bicolor]
Length=439

 Score =   262 bits (669),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 135/176 (77%), Positives = 152/176 (86%), Gaps = 8/176 (5%)
 Frame = +2

Query  158  LYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVa  337
            LY   +PVLQLNP+NFKSKVLNSNGVVLVEFFAPWCGHCK L P +EK A VLKGVATVA
Sbjct  22   LYSAGSPVLQLNPNNFKSKVLNSNGVVLVEFFAPWCGHCKQLAPAWEKAAGVLKGVATVA  81

Query  338  aldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDRLD  517
            ALDADAH +LAQEYGI+GFPTIKVF PGK PVDYQGAR+ K +V+F  +Q+++LL++RL 
Sbjct  82   ALDADAHQALAQEYGIRGFPTIKVFSPGKPPVDYQGARDVKPIVEFALSQVKSLLRERLS  141

Query  518  GKA--------TGGSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            GKA        +GGSS+KSEPSASVELNSRNFD+LVVKSKDLWIVEFFAPWCGHCK
Sbjct  142  GKASAGSNGKTSGGSSEKSEPSASVELNSRNFDELVVKSKDLWIVEFFAPWCGHCK  197


 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 50/110 (45%), Positives = 66/110 (60%), Gaps = 2/110 (2%)
 Frame = +2

Query  167  PSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaald  346
            PS  V +LN  NF   V+ S  + +VEFFAPWCGHCK L P ++K A  LKG   +  +D
Sbjct  162  PSASV-ELNSRNFDELVVKSKDLWIVEFFAPWCGHCKKLAPEWKKAAKNLKGQVKLGHVD  220

Query  347  adahsslaQEYGIKGFPTIKVFVPGKQ-PVDYQGAREAKSMVDFVKAQIR  493
             DA  SL  +Y ++GFPTI VF   K+ P  YQGAR + ++  F   Q+ 
Sbjct  221  CDAEKSLMSKYKVEGFPTILVFGADKESPFLYQGARVSSAIESFALEQLE  270



>ref|XP_010469533.1| PREDICTED: protein disulfide-isomerase 2-3-like [Camelina sativa]
Length=440

 Score =   262 bits (669),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 135/174 (78%), Positives = 155/174 (89%), Gaps = 4/174 (2%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            +ALYG S+PV+QL  SNFKSKVLNSNGVVLVEFFAPWCGHCK+LTPT+EKVA++LKGVAT
Sbjct  23   SALYGSSSPVVQLTASNFKSKVLNSNGVVLVEFFAPWCGHCKSLTPTWEKVANILKGVAT  82

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDR  511
            VAA+DADAH S AQ+YGIKGFPTIKVFVPGK P+DYQGAR+AKS+ +F   QI+ LL DR
Sbjct  83   VAAIDADAHQSAAQDYGIKGFPTIKVFVPGKPPIDYQGARDAKSIANFAYKQIKGLLSDR  142

Query  512  LDGKA--TGGSS--QKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            L+GK+  TGG S  +KSEPSASVELNS NFD+LV+KS +LWIVEFFAPWCGHCK
Sbjct  143  LEGKSKPTGGGSNEKKSEPSASVELNSSNFDELVIKSNELWIVEFFAPWCGHCK  196


 Score = 82.8 bits (203),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 46/111 (41%), Positives = 64/111 (58%), Gaps = 2/111 (2%)
 Frame = +2

Query  167  PSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaald  346
            PS  V +LN SNF   V+ SN + +VEFFAPWCGHCK L P ++K A  LKG   +  ++
Sbjct  161  PSASV-ELNSSNFDELVIKSNELWIVEFFAPWCGHCKKLAPEWKKAAKNLKGKVNLGHVN  219

Query  347  adahsslaQEYGIKGFPTIKVF-VPGKQPVDYQGAREAKSMVDFVKAQIRN  496
             D   S+   + ++GFPTI VF +    P  Y GAR A ++  F    + +
Sbjct  220  CDVEQSIMSRFKVQGFPTILVFGLDKSSPTSYDGARTASAIESFASELVES  270



>emb|CDY53400.1| BnaAnng12480D [Brassica napus]
Length=338

 Score =   258 bits (658),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 131/176 (74%), Positives = 151/176 (86%), Gaps = 6/176 (3%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            NALYG S+PVLQL PSNFKSKV+NSNGVVLVEFFAPWCGHCK+LTPT+EKVA+ LKG+AT
Sbjct  27   NALYGSSSPVLQLTPSNFKSKVINSNGVVLVEFFAPWCGHCKSLTPTWEKVATTLKGIAT  86

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDR  511
            VAA+DADAH S++Q+YG++GFPTIKVFVPGK P+DYQGAR+AK++  F   QI+ LLKDR
Sbjct  87   VAAIDADAHKSVSQDYGVRGFPTIKVFVPGKPPIDYQGARDAKAISQFAIKQIKALLKDR  146

Query  512  LD------GKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            LD          G S +KSEPSASVELNS NFD+LV +SKDLWIVEFFAPWCGHCK
Sbjct  147  LDGKTTGTNTGGGSSEKKSEPSASVELNSSNFDELVTESKDLWIVEFFAPWCGHCK  202


 Score = 84.0 bits (206),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 49/110 (45%), Positives = 65/110 (59%), Gaps = 2/110 (2%)
 Frame = +2

Query  167  PSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaald  346
            PS  V +LN SNF   V  S  + +VEFFAPWCGHCK L P ++K A  LKG   +  +D
Sbjct  167  PSASV-ELNSSNFDELVTESKDLWIVEFFAPWCGHCKKLAPEWKKAAKNLKGKVKLGHVD  225

Query  347  adahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIR  493
             DA  ++   + +KGFPTI VF   K  P+ Y+GAR A ++  F   Q+ 
Sbjct  226  CDADKAIQSRFKVKGFPTILVFGADKSSPLPYEGARSASAIESFALEQLE  275



>ref|NP_001105804.1| protein disulfide isomerase8 precursor [Zea mays]
 gb|AAX09966.1| protein disulfide isomerase [Zea mays]
 gb|ACF78413.1| unknown [Zea mays]
 tpg|DAA61729.1| TPA: putative protein disulfide isomerase family protein [Zea 
mays]
Length=439

 Score =   261 bits (666),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 135/171 (79%), Positives = 150/171 (88%), Gaps = 8/171 (5%)
 Frame = +2

Query  173  TPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaaldad  352
            +PVLQLNP+NFKSKVLNSNGVVLVEFFAPWCGHCK L P +EK A VLKGVATVAALDAD
Sbjct  27   SPVLQLNPNNFKSKVLNSNGVVLVEFFAPWCGHCKQLAPAWEKAAGVLKGVATVAALDAD  86

Query  353  ahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDRLDGKA--  526
            AH +LAQEYGIKGFPTIKVF PGK PVDYQGAR+ K +V+F  +Q+++LL+DRL GKA  
Sbjct  87   AHQALAQEYGIKGFPTIKVFSPGKPPVDYQGARDVKPIVEFALSQVKSLLRDRLSGKASA  146

Query  527  ------TGGSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
                  +GGSS+KSEPSASVELNSRNFD+LVVKSKDLWIVEFFAPWCGHCK
Sbjct  147  GSNGKTSGGSSEKSEPSASVELNSRNFDELVVKSKDLWIVEFFAPWCGHCK  197


 Score = 84.0 bits (206),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 51/110 (46%), Positives = 66/110 (60%), Gaps = 2/110 (2%)
 Frame = +2

Query  167  PSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaald  346
            PS  V +LN  NF   V+ S  + +VEFFAPWCGHCK L P ++K A  LKG   +  +D
Sbjct  162  PSASV-ELNSRNFDELVVKSKDLWIVEFFAPWCGHCKKLAPEWKKAAKNLKGQVKLGHVD  220

Query  347  adahsslaQEYGIKGFPTIKVFVPGKQ-PVDYQGAREAKSMVDFVKAQIR  493
             DA  SL  +Y ++GFPTI VF   K+ P  YQGAR A ++  F   Q+ 
Sbjct  221  CDAEKSLMSKYKVEGFPTILVFGADKESPFPYQGARVASAIESFALEQLE  270



>ref|XP_007141667.1| hypothetical protein PHAVU_008G215100g [Phaseolus vulgaris]
 gb|ESW13661.1| hypothetical protein PHAVU_008G215100g [Phaseolus vulgaris]
Length=436

 Score =   259 bits (663),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 133/169 (79%), Positives = 151/169 (89%), Gaps = 0/169 (0%)
 Frame = +2

Query  155  ALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATV  334
            ALYG S+PVLQL  SNFKSKVLN+NGVVLVEFFAPWCGHCKALTP +EK A+VLKGV TV
Sbjct  26   ALYGASSPVLQLTASNFKSKVLNANGVVLVEFFAPWCGHCKALTPIWEKAATVLKGVVTV  85

Query  335  aaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDRL  514
            AALDADAHSSLAQEYGIKGFPTIKVF PGK P DYQGAR+ K + +F   Q++ LLK+RL
Sbjct  86   AALDADAHSSLAQEYGIKGFPTIKVFAPGKPPADYQGARDVKPIAEFALQQVKALLKERL  145

Query  515  DGKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            +GKATGGS++K+E S+SVELNS NFD+LV+KSK+LWIVEFFAPWCGHCK
Sbjct  146  NGKATGGSNEKTETSSSVELNSGNFDELVLKSKELWIVEFFAPWCGHCK  194


 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 46/106 (43%), Positives = 64/106 (60%), Gaps = 1/106 (1%)
 Frame = +2

Query  182  LQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaaldadahs  361
            ++LN  NF   VL S  + +VEFFAPWCGHCK L P ++K ++ LKG   +  +D DA  
Sbjct  163  VELNSGNFDELVLKSKELWIVEFFAPWCGHCKKLAPEWKKASNNLKGKVKLGHVDCDAEK  222

Query  362  slaQEYGIKGFPTIKVFVPGKQ-PVDYQGAREAKSMVDFVKAQIRN  496
            SL   + ++GFPTI VF   K  P+ Y+GAR A ++  F   Q+  
Sbjct  223  SLMSRFKVQGFPTILVFGADKDSPIPYEGARTAAAIESFALEQLET  268



>ref|XP_010413931.1| PREDICTED: protein disulfide-isomerase 2-3-like [Camelina sativa]
Length=440

 Score =   259 bits (663),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 134/174 (77%), Positives = 154/174 (89%), Gaps = 4/174 (2%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            +ALYG S+PV+QL  SNFKSKVLNSNGVVLVEFFAPWCGHCKALTPT+EKVA++LKGVAT
Sbjct  23   SALYGSSSPVVQLTASNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTWEKVANILKGVAT  82

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDR  511
            VAA+DADAH S AQ+YGI+ FPTIKVFVPGK P+DYQGAR+AKS+ +F   QI+ LL DR
Sbjct  83   VAAIDADAHQSAAQDYGIQSFPTIKVFVPGKPPIDYQGARDAKSIANFAYKQIKGLLSDR  142

Query  512  LDGKA--TGGSS--QKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            L+GK+  TGG S  +KSEPSASVELNS NFD+LV+KS +LWIVEFFAPWCGHCK
Sbjct  143  LEGKSKPTGGGSNEKKSEPSASVELNSSNFDELVIKSNELWIVEFFAPWCGHCK  196


 Score = 82.8 bits (203),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 46/111 (41%), Positives = 64/111 (58%), Gaps = 2/111 (2%)
 Frame = +2

Query  167  PSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaald  346
            PS  V +LN SNF   V+ SN + +VEFFAPWCGHCK L P ++K A  LKG   +  ++
Sbjct  161  PSASV-ELNSSNFDELVIKSNELWIVEFFAPWCGHCKKLAPEWKKAAKNLKGKVNLGHVN  219

Query  347  adahsslaQEYGIKGFPTIKVF-VPGKQPVDYQGAREAKSMVDFVKAQIRN  496
             D   S+   + ++GFPTI VF +    P  Y GAR A ++  F    + +
Sbjct  220  CDVEQSIMSRFKVQGFPTILVFGLDKSSPTSYDGARTASAIESFASELVES  270



>emb|CDX79497.1| BnaC03g18330D [Brassica napus]
Length=443

 Score =   259 bits (662),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 135/174 (78%), Positives = 152/174 (87%), Gaps = 4/174 (2%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            NALYG S+PV+QL  SNFKSKVLNSNGVVLVEFFAPWCGHCKALTPT+EKVA VLKGVAT
Sbjct  24   NALYGSSSPVVQLTASNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTWEKVAGVLKGVAT  83

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDR  511
            VAA+DADAH S AQ+YGIKGFPTI VFVPGK PVDYQGAR+AKS+ +F   Q++ L+ +R
Sbjct  84   VAAIDADAHQSAAQDYGIKGFPTITVFVPGKPPVDYQGARDAKSIANFAYKQVKALVSNR  143

Query  512  LDGKAT---GGSSQ-KSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            L+GK+    GGSS+ KSEPSASVEL S NFD+LV+KS DLWIVEFFAPWCGHCK
Sbjct  144  LEGKSKPNGGGSSERKSEPSASVELTSSNFDELVIKSNDLWIVEFFAPWCGHCK  197


 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 46/104 (44%), Positives = 62/104 (60%), Gaps = 2/104 (2%)
 Frame = +2

Query  167  PSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaald  346
            PS  V +L  SNF   V+ SN + +VEFFAPWCGHCK L P ++K A  LKG   +  ++
Sbjct  162  PSASV-ELTSSNFDELVIKSNDLWIVEFFAPWCGHCKKLAPEWKKAAKNLKGKVKLGHVN  220

Query  347  adahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDF  475
             D   S+   + ++GFPTI VF   K  P  Y+GAR A ++  F
Sbjct  221  CDVEQSIMSRFKVQGFPTIMVFGADKSSPYAYEGARSASAIESF  264



>ref|XP_002881252.1| hypothetical protein ARALYDRAFT_482234 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57511.1| hypothetical protein ARALYDRAFT_482234 [Arabidopsis lyrata subsp. 
lyrata]
Length=440

 Score =   258 bits (660),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 133/174 (76%), Positives = 154/174 (89%), Gaps = 4/174 (2%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            +ALYG S+PV+QL  SNFKSKVLNSNGVVLVEFFAPWCGHCKALTPT+EKVA++LKGVAT
Sbjct  23   SALYGSSSPVVQLTASNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTWEKVANILKGVAT  82

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDR  511
            VAA+DADAH S AQ+YGIKGFPTIKVFVPGK P+DYQG R+AKS+ +F   QI+ LL DR
Sbjct  83   VAAIDADAHQSAAQDYGIKGFPTIKVFVPGKAPIDYQGERDAKSIANFAYKQIKGLLSDR  142

Query  512  LDGKA--TGGSS--QKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            L+GK+  TGG S  +KSEPSASVELN+ NFD+LV++S +LWIVEFFAPWCGHCK
Sbjct  143  LEGKSKPTGGGSKEKKSEPSASVELNAGNFDELVIESNELWIVEFFAPWCGHCK  196


 Score = 83.6 bits (205),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 46/111 (41%), Positives = 65/111 (59%), Gaps = 2/111 (2%)
 Frame = +2

Query  167  PSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaald  346
            PS  V +LN  NF   V+ SN + +VEFFAPWCGHCK L P ++K A  L+G   +  ++
Sbjct  161  PSASV-ELNAGNFDELVIESNELWIVEFFAPWCGHCKKLAPEWKKAAKNLQGKVKLGHVN  219

Query  347  adahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRN  496
             D   S+   + ++GFPTI VF P K  P  Y+GAR A ++  F    + +
Sbjct  220  CDVEQSIMSRFKVQGFPTILVFGPDKSSPYPYEGARSASAIESFASELVES  270



>ref|XP_003616851.1| Protein disulfide isomerase family [Medicago truncatula]
 gb|AES99809.1| protein disulfide isomerase-like protein [Medicago truncatula]
Length=435

 Score =   258 bits (659),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 133/172 (77%), Positives = 152/172 (88%), Gaps = 2/172 (1%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            +ALYG S+PVLQL P+NFKSKVLNSNGVVLVEFFAPWCGHCKALTP +EK A+VLKGV T
Sbjct  21   HALYGSSSPVLQLTPNNFKSKVLNSNGVVLVEFFAPWCGHCKALTPIWEKAATVLKGVVT  80

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDR  511
            VAALDADAH SLAQEYGI+GFPTIKVF PGK PVDYQGAR+ K + +F   Q++ LLK+R
Sbjct  81   VAALDADAHQSLAQEYGIRGFPTIKVFSPGKPPVDYQGARDVKPIAEFALQQVKALLKER  140

Query  512  LDGKATGGSSQKSEPSA--SVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            L+GKATGGS++K E +A  SVELNS NFD+LV+KSK+LWIVEFFAPWCGHCK
Sbjct  141  LNGKATGGSNEKKESTASSSVELNSSNFDELVIKSKELWIVEFFAPWCGHCK  192


 Score = 82.4 bits (202),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 45/106 (42%), Positives = 65/106 (61%), Gaps = 1/106 (1%)
 Frame = +2

Query  182  LQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaaldadahs  361
            ++LN SNF   V+ S  + +VEFFAPWCGHCK L P +++ ++ LKG   +  +D DA  
Sbjct  161  VELNSSNFDELVIKSKELWIVEFFAPWCGHCKKLAPEWKRASNNLKGKVKLGHVDCDADK  220

Query  362  slaQEYGIKGFPTIKVFVPGKQ-PVDYQGAREAKSMVDFVKAQIRN  496
            SL   + ++GFPTI VF   K  P+ Y+GAR A ++  F   Q+  
Sbjct  221  SLMSRFNVQGFPTILVFGADKDTPIPYEGARTAAAIESFALEQLET  266



>gb|KDP30825.1| hypothetical protein JCGZ_13768 [Jatropha curcas]
Length=434

 Score =   258 bits (658),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 139/170 (82%), Positives = 158/170 (93%), Gaps = 0/170 (0%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            NALYGPS+PV+QLNPSNFKSKVLNSNGVVLVEFFAPWCGHC+ALTP +EK A++LKGVAT
Sbjct  23   NALYGPSSPVVQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCQALTPIWEKAANILKGVAT  82

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDR  511
            VAALDADAH SLAQEYGI+GFPTIKVF PGK PVDYQGAREAK + +F   QI+ LLKDR
Sbjct  83   VAALDADAHQSLAQEYGIRGFPTIKVFAPGKPPVDYQGAREAKPIAEFALQQIKALLKDR  142

Query  512  LDGKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            L GK++GGSS+KSEP+AS+ELNSRNFD+LV+KSK+LW+VEFFAPWCGHCK
Sbjct  143  LSGKSSGGSSEKSEPNASIELNSRNFDELVIKSKELWVVEFFAPWCGHCK  192


 Score = 83.6 bits (205),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 47/106 (44%), Positives = 64/106 (60%), Gaps = 1/106 (1%)
 Frame = +2

Query  182  LQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaaldadahs  361
            ++LN  NF   V+ S  + +VEFFAPWCGHCK L P ++K AS LKG   +  +D DA  
Sbjct  161  IELNSRNFDELVIKSKELWVVEFFAPWCGHCKKLAPEWKKAASNLKGKVKLGHVDCDAEK  220

Query  362  slaQEYGIKGFPTIKVFVPGKQ-PVDYQGAREAKSMVDFVKAQIRN  496
            SL   + ++GFPTI VF   K  P+ Y+GAR A ++  F   Q+  
Sbjct  221  SLMSRFNVQGFPTILVFGADKDSPIPYEGARTASAIESFALDQLET  266



>emb|CDY18278.1| BnaC05g03010D [Brassica napus]
Length=436

 Score =   257 bits (657),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 131/176 (74%), Positives = 151/176 (86%), Gaps = 6/176 (3%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            NALYG S+PVLQL PSNFKSKV+NSNGVVLVEFFAPWCGHCK+LTPT+EKVA+ LKG+AT
Sbjct  26   NALYGSSSPVLQLTPSNFKSKVINSNGVVLVEFFAPWCGHCKSLTPTWEKVATTLKGIAT  85

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDR  511
            VAA+DADAH S++Q+YG++GFPTIKVFVPGK P+DYQGAR+AK++  F   QI+ LLKDR
Sbjct  86   VAAIDADAHKSVSQDYGVRGFPTIKVFVPGKPPIDYQGARDAKAISQFAIKQIKALLKDR  145

Query  512  LD------GKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            LD          G S +KSEPSASVELNS NFD+LV +SKDLWIVEFFAPWCGHCK
Sbjct  146  LDGKTTGTNTGGGSSEKKSEPSASVELNSSNFDELVTESKDLWIVEFFAPWCGHCK  201


 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 49/110 (45%), Positives = 65/110 (59%), Gaps = 2/110 (2%)
 Frame = +2

Query  167  PSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaald  346
            PS  V +LN SNF   V  S  + +VEFFAPWCGHCK L P ++K A  LKG   +  +D
Sbjct  166  PSASV-ELNSSNFDELVTESKDLWIVEFFAPWCGHCKKLAPEWKKAAKNLKGKVKLGHVD  224

Query  347  adahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIR  493
             DA  ++   + +KGFPTI VF   K  P+ Y+GAR A ++  F   Q+ 
Sbjct  225  CDADKAIQSRFKVKGFPTILVFGADKSSPLPYEGARSASAIESFALEQLE  274



>ref|XP_009119218.1| PREDICTED: protein disulfide-isomerase like 2-2 [Brassica rapa]
Length=438

 Score =   257 bits (657),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 131/176 (74%), Positives = 151/176 (86%), Gaps = 6/176 (3%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            NALYG S+PVLQL PSNFKSKV+NSNGVVLVEFFAPWCGHCK+LTPT+EKVA+ LKG+AT
Sbjct  28   NALYGSSSPVLQLTPSNFKSKVINSNGVVLVEFFAPWCGHCKSLTPTWEKVATTLKGIAT  87

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDR  511
            VAA+DADAH S++Q+YG++GFPTIKVFVPGK P+DYQGAR+AK++  F   QI+ LLKDR
Sbjct  88   VAAIDADAHKSVSQDYGVRGFPTIKVFVPGKPPIDYQGARDAKAISQFAIKQIKALLKDR  147

Query  512  LD------GKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            LD          G S +KSEPSASVELNS NFD+LV +SKDLWIVEFFAPWCGHCK
Sbjct  148  LDGKTTGTTTGGGSSEKKSEPSASVELNSSNFDELVTESKDLWIVEFFAPWCGHCK  203


 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 49/110 (45%), Positives = 65/110 (59%), Gaps = 2/110 (2%)
 Frame = +2

Query  167  PSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaald  346
            PS  V +LN SNF   V  S  + +VEFFAPWCGHCK L P ++K A  LKG   +  +D
Sbjct  168  PSASV-ELNSSNFDELVTESKDLWIVEFFAPWCGHCKKLAPEWKKAAKNLKGKVKLGHVD  226

Query  347  adahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIR  493
             DA  ++   + +KGFPTI VF   K  P+ Y+GAR A ++  F   Q+ 
Sbjct  227  CDADKAIQSRFKVKGFPTILVFGADKSSPLPYEGARSASAIESFALEQLE  276



>ref|XP_009606235.1| PREDICTED: protein disulfide isomerase-like 2-3 [Nicotiana tomentosiformis]
Length=432

 Score =   255 bits (652),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 139/170 (82%), Positives = 156/170 (92%), Gaps = 0/170 (0%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            NALYGPS+PVLQLNP+NFKSKVLNSNG+VLVEFFAPWCGHC++LTP +EK A++LKGVAT
Sbjct  21   NALYGPSSPVLQLNPNNFKSKVLNSNGIVLVEFFAPWCGHCQSLTPHWEKAATILKGVAT  80

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDR  511
            VAALDADAH SLAQEYGI+GFPTIKVF PGK PVDYQGAREAK + +F   QI+ LLK+R
Sbjct  81   VAALDADAHKSLAQEYGIRGFPTIKVFAPGKPPVDYQGAREAKPIAEFALQQIKTLLKER  140

Query  512  LDGKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            + GKATGGSS+ SEPSASVELNSRNFD+ V+KSKDLWIVEFFAPWCGHCK
Sbjct  141  VHGKATGGSSESSEPSASVELNSRNFDEKVLKSKDLWIVEFFAPWCGHCK  190


 Score = 82.4 bits (202),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 48/104 (46%), Positives = 62/104 (60%), Gaps = 1/104 (1%)
 Frame = +2

Query  188  LNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaaldadahssl  367
            LN  NF  KVL S  + +VEFFAPWCGHCK L P ++K A  L+G   +  +D DA  SL
Sbjct  161  LNSRNFDEKVLKSKDLWIVEFFAPWCGHCKKLAPEWKKAAKNLEGKVKLGHVDCDAEKSL  220

Query  368  aQEYGIKGFPTIKVFVPGKQ-PVDYQGAREAKSMVDFVKAQIRN  496
               + ++GFPTI VF   K  PV Y+GAR A ++  F   Q+  
Sbjct  221  MSRFNVQGFPTILVFGADKDSPVPYEGARTASAIESFGLEQLET  264



>ref|XP_002276520.1| PREDICTED: protein disulfide isomerase-like 2-3 [Vitis vinifera]
 emb|CBI28881.3| unnamed protein product [Vitis vinifera]
Length=433

 Score =   255 bits (651),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 138/168 (82%), Positives = 153/168 (91%), Gaps = 0/168 (0%)
 Frame = +2

Query  158  LYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVa  337
            LYGPS+PV+QLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPT+EK ASVLKGVATVA
Sbjct  28   LYGPSSPVVQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTWEKAASVLKGVATVA  87

Query  338  aldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDRLD  517
            ALDADA+ +LAQEYGI+GFPTIKVF PGK PVDYQGAR+ K + +F   QI+ LLK+RL 
Sbjct  88   ALDADANQALAQEYGIRGFPTIKVFAPGKPPVDYQGARDVKPIAEFALQQIKALLKERLS  147

Query  518  GKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            GKATGGSS+KSE S+SVEL S NFD+LV+KSKDLWIVEFFAPWCGHCK
Sbjct  148  GKATGGSSEKSEISSSVELTSSNFDELVLKSKDLWIVEFFAPWCGHCK  195


 Score = 82.4 bits (202),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 47/104 (45%), Positives = 62/104 (60%), Gaps = 1/104 (1%)
 Frame = +2

Query  188  LNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaaldadahssl  367
            L  SNF   VL S  + +VEFFAPWCGHCK L P ++K A+ LKG   +  +D D+  SL
Sbjct  166  LTSSNFDELVLKSKDLWIVEFFAPWCGHCKKLAPEWKKAANNLKGKVKLGHVDCDSDKSL  225

Query  368  aQEYGIKGFPTIKVFVPGKQ-PVDYQGAREAKSMVDFVKAQIRN  496
               + ++GFPTI VF   K  PV Y+GAR A ++  F   Q+  
Sbjct  226  MSRFSVQGFPTILVFGADKDTPVPYEGARTASAIESFALEQLET  269



>ref|XP_010270060.1| PREDICTED: protein disulfide isomerase-like 2-3 isoform X1 [Nelumbo 
nucifera]
Length=434

 Score =   253 bits (647),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 132/170 (78%), Positives = 156/170 (92%), Gaps = 0/170 (0%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            +ALYGPS+PV+QLNPSNFK+KVLNSNGVVLVEFFAPWCGHC+ALTPT+EK A+VLKGVAT
Sbjct  23   DALYGPSSPVVQLNPSNFKNKVLNSNGVVLVEFFAPWCGHCQALTPTWEKAATVLKGVAT  82

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDR  511
            VAALDADAH SLAQEY I+GFPTIKVF PGK P+DY+GAR+AK + +F   QI+ LLK+R
Sbjct  83   VAALDADAHKSLAQEYKIQGFPTIKVFAPGKPPIDYRGARDAKGIAEFALQQIKALLKER  142

Query  512  LDGKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            + GKA+GGSS+ S+ SAS+ELNS+NFDD+V+KSKDLW+VEFFAPWCGHCK
Sbjct  143  VHGKASGGSSETSKSSASIELNSKNFDDMVLKSKDLWMVEFFAPWCGHCK  192


 Score = 83.2 bits (204),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 47/106 (44%), Positives = 62/106 (58%), Gaps = 1/106 (1%)
 Frame = +2

Query  182  LQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaaldadahs  361
            ++LN  NF   VL S  + +VEFFAPWCGHCK L P ++K A+ LKG   +  +D DA  
Sbjct  161  IELNSKNFDDMVLKSKDLWMVEFFAPWCGHCKKLAPEWKKAANNLKGKVKLGHVDCDAEK  220

Query  362  slaQEYGIKGFPTIKVFVPGKQ-PVDYQGAREAKSMVDFVKAQIRN  496
             L   + ++GFPTI VF   K  P  Y+GAR A S+  F   Q+  
Sbjct  221  FLMSRFKVEGFPTILVFGADKDSPTKYEGARFASSIESFALEQLET  266



>ref|XP_003519441.1| PREDICTED: protein disulfide isomerase-like 2-3-like [Glycine 
max]
Length=438

 Score =   253 bits (645),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 135/169 (80%), Positives = 151/169 (89%), Gaps = 0/169 (0%)
 Frame = +2

Query  155  ALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATV  334
            ALYG STPVLQL PSNFKSKVLNSNGVVLVEFFAPWCGHC+ALTP +EK A+VLKGV TV
Sbjct  28   ALYGASTPVLQLTPSNFKSKVLNSNGVVLVEFFAPWCGHCQALTPIWEKAATVLKGVVTV  87

Query  335  aaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDRL  514
            AA+DADAH SLAQEYGI+GFPTIKVF PGK PVDYQGAR+ K + +F   Q++ LLKDRL
Sbjct  88   AAIDADAHPSLAQEYGIRGFPTIKVFAPGKPPVDYQGARDVKPIAEFALQQVKALLKDRL  147

Query  515  DGKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
             GKATGGSS+K+E S+SVELNS NFD+LV+KSK+LWIVEFFAPWCGHCK
Sbjct  148  SGKATGGSSEKTETSSSVELNSGNFDELVIKSKELWIVEFFAPWCGHCK  196


 Score = 80.9 bits (198),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 45/106 (42%), Positives = 64/106 (60%), Gaps = 1/106 (1%)
 Frame = +2

Query  182  LQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaaldadahs  361
            ++LN  NF   V+ S  + +VEFFAPWCGHCK L P ++K ++ LKG   +  +D DA  
Sbjct  165  VELNSGNFDELVIKSKELWIVEFFAPWCGHCKKLAPEWKKASNNLKGKVKLGHVDCDAEK  224

Query  362  slaQEYGIKGFPTIKVFVPGKQ-PVDYQGAREAKSMVDFVKAQIRN  496
            SL   + ++GFPTI VF   K  P+ Y+GAR A ++  F   Q+  
Sbjct  225  SLMSRFKVQGFPTILVFGADKDSPIPYEGARTASAIESFALEQLET  270



>ref|XP_008668262.1| PREDICTED: uncharacterized protein LOC100381521 isoform X1 [Zea 
mays]
Length=439

 Score =   252 bits (643),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 132/175 (75%), Positives = 148/175 (85%), Gaps = 8/175 (5%)
 Frame = +2

Query  161  YGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaa  340
            Y   +PVLQLN +NFKSKVLNSN VVLVEFFAPWCGHCK L PT+EK A VLKGVATVAA
Sbjct  23   YSSGSPVLQLNSNNFKSKVLNSNRVVLVEFFAPWCGHCKQLAPTWEKAAGVLKGVATVAA  82

Query  341  ldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDRLDG  520
            LDADA  +LAQEYGIKGFPTIKVF PGK PVDYQGAR+ K +V+F  +Q++ LL+DRL G
Sbjct  83   LDADAQQALAQEYGIKGFPTIKVFSPGKSPVDYQGARDVKPIVEFALSQVKALLRDRLSG  142

Query  521  KA--------TGGSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            KA        +GGSS+K+EPSASVELNSRNFD+LVVKSKD+WIVEFFAPWCGHCK
Sbjct  143  KASAGSNGKTSGGSSEKNEPSASVELNSRNFDELVVKSKDIWIVEFFAPWCGHCK  197


 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 51/110 (46%), Positives = 66/110 (60%), Gaps = 2/110 (2%)
 Frame = +2

Query  167  PSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaald  346
            PS  V +LN  NF   V+ S  + +VEFFAPWCGHCK L P ++K A  LKG   +  +D
Sbjct  162  PSASV-ELNSRNFDELVVKSKDIWIVEFFAPWCGHCKKLAPEWKKAAKNLKGQVKLGHVD  220

Query  347  adahsslaQEYGIKGFPTIKVFVPGKQ-PVDYQGAREAKSMVDFVKAQIR  493
             DA  SL  +Y ++GFPTI VF   K+ P  YQGAR A ++  F   Q+ 
Sbjct  221  CDAEKSLMSKYKVEGFPTILVFGADKESPFPYQGARVASAIESFALEQLE  270



>ref|XP_007049203.1| PDI-like 2-2 [Theobroma cacao]
 gb|EOX93360.1| PDI-like 2-2 [Theobroma cacao]
Length=434

 Score =   251 bits (641),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 138/169 (82%), Positives = 155/169 (92%), Gaps = 0/169 (0%)
 Frame = +2

Query  155  ALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATV  334
            ALYGPS+PV+QL PSNFKSKVLNSNGVVLVEFFAPWCGHC+ALTPT+EK A+VLKGVATV
Sbjct  24   ALYGPSSPVVQLTPSNFKSKVLNSNGVVLVEFFAPWCGHCQALTPTWEKAANVLKGVATV  83

Query  335  aaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDRL  514
            AALDADAH SLAQEYGI+GFPTIK F PGK PVDYQGAR+ K + +F   Q++ LLKDRL
Sbjct  84   AALDADAHKSLAQEYGIRGFPTIKFFAPGKPPVDYQGARDVKPIAEFALQQVKALLKDRL  143

Query  515  DGKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
             GKA+GGSS+KSEPS+SVELNSRNFD+LV+KSK+LWIVEFFAPWCGHCK
Sbjct  144  AGKASGGSSEKSEPSSSVELNSRNFDELVLKSKELWIVEFFAPWCGHCK  192


 Score = 82.4 bits (202),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 46/104 (44%), Positives = 62/104 (60%), Gaps = 1/104 (1%)
 Frame = +2

Query  188  LNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaaldadahssl  367
            LN  NF   VL S  + +VEFFAPWCGHCK L P ++K A+ LKG   +  +D D+  SL
Sbjct  163  LNSRNFDELVLKSKELWIVEFFAPWCGHCKKLAPEWKKAANNLKGKVKLGHVDCDSEKSL  222

Query  368  aQEYGIKGFPTIKVFVPGKQ-PVDYQGAREAKSMVDFVKAQIRN  496
               + ++GFPTI VF   K  P+ Y+GAR A ++  F   Q+  
Sbjct  223  MSRFNVQGFPTILVFGADKDSPIPYEGARTASAIESFALEQLET  266



>dbj|BAD38009.1| putative protein disulfide-isomerase A6 precursor [Oryza sativa 
Japonica Group]
 dbj|BAD38215.1| putative protein disulfide-isomerase A6 precursor [Oryza sativa 
Japonica Group]
Length=395

 Score =   248 bits (633),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 132/178 (74%), Positives = 151/178 (85%), Gaps = 8/178 (4%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            +ALY   +PVLQ NP+NFKSKVLNSNGVVLVEFFAPWCGHC+ LTP +EK A VLKGVAT
Sbjct  22   SALYSAGSPVLQFNPNNFKSKVLNSNGVVLVEFFAPWCGHCQQLTPIWEKAAGVLKGVAT  81

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDR  511
            VAALDADAH  LAQEYGI+GFPTIKVFVPGK PVDYQGAR+ K +V+F  +Q++ LL+DR
Sbjct  82   VAALDADAHKELAQEYGIRGFPTIKVFVPGKPPVDYQGARDVKPIVEFALSQVKALLRDR  141

Query  512  LDGKA--------TGGSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            L+GK         +GGSS+K+EPSAS+ELNS+NFD LV KSKDLWIVEFFAPWCGHCK
Sbjct  142  LNGKTSAGSGGKKSGGSSEKTEPSASIELNSQNFDKLVTKSKDLWIVEFFAPWCGHCK  199


 Score = 85.9 bits (211),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 56/161 (35%), Positives = 83/161 (52%), Gaps = 13/161 (8%)
 Frame = +2

Query  182  LQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaaldadahs  361
            ++LN  NF   V  S  + +VEFFAPWCGHCK L P ++K A  LKG   +  +D DA  
Sbjct  168  IELNSQNFDKLVTKSKDLWIVEFFAPWCGHCKKLAPEWKKAAKNLKGQVKLGHVDCDAEK  227

Query  362  slaQEYGIKGFPTIKVFVPGKQ-PVDYQGAREAKSMVDFVKAQIRNLLKDRLDGKATGGS  538
            SL  +Y ++GFPTI VF   K+ P  YQGAR A ++  F   Q+          +A    
Sbjct  228  SLMSKYKVEGFPTILVFGADKESPFPYQGARVASAIESFALEQL----------EANAAP  277

Query  539  SQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
             + SE +  V    R+ + +++  +    ++    W G C+
Sbjct  278  PEVSELTGPVSF--RDINKVILLWRQWSGIDVLTRWFGFCR  316



>ref|NP_001063331.1| Os09g0451500 [Oryza sativa Japonica Group]
 sp|Q67UF5.1|PDI23_ORYSJ RecName: Full=Protein disulfide isomerase-like 2-3; Short=OsPDIL2-3; 
AltName: Full=Protein disulfide isomerase-like 5-1; 
Short=OsPDIL5-1; Flags: Precursor [Oryza sativa Japonica Group]
 dbj|BAD38008.1| putative protein disulfide isomerase-related protein [Oryza sativa 
Japonica Group]
 dbj|BAD38214.1| putative protein disulfide isomerase-related protein [Oryza sativa 
Japonica Group]
 dbj|BAF25245.1| Os09g0451500 [Oryza sativa Japonica Group]
Length=441

 Score =   248 bits (634),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 132/178 (74%), Positives = 151/178 (85%), Gaps = 8/178 (4%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            +ALY   +PVLQ NP+NFKSKVLNSNGVVLVEFFAPWCGHC+ LTP +EK A VLKGVAT
Sbjct  22   SALYSAGSPVLQFNPNNFKSKVLNSNGVVLVEFFAPWCGHCQQLTPIWEKAAGVLKGVAT  81

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDR  511
            VAALDADAH  LAQEYGI+GFPTIKVFVPGK PVDYQGAR+ K +V+F  +Q++ LL+DR
Sbjct  82   VAALDADAHKELAQEYGIRGFPTIKVFVPGKPPVDYQGARDVKPIVEFALSQVKALLRDR  141

Query  512  LDGKA--------TGGSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            L+GK         +GGSS+K+EPSAS+ELNS+NFD LV KSKDLWIVEFFAPWCGHCK
Sbjct  142  LNGKTSAGSGGKKSGGSSEKTEPSASIELNSQNFDKLVTKSKDLWIVEFFAPWCGHCK  199


 Score = 82.8 bits (203),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 48/105 (46%), Positives = 63/105 (60%), Gaps = 1/105 (1%)
 Frame = +2

Query  182  LQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaaldadahs  361
            ++LN  NF   V  S  + +VEFFAPWCGHCK L P ++K A  LKG   +  +D DA  
Sbjct  168  IELNSQNFDKLVTKSKDLWIVEFFAPWCGHCKKLAPEWKKAAKNLKGQVKLGHVDCDAEK  227

Query  362  slaQEYGIKGFPTIKVFVPGKQ-PVDYQGAREAKSMVDFVKAQIR  493
            SL  +Y ++GFPTI VF   K+ P  YQGAR A ++  F   Q+ 
Sbjct  228  SLMSKYKVEGFPTILVFGADKESPFPYQGARVASAIESFALEQLE  272



>gb|EEC84682.1| hypothetical protein OsI_31602 [Oryza sativa Indica Group]
Length=455

 Score =   248 bits (634),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 132/178 (74%), Positives = 151/178 (85%), Gaps = 8/178 (4%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            +ALY   +PVLQ NP+NFKSKVLNSNGVVLVEFFAPWCGHC+ LTP +EK A VLKGVAT
Sbjct  22   SALYSAGSPVLQFNPNNFKSKVLNSNGVVLVEFFAPWCGHCQQLTPIWEKAAGVLKGVAT  81

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDR  511
            VAALDADAH  LAQEYGI+GFPTIKVFVPGK PVDYQGAR+ K +V+F  +Q++ LL+DR
Sbjct  82   VAALDADAHKELAQEYGIRGFPTIKVFVPGKPPVDYQGARDVKPIVEFALSQVKALLRDR  141

Query  512  LDGKA--------TGGSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            L+GK         +GGSS+K+EPSAS+ELNS+NFD LV KSKDLWIVEFFAPWCGHCK
Sbjct  142  LNGKTSAGSGGKKSGGSSEKTEPSASIELNSQNFDKLVTKSKDLWIVEFFAPWCGHCK  199


 Score = 73.9 bits (180),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 45/119 (38%), Positives = 61/119 (51%), Gaps = 15/119 (13%)
 Frame = +2

Query  182  LQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaa-------  340
            ++LN  NF   V  S  + +VEFFAPWCGHCK L P ++K A  LKG   +         
Sbjct  168  IELNSQNFDKLVTKSKDLWIVEFFAPWCGHCKKLAPEWKKAAKNLKGQVKLGHVDCDAEK  227

Query  341  -------ldadahsslaQEYGIKGFPTIKVFVPGKQ-PVDYQGAREAKSMVDFVKAQIR  493
                       ++ SL  +Y ++GFPTI VF   K+ P  YQGAR A ++  F   Q+ 
Sbjct  228  NTNSSVWSVDKSYRSLMSKYKVEGFPTILVFGADKESPFPYQGARVASAIESFALEQLE  286



>gb|KHG30032.1| Protein disulfide-isomerase like 2-2 [Gossypium arboreum]
Length=422

 Score =   247 bits (630),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 135/170 (79%), Positives = 154/170 (91%), Gaps = 0/170 (0%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            NALYGPS+PV+QL PSNFKSKVLNSNGVVLVEFFAPWCGHC+ LTPT+EK ++VLKGVAT
Sbjct  23   NALYGPSSPVVQLTPSNFKSKVLNSNGVVLVEFFAPWCGHCQTLTPTWEKASNVLKGVAT  82

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDR  511
            VAALDADAH SL+QEYGI+GFPTIKVFVPGK PVDY GAR+ K + +F   Q++ LLKDR
Sbjct  83   VAALDADAHKSLSQEYGIRGFPTIKVFVPGKPPVDYMGARDVKPIAEFALQQVKALLKDR  142

Query  512  LDGKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            L GKA+GGSS+KSE SASVELNS NFD+LV+KSK+LWI+EFFAPWCGHCK
Sbjct  143  LAGKASGGSSEKSESSASVELNSHNFDELVLKSKELWILEFFAPWCGHCK  192


 Score = 82.0 bits (201),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 45/106 (42%), Positives = 64/106 (60%), Gaps = 1/106 (1%)
 Frame = +2

Query  182  LQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaaldadahs  361
            ++LN  NF   VL S  + ++EFFAPWCGHCK L P +++ A+ LKG   +  +D D+  
Sbjct  161  VELNSHNFDELVLKSKELWILEFFAPWCGHCKRLAPEWKRAANNLKGKVKLGHVDCDSEK  220

Query  362  slaQEYGIKGFPTIKVFVPGKQ-PVDYQGAREAKSMVDFVKAQIRN  496
            SL   + ++GFPTI VF   K  PV Y+GAR A ++  F   Q+  
Sbjct  221  SLMSRFNVQGFPTILVFGADKDSPVPYEGARTASAIESFALEQLET  266



>ref|XP_010688926.1| PREDICTED: protein disulfide isomerase-like 2-3 [Beta vulgaris 
subsp. vulgaris]
Length=438

 Score =   247 bits (631),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 135/170 (79%), Positives = 151/170 (89%), Gaps = 0/170 (0%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            NALY  S+PVLQL PSNFKSKVLNSNGVVLVEFFAPWCGHC++LTP +EK ASVLKGVAT
Sbjct  24   NALYSASSPVLQLTPSNFKSKVLNSNGVVLVEFFAPWCGHCQSLTPIWEKAASVLKGVAT  83

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDR  511
            VAALDADAH SLAQEYGIKGFPTIKVFV GK PVDY GAR+ K + +F   Q++ LLKDR
Sbjct  84   VAALDADAHKSLAQEYGIKGFPTIKVFVNGKGPVDYMGARDVKPIAEFALQQVKALLKDR  143

Query  512  LDGKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            L+GK+ G S +KSEPS+SVELNSRNFD+LV+KSKDLW+VEFFAPWCGHCK
Sbjct  144  LNGKSGGSSEKKSEPSSSVELNSRNFDELVLKSKDLWVVEFFAPWCGHCK  193


 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 45/105 (43%), Positives = 62/105 (59%), Gaps = 1/105 (1%)
 Frame = +2

Query  182  LQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaaldadahs  361
            ++LN  NF   VL S  + +VEFFAPWCGHCK L P ++K A+ LKG   +  ++ D   
Sbjct  162  VELNSRNFDELVLKSKDLWVVEFFAPWCGHCKKLAPEWKKAANNLKGKVKLGHVNCDEEK  221

Query  362  slaQEYGIKGFPTIKVFVPGKQ-PVDYQGAREAKSMVDFVKAQIR  493
            SL  ++ ++GFPTI VF   K  P  Y+GAR A  +  F   Q+ 
Sbjct  222  SLMSKFKVQGFPTILVFGADKDSPFPYEGARSASGIESFALEQLE  266



>ref|XP_004243508.1| PREDICTED: protein disulfide isomerase-like 2-3 [Solanum lycopersicum]
Length=432

 Score =   247 bits (630),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 135/170 (79%), Positives = 153/170 (90%), Gaps = 0/170 (0%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            NALYGP++PV+QL  SNFKSKVLNS G+VLVEFFAPWCGHC+ALTP +EK A++LKGVAT
Sbjct  21   NALYGPTSPVVQLTESNFKSKVLNSKGIVLVEFFAPWCGHCQALTPAWEKAATILKGVAT  80

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDR  511
            VAALDADAH SLAQEYGI+GFPTIKVF PGK PVDYQGAREAK + ++   QI+ LLK+R
Sbjct  81   VAALDADAHKSLAQEYGIRGFPTIKVFAPGKPPVDYQGAREAKPIAEYALQQIKALLKER  140

Query  512  LDGKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            + GKATGGSS+ SEPSASVELNSRNFD+ V+KSKDLWIVEFFAPWCGHCK
Sbjct  141  IHGKATGGSSESSEPSASVELNSRNFDENVLKSKDLWIVEFFAPWCGHCK  190


 Score = 83.6 bits (205),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 48/104 (46%), Positives = 62/104 (60%), Gaps = 1/104 (1%)
 Frame = +2

Query  188  LNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaaldadahssl  367
            LN  NF   VL S  + +VEFFAPWCGHCK L P ++K A  L+G   +  +D DA  SL
Sbjct  161  LNSRNFDENVLKSKDLWIVEFFAPWCGHCKKLAPEWKKAAKNLQGKVKLGHVDCDAEKSL  220

Query  368  aQEYGIKGFPTIKVFVPGKQ-PVDYQGAREAKSMVDFVKAQIRN  496
               Y ++GFPTI VF   K+ PV Y+GAR A ++  F   Q+  
Sbjct  221  MSRYNVQGFPTILVFGADKESPVTYEGARTASAIESFGLEQLET  264



>gb|EYU43141.1| hypothetical protein MIMGU_mgv1a006693mg [Erythranthe guttata]
Length=434

 Score =   246 bits (627),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 134/169 (79%), Positives = 153/169 (91%), Gaps = 0/169 (0%)
 Frame = +2

Query  155  ALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATV  334
            ALYGPS+PVLQL   NFKSKVLNS GVV+VEFFAPWCGHC+ALTPT+EK A+VLKGVAT+
Sbjct  22   ALYGPSSPVLQLTADNFKSKVLNSKGVVVVEFFAPWCGHCQALTPTWEKAATVLKGVATI  81

Query  335  aaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDRL  514
            AALDADAH SLAQEYGIKGFPTIKVF PGK PVDYQGAR+ K + +F   Q+R L+K+RL
Sbjct  82   AALDADAHQSLAQEYGIKGFPTIKVFSPGKPPVDYQGARDIKPIAEFALKQVRALVKERL  141

Query  515  DGKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            +GK++GGSS+KSEPSASVELNS NFD+LV+KSK+LWIVEFFAPWCGHCK
Sbjct  142  EGKSSGGSSKKSEPSASVELNSSNFDELVLKSKELWIVEFFAPWCGHCK  190


 Score = 86.3 bits (212),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 51/111 (46%), Positives = 66/111 (59%), Gaps = 2/111 (2%)
 Frame = +2

Query  167  PSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaald  346
            PS  V +LN SNF   VL S  + +VEFFAPWCGHCK L P +++ AS LKG   +  +D
Sbjct  155  PSASV-ELNSSNFDELVLKSKELWIVEFFAPWCGHCKKLAPEWKRAASSLKGQVKLGHVD  213

Query  347  adahsslaQEYGIKGFPTIKVFVPGKQ-PVDYQGAREAKSMVDFVKAQIRN  496
             DA  SL   + ++GFPTI VF   K  P  Y+GAR A ++  F   Q+  
Sbjct  214  CDAEKSLMSRFNVQGFPTIMVFGADKDSPFPYEGARSASAIESFALEQLET  264



>ref|XP_006357974.1| PREDICTED: protein disulfide isomerase-like 2-3-like [Solanum 
tuberosum]
Length=432

 Score =   245 bits (626),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 134/170 (79%), Positives = 153/170 (90%), Gaps = 0/170 (0%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            NALYGP++PV+QL  SNFK+KVLNS G+VLVEFFAPWCGHC+ALTP +EK A++LKGVAT
Sbjct  21   NALYGPTSPVVQLTESNFKTKVLNSKGIVLVEFFAPWCGHCQALTPIWEKAATILKGVAT  80

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDR  511
            VAALDADAH SLAQEYGI+GFPTIKVF PGK PVDYQGAREAK + ++   QI+ LLK+R
Sbjct  81   VAALDADAHKSLAQEYGIRGFPTIKVFAPGKPPVDYQGAREAKPIAEYALQQIKALLKER  140

Query  512  LDGKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            + GKATGGSS+ SEPSASVELNSRNFD+ V+KSKDLWIVEFFAPWCGHCK
Sbjct  141  IHGKATGGSSESSEPSASVELNSRNFDENVLKSKDLWIVEFFAPWCGHCK  190


 Score = 83.2 bits (204),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 48/104 (46%), Positives = 62/104 (60%), Gaps = 1/104 (1%)
 Frame = +2

Query  188  LNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaaldadahssl  367
            LN  NF   VL S  + +VEFFAPWCGHCK L P ++K A  L+G   +  +D DA  SL
Sbjct  161  LNSRNFDENVLKSKDLWIVEFFAPWCGHCKKLAPEWKKAAKNLQGKVKLGHVDCDAEKSL  220

Query  368  aQEYGIKGFPTIKVFVPGKQ-PVDYQGAREAKSMVDFVKAQIRN  496
               Y ++GFPTI VF   K+ PV Y+GAR A ++  F   Q+  
Sbjct  221  MSRYNVQGFPTILVFGADKESPVPYEGARTASAIESFGLQQLET  264



>ref|XP_006447669.1| hypothetical protein CICLE_v10015327mg [Citrus clementina]
 gb|ESR60909.1| hypothetical protein CICLE_v10015327mg [Citrus clementina]
Length=428

 Score =   244 bits (622),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 127/172 (74%), Positives = 148/172 (86%), Gaps = 2/172 (1%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            +ALYG S+PV+QL P+NFKSKVLN+NGVVLVEF+APWCGHC+ALTP +EK A+VLKGVAT
Sbjct  23   DALYGSSSPVVQLTPNNFKSKVLNANGVVLVEFYAPWCGHCQALTPIWEKAATVLKGVAT  82

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDR  511
            VAALDA+ H SLAQEYGI+GFPTIKVFVPGK PVDYQGAR+ K + +FV  QI+ LLK+R
Sbjct  83   VAALDANEHQSLAQEYGIRGFPTIKVFVPGKPPVDYQGARDVKPIAEFVLQQIKALLKER  142

Query  512  LDGKAT--GGSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            L GKAT       KS+ + S+ELNS NFD+LV+KSKDLWIVEFFAPWCGHCK
Sbjct  143  LSGKATGGSSDKSKSDSNESIELNSSNFDELVLKSKDLWIVEFFAPWCGHCK  194


 Score = 85.9 bits (211),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 47/106 (44%), Positives = 66/106 (62%), Gaps = 1/106 (1%)
 Frame = +2

Query  182  LQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaaldadahs  361
            ++LN SNF   VL S  + +VEFFAPWCGHCK L P ++K A+ LKG   +  +D D+  
Sbjct  163  IELNSSNFDELVLKSKDLWIVEFFAPWCGHCKKLAPEWKKAANNLKGKVKLGHVDCDSEK  222

Query  362  slaQEYGIKGFPTIKVFVPGKQ-PVDYQGAREAKSMVDFVKAQIRN  496
            SL  ++ ++GFPTI VF   K  P+ Y+GAR A ++  F   Q+  
Sbjct  223  SLMSKFNVQGFPTILVFGADKDSPIPYEGARTAGAIESFALEQLET  268



>ref|XP_006469595.1| PREDICTED: LOW QUALITY PROTEIN: protein disulfide isomerase-like 
2-3-like [Citrus sinensis]
Length=439

 Score =   244 bits (622),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 127/172 (74%), Positives = 148/172 (86%), Gaps = 2/172 (1%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            +ALYG S+PV+QL P+NFKSKVLN+NGVVLVEF+APWCGHC+ALTP +EK A+VLKGVAT
Sbjct  23   DALYGSSSPVVQLTPNNFKSKVLNANGVVLVEFYAPWCGHCQALTPIWEKAATVLKGVAT  82

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDR  511
            VAALDA+ H SLAQEYGI+GFPTIKVFVPGK PVDYQGAR+ K + +FV  QI+ LLK+R
Sbjct  83   VAALDANEHQSLAQEYGIRGFPTIKVFVPGKPPVDYQGARDVKPIAEFVLQQIKALLKER  142

Query  512  LDGKAT--GGSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            L GKAT       KS+ + S+ELNS NFD+LV+KSKDLWIVEFFAPWCGHCK
Sbjct  143  LSGKATGGSSDKSKSDSNESIELNSSNFDELVLKSKDLWIVEFFAPWCGHCK  194


 Score = 85.9 bits (211),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 47/106 (44%), Positives = 66/106 (62%), Gaps = 1/106 (1%)
 Frame = +2

Query  182  LQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaaldadahs  361
            ++LN SNF   VL S  + +VEFFAPWCGHCK L P ++K A+ LKG   +  +D D+  
Sbjct  163  IELNSSNFDELVLKSKDLWIVEFFAPWCGHCKKLAPEWKKAANNLKGKVKLGHVDCDSEK  222

Query  362  slaQEYGIKGFPTIKVFVPGKQ-PVDYQGAREAKSMVDFVKAQIRN  496
            SL  ++ ++GFPTI VF   K  P+ Y+GAR A ++  F   Q+  
Sbjct  223  SLMSKFNVQGFPTILVFGADKDSPIPYEGARTAGAIESFALEQLET  268



>ref|XP_002528963.1| protein disulfide isomerase, putative [Ricinus communis]
 gb|EEF33437.1| protein disulfide isomerase, putative [Ricinus communis]
Length=348

 Score =   240 bits (613),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 122/150 (81%), Positives = 137/150 (91%), Gaps = 0/150 (0%)
 Frame = +2

Query  212  KVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaaldadahsslaQEYGIKG  391
            +VLN+NGVVLVEFFAPWCGHCKALTPT+EK A+VLKGVATVAALDADAH SLAQEYGI+G
Sbjct  6    RVLNANGVVLVEFFAPWCGHCKALTPTWEKAATVLKGVATVAALDADAHQSLAQEYGIRG  65

Query  392  FPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDRLDGKATGGSSQKSEPSASVE  571
            FPTIKVF PGK PVDYQGAR+ K + +F   QI+ LLK+RL+GK+TGGS +KSEPSASVE
Sbjct  66   FPTIKVFAPGKPPVDYQGARDVKPIAEFALQQIKALLKERLNGKSTGGSKEKSEPSASVE  125

Query  572  LNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            LNS NFDDLV+KSK+LWIVEFFAPWCGHCK
Sbjct  126  LNSSNFDDLVLKSKELWIVEFFAPWCGHCK  155


 Score = 83.2 bits (204),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 48/111 (43%), Positives = 66/111 (59%), Gaps = 2/111 (2%)
 Frame = +2

Query  167  PSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaald  346
            PS  V +LN SNF   VL S  + +VEFFAPWCGHCK L P ++K ++ L G   +  +D
Sbjct  120  PSASV-ELNSSNFDDLVLKSKELWIVEFFAPWCGHCKKLAPEWKKASNNLNGKVKMGHVD  178

Query  347  adahsslaQEYGIKGFPTIKVFVPGKQ-PVDYQGAREAKSMVDFVKAQIRN  496
             D+  SL   + ++GFPTI VF   K  P+ Y+GAR A ++  F   Q+  
Sbjct  179  CDSEKSLMSRFNVQGFPTILVFGADKDTPIPYEGARTASAIESFALEQLET  229



>gb|KDO59568.1| hypothetical protein CISIN_1g014216mg [Citrus sinensis]
Length=411

 Score =   242 bits (618),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 126/172 (73%), Positives = 147/172 (85%), Gaps = 2/172 (1%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            +ALYG S+PV+QL P+NFKSKVLN+NGVVLVEF+APWCGHC+ALTP +EK A+VLKGVAT
Sbjct  23   DALYGSSSPVVQLTPNNFKSKVLNANGVVLVEFYAPWCGHCQALTPIWEKAATVLKGVAT  82

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDR  511
            VAALDA+ H SLAQEYGI+GFPTIKVFVPGK PVDYQGAR+ K + +F   QI+ LLK+R
Sbjct  83   VAALDANEHQSLAQEYGIRGFPTIKVFVPGKPPVDYQGARDVKPIAEFALQQIKALLKER  142

Query  512  LDGKAT--GGSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            L GKAT       KS+ + S+ELNS NFD+LV+KSKDLWIVEFFAPWCGHCK
Sbjct  143  LSGKATGGSSDKSKSDSNESIELNSSNFDELVLKSKDLWIVEFFAPWCGHCK  194


 Score = 85.9 bits (211),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 47/106 (44%), Positives = 66/106 (62%), Gaps = 1/106 (1%)
 Frame = +2

Query  182  LQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaaldadahs  361
            ++LN SNF   VL S  + +VEFFAPWCGHCK L P ++K A+ LKG   +  +D D+  
Sbjct  163  IELNSSNFDELVLKSKDLWIVEFFAPWCGHCKKLAPEWKKAANNLKGKVKLGHVDCDSEK  222

Query  362  slaQEYGIKGFPTIKVFVPGKQ-PVDYQGAREAKSMVDFVKAQIRN  496
            SL  ++ ++GFPTI VF   K  P+ Y+GAR A ++  F   Q+  
Sbjct  223  SLMSKFNVQGFPTILVFGADKDSPIPYEGARTAGAIESFALEQLET  268



>gb|KDO59567.1| hypothetical protein CISIN_1g014216mg [Citrus sinensis]
Length=428

 Score =   242 bits (618),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 126/172 (73%), Positives = 147/172 (85%), Gaps = 2/172 (1%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            +ALYG S+PV+QL P+NFKSKVLN+NGVVLVEF+APWCGHC+ALTP +EK A+VLKGVAT
Sbjct  23   DALYGSSSPVVQLTPNNFKSKVLNANGVVLVEFYAPWCGHCQALTPIWEKAATVLKGVAT  82

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDR  511
            VAALDA+ H SLAQEYGI+GFPTIKVFVPGK PVDYQGAR+ K + +F   QI+ LLK+R
Sbjct  83   VAALDANEHQSLAQEYGIRGFPTIKVFVPGKPPVDYQGARDVKPIAEFALQQIKALLKER  142

Query  512  LDGKAT--GGSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            L GKAT       KS+ + S+ELNS NFD+LV+KSKDLWIVEFFAPWCGHCK
Sbjct  143  LSGKATGGSSDKSKSDSNESIELNSSNFDELVLKSKDLWIVEFFAPWCGHCK  194


 Score = 85.9 bits (211),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 47/106 (44%), Positives = 66/106 (62%), Gaps = 1/106 (1%)
 Frame = +2

Query  182  LQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaaldadahs  361
            ++LN SNF   VL S  + +VEFFAPWCGHCK L P ++K A+ LKG   +  +D D+  
Sbjct  163  IELNSSNFDELVLKSKDLWIVEFFAPWCGHCKKLAPEWKKAANNLKGKVKLGHVDCDSEK  222

Query  362  slaQEYGIKGFPTIKVFVPGKQ-PVDYQGAREAKSMVDFVKAQIRN  496
            SL  ++ ++GFPTI VF   K  P+ Y+GAR A ++  F   Q+  
Sbjct  223  SLMSKFNVQGFPTILVFGADKDSPIPYEGARTAGAIESFALEQLET  268



>gb|KFK31099.1| hypothetical protein AALP_AA6G068000 [Arabis alpina]
Length=441

 Score =   242 bits (618),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 130/174 (75%), Positives = 150/174 (86%), Gaps = 4/174 (2%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            NALY PS+PV+QL  +NFKSKVLNSNGVVLVEFFAPWCGHCKALTPT+EKVAS+LKGVAT
Sbjct  23   NALYEPSSPVVQLTATNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTWEKVASILKGVAT  82

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDR  511
            VAA+DADAH S  Q+YGIKGFPTIKVFV GK P+DYQGAR+AKS+ +F   QI+ L+ DR
Sbjct  83   VAAIDADAHQSAVQDYGIKGFPTIKVFVAGKPPIDYQGARDAKSIANFAYKQIKALVNDR  142

Query  512  LDGKA----TGGSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            L+GK+     G S +KSE SASVELN+ NFD+LV+KS +LWIVEFFAPWCGHCK
Sbjct  143  LEGKSKPNGGGSSEKKSESSASVELNASNFDELVIKSNELWIVEFFAPWCGHCK  196


 Score = 85.5 bits (210),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 45/106 (42%), Positives = 63/106 (59%), Gaps = 1/106 (1%)
 Frame = +2

Query  182  LQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaaldadahs  361
            ++LN SNF   V+ SN + +VEFFAPWCGHCK L P +++ A  LKG   +  ++ D   
Sbjct  165  VELNASNFDELVIKSNELWIVEFFAPWCGHCKKLAPEWKRAAKNLKGKVKLGHVNCDVEQ  224

Query  362  slaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRN  496
            S+   + ++GFPTI VF P K  P  Y+GAR A ++  F      N
Sbjct  225  SIMSRFKVQGFPTILVFGPDKSSPYPYEGARSASAIESFASELAEN  270



>ref|XP_010913398.1| PREDICTED: protein disulfide isomerase-like 2-3 [Elaeis guineensis]
Length=429

 Score =   239 bits (609),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 134/169 (79%), Positives = 151/169 (89%), Gaps = 0/169 (0%)
 Frame = +2

Query  155  ALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATV  334
            ALY  S+PV+QLNPSNF SKVLN+ GVVLVEFFAPWCGHC+ALTPT+EK A+VLKGVATV
Sbjct  19   ALYSSSSPVVQLNPSNFNSKVLNAKGVVLVEFFAPWCGHCQALTPTWEKAATVLKGVATV  78

Query  335  aaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDRL  514
            AALDADAH SLAQEYGI GFPTIKVF+PGK PVDYQGAR+ K + +F   QI+ LLK+RL
Sbjct  79   AALDADAHKSLAQEYGIIGFPTIKVFLPGKPPVDYQGARDVKPIAEFALQQIKALLKERL  138

Query  515  DGKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
             GK++GGSS+KSE SASVEL SRNFD+LV+KSKDLWIVEFFAPWCGHCK
Sbjct  139  HGKSSGGSSEKSETSASVELTSRNFDELVLKSKDLWIVEFFAPWCGHCK  187


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 44/106 (42%), Positives = 62/106 (58%), Gaps = 1/106 (1%)
 Frame = +2

Query  182  LQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaaldadahs  361
            ++L   NF   VL S  + +VEFFAPWCGHCK L P ++K ++ LKG   +  +D DA  
Sbjct  156  VELTSRNFDELVLKSKDLWIVEFFAPWCGHCKKLAPEWKKASNNLKGKVKLGHVDCDAEK  215

Query  362  slaQEYGIKGFPTIKVF-VPGKQPVDYQGAREAKSMVDFVKAQIRN  496
            SL   + ++GFPTI VF +    P  Y+GAR A ++  F   Q+  
Sbjct  216  SLMSRFNVQGFPTILVFGIDKDSPYPYEGARVASAIESFALEQVET  261



>dbj|BAJ84858.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ95210.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=440

 Score =   236 bits (603),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 125/172 (73%), Positives = 145/172 (84%), Gaps = 10/172 (6%)
 Frame = +2

Query  173  TPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaaldad  352
            +PVLQLNP+NFK KVLN+NGVVLVEFFAPWCGHCK LTP +EK A VLKGVATVAALDAD
Sbjct  28   SPVLQLNPNNFK-KVLNANGVVLVEFFAPWCGHCKQLTPIWEKAAGVLKGVATVAALDAD  86

Query  353  ahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDRLDGKA--  526
            AH  LAQ+YGI+GFPTIKVF+PGK PVDY+GAR+ K +V+F  +Q++ LL+DRLDGKA  
Sbjct  87   AHKELAQQYGIRGFPTIKVFLPGKPPVDYEGARDVKPIVNFALSQVKGLLRDRLDGKASG  146

Query  527  -------TGGSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
                    G S +K+EP+ SVELNS NFD+LV+KSKDLWIVEFFAPWCGHCK
Sbjct  147  GSSSKTSGGSSEKKNEPNESVELNSSNFDELVIKSKDLWIVEFFAPWCGHCK  198


 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 47/105 (45%), Positives = 64/105 (61%), Gaps = 1/105 (1%)
 Frame = +2

Query  182  LQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaaldadahs  361
            ++LN SNF   V+ S  + +VEFFAPWCGHCK L P +++ A  LKG   +  +D D+  
Sbjct  167  VELNSSNFDELVIKSKDLWIVEFFAPWCGHCKKLAPEWKRAAKNLKGQVKLGHVDCDSDK  226

Query  362  slaQEYGIKGFPTIKVFVPGKQ-PVDYQGAREAKSMVDFVKAQIR  493
            SL  +Y ++GFPTI VF   K  P  YQGAR A ++  F   Q+ 
Sbjct  227  SLMSKYKVEGFPTILVFGADKDSPFPYQGARAASAIESFALEQLE  271



>ref|XP_004956980.1| PREDICTED: protein disulfide isomerase-like 2-3-like [Setaria 
italica]
Length=440

 Score =   236 bits (601),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 129/171 (75%), Positives = 148/171 (87%), Gaps = 8/171 (5%)
 Frame = +2

Query  173  TPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaaldad  352
            +PVLQLNP+NFKSKVL +NGVVLVEFFAPWCGHCK L P +EK A VLKGVA VAALDAD
Sbjct  28   SPVLQLNPNNFKSKVLEANGVVLVEFFAPWCGHCKQLAPAWEKAAGVLKGVARVAALDAD  87

Query  353  ahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDRLD-----  517
            AH +LAQEYGI+GFPTIKVF PGK PVDYQGAR+ K +V+F  +Q++ LL+DRL+     
Sbjct  88   AHQALAQEYGIRGFPTIKVFAPGKPPVDYQGARDVKPIVEFALSQVKALLRDRLNGKASG  147

Query  518  ---GKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
               GKA+GGSS+K+EPSASVELNSRNFD+LV+KSKDLWIVEFFAPWCGHCK
Sbjct  148  GSSGKASGGSSEKNEPSASVELNSRNFDELVIKSKDLWIVEFFAPWCGHCK  198


 Score = 83.2 bits (204),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 50/110 (45%), Positives = 66/110 (60%), Gaps = 2/110 (2%)
 Frame = +2

Query  167  PSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaald  346
            PS  V +LN  NF   V+ S  + +VEFFAPWCGHCK L P +++ A  LKG   +  +D
Sbjct  163  PSASV-ELNSRNFDELVIKSKDLWIVEFFAPWCGHCKKLAPEWKRAAKNLKGQVKLGHVD  221

Query  347  adahsslaQEYGIKGFPTIKVFVPGKQ-PVDYQGAREAKSMVDFVKAQIR  493
             DA  SL  +Y ++GFPTI VF   K+ P  YQGAR A ++  F   Q+ 
Sbjct  222  CDAEKSLMSKYKVEGFPTILVFGADKESPFPYQGARVASAIESFALEQLE  271



>gb|EMT02125.1| Protein disulfide-isomerase A6 [Aegilops tauschii]
Length=422

 Score =   231 bits (589),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 126/172 (73%), Positives = 147/172 (85%), Gaps = 10/172 (6%)
 Frame = +2

Query  173  TPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaaldad  352
            +PVLQLNP+NFK KVLN+NGVVLVEFFAPWCGHCK LTP +EK A VLKGVATVAALDAD
Sbjct  28   SPVLQLNPNNFK-KVLNANGVVLVEFFAPWCGHCKQLTPIWEKAAGVLKGVATVAALDAD  86

Query  353  ahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDRLDGKATG  532
            AH  LAQ+YGI+GFPTIKVF+PGK PVDY+GAR+ K++V+F  +Q++ LL+DRLDGK +G
Sbjct  87   AHKELAQQYGIQGFPTIKVFLPGKPPVDYEGARDVKAIVNFALSQVKGLLRDRLDGKTSG  146

Query  533  GS---------SQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            GS          +K+EP+ SVELNS NFD+LVVKSKDLWIVEFFAPWCGHCK
Sbjct  147  GSSGKTSGGSREKKTEPNESVELNSSNFDELVVKSKDLWIVEFFAPWCGHCK  198


 Score = 85.1 bits (209),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 47/105 (45%), Positives = 65/105 (62%), Gaps = 1/105 (1%)
 Frame = +2

Query  182  LQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaaldadahs  361
            ++LN SNF   V+ S  + +VEFFAPWCGHCK L P +++ A  LKG   +  +D D+  
Sbjct  167  VELNSSNFDELVVKSKDLWIVEFFAPWCGHCKKLAPEWKRAAKNLKGQVKLGHIDCDSDK  226

Query  362  slaQEYGIKGFPTIKVFVPGKQ-PVDYQGAREAKSMVDFVKAQIR  493
            SL  +Y ++GFPTI VF   K+ P  YQGAR A ++  F   Q+ 
Sbjct  227  SLMSKYKVEGFPTILVFGADKESPFPYQGARAASAIESFALEQLE  271



>emb|CBG91909.1| putative PDI-like protein [Triticum aestivum]
Length=440

 Score =   229 bits (585),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 123/172 (72%), Positives = 142/172 (83%), Gaps = 10/172 (6%)
 Frame = +2

Query  173  TPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaaldad  352
            +PVLQLNP+NFK KVLN+NGVVLVEFFAPWCGHCK LTP +EK A VLKGVATVAALDAD
Sbjct  28   SPVLQLNPNNFK-KVLNANGVVLVEFFAPWCGHCKQLTPIWEKAAGVLKGVATVAALDAD  86

Query  353  ahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDRLD-----  517
            AH  LAQ+YGI+GFPTIKVF+PGK PVDY+GAR+ K +V+F  +Q++ LL+DRLD     
Sbjct  87   AHKELAQQYGIRGFPTIKVFLPGKPPVDYEGARDVKPIVNFALSQVKGLLRDRLDGKTSG  146

Query  518  ----GKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
                  + G S +K EP+ SVELNS NFD+LVVKSKDLWIVEFFAPWCGHCK
Sbjct  147  GSSGKTSGGSSEKKHEPNESVELNSSNFDELVVKSKDLWIVEFFAPWCGHCK  198


 Score = 85.1 bits (209),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 47/105 (45%), Positives = 65/105 (62%), Gaps = 1/105 (1%)
 Frame = +2

Query  182  LQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaaldadahs  361
            ++LN SNF   V+ S  + +VEFFAPWCGHCK L P +++ A  LKG   +  +D D+  
Sbjct  167  VELNSSNFDELVVKSKDLWIVEFFAPWCGHCKKLAPEWKRAAKNLKGQVKLGHVDCDSDK  226

Query  362  slaQEYGIKGFPTIKVFVPGKQ-PVDYQGAREAKSMVDFVKAQIR  493
            SL  +Y ++GFPTI VF   K+ P  YQGAR A ++  F   Q+ 
Sbjct  227  SLMSKYKVEGFPTILVFGADKESPFPYQGARAASAIESFALEQLE  271



>emb|CBG91908.1| putative PDI-like protein [Triticum aestivum]
Length=440

 Score =   228 bits (582),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 122/172 (71%), Positives = 143/172 (83%), Gaps = 10/172 (6%)
 Frame = +2

Query  173  TPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaaldad  352
            +PVLQLNP+NFK KVLN+NGVVLVEFFAPWCGHCK LTP +EK A VLKGVATVAALDAD
Sbjct  28   SPVLQLNPNNFK-KVLNANGVVLVEFFAPWCGHCKQLTPIWEKAAGVLKGVATVAALDAD  86

Query  353  ahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDRLD-----  517
            AH  LAQ+YGI+GFPTIKVF+PGK PVDY+GAR+ + +V+F  +Q++ LL+DRLD     
Sbjct  87   AHKELAQQYGIRGFPTIKVFLPGKPPVDYEGARDVEPIVNFALSQVKGLLRDRLDGKTSG  146

Query  518  ----GKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
                  + G S +K+EP+ SVELNS NFD+LVVKSKDLWIVEFFAPWCGHCK
Sbjct  147  GSSGKTSGGSSEKKNEPNESVELNSSNFDELVVKSKDLWIVEFFAPWCGHCK  198


 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 47/105 (45%), Positives = 65/105 (62%), Gaps = 1/105 (1%)
 Frame = +2

Query  182  LQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaaldadahs  361
            ++LN SNF   V+ S  + +VEFFAPWCGHCK L P +++ A  LKG   +  +D D+  
Sbjct  167  VELNSSNFDELVVKSKDLWIVEFFAPWCGHCKKLAPEWKRAAKNLKGQVKLGHVDCDSDK  226

Query  362  slaQEYGIKGFPTIKVFVPGKQ-PVDYQGAREAKSMVDFVKAQIR  493
            SL  +Y ++GFPTI VF   K+ P  YQGAR A ++  F   Q+ 
Sbjct  227  SLMSKYKVEGFPTILVFGADKESPFPYQGARAASAIEPFALEQLE  271



>dbj|BAO79454.1| protein disulfide isomerase family protein 5-1 [Triticum aestivum]
Length=440

 Score =   227 bits (579),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 122/172 (71%), Positives = 142/172 (83%), Gaps = 10/172 (6%)
 Frame = +2

Query  173  TPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaaldad  352
            +PV QLNP+NFK KVLN+NGVVLVEFFAPWCGHCK LTP +EK A VLKGVATVAALDAD
Sbjct  28   SPVHQLNPNNFK-KVLNANGVVLVEFFAPWCGHCKQLTPIWEKAAGVLKGVATVAALDAD  86

Query  353  ahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDRLD-----  517
            AH  LAQ+YGI+GFPTIKVF+PGK PVDY+GAR+ K +V+F  +Q++ LL+DRLD     
Sbjct  87   AHKELAQQYGIRGFPTIKVFLPGKPPVDYEGARDVKPIVNFALSQVKGLLRDRLDGKTSG  146

Query  518  ----GKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
                  + G S +K+EP+ SVELNS NFD+LVVKSKDLWIVEFFAPWCGHCK
Sbjct  147  GSSGKTSGGSSEKKNEPNESVELNSSNFDELVVKSKDLWIVEFFAPWCGHCK  198


 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 47/105 (45%), Positives = 65/105 (62%), Gaps = 1/105 (1%)
 Frame = +2

Query  182  LQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaaldadahs  361
            ++LN SNF   V+ S  + +VEFFAPWCGHCK L P +++ A  LKG   +  +D D+  
Sbjct  167  VELNSSNFDELVVKSKDLWIVEFFAPWCGHCKKLAPEWKRAAKNLKGQVKLGHVDCDSDK  226

Query  362  slaQEYGIKGFPTIKVFVPGKQ-PVDYQGAREAKSMVDFVKAQIR  493
            SL  +Y ++GFPTI VF   K+ P  YQGAR A ++  F   Q+ 
Sbjct  227  SLMSKYKVEGFPTILVFGADKESPFPYQGARAASAIEPFALEQLE  271



>ref|XP_003578205.1| PREDICTED: protein disulfide isomerase-like 2-3 [Brachypodium 
distachyon]
Length=440

 Score =   227 bits (578),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 120/172 (70%), Positives = 143/172 (83%), Gaps = 10/172 (6%)
 Frame = +2

Query  173  TPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaaldad  352
            +PVLQLNP+NFK KVLN+NGVVLVEFFAPWCGHCK LTPT+EK A VLKGVAT+AALDAD
Sbjct  28   SPVLQLNPNNFK-KVLNANGVVLVEFFAPWCGHCKQLTPTWEKAAGVLKGVATIAALDAD  86

Query  353  ahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDRLD-----  517
            AH  LAQ+YGI+GFPTIKVF+PGK PVDY+GAR+ K +V+F   Q+++LLKDRLD     
Sbjct  87   AHKELAQQYGIQGFPTIKVFIPGKPPVDYEGARDVKPIVNFALQQVKSLLKDRLDGKTSG  146

Query  518  ----GKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
                  + G S +K++ + S+ELNS NFD+LV+KSKDLWIVEFFAPWCGHCK
Sbjct  147  GSSGKTSGGSSEKKTDTNESIELNSSNFDELVIKSKDLWIVEFFAPWCGHCK  198


 Score = 85.9 bits (211),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 47/105 (45%), Positives = 65/105 (62%), Gaps = 1/105 (1%)
 Frame = +2

Query  182  LQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaaldadahs  361
            ++LN SNF   V+ S  + +VEFFAPWCGHCK L P +++ A  LKG   +  +D D+  
Sbjct  167  IELNSSNFDELVIKSKDLWIVEFFAPWCGHCKKLAPEWKRAAKNLKGQVKLGHVDCDSDK  226

Query  362  slaQEYGIKGFPTIKVFVPGKQ-PVDYQGAREAKSMVDFVKAQIR  493
            SL  +Y ++GFPTI VF   K+ P  YQGAR A ++  F   Q+ 
Sbjct  227  SLMSKYKVEGFPTILVFGADKESPFPYQGARAASAIESFALEQLE  271



>ref|XP_006661300.1| PREDICTED: protein disulfide isomerase-like 2-3-like [Oryza brachyantha]
Length=425

 Score =   224 bits (572),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 116/158 (73%), Positives = 133/158 (84%), Gaps = 8/158 (5%)
 Frame = +2

Query  212  KVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaaldadahsslaQEYGIKG  391
            +VLNSNGVVLVEFFAPWCGHC+ LTPT+EK A +LKGVATVAALDADAH  LAQEYGI+G
Sbjct  26   RVLNSNGVVLVEFFAPWCGHCQQLTPTWEKAAGILKGVATVAALDADAHKELAQEYGIRG  85

Query  392  FPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDRLDGKATGG--------SSQK  547
            FPTIKVFVPGK P DYQGAR+ K +V+F   Q++ LL+DRL GK + G        SS+K
Sbjct  86   FPTIKVFVPGKPPADYQGARDVKPIVEFALKQVKGLLRDRLSGKTSAGSDSKASSGSSEK  145

Query  548  SEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            +E SAS+ELNSRNFD+LV+KSKDLWIVEFFAPWCGHCK
Sbjct  146  TEASASIELNSRNFDELVIKSKDLWIVEFFAPWCGHCK  183


 Score = 83.6 bits (205),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 47/105 (45%), Positives = 64/105 (61%), Gaps = 1/105 (1%)
 Frame = +2

Query  182  LQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaaldadahs  361
            ++LN  NF   V+ S  + +VEFFAPWCGHCK L P +++ A  LKG   +  +D DA  
Sbjct  152  IELNSRNFDELVIKSKDLWIVEFFAPWCGHCKKLAPEWKRAAKNLKGQVKLGHVDCDADK  211

Query  362  slaQEYGIKGFPTIKVFVPGKQ-PVDYQGAREAKSMVDFVKAQIR  493
            SL  +Y ++GFPTI VF   K+ P  YQGAR A ++  F   Q+ 
Sbjct  212  SLMSKYKVEGFPTILVFGADKESPFPYQGARVASAIESFALEQLE  256



>emb|CBG91899.1| putative PDI-like protein [Triticum aestivum]
Length=440

 Score =   225 bits (573),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 121/172 (70%), Positives = 142/172 (83%), Gaps = 10/172 (6%)
 Frame = +2

Query  173  TPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaaldad  352
            +PVLQLNP+NFK KVLN+NGVVLVEFFAPWCG CK LTP +EK A VLKGVATVAALDAD
Sbjct  28   SPVLQLNPNNFK-KVLNANGVVLVEFFAPWCGLCKQLTPIWEKAAGVLKGVATVAALDAD  86

Query  353  ahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDRLD-----  517
            AH  LAQ+YGI+GFPTIKVF+PGK PVDY+GAR+ K +V+F  +Q++ LL+DRLD     
Sbjct  87   AHKELAQQYGIRGFPTIKVFLPGKPPVDYEGARDVKPIVNFALSQVQGLLRDRLDGKTSG  146

Query  518  ----GKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
                  + G S +K+EP+ SVELNS NFD+LVV+SKDLWIVEFFAPWCGHCK
Sbjct  147  GSSGKTSGGSSEKKNEPNESVELNSSNFDELVVRSKDLWIVEFFAPWCGHCK  198


 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 47/105 (45%), Positives = 65/105 (62%), Gaps = 1/105 (1%)
 Frame = +2

Query  182  LQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaaldadahs  361
            ++LN SNF   V+ S  + +VEFFAPWCGHCK L P +++ A  LKG   +  +D D+  
Sbjct  167  VELNSSNFDELVVRSKDLWIVEFFAPWCGHCKKLAPEWKRAAKNLKGQVKLGHVDCDSDK  226

Query  362  slaQEYGIKGFPTIKVFVPGKQ-PVDYQGAREAKSMVDFVKAQIR  493
            SL  +Y ++GFPTI VF   K+ P  YQGAR A ++  F   Q+ 
Sbjct  227  SLMSKYKVEGFPTILVFGADKESPFPYQGARAASAIEPFALEQLE  271



>gb|ACN39830.1| unknown [Picea sitchensis]
Length=445

 Score =   220 bits (560),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 118/173 (68%), Positives = 142/173 (82%), Gaps = 5/173 (3%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
             ALYGPS+ VL L PS FKSKVLNS+G+VLVEFFAPWCGHC+ALTP +EK A++LKG  T
Sbjct  32   EALYGPSSDVLLLTPSTFKSKVLNSDGIVLVEFFAPWCGHCQALTPIWEKTAAILKGFVT  91

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDR  511
            VAALDADAH SLAQEYGI+GFPTIKVF PGK P+ YQGAR+ K + +F   Q++ ++KDR
Sbjct  92   VAALDADAHKSLAQEYGIQGFPTIKVFTPGKPPIAYQGARDPKPIAEFAIQQLKTIVKDR  151

Query  512  LDGKATGGSSQK---SEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            L+GK   GS++K   S  S+SVEL S NFDD+V+KSKD W+VEF+APWCGHCK
Sbjct  152  LNGKT--GSNKKSSSSSSSSSVELTSNNFDDIVLKSKDPWLVEFYAPWCGHCK  202


 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 45/106 (42%), Positives = 64/106 (60%), Gaps = 1/106 (1%)
 Frame = +2

Query  182  LQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaaldadahs  361
            ++L  +NF   VL S    LVEF+APWCGHCK L P ++K A+ LKG   +  ++ D+  
Sbjct  171  VELTSNNFDDIVLKSKDPWLVEFYAPWCGHCKKLGPEWKKAANNLKGKVNMGQVNCDSEK  230

Query  362  slaQEYGIKGFPTIKVFVPGKQ-PVDYQGAREAKSMVDFVKAQIRN  496
            SL   + ++GFPTI VF   K+ PV Y+GAR A ++  F   Q+  
Sbjct  231  SLMSRFNVQGFPTILVFGSDKESPVPYEGARTASAIESFALEQLET  276



>gb|KHN38504.1| Protein disulfide isomerase-like 2-3 [Glycine soja]
Length=391

 Score =   217 bits (553),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 117/150 (78%), Positives = 134/150 (89%), Gaps = 0/150 (0%)
 Frame = +2

Query  212  KVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaaldadahsslaQEYGIKG  391
            +VLNSNGVVLVEFFAPWCGHC+ALTP +EK A+VLKGV TVAA+DADAH SLAQEYGI+G
Sbjct  9    QVLNSNGVVLVEFFAPWCGHCQALTPIWEKAATVLKGVVTVAAIDADAHPSLAQEYGIRG  68

Query  392  FPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDRLDGKATGGSSQKSEPSASVE  571
            FPTIKVF PGK PVDYQGAR+ K + +F   Q++ LLKDRL GKATGGSS+K+E S+SVE
Sbjct  69   FPTIKVFAPGKPPVDYQGARDVKPIAEFALQQVKALLKDRLSGKATGGSSEKTETSSSVE  128

Query  572  LNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            LNS NFD+LV+KSK+LWIVEFFAPWCGHCK
Sbjct  129  LNSGNFDELVIKSKELWIVEFFAPWCGHCK  158


 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 43/111 (39%), Positives = 62/111 (56%), Gaps = 6/111 (5%)
 Frame = +2

Query  182  LQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATV-----aald  346
            ++LN  NF   V+ S  + +VEFFAPWCGHCK L P ++K ++ LKG   +      A  
Sbjct  127  VELNSGNFDELVIKSKELWIVEFFAPWCGHCKKLAPEWKKASNNLKGKVKLGHVDCDAEK  186

Query  347  adahsslaQEYGIKGFPTIKVFVPGKQ-PVDYQGAREAKSMVDFVKAQIRN  496
               + SL   + ++GFPTI VF   K  P+ Y+GAR A ++  F   Q+  
Sbjct  187  DICYQSLMSRFKVQGFPTILVFGADKDSPIPYEGARTASAIESFALEQLET  237



>gb|EMS60416.1| Protein disulfide isomerase-like 2-3 [Triticum urartu]
Length=371

 Score =   213 bits (542),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 123/205 (60%), Positives = 143/205 (70%), Gaps = 43/205 (21%)
 Frame = +2

Query  173  TPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaaldad  352
            +PVLQLNP+NFK KVLN+NGVVLVEFFAPWCGHCK LTP +EK A VLKGVATVAALDAD
Sbjct  28   SPVLQLNPNNFK-KVLNANGVVLVEFFAPWCGHCKQLTPIWEKAAGVLKGVATVAALDAD  86

Query  353  ahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQ---------------  487
            AH  LAQ+YGI+GFPTIKVF+PGK PVDY+GAR+ K +V+F  +Q               
Sbjct  87   AHKELAQQYGIRGFPTIKVFLPGKPPVDYEGARDVKPIVNFALSQTFKPLYPTYKPNRRE  146

Query  488  ------------------IRNLLKDRLD---------GKATGGSSQKSEPSASVELNSRN  586
                              ++ LL+DRLD           + G S +K+EP+ SVELNS N
Sbjct  147  YEFVSYVAKVVSFHFHYKVKGLLRDRLDGKTSGGSSGKTSGGSSEKKNEPNESVELNSSN  206

Query  587  FDDLVVKSKDLWIVEFFAPWCGHCK  661
            FD+LVVKSKDLWIVEFFAPWCGHCK
Sbjct  207  FDELVVKSKDLWIVEFFAPWCGHCK  231


 Score = 84.7 bits (208),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 47/105 (45%), Positives = 65/105 (62%), Gaps = 1/105 (1%)
 Frame = +2

Query  182  LQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaaldadahs  361
            ++LN SNF   V+ S  + +VEFFAPWCGHCK L P +++ A  LKG   +  +D D+  
Sbjct  200  VELNSSNFDELVVKSKDLWIVEFFAPWCGHCKKLAPEWKRAAKNLKGQVKLGHVDCDSDK  259

Query  362  slaQEYGIKGFPTIKVFVPGKQ-PVDYQGAREAKSMVDFVKAQIR  493
            SL  +Y ++GFPTI VF   K+ P  YQGAR A ++  F   Q+ 
Sbjct  260  SLMSKYKVEGFPTILVFGADKESPFPYQGARAASAIESFALEQLE  304



>ref|XP_001780684.1| predicted protein [Physcomitrella patens]
 gb|EDQ54468.1| predicted protein [Physcomitrella patens]
Length=427

 Score =   205 bits (521),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 107/176 (61%), Positives = 134/176 (76%), Gaps = 6/176 (3%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            +ALYGPS+ V+QL  SNFK+KVL + G+VLVEF+A WCGHCK L P +EK A+ LKG+ T
Sbjct  18   SALYGPSSDVVQLTSSNFKNKVLGAEGIVLVEFYANWCGHCKNLAPAWEKAATSLKGIVT  77

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDR  511
            VAA+DAD H  LAQ+YGI+GFPTIKVF  GK P+DYQGAREAK++VD+   Q++ L  DR
Sbjct  78   VAAVDADTHKDLAQQYGIQGFPTIKVFGLGKSPIDYQGAREAKAIVDYALQQVKTLALDR  137

Query  512  LDGKATGGSSQKSE------PSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            L+GK+    S   +      PSAS EL+S NFD LVV+S D W++EF+APWCGHCK
Sbjct  138  LNGKSGSKKSSSKKDKDSNGPSASTELSSSNFDKLVVQSDDTWLIEFYAPWCGHCK  193


 Score = 85.5 bits (210),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 47/111 (42%), Positives = 69/111 (62%), Gaps = 2/111 (2%)
 Frame = +2

Query  164  GPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaal  343
            GPS    +L+ SNF   V+ S+   L+EF+APWCGHCK L P ++  A  LKG   +  +
Sbjct  157  GPSAST-ELSSSNFDKLVVQSDDTWLIEFYAPWCGHCKKLAPEWKTAAKNLKGKMKLGQV  215

Query  344  dadahsslaQEYGIKGFPTIKVF-VPGKQPVDYQGAREAKSMVDFVKAQIR  493
            D + +  LAQ+YGI+GFPTI +F V  + P  Y+GAR A ++  +  +Q+ 
Sbjct  216  DCETNKDLAQKYGIQGFPTIMLFGVDKENPTLYEGARTAGAIESYAISQLE  266



>ref|XP_002973288.1| hypothetical protein SELMODRAFT_232026 [Selaginella moellendorffii]
 gb|EFJ25662.1| hypothetical protein SELMODRAFT_232026 [Selaginella moellendorffii]
Length=442

 Score =   194 bits (493),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 101/171 (59%), Positives = 126/171 (74%), Gaps = 3/171 (2%)
 Frame = +2

Query  158  LYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVa  337
            LY  S+ V+ +NPSNFKSKVL++ G+V+VEFFA WCGHCKAL P ++K A+ LKG+ T+A
Sbjct  28   LYDASSDVVIVNPSNFKSKVLDAKGIVIVEFFANWCGHCKALAPAWDKAATALKGIVTIA  87

Query  338  aldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDRLD  517
            A+DAD H SLA EYG++GFPTIKVF  GK P+DYQG REAK +V+F   Q + L  DRL 
Sbjct  88   AVDADTHKSLAAEYGLQGFPTIKVFGVGKSPIDYQGPREAKGIVEFALQQAKTLALDRLK  147

Query  518  GKATGGSSQKSEPS---ASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
             K      +K  P    AS+EL   NFD+ V+KS D+W+VEFFAPWCGHCK
Sbjct  148  SKKKSQDKEKKNPDKEKASIELTPTNFDEQVLKSNDIWLVEFFAPWCGHCK  198


 Score = 91.3 bits (225),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 63/96 (66%), Gaps = 1/96 (1%)
 Frame = +2

Query  182  LQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaaldadahs  361
            ++L P+NF  +VL SN + LVEFFAPWCGHCK L P ++  A  LKG   +  +D DAH 
Sbjct  167  IELTPTNFDEQVLKSNDIWLVEFFAPWCGHCKKLAPEWKNAAKRLKGKVKLGQVDGDAHK  226

Query  362  slaQEYGIKGFPTIKVFVPGKQ-PVDYQGAREAKSM  466
             L  +Y + GFPTI VF   KQ P  YQGAR+A ++
Sbjct  227  DLMSKYSVTGFPTILVFGADKQNPTVYQGARDASAI  262



>ref|XP_002976616.1| hypothetical protein SELMODRAFT_232834 [Selaginella moellendorffii]
 gb|EFJ22285.1| hypothetical protein SELMODRAFT_232834 [Selaginella moellendorffii]
Length=442

 Score =   192 bits (487),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 98/171 (57%), Positives = 124/171 (73%), Gaps = 3/171 (2%)
 Frame = +2

Query  158  LYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVa  337
            LY  S+ V+ +NPSNFKSKVL++ G+V+VEFFA WCGHCKAL P ++K A+ LKG+ T+A
Sbjct  28   LYDASSDVVIVNPSNFKSKVLDAKGIVIVEFFANWCGHCKALAPAWDKAATALKGIVTIA  87

Query  338  aldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDRL-  514
            A+DAD H SLA EYG++GFPTIKVF  GK P+DYQG REAK +V+F   Q + L  DRL 
Sbjct  88   AVDADTHKSLAAEYGLQGFPTIKVFGVGKSPIDYQGPREAKGIVEFALQQAKTLALDRLK  147

Query  515  --DGKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
                        + +  AS+EL   NFD+ V+KS D+W+VEFFAPWCGHCK
Sbjct  148  SKKKSQDKEKKNQDKEKASIELTPTNFDEQVLKSNDIWLVEFFAPWCGHCK  198


 Score = 90.9 bits (224),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 63/96 (66%), Gaps = 1/96 (1%)
 Frame = +2

Query  182  LQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaaldadahs  361
            ++L P+NF  +VL SN + LVEFFAPWCGHCK L P ++  A  LKG   +  +D DAH 
Sbjct  167  IELTPTNFDEQVLKSNDIWLVEFFAPWCGHCKKLAPEWKNAAKRLKGKVKLGQVDGDAHK  226

Query  362  slaQEYGIKGFPTIKVFVPGKQ-PVDYQGAREAKSM  466
             L  +Y + GFPTI VF   KQ P  YQGAR+A ++
Sbjct  227  DLMSKYSVTGFPTILVFGADKQNPTVYQGARDASAI  262



>ref|XP_006869520.1| PREDICTED: protein disulfide-isomerase A6 [Chrysochloris asiatica]
Length=437

 Score =   179 bits (454),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 91/173 (53%), Positives = 122/173 (71%), Gaps = 3/173 (2%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            N LY  S  V++L PSNF  +V+ S+ + LVEFFAPWCGHC+ LTP ++KVA+ LKGV  
Sbjct  18   NGLYSSSDDVIELTPSNFNREVIQSDSLWLVEFFAPWCGHCQRLTPEWKKVATALKGVVK  77

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  508
            V A+DAD H SL  +YG++GFPTIK+F   K +P DYQG R A+++VD   + +R L+KD
Sbjct  78   VGAVDADKHQSLGGQYGVQGFPTIKIFSSNKNRPEDYQGGRTAEAIVDAALSAVRQLVKD  137

Query  509  RLDGKATG--GSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            RL G++ G  G S+ S     +EL    FD  V+ S+D+W+VEF+APWCGHCK
Sbjct  138  RLGGRSGGKQGRSEGSSKKDVIELTDDTFDKNVLDSEDVWMVEFYAPWCGHCK  190


 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 47/101 (47%), Positives = 63/101 (62%), Gaps = 4/101 (4%)
 Frame = +2

Query  179  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  346
            V++L    F   VL+S  V +VEF+APWCGHCK L P +   A+ +    KG   +AA+D
Sbjct  158  VIELTDDTFDKNVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAATEVKEQTKGKVKLAAVD  217

Query  347  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  469
            A A+  LA  Y I+GFPTIK+F  G+ PVDY G R   ++V
Sbjct  218  ATANQMLANRYEIRGFPTIKIFQKGESPVDYDGGRTKSNIV  258



>gb|EPQ08422.1| Protein disulfide-isomerase A6 [Myotis brandtii]
Length=460

 Score =   176 bits (447),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 91/175 (52%), Positives = 122/175 (70%), Gaps = 5/175 (3%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            N LY  S  V++L PSNF  +V+ SN +  VEFFAPWCGHC+ LTP ++KVA+ LKGV  
Sbjct  40   NGLYSSSDDVIELTPSNFNQEVIQSNSLWFVEFFAPWCGHCQRLTPEWKKVATALKGVVK  99

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  508
            V A+DAD H SL  +YG++GFPTIK+F   K +P DYQG R A ++VD   + +R L+KD
Sbjct  100  VGAVDADKHQSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTADAIVDAALSALRQLIKD  159

Query  509  RLDGKA-TGGSSQKSEPSAS---VELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            RL G+  + G   +SE S+    +EL   +FD  V+ S+D+W+VEF+APWCGHCK
Sbjct  160  RLGGRGYSSGRQGRSESSSKKDVIELTDDSFDKNVLDSEDVWMVEFYAPWCGHCK  214


 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 47/101 (47%), Positives = 63/101 (62%), Gaps = 4/101 (4%)
 Frame = +2

Query  179  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  346
            V++L   +F   VL+S  V +VEF+APWCGHCK L P +   A+ +    KG   +AA+D
Sbjct  182  VIELTDDSFDKNVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAATEVKEQTKGKVKLAAVD  241

Query  347  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  469
            A A+  L   YGI+GFPTIK+F  G+ PVDY G R    +V
Sbjct  242  ATANQMLTGRYGIRGFPTIKIFQKGESPVDYDGGRTRSDIV  282



>ref|XP_007243763.1| PREDICTED: protein disulfide-isomerase A6-like, partial [Astyanax 
mexicanus]
Length=205

 Score =   169 bits (429),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 90/183 (49%), Positives = 123/183 (67%), Gaps = 14/183 (8%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            + LY  S  V++LNPSNF  +VL S+ + LVEF+APWCGHC++L P ++K AS LKGV  
Sbjct  23   HGLYSASDDVIELNPSNFNREVLQSDSLWLVEFYAPWCGHCQSLVPEWKKAASALKGVVK  82

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  508
            + A+DAD H+SL  +YG++GFPTIK+F   K +P +YQG R ++++VD     +R+++KD
Sbjct  83   IGAVDADQHNSLGGQYGVRGFPTIKIFGANKNKPEEYQGGRSSQAIVDTALNALRSIVKD  142

Query  509  RLDGKATGGSSQKSEPSAS------------VELNSRNFDDLVVKSKDLWIVEFFAPWCG  652
            RL GK TGGS    + S              +EL   NFD+ V  S D+W+VEFFAPWCG
Sbjct  143  RLSGK-TGGSDYSRQSSGGGGGSSGGSKQDVIELTDDNFDEKVFGSDDVWMVEFFAPWCG  201

Query  653  HCK  661
            HCK
Sbjct  202  HCK  204



>gb|ELK29163.1| Protein disulfide-isomerase A6 [Myotis davidii]
Length=525

 Score =   177 bits (449),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 92/175 (53%), Positives = 121/175 (69%), Gaps = 5/175 (3%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            N LY  S  V++L PSNF  +V+ SN +  VEFFAPWCGHC+ LTP ++KVA+ LKGV  
Sbjct  105  NGLYSSSDDVIELTPSNFNQEVIQSNSLWFVEFFAPWCGHCQRLTPEWKKVATALKGVVK  164

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  508
            V A+DAD H SL  +YG++GFPTIK+F   K +P DYQG R A ++VD     +R L+KD
Sbjct  165  VGAVDADKHQSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTADAIVDAALGALRQLVKD  224

Query  509  RLDGKA-TGGSSQKSEPSAS---VELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            RL G+  + G   +SE S+    +EL   NFD  V+ S+D+W+VEF+APWCGHCK
Sbjct  225  RLGGRGYSSGRQGRSESSSKKDVIELTDDNFDKNVLDSEDVWMVEFYAPWCGHCK  279


 Score = 89.4 bits (220),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 63/101 (62%), Gaps = 4/101 (4%)
 Frame = +2

Query  179  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  346
            V++L   NF   VL+S  V +VEF+APWCGHCK L P +   A+ +    KG   +AA+D
Sbjct  247  VIELTDDNFDKNVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAATEVKEQTKGKVKLAAVD  306

Query  347  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  469
            A A+  L   YGI+GFPTIK+F  G+ PVDY G R    +V
Sbjct  307  ATANQMLTGRYGIRGFPTIKIFQKGESPVDYDGGRTRSDIV  347



>ref|XP_006102414.1| PREDICTED: protein disulfide-isomerase A6 [Myotis lucifugus]
Length=503

 Score =   177 bits (448),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 92/175 (53%), Positives = 122/175 (70%), Gaps = 5/175 (3%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            N LY  S  V++L PSNF  +V+ SN +  VEFFAPWCGHC+ LTP ++KVA+ LKGV  
Sbjct  83   NGLYSSSDDVIELTPSNFNQEVIQSNSLWFVEFFAPWCGHCQRLTPEWKKVATALKGVVK  142

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  508
            V A+DAD H SL  +YG++GFPTIK+F   K +P DYQG R A ++VD   + +R L+KD
Sbjct  143  VGAVDADKHQSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTADAIVDAALSALRQLVKD  202

Query  509  RLDGKA-TGGSSQKSEPSAS---VELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            RL G+  + G   +SE S+    +EL   NFD  V+ S+D+W+VEF+APWCGHCK
Sbjct  203  RLGGRGYSSGRQGRSESSSKKDVIELTDDNFDKNVLDSEDVWMVEFYAPWCGHCK  257


 Score = 89.0 bits (219),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 63/101 (62%), Gaps = 4/101 (4%)
 Frame = +2

Query  179  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  346
            V++L   NF   VL+S  V +VEF+APWCGHCK L P +   A+ +    KG   +AA+D
Sbjct  225  VIELTDDNFDKNVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAATEVKEQTKGKVKLAAVD  284

Query  347  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  469
            A A+  L   YGI+GFPTIK+F  G+ PVDY G R    +V
Sbjct  285  ATANQMLTGRYGIRGFPTIKIFQKGESPVDYDGGRTRSDIV  325



>ref|XP_005803193.1| PREDICTED: protein disulfide-isomerase A6-like isoform X1 [Xiphophorus 
maculatus]
Length=440

 Score =   175 bits (444),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 88/175 (50%), Positives = 121/175 (69%), Gaps = 6/175 (3%)
 Frame = +2

Query  155  ALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATV  334
            A+Y  S  V++L PSNF  +V+ S+ + LVEF+APWCGHC++L P ++K A+ LKG+  V
Sbjct  19   AMYSSSDDVIELTPSNFNREVIQSDSLWLVEFYAPWCGHCQSLAPEWKKAATALKGIVKV  78

Query  335  aaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKDR  511
             A+DAD H SL  +YG++GFPTIKVF   K +P +YQG R ++++VD     +R L+K+R
Sbjct  79   GAVDADQHKSLGGQYGVRGFPTIKVFGANKNKPEEYQGGRSSQAIVDGAMNALRALVKER  138

Query  512  LDGKATGGSSQKSEPSAS-----VELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            L GK+ G S  K + S       VEL   NFD+ V+ S D+W+VEFFAPWCGHCK
Sbjct  139  LSGKSGGSSYNKQQSSGGSKKDVVELTDDNFDETVLNSDDVWLVEFFAPWCGHCK  193


 Score = 93.2 bits (230),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 47/107 (44%), Positives = 66/107 (62%), Gaps = 4/107 (4%)
 Frame = +2

Query  164  GPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVAT  331
            G    V++L   NF   VLNS+ V LVEFFAPWCGHCK L P +   A+ +    KG   
Sbjct  156  GSKKDVVELTDDNFDETVLNSDDVWLVEFFAPWCGHCKNLEPEWAAAATAVKEQTKGKVR  215

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVD  472
            + A+DA  H  ++  YG++GFP+IK+F  G++P DYQG R    +++
Sbjct  216  LGAVDATVHQVVSSRYGVRGFPSIKIFRKGEEPEDYQGGRTRGDIIE  262



>ref|XP_006765261.1| PREDICTED: protein disulfide-isomerase A6 [Myotis davidii]
Length=539

 Score =   177 bits (449),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 92/175 (53%), Positives = 121/175 (69%), Gaps = 5/175 (3%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            N LY  S  V++L PSNF  +V+ SN +  VEFFAPWCGHC+ LTP ++KVA+ LKGV  
Sbjct  119  NGLYSSSDDVIELTPSNFNQEVIQSNSLWFVEFFAPWCGHCQRLTPEWKKVATALKGVVK  178

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  508
            V A+DAD H SL  +YG++GFPTIK+F   K +P DYQG R A ++VD     +R L+KD
Sbjct  179  VGAVDADKHQSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTADAIVDAALGALRQLVKD  238

Query  509  RLDGKA-TGGSSQKSEPSAS---VELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            RL G+  + G   +SE S+    +EL   NFD  V+ S+D+W+VEF+APWCGHCK
Sbjct  239  RLGGRGYSSGRQGRSESSSKKDVIELTDDNFDKNVLDSEDVWMVEFYAPWCGHCK  293


 Score = 89.0 bits (219),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 63/101 (62%), Gaps = 4/101 (4%)
 Frame = +2

Query  179  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  346
            V++L   NF   VL+S  V +VEF+APWCGHCK L P +   A+ +    KG   +AA+D
Sbjct  261  VIELTDDNFDKNVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAATEVKEQTKGKVKLAAVD  320

Query  347  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  469
            A A+  L   YGI+GFPTIK+F  G+ PVDY G R    +V
Sbjct  321  ATANQMLTGRYGIRGFPTIKIFQKGESPVDYDGGRTRSDIV  361



>ref|XP_007257385.1| PREDICTED: protein disulfide-isomerase A6 [Astyanax mexicanus]
Length=441

 Score =   175 bits (443),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 89/180 (49%), Positives = 121/180 (67%), Gaps = 11/180 (6%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            +  Y  S  V++LNPSNF  +VL S+ + L+EF+APWCGHC+ LTP ++K A+ LKG+  
Sbjct  17   HGFYTASDDVIELNPSNFNKQVLQSDSLWLIEFYAPWCGHCQRLTPDWKKAATALKGIVK  76

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  508
            + A+DAD H SL  +YGI+GFPTIKVF   K +P DYQG R ++++V+     +R+L+KD
Sbjct  77   IGAVDADQHKSLGSQYGIRGFPTIKVFGANKNKPDDYQGGRTSEAIVEGAMTALRSLVKD  136

Query  509  RLDGKATGGSSQKSEPSAS---------VELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            RL G+ TGGS Q  +             VEL   NFD LV+   ++W+VEFFAPWCGHCK
Sbjct  137  RLSGR-TGGSGQSKQSGGGSGAGDKKDVVELTDDNFDRLVLNGDEVWMVEFFAPWCGHCK  195


 Score = 90.5 bits (223),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 49/106 (46%), Positives = 64/106 (60%), Gaps = 4/106 (4%)
 Frame = +2

Query  164  GPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVAT  331
            G    V++L   NF   VLN + V +VEFFAPWCGHCK L P +   A+ +    KG   
Sbjct  158  GDKKDVVELTDDNFDRLVLNGDEVWMVEFFAPWCGHCKRLEPEWTAAATAVKDQTKGKVK  217

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  469
            + A+DA  H  LA  YGI+GFPTIK+F  G++P DY+G R    +V
Sbjct  218  LGAVDATVHQGLASRYGIRGFPTIKIFSKGEEPEDYEGGRTRADIV  263



>ref|XP_005803194.1| PREDICTED: protein disulfide-isomerase A6-like isoform X2 [Xiphophorus 
maculatus]
Length=439

 Score =   175 bits (443),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 88/174 (51%), Positives = 120/174 (69%), Gaps = 5/174 (3%)
 Frame = +2

Query  155  ALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATV  334
            A+Y  S  V++L PSNF  +V+ S+ + LVEF+APWCGHC++L P ++K A+ LKG+  V
Sbjct  19   AMYSSSDDVIELTPSNFNREVIQSDSLWLVEFYAPWCGHCQSLAPEWKKAATALKGIVKV  78

Query  335  aaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKDR  511
             A+DAD H SL  +YG++GFPTIKVF   K +P +YQG R ++++VD     +R L+K+R
Sbjct  79   GAVDADQHKSLGGQYGVRGFPTIKVFGANKNKPEEYQGGRSSQAIVDGAMNALRALVKER  138

Query  512  LDGKATGGSSQKSEPSAS----VELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            L GK+ G S  K     S    VEL   NFD+ V+ S D+W+VEFFAPWCGHCK
Sbjct  139  LSGKSGGSSYNKQSSGGSKKDVVELTDDNFDETVLNSDDVWLVEFFAPWCGHCK  192


 Score = 93.2 bits (230),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 47/107 (44%), Positives = 66/107 (62%), Gaps = 4/107 (4%)
 Frame = +2

Query  164  GPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVAT  331
            G    V++L   NF   VLNS+ V LVEFFAPWCGHCK L P +   A+ +    KG   
Sbjct  155  GSKKDVVELTDDNFDETVLNSDDVWLVEFFAPWCGHCKNLEPEWAAAATAVKEQTKGKVR  214

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVD  472
            + A+DA  H  ++  YG++GFP+IK+F  G++P DYQG R    +++
Sbjct  215  LGAVDATVHQVVSSRYGVRGFPSIKIFRKGEEPEDYQGGRTRGDIIE  261



>ref|XP_005867329.1| PREDICTED: protein disulfide-isomerase A6 [Myotis brandtii]
Length=471

 Score =   175 bits (444),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 91/175 (52%), Positives = 122/175 (70%), Gaps = 5/175 (3%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            N LY  S  V++L PSNF  +V+ SN +  VEFFAPWCGHC+ LTP ++KVA+ LKGV  
Sbjct  51   NGLYSSSDDVIELTPSNFNQEVIQSNSLWFVEFFAPWCGHCQRLTPEWKKVATALKGVVK  110

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  508
            V A+DAD H SL  +YG++GFPTIK+F   K +P DYQG R A ++VD   + +R L+KD
Sbjct  111  VGAVDADKHQSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTADAIVDAALSALRQLIKD  170

Query  509  RLDGKA-TGGSSQKSEPSAS---VELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            RL G+  + G   +SE S+    +EL   +FD  V+ S+D+W+VEF+APWCGHCK
Sbjct  171  RLGGRGYSSGRQGRSESSSKKDVIELTDDSFDKNVLDSEDVWMVEFYAPWCGHCK  225


 Score = 87.0 bits (214),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 47/101 (47%), Positives = 63/101 (62%), Gaps = 4/101 (4%)
 Frame = +2

Query  179  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  346
            V++L   +F   VL+S  V +VEF+APWCGHCK L P +   A+ +    KG   +AA+D
Sbjct  193  VIELTDDSFDKNVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAATEVKEQTKGKVKLAAVD  252

Query  347  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  469
            A A+  L   YGI+GFPTIK+F  G+ PVDY G R    +V
Sbjct  253  ATANQMLTGRYGIRGFPTIKIFQKGESPVDYDGGRTRSDIV  293



>ref|XP_007546385.1| PREDICTED: protein disulfide-isomerase A6 isoform X1 [Poecilia 
formosa]
Length=440

 Score =   174 bits (442),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 88/175 (50%), Positives = 120/175 (69%), Gaps = 6/175 (3%)
 Frame = +2

Query  155  ALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATV  334
            A+Y  S  V++L PSNF  +V+ S+ + LVEF+APWCGHC+ L P ++K A+ LKG+  V
Sbjct  19   AMYSSSDDVIELTPSNFNREVIQSDSLWLVEFYAPWCGHCQNLAPEWKKAATALKGIVKV  78

Query  335  aaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKDR  511
             A+DAD H SL  +YG++GFPTIKVF   K +P +YQG R ++++VD     +R L+K+R
Sbjct  79   GAVDADQHKSLGGQYGVRGFPTIKVFGANKNKPEEYQGGRSSQAIVDGAMNALRTLVKER  138

Query  512  LDGKATGGSSQKSEPSAS-----VELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            L GK+ G S  K + S       VEL   NFD+ V+ S D+W+VEFFAPWCGHCK
Sbjct  139  LSGKSGGSSYNKQQSSGGSKKDVVELTDDNFDETVLNSDDVWLVEFFAPWCGHCK  193


 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 50/107 (47%), Positives = 66/107 (62%), Gaps = 4/107 (4%)
 Frame = +2

Query  164  GPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVAT  331
            G    V++L   NF   VLNS+ V LVEFFAPWCGHCK L P +   A+ +    KG   
Sbjct  156  GSKKDVVELTDDNFDETVLNSDDVWLVEFFAPWCGHCKNLEPEWAAAATAVKEQTKGKVR  215

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVD  472
            + A+DA  H  ++  YGI+GFPTIKVF  G++P DYQG R    +++
Sbjct  216  LGAVDATVHQVVSSRYGIRGFPTIKVFRKGEEPEDYQGGRTRGDIIE  262



>ref|XP_011160406.1| PREDICTED: protein disulfide-isomerase A6 [Solenopsis invicta]
 gb|EFZ17811.1| hypothetical protein SINV_06451 [Solenopsis invicta]
Length=439

 Score =   174 bits (442),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 83/170 (49%), Positives = 115/170 (68%), Gaps = 0/170 (0%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            N +Y  ++ V+ L P+NF + VLNS+ + +VEF+APWCGHC+ LTP Y+K A+ LKGV  
Sbjct  26   NCMYASNSAVVDLRPNNFDNLVLNSDHIWIVEFYAPWCGHCQQLTPEYDKAATALKGVVK  85

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDR  511
            V A++AD H SL  +YG++GFPTIK+F   K+P DY G R A  +VD         ++  
Sbjct  86   VGAVNADEHKSLGSKYGVRGFPTIKIFGLDKKPEDYNGPRSAAGIVDAALNAASQKVRKV  145

Query  512  LDGKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            L GK +GG S+  +P   +EL   NFD  V+ S+D+W+VEF+APWCGHCK
Sbjct  146  LGGKTSGGESKSKDPKDVIELTDENFDKNVLNSEDMWLVEFYAPWCGHCK  195


 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 47/104 (45%), Positives = 63/104 (61%), Gaps = 4/104 (4%)
 Frame = +2

Query  179  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaaldadah  358
            V++L   NF   VLNS  + LVEF+APWCGHCK L P +   A+ LKG   + ALDA  +
Sbjct  163  VIELTDENFDKNVLNSEDMWLVEFYAPWCGHCKNLAPEWAAAATELKGKVKLGALDATVN  222

Query  359  sslaQEYGIKGFPTIKVFVPGKQPV----DYQGAREAKSMVDFV  478
            +    +Y IKG+PTIK F PGK+      DY G R +  +V++ 
Sbjct  223  TLKTSKYEIKGYPTIKFFAPGKKDADSVQDYDGGRTSGDIVNWA  266



>ref|NP_922915.2| protein disulfide-isomerase A6 precursor [Danio rerio]
 gb|AAH44507.1| Protein disulfide isomerase-related protein (provisional) [Danio 
rerio]
 gb|AAI65811.1| Pdip5 protein [Danio rerio]
Length=440

 Score =   174 bits (442),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 94/177 (53%), Positives = 125/177 (71%), Gaps = 9/177 (5%)
 Frame = +2

Query  155  ALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATV  334
             LY  S  V++LNPSNF  +V+ S+ + LVEF+APWCGHCK+L P ++K A+ LKG+  V
Sbjct  19   GLYTSSDDVVELNPSNFNREVIQSDSLWLVEFYAPWCGHCKSLAPEWKKAATALKGIVKV  78

Query  335  aaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKDR  511
             A+DAD H+SL  +YG++GFPTIK+F   K +P DYQG R  +++VD     +R+L+KDR
Sbjct  79   GAVDADQHNSLGGQYGVRGFPTIKIFGGNKHKPEDYQGGRTNQAIVDAALNALRSLVKDR  138

Query  512  LDGKATGGS--SQKSEPSAS-----VELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            L GK TGGS  S++S   A      VEL   NFD  V++S D+W+VEFFAPWCGHCK
Sbjct  139  LGGK-TGGSDYSRQSGGGAGNKKDVVELTDDNFDRTVLESDDVWLVEFFAPWCGHCK  194


 Score = 90.5 bits (223),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 52/106 (49%), Positives = 64/106 (60%), Gaps = 4/106 (4%)
 Frame = +2

Query  164  GPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVAT  331
            G    V++L   NF   VL S+ V LVEFFAPWCGHCK L P +   A+ +    KG   
Sbjct  157  GNKKDVVELTDDNFDRTVLESDDVWLVEFFAPWCGHCKNLEPEWTAAATEVKEQTKGKVR  216

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  469
            +AA DA  H  LA  +GI+GFPTIKVF  G++P DYQG R    +V
Sbjct  217  LAAEDATVHQGLASRFGIRGFPTIKVFRKGEEPEDYQGGRTRSDIV  262



>ref|XP_007529904.1| PREDICTED: protein disulfide-isomerase A6 [Erinaceus europaeus]
Length=440

 Score =   174 bits (442),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 91/177 (51%), Positives = 120/177 (68%), Gaps = 7/177 (4%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            N LY  S  V++L PSNF  +V+ SN + LVEF+APWCGHC+ LTP ++K AS LKGV  
Sbjct  18   NGLYSSSDDVIELTPSNFNQEVIQSNSLWLVEFYAPWCGHCQRLTPEWKKAASALKGVVK  77

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  508
            V A++AD H SL  +YG++GFPTIK+F   K +  DYQG R ++++VD     +R L+KD
Sbjct  78   VGAVNADKHQSLGGQYGVQGFPTIKIFGSNKNRAEDYQGGRTSEAIVDAALTALRQLVKD  137

Query  509  RLDGKATGGSSQKSEPSAS------VELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            RL G+  G SS K   S S      +EL   NFD  V+ S+D+W+VEF+APWCGHCK
Sbjct  138  RLAGRDGGYSSGKQGRSESSSKKDVIELTDDNFDTNVLDSEDVWMVEFYAPWCGHCK  194


 Score = 89.4 bits (220),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 47/101 (47%), Positives = 64/101 (63%), Gaps = 4/101 (4%)
 Frame = +2

Query  179  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  346
            V++L   NF + VL+S  V +VEF+APWCGHCK L P +   A+ +    KG   +AA+D
Sbjct  162  VIELTDDNFDTNVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAATEVKDQTKGKVKLAAVD  221

Query  347  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  469
            A  +  LA  YGI+GFPTIK+F  G+ P+DY G R    +V
Sbjct  222  ATVNQVLASRYGIRGFPTIKIFQKGESPMDYDGGRTKSDIV  262



>ref|XP_008287318.1| PREDICTED: protein disulfide-isomerase A6 [Stegastes partitus]
Length=442

 Score =   174 bits (442),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 92/179 (51%), Positives = 122/179 (68%), Gaps = 10/179 (6%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
             ALY     V++LNPSNF  +V+ S+ + LVEF+APWCGHC++LTP ++K A+ LKGV  
Sbjct  18   QALYSSGDDVVELNPSNFNREVIQSDSLWLVEFYAPWCGHCQSLTPEWKKAATALKGVVK  77

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  508
            V A+DAD H SL  +YG+KGFPTIK+F   K +P  YQG R ++++VD     +R+L+KD
Sbjct  78   VGAVDADQHKSLGGQYGVKGFPTIKIFGGNKNKPEAYQGGRSSQAIVDAAMNALRSLVKD  137

Query  509  RLDGKATGGSSQKSEPSAS--------VELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            RL GK +GGSS   +            VEL   NFD +V+ S D+W+VEFFAPWCGHCK
Sbjct  138  RLSGK-SGGSSYNQQSGGGGGGSKKDVVELTDDNFDRMVLDSDDVWLVEFFAPWCGHCK  195


 Score = 92.4 bits (228),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 48/102 (47%), Positives = 65/102 (64%), Gaps = 4/102 (4%)
 Frame = +2

Query  179  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  346
            V++L   NF   VL+S+ V LVEFFAPWCGHCK L P +   A+ +    KG   + A+D
Sbjct  163  VVELTDDNFDRMVLDSDDVWLVEFFAPWCGHCKNLEPEWAAAATAVKEQTKGRVRLGAVD  222

Query  347  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVD  472
            A  H  ++  YGI+GFPTIKVF  G++P DYQG R    +++
Sbjct  223  ATVHQVVSSRYGIRGFPTIKVFKKGEEPEDYQGGRSRGDIIE  264



>gb|AAK71636.1|AF387900_1 protein disulfide isomerase-related protein P5 precursor [Danio 
rerio]
Length=440

 Score =   174 bits (441),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 94/177 (53%), Positives = 125/177 (71%), Gaps = 9/177 (5%)
 Frame = +2

Query  155  ALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATV  334
             LY  S  V++LNPSNF  +V+ S+ + LVEF+APWCGHCK+L P ++K A+ LKG+  V
Sbjct  19   GLYTSSDDVVELNPSNFNREVIQSDSLWLVEFYAPWCGHCKSLAPEWKKAATALKGIVKV  78

Query  335  aaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKDR  511
             A+DAD H+SL  +YG++GFPTIK+F   K +P DYQG R  +++VD     +R+L+KDR
Sbjct  79   GAVDADQHNSLGGQYGVRGFPTIKIFGGNKHKPEDYQGGRTNQAIVDAALNALRSLVKDR  138

Query  512  LDGKATGGS--SQKSEPSAS-----VELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            L GK TGGS  S++S   A      VEL   NFD  V++S D+W+VEFFAPWCGHCK
Sbjct  139  LGGK-TGGSDYSRQSGGGAGNKKDVVELTDDNFDRTVLESDDVWLVEFFAPWCGHCK  194


 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 52/106 (49%), Positives = 65/106 (61%), Gaps = 4/106 (4%)
 Frame = +2

Query  164  GPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVAT  331
            G    V++L   NF   VL S+ V LVEFFAPWCGHCK L P +   A+ +    KG   
Sbjct  157  GNKKDVVELTDDNFDRTVLESDDVWLVEFFAPWCGHCKNLEPEWTAAATEVKEQTKGKVK  216

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  469
            +AA+DA  H  LA  +GI+GFPTIKVF  G++P DYQG R    +V
Sbjct  217  LAAVDATVHQGLASRFGIRGFPTIKVFRKGEEPEDYQGGRTRSDIV  262



>ref|XP_007546392.1| PREDICTED: protein disulfide-isomerase A6 isoform X2 [Poecilia 
formosa]
Length=439

 Score =   174 bits (441),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 88/174 (51%), Positives = 119/174 (68%), Gaps = 5/174 (3%)
 Frame = +2

Query  155  ALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATV  334
            A+Y  S  V++L PSNF  +V+ S+ + LVEF+APWCGHC+ L P ++K A+ LKG+  V
Sbjct  19   AMYSSSDDVIELTPSNFNREVIQSDSLWLVEFYAPWCGHCQNLAPEWKKAATALKGIVKV  78

Query  335  aaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKDR  511
             A+DAD H SL  +YG++GFPTIKVF   K +P +YQG R ++++VD     +R L+K+R
Sbjct  79   GAVDADQHKSLGGQYGVRGFPTIKVFGANKNKPEEYQGGRSSQAIVDGAMNALRTLVKER  138

Query  512  LDGKATGGSSQKSEPSAS----VELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            L GK+ G S  K     S    VEL   NFD+ V+ S D+W+VEFFAPWCGHCK
Sbjct  139  LSGKSGGSSYNKQSSGGSKKDVVELTDDNFDETVLNSDDVWLVEFFAPWCGHCK  192


 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 50/107 (47%), Positives = 66/107 (62%), Gaps = 4/107 (4%)
 Frame = +2

Query  164  GPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVAT  331
            G    V++L   NF   VLNS+ V LVEFFAPWCGHCK L P +   A+ +    KG   
Sbjct  155  GSKKDVVELTDDNFDETVLNSDDVWLVEFFAPWCGHCKNLEPEWAAAATAVKEQTKGKVR  214

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVD  472
            + A+DA  H  ++  YGI+GFPTIKVF  G++P DYQG R    +++
Sbjct  215  LGAVDATVHQVVSSRYGIRGFPTIKVFRKGEEPEDYQGGRTRGDIIE  261



>ref|XP_008160636.1| PREDICTED: protein disulfide-isomerase A6 [Eptesicus fuscus]
Length=438

 Score =   174 bits (440),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 90/175 (51%), Positives = 121/175 (69%), Gaps = 5/175 (3%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            + LY     V++L PSNF  +V+ SN + LVEFFAPWCGHC+ LTP ++KVA+ LKGV  
Sbjct  18   SGLYSSGDDVIELTPSNFNQEVIQSNSLWLVEFFAPWCGHCQRLTPEWKKVATALKGVVR  77

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  508
            V A+DAD H SL  +YG++GFPTIK+F   K +P DYQG R A ++VD     +R L+KD
Sbjct  78   VGAVDADKHQSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTADAIVDAALGALRQLVKD  137

Query  509  RLDGKA-TGGSSQKSEPSAS---VELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            RL G+  + G   +SE S+    +EL   +FD  V+ S+D+W+VEF+APWCGHCK
Sbjct  138  RLGGRGYSSGRQGRSESSSKKDVIELTDDSFDKNVLDSEDVWMVEFYAPWCGHCK  192


 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 47/101 (47%), Positives = 63/101 (62%), Gaps = 4/101 (4%)
 Frame = +2

Query  179  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  346
            V++L   +F   VL+S  V +VEF+APWCGHCK L P +   A+ +    KG   +AA+D
Sbjct  160  VIELTDDSFDKNVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAATEVKEQTKGKVKLAAVD  219

Query  347  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  469
            A A+  L   YGI+GFPTIK+F  G+ PVDY G R    +V
Sbjct  220  ATANQMLTGRYGIRGFPTIKIFQKGESPVDYDGGRTRSDIV  260



>ref|XP_003488434.1| PREDICTED: protein disulfide-isomerase A6-like [Bombus impatiens]
Length=428

 Score =   173 bits (438),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 84/170 (49%), Positives = 113/170 (66%), Gaps = 0/170 (0%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            + LY  ++ V++L P+NF S VLNS+ V +VEFFAPWCGHC+ LTP Y+K A+ LKG+  
Sbjct  15   HCLYSSNSDVIELKPNNFDSLVLNSDNVWIVEFFAPWCGHCQQLTPEYDKAATALKGIVK  74

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDR  511
            V A++AD H SL   YGI+GFPTIK+F    +P DY G R A  +VD          +  
Sbjct  75   VGAVNADEHKSLGSRYGIQGFPTIKIFGTDNKPEDYNGPRTATGIVDAALNAASQKARRA  134

Query  512  LDGKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            L GK +GG S+  +    +EL   NFD +V+ S+D+W+VEF+APWCGHCK
Sbjct  135  LGGKRSGGDSKSKDSKDVIELTDDNFDKMVMNSEDMWLVEFYAPWCGHCK  184


 Score = 90.1 bits (222),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 47/106 (44%), Positives = 64/106 (60%), Gaps = 4/106 (4%)
 Frame = +2

Query  170  STPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaalda  349
            S  V++L   NF   V+NS  + LVEF+APWCGHCK L P +   A+ LKG   + A+DA
Sbjct  149  SKDVIELTDDNFDKMVMNSEDMWLVEFYAPWCGHCKNLAPIWASAATELKGKVKLGAIDA  208

Query  350  dahsslaQEYGIKGFPTIKVFVPGKQPVD----YQGAREAKSMVDF  475
              +   A +Y IKG+PTIK F PGK+  D    Y G R +  +V++
Sbjct  209  TVNRVKASQYEIKGYPTIKYFAPGKKSFDSVQEYDGGRTSSDIVNW  254


 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 25/45 (56%), Positives = 30/45 (67%), Gaps = 0/45 (0%)
 Frame = +2

Query  527  TGGSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            TG     S  S  +EL   NFD LV+ S ++WIVEFFAPWCGHC+
Sbjct  12   TGAHCLYSSNSDVIELKPNNFDSLVLNSDNVWIVEFFAPWCGHCQ  56



>ref|XP_003398403.1| PREDICTED: protein disulfide-isomerase A6-like [Bombus terrestris]
Length=428

 Score =   173 bits (438),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 84/170 (49%), Positives = 113/170 (66%), Gaps = 0/170 (0%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            + LY  ++ V++L P+NF S VLNS+ V +VEFFAPWCGHC+ LTP Y+K A+ LKG+  
Sbjct  15   HCLYSSNSDVIELKPNNFDSLVLNSDNVWIVEFFAPWCGHCQQLTPEYDKAATALKGIVK  74

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDR  511
            V A++AD H SL   YGI+GFPTIK+F    +P DY G R A  +VD          +  
Sbjct  75   VGAVNADEHKSLGSRYGIQGFPTIKIFGTDNKPEDYNGPRTATGIVDAALNAASQKARRA  134

Query  512  LDGKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            L GK +GG S+  +    +EL   NFD +V+ S+D+W+VEF+APWCGHCK
Sbjct  135  LGGKRSGGDSKSKDSKDVIELTDDNFDKIVMNSEDMWLVEFYAPWCGHCK  184


 Score = 89.4 bits (220),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 47/106 (44%), Positives = 64/106 (60%), Gaps = 4/106 (4%)
 Frame = +2

Query  170  STPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaalda  349
            S  V++L   NF   V+NS  + LVEF+APWCGHCK L P +   A+ LKG   + A+DA
Sbjct  149  SKDVIELTDDNFDKIVMNSEDMWLVEFYAPWCGHCKNLAPIWASAATELKGKVKLGAIDA  208

Query  350  dahsslaQEYGIKGFPTIKVFVPGKQPVD----YQGAREAKSMVDF  475
              +   A +Y IKG+PTIK F PGK+  D    Y G R +  +V++
Sbjct  209  TVNRVKASQYEIKGYPTIKYFAPGKKSSDSVQEYDGGRTSSDIVNW  254


 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 25/45 (56%), Positives = 30/45 (67%), Gaps = 0/45 (0%)
 Frame = +2

Query  527  TGGSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            TG     S  S  +EL   NFD LV+ S ++WIVEFFAPWCGHC+
Sbjct  12   TGAHCLYSSNSDVIELKPNNFDSLVLNSDNVWIVEFFAPWCGHCQ  56



>ref|XP_008528120.1| PREDICTED: protein disulfide-isomerase A6 [Equus przewalskii]
Length=482

 Score =   173 bits (439),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 90/178 (51%), Positives = 124/178 (70%), Gaps = 8/178 (4%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            N LY  S  V++L PSNF  +V+ S+ + LVEF+APWCGHC+ LTP ++KVA+ LK V  
Sbjct  59   NGLYSSSDDVIELTPSNFNREVIQSDSLWLVEFYAPWCGHCQRLTPEWKKVATALKDVVK  118

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  508
            V A+DAD H SL  +YG++GFPTIK+F   K +P DYQG R  +++VD   + +R L+KD
Sbjct  119  VGAVDADKHQSLGGQYGVQGFPTIKIFGANKNRPEDYQGGRSGEAIVDAALSALRQLVKD  178

Query  509  RLDGKATGGSSQ----KSEPSAS---VELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            RL G++ GG S     +SE S+    +EL   +FD  V+ S+D+W+VEF+APWCGHCK
Sbjct  179  RLGGRSHGGYSSGKQGRSESSSKKDVIELTDDSFDKNVLDSEDVWMVEFYAPWCGHCK  236


 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 46/101 (46%), Positives = 63/101 (62%), Gaps = 4/101 (4%)
 Frame = +2

Query  179  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  346
            V++L   +F   VL+S  V +VEF+APWCGHCK L P +   A+ +    KG   +AA+D
Sbjct  204  VIELTDDSFDKNVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAATEVKEQTKGKVKLAAVD  263

Query  347  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  469
            A  +  LA  YGI+GFPTIK+F  G+ PVDY G R    ++
Sbjct  264  ATVNQVLASRYGIRGFPTIKIFQKGESPVDYDGGRTRSDII  304



>ref|XP_006903376.1| PREDICTED: protein disulfide-isomerase A6-like [Elephantulus 
edwardii]
Length=508

 Score =   173 bits (439),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 89/176 (51%), Positives = 122/176 (69%), Gaps = 6/176 (3%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            N LY  S  V++L PSNF  +V+ S+ + L+EF+APWCGHC+ LTP ++KVA+ LKG   
Sbjct  87   NGLYSSSDDVIELTPSNFNREVIQSDSLWLIEFYAPWCGHCQRLTPEWKKVATALKGTVK  146

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  508
            V A+DAD H SL  +YG++GFPTIK+F   K +P DYQG R A+++VD   + +R L+KD
Sbjct  147  VGAVDADKHQSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTAEAIVDSAVSAVRQLVKD  206

Query  509  RLDGKA--TGGSSQKSEPSAS---VELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            RL GK+  + G   +SE S+    +EL    FD  V+ S D+W+VEF+APWCGHCK
Sbjct  207  RLGGKSGYSSGKQGRSESSSKKDVIELTDDTFDKNVLDSDDVWMVEFYAPWCGHCK  262


 Score = 90.9 bits (224),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 66/101 (65%), Gaps = 4/101 (4%)
 Frame = +2

Query  179  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  346
            V++L    F   VL+S+ V +VEF+APWCGHCK L P +   A+ +    KG   +AA+D
Sbjct  230  VIELTDDTFDKNVLDSDDVWMVEFYAPWCGHCKNLEPEWAAAATEVKEQTKGKVKLAAVD  289

Query  347  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  469
            A A+  L+Q YGI+GFPTIK+F  G+ PVDY G R   ++V
Sbjct  290  ATANQLLSQRYGIRGFPTIKIFQKGESPVDYDGGRTKSNIV  330



>ref|XP_011062424.1| PREDICTED: protein disulfide-isomerase A6 [Acromyrmex echinatior]
 gb|EGI60656.1| Protein disulfide-isomerase A6 [Acromyrmex echinatior]
Length=439

 Score =   172 bits (435),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 82/170 (48%), Positives = 114/170 (67%), Gaps = 0/170 (0%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            N +Y  ++ V+ L P+NF + VLNS+ + +VEF+APWCGHC+ LTP Y+K A+ LKGV  
Sbjct  26   NCMYASNSAVVDLRPNNFDNLVLNSDHIWVVEFYAPWCGHCQQLTPEYDKAATALKGVVK  85

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDR  511
            V A++AD H SL  +YG++GFPTIK+F   K+P DY G R A  +VD         ++  
Sbjct  86   VGAVNADEHKSLGSKYGVRGFPTIKIFGLDKKPEDYNGPRSAAGIVDAALNAASQKVRKV  145

Query  512  LDGKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            L GK +GG S+  +    +EL   NFD  V+ S+D+W+VEF+APWCGHCK
Sbjct  146  LGGKTSGGESKSKDSKDVIELTDENFDKTVLNSEDMWLVEFYAPWCGHCK  195


 Score = 90.5 bits (223),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 49/107 (46%), Positives = 65/107 (61%), Gaps = 4/107 (4%)
 Frame = +2

Query  170  STPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaalda  349
            S  V++L   NF   VLNS  + LVEF+APWCGHCK L P +   A+ LKG   + ALDA
Sbjct  160  SKDVIELTDENFDKTVLNSEDMWLVEFYAPWCGHCKNLAPEWATAATELKGKVKLGALDA  219

Query  350  dahsslaQEYGIKGFPTIKVFVPGKQPV----DYQGAREAKSMVDFV  478
              ++  A +Y IKG+PTIK F PGK+      DY G R +  +V++ 
Sbjct  220  TVNTLKASKYEIKGYPTIKFFAPGKKDADSMQDYDGGRTSGDIVNWA  266



>gb|EFN84761.1| Protein disulfide-isomerase A6 [Harpegnathos saltator]
Length=420

 Score =   171 bits (434),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 81/170 (48%), Positives = 114/170 (67%), Gaps = 0/170 (0%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            N +Y  ++ V+ L P+NF + VLNS+ + +VEF+APWCGHC+ L P Y+K A+ LKGVA 
Sbjct  15   NCMYAANSAVIDLRPNNFDNLVLNSDHIWVVEFYAPWCGHCQQLMPEYDKAATALKGVAK  74

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDR  511
            V A++AD H SL  +YG++GFPTIK+F    +P DY G R A  +VD     +   ++  
Sbjct  75   VGAVNADEHKSLGAKYGVRGFPTIKIFGLDSKPEDYNGQRTAAGIVDAALNAVSQKVRRT  134

Query  512  LDGKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            L GK TGG S+       +EL   NF+ +V+ S+D+W+VEF+APWCGHCK
Sbjct  135  LGGKKTGGDSKSKSSKDVIELTDENFEKMVLNSEDMWLVEFYAPWCGHCK  184


 Score = 90.1 bits (222),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 49/106 (46%), Positives = 65/106 (61%), Gaps = 4/106 (4%)
 Frame = +2

Query  170  STPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaalda  349
            S  V++L   NF+  VLNS  + LVEF+APWCGHCK L P +   A+ LKG   + ALDA
Sbjct  149  SKDVIELTDENFEKMVLNSEDMWLVEFYAPWCGHCKNLAPEWATAATELKGKVKLGALDA  208

Query  350  dahsslaQEYGIKGFPTIKVFVPGKQPV----DYQGAREAKSMVDF  475
              ++  A  Y IKG+PTIK F PGK+      DY G R +  +V++
Sbjct  209  TVNTLKASRYDIKGYPTIKYFSPGKKDADSVQDYDGGRTSGDIVNW  254


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 22/45 (49%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +2

Query  527  TGGSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            TG +   +  SA ++L   NFD+LV+ S  +W+VEF+APWCGHC+
Sbjct  12   TGVNCMYAANSAVIDLRPNNFDNLVLNSDHIWVVEFYAPWCGHCQ  56



>ref|XP_011139060.1| PREDICTED: protein disulfide-isomerase A6 isoform X1 [Harpegnathos 
saltator]
Length=438

 Score =   172 bits (435),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 81/170 (48%), Positives = 114/170 (67%), Gaps = 0/170 (0%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            N +Y  ++ V+ L P+NF + VLNS+ + +VEF+APWCGHC+ L P Y+K A+ LKGVA 
Sbjct  26   NCMYAANSAVIDLRPNNFDNLVLNSDHIWVVEFYAPWCGHCQQLMPEYDKAATALKGVAK  85

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDR  511
            V A++AD H SL  +YG++GFPTIK+F    +P DY G R A  +VD     +   ++  
Sbjct  86   VGAVNADEHKSLGAKYGVRGFPTIKIFGLDSKPEDYNGQRTAAGIVDAALNAVSQKVRRT  145

Query  512  LDGKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            L GK TGG S+       +EL   NF+ +V+ S+D+W+VEF+APWCGHCK
Sbjct  146  LGGKKTGGDSKSKSSKDVIELTDENFEKMVLNSEDMWLVEFYAPWCGHCK  195


 Score = 90.5 bits (223),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 49/106 (46%), Positives = 65/106 (61%), Gaps = 4/106 (4%)
 Frame = +2

Query  170  STPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaalda  349
            S  V++L   NF+  VLNS  + LVEF+APWCGHCK L P +   A+ LKG   + ALDA
Sbjct  160  SKDVIELTDENFEKMVLNSEDMWLVEFYAPWCGHCKNLAPEWATAATELKGKVKLGALDA  219

Query  350  dahsslaQEYGIKGFPTIKVFVPGKQPV----DYQGAREAKSMVDF  475
              ++  A  Y IKG+PTIK F PGK+      DY G R +  +V++
Sbjct  220  TVNTLKASRYDIKGYPTIKYFSPGKKDADSVQDYDGGRTSGDIVNW  265


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 22/45 (49%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +2

Query  527  TGGSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            TG +   +  SA ++L   NFD+LV+ S  +W+VEF+APWCGHC+
Sbjct  23   TGVNCMYAANSAVIDLRPNNFDNLVLNSDHIWVVEFYAPWCGHCQ  67



>ref|XP_010887778.1| PREDICTED: protein disulfide-isomerase A6 [Esox lucius]
Length=442

 Score =   172 bits (435),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 87/177 (49%), Positives = 119/177 (67%), Gaps = 8/177 (5%)
 Frame = +2

Query  155  ALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATV  334
              Y  S  V++LNPSNF  +VL S+ + L+EF+APWCGHC++LT  ++K A+ LKG+  V
Sbjct  19   GFYSASDDVVELNPSNFNREVLQSDSLWLIEFYAPWCGHCQSLTADWKKTATALKGIVKV  78

Query  335  aaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKDR  511
             A+DAD H SL  +YG+KGFPTIK+F   K +P DYQGAR ++++VD     +R+L+KDR
Sbjct  79   GAVDADQHKSLGGQYGVKGFPTIKIFGANKNKPDDYQGARSSQAIVDGALNALRSLVKDR  138

Query  512  LDGKATGGSSQKSEPSAS-------VELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            + G++ G    +             VEL   NFD LV+ S D+W+VEFFAPWCGHCK
Sbjct  139  MSGRSGGSDYNRQSGGGGGGSKKDVVELTDDNFDRLVLGSDDVWLVEFFAPWCGHCK  195


 Score = 88.6 bits (218),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 44/101 (44%), Positives = 58/101 (57%), Gaps = 4/101 (4%)
 Frame = +2

Query  179  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaaldadah  358
            V++L   NF   VL S+ V LVEFFAPWCGHCK L P +   AS +K             
Sbjct  163  VVELTDDNFDRLVLGSDDVWLVEFFAPWCGHCKNLEPEWTAAASAVKEQTKDKVHLGAVD  222

Query  359  sslaQ----EYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  469
            +++ Q     YGI+GFPTIK+F  G++P DYQG R    ++
Sbjct  223  ATVHQGLASRYGIRGFPTIKIFKKGEEPEDYQGGRTRSDII  263



>emb|CDJ95511.1| Thioredoxin domain containing protein [Haemonchus contortus]
Length=437

 Score =   171 bits (434),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 93/195 (48%), Positives = 123/195 (63%), Gaps = 4/195 (2%)
 Frame = +2

Query  89   MERSARFlplplllvtlittvNALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCG  268
            M RS+R L        L+ + +ALY     V++L  +NF+SKV+NS+ V +VEFFAPWCG
Sbjct  1    MSRSSRNLLTLFGAAFLLASCHALYSAKDDVVELTAANFRSKVINSDEVWVVEFFAPWCG  60

Query  269  HCKALTPTYEKVASVLKGVATVaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQG  445
            HCK L P Y+K A+ LKG+A V A+D   H SL   Y ++GFPTIK+F   K +P+DY G
Sbjct  61   HCKNLVPEYKKAATALKGIAKVGAVDMTVHESLGSTYRVQGFPTIKIFAANKDKPIDYNG  120

Query  446  AREAKSMVDFVKAQIRNLLKDRLDGKATGGSSQKSEPSAS---VELNSRNFDDLVVKSKD  616
            AR A+ +   V A+I+N +  RL+G   G     S        +EL   NF+ LV+ SKD
Sbjct  121  ARTAQGISSTVLAEIKNTVTSRLEGPGQGKGKDDSGSKGRGDVIELTDANFEKLVLNSKD  180

Query  617  LWIVEFFAPWCGHCK  661
             W+VEFFAPWCGHCK
Sbjct  181  PWLVEFFAPWCGHCK  195


 Score = 93.6 bits (231),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 52/111 (47%), Positives = 71/111 (64%), Gaps = 4/111 (4%)
 Frame = +2

Query  179  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaaldadah  358
            V++L  +NF+  VLNS    LVEFFAPWCGHCK L P ++  AS LKG   + ALDA  H
Sbjct  163  VIELTDANFEKLVLNSKDPWLVEFFAPWCGHCKNLEPHWKAAASQLKGKVKLGALDATVH  222

Query  359  sslaQEYGIKGFPTIKVFVPG---KQPVDYQGAREAKSMVDFVKAQ-IRNL  499
            + ++ +YG++GFPTIK F PG      VDY G R    +V + +++ + NL
Sbjct  223  TLMSNKYGVRGFPTIKYFAPGSSDSDAVDYDGGRTTSDIVSWAESKAMENL  273



>gb|EAZ44947.1| hypothetical protein OsJ_29589 [Oryza sativa Japonica Group]
Length=143

 Score =   163 bits (412),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 87/114 (76%), Positives = 98/114 (86%), Gaps = 0/114 (0%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            +ALY   +PVLQ NP+NFKSKVLNSNGVVLVEFFAPWCGHC+ LTP +EK A VLKGVAT
Sbjct  22   SALYSAGSPVLQFNPNNFKSKVLNSNGVVLVEFFAPWCGHCQQLTPIWEKAAGVLKGVAT  81

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIR  493
            VAALDADAH  LAQEYGI+GFPTIKVFVPGK PVDYQGAR+ K +V+F  +Q +
Sbjct  82   VAALDADAHKELAQEYGIRGFPTIKVFVPGKPPVDYQGARDVKPIVEFALSQTK  135



>ref|NP_001265732.1| protein disulfide-isomerase A6 precursor [Ictalurus punctatus]
 gb|AFL70280.1| protein disulfide-isomerase A6 [Ictalurus punctatus]
 gb|AFL70281.1| protein disulfide-isomerase A6 [Ictalurus punctatus]
Length=439

 Score =   171 bits (432),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 89/177 (50%), Positives = 120/177 (68%), Gaps = 8/177 (5%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            + LY  S  V++LNPSNF  +VL S+ + LVEF+APWCGHC++L P ++K A+ LKGV  
Sbjct  18   HGLYSASDDVIELNPSNFNREVLQSDSLWLVEFYAPWCGHCQSLVPEWKKAATALKGVVK  77

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  508
            V A+DAD H SL  +YG++GFPTIK+F   K +P DYQG R ++++V+      R+L+KD
Sbjct  78   VGAVDADQHKSLGGQYGVRGFPTIKIFGANKHKPEDYQGGRSSQAIVEAALNAARSLVKD  137

Query  509  RLDGKATGGSSQKSEPSAS------VELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            RL GK +GGS    + S        VEL   NFD +V+    +W+VEFFAPWCGHCK
Sbjct  138  RLSGK-SGGSDYSRQSSGGGNKKDVVELTDDNFDRMVLDGDAVWMVEFFAPWCGHCK  193


 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 49/106 (46%), Positives = 64/106 (60%), Gaps = 4/106 (4%)
 Frame = +2

Query  164  GPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLK----GVAT  331
            G    V++L   NF   VL+ + V +VEFFAPWCGHCK L P +   A+ +K    G   
Sbjct  156  GNKKDVVELTDDNFDRMVLDGDAVWMVEFFAPWCGHCKNLEPEWTAAATQVKEQTSGRVK  215

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  469
            + A+DA  H  LA  YGIKGFPTIK+F  G++P DYQG R    ++
Sbjct  216  LGAVDATVHQGLASRYGIKGFPTIKIFRKGEEPEDYQGGRTRSDII  261



>ref|XP_011139061.1| PREDICTED: protein disulfide-isomerase A6 isoform X2 [Harpegnathos 
saltator]
Length=411

 Score =   169 bits (429),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 80/168 (48%), Positives = 113/168 (67%), Gaps = 0/168 (0%)
 Frame = +2

Query  158  LYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVa  337
            +Y  ++ V+ L P+NF + VLNS+ + +VEF+APWCGHC+ L P Y+K A+ LKGVA V 
Sbjct  1    MYAANSAVIDLRPNNFDNLVLNSDHIWVVEFYAPWCGHCQQLMPEYDKAATALKGVAKVG  60

Query  338  aldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDRLD  517
            A++AD H SL  +YG++GFPTIK+F    +P DY G R A  +VD     +   ++  L 
Sbjct  61   AVNADEHKSLGAKYGVRGFPTIKIFGLDSKPEDYNGQRTAAGIVDAALNAVSQKVRRTLG  120

Query  518  GKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            GK TGG S+       +EL   NF+ +V+ S+D+W+VEF+APWCGHCK
Sbjct  121  GKKTGGDSKSKSSKDVIELTDENFEKMVLNSEDMWLVEFYAPWCGHCK  168


 Score = 90.5 bits (223),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 49/107 (46%), Positives = 65/107 (61%), Gaps = 4/107 (4%)
 Frame = +2

Query  170  STPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaalda  349
            S  V++L   NF+  VLNS  + LVEF+APWCGHCK L P +   A+ LKG   + ALDA
Sbjct  133  SKDVIELTDENFEKMVLNSEDMWLVEFYAPWCGHCKNLAPEWATAATELKGKVKLGALDA  192

Query  350  dahsslaQEYGIKGFPTIKVFVPGKQPV----DYQGAREAKSMVDFV  478
              ++  A  Y IKG+PTIK F PGK+      DY G R +  +V++ 
Sbjct  193  TVNTLKASRYDIKGYPTIKYFSPGKKDADSVQDYDGGRTSGDIVNWA  239



>ref|XP_010781928.1| PREDICTED: protein disulfide-isomerase A6 [Notothenia coriiceps]
Length=443

 Score =   170 bits (431),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 85/177 (48%), Positives = 122/177 (69%), Gaps = 7/177 (4%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
             A Y  S  V++LNPSNF  +VL S+ + L+EF+APWCGHC++LT  ++K A+ LKG+  
Sbjct  18   QAFYSASDDVVELNPSNFNKEVLQSDSLWLIEFYAPWCGHCQSLTADWKKAATTLKGIVK  77

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  508
            V A+DAD H SL  ++G+KGFPTIKVF   K +P D+QG R ++++VD     + +L+KD
Sbjct  78   VGAVDADQHKSLGSQFGVKGFPTIKVFGANKNKPEDFQGGRTSQAIVDGAMKSLNSLVKD  137

Query  509  RLDGKATGGSSQKSEPSAS------VELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            RL GK+ G   ++S    +      VEL   NFD +V++ +++W+VEFFAPWCGHCK
Sbjct  138  RLSGKSGGSGYKQSGGGGAGSKQDVVELTDDNFDKMVLQGEEVWLVEFFAPWCGHCK  194


 Score = 87.8 bits (216),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 47/106 (44%), Positives = 63/106 (59%), Gaps = 4/106 (4%)
 Frame = +2

Query  164  GPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVAT  331
            G    V++L   NF   VL    V LVEFFAPWCGHCK L P +   AS +    KG   
Sbjct  157  GSKQDVVELTDDNFDKMVLQGEEVWLVEFFAPWCGHCKNLEPEWTAAASAVMEQTKGKVR  216

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  469
            + A+DA  H +++  YGI+GFPTIK+F  G++P D+QG R    ++
Sbjct  217  LGAMDATVHQAVSGRYGIRGFPTIKIFRKGEEPEDFQGGRTRGDII  262



>ref|XP_003458276.1| PREDICTED: protein disulfide-isomerase A6-like [Oreochromis niloticus]
Length=441

 Score =   170 bits (431),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 88/179 (49%), Positives = 120/179 (67%), Gaps = 11/179 (6%)
 Frame = +2

Query  155  ALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATV  334
            ALY  S  V++L PSNF  +V+ S+ + LVEF+APWCGHC+ L P ++K A+ LKG+  V
Sbjct  19   ALYSASDDVIELTPSNFNREVIQSDSLWLVEFYAPWCGHCRNLAPDWKKAATALKGIVKV  78

Query  335  aaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKDR  511
             A+DAD H SL  +YG++GFPTIK+F   K +P +YQG R ++++VD     +RNL+K+R
Sbjct  79   GAVDADQHKSLGGQYGVRGFPTIKIFGANKNKPEEYQGGRSSQAIVDGAMNALRNLVKER  138

Query  512  LDGKATGGSSQKSEPSAS---------VELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            L G+ +GGS  K               VEL   NFD +V+ S D+W+VEFFAPWCGHCK
Sbjct  139  LSGR-SGGSDYKQSGGGGSSGGNKKDVVELTDDNFDKMVLDSDDVWLVEFFAPWCGHCK  196


 Score = 91.7 bits (226),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 47/102 (46%), Positives = 66/102 (65%), Gaps = 4/102 (4%)
 Frame = +2

Query  179  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  346
            V++L   NF   VL+S+ V LVEFFAPWCGHCK L P +   A+ +    KG   + A+D
Sbjct  164  VVELTDDNFDKMVLDSDDVWLVEFFAPWCGHCKNLEPEWAAAATAVKEQTKGKVRLGAVD  223

Query  347  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVD  472
            A  H +++  YGI+GFPTIK+F  G++P DYQG R    +++
Sbjct  224  ATVHQAVSGRYGIRGFPTIKIFRKGEEPEDYQGGRTRGDIIE  265



>gb|ABG81451.1| protein disulfide isomerase-associated 6 [Bos taurus]
Length=201

 Score =   163 bits (412),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 87/177 (49%), Positives = 118/177 (67%), Gaps = 7/177 (4%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            N LY  S  V++L PSNF  +V+ S+ + LVEF+APWCGHC+ LTP ++K A+ LK V  
Sbjct  18   NGLYSSSDDVIELTPSNFNREVIQSDSLWLVEFYAPWCGHCQRLTPEWKKAATALKDVVK  77

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  508
            V A+DAD H SL  +YG++GFPTIK+F   K +P DYQG R  +++VD   + +R L+KD
Sbjct  78   VGAVDADKHQSLGGQYGVQGFPTIKIFGSNKNKPEDYQGGRTGEAIVDAALSALRQLVKD  137

Query  509  RLDGKATG------GSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            RL G+ +G      G    S     +EL   NFD  V+ S+D+W+VEF+APWCGHCK
Sbjct  138  RLGGRGSGYSSGKQGRGDSSSKKDVIELTDDNFDKNVLDSEDVWMVEFYAPWCGHCK  194


 Score = 54.7 bits (130),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 21/39 (54%), Positives = 27/39 (69%), Gaps = 0/39 (0%)
 Frame = +2

Query  179  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTY  295
            V++L   NF   VL+S  V +VEF+APWCGHCK L P +
Sbjct  162  VIELTDDNFDKNVLDSEDVWMVEFYAPWCGHCKNLEPEW  200



>ref|XP_005731103.1| PREDICTED: protein disulfide-isomerase A6-like [Pundamilia nyererei]
Length=443

 Score =   168 bits (426),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 88/181 (49%), Positives = 120/181 (66%), Gaps = 13/181 (7%)
 Frame = +2

Query  155  ALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATV  334
            ALY  S  V++L  SNF  +V+ S+ + LVEF+APWCGHC+ L P ++K A+ LKG+  V
Sbjct  19   ALYSASDDVIELTQSNFNREVIQSDSLWLVEFYAPWCGHCRNLAPDWKKAATALKGIVKV  78

Query  335  aaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKDR  511
             A+DAD H SL  +YG++GFPTIK+F   K +P +YQG R ++++VD     +RNL+K+R
Sbjct  79   GAVDADQHKSLGGQYGVRGFPTIKIFGANKNKPEEYQGGRSSQAIVDGAMNALRNLVKER  138

Query  512  LDGKATGGSSQKSEPSAS-----------VELNSRNFDDLVVKSKDLWIVEFFAPWCGHC  658
            L G+ +GGS  K +               VEL   NFD LV+ S D+W+VEFFAPWCGHC
Sbjct  139  LSGR-SGGSDYKQQSGGGGGSSGGNKKDVVELTDDNFDKLVLDSDDVWLVEFFAPWCGHC  197

Query  659  K  661
            K
Sbjct  198  K  198


 Score = 91.7 bits (226),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 47/102 (46%), Positives = 65/102 (64%), Gaps = 4/102 (4%)
 Frame = +2

Query  179  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  346
            V++L   NF   VL+S+ V LVEFFAPWCGHCK L P +   A+ +    KG   + A+D
Sbjct  166  VVELTDDNFDKLVLDSDDVWLVEFFAPWCGHCKNLEPEWAAAATAVKEQTKGKVRLGAVD  225

Query  347  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVD  472
            A  H  ++  YGI+GFPTIK+F  G++P DYQG R    +++
Sbjct  226  ATVHQGVSSRYGIRGFPTIKIFRKGEEPEDYQGGRTRGDIIE  267



>ref|XP_004568809.1| PREDICTED: protein disulfide-isomerase A6-like isoform X1 [Maylandia 
zebra]
 ref|XP_005921648.1| PREDICTED: protein disulfide-isomerase A6-like isoform X1 [Haplochromis 
burtoni]
Length=443

 Score =   168 bits (426),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 88/181 (49%), Positives = 120/181 (66%), Gaps = 13/181 (7%)
 Frame = +2

Query  155  ALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATV  334
            ALY  S  V++L  SNF  +V+ S+ + LVEF+APWCGHC+ L P ++K A+ LKG+  V
Sbjct  19   ALYSASDDVIELTQSNFNREVIQSDSLWLVEFYAPWCGHCRNLAPDWKKAATALKGIVKV  78

Query  335  aaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKDR  511
             A+DAD H SL  +YG++GFPTIK+F   K +P +YQG R ++++VD     +RNL+K+R
Sbjct  79   GAVDADQHKSLGGQYGVRGFPTIKIFGANKNKPEEYQGGRSSQAIVDGAMNALRNLVKER  138

Query  512  LDGKATGGSSQKSEPSAS-----------VELNSRNFDDLVVKSKDLWIVEFFAPWCGHC  658
            L G+ +GGS  K +               VEL   NFD LV+ S D+W+VEFFAPWCGHC
Sbjct  139  LSGR-SGGSDYKQQSGGGGGSSGGNKKDVVELTDDNFDKLVLDSDDVWLVEFFAPWCGHC  197

Query  659  K  661
            K
Sbjct  198  K  198


 Score = 91.7 bits (226),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 47/102 (46%), Positives = 65/102 (64%), Gaps = 4/102 (4%)
 Frame = +2

Query  179  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  346
            V++L   NF   VL+S+ V LVEFFAPWCGHCK L P +   A+ +    KG   + A+D
Sbjct  166  VVELTDDNFDKLVLDSDDVWLVEFFAPWCGHCKNLEPEWAAAATAVKEQTKGKVRLGAVD  225

Query  347  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVD  472
            A  H  ++  YGI+GFPTIK+F  G++P DYQG R    +++
Sbjct  226  ATVHQGVSSRYGIRGFPTIKIFRKGEEPEDYQGGRTRGDIIE  267



>gb|EGT53613.1| hypothetical protein CAEBREN_31752 [Caenorhabditis brenneri]
Length=433

 Score =   168 bits (425),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 84/169 (50%), Positives = 111/169 (66%), Gaps = 1/169 (1%)
 Frame = +2

Query  155  ALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATV  334
            A Y PS  V++L  +NF SKVL S+ + +VEF+AP+CGHCK L P Y+K A +LKG+A V
Sbjct  18   AFYAPSDGVVELTDANFDSKVLKSDRIWIVEFYAPYCGHCKNLVPEYKKAAKLLKGIAAV  77

Query  335  aaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDRL  514
             A+DA     +  EY IKG+PTIK+F  GK+ +DY G R AK + D VK  I   L +RL
Sbjct  78   GAIDATTQQGIPSEYSIKGYPTIKIFA-GKKSIDYNGPRTAKGIADAVKKAIGKTLDERL  136

Query  515  DGKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
             G  +  S++K +    V L   NF+ LV  SKD W+VEF+APWCGHC+
Sbjct  137  SGGKSEKSNKKGKGGDVVVLTDSNFEKLVFNSKDAWMVEFYAPWCGHCQ  185


 Score = 87.8 bits (216),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 49/116 (42%), Positives = 69/116 (59%), Gaps = 4/116 (3%)
 Frame = +2

Query  164  GPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaal  343
            G    V+ L  SNF+  V NS    +VEF+APWCGHC+ L P +++ A  + G     AL
Sbjct  148  GKGGDVVVLTDSNFEKLVFNSKDAWMVEFYAPWCGHCQKLEPEWKRAAKEMGGKVKFGAL  207

Query  344  dadahsslaQEYGIKGFPTIKVFVPGKQPV----DYQGAREAKSMVDFVKAQIRNL  499
            DA AH S+A+++ I+GFPTIK F PG        DYQG R +  +V F +++  N+
Sbjct  208  DATAHESMARKFSIQGFPTIKFFAPGSSSASDAEDYQGGRTSSDLVSFAESKFENV  263



>ref|XP_010336276.1| PREDICTED: protein disulfide-isomerase A6 [Saimiri boliviensis 
boliviensis]
Length=638

 Score =   171 bits (432),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 88/177 (50%), Positives = 120/177 (68%), Gaps = 7/177 (4%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            N LY  S  V++L PSNF  +V+ S+ + LVEF+APWCGHC+ LTP ++K A+ LK V  
Sbjct  216  NGLYSSSDDVIELTPSNFHREVIQSDSLWLVEFYAPWCGHCQRLTPEWKKAATALKDVVK  275

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  508
            V A+DAD H SL  +YG++GFPTIK+F   K +P DYQG R  +++VD   + +  L+KD
Sbjct  276  VGAVDADKHQSLGGQYGVQGFPTIKIFGSNKNRPGDYQGGRTGEAIVDAALSALHQLVKD  335

Query  509  RLDGKATGGSSQK------SEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            RL+G++ G SS K      S     +EL   NFD  V+ S+D+W+VEF+APWCGHCK
Sbjct  336  RLEGRSGGYSSGKQGRGDSSSKKDVIELTDSNFDQNVLDSEDIWMVEFYAPWCGHCK  392


 Score = 93.6 bits (231),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 52/104 (50%), Positives = 67/104 (64%), Gaps = 4/104 (4%)
 Frame = +2

Query  179  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  346
            V++L  SNF   VL+S  + +VEF+APWCGHCK L P +   AS +    KG   +AA+D
Sbjct  360  VIELTDSNFDQNVLDSEDIWMVEFYAPWCGHCKQLEPEWAAAASEVKEQTKGKVKLAAVD  419

Query  347  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFV  478
            A A+  LA  YGI+GFPTIKVF  G+ PVDY GAR    +V + 
Sbjct  420  ATANQVLASRYGIRGFPTIKVFQKGESPVDYDGARTRSHIVSWA  463



>ref|XP_011266529.1| PREDICTED: protein disulfide-isomerase A6 [Camponotus floridanus]
 gb|EFN61326.1| Protein disulfide-isomerase A6 [Camponotus floridanus]
Length=439

 Score =   168 bits (425),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 81/170 (48%), Positives = 111/170 (65%), Gaps = 0/170 (0%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            N LY  ++ V+ L P+NF + VLNS+ + +VEF+APWCGHC+ LTP YEK A+ LKG+  
Sbjct  26   NCLYSSNSAVIDLRPNNFDNLVLNSDHIWVVEFYAPWCGHCQQLTPEYEKAANALKGIVK  85

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDR  511
            V A++AD H SL  +YG++GFPTIK+F    +P D+ G R A  +VD          +  
Sbjct  86   VGAVNADEHKSLGGKYGVRGFPTIKIFGLDSKPEDFNGPRSAAGIVDAALNAASKKARRA  145

Query  512  LDGKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            L GK     S+ S+P   +EL   NFD  V+ S+D+W+VEF+APWCGHCK
Sbjct  146  LSGKKADSDSKSSDPKDVIELTDENFDKTVLNSEDMWLVEFYAPWCGHCK  195


 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 48/104 (46%), Positives = 64/104 (62%), Gaps = 4/104 (4%)
 Frame = +2

Query  179  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaaldadah  358
            V++L   NF   VLNS  + LVEF+APWCGHCK L P +   A+ LKG   + ALDA  +
Sbjct  163  VIELTDENFDKTVLNSEDMWLVEFYAPWCGHCKNLAPEWAAAATQLKGKVKLGALDATVN  222

Query  359  sslaQEYGIKGFPTIKVFVPGKQPVD----YQGAREAKSMVDFV  478
            +  A +Y IKG+PTIK F PGK+  D    Y G R +  +V++ 
Sbjct  223  TLKASKYEIKGYPTIKYFAPGKKDADSVQEYDGGRTSGDIVNWA  266


 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 22/45 (49%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +2

Query  527  TGGSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            +G +   S  SA ++L   NFD+LV+ S  +W+VEF+APWCGHC+
Sbjct  23   SGANCLYSSNSAVIDLRPNNFDNLVLNSDHIWVVEFYAPWCGHCQ  67



>ref|XP_004568810.1| PREDICTED: protein disulfide-isomerase A6-like isoform X2 [Maylandia 
zebra]
 ref|XP_005921649.1| PREDICTED: protein disulfide-isomerase A6-like isoform X2 [Haplochromis 
burtoni]
Length=442

 Score =   167 bits (424),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 88/180 (49%), Positives = 119/180 (66%), Gaps = 12/180 (7%)
 Frame = +2

Query  155  ALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATV  334
            ALY  S  V++L  SNF  +V+ S+ + LVEF+APWCGHC+ L P ++K A+ LKG+  V
Sbjct  19   ALYSASDDVIELTQSNFNREVIQSDSLWLVEFYAPWCGHCRNLAPDWKKAATALKGIVKV  78

Query  335  aaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKDR  511
             A+DAD H SL  +YG++GFPTIK+F   K +P +YQG R ++++VD     +RNL+K+R
Sbjct  79   GAVDADQHKSLGGQYGVRGFPTIKIFGANKNKPEEYQGGRSSQAIVDGAMNALRNLVKER  138

Query  512  LDGKATGGSSQKSEPSAS----------VELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            L G+ +GGS  K                VEL   NFD LV+ S D+W+VEFFAPWCGHCK
Sbjct  139  LSGR-SGGSDYKQSGGGGGSSGGNKKDVVELTDDNFDKLVLDSDDVWLVEFFAPWCGHCK  197


 Score = 91.7 bits (226),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 47/102 (46%), Positives = 65/102 (64%), Gaps = 4/102 (4%)
 Frame = +2

Query  179  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  346
            V++L   NF   VL+S+ V LVEFFAPWCGHCK L P +   A+ +    KG   + A+D
Sbjct  165  VVELTDDNFDKLVLDSDDVWLVEFFAPWCGHCKNLEPEWAAAATAVKEQTKGKVRLGAVD  224

Query  347  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVD  472
            A  H  ++  YGI+GFPTIK+F  G++P DYQG R    +++
Sbjct  225  ATVHQGVSSRYGIRGFPTIKIFRKGEEPEDYQGGRTRGDIIE  266



>ref|XP_006792591.1| PREDICTED: protein disulfide-isomerase A6-like isoform X1 [Neolamprologus 
brichardi]
Length=442

 Score =   167 bits (424),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 87/180 (48%), Positives = 119/180 (66%), Gaps = 12/180 (7%)
 Frame = +2

Query  155  ALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATV  334
            ALY  S  V++L  SNF  +V+ S+ + LVEF+APWCGHC+ L P ++K A+ LKG+  V
Sbjct  19   ALYSASDDVIELTQSNFNREVIQSDSLWLVEFYAPWCGHCRNLAPDWKKAATALKGIVKV  78

Query  335  aaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKDR  511
             A+DAD H SL  +YG++GFPTIK+F   K +P +YQG R ++++VD     +RNL+K+R
Sbjct  79   GAVDADQHKSLGGQYGVRGFPTIKIFGANKNKPEEYQGGRSSQAIVDGAMNALRNLVKER  138

Query  512  LDGKATGGSSQKSEPSAS----------VELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            L G  +GGS  K +              VEL   NFD +V+ S D+W+VEFFAPWCGHCK
Sbjct  139  LSG-GSGGSDYKQQSGGGGSSGGNKKDVVELTDDNFDKMVLDSDDVWLVEFFAPWCGHCK  197


 Score = 92.0 bits (227),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 47/102 (46%), Positives = 65/102 (64%), Gaps = 4/102 (4%)
 Frame = +2

Query  179  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  346
            V++L   NF   VL+S+ V LVEFFAPWCGHCK L P +   A+ +    KG   + A+D
Sbjct  165  VVELTDDNFDKMVLDSDDVWLVEFFAPWCGHCKNLEPEWAAAATTVKEQTKGKVRLGAVD  224

Query  347  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVD  472
            A  H  ++  YGI+GFPTIK+F  G++P DYQG R    +++
Sbjct  225  ATVHQGVSSRYGIRGFPTIKIFRKGEEPEDYQGGRTRGDIIE  266



>ref|XP_006197174.1| PREDICTED: protein disulfide-isomerase A6 [Vicugna pacos]
Length=440

 Score =   167 bits (422),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 89/177 (50%), Positives = 121/177 (68%), Gaps = 7/177 (4%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            N LY  S  V++L PSNF  +V+ S+ + LVEFFAPWCGHC+ LTP ++KVA+ LK V  
Sbjct  18   NGLYSSSDDVIELTPSNFNREVIQSDSLWLVEFFAPWCGHCQRLTPEWKKVATALKDVVK  77

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  508
            V A+DAD H SL  +YG++GFPTIK+F   K +P DYQG R ++++VD   + +R L+KD
Sbjct  78   VGAVDADKHQSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTSEAIVDAALSALRQLVKD  137

Query  509  RLDGKATG------GSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            RL G+  G      G S+ S     +EL   +FD  V+ S+D+W+VEF+APWCGHCK
Sbjct  138  RLGGRGGGYSSGKQGRSESSSKKDVIELTDDSFDKNVLDSEDVWMVEFYAPWCGHCK  194


 Score = 87.8 bits (216),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 47/101 (47%), Positives = 63/101 (62%), Gaps = 4/101 (4%)
 Frame = +2

Query  179  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  346
            V++L   +F   VL+S  V +VEF+APWCGHCK L P +   A+ +    KG   +AA+D
Sbjct  162  VIELTDDSFDKNVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAATEVKEQTKGKVKLAAVD  221

Query  347  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  469
            A  +  LA  YGI+GFPTIK+F  G+ PVDY G R    +V
Sbjct  222  ATVNQVLASRYGIRGFPTIKIFQKGESPVDYDGGRTRSDIV  262



>ref|XP_006792592.1| PREDICTED: protein disulfide-isomerase A6-like isoform X2 [Neolamprologus 
brichardi]
Length=441

 Score =   167 bits (422),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 87/179 (49%), Positives = 118/179 (66%), Gaps = 11/179 (6%)
 Frame = +2

Query  155  ALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATV  334
            ALY  S  V++L  SNF  +V+ S+ + LVEF+APWCGHC+ L P ++K A+ LKG+  V
Sbjct  19   ALYSASDDVIELTQSNFNREVIQSDSLWLVEFYAPWCGHCRNLAPDWKKAATALKGIVKV  78

Query  335  aaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKDR  511
             A+DAD H SL  +YG++GFPTIK+F   K +P +YQG R ++++VD     +RNL+K+R
Sbjct  79   GAVDADQHKSLGGQYGVRGFPTIKIFGANKNKPEEYQGGRSSQAIVDGAMNALRNLVKER  138

Query  512  LDGKATGGSSQKSEPSAS---------VELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            L G  +GGS  K               VEL   NFD +V+ S D+W+VEFFAPWCGHCK
Sbjct  139  LSG-GSGGSDYKQSGGGGSSGGNKKDVVELTDDNFDKMVLDSDDVWLVEFFAPWCGHCK  196


 Score = 92.0 bits (227),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 47/102 (46%), Positives = 65/102 (64%), Gaps = 4/102 (4%)
 Frame = +2

Query  179  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  346
            V++L   NF   VL+S+ V LVEFFAPWCGHCK L P +   A+ +    KG   + A+D
Sbjct  164  VVELTDDNFDKMVLDSDDVWLVEFFAPWCGHCKNLEPEWAAAATTVKEQTKGKVRLGAVD  223

Query  347  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVD  472
            A  H  ++  YGI+GFPTIK+F  G++P DYQG R    +++
Sbjct  224  ATVHQGVSSRYGIRGFPTIKIFRKGEEPEDYQGGRTRGDIIE  265



>ref|XP_010962323.1| PREDICTED: protein disulfide-isomerase A6 [Camelus bactrianus]
 ref|XP_010981000.1| PREDICTED: protein disulfide-isomerase A6 [Camelus dromedarius]
Length=440

 Score =   167 bits (422),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 89/177 (50%), Positives = 121/177 (68%), Gaps = 7/177 (4%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            N LY  S  V++L PSNF  +V+ S+ + LVEFFAPWCGHC+ LTP ++KVA+ LK V  
Sbjct  18   NGLYSSSDDVIELTPSNFNREVIQSDSLWLVEFFAPWCGHCQRLTPEWKKVATALKDVVK  77

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  508
            V A+DAD H SL  +YG++GFPTIK+F   K +P DYQG R ++++VD   + +R L+KD
Sbjct  78   VGAVDADKHQSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTSEAIVDAALSALRQLVKD  137

Query  509  RLDGKATG------GSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            RL G+  G      G S+ S     +EL   +FD  V+ S+D+W+VEF+APWCGHCK
Sbjct  138  RLGGRGGGYSSGKQGRSESSSKKDVIELTDDSFDKNVLDSEDVWMVEFYAPWCGHCK  194


 Score = 87.8 bits (216),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 47/101 (47%), Positives = 63/101 (62%), Gaps = 4/101 (4%)
 Frame = +2

Query  179  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  346
            V++L   +F   VL+S  V +VEF+APWCGHCK L P +   A+ +    KG   +AA+D
Sbjct  162  VIELTDDSFDKNVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAATEVKEQTKGKVKLAAVD  221

Query  347  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  469
            A  +  LA  YGI+GFPTIK+F  G+ PVDY G R    +V
Sbjct  222  ATVNQVLASRYGIRGFPTIKIFQKGESPVDYDGGRTRSDIV  262



>ref|XP_007195772.1| PREDICTED: protein disulfide-isomerase A6 [Balaenoptera acutorostrata 
scammoni]
Length=429

 Score =   166 bits (421),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 89/177 (50%), Positives = 119/177 (67%), Gaps = 7/177 (4%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            N LY  S  V++L PSNF  +V+ S+ + LVEF+APWCGHC+ LTP ++KVA+ LK V  
Sbjct  18   NGLYSSSDDVIELTPSNFNREVIQSDSLWLVEFYAPWCGHCQRLTPEWKKVATALKDVVK  77

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  508
            V A+DAD H SL  +YG++GFPTIK+F   K QP DYQG R  +++VD   + +R L+KD
Sbjct  78   VGAVDADKHQSLGGQYGVQGFPTIKIFGSNKNQPEDYQGGRTGEAIVDAALSALRQLVKD  137

Query  509  RLDGKATG------GSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            RL G++ G      G S  S     +EL    FD  V+ S+D+W+VEF+APWCGHCK
Sbjct  138  RLGGRSGGYSSGKQGRSDSSSKKDVIELTDDTFDKSVLDSEDVWMVEFYAPWCGHCK  194


 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 46/101 (46%), Positives = 61/101 (60%), Gaps = 4/101 (4%)
 Frame = +2

Query  179  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  346
            V++L    F   VL+S  V +VEF+APWCGHCK L P +   A+ +    KG   +AA+D
Sbjct  162  VIELTDDTFDKSVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAATEVKEQTKGKVKLAAVD  221

Query  347  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  469
            A  +  LA  Y I+GFPTIK+F  G+ PVDY G R    +V
Sbjct  222  ATVNQVLASRYEIRGFPTIKIFQKGESPVDYDGGRTRSDIV  262



>ref|XP_006191925.1| PREDICTED: protein disulfide-isomerase A6, partial [Camelus ferus]
Length=436

 Score =   167 bits (422),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 89/177 (50%), Positives = 121/177 (68%), Gaps = 7/177 (4%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            N LY  S  V++L PSNF  +V+ S+ + LVEFFAPWCGHC+ LTP ++KVA+ LK V  
Sbjct  14   NGLYSSSDDVIELTPSNFNREVIQSDSLWLVEFFAPWCGHCQRLTPEWKKVATALKDVVK  73

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  508
            V A+DAD H SL  +YG++GFPTIK+F   K +P DYQG R ++++VD   + +R L+KD
Sbjct  74   VGAVDADKHQSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTSEAIVDAALSALRQLVKD  133

Query  509  RLDGKATG------GSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            RL G+  G      G S+ S     +EL   +FD  V+ S+D+W+VEF+APWCGHCK
Sbjct  134  RLGGRGGGYSSGKQGRSESSSKKDVIELTDDSFDKNVLDSEDVWMVEFYAPWCGHCK  190


 Score = 87.8 bits (216),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 47/101 (47%), Positives = 63/101 (62%), Gaps = 4/101 (4%)
 Frame = +2

Query  179  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  346
            V++L   +F   VL+S  V +VEF+APWCGHCK L P +   A+ +    KG   +AA+D
Sbjct  158  VIELTDDSFDKNVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAATEVKEQTKGKVKLAAVD  217

Query  347  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  469
            A  +  LA  YGI+GFPTIK+F  G+ PVDY G R    +V
Sbjct  218  ATVNQVLASRYGIRGFPTIKIFQKGESPVDYDGGRTRSDIV  258



>ref|XP_007127699.1| PREDICTED: protein disulfide-isomerase A6 [Physeter catodon]
Length=440

 Score =   166 bits (421),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 89/177 (50%), Positives = 119/177 (67%), Gaps = 7/177 (4%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            N LY  S  V++L PSNF  +V+ S+ + LVEF+APWCGHC+ LTP ++KVA+ LK V  
Sbjct  18   NGLYSSSDDVIELTPSNFNREVIQSDSLWLVEFYAPWCGHCQRLTPEWKKVATALKDVVK  77

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  508
            V A+DAD H SL  +YG++GFPTIK+F   K QP DYQG R  +++VD   + +R L+KD
Sbjct  78   VGAVDADKHQSLGGQYGVQGFPTIKIFGSNKNQPEDYQGGRTGEAIVDAALSALRQLVKD  137

Query  509  RLDGKATG------GSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            RL G++ G      G S  S     +EL    FD  V+ S+D+W+VEF+APWCGHCK
Sbjct  138  RLGGRSGGYSSGKQGRSDSSSKKDVIELTDDTFDKSVLDSEDVWMVEFYAPWCGHCK  194


 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 46/101 (46%), Positives = 61/101 (60%), Gaps = 4/101 (4%)
 Frame = +2

Query  179  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  346
            V++L    F   VL+S  V +VEF+APWCGHCK L P +   A+ +    KG   +AA+D
Sbjct  162  VIELTDDTFDKSVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAATEVKEQTKGKVKLAAVD  221

Query  347  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  469
            A  +  LA  Y I+GFPTIK+F  G+ PVDY G R    +V
Sbjct  222  ATINQVLASRYEIRGFPTIKIFQKGESPVDYDGGRTRSDIV  262



>gb|ACI34364.1| disulfide-isomerase A6 precursor [Salmo salar]
Length=442

 Score =   166 bits (421),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 83/177 (47%), Positives = 117/177 (66%), Gaps = 8/177 (5%)
 Frame = +2

Query  155  ALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATV  334
              Y  +  V++LNPSNF  +VL S+ + L+EF+APWCGHC++LT  ++K A+ LKG+  V
Sbjct  19   GFYSANDDVVELNPSNFNREVLQSDSLWLIEFYAPWCGHCQSLTADWKKTATALKGIVKV  78

Query  335  aaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKDR  511
             A+DAD H SL  +YG+KGFP+IK+F   K +P DYQG R ++++VD     +R L+KDR
Sbjct  79   GAVDADQHKSLGGQYGVKGFPSIKIFGANKSKPDDYQGGRSSQAIVDAALNTLRTLVKDR  138

Query  512  LDGKATGGSSQKSEPSAS-------VELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            + G++ G    +             VEL   NFD LV+ S ++W+VEFFAPWCGHCK
Sbjct  139  MSGRSGGSDYSRQSGGGGGGSKKNVVELTDDNFDRLVLDSGEVWLVEFFAPWCGHCK  195


 Score = 88.6 bits (218),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 43/101 (43%), Positives = 59/101 (58%), Gaps = 4/101 (4%)
 Frame = +2

Query  179  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaaldadah  358
            V++L   NF   VL+S  V LVEFFAPWCGHCK+L P +   AS +K             
Sbjct  163  VVELTDDNFDRLVLDSGEVWLVEFFAPWCGHCKSLEPEWAAAASAVKEQTKDKVHLGAVD  222

Query  359  sslaQ----EYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  469
            +++ Q     YG++GFPTIK+F  G++P DYQG R    ++
Sbjct  223  ATVHQGLASRYGVRGFPTIKIFKKGEEPEDYQGGRTRGDII  263



>gb|EHB04452.1| Protein disulfide-isomerase A6, partial [Heterocephalus glaber]
Length=434

 Score =   166 bits (421),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 88/177 (50%), Positives = 117/177 (66%), Gaps = 7/177 (4%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            N LY     V++L P+NF  +V+ S+ + LVEF+APWCGHC+ L P ++K AS LK V  
Sbjct  12   NGLYSSGDAVIELTPANFNREVIQSDSLWLVEFYAPWCGHCQRLAPEWKKAASALKDVVK  71

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  508
            V A+DAD H SLA +YG++GFPTIKVF   K +P DYQG R A+++VD   + +R L+KD
Sbjct  72   VGAVDADKHQSLAGQYGVQGFPTIKVFRADKNKPEDYQGGRTAEAIVDAALSALRQLVKD  131

Query  509  RLDGKATG------GSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            RL G+A        G S+ S     +EL    FD  V+ S D+W+VEF+APWCGHCK
Sbjct  132  RLGGRAGAQGSGRQGRSEGSGKKDVIELTDDTFDKNVLDSPDVWMVEFYAPWCGHCK  188


 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 47/101 (47%), Positives = 63/101 (62%), Gaps = 4/101 (4%)
 Frame = +2

Query  179  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  346
            V++L    F   VL+S  V +VEF+APWCGHCK L P +   A+ +    KG   +AA+D
Sbjct  156  VIELTDDTFDKNVLDSPDVWMVEFYAPWCGHCKNLEPEWAAAATEVKEQTKGRVKLAAVD  215

Query  347  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  469
            A A+  LA  YGI+GFPTIK+F  G+ P+DY G R    +V
Sbjct  216  ATANQVLAGRYGIRGFPTIKIFQGGETPMDYDGGRTRSDIV  256



>ref|XP_004870016.1| PREDICTED: protein disulfide-isomerase A6 [Heterocephalus glaber]
Length=440

 Score =   166 bits (421),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 88/177 (50%), Positives = 117/177 (66%), Gaps = 7/177 (4%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            N LY     V++L P+NF  +V+ S+ + LVEF+APWCGHC+ L P ++K AS LK V  
Sbjct  18   NGLYSSGDAVIELTPANFNREVIQSDSLWLVEFYAPWCGHCQRLAPEWKKAASALKDVVK  77

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  508
            V A+DAD H SLA +YG++GFPTIKVF   K +P DYQG R A+++VD   + +R L+KD
Sbjct  78   VGAVDADKHQSLAGQYGVQGFPTIKVFRADKNKPEDYQGGRTAEAIVDAALSALRQLVKD  137

Query  509  RLDGKATG------GSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            RL G+A        G S+ S     +EL    FD  V+ S D+W+VEF+APWCGHCK
Sbjct  138  RLGGRAGAQGSGRQGRSEGSGKKDVIELTDDTFDKNVLDSPDVWMVEFYAPWCGHCK  194


 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 47/101 (47%), Positives = 63/101 (62%), Gaps = 4/101 (4%)
 Frame = +2

Query  179  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  346
            V++L    F   VL+S  V +VEF+APWCGHCK L P +   A+ +    KG   +AA+D
Sbjct  162  VIELTDDTFDKNVLDSPDVWMVEFYAPWCGHCKNLEPEWAAAATEVKEQTKGRVKLAAVD  221

Query  347  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  469
            A A+  LA  YGI+GFPTIK+F  G+ P+DY G R    +V
Sbjct  222  ATANQVLAGRYGIRGFPTIKIFQGGETPMDYDGGRTRSDIV  262



>ref|XP_003744350.1| PREDICTED: protein disulfide-isomerase A6-like [Metaseiulus occidentalis]
Length=443

 Score =   166 bits (421),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 88/176 (50%), Positives = 117/176 (66%), Gaps = 6/176 (3%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            NALY     V++L P  F  +VLN + V +VEFFAPWCGHCK L P Y+K A  LKG+A 
Sbjct  18   NALYDSRDDVVELTPDTFSKRVLNGDQVWIVEFFAPWCGHCKNLAPEYKKAARALKGIAG  77

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  508
            V A+DAD H SL  +YG++GFPT+K+FVPG  +P++YQGAR A  + D V  +++NL+  
Sbjct  78   VGAVDADQHKSLPGQYGVRGFPTLKIFVPGNSKPIEYQGARTADGIADAVLREMKNLVNK  137

Query  509  RLDGKATGGSSQKSEPSAS-----VELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            +L   +  G S      +      V+L S NF  LV+ SKD+W+VEF+APWCGHCK
Sbjct  138  KLGKSSGSGGSSSGSGGSGNDKDVVQLTSENFRKLVLDSKDIWLVEFYAPWCGHCK  193


 Score = 88.6 bits (218),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 47/101 (47%), Positives = 63/101 (62%), Gaps = 4/101 (4%)
 Frame = +2

Query  179  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaaldadah  358
            V+QL   NF+  VL+S  + LVEF+APWCGHCK L P + K A+ LKG   + A+D+  +
Sbjct  161  VVQLTSENFRKLVLDSKDIWLVEFYAPWCGHCKNLAPHWAKAATQLKGQVKLGAVDSTVY  220

Query  359  sslaQEYGIKGFPTIKVFVPG----KQPVDYQGAREAKSMV  469
              LAQEYG++G+PTIK F  G        +Y G R A  +V
Sbjct  221  QELAQEYGVRGYPTIKYFPAGPKDSNSAEEYNGGRTADDIV  261



>emb|CDQ62935.1| unnamed protein product [Oncorhynchus mykiss]
Length=443

 Score =   166 bits (421),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 82/178 (46%), Positives = 118/178 (66%), Gaps = 9/178 (5%)
 Frame = +2

Query  155  ALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATV  334
              Y  +  V++LNPSNF  +VL S+ + L+EF+APWCGHC++LT  ++K A+ LKG+  V
Sbjct  19   GFYSAADDVVELNPSNFNREVLQSDSLWLIEFYAPWCGHCQSLTADWKKTATALKGIVKV  78

Query  335  aaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKDR  511
             A+DAD H SL  +YG++GFP+IK+F   K +P DYQG R ++++VD     +R L+KDR
Sbjct  79   GAVDADQHKSLGGQYGVRGFPSIKIFGANKNKPDDYQGGRSSQAIVDGALNTLRTLVKDR  138

Query  512  LDGKATGGSSQKSEPSAS--------VELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            + G++ G  + +              VEL   NFD LV+ S ++W+VEFFAPWCGHCK
Sbjct  139  MSGRSGGSDNNRQSGGGGGGGSKKNVVELTDDNFDRLVLDSGEVWLVEFFAPWCGHCK  196


 Score = 89.4 bits (220),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 44/101 (44%), Positives = 59/101 (58%), Gaps = 4/101 (4%)
 Frame = +2

Query  179  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaaldadah  358
            V++L   NF   VL+S  V LVEFFAPWCGHCK+L P +   AS +K             
Sbjct  164  VVELTDDNFDRLVLDSGEVWLVEFFAPWCGHCKSLEPEWAAAASAVKEQTKDKVHLGAVD  223

Query  359  sslaQ----EYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  469
            +++ Q     YGI+GFPTIK+F  G++P DYQG R    ++
Sbjct  224  ATVHQGLASRYGIRGFPTIKIFKKGEEPEDYQGGRTRGDII  264



>ref|XP_003411934.1| PREDICTED: protein disulfide-isomerase A6 [Loxodonta africana]
Length=440

 Score =   166 bits (421),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 88/177 (50%), Positives = 123/177 (69%), Gaps = 7/177 (4%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            N LY  S  V++L PSNF  +V+ S+ + L+EF+APWCGHC+ LTP ++KVA+ LK V  
Sbjct  18   NGLYSSSDDVIELTPSNFNREVIQSDSLWLIEFYAPWCGHCQRLTPEWKKVATALKDVVK  77

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  508
            V A+DAD H SLA +YG++GFPTI++F   K +P DYQG R A+++VD   + +R L+KD
Sbjct  78   VGAVDADKHQSLAGQYGVQGFPTIRIFGSNKNRPEDYQGGRTAEAIVDAALSAVRQLVKD  137

Query  509  RLDGKATG------GSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            RL G++ G      G S+ S     +EL    FD  V++S+D+W+VEF+APWCGHCK
Sbjct  138  RLGGRSGGYSSGKQGRSESSSKKDVIELTDDTFDKNVLESEDVWMVEFYAPWCGHCK  194


 Score = 86.7 bits (213),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 47/101 (47%), Positives = 61/101 (60%), Gaps = 4/101 (4%)
 Frame = +2

Query  179  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  346
            V++L    F   VL S  V +VEF+APWCGHCK L P +   A+ +    KG   +AA+D
Sbjct  162  VIELTDDTFDKNVLESEDVWMVEFYAPWCGHCKNLEPEWAAAATEVKDQTKGKVKLAAVD  221

Query  347  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  469
            A  +  LA  YGI+GFPTIK+F  G+ PVDY G R    +V
Sbjct  222  ATVNQVLASRYGIRGFPTIKIFQKGESPVDYDGGRTKSDIV  262



>ref|XP_006976688.1| PREDICTED: protein disulfide-isomerase A6 [Peromyscus maniculatus 
bairdii]
Length=602

 Score =   168 bits (426),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 89/177 (50%), Positives = 119/177 (67%), Gaps = 7/177 (4%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            + LY  S  V++L PSNF  +V+ SN + LVEF+APWCGHC+ LTP ++K A+ LK V  
Sbjct  180  SGLYSSSDDVIELTPSNFNREVIQSNSLWLVEFYAPWCGHCQRLTPEWKKAATALKDVVK  239

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  508
            V A+DAD H SL  +YG++GFPTIK+F   K +P DYQG R  +++VD   + +R L+KD
Sbjct  240  VGAVDADKHQSLGGQYGVQGFPTIKIFGANKNKPEDYQGGRTGEAIVDAALSALRQLVKD  299

Query  509  RLDGKATGGSSQK------SEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            RL G++ G SS K      S     VEL    FD  V+ S+D+W+VEF+APWCGHCK
Sbjct  300  RLAGRSGGYSSGKQGRGDSSSKKDVVELTDDTFDKNVLDSEDVWMVEFYAPWCGHCK  356


 Score = 86.3 bits (212),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 47/101 (47%), Positives = 62/101 (61%), Gaps = 4/101 (4%)
 Frame = +2

Query  179  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  346
            V++L    F   VL+S  V +VEF+APWCGHCK L P +   A+ +    KG   +AA+D
Sbjct  324  VVELTDDTFDKNVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAATEVKDQTKGKVKLAAVD  383

Query  347  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  469
            A  +  LA  YGI+GFPTIK+F  G+ PVDY G R    +V
Sbjct  384  ATVNQVLASRYGIRGFPTIKIFQKGESPVDYDGGRTRSDIV  424



>ref|XP_011489880.1| PREDICTED: protein disulfide-isomerase A6 isoform X1 [Oryzias 
latipes]
Length=443

 Score =   166 bits (420),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 87/179 (49%), Positives = 121/179 (68%), Gaps = 9/179 (5%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
             ALY PS  V++L PSNF  +V+ S+ + LVEF+APWCGHC+ L P ++K A+ LKG+  
Sbjct  18   EALYSPSDDVVELTPSNFNREVMQSDSLWLVEFYAPWCGHCRNLAPDWKKAATALKGIVK  77

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  508
            V A+DAD H SL  +YG++GFPTIK+F   K +P +YQGAR ++++VD     +R+L+KD
Sbjct  78   VGAVDADEHKSLGGQYGVRGFPTIKIFGANKNKPEEYQGARSSQAIVDGAMNALRSLVKD  137

Query  509  RLDGKATGGSSQKSEPSAS--------VELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            RL GK+      + +  +         VEL   NFD  V++S D+W+VEFFAPWCGHCK
Sbjct  138  RLSGKSGSSGYSRQQSDSGSSGSSKDVVELTDDNFDKTVLQSDDVWLVEFFAPWCGHCK  196


 Score = 90.5 bits (223),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 47/102 (46%), Positives = 64/102 (63%), Gaps = 4/102 (4%)
 Frame = +2

Query  179  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  346
            V++L   NF   VL S+ V LVEFFAPWCGHCK L P +   A+ +    KG   + A+D
Sbjct  164  VVELTDDNFDKTVLQSDDVWLVEFFAPWCGHCKNLEPEWAAAATAVKEQTKGKVRLGAVD  223

Query  347  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVD  472
            A  H  L+  YG++GFPTIK+F  G++P DYQG R    +++
Sbjct  224  ATVHQVLSSRYGVRGFPTIKIFRKGEEPEDYQGGRTRGDIIE  265



>gb|ELK13980.1| Protein disulfide-isomerase A6 [Pteropus alecto]
Length=469

 Score =   166 bits (421),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 87/177 (49%), Positives = 117/177 (66%), Gaps = 7/177 (4%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            N LY  S  V++L PSNF  +V+ S  + LVEF+APWCGHC+ LTP ++KVA+ LK V  
Sbjct  47   NGLYSSSDDVIELTPSNFNQEVIQSGSLWLVEFYAPWCGHCQRLTPEWKKVATALKDVVK  106

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  508
            V A+DAD H SL  +YG++GFPTIK+F   K +P DYQGAR ++++VD   + +R L+KD
Sbjct  107  VGAVDADKHQSLGGQYGVQGFPTIKIFGSNKNKPEDYQGARTSEAIVDAALSAVRQLVKD  166

Query  509  RL------DGKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            RL            G S+ S     +EL   +FD  V+ S D+W+VEF+APWCGHCK
Sbjct  167  RLAGRGGGYSSGRQGRSESSSKKDVIELTDDSFDKNVLDSDDVWMVEFYAPWCGHCK  223


 Score = 88.6 bits (218),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 47/101 (47%), Positives = 65/101 (64%), Gaps = 4/101 (4%)
 Frame = +2

Query  179  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  346
            V++L   +F   VL+S+ V +VEF+APWCGHCK L P +   A+ +    KG   +AA+D
Sbjct  191  VIELTDDSFDKNVLDSDDVWMVEFYAPWCGHCKNLEPEWAAAATEVKEQTKGKVKLAAVD  250

Query  347  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  469
            A A+  L+  YGI+GFPTIK+F  G+ PVDY G R    +V
Sbjct  251  ATANQVLSSRYGIRGFPTIKIFQKGESPVDYDGGRTRSDIV  291



>emb|CAH65062.1| hypothetical protein RCJMB04_2j3, partial [Gallus gallus]
Length=247

 Score =   161 bits (407),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 84/182 (46%), Positives = 117/182 (64%), Gaps = 16/182 (9%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            N LY  S  V++L P+NF  +V+ S  + LVEF+APWCGHC+ LTP ++K A+ LKGV  
Sbjct  23   NGLYSASDDVIELTPTNFNKEVIQSESLWLVEFYAPWCGHCQRLTPEWKKAATALKGVVK  82

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPV-DYQGAREAKSMVDFVKAQIRNLLKD  508
            V A+DAD H SL  +YG++GFPTIK+F   K    DYQG R ++++VD   + +R+L+KD
Sbjct  83   VGAVDADKHQSLGGQYGVRGFPTIKIFGANKNKAEDYQGGRTSEAIVDAALSALRSLVKD  142

Query  509  RL-----------DGKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGH  655
            RL             + +GG  +K      +EL   +FD  V+ S D+W+VEF+APWCGH
Sbjct  143  RLSGRSGGYSSGRQSRESGGGDKKD----VIELTDDSFDKNVINSDDVWMVEFYAPWCGH  198

Query  656  CK  661
            CK
Sbjct  199  CK  200


 Score = 67.0 bits (162),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 52/85 (61%), Gaps = 4/85 (5%)
 Frame = +2

Query  164  GPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVAT  331
            G    V++L   +F   V+NS+ V +VEF+APWCGHCK L P +   A+ +    KG   
Sbjct  163  GDKKDVIELTDDSFDKNVINSDDVWMVEFYAPWCGHCKNLEPEWAAAATEVKEQTKGKVK  222

Query  332  VaaldadahsslaQEYGIKGFPTIK  406
            +AA+DA  +  LA  YGI+GFP IK
Sbjct  223  LAAVDATVNQMLANRYGIRGFPPIK  247



>ref|XP_004887060.1| PREDICTED: protein disulfide-isomerase A6 [Heterocephalus glaber]
Length=477

 Score =   166 bits (420),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 88/177 (50%), Positives = 117/177 (66%), Gaps = 7/177 (4%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            N LY     V++L P+NF  +V+ S+ + LVEF+APWCGHC+ L P ++K AS LK V  
Sbjct  55   NGLYSSGDAVIELTPANFNREVIQSDSLWLVEFYAPWCGHCQRLAPEWKKAASALKDVVK  114

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  508
            V A+DAD H SLA +YG++GFPTIKVF   K +P DYQG R A+++VD   + +R L+KD
Sbjct  115  VGAVDADKHQSLAGQYGVQGFPTIKVFRADKNKPEDYQGGRTAEAIVDAALSALRQLVKD  174

Query  509  RLDGKATG------GSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            RL G+A        G S+ S     +EL    FD  V+ S D+W+VEF+APWCGHCK
Sbjct  175  RLGGRAGAQGSGRQGRSEGSGKKDVIELTDDTFDKNVLDSPDVWMVEFYAPWCGHCK  231


 Score = 84.3 bits (207),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 47/101 (47%), Positives = 63/101 (62%), Gaps = 4/101 (4%)
 Frame = +2

Query  179  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  346
            V++L    F   VL+S  V +VEF+APWCGHCK L P +   A+ +    KG   +AA+D
Sbjct  199  VIELTDDTFDKNVLDSPDVWMVEFYAPWCGHCKNLEPEWAAAATEVKEQTKGRVKLAAVD  258

Query  347  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  469
            A A+  LA  YGI+GFPTIK+F  G+ P+DY G R    +V
Sbjct  259  ATANQVLAGRYGIRGFPTIKIFQGGETPMDYDGGRTRSDIV  299



>ref|XP_004436529.1| PREDICTED: protein disulfide-isomerase A6 [Ceratotherium simum 
simum]
Length=432

 Score =   165 bits (418),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 88/177 (50%), Positives = 120/177 (68%), Gaps = 7/177 (4%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            N LY  S  V++L PSNF  +V+ SN + LVEF+APWCGHC+ L P ++KVA+ LK V  
Sbjct  10   NGLYSSSDDVIELTPSNFNREVIQSNSLWLVEFYAPWCGHCQRLAPEWKKVATALKDVVK  69

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  508
            V A+DAD H SL  +YG++GFPTIK+F   K +P DYQG R  +++VD   + +R L+KD
Sbjct  70   VGAVDADKHQSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTGEAIVDAALSALRQLVKD  129

Query  509  RLDGKATG------GSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            RL G++ G      G S+ S     +EL   +FD  V+ S+D+W+VEF+APWCGHCK
Sbjct  130  RLGGRSGGYSSGKQGRSESSSKKDVIELTDDSFDKNVLDSEDVWMVEFYAPWCGHCK  186


 Score = 87.8 bits (216),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 47/101 (47%), Positives = 63/101 (62%), Gaps = 4/101 (4%)
 Frame = +2

Query  179  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  346
            V++L   +F   VL+S  V +VEF+APWCGHCK L P +   A+ +    KG   +AA+D
Sbjct  154  VIELTDDSFDKNVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAATEVKEQTKGKVKLAAVD  213

Query  347  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  469
            A  +  LA  YGI+GFPTIK+F  G+ PVDY G R    +V
Sbjct  214  ATVNQELASRYGIRGFPTIKIFQKGESPVDYDGGRTRSDIV  254



>ref|XP_004083501.1| PREDICTED: protein disulfide-isomerase A6 isoform X2 [Oryzias 
latipes]
Length=442

 Score =   165 bits (418),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 89/178 (50%), Positives = 121/178 (68%), Gaps = 8/178 (4%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
             ALY PS  V++L PSNF  +V+ S+ + LVEF+APWCGHC+ L P ++K A+ LKG+  
Sbjct  18   EALYSPSDDVVELTPSNFNREVMQSDSLWLVEFYAPWCGHCRNLAPDWKKAATALKGIVK  77

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  508
            V A+DAD H SL  +YG++GFPTIK+F   K +P +YQGAR ++++VD     +R+L+KD
Sbjct  78   VGAVDADEHKSLGGQYGVRGFPTIKIFGANKNKPEEYQGARSSQAIVDGAMNALRSLVKD  137

Query  509  RLDGKATGGSSQKSEPSAS-------VELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            RL GK+      +   S S       VEL   NFD  V++S D+W+VEFFAPWCGHCK
Sbjct  138  RLSGKSGSSGYSRQSDSGSSGSSKDVVELTDDNFDKTVLQSDDVWLVEFFAPWCGHCK  195


 Score = 90.5 bits (223),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 47/102 (46%), Positives = 64/102 (63%), Gaps = 4/102 (4%)
 Frame = +2

Query  179  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  346
            V++L   NF   VL S+ V LVEFFAPWCGHCK L P +   A+ +    KG   + A+D
Sbjct  163  VVELTDDNFDKTVLQSDDVWLVEFFAPWCGHCKNLEPEWAAAATAVKEQTKGKVRLGAVD  222

Query  347  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVD  472
            A  H  L+  YG++GFPTIK+F  G++P DYQG R    +++
Sbjct  223  ATVHQVLSSRYGVRGFPTIKIFRKGEEPEDYQGGRTRGDIIE  264



>gb|KFU90776.1| Protein disulfide-isomerase A6, partial [Chaetura pelagica]
Length=440

 Score =   165 bits (418),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 86/182 (47%), Positives = 117/182 (64%), Gaps = 16/182 (9%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            N LY  S  V++L P+NF  +V+ S  + LVEF+APWCGHC+ LTP ++K A+ LKGV  
Sbjct  17   NGLYSASDDVIELTPTNFNREVIQSESLWLVEFYAPWCGHCQRLTPEWKKAATALKGVVK  76

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPV-DYQGAREAKSMVDFVKAQIRNLLKD  508
            V A+DAD H SL  +YG++GFPTIK+F   K    DYQG R + ++VD   + +R+L+KD
Sbjct  77   VGAVDADKHQSLGGQYGVRGFPTIKIFGTNKNKAEDYQGGRTSDAIVDAALSALRSLVKD  136

Query  509  RL-----------DGKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGH  655
            RL             + +GG  +K      +ELN  NFD  V+ S D+W+VEF+APWCGH
Sbjct  137  RLSGRSGGYSSGKQSRESGGGDKKD----VIELNDDNFDKKVINSDDVWMVEFYAPWCGH  192

Query  656  CK  661
            CK
Sbjct  193  CK  194


 Score = 95.9 bits (237),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 51/106 (48%), Positives = 67/106 (63%), Gaps = 4/106 (4%)
 Frame = +2

Query  164  GPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVAT  331
            G    V++LN  NF  KV+NS+ V +VEF+APWCGHCK L P +   A+ +    KG   
Sbjct  157  GDKKDVIELNDDNFDKKVINSDDVWMVEFYAPWCGHCKNLEPEWAAAATEVKEQTKGKVK  216

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  469
            +AA+DA  +  LA  YGI+GFPTIK+F  G+ PVDY G R    +V
Sbjct  217  LAAVDATVNQMLAGRYGIRGFPTIKIFQKGEDPVDYDGGRTRSDIV  262



>ref|XP_008848336.1| PREDICTED: protein disulfide-isomerase A6 [Nannospalax galili]
Length=440

 Score =   165 bits (418),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 90/177 (51%), Positives = 119/177 (67%), Gaps = 7/177 (4%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            N LY  S  V++L PSNF  +V+ SN + LVEF+APWCGHC+ LTP ++K A+ LK V  
Sbjct  18   NGLYSSSDDVIELTPSNFNREVIQSNSLWLVEFYAPWCGHCQRLTPEWKKAATALKDVVK  77

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  508
            V A+DAD H SL  +YG++GFPTIK+F   K +P DYQG R  +++VD   + +R L+KD
Sbjct  78   VGAVDADKHQSLGGQYGVQGFPTIKIFGANKNKPEDYQGGRTGEAIVDAALSALRQLVKD  137

Query  509  RLDGKATG------GSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            RL GK+ G      G S  S     VEL   +FD  V+ S+D+W+VEF+APWCGHCK
Sbjct  138  RLGGKSGGYSSGKQGRSDSSSKKDVVELTDDSFDKHVLDSEDVWMVEFYAPWCGHCK  194


 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 47/101 (47%), Positives = 63/101 (62%), Gaps = 4/101 (4%)
 Frame = +2

Query  179  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  346
            V++L   +F   VL+S  V +VEF+APWCGHCK L P +   A+ +    KG   +AA+D
Sbjct  162  VVELTDDSFDKHVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAATEVKEQTKGKVKLAAVD  221

Query  347  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  469
            A  +  LA  YGI+GFPTIK+F  G+ PVDY G R    +V
Sbjct  222  ATVNQVLASRYGIRGFPTIKIFQKGESPVDYDGGRTRSDIV  262



>ref|XP_001502324.3| PREDICTED: protein disulfide-isomerase A6 [Equus caballus]
Length=448

 Score =   165 bits (418),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 88/177 (50%), Positives = 121/177 (68%), Gaps = 7/177 (4%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            N LY  S  V++L PSNF  +V+ S+ + LVEF+APWCGHC+ LTP ++KVA+ LK V  
Sbjct  26   NGLYSSSDDVIELTPSNFNREVIQSDSLWLVEFYAPWCGHCQRLTPEWKKVATALKDVVK  85

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  508
            V A+DAD H SL  +YG++GFPTIK+F   K +P DYQG R  +++VD   + +R L+KD
Sbjct  86   VGAVDADKHQSLGGQYGVQGFPTIKIFGANKNRPEDYQGGRSGEAIVDAALSALRQLVKD  145

Query  509  RLDGKATG------GSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            RL G++ G      G S+ S     +EL   +FD  V+ S+D+W+VEF+APWCGHCK
Sbjct  146  RLGGRSGGYSSGKQGRSESSSKKDVIELTDDSFDKNVLDSEDVWMVEFYAPWCGHCK  202


 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 46/101 (46%), Positives = 63/101 (62%), Gaps = 4/101 (4%)
 Frame = +2

Query  179  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  346
            V++L   +F   VL+S  V +VEF+APWCGHCK L P +   A+ +    KG   +AA+D
Sbjct  170  VIELTDDSFDKNVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAATEVKEQTKGKVKLAAVD  229

Query  347  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  469
            A  +  LA  YGI+GFPTIK+F  G+ PVDY G R    ++
Sbjct  230  ATVNQVLASRYGIRGFPTIKIFQKGESPVDYDGGRTRSDII  270



>ref|XP_532876.2| PREDICTED: protein disulfide-isomerase A6 [Canis lupus familiaris]
Length=440

 Score =   165 bits (417),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 88/177 (50%), Positives = 119/177 (67%), Gaps = 7/177 (4%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            N LY  S  V++L PSNF  +V+ S+ + LVEF+APWCGHC+ LTP ++KVA+ LK V  
Sbjct  18   NGLYSSSDDVIELTPSNFNREVIQSDNLWLVEFYAPWCGHCQRLTPEWKKVATALKDVVK  77

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  508
            V A+DAD H SL  +YG++GFPTIK+F   K +P DYQG+R  +++VD     +R L+KD
Sbjct  78   VGAVDADKHQSLGGQYGVQGFPTIKIFGSNKNRPEDYQGSRTGEAIVDAALGALRQLVKD  137

Query  509  RLDGKATG------GSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            RL G+  G      G S+ S     +EL   +FD  V+ S D+W+VEF+APWCGHCK
Sbjct  138  RLGGRGGGYSSGKQGRSESSNKKDVIELTDDSFDKNVLDSDDVWMVEFYAPWCGHCK  194


 Score = 86.3 bits (212),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 45/101 (45%), Positives = 65/101 (64%), Gaps = 4/101 (4%)
 Frame = +2

Query  179  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  346
            V++L   +F   VL+S+ V +VEF+APWCGHCK L P +   A+ +    KG   +AA+D
Sbjct  162  VIELTDDSFDKNVLDSDDVWMVEFYAPWCGHCKNLEPEWAAAATEVKEQTKGKVKLAAVD  221

Query  347  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  469
            A  +  LA  YGI+GFPTIK+F  G+ P++Y+G R    +V
Sbjct  222  ATVNQLLASRYGIRGFPTIKIFQKGESPMEYEGGRTRSDIV  262



>ref|XP_002408975.1| protein disulfide isomerase 1, putative [Ixodes scapularis]
 gb|EEC04085.1| protein disulfide isomerase 1, putative [Ixodes scapularis]
Length=435

 Score =   165 bits (417),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 85/170 (50%), Positives = 121/170 (71%), Gaps = 5/170 (3%)
 Frame = +2

Query  158  LYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVa  337
            LYGP T V+ L+ +NF+++V++S+ V +VEFFAPWCGHC++  P Y K A+ LKGV  V 
Sbjct  19   LYGPHTEVVDLSSANFRNRVVDSDEVWIVEFFAPWCGHCQSFAPEYIKAAAALKGVVKVG  78

Query  338  aldadahsslaQEYGIKGFPTIKVF-VPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDRL  514
            A+DAD   SLA +YG++GFPT+K+F V    P D+ GAR A+ +      +++ ++  RL
Sbjct  79   AVDADKDKSLAGQYGVRGFPTVKIFGVNKNSPTDFNGARTAEGVASAGLQELKKVVDQRL  138

Query  515  DGK-ATGGSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
              K ++GGS  KS+    VEL+  NF++LV+ S+DLW+VEFFAPWCGHCK
Sbjct  139  GKKTSSGGSKGKSD---VVELDESNFEELVLDSEDLWLVEFFAPWCGHCK  185


 Score = 92.8 bits (229),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 53/105 (50%), Positives = 69/105 (66%), Gaps = 4/105 (4%)
 Frame = +2

Query  173  TPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaaldad  352
            + V++L+ SNF+  VL+S  + LVEFFAPWCGHCK L P +EK A+ LKG   + A+DA 
Sbjct  151  SDVVELDESNFEELVLDSEDLWLVEFFAPWCGHCKNLAPHWEKAATELKGKVKLGAVDAT  210

Query  353  ahsslaQEYGIKGFPTIKVFVPGKQPV----DYQGAREAKSMVDF  475
             H  LA +YGIKGFPTIK F  GK+      +Y G R A  +V +
Sbjct  211  VHQGLASKYGIKGFPTIKFFPGGKKDSSSAEEYNGGRTADDIVHW  255



>ref|XP_009997534.1| PREDICTED: protein disulfide-isomerase A6 [Chaetura pelagica]
Length=464

 Score =   165 bits (418),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 86/182 (47%), Positives = 117/182 (64%), Gaps = 16/182 (9%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            N LY  S  V++L P+NF  +V+ S  + LVEF+APWCGHC+ LTP ++K A+ LKGV  
Sbjct  41   NGLYSASDDVIELTPTNFNREVIQSESLWLVEFYAPWCGHCQRLTPEWKKAATALKGVVK  100

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPV-DYQGAREAKSMVDFVKAQIRNLLKD  508
            V A+DAD H SL  +YG++GFPTIK+F   K    DYQG R + ++VD   + +R+L+KD
Sbjct  101  VGAVDADKHQSLGGQYGVRGFPTIKIFGTNKNKAEDYQGGRTSDAIVDAALSALRSLVKD  160

Query  509  RL-----------DGKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGH  655
            RL             + +GG  +K      +ELN  NFD  V+ S D+W+VEF+APWCGH
Sbjct  161  RLSGRSGGYSSGKQSRESGGGDKKD----VIELNDDNFDKKVINSDDVWMVEFYAPWCGH  216

Query  656  CK  661
            CK
Sbjct  217  CK  218


 Score = 95.5 bits (236),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 51/106 (48%), Positives = 67/106 (63%), Gaps = 4/106 (4%)
 Frame = +2

Query  164  GPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVAT  331
            G    V++LN  NF  KV+NS+ V +VEF+APWCGHCK L P +   A+ +    KG   
Sbjct  181  GDKKDVIELNDDNFDKKVINSDDVWMVEFYAPWCGHCKNLEPEWAAAATEVKEQTKGKVK  240

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  469
            +AA+DA  +  LA  YGI+GFPTIK+F  G+ PVDY G R    +V
Sbjct  241  LAAVDATVNQMLAGRYGIRGFPTIKIFQKGEDPVDYDGGRTRSDIV  286



>ref|XP_003971872.1| PREDICTED: protein disulfide-isomerase A6-like [Takifugu rubripes]
Length=442

 Score =   165 bits (417),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 85/177 (48%), Positives = 122/177 (69%), Gaps = 8/177 (5%)
 Frame = +2

Query  155  ALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATV  334
            A Y P   V++L PSNF  +V+ S+ + LVEF+APWCGHC+ L P ++K A+ LKG+  V
Sbjct  19   AFYSPDDDVVELTPSNFNKEVIQSDALWLVEFYAPWCGHCRNLVPDWKKAAAALKGIVKV  78

Query  335  aaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKDR  511
             A+DAD H SL  +YG++GFPTIK+F   K +P +YQG R ++++VD   + +R+L+K+R
Sbjct  79   GAVDADQHKSLGGQYGVRGFPTIKIFGANKNKPEEYQGGRSSQAIVDGALSALRSLVKER  138

Query  512  LDGKATGGSSQKSEPSAS-------VELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            L G ++G    K + S S       VEL   NFD +V++S ++W+VEFFAPWCGHCK
Sbjct  139  LSGGSSGSGYNKQQQSGSGGSKKDVVELTDDNFDQMVLESGEVWMVEFFAPWCGHCK  195


 Score = 90.9 bits (224),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 47/107 (44%), Positives = 64/107 (60%), Gaps = 4/107 (4%)
 Frame = +2

Query  164  GPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVAT  331
            G    V++L   NF   VL S  V +VEFFAPWCGHCK L P +   A+ +    KG   
Sbjct  158  GSKKDVVELTDDNFDQMVLESGEVWMVEFFAPWCGHCKNLEPEWTAAATAVKEQTKGKVR  217

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVD  472
            + A+DA  H  ++  YGI+GFPTIK+F  G++P DYQG R    +++
Sbjct  218  LGAVDATVHQVVSSRYGIRGFPTIKIFRKGEEPEDYQGGRTRADIIE  264



>gb|EFB24563.1| hypothetical protein PANDA_010457 [Ailuropoda melanoleuca]
Length=413

 Score =   164 bits (415),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 88/177 (50%), Positives = 119/177 (67%), Gaps = 7/177 (4%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            N LY  S  V++L P+NF  +V+ S+ + LVEF+APWCGHC+ LTP ++KVA+ LK V  
Sbjct  12   NGLYSSSDDVIELTPTNFNREVIQSDSLWLVEFYAPWCGHCQRLTPEWKKVATALKDVVK  71

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  508
            V A+DAD H SL  +YG++GFPTIK+F   K +P DYQG R  +++VD   + +R L+KD
Sbjct  72   VGAVDADKHQSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTGEAIVDAALSALRQLVKD  131

Query  509  RLDGKATG------GSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            RL G+  G      G S+ S     VEL   +FD  V+ S D+W+VEF+APWCGHCK
Sbjct  132  RLGGRGGGYSSGKQGRSESSSKKDVVELTDDSFDKNVLDSDDVWMVEFYAPWCGHCK  188


 Score = 87.0 bits (214),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 46/101 (46%), Positives = 64/101 (63%), Gaps = 4/101 (4%)
 Frame = +2

Query  179  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  346
            V++L   +F   VL+S+ V +VEF+APWCGHCK L P +   A+ +    KG   +AA+D
Sbjct  156  VVELTDDSFDKNVLDSDDVWMVEFYAPWCGHCKNLEPEWAAAATEVREQTKGKVKLAAVD  215

Query  347  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  469
            A  +  LA  YGI+GFPTIK+F  G+ PVDY G R    ++
Sbjct  216  ATVNQLLASRYGIRGFPTIKIFQKGESPVDYDGGRTRSDII  256



>ref|XP_004642404.1| PREDICTED: protein disulfide-isomerase A6 [Octodon degus]
Length=515

 Score =   166 bits (420),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 85/177 (48%), Positives = 118/177 (67%), Gaps = 7/177 (4%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            + LY     V++L P+NF  +V+ S+ + LVEF+APWCGHC+ L P ++K A+ LK V  
Sbjct  93   HGLYSSGDAVIELTPTNFHREVIQSDSLWLVEFYAPWCGHCQRLAPEWKKAANALKDVVK  152

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  508
            V A+DAD H SL  +YG++GFPTIK+F   K +P DYQG R A+++VD   + +R L+KD
Sbjct  153  VGAVDADKHQSLGGQYGVQGFPTIKIFGANKNKPEDYQGGRTAEAIVDAALSAVRQLVKD  212

Query  509  RLDGKATG------GSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            RL G+A G      G S+ S     +EL    FD+ V+ S D+W+VEF+APWCGHCK
Sbjct  213  RLGGRAGGHSSGRQGRSEGSGKKDVIELTDDTFDENVLDSPDVWMVEFYAPWCGHCK  269


 Score = 85.9 bits (211),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 47/101 (47%), Positives = 62/101 (61%), Gaps = 4/101 (4%)
 Frame = +2

Query  179  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  346
            V++L    F   VL+S  V +VEF+APWCGHCK L P +   A+ +    KG   +AA+D
Sbjct  237  VIELTDDTFDENVLDSPDVWMVEFYAPWCGHCKNLEPEWAAAATEVKEQTKGRVKLAAVD  296

Query  347  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  469
            A  +  LA  YGI+GFPTIK+F  G+ PVDY G R    +V
Sbjct  297  ATVNQVLASRYGIRGFPTIKIFQKGEAPVDYDGGRTRSDIV  337



>ref|XP_004582660.1| PREDICTED: protein disulfide-isomerase A6 isoform X2 [Ochotona 
princeps]
Length=440

 Score =   164 bits (416),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 86/177 (49%), Positives = 120/177 (68%), Gaps = 7/177 (4%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            N LY  S  V++L PSNF  +V+ S+ + LVEF+APWCGHC+ LTP ++K A+ LK V  
Sbjct  18   NGLYSSSDDVIELTPSNFNREVIQSDSLWLVEFYAPWCGHCQRLTPEWKKAATALKDVVK  77

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  508
            V A+DAD H SL  +YG++GFPTIK+F   K +P DYQG R  +++VD   + +R L+KD
Sbjct  78   VGAVDADKHQSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTGEAIVDAALSALRQLVKD  137

Query  509  RLDGKATG------GSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            RL G+++       G S  S     +EL   +FD+ V+ S+D+W+VEF+APWCGHCK
Sbjct  138  RLGGRSSSYSSGKQGRSDSSSKKDVIELTDDSFDENVLDSEDIWMVEFYAPWCGHCK  194


 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 45/101 (45%), Positives = 63/101 (62%), Gaps = 4/101 (4%)
 Frame = +2

Query  179  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  346
            V++L   +F   VL+S  + +VEF+APWCGHCK L P +   A+ +    KG   +AA+D
Sbjct  162  VIELTDDSFDENVLDSEDIWMVEFYAPWCGHCKNLEPEWAAAATEVKEQTKGKVKLAAVD  221

Query  347  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  469
            A  +  L+  YGI+GFPTIK+F  G+ PVDY G R    +V
Sbjct  222  ATVNQLLSSRYGIRGFPTIKIFQKGESPVDYDGGRTRSDIV  262



>ref|XP_009181940.1| PREDICTED: protein disulfide-isomerase A6 isoform X2 [Papio anubis]
Length=437

 Score =   164 bits (415),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 87/177 (49%), Positives = 120/177 (68%), Gaps = 7/177 (4%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            N LY  S  V++L PSNF  +V+ S+ + LVEF+APWCGHC+ LTP ++K A+ LK V  
Sbjct  15   NGLYSSSDDVIELTPSNFNREVIQSDSLWLVEFYAPWCGHCQRLTPEWKKAATALKDVVK  74

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  508
            V A+DAD H SL  +YG++GFPTIK+F   K +P DYQG R  +++VD   + +R L+KD
Sbjct  75   VGAVDADKHQSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTGEAIVDAALSALRQLVKD  134

Query  509  RLDGKATG------GSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            RL G++ G      G S  S     +EL   +FD+ V+ S+D+W+VEF+APWCGHCK
Sbjct  135  RLGGRSGGYSSGKQGRSDSSSKKDVIELTDDSFDENVLDSEDVWMVEFYAPWCGHCK  191


 Score = 89.0 bits (219),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 63/101 (62%), Gaps = 4/101 (4%)
 Frame = +2

Query  179  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  346
            V++L   +F   VL+S  V +VEF+APWCGHCK L P +   AS +    KG   +AA+D
Sbjct  159  VIELTDDSFDENVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAASEVKEQTKGKVKLAAVD  218

Query  347  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  469
            A  +  LA  YGI+GFPTIK+F  G+ PVDY G R    +V
Sbjct  219  ATVNQVLASRYGIRGFPTIKIFQKGESPVDYDGGRTRSDIV  259



>ref|XP_005404513.1| PREDICTED: protein disulfide-isomerase A6, partial [Chinchilla 
lanigera]
Length=610

 Score =   166 bits (421),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 86/177 (49%), Positives = 118/177 (67%), Gaps = 7/177 (4%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            + LY     V++L P+NF+ +V+ S+ + LVEF+APWCGHC+ L P ++KVAS LK V  
Sbjct  188  HGLYSSGDAVIELTPANFQREVIQSDSLWLVEFYAPWCGHCQRLAPEWKKVASALKDVVK  247

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  508
            V A+DAD H SL  +YG++GFPTIK+F   K +P DYQG R A+++VD   + +R L+KD
Sbjct  248  VGAVDADKHQSLGGQYGVQGFPTIKIFGANKNKPEDYQGGRTAEAIVDAALSAVRQLVKD  307

Query  509  RLDGKATGGSSQKSEPSAS------VELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            RL G+A G SS +            +EL    FD  V+ S D+W+VEF+APWCGHCK
Sbjct  308  RLSGRAGGQSSGRQGRGEGPGKKDVIELTDDTFDGNVLDSPDVWMVEFYAPWCGHCK  364


 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 46/101 (46%), Positives = 62/101 (61%), Gaps = 4/101 (4%)
 Frame = +2

Query  179  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  346
            V++L    F   VL+S  V +VEF+APWCGHCK L P +   A+ +    KG   +AA+D
Sbjct  332  VIELTDDTFDGNVLDSPDVWMVEFYAPWCGHCKNLEPEWSAAATEVKEQTKGRVKLAAVD  391

Query  347  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  469
            A  +  LA  YGI+GFPTIK+F  G+ P+DY G R    +V
Sbjct  392  ATVNQVLASRYGIRGFPTIKIFQKGEDPIDYDGGRTRSDIV  432



>ref|XP_003908325.1| PREDICTED: protein disulfide-isomerase A6 isoform X1 [Papio anubis]
Length=440

 Score =   164 bits (415),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 87/177 (49%), Positives = 120/177 (68%), Gaps = 7/177 (4%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            N LY  S  V++L PSNF  +V+ S+ + LVEF+APWCGHC+ LTP ++K A+ LK V  
Sbjct  18   NGLYSSSDDVIELTPSNFNREVIQSDSLWLVEFYAPWCGHCQRLTPEWKKAATALKDVVK  77

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  508
            V A+DAD H SL  +YG++GFPTIK+F   K +P DYQG R  +++VD   + +R L+KD
Sbjct  78   VGAVDADKHQSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTGEAIVDAALSALRQLVKD  137

Query  509  RLDGKATG------GSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            RL G++ G      G S  S     +EL   +FD+ V+ S+D+W+VEF+APWCGHCK
Sbjct  138  RLGGRSGGYSSGKQGRSDSSSKKDVIELTDDSFDENVLDSEDVWMVEFYAPWCGHCK  194


 Score = 89.0 bits (219),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 63/101 (62%), Gaps = 4/101 (4%)
 Frame = +2

Query  179  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  346
            V++L   +F   VL+S  V +VEF+APWCGHCK L P +   AS +    KG   +AA+D
Sbjct  162  VIELTDDSFDENVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAASEVKEQTKGKVKLAAVD  221

Query  347  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  469
            A  +  LA  YGI+GFPTIK+F  G+ PVDY G R    +V
Sbjct  222  ATVNQVLASRYGIRGFPTIKIFQKGESPVDYDGGRTRSDIV  262



>ref|NP_001253564.1| protein disulfide-isomerase A6 precursor [Macaca mulatta]
 ref|XP_005576620.1| PREDICTED: protein disulfide-isomerase A6 [Macaca fascicularis]
 ref|XP_007969684.1| PREDICTED: protein disulfide-isomerase A6 isoform X1 [Chlorocebus 
sabaeus]
 ref|XP_007969685.1| PREDICTED: protein disulfide-isomerase A6 isoform X2 [Chlorocebus 
sabaeus]
Length=440

 Score =   164 bits (415),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 87/177 (49%), Positives = 120/177 (68%), Gaps = 7/177 (4%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            N LY  S  V++L PSNF  +V+ S+ + LVEF+APWCGHC+ LTP ++K A+ LK V  
Sbjct  18   NGLYSSSDDVIELTPSNFNREVIQSDSLWLVEFYAPWCGHCQRLTPEWKKAATALKDVVK  77

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  508
            V A+DAD H SL  +YG++GFPTIK+F   K +P DYQG R  +++VD   + +R L+KD
Sbjct  78   VGAVDADKHQSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTGEAIVDAALSALRQLVKD  137

Query  509  RLDGKATG------GSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            RL G++ G      G S  S     +EL   +FD+ V+ S+D+W+VEF+APWCGHCK
Sbjct  138  RLGGRSGGYSSGKQGRSDSSSKKDVIELTDDSFDENVLDSEDVWMVEFYAPWCGHCK  194


 Score = 89.0 bits (219),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 63/101 (62%), Gaps = 4/101 (4%)
 Frame = +2

Query  179  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  346
            V++L   +F   VL+S  V +VEF+APWCGHCK L P +   AS +    KG   +AA+D
Sbjct  162  VIELTDDSFDENVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAASEVKEQTKGKVKLAAVD  221

Query  347  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  469
            A  +  LA  YGI+GFPTIK+F  G+ PVDY G R    +V
Sbjct  222  ATVNQVLASRYGIRGFPTIKIFQKGESPVDYDGGRTRSDIV  262



>ref|XP_006910476.1| PREDICTED: protein disulfide-isomerase A6 [Pteropus alecto]
Length=527

 Score =   166 bits (419),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 87/177 (49%), Positives = 117/177 (66%), Gaps = 7/177 (4%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            N LY  S  V++L PSNF  +V+ S  + LVEF+APWCGHC+ LTP ++KVA+ LK V  
Sbjct  105  NGLYSSSDDVIELTPSNFNQEVIQSGSLWLVEFYAPWCGHCQRLTPEWKKVATALKDVVK  164

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  508
            V A+DAD H SL  +YG++GFPTIK+F   K +P DYQGAR ++++VD   + +R L+KD
Sbjct  165  VGAVDADKHQSLGGQYGVQGFPTIKIFGSNKNKPEDYQGARTSEAIVDAALSAVRQLVKD  224

Query  509  RL------DGKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            RL            G S+ S     +EL   +FD  V+ S D+W+VEF+APWCGHCK
Sbjct  225  RLAGRGGGYSSGRQGRSESSSKKDVIELTDDSFDKNVLDSDDVWMVEFYAPWCGHCK  281


 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 47/101 (47%), Positives = 65/101 (64%), Gaps = 4/101 (4%)
 Frame = +2

Query  179  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  346
            V++L   +F   VL+S+ V +VEF+APWCGHCK L P +   A+ +    KG   +AA+D
Sbjct  249  VIELTDDSFDKNVLDSDDVWMVEFYAPWCGHCKNLEPEWAAAATEVKEQTKGKVKLAAVD  308

Query  347  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  469
            A A+  L+  YGI+GFPTIK+F  G+ PVDY G R    +V
Sbjct  309  ATANQVLSSRYGIRGFPTIKIFQKGESPVDYDGGRTRSDIV  349



>ref|NP_001182048.1| protein disulfide-isomerase A6 precursor [Sus scrofa]
 dbj|BAJ11758.1| protein disulfide isomerase P5 [Sus scrofa]
Length=440

 Score =   164 bits (415),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 88/177 (50%), Positives = 119/177 (67%), Gaps = 7/177 (4%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            N LY  S  V++L PSNF  +V+ S+ + LVEF+APWCGHC+ LTP ++KVA+ LK V  
Sbjct  18   NGLYSSSDDVIELTPSNFNREVIQSDSLWLVEFYAPWCGHCQRLTPEWKKVATALKDVVK  77

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  508
            V A+DAD H SL  +YG++GFPTIK+F   K +P DYQG R  +++VD   + +R L+KD
Sbjct  78   VGAVDADKHQSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTGEAIVDAALSALRQLVKD  137

Query  509  RLDGKATG------GSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            RL G+  G      G S+ S     +EL    FD  V+ S+D+W+VEF+APWCGHCK
Sbjct  138  RLGGRGGGYSSGKQGRSEGSGKKDVIELTDDTFDKNVLDSEDVWMVEFYAPWCGHCK  194


 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 47/101 (47%), Positives = 62/101 (61%), Gaps = 4/101 (4%)
 Frame = +2

Query  179  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  346
            V++L    F   VL+S  V +VEF+APWCGHCK L P +   A+ +    KG   +AA+D
Sbjct  162  VIELTDDTFDKNVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAATEVKEQTKGKVKLAAVD  221

Query  347  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  469
            A  +  LA  YGI+GFPTIK+F  G+ PVDY G R    +V
Sbjct  222  ATVNQVLASRYGIRGFPTIKIFQKGESPVDYDGGRTRSDIV  262



>ref|XP_004582659.1| PREDICTED: protein disulfide-isomerase A6 isoform X1 [Ochotona 
princeps]
Length=442

 Score =   164 bits (415),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 86/177 (49%), Positives = 120/177 (68%), Gaps = 7/177 (4%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            N LY  S  V++L PSNF  +V+ S+ + LVEF+APWCGHC+ LTP ++K A+ LK V  
Sbjct  20   NGLYSSSDDVIELTPSNFNREVIQSDSLWLVEFYAPWCGHCQRLTPEWKKAATALKDVVK  79

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  508
            V A+DAD H SL  +YG++GFPTIK+F   K +P DYQG R  +++VD   + +R L+KD
Sbjct  80   VGAVDADKHQSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTGEAIVDAALSALRQLVKD  139

Query  509  RLDGKATG------GSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            RL G+++       G S  S     +EL   +FD+ V+ S+D+W+VEF+APWCGHCK
Sbjct  140  RLGGRSSSYSSGKQGRSDSSSKKDVIELTDDSFDENVLDSEDIWMVEFYAPWCGHCK  196


 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 45/101 (45%), Positives = 63/101 (62%), Gaps = 4/101 (4%)
 Frame = +2

Query  179  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  346
            V++L   +F   VL+S  + +VEF+APWCGHCK L P +   A+ +    KG   +AA+D
Sbjct  164  VIELTDDSFDENVLDSEDIWMVEFYAPWCGHCKNLEPEWAAAATEVKEQTKGKVKLAAVD  223

Query  347  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  469
            A  +  L+  YGI+GFPTIK+F  G+ PVDY G R    +V
Sbjct  224  ATVNQLLSSRYGIRGFPTIKIFQKGESPVDYDGGRTRSDIV  264



>emb|CDP96040.1| Protein BM-TAG-320, isoform b [Brugia malayi]
Length=435

 Score =   164 bits (414),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 81/175 (46%), Positives = 118/175 (67%), Gaps = 5/175 (3%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            +ALY  +  V+QL  SNF +KVL S+ + +VEFFAPWCGHC+ L P Y K+A+ LKG+  
Sbjct  14   HALYDGNRNVIQLTESNFNNKVLKSDEIWIVEFFAPWCGHCQKLVPEYMKLANALKGIFK  73

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGKQ-PVDYQGAREAKSMVDFVKAQIRNLLKD  508
            V A+D   H S+  +Y I+GFPTIK+F   K+ P+DYQG R A+++ D +  ++R  +  
Sbjct  74   VGAVDMTQHQSVGAQYNIQGFPTIKIFGADKKVPLDYQGPRTAQAITDSLINELRKTVNA  133

Query  509  RL----DGKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            +L      ++ G + +KS     +EL   NF+++V+ SKD+W+VEFFAPWCGHCK
Sbjct  134  KLGISSSSQSRGANDKKSSGKYVIELTDSNFEEMVLHSKDIWLVEFFAPWCGHCK  188


 Score = 94.7 bits (234),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 53/102 (52%), Positives = 65/102 (64%), Gaps = 3/102 (3%)
 Frame = +2

Query  179  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaaldadah  358
            V++L  SNF+  VL+S  + LVEFFAPWCGHCKAL P +E  AS L G   V ALDA  H
Sbjct  156  VIELTDSNFEEMVLHSKDIWLVEFFAPWCGHCKALKPHWEMAASELAGKVKVGALDATVH  215

Query  359  sslaQEYGIKGFPTIKVFVPGKQPV---DYQGAREAKSMVDF  475
             ++A  +GIKGFPTIK F PG       DY G R +  +V +
Sbjct  216  QAMASHFGIKGFPTIKYFAPGSSASDAEDYVGGRTSDDIVQY  257



>gb|KHJ46223.1| protein disulfide-isomerase domain protein [Trichuris suis]
Length=434

 Score =   164 bits (414),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 76/175 (43%), Positives = 115/175 (66%), Gaps = 5/175 (3%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            + LY  +  V++L  SNF+SKV++S+ V +VEF+APWCGHC+   P + K A  LKG+  
Sbjct  18   STLYSGNNDVVELTASNFQSKVIDSDAVWIVEFYAPWCGHCQNFAPEFAKAAKALKGIVK  77

Query  332  VaaldadahsslaQEYGIKGFPTIKVF-VPGKQPVDYQGAREAKSMVDFVKAQIRNLLKD  508
            V  +D D H S+   Y ++GFPT+K+F +   +P D+QG R A+++ D    +++ L++ 
Sbjct  78   VGGVDMDKHGSVGGPYNVQGFPTVKIFGIDKNKPTDFQGGRTAQALADAAINEVKRLVQM  137

Query  509  RLDGKATGGSSQKSEPSAS----VELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            RL G+  G  S+KS  + S    +EL   NF+D++  S D+W+VEFFAPWCGHCK
Sbjct  138  RLTGRRPGADSKKSSSTGSAKDVIELTDSNFEDMITNSDDMWLVEFFAPWCGHCK  192


 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 50/113 (44%), Positives = 74/113 (65%), Gaps = 4/113 (4%)
 Frame = +2

Query  164  GPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaal  343
            G +  V++L  SNF+  + NS+ + LVEFFAPWCGHCK L P ++  A+ LKG   VAA+
Sbjct  155  GSAKDVIELTDSNFEDMITNSDDMWLVEFFAPWCGHCKNLAPHWQSAATQLKGRVKVAAI  214

Query  344  dadahsslaQEYGIKGFPTIKVFVPGKQPVD----YQGAREAKSMVDFVKAQI  490
            DA  ++ +AQ +GI+GFPTIK+F  G + +D    Y G R A  +V + + ++
Sbjct  215  DATVNTVMAQRFGIQGFPTIKMFPSGAKSLDDAVEYTGGRSASDIVQWAEEKL  267



>emb|CAJ82905.1| protein disulfide isomerase family A, member 6 [Xenopus (Silurana) 
tropicalis]
Length=441

 Score =   164 bits (414),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 84/182 (46%), Positives = 119/182 (65%), Gaps = 16/182 (9%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            +A+Y PS  V++L PSNF  +V+ S+ + LVEF+APWCGHC+ LTP ++K A+ LKGV  
Sbjct  18   SAMYSPSDDVIELTPSNFNKEVIQSDSLWLVEFYAPWCGHCQRLTPDWKKAATALKGVVK  77

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  508
            + A++AD H SL  +YG++GFPTIKVF   K +P DYQG R A +++D   + +R+ +KD
Sbjct  78   IGAVNADQHQSLGGQYGVRGFPTIKVFGANKNKPDDYQGGRTADAIIDAALSSLRSFVKD  137

Query  509  RL-----------DGKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGH  655
            RL              ++GG S+K      ++L    FD  V+ S D+W VEF+APWCGH
Sbjct  138  RLGGRSGGSDSGRQSYSSGGGSKKD----VIDLTDDTFDKNVLNSDDVWFVEFYAPWCGH  193

Query  656  CK  661
            CK
Sbjct  194  CK  195


 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 49/106 (46%), Positives = 61/106 (58%), Gaps = 4/106 (4%)
 Frame = +2

Query  164  GPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLK----GVAT  331
            G    V+ L    F   VLNS+ V  VEF+APWCGHCK L P +   A+ +K    G   
Sbjct  158  GSKKDVIDLTDDTFDKNVLNSDDVWFVEFYAPWCGHCKNLEPEWAAAATEIKQQTNGKVK  217

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  469
            +AA+DA     LA  YGI+GFPTIK+F  G+ PVDY G R    +V
Sbjct  218  LAAVDATVSQVLASRYGIRGFPTIKIFQKGEDPVDYDGGRTKADIV  263



>ref|XP_006745860.1| PREDICTED: protein disulfide-isomerase A6 [Leptonychotes weddellii]
Length=432

 Score =   164 bits (414),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 88/177 (50%), Positives = 118/177 (67%), Gaps = 7/177 (4%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            N LY  S  V++L PSNF  +V+ S  + LVEF+APWCGHC+ LTP ++KVA+ LK V  
Sbjct  10   NGLYSSSDDVIELTPSNFNREVIQSASLWLVEFYAPWCGHCQRLTPEWKKVATALKDVVK  69

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  508
            V A+DAD H SL  +YG++GFPTIK+F   K +P DYQG R  +++VD   + +R L+KD
Sbjct  70   VGAVDADKHQSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTGEAIVDAALSALRQLVKD  129

Query  509  RLDGKATG------GSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            RL G+  G      G S+ S     +EL   +FD  V+ S D+W+VEF+APWCGHCK
Sbjct  130  RLGGRGGGYSSGKQGRSESSSKKDVIELTDDSFDKNVLDSDDVWMVEFYAPWCGHCK  186


 Score = 85.5 bits (210),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 46/101 (46%), Positives = 63/101 (62%), Gaps = 4/101 (4%)
 Frame = +2

Query  179  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  346
            V++L   +F   VL+S+ V +VEF+APWCGHCK L P +   A+ +    KG   +AA+D
Sbjct  154  VIELTDDSFDKNVLDSDDVWMVEFYAPWCGHCKNLEPEWAAAATEVKEQTKGKVKLAAVD  213

Query  347  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  469
            A  +  LA  Y I+GFPTIK+F  G+ PVDY G R    +V
Sbjct  214  ATGNQLLASRYEIRGFPTIKIFQKGESPVDYDGGRTRSDIV  254



>ref|XP_007933283.1| PREDICTED: protein disulfide-isomerase A6 [Orycteropus afer afer]
Length=440

 Score =   164 bits (414),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 87/177 (49%), Positives = 120/177 (68%), Gaps = 7/177 (4%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            + LY  S  V++L PSNF  +V+ S+ + LVEF+APWCGHC+ LTP ++KVA+ LKG+  
Sbjct  18   SGLYSSSDDVIELTPSNFNREVIQSDSLWLVEFYAPWCGHCQKLTPEWKKVATALKGIVR  77

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  508
            V A+DAD H SL  +YG++GFPTIK+F   K +P DYQG R A+++VD   +  R ++KD
Sbjct  78   VGAVDADKHQSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTAEAIVDAAVSAARQIVKD  137

Query  509  RLDGKATG------GSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            RL G++ G      G S  S     +EL    FD  V+ S+D+W+VEF+APWCGHCK
Sbjct  138  RLGGRSGGYSSGKQGRSDSSSKKDVIELTDDTFDKNVLDSEDVWMVEFYAPWCGHCK  194


 Score = 88.2 bits (217),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 64/101 (63%), Gaps = 4/101 (4%)
 Frame = +2

Query  179  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  346
            V++L    F   VL+S  V +VEF+APWCGHCK L P +   A+ +    KG   +AA+D
Sbjct  162  VIELTDDTFDKNVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAATEVKEQTKGKVKLAAVD  221

Query  347  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  469
            A A+  LA  YGI+GFPTIK+F  G+ PVDY G R   ++V
Sbjct  222  ATANQMLASRYGIRGFPTIKIFQKGESPVDYDGGRSKSNIV  262



>ref|XP_004401842.1| PREDICTED: protein disulfide-isomerase A6 [Odobenus rosmarus 
divergens]
Length=440

 Score =   164 bits (414),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 89/177 (50%), Positives = 119/177 (67%), Gaps = 7/177 (4%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            N LY  S  V++L+PSNF  +V+ S  + LVEF+APWCGHC+ LTP ++KVA+ LK V  
Sbjct  18   NGLYSSSDDVIELSPSNFNREVIQSASLWLVEFYAPWCGHCQRLTPEWKKVATALKDVVK  77

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  508
            V A+DAD H SL  +YG++GFPTIK+F   K +P DYQG R  +++VD   + +R L+KD
Sbjct  78   VGAVDADKHQSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTGEAIVDAALSALRQLVKD  137

Query  509  RLDGKATG------GSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            RL GK  G      G S+ S     +EL   +FD  V+ S D+W+VEF+APWCGHCK
Sbjct  138  RLGGKGGGYSSGKQGRSESSSKKDVIELTDDSFDKNVLDSDDVWMVEFYAPWCGHCK  194


 Score = 85.5 bits (210),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 46/101 (46%), Positives = 63/101 (62%), Gaps = 4/101 (4%)
 Frame = +2

Query  179  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  346
            V++L   +F   VL+S+ V +VEF+APWCGHCK L P +   A+ +    KG   +AA+D
Sbjct  162  VIELTDDSFDKNVLDSDDVWMVEFYAPWCGHCKNLEPEWAAAATEVKDQTKGKVKLAAVD  221

Query  347  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  469
            A  +  LA  Y I+GFPTIK+F  G+ PVDY G R    +V
Sbjct  222  ATVNQLLASRYEIRGFPTIKIFQKGESPVDYDGGRTRSDIV  262



>ref|XP_011343321.1| PREDICTED: protein disulfide-isomerase A6 isoform X2 [Cerapachys 
biroi]
 gb|EZA51474.1| Protein disulfide-isomerase A6 [Cerapachys biroi]
Length=412

 Score =   163 bits (413),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 77/168 (46%), Positives = 111/168 (66%), Gaps = 0/168 (0%)
 Frame = +2

Query  158  LYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVa  337
            +Y  ++ V+ L P+NF + VLNS+ + +VEF+APWCGHC+ L P Y+K A+ LKG+  V 
Sbjct  1    MYASNSAVVDLRPNNFDNLVLNSDHIWVVEFYAPWCGHCQQLMPEYDKAATALKGIIKVG  60

Query  338  aldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDRLD  517
            A++AD H SL  +YG++GFPTIK+F    +P DY G R A  +++          +  L 
Sbjct  61   AVNADEHKSLGSKYGVRGFPTIKIFGLDSKPEDYNGPRTASGIIEAALNAAGQKARKALG  120

Query  518  GKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            GK TGG S+  +    +EL   NF+ LV+ S+D+W+VEF+APWCGHCK
Sbjct  121  GKKTGGDSKSKDSKDVIELTDENFEKLVLNSEDMWLVEFYAPWCGHCK  168


 Score = 90.1 bits (222),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 49/107 (46%), Positives = 66/107 (62%), Gaps = 4/107 (4%)
 Frame = +2

Query  170  STPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaalda  349
            S  V++L   NF+  VLNS  + LVEF+APWCGHCK L P +   A+ LKG   + ALDA
Sbjct  133  SKDVIELTDENFEKLVLNSEDMWLVEFYAPWCGHCKNLAPEWAAAATELKGKVKLGALDA  192

Query  350  dahsslaQEYGIKGFPTIKVFVPGKQPVD----YQGAREAKSMVDFV  478
              ++  A +Y IKG+PTIK F PGK+  D    Y G R +  +V++ 
Sbjct  193  TVNTVKASKYEIKGYPTIKYFTPGKKDADSVQEYDGGRTSGDIVNWA  239



>ref|NP_001007974.1| protein disulfide-isomerase A6 precursor [Xenopus (Silurana) 
tropicalis]
 gb|AAH80483.1| protein disulfide isomerase family A, member 6 [Xenopus (Silurana) 
tropicalis]
Length=441

 Score =   164 bits (414),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 84/182 (46%), Positives = 119/182 (65%), Gaps = 16/182 (9%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            +A+Y PS  V++L PSNF  +V+ S+ + LVEF+APWCGHC+ LTP ++K A+ LKGV  
Sbjct  18   SAMYSPSDDVIELTPSNFNKEVIQSDSLWLVEFYAPWCGHCQRLTPDWKKAATALKGVVK  77

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  508
            + A++AD H SL  +YG++GFPTIKVF   K +P DYQG R A +++D   + +R+ +KD
Sbjct  78   IGAVNADQHQSLGGQYGVRGFPTIKVFGANKNKPDDYQGGRTADAIIDAALSSLRSFVKD  137

Query  509  RL-----------DGKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGH  655
            RL              ++GG S+K      ++L    FD  V+ S D+W VEF+APWCGH
Sbjct  138  RLGGRSGGSDSGRQSYSSGGGSKKD----VIDLTDDTFDKNVLNSDDVWFVEFYAPWCGH  193

Query  656  CK  661
            CK
Sbjct  194  CK  195


 Score = 89.0 bits (219),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 49/106 (46%), Positives = 61/106 (58%), Gaps = 4/106 (4%)
 Frame = +2

Query  164  GPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLK----GVAT  331
            G    V+ L    F   VLNS+ V  VEF+APWCGHCK L P +   A+ +K    G   
Sbjct  158  GSKKDVIDLTDDTFDKNVLNSDDVWFVEFYAPWCGHCKNLEPEWAAAATEIKQQTNGKVK  217

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  469
            +AA+DA     LA  YGI+GFPTIK+F  G+ PVDY G R    +V
Sbjct  218  LAAVDATVSQVLASRYGIRGFPTIKIFQKGEDPVDYDGGRTKPDIV  263



>ref|NP_001193274.1| protein disulfide-isomerase A6 precursor [Bos taurus]
 ref|XP_005892611.1| PREDICTED: protein disulfide-isomerase A6 [Bos mutus]
Length=440

 Score =   163 bits (413),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 87/177 (49%), Positives = 118/177 (67%), Gaps = 7/177 (4%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            N LY  S  V++L PSNF  +V+ S+ + LVEF+APWCGHC+ LTP ++K A+ LK V  
Sbjct  18   NGLYSSSDDVIELTPSNFNREVIQSDSLWLVEFYAPWCGHCQRLTPEWKKAATALKDVVK  77

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  508
            V A+DAD H SL  +YG++GFPTIK+F   K +P DYQG R  +++VD   + +R L+KD
Sbjct  78   VGAVDADKHQSLGGQYGVQGFPTIKIFGSNKNKPEDYQGGRTGEAIVDAALSALRQLVKD  137

Query  509  RLDGKATG------GSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            RL G+ +G      G    S     +EL   NFD  V+ S+D+W+VEF+APWCGHCK
Sbjct  138  RLGGRGSGYSSGKQGRGDSSSKKDVIELTDDNFDKNVLDSEDVWMVEFYAPWCGHCK  194


 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 63/101 (62%), Gaps = 4/101 (4%)
 Frame = +2

Query  179  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  346
            V++L   NF   VL+S  V +VEF+APWCGHCK L P +   A+ +    KG   +AA+D
Sbjct  162  VIELTDDNFDKNVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAATEVKEQTKGKVKLAAVD  221

Query  347  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  469
            A  +  LA  YGI+GFPTIK+F  G+ PVDY G R    +V
Sbjct  222  ATVNQVLASRYGIRGFPTIKIFQKGESPVDYDGGRTRSDIV  262



>ref|XP_004005735.1| PREDICTED: protein disulfide-isomerase A6 isoform 2 [Ovis aries]
Length=432

 Score =   163 bits (413),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 87/177 (49%), Positives = 118/177 (67%), Gaps = 7/177 (4%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            N LY  S  V++L PSNF  +V+ S+ + LVEF+APWCGHC+ LTP ++K A+ LK V  
Sbjct  10   NGLYSSSDDVIELTPSNFNREVIQSDSLWLVEFYAPWCGHCQRLTPEWKKAATALKDVVK  69

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  508
            V A+DAD H SL  +YG++GFPTIK+F   K +P DYQG R  +++VD   + +R L+KD
Sbjct  70   VGAVDADKHQSLGGQYGVQGFPTIKIFGSNKNKPEDYQGGRTGEAIVDAALSALRQLVKD  129

Query  509  RLDGKATG------GSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            RL G+ +G      G    S     +EL   NFD  V+ S+D+W+VEF+APWCGHCK
Sbjct  130  RLGGRGSGYSSGKQGRGDSSSKKDVIELTDDNFDKNVLDSEDVWMVEFYAPWCGHCK  186


 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 63/101 (62%), Gaps = 4/101 (4%)
 Frame = +2

Query  179  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  346
            V++L   NF   VL+S  V +VEF+APWCGHCK L P +   A+ +    KG   +AA+D
Sbjct  154  VIELTDDNFDKNVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAATEVKEQTKGKVKLAAVD  213

Query  347  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  469
            A  +  LA  YGI+GFPTIK+F  G+ PVDY G R    +V
Sbjct  214  ATVNQVLASRYGIRGFPTIKIFQKGESPVDYDGGRTRSDIV  254



>gb|AAI48887.1| PDIA6 protein [Bos taurus]
Length=453

 Score =   164 bits (414),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 87/177 (49%), Positives = 118/177 (67%), Gaps = 7/177 (4%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            N LY  S  V++L PSNF  +V+ S+ + LVEF+APWCGHC+ LTP ++K A+ LK V  
Sbjct  31   NGLYSSSDDVIELTPSNFNREVIQSDSLWLVEFYAPWCGHCQRLTPEWKKAATALKDVVK  90

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  508
            V A+DAD H SL  +YG++GFPTIK+F   K +P DYQG R  +++VD   + +R L+KD
Sbjct  91   VGAVDADKHQSLGGQYGVQGFPTIKIFGSNKNKPEDYQGGRTGEAIVDAALSALRQLVKD  150

Query  509  RLDGKATG------GSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            RL G+ +G      G    S     +EL   NFD  V+ S+D+W+VEF+APWCGHCK
Sbjct  151  RLGGRGSGYSSGKQGRGDSSSKKDVIELTDDNFDKNVLDSEDVWMVEFYAPWCGHCK  207


 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 63/101 (62%), Gaps = 4/101 (4%)
 Frame = +2

Query  179  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  346
            V++L   NF   VL+S  V +VEF+APWCGHCK L P +   A+ +    KG   +AA+D
Sbjct  175  VIELTDDNFDKNVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAATEVKEQTKGKVKLAAVD  234

Query  347  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  469
            A  +  LA  YGI+GFPTIK+F  G+ PVDY G R    +V
Sbjct  235  ATVNQVLASRYGIRGFPTIKIFQKGESPVDYDGGRTRSDIV  275



>gb|ABC75564.1| protein disulfide isomerase-related protein P5 precursor [Ictalurus 
punctatus]
Length=307

 Score =   160 bits (406),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 87/175 (50%), Positives = 118/175 (67%), Gaps = 13/175 (7%)
 Frame = +2

Query  170  STPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaalda  349
            S  V++LNPSNF  +V+ S+ + LVEF+APWCGHC++L P ++K A+ LKGV  V A+DA
Sbjct  3    SDDVVELNPSNFNREVVQSDSLWLVEFYAPWCGHCQSLVPEWKKAATALKGVVKVGAVDA  62

Query  350  dahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKDRLDGKA  526
            D H SL  +YG++GFPTIK+F   K +P DYQG R ++++V+      R+L+KDRL GK+
Sbjct  63   DQHKSLGGQYGVRGFPTIKIFGANKHKPEDYQGGRSSQAIVEAALTAARSLVKDRLSGKS  122

Query  527  TGGSSQKSEPSAS----------VELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
              GSS  S  S+           VEL   NFD +V+    +W+VEFFAPWCGHCK
Sbjct  123  --GSSDYSRQSSGGSSGGSKKDVVELTDDNFDRMVLDGDAVWMVEFFAPWCGHCK  175


 Score = 90.9 bits (224),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 49/101 (49%), Positives = 63/101 (62%), Gaps = 4/101 (4%)
 Frame = +2

Query  179  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLK----GVATVaald  346
            V++L   NF   VL+ + V +VEFFAPWCGHCK L P +   AS +K    G   + A+D
Sbjct  143  VVELTDDNFDRMVLDGDAVWMVEFFAPWCGHCKNLEPEWTAAASQVKEQTGGRVKLGAVD  202

Query  347  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  469
            A  H  LA  YGIKGFPTIK+F  G++P DYQG R    ++
Sbjct  203  ATVHQGLASRYGIKGFPTIKIFRKGEEPEDYQGGRTRSDII  243



>emb|CDQ71639.1| unnamed protein product [Oncorhynchus mykiss]
Length=448

 Score =   164 bits (414),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 83/177 (47%), Positives = 116/177 (66%), Gaps = 8/177 (5%)
 Frame = +2

Query  155  ALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATV  334
              Y  S  V++LNPSNF  +VL S+ + L+EF+APWCGHC++LT  ++K A+ LKG+  V
Sbjct  25   GFYSASDDVVELNPSNFNREVLQSDSLWLIEFYAPWCGHCQSLTADWKKTATALKGIVKV  84

Query  335  aaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKDR  511
             A+DAD H+SL  +Y +KGFPTIK+F   K +P DYQG R ++++VD     +  L+KDR
Sbjct  85   GAVDADQHNSLGGQYSVKGFPTIKIFGANKNKPDDYQGGRNSQAIVDGALNALHTLVKDR  144

Query  512  LDGKATGGSSQKSEPSAS-------VELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            + G++ G    +             VEL   NFD LV+ S ++W+VEFFAPWCGHCK
Sbjct  145  MSGRSGGSDYSRQSGGGGGGSKKDVVELTDDNFDRLVLNSGEVWLVEFFAPWCGHCK  201


 Score = 90.5 bits (223),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 45/101 (45%), Positives = 59/101 (58%), Gaps = 4/101 (4%)
 Frame = +2

Query  179  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaaldadah  358
            V++L   NF   VLNS  V LVEFFAPWCGHCK+L P +   AS +K             
Sbjct  169  VVELTDDNFDRLVLNSGEVWLVEFFAPWCGHCKSLEPEWAAAASAVKEQTKDKVHLGAVD  228

Query  359  sslaQ----EYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  469
            +++ Q     YGI+GFPTIK+F  G++P DYQG R    ++
Sbjct  229  ATVHQGLASRYGIRGFPTIKIFKKGEEPEDYQGGRTRGDII  269



>gb|ACI33422.1| disulfide-isomerase A6 precursor [Salmo salar]
 gb|ACN10934.1| disulfide-isomerase A6 precursor [Salmo salar]
Length=443

 Score =   164 bits (414),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 82/179 (46%), Positives = 116/179 (65%), Gaps = 10/179 (6%)
 Frame = +2

Query  155  ALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATV  334
              Y  S  V++LNPSNF  +VL S+ + L+EF+APWCGHC++LT  ++K A+ LKG+  V
Sbjct  18   GFYSASDDVVELNPSNFNQEVLQSDSLWLIEFYAPWCGHCQSLTADWKKTATALKGIVKV  77

Query  335  aaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKDR  511
             A+DAD H SL  +Y ++GFPTIK+F   K +P DYQG R ++++VD     ++ L+KDR
Sbjct  78   GAVDADQHKSLGGQYSVRGFPTIKIFGANKNKPDDYQGGRSSQAIVDGALNALQTLVKDR  137

Query  512  LDGKATGGSSQKSEPSAS---------VELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            + G++ G    +               VEL   NFD LV+ S ++W+VEFFAPWCGHCK
Sbjct  138  MSGRSGGSDYSRQSGGGGGGGGSKKDVVELTDDNFDRLVLNSDEVWLVEFFAPWCGHCK  196


 Score = 92.0 bits (227),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 45/101 (45%), Positives = 60/101 (59%), Gaps = 4/101 (4%)
 Frame = +2

Query  179  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaaldadah  358
            V++L   NF   VLNS+ V LVEFFAPWCGHCK+L P +   AS +K             
Sbjct  164  VVELTDDNFDRLVLNSDEVWLVEFFAPWCGHCKSLEPEWAAAASAVKEQTKDKVHLGAVD  223

Query  359  sslaQ----EYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  469
            +++ Q     YGI+GFPTIK+F  G++P DYQG R    ++
Sbjct  224  ATVHQGLASRYGIRGFPTIKIFKKGEEPEDYQGGRTRGDII  264



>emb|CAG03659.1| unnamed protein product [Tetraodon nigroviridis]
Length=440

 Score =   163 bits (413),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 87/181 (48%), Positives = 122/181 (67%), Gaps = 16/181 (9%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
             ALY     V++LNPSNF  +V+ S+ + LVEF+APWCGHC+ L P ++K A+ LKGV  
Sbjct  18   QALYSSDDDVVELNPSNFNREVIQSDSLWLVEFYAPWCGHCRNLVPDWKKAATALKGVVK  77

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  508
            V A+DAD H SL  +YG++GFPTIKVF   K +P +YQG R ++++VD   + +R+L+K+
Sbjct  78   VGAVDADQHKSLGGQYGVRGFPTIKVFGANKNKPEEYQGGRSSQAIVDGALSALRSLVKE  137

Query  509  RLDG----------KATGGSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHC  658
            RL G          ++TGGS +       VEL   NFD +V++  ++W+VEFFAPWCGHC
Sbjct  138  RLSGGSSGSGYNKQQSTGGSKKD-----VVELTDDNFDQMVLEGDEVWMVEFFAPWCGHC  192

Query  659  K  661
            K
Sbjct  193  K  193


 Score = 89.4 bits (220),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 46/107 (43%), Positives = 64/107 (60%), Gaps = 4/107 (4%)
 Frame = +2

Query  164  GPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVAT  331
            G    V++L   NF   VL  + V +VEFFAPWCGHCK L P +   A+ +    KG   
Sbjct  156  GSKKDVVELTDDNFDQMVLEGDEVWMVEFFAPWCGHCKNLEPEWAAAATAVKEQTKGKVR  215

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVD  472
            + A+DA  H  ++  YGI+GFPTIK+F  G++P DYQG R    +++
Sbjct  216  LGAVDATVHQGVSGRYGIRGFPTIKIFRKGEEPEDYQGGRTRADIIE  262



>ref|XP_011343320.1| PREDICTED: protein disulfide-isomerase A6 isoform X1 [Cerapachys 
biroi]
Length=439

 Score =   163 bits (413),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 77/168 (46%), Positives = 111/168 (66%), Gaps = 0/168 (0%)
 Frame = +2

Query  158  LYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVa  337
            +Y  ++ V+ L P+NF + VLNS+ + +VEF+APWCGHC+ L P Y+K A+ LKG+  V 
Sbjct  28   MYASNSAVVDLRPNNFDNLVLNSDHIWVVEFYAPWCGHCQQLMPEYDKAATALKGIIKVG  87

Query  338  aldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVDFVKAQIRNLLKDRLD  517
            A++AD H SL  +YG++GFPTIK+F    +P DY G R A  +++          +  L 
Sbjct  88   AVNADEHKSLGSKYGVRGFPTIKIFGLDSKPEDYNGPRTASGIIEAALNAAGQKARKALG  147

Query  518  GKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            GK TGG S+  +    +EL   NF+ LV+ S+D+W+VEF+APWCGHCK
Sbjct  148  GKKTGGDSKSKDSKDVIELTDENFEKLVLNSEDMWLVEFYAPWCGHCK  195


 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 49/107 (46%), Positives = 66/107 (62%), Gaps = 4/107 (4%)
 Frame = +2

Query  170  STPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaalda  349
            S  V++L   NF+  VLNS  + LVEF+APWCGHCK L P +   A+ LKG   + ALDA
Sbjct  160  SKDVIELTDENFEKLVLNSEDMWLVEFYAPWCGHCKNLAPEWAAAATELKGKVKLGALDA  219

Query  350  dahsslaQEYGIKGFPTIKVFVPGKQPVD----YQGAREAKSMVDFV  478
              ++  A +Y IKG+PTIK F PGK+  D    Y G R +  +V++ 
Sbjct  220  TVNTVKASKYEIKGYPTIKYFTPGKKDADSVQEYDGGRTSGDIVNWA  266


 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 24/45 (53%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +2

Query  527  TGGSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            TG S   +  SA V+L   NFD+LV+ S  +W+VEF+APWCGHC+
Sbjct  23   TGASCMYASNSAVVDLRPNNFDNLVLNSDHIWVVEFYAPWCGHCQ  67



>gb|ERE68285.1| protein disulfide-isomerase A6-like protein [Cricetulus griseus]
Length=285

 Score =   160 bits (404),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 87/180 (48%), Positives = 117/180 (65%), Gaps = 13/180 (7%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            + LY  S  V++L PSNF  +V+ SN + LVEF+APWCGHC+ LTP ++K A+ LK V  
Sbjct  16   SGLYSSSDDVIELTPSNFNREVIQSNSLWLVEFYAPWCGHCQRLTPEWKKAATALKDVVK  75

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  508
            V A+DAD H SL  +YG++GFPTIK+F   K +P DYQG R  +++VD   + +R L+KD
Sbjct  76   VGAVDADKHQSLGGQYGVQGFPTIKIFGANKNKPEDYQGGRTGEAIVDAALSALRQLVKD  135

Query  509  RLDG---------KATGGSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            RL G         +  G SS K +    +EL    FD  V+ S D+W+VEF+APWCGHCK
Sbjct  136  RLSGRSGGYSSGKQGRGDSSSKKD---VIELTDDTFDKNVLDSDDVWMVEFYAPWCGHCK  192


 Score = 87.8 bits (216),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 47/101 (47%), Positives = 63/101 (62%), Gaps = 4/101 (4%)
 Frame = +2

Query  179  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  346
            V++L    F   VL+S+ V +VEF+APWCGHCK L P +   A+ +    KG   +AA+D
Sbjct  160  VIELTDDTFDKNVLDSDDVWMVEFYAPWCGHCKNLEPEWATAATEVKEQTKGKVKLAAVD  219

Query  347  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  469
            A  +  LA  YGI+GFPTIK+F  G+ PVDY G R    +V
Sbjct  220  ATVNQVLANRYGIRGFPTIKIFQKGEAPVDYDGGRTRSDIV  260



>ref|XP_011363442.1| PREDICTED: protein disulfide-isomerase A6 [Pteropus vampyrus]
Length=650

 Score =   166 bits (419),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 89/177 (50%), Positives = 120/177 (68%), Gaps = 7/177 (4%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            N LY  S  V++L PSNF  +V+ S  + LVEF+APWCGHC+ LTP ++KVA+ LK V  
Sbjct  228  NGLYSSSDDVIELTPSNFNQEVIQSGSLWLVEFYAPWCGHCQRLTPEWKKVATALKDVVK  287

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  508
            V A+DAD H SL  +YG++GFPTIK+F   K +P DYQGAR ++++VD   + +R L+KD
Sbjct  288  VGAVDADKHQSLGGQYGVQGFPTIKIFGSNKNKPEDYQGARTSEAIVDAALSAVRQLVKD  347

Query  509  RLDGKATG------GSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            RL G+  G      G S+ S     +EL   +FD  V+ S D+W+VEF+APWCGHCK
Sbjct  348  RLAGRGGGYSSGRQGRSESSSKKDVIELTDDSFDKNVLDSDDVWMVEFYAPWCGHCK  404


 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 47/101 (47%), Positives = 65/101 (64%), Gaps = 4/101 (4%)
 Frame = +2

Query  179  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  346
            V++L   +F   VL+S+ V +VEF+APWCGHCK L P +   A+ +    KG   +AA+D
Sbjct  372  VIELTDDSFDKNVLDSDDVWMVEFYAPWCGHCKNLEPEWAAAATEVKEQTKGKVKLAAVD  431

Query  347  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  469
            A A+  L+  YGI+GFPTIK+F  G+ PVDY G R    +V
Sbjct  432  ATANQVLSSRYGIRGFPTIKIFQKGESPVDYDGGRTRSDIV  472



>ref|XP_008311310.1| PREDICTED: protein disulfide-isomerase A6 [Cynoglossus semilaevis]
Length=438

 Score =   163 bits (413),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 89/173 (51%), Positives = 124/173 (72%), Gaps = 4/173 (2%)
 Frame = +2

Query  155  ALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATV  334
            ALY PS  V++L  SNF  +V+ S+ + LVEF+APWCGHC+ L P ++K A+ LKG+  V
Sbjct  19   ALYSPSDDVVELTSSNFNREVIQSDSLWLVEFYAPWCGHCRNLAPDWKKAATALKGIVKV  78

Query  335  aaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKDR  511
             A+DAD H+SL  +YG++GFPTIK+F   K +P +YQG R ++++VD     +RNL+K+R
Sbjct  79   GAVDADQHNSLGGQYGVRGFPTIKIFGANKNKPEEYQGGRSSQAIVDGAMNALRNLVKER  138

Query  512  LDGKATGGSSQKSEPSAS---VELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            L GK+ G   Q+S   +S   VEL   NFD +V++S D+W+VEFFAPWCGHCK
Sbjct  139  LSGKSGGSGGQQSSGGSSKDVVELTDDNFDKMVMESDDIWLVEFFAPWCGHCK  191


 Score = 89.0 bits (219),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 44/102 (43%), Positives = 65/102 (64%), Gaps = 4/102 (4%)
 Frame = +2

Query  179  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  346
            V++L   NF   V+ S+ + LVEFFAPWCGHCK L P +   A+ +    KG   + A+D
Sbjct  159  VVELTDDNFDKMVMESDDIWLVEFFAPWCGHCKKLEPEWAAAATAVKEQTKGRVRLGAVD  218

Query  347  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVD  472
            A  H +++  YGI+G+P+IKVF  G++P DYQG R    +++
Sbjct  219  ATVHQAVSSRYGIRGYPSIKVFRKGEEPEDYQGGRTRNDIIE  260



>ref|XP_010304195.1| PREDICTED: protein disulfide-isomerase A6 [Balearica regulorum 
gibbericeps]
Length=444

 Score =   163 bits (413),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 85/182 (47%), Positives = 117/182 (64%), Gaps = 16/182 (9%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            N LY  S  V++L P+NF  +V+ S  + LVEF+APWCGHC+ LTP ++K A+ LKGV  
Sbjct  21   NGLYSASDDVIELTPTNFNKEVIQSESLWLVEFYAPWCGHCQRLTPEWKKAATALKGVVK  80

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPV-DYQGAREAKSMVDFVKAQIRNLLKD  508
            V A+DAD H SL  +YG++GFPTIK+F   K    DYQG R + ++VD   + +R+L+KD
Sbjct  81   VGAVDADKHQSLGGQYGVRGFPTIKIFGANKNKAEDYQGGRTSDAIVDAALSALRSLVKD  140

Query  509  RL-----------DGKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGH  655
            RL            G+ +GG  +K      +EL   +FD  V+ S D+W+VEF+APWCGH
Sbjct  141  RLSGRSGGYSSGKQGRESGGGDKKD----VIELTDDSFDKNVINSDDVWMVEFYAPWCGH  196

Query  656  CK  661
            CK
Sbjct  197  CK  198


 Score = 89.4 bits (220),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 47/106 (44%), Positives = 66/106 (62%), Gaps = 4/106 (4%)
 Frame = +2

Query  164  GPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVAT  331
            G    V++L   +F   V+NS+ V +VEF+APWCGHCK L P +   A+ +    KG   
Sbjct  161  GDKKDVIELTDDSFDKNVINSDDVWMVEFYAPWCGHCKNLEPEWAAAATEVKEQTKGKVK  220

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  469
            +AA+DA  +  LA  YGI+GFPTIK+F  G+ PVDY G+R    ++
Sbjct  221  LAAVDATVNQMLAGRYGIRGFPTIKIFQKGEDPVDYDGSRTRSDII  266



>ref|XP_006138598.1| PREDICTED: protein disulfide-isomerase A6 [Pelodiscus sinensis]
Length=428

 Score =   163 bits (412),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 84/182 (46%), Positives = 122/182 (67%), Gaps = 17/182 (9%)
 Frame = +2

Query  155  ALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATV  334
            +LY  S  V++L P+NF  +V+ S+ + LVEF+APWCGHC+ LTP ++K A+ LKG+  V
Sbjct  5    SLYSSSDDVIELTPTNFNKEVIQSDSLWLVEFYAPWCGHCQRLTPEWKKAATALKGIVKV  64

Query  335  aaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKDR  511
             A+DAD H SL  +YG++GFP+IK+F   K +P DYQG R ++++VD   + +R+L+KDR
Sbjct  65   GAVDADKHQSLGGQYGVRGFPSIKIFGSNKNKPEDYQGGRTSEAIVDAALSSLRSLVKDR  124

Query  512  L------------DGKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGH  655
            L              + +GGS +K+     +EL   +FD  VV S D+W+VEF+APWCGH
Sbjct  125  LSGRSGGHSSGKQSSRESGGSDKKN----VIELTDDSFDKNVVNSDDVWLVEFYAPWCGH  180

Query  656  CK  661
            CK
Sbjct  181  CK  182


 Score = 89.0 bits (219),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 63/101 (62%), Gaps = 4/101 (4%)
 Frame = +2

Query  179  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYE----KVASVLKGVATVaald  346
            V++L   +F   V+NS+ V LVEF+APWCGHCK L P +     +V    KG   +AA+D
Sbjct  150  VIELTDDSFDKNVVNSDDVWLVEFYAPWCGHCKNLEPEWAAAAIEVEEQTKGKVKLAAVD  209

Query  347  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  469
            A  +  LA  YGI+GFPTIK+F  G+ PVDY G R    +V
Sbjct  210  ATVNQMLASRYGIRGFPTIKIFQKGEDPVDYDGGRTKSDIV  250



>gb|ELR58675.1| Protein disulfide-isomerase A6, partial [Bos mutus]
Length=444

 Score =   163 bits (413),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 87/177 (49%), Positives = 118/177 (67%), Gaps = 7/177 (4%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            N LY  S  V++L PSNF  +V+ S+ + LVEF+APWCGHC+ LTP ++K A+ LK V  
Sbjct  22   NGLYSSSDDVIELTPSNFNREVIQSDSLWLVEFYAPWCGHCQRLTPEWKKAATALKDVVK  81

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  508
            V A+DAD H SL  +YG++GFPTIK+F   K +P DYQG R  +++VD   + +R L+KD
Sbjct  82   VGAVDADKHQSLGGQYGVQGFPTIKIFGSNKNKPEDYQGGRTGEAIVDAALSALRQLVKD  141

Query  509  RLDGKATG------GSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            RL G+ +G      G    S     +EL   NFD  V+ S+D+W+VEF+APWCGHCK
Sbjct  142  RLGGRGSGYSSGKQGRGDSSSKKDVIELTDDNFDKNVLDSEDVWMVEFYAPWCGHCK  198


 Score = 89.7 bits (221),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 63/101 (62%), Gaps = 4/101 (4%)
 Frame = +2

Query  179  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  346
            V++L   NF   VL+S  V +VEF+APWCGHCK L P +   A+ +    KG   +AA+D
Sbjct  166  VIELTDDNFDKNVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAATEVKEQTKGKVKLAAVD  225

Query  347  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  469
            A  +  LA  YGI+GFPTIK+F  G+ PVDY G R    +V
Sbjct  226  ATVNQVLASRYGIRGFPTIKIFQKGESPVDYDGGRTRSDIV  266



>ref|XP_004005734.1| PREDICTED: protein disulfide-isomerase A6 isoform 1 [Ovis aries]
Length=440

 Score =   163 bits (413),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 87/177 (49%), Positives = 118/177 (67%), Gaps = 7/177 (4%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            N LY  S  V++L PSNF  +V+ S+ + LVEF+APWCGHC+ LTP ++K A+ LK V  
Sbjct  18   NGLYSSSDDVIELTPSNFNREVIQSDSLWLVEFYAPWCGHCQRLTPEWKKAATALKDVVK  77

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  508
            V A+DAD H SL  +YG++GFPTIK+F   K +P DYQG R  +++VD   + +R L+KD
Sbjct  78   VGAVDADKHQSLGGQYGVQGFPTIKIFGSNKNKPEDYQGGRTGEAIVDAALSALRQLVKD  137

Query  509  RLDGKATG------GSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            RL G+ +G      G    S     +EL   NFD  V+ S+D+W+VEF+APWCGHCK
Sbjct  138  RLGGRGSGYSSGKQGRGDSSSKKDVIELTDDNFDKNVLDSEDVWMVEFYAPWCGHCK  194


 Score = 89.7 bits (221),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 63/101 (62%), Gaps = 4/101 (4%)
 Frame = +2

Query  179  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  346
            V++L   NF   VL+S  V +VEF+APWCGHCK L P +   A+ +    KG   +AA+D
Sbjct  162  VIELTDDNFDKNVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAATEVKEQTKGKVKLAAVD  221

Query  347  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  469
            A  +  LA  YGI+GFPTIK+F  G+ PVDY G R    +V
Sbjct  222  ATVNQVLASRYGIRGFPTIKIFQKGESPVDYDGGRTRSDIV  262



>gb|KFO12540.1| Protein disulfide-isomerase A6, partial [Balearica regulorum 
gibbericeps]
Length=440

 Score =   163 bits (412),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 85/182 (47%), Positives = 117/182 (64%), Gaps = 16/182 (9%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            N LY  S  V++L P+NF  +V+ S  + LVEF+APWCGHC+ LTP ++K A+ LKGV  
Sbjct  17   NGLYSASDDVIELTPTNFNKEVIQSESLWLVEFYAPWCGHCQRLTPEWKKAATALKGVVK  76

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPV-DYQGAREAKSMVDFVKAQIRNLLKD  508
            V A+DAD H SL  +YG++GFPTIK+F   K    DYQG R + ++VD   + +R+L+KD
Sbjct  77   VGAVDADKHQSLGGQYGVRGFPTIKIFGANKNKAEDYQGGRTSDAIVDAALSALRSLVKD  136

Query  509  RL-----------DGKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGH  655
            RL            G+ +GG  +K      +EL   +FD  V+ S D+W+VEF+APWCGH
Sbjct  137  RLSGRSGGYSSGKQGRESGGGDKKD----VIELTDDSFDKNVINSDDVWMVEFYAPWCGH  192

Query  656  CK  661
            CK
Sbjct  193  CK  194


 Score = 89.4 bits (220),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 47/106 (44%), Positives = 66/106 (62%), Gaps = 4/106 (4%)
 Frame = +2

Query  164  GPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVAT  331
            G    V++L   +F   V+NS+ V +VEF+APWCGHCK L P +   A+ +    KG   
Sbjct  157  GDKKDVIELTDDSFDKNVINSDDVWMVEFYAPWCGHCKNLEPEWAAAATEVKEQTKGKVK  216

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  469
            +AA+DA  +  LA  YGI+GFPTIK+F  G+ PVDY G+R    ++
Sbjct  217  LAAVDATVNQMLAGRYGIRGFPTIKIFQKGEDPVDYDGSRTRSDII  262



>gb|KFD51103.1| hypothetical protein M513_08003 [Trichuris suis]
 gb|KFD63072.1| hypothetical protein M514_08003 [Trichuris suis]
Length=461

 Score =   163 bits (413),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 76/175 (43%), Positives = 115/175 (66%), Gaps = 5/175 (3%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            + LY  +  V++L  SNF+SKV++S+ V +VEF+APWCGHC+   P + K A  LKG+  
Sbjct  45   STLYSGNNDVVELTASNFQSKVIDSDAVWIVEFYAPWCGHCQNFAPEFAKAAKALKGIVK  104

Query  332  VaaldadahsslaQEYGIKGFPTIKVF-VPGKQPVDYQGAREAKSMVDFVKAQIRNLLKD  508
            V  +D D H S+   Y ++GFPT+K+F +   +P D+QG R A+++ D    +++ L++ 
Sbjct  105  VGGVDMDKHGSVGGPYNVQGFPTVKIFGIDKNKPTDFQGGRTAQALADAAINEVKRLVQM  164

Query  509  RLDGKATGGSSQKSEPSAS----VELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            RL G+  G  S+KS  + S    +EL   NF+D++  S D+W+VEFFAPWCGHCK
Sbjct  165  RLTGRRPGADSKKSSSTGSAKDVIELTDSNFEDMITNSDDMWLVEFFAPWCGHCK  219


 Score = 95.1 bits (235),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 50/113 (44%), Positives = 74/113 (65%), Gaps = 4/113 (4%)
 Frame = +2

Query  164  GPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaal  343
            G +  V++L  SNF+  + NS+ + LVEFFAPWCGHCK L P ++  A+ LKG   VAA+
Sbjct  182  GSAKDVIELTDSNFEDMITNSDDMWLVEFFAPWCGHCKNLAPHWQSAATQLKGRVKVAAI  241

Query  344  dadahsslaQEYGIKGFPTIKVFVPGKQPVD----YQGAREAKSMVDFVKAQI  490
            DA  ++ +AQ +GI+GFPTIK+F  G + +D    Y G R A  +V + + ++
Sbjct  242  DATVNTVMAQRFGIQGFPTIKMFPSGAKSLDDAVEYTGGRSASDIVQWAEEKL  294



>gb|KFV46902.1| Protein disulfide-isomerase A6, partial [Tyto alba]
Length=440

 Score =   163 bits (412),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 85/182 (47%), Positives = 117/182 (64%), Gaps = 16/182 (9%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            N+LY  S  V++L P+NF  +V+ S  + LVEF+APWCGHC+ LTP ++K A+ LKGV  
Sbjct  17   NSLYSSSDDVIELTPTNFNKEVIQSESLWLVEFYAPWCGHCQRLTPEWKKAATALKGVVK  76

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPV-DYQGAREAKSMVDFVKAQIRNLLKD  508
            V A+DAD H SL  +YG++GFPTIK+F   K    DYQG R + ++VD   + +R+L+KD
Sbjct  77   VGAVDADKHQSLGGQYGVRGFPTIKIFGANKNKAEDYQGGRTSDAIVDAALSALRSLVKD  136

Query  509  RL-----------DGKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGH  655
            RL             + +GG  +K      +EL   NFD  V+ S D+W+VEF+APWCGH
Sbjct  137  RLSGRSGGYSSGKQSRESGGGDKKD----VIELTDDNFDKNVINSDDVWMVEFYAPWCGH  192

Query  656  CK  661
            CK
Sbjct  193  CK  194


 Score = 92.0 bits (227),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 48/106 (45%), Positives = 65/106 (61%), Gaps = 4/106 (4%)
 Frame = +2

Query  164  GPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVAT  331
            G    V++L   NF   V+NS+ V +VEF+APWCGHCK L P +   A+ +    KG   
Sbjct  157  GDKKDVIELTDDNFDKNVINSDDVWMVEFYAPWCGHCKNLEPEWAAAATEVKEQTKGKVK  216

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  469
            +AA+DA  +  LA  YGI+GFPTIK+F  G+ PVDY G R    ++
Sbjct  217  LAAVDATVNQMLASRYGIRGFPTIKIFQKGEDPVDYDGGRTRSDII  262



>ref|XP_002586165.1| hypothetical protein BRAFLDRAFT_289141 [Branchiostoma floridae]
 gb|EEN42176.1| hypothetical protein BRAFLDRAFT_289141 [Branchiostoma floridae]
Length=443

 Score =   163 bits (412),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 89/179 (50%), Positives = 113/179 (63%), Gaps = 9/179 (5%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            +ALY PS  V++L  SNF+ KV+ S  V LVEF+APWCGHCK L P ++K A+ LKGVA 
Sbjct  18   HALYSPSDDVIELTSSNFQQKVIQSGDVWLVEFYAPWCGHCKNLVPEWKKAATALKGVAK  77

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  508
            V A+D  AH S+   Y ++GFPTIKVF   K +P DY GAR A++MVD    Q++ ++K 
Sbjct  78   VGAVDMTAHQSVGGPYNVRGFPTIKVFGLNKDKPEDYNGARSAQAMVDSALQQVQKVVKA  137

Query  509  RLDGKATGGSSQKSEPSAS--------VELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            RL GK                      +EL   NF+D V+ S DLW+VEFFAPWCGHCK
Sbjct  138  RLSGKGGKSGGSGGSGGQGSGGSKDDVIELTDSNFEDQVLNSDDLWLVEFFAPWCGHCK  196


 Score = 97.4 bits (241),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 55/111 (50%), Positives = 72/111 (65%), Gaps = 4/111 (4%)
 Frame = +2

Query  179  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaaldadah  358
            V++L  SNF+ +VLNS+ + LVEFFAPWCGHCK L P +   A+ LKG   + ALDA  H
Sbjct  164  VIELTDSNFEDQVLNSDDLWLVEFFAPWCGHCKRLEPEWASAATELKGKVKLGALDATVH  223

Query  359  sslaQEYGIKGFPTIKVFVPGKQ---PVDYQGAREAKSMVDF-VKAQIRNL  499
            + +A  Y I+GFPTIKVF  GK+     DYQG R A  +V + + A   N+
Sbjct  224  TVMASRYQIQGFPTIKVFAAGKKDGDATDYQGGRTASDIVAYALDAHAENI  274



>gb|EHH21891.1| hypothetical protein EGK_05054 [Macaca mulatta]
 gb|EHH55361.1| hypothetical protein EGM_04558 [Macaca fascicularis]
Length=508

 Score =   164 bits (415),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 87/177 (49%), Positives = 120/177 (68%), Gaps = 7/177 (4%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            N LY  S  V++L PSNF  +V+ S+ + LVEF+APWCGHC+ LTP ++K A+ LK V  
Sbjct  86   NGLYSSSDDVIELTPSNFNREVIQSDSLWLVEFYAPWCGHCQRLTPEWKKAATALKDVVK  145

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  508
            V A+DAD H SL  +YG++GFPTIK+F   K +P DYQG R  +++VD   + +R L+KD
Sbjct  146  VGAVDADKHQSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTGEAIVDAALSALRQLVKD  205

Query  509  RLDGKATG------GSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            RL G++ G      G S  S     +EL   +FD+ V+ S+D+W+VEF+APWCGHCK
Sbjct  206  RLGGRSGGYSSGKQGRSDSSSKKDVIELTDDSFDENVLDSEDVWMVEFYAPWCGHCK  262


 Score = 89.0 bits (219),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 63/101 (62%), Gaps = 4/101 (4%)
 Frame = +2

Query  179  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  346
            V++L   +F   VL+S  V +VEF+APWCGHCK L P +   AS +    KG   +AA+D
Sbjct  230  VIELTDDSFDENVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAASEVKEQTKGKVKLAAVD  289

Query  347  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  469
            A  +  LA  YGI+GFPTIK+F  G+ PVDY G R    +V
Sbjct  290  ATVNQVLASRYGIRGFPTIKIFQKGESPVDYDGGRTRSDIV  330



>dbj|BAF63672.1| protein disulfide isomerase-1 [Haemaphysalis longicornis]
Length=435

 Score =   163 bits (412),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 84/170 (49%), Positives = 116/170 (68%), Gaps = 3/170 (2%)
 Frame = +2

Query  155  ALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATV  334
            A+YGP T V+ L+P+NFK++V++S+ V +VEF+APWCGHC++  P Y K A+ LKG+  V
Sbjct  18   AMYGPHTEVVDLSPANFKNRVVDSDEVWIVEFYAPWCGHCQSFAPEYTKAAAALKGIVKV  77

Query  335  aaldadahsslaQEYGIKGFPTIKVFVPGKQ-PVDYQGAREAKSMVDFVKAQIRNLLKDR  511
             A+DAD   SL  +YG++GFPT+K+F   K  P DY G R A  +      + R ++  R
Sbjct  78   GAVDADKDKSLGGQYGVRGFPTVKIFGANKHNPTDYSGPRTADGVASAALQEARKVVDQR  137

Query  512  LDGKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            L G+ T G S   +    VEL+  NF++LV+KS DLW+VEFFAPWCGHCK
Sbjct  138  L-GRKTSGGSSGGKSDV-VELDESNFEELVLKSDDLWLVEFFAPWCGHCK  185


 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 48/103 (47%), Positives = 66/103 (64%), Gaps = 4/103 (4%)
 Frame = +2

Query  179  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATVaaldadah  358
            V++L+ SNF+  VL S+ + LVEFFAPWCGHCK L P + K A+ LKG   + A+DA  H
Sbjct  153  VVELDESNFEELVLKSDDLWLVEFFAPWCGHCKNLAPHWAKAATELKGKVKLGAVDATVH  212

Query  359  sslaQEYGIKGFPTIKVFVPGKQ----PVDYQGAREAKSMVDF  475
              LA ++ +KG+PTIK F  GK+      +Y G R A  +V +
Sbjct  213  QGLASQFDVKGYPTIKFFPGGKKDRHSAXEYNGGRTADDIVQW  255



>ref|XP_007456979.1| PREDICTED: protein disulfide-isomerase A6 [Lipotes vexillifer]
Length=440

 Score =   163 bits (412),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 88/177 (50%), Positives = 117/177 (66%), Gaps = 7/177 (4%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            N LY  S  V++L PSNF  +V+ S+ + LVEF+APWCGHC+ LTP ++KVA+ LK V  
Sbjct  18   NGLYSSSDDVIELTPSNFNREVIQSDSLWLVEFYAPWCGHCQRLTPEWKKVATALKDVVK  77

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  508
            V A+DAD H SL  +YG++GFPTIK+F   K QP DYQG R  +++VD     +R L+K 
Sbjct  78   VGAVDADKHQSLGGQYGVQGFPTIKIFGSNKNQPEDYQGGRTGEAIVDAALGALRQLVKG  137

Query  509  RLDGKATG------GSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            RL G++ G      G S  S     +EL    FD  V+ S+D+W+VEF+APWCGHCK
Sbjct  138  RLGGRSGGYSSGKQGRSDSSSKKDVIELTDDTFDKSVLDSEDVWMVEFYAPWCGHCK  194


 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 46/101 (46%), Positives = 61/101 (60%), Gaps = 4/101 (4%)
 Frame = +2

Query  179  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  346
            V++L    F   VL+S  V +VEF+APWCGHCK L P +   A+ +    KG   +AA+D
Sbjct  162  VIELTDDTFDKSVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAATEVKEQTKGKVKLAAVD  221

Query  347  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  469
            A  +  LA  Y I+GFPTIK+F  G+ PVDY G R    +V
Sbjct  222  ATINQVLASRYEIRGFPTIKIFQKGESPVDYDGGRTRSDIV  262



>ref|XP_008248061.1| PREDICTED: protein disulfide-isomerase A6 [Oryctolagus cuniculus]
Length=440

 Score =   163 bits (412),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 85/180 (47%), Positives = 119/180 (66%), Gaps = 13/180 (7%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            N LY  S  V++L PSNF  +V+ S+ + LVEF+APWCGHC+ LTP ++K AS LK V  
Sbjct  18   NGLYSSSDDVIELTPSNFNREVIQSDSLWLVEFYAPWCGHCQRLTPEWKKAASALKDVVK  77

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  508
            V A+DAD H +L  +YG++GFPTIK+F   K +P DYQG R  +++VD   + +R L+KD
Sbjct  78   VGAVDADKHQALGGQYGVQGFPTIKIFGANKNRPEDYQGGRTGEAIVDAALSALRQLVKD  137

Query  509  RL---------DGKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            RL           +  G S+ K +    +EL   +FD+ V++S D+W+VEF+APWCGHCK
Sbjct  138  RLGGRSGSHSSGRQGRGDSASKKD---VIELTDDSFDENVLESDDIWMVEFYAPWCGHCK  194


 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 45/101 (45%), Positives = 63/101 (62%), Gaps = 4/101 (4%)
 Frame = +2

Query  179  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  346
            V++L   +F   VL S+ + +VEF+APWCGHCK L P +   A+ +    KG   +AA+D
Sbjct  162  VIELTDDSFDENVLESDDIWMVEFYAPWCGHCKNLEPEWAAAATEVKEQTKGKVKLAAVD  221

Query  347  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  469
            A  +  L+  YGI+GFPTIK+F  G+ PVDY G R    +V
Sbjct  222  ATVNQMLSSRYGIRGFPTIKIFQKGESPVDYDGGRTRSDIV  262



>ref|XP_004274932.1| PREDICTED: protein disulfide-isomerase A6 [Orcinus orca]
 ref|XP_004310311.1| PREDICTED: protein disulfide-isomerase A6 isoform 2 [Tursiops 
truncatus]
Length=440

 Score =   163 bits (412),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 88/177 (50%), Positives = 117/177 (66%), Gaps = 7/177 (4%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            N LY  S  V++L PSNF  +V+ S+ + LVEF+APWCGHC+ LTP ++KVA+ LK V  
Sbjct  18   NGLYSSSDDVIELTPSNFNREVIQSDSLWLVEFYAPWCGHCQRLTPEWKKVATALKDVVK  77

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  508
            V A+DAD H SL  +YG++GFPTIK+F   K QP DYQG R  +++VD     +R L+K 
Sbjct  78   VGAVDADKHQSLGGQYGVQGFPTIKIFGSNKNQPEDYQGGRTGEAIVDAALGALRQLVKG  137

Query  509  RLDGKATG------GSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            RL G++ G      G S  S     +EL    FD  V+ S+D+W+VEF+APWCGHCK
Sbjct  138  RLGGRSGGYSSGKQGRSDSSSKKDVIELTDDTFDKSVLDSEDVWMVEFYAPWCGHCK  194


 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 46/101 (46%), Positives = 61/101 (60%), Gaps = 4/101 (4%)
 Frame = +2

Query  179  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  346
            V++L    F   VL+S  V +VEF+APWCGHCK L P +   A+ +    KG   +AA+D
Sbjct  162  VIELTDDTFDKSVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAATEVKEQTKGKVKLAAVD  221

Query  347  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  469
            A  +  LA  Y I+GFPTIK+F  G+ PVDY G R    +V
Sbjct  222  ATVNQVLASRYEIRGFPTIKIFQKGESPVDYDGGRTRSDIV  262



>ref|XP_004665748.1| PREDICTED: protein disulfide-isomerase A6 [Jaculus jaculus]
Length=440

 Score =   163 bits (412),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 88/177 (50%), Positives = 117/177 (66%), Gaps = 7/177 (4%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            N LY  S  V++L PSNF  +V+ SN + LVEF+APWCGHC+ LTP ++K A+ LK V  
Sbjct  18   NGLYSSSDDVIELTPSNFNREVIQSNSLWLVEFYAPWCGHCQRLTPEWKKAATALKDVVK  77

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  508
            V A+DAD H SL  +YG++GFPTIK+F   K +P DYQG R  +++VD   + +R L+KD
Sbjct  78   VGAVDADKHQSLGGQYGVQGFPTIKIFGANKNRPEDYQGGRTGEAIVDAALSALRQLVKD  137

Query  509  RLDGKATG------GSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            RL G++ G      G    S     VEL   +FD  V+ S D+W+VEF+APWCGHCK
Sbjct  138  RLGGRSGGYSSGKQGRGDSSSKKDVVELTDDSFDKNVLDSDDVWMVEFYAPWCGHCK  194


 Score = 88.2 bits (217),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 47/101 (47%), Positives = 64/101 (63%), Gaps = 4/101 (4%)
 Frame = +2

Query  179  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  346
            V++L   +F   VL+S+ V +VEF+APWCGHCK L P +   A+ +    KG   +AA+D
Sbjct  162  VVELTDDSFDKNVLDSDDVWMVEFYAPWCGHCKNLEPEWAAAATEVKEQTKGKVKLAAVD  221

Query  347  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  469
            A  +  LA  YGI+GFPTIK+F  G+ PVDY G R    +V
Sbjct  222  ATVNQVLASRYGIRGFPTIKIFQKGESPVDYDGGRTKSDIV  262



>ref|XP_004686132.1| PREDICTED: protein disulfide-isomerase A6 [Condylura cristata]
Length=492

 Score =   164 bits (414),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 87/177 (49%), Positives = 117/177 (66%), Gaps = 7/177 (4%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            + LY  S  V++L PSNF  +V+ S+ + LVEF+APWCGHC+ LTP ++KVA+ LKGV  
Sbjct  70   SGLYSSSDDVIELTPSNFNREVIQSDSLWLVEFYAPWCGHCQRLTPEWKKVATALKGVVK  129

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  508
            V A+DAD H SL  +YG++GFPTIK+F   K +P DYQG R   ++VD     +R L+KD
Sbjct  130  VGAVDADKHQSLGGQYGVQGFPTIKIFGANKNRPEDYQGGRTGDAIVDAALGTLRQLVKD  189

Query  509  RLDGKATG------GSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            RL G+  G      G  + S     +EL    FD+ V+ S D+W+VEF+APWCGHCK
Sbjct  190  RLGGRGGGYSSGKQGRGESSSKKDVIELTDDTFDENVLDSDDVWMVEFYAPWCGHCK  246


 Score = 89.0 bits (219),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 64/101 (63%), Gaps = 4/101 (4%)
 Frame = +2

Query  179  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  346
            V++L    F   VL+S+ V +VEF+APWCGHCK L P +   A+ +    KG   +AA+D
Sbjct  214  VIELTDDTFDENVLDSDDVWMVEFYAPWCGHCKNLEPEWAAAATEVKEQTKGKVKLAAVD  273

Query  347  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  469
            A A+ +L   YGI+GFPTIKVF  G+ PVDY G R    +V
Sbjct  274  ATANQALTSRYGIRGFPTIKVFQKGESPVDYDGGRTRSDIV  314



>ref|XP_004028893.1| PREDICTED: protein disulfide-isomerase A6 isoform 2 [Gorilla 
gorilla gorilla]
Length=437

 Score =   163 bits (412),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 87/177 (49%), Positives = 119/177 (67%), Gaps = 7/177 (4%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            N LY  S  V++L PSNF  +V+ S+ + LVEF+APWCGHC+ LTP ++K A+ LK V  
Sbjct  15   NGLYSSSDDVIELTPSNFNREVIQSDSLWLVEFYAPWCGHCQRLTPEWKKAATALKDVVK  74

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  508
            V A+DAD H SL  +YG++GFPTIK+F   K +P DYQG R  +++VD   + +R L+KD
Sbjct  75   VGAVDADKHHSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTGEAIVDAALSALRQLVKD  134

Query  509  RLDGKATG------GSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            RL G++ G      G S  S     +EL   +FD  V+ S+D+W+VEF+APWCGHCK
Sbjct  135  RLGGRSGGYSSGKQGRSDSSSKKDVIELTDDSFDKNVLDSEDVWMVEFYAPWCGHCK  191


 Score = 88.6 bits (218),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 63/101 (62%), Gaps = 4/101 (4%)
 Frame = +2

Query  179  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  346
            V++L   +F   VL+S  V +VEF+APWCGHCK L P +   AS +    KG   +AA+D
Sbjct  159  VIELTDDSFDKNVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAASEVKEQTKGKVKLAAVD  218

Query  347  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  469
            A  +  LA  YGI+GFPTIK+F  G+ PVDY G R    +V
Sbjct  219  ATVNQVLASRYGIRGFPTIKIFQKGESPVDYDGGRTRSDIV  259



>ref|NP_001269636.1| protein disulfide-isomerase A6 isoform e precursor [Homo sapiens]
 dbj|BAH11740.1| unnamed protein product [Homo sapiens]
Length=437

 Score =   163 bits (412),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 87/177 (49%), Positives = 119/177 (67%), Gaps = 7/177 (4%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            N LY  S  V++L PSNF  +V+ S+ + LVEF+APWCGHC+ LTP ++K A+ LK V  
Sbjct  15   NGLYSSSDDVIELTPSNFNREVIQSDSLWLVEFYAPWCGHCQRLTPEWKKAATALKDVVK  74

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  508
            V A+DAD H SL  +YG++GFPTIK+F   K +P DYQG R  +++VD   + +R L+KD
Sbjct  75   VGAVDADKHHSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTGEAIVDAALSALRQLVKD  134

Query  509  RLDGKATG------GSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            RL G++ G      G S  S     +EL   +FD  V+ S+D+W+VEF+APWCGHCK
Sbjct  135  RLGGRSGGYSSGKQGRSDSSSKKDVIELTDDSFDKNVLDSEDVWMVEFYAPWCGHCK  191


 Score = 88.6 bits (218),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 63/101 (62%), Gaps = 4/101 (4%)
 Frame = +2

Query  179  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  346
            V++L   +F   VL+S  V +VEF+APWCGHCK L P +   AS +    KG   +AA+D
Sbjct  159  VIELTDDSFDKNVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAASEVKEQTKGKVKLAAVD  218

Query  347  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  469
            A  +  LA  YGI+GFPTIK+F  G+ PVDY G R    +V
Sbjct  219  ATVNQVLASRYGIRGFPTIKIFQKGESPVDYDGGRTRSDIV  259



>dbj|BAB24354.1| unnamed protein product [Mus musculus]
Length=391

 Score =   162 bits (409),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 86/177 (49%), Positives = 118/177 (67%), Gaps = 7/177 (4%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            + LY  S  V++L PSNF  +V+ S+G+ LVEF+APWCGHC+ LTP ++K A+ LK V  
Sbjct  23   SGLYSSSDDVIELTPSNFNREVIQSDGLWLVEFYAPWCGHCQRLTPEWKKAATALKDVVK  82

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  508
            V A++AD H SL  +YG++GFPTIK+F   K +P DYQG R  +++VD   + +R L+KD
Sbjct  83   VGAVNADKHQSLGGQYGVQGFPTIKIFGANKNKPEDYQGGRTGEAIVDAALSALRQLVKD  142

Query  509  RLDGKATG------GSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            RL G++ G      G    S     VEL    FD  V+ S+D+W+VEF+APWCGHCK
Sbjct  143  RLGGRSGGYSSGKQGRGDSSSKKDVVELTDDTFDKNVLDSEDVWMVEFYAPWCGHCK  199


 Score = 87.4 bits (215),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 62/101 (61%), Gaps = 4/101 (4%)
 Frame = +2

Query  179  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  346
            V++L    F   VL+S  V +VEF+APWCGHCK L P +   A+ +    KG   +AA+D
Sbjct  167  VVELTDDTFDKNVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAATEVKEQTKGKVKLAAVD  226

Query  347  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  469
            A  +  LA  YGIKGFPTIK+F  G+ PVDY G R    +V
Sbjct  227  ATMNQVLASRYGIKGFPTIKIFQKGESPVDYDGGRTRSDIV  267



>gb|EDK98488.1| protein disulfide isomerase associated 6, isoform CRA_b [Mus 
musculus]
Length=400

 Score =   162 bits (410),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 86/177 (49%), Positives = 118/177 (67%), Gaps = 7/177 (4%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            + LY  S  V++L PSNF  +V+ S+G+ LVEF+APWCGHC+ LTP ++K A+ LK V  
Sbjct  32   SGLYSSSDDVIELTPSNFNREVIQSDGLWLVEFYAPWCGHCQRLTPEWKKAATALKDVVK  91

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  508
            V A++AD H SL  +YG++GFPTIK+F   K +P DYQG R  +++VD   + +R L+KD
Sbjct  92   VGAVNADKHQSLGGQYGVQGFPTIKIFGANKNKPEDYQGGRTGEAIVDAALSALRQLVKD  151

Query  509  RLDGKATG------GSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            RL G++ G      G    S     VEL    FD  V+ S+D+W+VEF+APWCGHCK
Sbjct  152  RLGGRSGGYSSGKQGRGDSSSKKDVVELTDDTFDKNVLDSEDVWMVEFYAPWCGHCK  208


 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 62/101 (61%), Gaps = 4/101 (4%)
 Frame = +2

Query  179  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  346
            V++L    F   VL+S  V +VEF+APWCGHCK L P +   A+ +    KG   +AA+D
Sbjct  176  VVELTDDTFDKNVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAATEVKEQTKGKVKLAAVD  235

Query  347  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  469
            A  +  LA  YGIKGFPTIK+F  G+ PVDY G R    +V
Sbjct  236  ATVNQVLASRYGIKGFPTIKIFQKGESPVDYDGGRTRSDIV  276



>ref|XP_010377997.1| PREDICTED: protein disulfide-isomerase A6 [Rhinopithecus roxellana]
Length=512

 Score =   164 bits (415),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 87/177 (49%), Positives = 120/177 (68%), Gaps = 7/177 (4%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            N LY  S  V++L PSNF  +V+ S+ + LVEF+APWCGHC+ LTP ++K A+ LK V  
Sbjct  90   NGLYSSSDDVIELTPSNFNREVIQSDSLWLVEFYAPWCGHCQRLTPEWKKAATALKDVVK  149

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  508
            V A+DAD H SL  +YG++GFPTIK+F   K +P DYQG R  +++VD   + +R L+KD
Sbjct  150  VGAVDADKHQSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTGEAIVDAALSALRQLVKD  209

Query  509  RLDGKATG------GSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            RL G++ G      G S  S     +EL   +FD+ V+ S+D+W+VEF+APWCGHCK
Sbjct  210  RLGGRSGGYSSGKQGRSDSSSKKDVIELTDDSFDENVLDSEDVWMVEFYAPWCGHCK  266


 Score = 89.0 bits (219),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 63/101 (62%), Gaps = 4/101 (4%)
 Frame = +2

Query  179  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  346
            V++L   +F   VL+S  V +VEF+APWCGHCK L P +   AS +    KG   +AA+D
Sbjct  234  VIELTDDSFDENVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAASEVKEQTKGKVKLAAVD  293

Query  347  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  469
            A  +  LA  YGI+GFPTIK+F  G+ PVDY G R    +V
Sbjct  294  ATVNQVLASRYGIRGFPTIKIFQKGESPVDYDGGRTRSDIV  334



>ref|XP_005366580.1| PREDICTED: protein disulfide-isomerase A6 [Microtus ochrogaster]
Length=445

 Score =   163 bits (412),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 87/177 (49%), Positives = 117/177 (66%), Gaps = 7/177 (4%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            N LY  S  V++L PSNF  +V+ SN + LVEF+APWCGHC+ LTP ++K A+ LK V  
Sbjct  23   NGLYSSSDDVIELTPSNFNREVIQSNSLWLVEFYAPWCGHCQRLTPEWKKAATALKDVVK  82

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  508
            V A+DAD H SL  +YG++GFPTIK+F   K +P DYQG R  +++VD   + +R L+KD
Sbjct  83   VGAVDADKHQSLGGQYGVQGFPTIKIFGANKNKPEDYQGGRTGEAIVDAALSALRQLVKD  142

Query  509  RLDGKATG------GSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            RL G++ G      G    S     +EL    FD  V+ S+D+W+VEF+APWCGHCK
Sbjct  143  RLGGRSGGYSSGKQGRGDSSSKKDVIELTDDTFDKNVLDSEDVWMVEFYAPWCGHCK  199


 Score = 85.9 bits (211),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 46/101 (46%), Positives = 61/101 (60%), Gaps = 4/101 (4%)
 Frame = +2

Query  179  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  346
            V++L    F   VL+S  V +VEF+APWCGHCK L P +   A+ +    KG   +AA+D
Sbjct  167  VIELTDDTFDKNVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAATEVKEQTKGKVKLAAVD  226

Query  347  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  469
            A  +  LA  YGI+GFPTIK+F  G+ P DY G R    +V
Sbjct  227  ATVNQVLASRYGIRGFPTIKIFQKGESPADYDGGRTRSDIV  267



>ref|XP_008570350.1| PREDICTED: protein disulfide-isomerase A6 [Galeopterus variegatus]
Length=460

 Score =   163 bits (412),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 87/177 (49%), Positives = 118/177 (67%), Gaps = 7/177 (4%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            N LY  +  V++L PSNF  +V+ S+ + LVEF+APWCGHC+ LTP ++K A+ LK V  
Sbjct  38   NGLYSSTDDVIELTPSNFNQEVIQSDSLWLVEFYAPWCGHCQRLTPEWKKAATALKDVVK  97

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  508
            V A+DAD H SL  +YG++GFPTIK+F   K +P DYQG R  +++VD     +R L+KD
Sbjct  98   VGAVDADKHQSLGGQYGVQGFPTIKIFGSNKNKPEDYQGGRTGEAIVDAALNAVRQLVKD  157

Query  509  RLDGKATG------GSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            RL G++ G      G S  S     +EL   NFD  V+ S+D+W+VEF+APWCGHCK
Sbjct  158  RLGGRSGGYSSGKQGRSDSSSKKDVIELTDDNFDKNVLDSEDVWMVEFYAPWCGHCK  214


 Score = 89.4 bits (220),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 63/101 (62%), Gaps = 4/101 (4%)
 Frame = +2

Query  179  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  346
            V++L   NF   VL+S  V +VEF+APWCGHCK L P +   A+ +    KG   +AA+D
Sbjct  182  VIELTDDNFDKNVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAATEVKEQTKGKVKLAAVD  241

Query  347  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  469
            A  +  LA  YGI+GFPTIK+F  G+ PVDY G R    +V
Sbjct  242  ATVNQVLASRYGIRGFPTIKIFQKGESPVDYDGGRTRSDIV  282



>ref|XP_008686251.1| PREDICTED: protein disulfide-isomerase A6 [Ursus maritimus]
Length=540

 Score =   164 bits (415),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 88/177 (50%), Positives = 119/177 (67%), Gaps = 7/177 (4%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            N LY  S  V++L P+NF  +V+ S+ + LVEF+APWCGHC+ LTP ++KVA+ LK V  
Sbjct  103  NGLYSSSDDVIELTPTNFNREVIQSDSLWLVEFYAPWCGHCQRLTPEWKKVATALKDVVK  162

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  508
            V A+DAD H SL  +YG++GFPTIK+F   K +P DYQG R  +++VD   + +R L+KD
Sbjct  163  VGAVDADRHQSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTGEAIVDAALSALRQLVKD  222

Query  509  RLDGKATG------GSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            RL G+  G      G S+ S     VEL   +FD  V+ S D+W+VEF+APWCGHCK
Sbjct  223  RLGGRGGGYSSGKQGRSESSSKKDVVELTDDSFDKNVLDSDDVWMVEFYAPWCGHCK  279


 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 64/101 (63%), Gaps = 4/101 (4%)
 Frame = +2

Query  179  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  346
            V++L   +F   VL+S+ V +VEF+APWCGHCK L P +   A+ +    KG   +AA+D
Sbjct  247  VVELTDDSFDKNVLDSDDVWMVEFYAPWCGHCKNLEPEWAAAATEVKERTKGKVKLAAVD  306

Query  347  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  469
            A A   LA  YGI+GFPTIK+F  G+ PVDY G R    +V
Sbjct  307  ATASQLLASRYGIRGFPTIKIFQKGESPVDYDGGRTRSDIV  347



>ref|NP_001233576.1| protein disulfide-isomerase A6 precursor [Pan troglodytes]
 ref|XP_003827017.1| PREDICTED: protein disulfide-isomerase A6 [Pan paniscus]
 ref|XP_004028892.1| PREDICTED: protein disulfide-isomerase A6 isoform 1 [Gorilla 
gorilla gorilla]
 dbj|BAK63728.1| protein disulfide-isomerase A6 precursor [Pan troglodytes]
Length=440

 Score =   162 bits (411),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 87/177 (49%), Positives = 119/177 (67%), Gaps = 7/177 (4%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            N LY  S  V++L PSNF  +V+ S+ + LVEF+APWCGHC+ LTP ++K A+ LK V  
Sbjct  18   NGLYSSSDDVIELTPSNFNREVIQSDSLWLVEFYAPWCGHCQRLTPEWKKAATALKDVVK  77

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  508
            V A+DAD H SL  +YG++GFPTIK+F   K +P DYQG R  +++VD   + +R L+KD
Sbjct  78   VGAVDADKHHSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTGEAIVDAALSALRQLVKD  137

Query  509  RLDGKATG------GSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            RL G++ G      G S  S     +EL   +FD  V+ S+D+W+VEF+APWCGHCK
Sbjct  138  RLGGRSGGYSSGKQGRSDSSSKKDVIELTDDSFDKNVLDSEDVWMVEFYAPWCGHCK  194


 Score = 88.6 bits (218),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 63/101 (62%), Gaps = 4/101 (4%)
 Frame = +2

Query  179  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  346
            V++L   +F   VL+S  V +VEF+APWCGHCK L P +   AS +    KG   +AA+D
Sbjct  162  VIELTDDSFDKNVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAASEVKEQTKGKVKLAAVD  221

Query  347  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  469
            A  +  LA  YGI+GFPTIK+F  G+ PVDY G R    +V
Sbjct  222  ATVNQVLASRYGIRGFPTIKIFQKGESPVDYDGGRTRSDIV  262



>ref|NP_001126483.1| protein disulfide-isomerase A6 precursor [Pongo abelii]
 sp|Q5R6T1.1|PDIA6_PONAB RecName: Full=Protein disulfide-isomerase A6; Flags: Precursor 
[Pongo abelii]
 emb|CAH92529.1| hypothetical protein [Pongo abelii]
Length=440

 Score =   162 bits (411),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 87/177 (49%), Positives = 119/177 (67%), Gaps = 7/177 (4%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            N LY  S  V++L PSNF  +V+ S+ + LVEF+APWCGHC+ LTP ++K A+ LK V  
Sbjct  18   NGLYSSSDDVIELTPSNFNREVIQSDSLWLVEFYAPWCGHCQRLTPEWKKAATALKDVVK  77

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  508
            V A+DAD H SL  +YG++GFPTIK+F   K +P DYQG R  +++VD   + +R L+KD
Sbjct  78   VGAVDADKHHSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTGEAIVDAALSALRQLVKD  137

Query  509  RLDGKATG------GSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            RL G++ G      G S  S     +EL   +FD  V+ S+D+W+VEF+APWCGHCK
Sbjct  138  RLGGQSGGYSSGKQGRSDSSSKKDVIELTDDSFDKNVLDSEDVWMVEFYAPWCGHCK  194


 Score = 88.6 bits (218),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 63/101 (62%), Gaps = 4/101 (4%)
 Frame = +2

Query  179  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  346
            V++L   +F   VL+S  V +VEF+APWCGHCK L P +   AS +    KG   +AA+D
Sbjct  162  VIELTDDSFDKNVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAASEVKEQTKGKVKLAAVD  221

Query  347  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  469
            A  +  LA  YGI+GFPTIK+F  G+ PVDY G R    +V
Sbjct  222  ATVNQVLASRYGIRGFPTIKIFQKGESPVDYDGGRTRSDIV  262



>ref|XP_008395804.1| PREDICTED: protein disulfide-isomerase A6 isoform X1 [Poecilia 
reticulata]
Length=440

 Score =   162 bits (411),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 86/175 (49%), Positives = 119/175 (68%), Gaps = 6/175 (3%)
 Frame = +2

Query  155  ALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATV  334
            A+Y  S  V++L PSNF  +V+ S+ + LVEF+APWCGHC+ L P ++K A+ LKG+  V
Sbjct  19   AMYSSSDDVIELTPSNFNREVIQSDSLWLVEFYAPWCGHCQNLAPEWKKAATALKGIVKV  78

Query  335  aaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKDR  511
             A+DAD H SL  +YG++GFPTIKVF   K +P +YQG R ++++VD     +R L+K+R
Sbjct  79   GAVDADQHKSLGGQYGVRGFPTIKVFGANKNKPEEYQGGRSSQAIVDGAMNALRTLVKER  138

Query  512  LDGKATGGSSQKSEPSAS-----VELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            L G++ G S  K + S       VEL   NFD+ V+   D+W+VEFFAPWCGHCK
Sbjct  139  LSGRSGGSSYSKQQSSGGSKKDVVELTDDNFDETVLNGDDVWLVEFFAPWCGHCK  193


 Score = 93.6 bits (231),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 48/107 (45%), Positives = 65/107 (61%), Gaps = 4/107 (4%)
 Frame = +2

Query  164  GPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVAT  331
            G    V++L   NF   VLN + V LVEFFAPWCGHCK L P +   A+ +    KG   
Sbjct  156  GSKKDVVELTDDNFDETVLNGDDVWLVEFFAPWCGHCKNLEPEWAAAATAVKEQTKGKVR  215

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVD  472
            + A+DA  H  ++  YGI+GFPTIK+F  G++P DYQG R    +++
Sbjct  216  LGAVDATVHQVVSSRYGIRGFPTIKIFRKGEEPEDYQGGRTRGDIIE  262



>ref|XP_009961799.1| PREDICTED: protein disulfide-isomerase A6 [Tyto alba]
Length=444

 Score =   162 bits (411),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 85/182 (47%), Positives = 117/182 (64%), Gaps = 16/182 (9%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            N+LY  S  V++L P+NF  +V+ S  + LVEF+APWCGHC+ LTP ++K A+ LKGV  
Sbjct  21   NSLYSSSDDVIELTPTNFNKEVIQSESLWLVEFYAPWCGHCQRLTPEWKKAATALKGVVK  80

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPV-DYQGAREAKSMVDFVKAQIRNLLKD  508
            V A+DAD H SL  +YG++GFPTIK+F   K    DYQG R + ++VD   + +R+L+KD
Sbjct  81   VGAVDADKHQSLGGQYGVRGFPTIKIFGANKNKAEDYQGGRTSDAIVDAALSALRSLVKD  140

Query  509  RL-----------DGKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGH  655
            RL             + +GG  +K      +EL   NFD  V+ S D+W+VEF+APWCGH
Sbjct  141  RLSGRSGGYSSGKQSRESGGGDKKD----VIELTDDNFDKNVINSDDVWMVEFYAPWCGH  196

Query  656  CK  661
            CK
Sbjct  197  CK  198


 Score = 91.7 bits (226),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 48/106 (45%), Positives = 65/106 (61%), Gaps = 4/106 (4%)
 Frame = +2

Query  164  GPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVAT  331
            G    V++L   NF   V+NS+ V +VEF+APWCGHCK L P +   A+ +    KG   
Sbjct  161  GDKKDVIELTDDNFDKNVINSDDVWMVEFYAPWCGHCKNLEPEWAAAATEVKEQTKGKVK  220

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  469
            +AA+DA  +  LA  YGI+GFPTIK+F  G+ PVDY G R    ++
Sbjct  221  LAAVDATVNQMLASRYGIRGFPTIKIFQKGEDPVDYDGGRTRSDII  266



>ref|NP_005733.1| protein disulfide-isomerase A6 isoform d precursor [Homo sapiens]
 sp|Q15084.1|PDIA6_HUMAN RecName: Full=Protein disulfide-isomerase A6; AltName: Full=Endoplasmic 
reticulum protein 5; Short=ER protein 5; Short=ERp5; 
AltName: Full=Protein disulfide isomerase P5; AltName: Full=Thioredoxin 
domain-containing protein 7; Flags: Precursor 
[Homo sapiens]
 dbj|BAA08450.1| human P5 [Homo sapiens]
 gb|AAH01312.1| Protein disulfide isomerase family A, member 6 [Homo sapiens]
 gb|AAY24070.1| unknown [Homo sapiens]
 gb|EAX00950.1| protein disulfide isomerase family A, member 6, isoform CRA_b 
[Homo sapiens]
 gb|ABM82112.1| protein disulfide isomerase family A, member 6 [synthetic construct]
 gb|ABM85295.1| protein disulfide isomerase family A, member 6 [synthetic construct]
 dbj|BAF82117.1| unnamed protein product [Homo sapiens]
 gb|AIC50514.1| PDIA6, partial [synthetic construct]
Length=440

 Score =   162 bits (411),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 87/177 (49%), Positives = 119/177 (67%), Gaps = 7/177 (4%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            N LY  S  V++L PSNF  +V+ S+ + LVEF+APWCGHC+ LTP ++K A+ LK V  
Sbjct  18   NGLYSSSDDVIELTPSNFNREVIQSDSLWLVEFYAPWCGHCQRLTPEWKKAATALKDVVK  77

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  508
            V A+DAD H SL  +YG++GFPTIK+F   K +P DYQG R  +++VD   + +R L+KD
Sbjct  78   VGAVDADKHHSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTGEAIVDAALSALRQLVKD  137

Query  509  RLDGKATG------GSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            RL G++ G      G S  S     +EL   +FD  V+ S+D+W+VEF+APWCGHCK
Sbjct  138  RLGGRSGGYSSGKQGRSDSSSKKDVIELTDDSFDKNVLDSEDVWMVEFYAPWCGHCK  194


 Score = 88.6 bits (218),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 63/101 (62%), Gaps = 4/101 (4%)
 Frame = +2

Query  179  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  346
            V++L   +F   VL+S  V +VEF+APWCGHCK L P +   AS +    KG   +AA+D
Sbjct  162  VIELTDDSFDKNVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAASEVKEQTKGKVKLAAVD  221

Query  347  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  469
            A  +  LA  YGI+GFPTIK+F  G+ PVDY G R    +V
Sbjct  222  ATVNQVLASRYGIRGFPTIKIFQKGESPVDYDGGRTRSDIV  262



>ref|XP_003215468.2| PREDICTED: protein disulfide-isomerase A6 [Anolis carolinensis]
Length=490

 Score =   163 bits (413),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 86/183 (47%), Positives = 119/183 (65%), Gaps = 17/183 (9%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            N+LY  S  V++L P+NF  +V+ S+ + LVEF+APWCGHC+ LTP ++K A+ LKGV  
Sbjct  64   NSLYSSSDDVIELTPTNFNREVVQSDNLWLVEFYAPWCGHCQRLTPEWKKAATALKGVVK  123

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPV-DYQGAREAKSMVDFVKAQIRNLLKD  508
            + A+DAD H SL  +YG+KGFPTIK+F   K    DYQGAR + ++VD   + +R+L+KD
Sbjct  124  IGAVDADKHQSLGGQYGVKGFPTIKIFGANKNKAEDYQGARTSDAIVDAALSALRSLVKD  183

Query  509  RL------------DGKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCG  652
            RL              + +GGS +K      +EL    FD  V+ S D+W+VEF+APWCG
Sbjct  184  RLGGRGGGYSSGKQSSRESGGSGKKD----VIELTDDTFDKNVLDSNDVWLVEFYAPWCG  239

Query  653  HCK  661
            HCK
Sbjct  240  HCK  242


 Score = 89.7 bits (221),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 47/101 (47%), Positives = 63/101 (62%), Gaps = 4/101 (4%)
 Frame = +2

Query  179  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLK----GVATVaald  346
            V++L    F   VL+SN V LVEF+APWCGHCK L P +   A+ +K    G   +AA+D
Sbjct  210  VIELTDDTFDKNVLDSNDVWLVEFYAPWCGHCKNLEPEWAAAATEVKEQTNGKVKLAAVD  269

Query  347  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  469
            A  +  +A  YGI+GFPTIK+F  G+ P+DY G R    +V
Sbjct  270  ATVNQVVAGRYGIRGFPTIKIFQKGEDPIDYDGGRTKTDIV  310



>ref|XP_007053233.1| PREDICTED: protein disulfide-isomerase A6, partial [Chelonia 
mydas]
Length=445

 Score =   162 bits (411),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 85/183 (46%), Positives = 119/183 (65%), Gaps = 17/183 (9%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            N+LY  S  V++L P+NF  +V+ S+ + LVEF+APWCGHC+ LTP ++K A+ LKGV  
Sbjct  21   NSLYSSSDDVIELTPTNFNKEVIQSDSLWLVEFYAPWCGHCQRLTPEWKKAATALKGVVK  80

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPV-DYQGAREAKSMVDFVKAQIRNLLKD  508
            V A+DAD H SL  +YG++GFPTIK+F   K    DYQG R ++++VD   + +R+L+KD
Sbjct  81   VGAVDADKHQSLGGQYGVRGFPTIKIFGSNKNKAEDYQGGRTSEAIVDAALSTLRSLVKD  140

Query  509  RL------------DGKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCG  652
            RL              + +GG  +K      +EL   +FD  VV S D+W+VEF+APWCG
Sbjct  141  RLSGRSGGYSSGKQSSRESGGGDKKD----VIELTDDSFDKNVVNSDDVWLVEFYAPWCG  196

Query  653  HCK  661
            HCK
Sbjct  197  HCK  199


 Score = 90.9 bits (224),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 49/106 (46%), Positives = 65/106 (61%), Gaps = 4/106 (4%)
 Frame = +2

Query  164  GPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVAT  331
            G    V++L   +F   V+NS+ V LVEF+APWCGHCK L P +   A+ +    KG   
Sbjct  162  GDKKDVIELTDDSFDKNVVNSDDVWLVEFYAPWCGHCKNLEPEWAAAATEVKEQTKGKVK  221

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  469
            +AA+DA  +  LA  YGI+GFPTIK+F  G+ PVDY G R    +V
Sbjct  222  LAAVDATVNQMLASRYGIRGFPTIKIFQKGEDPVDYDGGRTRSDIV  267



>ref|NP_001269635.1| protein disulfide-isomerase A6 isoform c [Homo sapiens]
Length=445

 Score =   162 bits (411),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 87/177 (49%), Positives = 119/177 (67%), Gaps = 7/177 (4%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            N LY  S  V++L PSNF  +V+ S+ + LVEF+APWCGHC+ LTP ++K A+ LK V  
Sbjct  23   NGLYSSSDDVIELTPSNFNREVIQSDSLWLVEFYAPWCGHCQRLTPEWKKAATALKDVVK  82

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  508
            V A+DAD H SL  +YG++GFPTIK+F   K +P DYQG R  +++VD   + +R L+KD
Sbjct  83   VGAVDADKHHSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTGEAIVDAALSALRQLVKD  142

Query  509  RLDGKATG------GSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            RL G++ G      G S  S     +EL   +FD  V+ S+D+W+VEF+APWCGHCK
Sbjct  143  RLGGRSGGYSSGKQGRSDSSSKKDVIELTDDSFDKNVLDSEDVWMVEFYAPWCGHCK  199


 Score = 88.6 bits (218),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 63/101 (62%), Gaps = 4/101 (4%)
 Frame = +2

Query  179  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  346
            V++L   +F   VL+S  V +VEF+APWCGHCK L P +   AS +    KG   +AA+D
Sbjct  167  VIELTDDSFDKNVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAASEVKEQTKGKVKLAAVD  226

Query  347  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  469
            A  +  LA  YGI+GFPTIK+F  G+ PVDY G R    +V
Sbjct  227  ATVNQVLASRYGIRGFPTIKIFQKGESPVDYDGGRTRSDIV  267



>ref|XP_002921563.2| PREDICTED: protein disulfide-isomerase A6 [Ailuropoda melanoleuca]
Length=534

 Score =   164 bits (415),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 88/177 (50%), Positives = 119/177 (67%), Gaps = 7/177 (4%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            N LY  S  V++L P+NF  +V+ S+ + LVEF+APWCGHC+ LTP ++KVA+ LK V  
Sbjct  112  NGLYSSSDDVIELTPTNFNREVIQSDSLWLVEFYAPWCGHCQRLTPEWKKVATALKDVVK  171

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  508
            V A+DAD H SL  +YG++GFPTIK+F   K +P DYQG R  +++VD   + +R L+KD
Sbjct  172  VGAVDADKHQSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTGEAIVDAALSALRQLVKD  231

Query  509  RLDGKATG------GSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            RL G+  G      G S+ S     VEL   +FD  V+ S D+W+VEF+APWCGHCK
Sbjct  232  RLGGRGGGYSSGKQGRSESSSKKDVVELTDDSFDKNVLDSDDVWMVEFYAPWCGHCK  288


 Score = 87.4 bits (215),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 46/101 (46%), Positives = 64/101 (63%), Gaps = 4/101 (4%)
 Frame = +2

Query  179  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  346
            V++L   +F   VL+S+ V +VEF+APWCGHCK L P +   A+ +    KG   +AA+D
Sbjct  256  VVELTDDSFDKNVLDSDDVWMVEFYAPWCGHCKNLEPEWAAAATEVREQTKGKVKLAAVD  315

Query  347  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  469
            A  +  LA  YGI+GFPTIK+F  G+ PVDY G R    ++
Sbjct  316  ATVNQLLASRYGIRGFPTIKIFQKGESPVDYDGGRTRSDII  356



>ref|XP_004310310.1| PREDICTED: protein disulfide-isomerase A6 isoform 1 [Tursiops 
truncatus]
Length=448

 Score =   162 bits (411),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 88/177 (50%), Positives = 117/177 (66%), Gaps = 7/177 (4%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            N LY  S  V++L PSNF  +V+ S+ + LVEF+APWCGHC+ LTP ++KVA+ LK V  
Sbjct  26   NGLYSSSDDVIELTPSNFNREVIQSDSLWLVEFYAPWCGHCQRLTPEWKKVATALKDVVK  85

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  508
            V A+DAD H SL  +YG++GFPTIK+F   K QP DYQG R  +++VD     +R L+K 
Sbjct  86   VGAVDADKHQSLGGQYGVQGFPTIKIFGSNKNQPEDYQGGRTGEAIVDAALGALRQLVKG  145

Query  509  RLDGKATG------GSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            RL G++ G      G S  S     +EL    FD  V+ S+D+W+VEF+APWCGHCK
Sbjct  146  RLGGRSGGYSSGKQGRSDSSSKKDVIELTDDTFDKSVLDSEDVWMVEFYAPWCGHCK  202


 Score = 84.0 bits (206),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 46/101 (46%), Positives = 61/101 (60%), Gaps = 4/101 (4%)
 Frame = +2

Query  179  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  346
            V++L    F   VL+S  V +VEF+APWCGHCK L P +   A+ +    KG   +AA+D
Sbjct  170  VIELTDDTFDKSVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAATEVKEQTKGKVKLAAVD  229

Query  347  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  469
            A  +  LA  Y I+GFPTIK+F  G+ PVDY G R    +V
Sbjct  230  ATVNQVLASRYEIRGFPTIKIFQKGESPVDYDGGRTRSDIV  270



>ref|XP_004373116.1| PREDICTED: protein disulfide-isomerase A6 [Trichechus manatus 
latirostris]
Length=440

 Score =   162 bits (411),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 86/177 (49%), Positives = 120/177 (68%), Gaps = 7/177 (4%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            N LY  S  V++L PSNF  +V+ S+ + LVEF+APWCGHC+ LTP ++KVA+ LK +  
Sbjct  18   NGLYSSSDDVIELTPSNFNREVIQSDSLWLVEFYAPWCGHCQRLTPEWKKVATALKDIVK  77

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  508
            V A+DAD H SL  +YG++GFPTIK+F   K +  DYQG R A+++VD   + +R L+KD
Sbjct  78   VGAVDADKHQSLGGQYGVQGFPTIKIFGSNKNRAEDYQGGRTAEAIVDAAISAVRQLVKD  137

Query  509  RLDGKATG------GSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            R+ G++ G      G S+ S     +EL    FD  V+ S+D+W+VEF+APWCGHCK
Sbjct  138  RIGGRSGGYSSGRQGRSESSSKKDVIELTDDTFDKNVLDSEDVWMVEFYAPWCGHCK  194


 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 47/101 (47%), Positives = 62/101 (61%), Gaps = 4/101 (4%)
 Frame = +2

Query  179  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  346
            V++L    F   VL+S  V +VEF+APWCGHCK L P +   A+ +    KG   +AA+D
Sbjct  162  VIELTDDTFDKNVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAATEVKEQTKGKVKLAAVD  221

Query  347  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  469
            A  +  LA  YGI+GFPTIK+F  G+ PVDY G R    +V
Sbjct  222  ATVNQVLANRYGIRGFPTIKIFQKGEPPVDYDGGRTKSDIV  262



>ref|XP_005085000.1| PREDICTED: protein disulfide-isomerase A6 [Mesocricetus auratus]
Length=445

 Score =   162 bits (411),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 87/177 (49%), Positives = 116/177 (66%), Gaps = 7/177 (4%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            N LY  S  V++L PSNF  +V+ SN + LVEF+APWCGHC+ LTP ++K A+ LK V  
Sbjct  23   NGLYSSSDDVIELTPSNFNREVIQSNSLWLVEFYAPWCGHCQRLTPEWKKAATALKDVVK  82

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  508
            V A+DAD H SL  +YG++GFPTIK+F   K +P DYQG R  +++VD   + +R L+KD
Sbjct  83   VGAVDADKHQSLGGQYGVQGFPTIKIFGANKNKPEDYQGGRTGEAIVDAALSALRQLVKD  142

Query  509  RLDGKATG------GSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            RL G++ G      G    S     +EL    FD  V+ S D+W+VEF+APWCGHCK
Sbjct  143  RLSGRSGGYSSGKQGRGDSSSKKDVIELTDDTFDKNVLDSDDVWMVEFYAPWCGHCK  199


 Score = 88.2 bits (217),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 47/101 (47%), Positives = 63/101 (62%), Gaps = 4/101 (4%)
 Frame = +2

Query  179  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  346
            V++L    F   VL+S+ V +VEF+APWCGHCK L P +   A+ +    KG   +AA+D
Sbjct  167  VIELTDDTFDKNVLDSDDVWMVEFYAPWCGHCKNLEPEWAAAATEVKEQTKGKVKLAAVD  226

Query  347  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  469
            A  +  LA  YGI+GFPTIK+F  G+ PVDY G R    +V
Sbjct  227  ATVNQVLASRYGIRGFPTIKIFQKGESPVDYDGGRTRSDIV  267



>ref|XP_004746019.1| PREDICTED: protein disulfide-isomerase A6 [Mustela putorius furo]
 ref|XP_004790281.1| PREDICTED: protein disulfide-isomerase A6 [Mustela putorius furo]
Length=454

 Score =   162 bits (411),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 87/177 (49%), Positives = 117/177 (66%), Gaps = 7/177 (4%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            N LY  S  V++L PSNF  +V+ S+ + LVEF+APWCGHC+ LTP ++K A+ LK V  
Sbjct  32   NGLYSSSDDVIELTPSNFNREVIQSDSLWLVEFYAPWCGHCQRLTPEWKKAATALKDVVK  91

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  508
            V A+DAD H SL  +YG++GFPTIK+F   K +P DYQG R  +++VD     +R L+KD
Sbjct  92   VGAVDADKHQSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTGEAIVDAALGALRQLVKD  151

Query  509  RLDGKATG------GSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            RL G+  G      G S+ S     +EL   +FD  V+ S D+W+VEF+APWCGHCK
Sbjct  152  RLGGRGGGYSSGKQGRSESSSKKDVIELTDDSFDKNVLDSDDVWMVEFYAPWCGHCK  208


 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 65/101 (64%), Gaps = 4/101 (4%)
 Frame = +2

Query  179  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLK----GVATVaald  346
            V++L   +F   VL+S+ V +VEF+APWCGHCK L P +   A+ +K    G   +AA+D
Sbjct  176  VIELTDDSFDKNVLDSDDVWMVEFYAPWCGHCKNLEPEWAAAATEVKEQTQGKVKLAAVD  235

Query  347  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  469
            A A+  LA  YGI+GFPTIK+F  G+ PVDY G R    +V
Sbjct  236  ATANQFLASRYGIRGFPTIKIFQKGESPVDYDGGRTRSDIV  276



>ref|XP_005014200.1| PREDICTED: protein disulfide-isomerase A6 [Anas platyrhynchos]
Length=393

 Score =   161 bits (408),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 84/182 (46%), Positives = 117/182 (64%), Gaps = 16/182 (9%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            N LY  S  V++L P+NF  +V+ S+ + LVEF+APWCGHC+ LTP ++K A+ LKGV  
Sbjct  21   NGLYSASDDVIELTPTNFNKEVIQSDSLWLVEFYAPWCGHCQRLTPEWKKAATALKGVVK  80

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPV-DYQGAREAKSMVDFVKAQIRNLLKD  508
            V A+DAD H SL  +YG++GFPTIK+F   K    DYQG R + ++VD   + +R+L+KD
Sbjct  81   VGAVDADKHQSLGGQYGVRGFPTIKIFGANKNKAEDYQGGRTSDAIVDAALSALRSLVKD  140

Query  509  RL-----------DGKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGH  655
            RL             + +GG  +K      +EL   +FD  V+ S D+W+VEF+APWCGH
Sbjct  141  RLSGRSGGYSSGRQSRESGGGDKKD----VIELTDDSFDKNVINSDDVWMVEFYAPWCGH  196

Query  656  CK  661
            CK
Sbjct  197  CK  198


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 33/52 (63%), Gaps = 0/52 (0%)
 Frame = +2

Query  164  GPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLK  319
            G    V++L   +F   V+NS+ V +VEF+APWCGHCK L P +   A+ +K
Sbjct  161  GDKKDVIELTDDSFDKNVINSDDVWMVEFYAPWCGHCKNLEPEWAAAATEVK  212



>gb|EDK98487.1| protein disulfide isomerase associated 6, isoform CRA_a [Mus 
musculus]
Length=414

 Score =   162 bits (409),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 86/177 (49%), Positives = 118/177 (67%), Gaps = 7/177 (4%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            + LY  S  V++L PSNF  +V+ S+G+ LVEF+APWCGHC+ LTP ++K A+ LK V  
Sbjct  23   SGLYSSSDDVIELTPSNFNREVIQSDGLWLVEFYAPWCGHCQRLTPEWKKAATALKDVVK  82

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  508
            V A++AD H SL  +YG++GFPTIK+F   K +P DYQG R  +++VD   + +R L+KD
Sbjct  83   VGAVNADKHQSLGGQYGVQGFPTIKIFGANKNKPEDYQGGRTGEAIVDAALSALRQLVKD  142

Query  509  RLDGKATG------GSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            RL G++ G      G    S     VEL    FD  V+ S+D+W+VEF+APWCGHCK
Sbjct  143  RLGGRSGGYSSGKQGRGDSSSKKDVVELTDDTFDKNVLDSEDVWMVEFYAPWCGHCK  199


 Score = 87.0 bits (214),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 62/101 (61%), Gaps = 4/101 (4%)
 Frame = +2

Query  179  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  346
            V++L    F   VL+S  V +VEF+APWCGHCK L P +   A+ +    KG   +AA+D
Sbjct  167  VVELTDDTFDKNVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAATEVKEQTKGKVKLAAVD  226

Query  347  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  469
            A  +  LA  YGIKGFPTIK+F  G+ PVDY G R    +V
Sbjct  227  ATVNQVLASRYGIKGFPTIKIFQKGESPVDYDGGRTRSDIV  267



>ref|XP_008395805.1| PREDICTED: protein disulfide-isomerase A6 isoform X2 [Poecilia 
reticulata]
Length=439

 Score =   162 bits (410),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 86/174 (49%), Positives = 118/174 (68%), Gaps = 5/174 (3%)
 Frame = +2

Query  155  ALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVATV  334
            A+Y  S  V++L PSNF  +V+ S+ + LVEF+APWCGHC+ L P ++K A+ LKG+  V
Sbjct  19   AMYSSSDDVIELTPSNFNREVIQSDSLWLVEFYAPWCGHCQNLAPEWKKAATALKGIVKV  78

Query  335  aaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKDR  511
             A+DAD H SL  +YG++GFPTIKVF   K +P +YQG R ++++VD     +R L+K+R
Sbjct  79   GAVDADQHKSLGGQYGVRGFPTIKVFGANKNKPEEYQGGRSSQAIVDGAMNALRTLVKER  138

Query  512  LDGKATGGSSQKSEPSAS----VELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            L G++ G S  K     S    VEL   NFD+ V+   D+W+VEFFAPWCGHCK
Sbjct  139  LSGRSGGSSYSKQSSGGSKKDVVELTDDNFDETVLNGDDVWLVEFFAPWCGHCK  192


 Score = 93.6 bits (231),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 48/107 (45%), Positives = 65/107 (61%), Gaps = 4/107 (4%)
 Frame = +2

Query  164  GPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVAT  331
            G    V++L   NF   VLN + V LVEFFAPWCGHCK L P +   A+ +    KG   
Sbjct  155  GSKKDVVELTDDNFDETVLNGDDVWLVEFFAPWCGHCKNLEPEWAAAATAVKEQTKGKVR  214

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVD  472
            + A+DA  H  ++  YGI+GFPTIK+F  G++P DYQG R    +++
Sbjct  215  LGAVDATVHQVVSSRYGIRGFPTIKIFRKGEEPEDYQGGRTRGDIIE  261



>ref|NP_001269634.1| protein disulfide-isomerase A6 isoform b [Homo sapiens]
Length=488

 Score =   163 bits (412),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 87/177 (49%), Positives = 119/177 (67%), Gaps = 7/177 (4%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            N LY  S  V++L PSNF  +V+ S+ + LVEF+APWCGHC+ LTP ++K A+ LK V  
Sbjct  66   NGLYSSSDDVIELTPSNFNREVIQSDSLWLVEFYAPWCGHCQRLTPEWKKAATALKDVVK  125

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  508
            V A+DAD H SL  +YG++GFPTIK+F   K +P DYQG R  +++VD   + +R L+KD
Sbjct  126  VGAVDADKHHSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTGEAIVDAALSALRQLVKD  185

Query  509  RLDGKATG------GSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            RL G++ G      G S  S     +EL   +FD  V+ S+D+W+VEF+APWCGHCK
Sbjct  186  RLGGRSGGYSSGKQGRSDSSSKKDVIELTDDSFDKNVLDSEDVWMVEFYAPWCGHCK  242


 Score = 88.6 bits (218),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 63/101 (62%), Gaps = 4/101 (4%)
 Frame = +2

Query  179  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  346
            V++L   +F   VL+S  V +VEF+APWCGHCK L P +   AS +    KG   +AA+D
Sbjct  210  VIELTDDSFDKNVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAASEVKEQTKGKVKLAAVD  269

Query  347  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  469
            A  +  LA  YGI+GFPTIK+F  G+ PVDY G R    +V
Sbjct  270  ATVNQVLASRYGIRGFPTIKIFQKGESPVDYDGGRTRSDIV  310



>dbj|BAG54757.1| unnamed protein product [Homo sapiens]
Length=488

 Score =   163 bits (412),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 87/177 (49%), Positives = 119/177 (67%), Gaps = 7/177 (4%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            N LY  S  V++L PSNF  +V+ S+ + LVEF+APWCGHC+ LTP ++K A+ LK V  
Sbjct  66   NGLYSSSDDVIELTPSNFNREVIQSDSLWLVEFYAPWCGHCQRLTPEWKKAATALKDVVK  125

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  508
            V A+DAD H SL  +YG++GFPTIK+F   K +P DYQG R  +++VD   + +R L+KD
Sbjct  126  VGAVDADKHHSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTGEAIVDAALSALRQLVKD  185

Query  509  RLDGKATG------GSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            RL G++ G      G S  S     +EL   +FD  V+ S+D+W+VEF+APWCGHCK
Sbjct  186  RLGGRSGGYSSGKQGRSDSSSKKDVIELTDDSFDKNVLDSEDVWMVEFYAPWCGHCK  242


 Score = 88.6 bits (218),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 63/101 (62%), Gaps = 4/101 (4%)
 Frame = +2

Query  179  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  346
            V++L   +F   VL+S  V +VEF+APWCGHCK L P +   AS +    KG   +AA+D
Sbjct  210  VIELTDDSFDKNVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAASEVKEQTKGRVKLAAVD  269

Query  347  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  469
            A  +  LA  YGI+GFPTIK+F  G+ PVDY G R    +V
Sbjct  270  ATVNQVLASRYGIRGFPTIKIFQKGESPVDYDGGRTRSDIV  310



>ref|XP_003272792.1| PREDICTED: LOW QUALITY PROTEIN: protein disulfide-isomerase A6 
[Nomascus leucogenys]
Length=441

 Score =   162 bits (409),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 87/177 (49%), Positives = 119/177 (67%), Gaps = 7/177 (4%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            N LY  S  V++L PSNF  +V+ S+ V LVEF+APWCGHC+ LTP ++K A+ LK V  
Sbjct  18   NGLYSSSDDVIELTPSNFNREVIQSDSVWLVEFYAPWCGHCQRLTPEWKKAATALKDVVK  77

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  508
            V A+DAD H SL  +YG++GFPTIK+F   K +P DYQG R  +++VD   + +R L+K+
Sbjct  78   VGAVDADKHHSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTGEAIVDAALSALRQLVKE  137

Query  509  RLDGKATG------GSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            RL G++ G      G S  S     +EL   +FD  V+ S+D+W+VEF+APWCGHCK
Sbjct  138  RLGGQSGGYSSGKQGRSDSSSKKDVIELTDDSFDKNVLDSEDVWMVEFYAPWCGHCK  194


 Score = 88.2 bits (217),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 63/101 (62%), Gaps = 4/101 (4%)
 Frame = +2

Query  179  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  346
            V++L   +F   VL+S  V +VEF+APWCGHCK L P +   AS +    KG   +AA+D
Sbjct  162  VIELTDDSFDKNVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAASEVKEQTKGKVKLAAVD  221

Query  347  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  469
            A  +  LA  YGI+GFPTIK+F  G+ PVDY G R    +V
Sbjct  222  ATVNQVLASRYGIRGFPTIKIFQKGESPVDYDGGRTRSDIV  262



>gb|EMP42001.1| Protein disulfide-isomerase A6, partial [Chelonia mydas]
Length=465

 Score =   162 bits (410),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 85/183 (46%), Positives = 119/183 (65%), Gaps = 17/183 (9%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            N+LY  S  V++L P+NF  +V+ S+ + LVEF+APWCGHC+ LTP ++K A+ LKGV  
Sbjct  14   NSLYSSSDDVIELTPTNFNKEVIQSDSLWLVEFYAPWCGHCQRLTPEWKKAATALKGVVK  73

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPV-DYQGAREAKSMVDFVKAQIRNLLKD  508
            V A+DAD H SL  +YG++GFPTIK+F   K    DYQG R ++++VD   + +R+L+KD
Sbjct  74   VGAVDADKHQSLGGQYGVRGFPTIKIFGSNKNKAEDYQGGRTSEAIVDAALSTLRSLVKD  133

Query  509  RL------------DGKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCG  652
            RL              + +GG  +K      +EL   +FD  VV S D+W+VEF+APWCG
Sbjct  134  RLSGRSGGYSSGKQSSRESGGGDKKD----VIELTDDSFDKNVVNSDDVWLVEFYAPWCG  189

Query  653  HCK  661
            HCK
Sbjct  190  HCK  192


 Score = 90.9 bits (224),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 49/106 (46%), Positives = 65/106 (61%), Gaps = 4/106 (4%)
 Frame = +2

Query  164  GPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVAT  331
            G    V++L   +F   V+NS+ V LVEF+APWCGHCK L P +   A+ +    KG   
Sbjct  155  GDKKDVIELTDDSFDKNVVNSDDVWLVEFYAPWCGHCKNLEPEWAAAATEVKEQTKGKVK  214

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  469
            +AA+DA  +  LA  YGI+GFPTIK+F  G+ PVDY G R    +V
Sbjct  215  LAAVDATVNQMLASRYGIRGFPTIKIFQKGEDPVDYDGGRTRSDIV  260



>ref|XP_005246202.1| PREDICTED: protein disulfide-isomerase A6 isoform X3 [Homo sapiens]
Length=447

 Score =   162 bits (410),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 87/177 (49%), Positives = 119/177 (67%), Gaps = 7/177 (4%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            N LY  S  V++L PSNF  +V+ S+ + LVEF+APWCGHC+ LTP ++K A+ LK V  
Sbjct  18   NGLYSSSDDVIELTPSNFNREVIQSDSLWLVEFYAPWCGHCQRLTPEWKKAATALKDVVK  77

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  508
            V A+DAD H SL  +YG++GFPTIK+F   K +P DYQG R  +++VD   + +R L+KD
Sbjct  78   VGAVDADKHHSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTGEAIVDAALSALRQLVKD  137

Query  509  RLDGKATG------GSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            RL G++ G      G S  S     +EL   +FD  V+ S+D+W+VEF+APWCGHCK
Sbjct  138  RLGGRSGGYSSGKQGRSDSSSKKDVIELTDDSFDKNVLDSEDVWMVEFYAPWCGHCK  194


 Score = 87.8 bits (216),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 63/101 (62%), Gaps = 4/101 (4%)
 Frame = +2

Query  179  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  346
            V++L   +F   VL+S  V +VEF+APWCGHCK L P +   AS +    KG   +AA+D
Sbjct  162  VIELTDDSFDKNVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAASEVKEQTKGKVKLAAVD  221

Query  347  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  469
            A  +  LA  YGI+GFPTIK+F  G+ PVDY G R    +V
Sbjct  222  ATVNQVLASRYGIRGFPTIKIFQKGESPVDYDGGRTRSDIV  262



>ref|XP_009806227.1| PREDICTED: protein disulfide-isomerase A6 [Gavia stellata]
Length=444

 Score =   162 bits (409),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 85/182 (47%), Positives = 116/182 (64%), Gaps = 16/182 (9%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            N LY  S  V++L P+NF  +V+ S  + LVEF+APWCGHC+ LTP ++K A+ LKGV  
Sbjct  21   NGLYSASDDVIELTPTNFNKEVIQSESLWLVEFYAPWCGHCQRLTPEWKKAATALKGVVK  80

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPV-DYQGAREAKSMVDFVKAQIRNLLKD  508
            V A+DAD H SL  +YG++GFPTIK+F   K    DYQG R + S+VD   + +R+L+KD
Sbjct  81   VGAVDADKHQSLGGQYGVRGFPTIKIFGANKNKAEDYQGGRTSDSIVDAALSALRSLVKD  140

Query  509  RL-----------DGKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGH  655
            RL             + +GG  +K      +EL   +FD  V+ S D+W+VEF+APWCGH
Sbjct  141  RLSGRSGGYSSGKQSRESGGGDKKD----VIELTDDSFDKNVINSDDVWMVEFYAPWCGH  196

Query  656  CK  661
            CK
Sbjct  197  CK  198


 Score = 89.4 bits (220),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 47/106 (44%), Positives = 65/106 (61%), Gaps = 4/106 (4%)
 Frame = +2

Query  164  GPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVAT  331
            G    V++L   +F   V+NS+ V +VEF+APWCGHCK L P +   A+ +    KG   
Sbjct  161  GDKKDVIELTDDSFDKNVINSDDVWMVEFYAPWCGHCKNLEPEWAAAATEVKEQTKGKVK  220

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  469
            +AA+DA  +  LA  YGI+GFPTIK+F  G+ PVDY G R    ++
Sbjct  221  LAAVDATINQMLAGRYGIRGFPTIKIFQKGEDPVDYDGGRTRSDII  266



>ref|XP_002758076.1| PREDICTED: protein disulfide-isomerase A6 [Callithrix jacchus]
Length=440

 Score =   162 bits (409),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 87/180 (48%), Positives = 119/180 (66%), Gaps = 13/180 (7%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            N LY  S  V++L PSNF  +V+ S+ + LVEF+APWCGHC+ LTP ++K A+ LK V  
Sbjct  18   NGLYSSSDDVIELTPSNFNREVIQSDSLWLVEFYAPWCGHCQRLTPEWKKAATALKDVVK  77

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  508
            V A+DAD H SL  +YG++GFPTIK+F   K +P DYQG R  +++VD   + +R L+KD
Sbjct  78   VGAVDADKHQSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTGEAIVDAALSALRQLVKD  137

Query  509  RLDG---------KATGGSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            RL G         +  G SS K +    +EL   +FD  V+ S+D+W+VEF+APWCGHCK
Sbjct  138  RLGGRSGGYSSGKQGRGDSSSKKD---VIELTDDSFDQNVLDSEDVWMVEFYAPWCGHCK  194


 Score = 88.6 bits (218),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 63/101 (62%), Gaps = 4/101 (4%)
 Frame = +2

Query  179  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  346
            V++L   +F   VL+S  V +VEF+APWCGHCK L P +   AS +    KG   +AA+D
Sbjct  162  VIELTDDSFDQNVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAASEVKEQTKGKVKLAAVD  221

Query  347  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  469
            A  +  LA  YGI+GFPTIK+F  G+ PVDY G R    +V
Sbjct  222  ATVNQVLASRYGIRGFPTIKIFQKGESPVDYDGGRTRSDIV  262



>ref|XP_010850414.1| PREDICTED: protein disulfide-isomerase A6 [Bison bison bison]
Length=540

 Score =   163 bits (413),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 88/180 (49%), Positives = 119/180 (66%), Gaps = 13/180 (7%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            N LY  S  V++L PSNF  +V+ S+ + LVEF+APWCGHC+ LTP ++K A+ LK V  
Sbjct  118  NGLYSSSDDVIELTPSNFNREVIQSDSLWLVEFYAPWCGHCQRLTPEWKKAATALKDVVK  177

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  508
            V A+DAD H SL  +YG++GFPTIK+F   K +P DYQG R  +++VD   + +R L+KD
Sbjct  178  VGAVDADKHQSLGGQYGVQGFPTIKIFGSNKNKPEDYQGGRTGEAIVDAALSALRQLVKD  237

Query  509  RLDG---------KATGGSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            RL G         +  G SS K +    +EL   NFD  V+ S+D+W+VEF+APWCGHCK
Sbjct  238  RLGGRGSGYSSGKQGRGDSSSKKD---VIELTDDNFDKNVLDSEDVWMVEFYAPWCGHCK  294


 Score = 89.4 bits (220),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 63/101 (62%), Gaps = 4/101 (4%)
 Frame = +2

Query  179  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  346
            V++L   NF   VL+S  V +VEF+APWCGHCK L P +   A+ +    KG   +AA+D
Sbjct  262  VIELTDDNFDKNVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAATEVKEQTKGKVKLAAVD  321

Query  347  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  469
            A  +  LA  YGI+GFPTIK+F  G+ PVDY G R    +V
Sbjct  322  ATVNQVLASRYGIRGFPTIKIFQKGESPVDYDGGRTRSDIV  362



>ref|NP_082235.1| protein disulfide-isomerase A6 precursor [Mus musculus]
 dbj|BAC36392.1| unnamed protein product [Mus musculus]
 dbj|BAE38431.1| unnamed protein product [Mus musculus]
 dbj|BAE38578.1| unnamed protein product [Mus musculus]
 dbj|BAE31623.1| unnamed protein product [Mus musculus]
Length=445

 Score =   162 bits (409),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 86/177 (49%), Positives = 118/177 (67%), Gaps = 7/177 (4%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            + LY  S  V++L PSNF  +V+ S+G+ LVEF+APWCGHC+ LTP ++K A+ LK V  
Sbjct  23   SGLYSSSDDVIELTPSNFNREVIQSDGLWLVEFYAPWCGHCQRLTPEWKKAATALKDVVK  82

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  508
            V A++AD H SL  +YG++GFPTIK+F   K +P DYQG R  +++VD   + +R L+KD
Sbjct  83   VGAVNADKHQSLGGQYGVQGFPTIKIFGANKNKPEDYQGGRTGEAIVDAALSALRQLVKD  142

Query  509  RLDGKATG------GSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            RL G++ G      G    S     VEL    FD  V+ S+D+W+VEF+APWCGHCK
Sbjct  143  RLGGRSGGYSSGKQGRGDSSSKKDVVELTDDTFDKNVLDSEDVWMVEFYAPWCGHCK  199


 Score = 87.8 bits (216),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 62/101 (61%), Gaps = 4/101 (4%)
 Frame = +2

Query  179  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  346
            V++L    F   VL+S  V +VEF+APWCGHCK L P +   A+ +    KG   +AA+D
Sbjct  167  VVELTDDTFDKNVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAATEVKEQTKGKVKLAAVD  226

Query  347  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  469
            A  +  LA  YGIKGFPTIK+F  G+ PVDY G R    +V
Sbjct  227  ATMNQVLASRYGIKGFPTIKIFQKGESPVDYDGGRTRSDIV  267



>gb|AAH06865.2| Protein disulfide isomerase associated 6 [Mus musculus]
 dbj|BAE40104.1| unnamed protein product [Mus musculus]
 dbj|BAE40225.1| unnamed protein product [Mus musculus]
Length=445

 Score =   162 bits (409),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 86/177 (49%), Positives = 118/177 (67%), Gaps = 7/177 (4%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            + LY  S  V++L PSNF  +V+ S+G+ LVEF+APWCGHC+ LTP ++K A+ LK V  
Sbjct  23   SGLYSSSDDVIELTPSNFNREVIQSDGLWLVEFYAPWCGHCQRLTPEWKKAATALKDVVK  82

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  508
            V A++AD H SL  +YG++GFPTIK+F   K +P DYQG R  +++VD   + +R L+KD
Sbjct  83   VGAVNADKHQSLGGQYGVQGFPTIKIFGANKNKPEDYQGGRTGEAIVDAALSALRQLVKD  142

Query  509  RLDGKATG------GSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            RL G++ G      G    S     VEL    FD  V+ S+D+W+VEF+APWCGHCK
Sbjct  143  RLGGRSGGYSSGKQGRGDSSSKKDVVELTDDTFDKNVLDSEDVWMVEFYAPWCGHCK  199


 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 62/101 (61%), Gaps = 4/101 (4%)
 Frame = +2

Query  179  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  346
            V++L    F   VL+S  V +VEF+APWCGHCK L P +   A+ +    KG   +AA+D
Sbjct  167  VVELTDDTFDKNVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAATEVKEQTKGKVKLAAVD  226

Query  347  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  469
            A  +  LA  YGIKGFPTIK+F  G+ PVDY G R    +V
Sbjct  227  ATVNQVLASRYGIKGFPTIKIFQKGESPVDYDGGRTRSDIV  267



>ref|XP_010738984.1| PREDICTED: protein disulfide-isomerase A6 [Larimichthys crocea]
Length=441

 Score =   162 bits (409),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 85/178 (48%), Positives = 117/178 (66%), Gaps = 8/178 (4%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
             A Y  S  V+ L PSNF  +V+ S+ + LVEF+APWCGHC++LTP ++K A+ LKG+  
Sbjct  18   QAFYSASDDVIVLTPSNFNKEVIQSDSLWLVEFYAPWCGHCQSLTPDWKKAATALKGIVK  77

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  508
            + A+DAD H SL  +YG++GFPTIK+F   K +P +YQG R ++++VD     +RNL+KD
Sbjct  78   IGAVDADEHKSLGGQYGVRGFPTIKIFGANKNKPEEYQGGRSSQAIVDGAMNALRNLVKD  137

Query  509  RLDGKATGGSSQKSEPSAS-------VELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            RL GK+        +           VEL   NFD LV++  D+W+VEFFAPWCGHCK
Sbjct  138  RLSGKSGSSGGSGKQSGGGSGSKKDVVELTDDNFDKLVLEGDDVWMVEFFAPWCGHCK  195


 Score = 91.3 bits (225),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 46/102 (45%), Positives = 65/102 (64%), Gaps = 4/102 (4%)
 Frame = +2

Query  179  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  346
            V++L   NF   VL  + V +VEFFAPWCGHCK+L P +   AS +    KG   + A+D
Sbjct  163  VVELTDDNFDKLVLEGDDVWMVEFFAPWCGHCKSLEPEWAAAASAIKEQTKGKVRLGAVD  222

Query  347  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMVD  472
            A  H +++  YGI+GFPTIK+F  G++P DYQG R    +++
Sbjct  223  ATVHQAVSSRYGIRGFPTIKIFRKGEEPEDYQGGRSRGDIIE  264



>tpg|DAA24511.1| TPA: protein disulfide isomerase family A, member 6 [Bos taurus]
Length=590

 Score =   164 bits (414),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 88/180 (49%), Positives = 119/180 (66%), Gaps = 13/180 (7%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            N LY  S  V++L PSNF  +V+ S+ + LVEF+APWCGHC+ LTP ++K A+ LK V  
Sbjct  168  NGLYSSSDDVIELTPSNFNREVIQSDSLWLVEFYAPWCGHCQRLTPEWKKAATALKDVVK  227

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  508
            V A+DAD H SL  +YG++GFPTIK+F   K +P DYQG R  +++VD   + +R L+KD
Sbjct  228  VGAVDADKHQSLGGQYGVQGFPTIKIFGSNKNKPEDYQGGRTGEAIVDAALSALRQLVKD  287

Query  509  RLDG---------KATGGSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            RL G         +  G SS K +    +EL   NFD  V+ S+D+W+VEF+APWCGHCK
Sbjct  288  RLGGRGSGYSSGKQGRGDSSSKKD---VIELTDDNFDKNVLDSEDVWMVEFYAPWCGHCK  344


 Score = 89.7 bits (221),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 63/101 (62%), Gaps = 4/101 (4%)
 Frame = +2

Query  179  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  346
            V++L   NF   VL+S  V +VEF+APWCGHCK L P +   A+ +    KG   +AA+D
Sbjct  312  VIELTDDNFDKNVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAATEVKEQTKGKVKLAAVD  371

Query  347  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  469
            A  +  LA  YGI+GFPTIK+F  G+ PVDY G R    +V
Sbjct  372  ATVNQVLASRYGIRGFPTIKIFQKGESPVDYDGGRTRSDIV  412



>emb|CAA55891.1| CaBP1 [Rattus norvegicus]
Length=431

 Score =   161 bits (408),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 88/180 (49%), Positives = 119/180 (66%), Gaps = 13/180 (7%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            +ALY  S  V++L PSNF  +V+ S+ + LVEF+APWCGHC+ LTP ++K AS LK V  
Sbjct  9    SALYSSSDDVIELTPSNFNREVIQSDSLWLVEFYAPWCGHCQRLTPEWKKAASALKDVVK  68

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  508
            V A++AD H SL  +YG++GFPTIK+F   K +P DYQG R  +++VD   + +R L+KD
Sbjct  69   VGAVNADKHQSLGGQYGVQGFPTIKIFGANKNKPEDYQGGRTGEAIVDAALSALRQLVKD  128

Query  509  RLDG---------KATGGSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            RL G         +  G SS K +    VEL    FD  V+ S+D+W+VEF+APWCGHCK
Sbjct  129  RLGGRSGGYSSGKQGRGDSSSKKD---VVELTDDTFDKNVLDSEDVWMVEFYAPWCGHCK  185


 Score = 87.8 bits (216),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 62/101 (61%), Gaps = 4/101 (4%)
 Frame = +2

Query  179  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  346
            V++L    F   VL+S  V +VEF+APWCGHCK L P +   A+ +    KG   +AA+D
Sbjct  153  VVELTDDTFDKNVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAATEVKEQTKGKVKLAAVD  212

Query  347  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  469
            A  +  LA  YGIKGFPTIK+F  G+ PVDY G R    +V
Sbjct  213  ATVNQVLASRYGIKGFPTIKIFQKGESPVDYDGGRTRSDIV  253



>gb|KFV41194.1| Protein disulfide-isomerase A6, partial [Gavia stellata]
Length=440

 Score =   161 bits (408),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 85/182 (47%), Positives = 116/182 (64%), Gaps = 16/182 (9%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            N LY  S  V++L P+NF  +V+ S  + LVEF+APWCGHC+ LTP ++K A+ LKGV  
Sbjct  17   NGLYSASDDVIELTPTNFNKEVIQSESLWLVEFYAPWCGHCQRLTPEWKKAATALKGVVK  76

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPV-DYQGAREAKSMVDFVKAQIRNLLKD  508
            V A+DAD H SL  +YG++GFPTIK+F   K    DYQG R + S+VD   + +R+L+KD
Sbjct  77   VGAVDADKHQSLGGQYGVRGFPTIKIFGANKNKAEDYQGGRTSDSIVDAALSALRSLVKD  136

Query  509  RL-----------DGKATGGSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGH  655
            RL             + +GG  +K      +EL   +FD  V+ S D+W+VEF+APWCGH
Sbjct  137  RLSGRSGGYSSGKQSRESGGGDKKD----VIELTDDSFDKNVINSDDVWMVEFYAPWCGH  192

Query  656  CK  661
            CK
Sbjct  193  CK  194


 Score = 89.0 bits (219),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 47/106 (44%), Positives = 65/106 (61%), Gaps = 4/106 (4%)
 Frame = +2

Query  164  GPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVAT  331
            G    V++L   +F   V+NS+ V +VEF+APWCGHCK L P +   A+ +    KG   
Sbjct  157  GDKKDVIELTDDSFDKNVINSDDVWMVEFYAPWCGHCKNLEPEWAAAATEVKEQTKGKVK  216

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  469
            +AA+DA  +  LA  YGI+GFPTIK+F  G+ PVDY G R    ++
Sbjct  217  LAAVDATINQMLAGRYGIRGFPTIKIFQKGEDPVDYDGGRTRSDII  262



>sp|Q922R8.3|PDIA6_MOUSE RecName: Full=Protein disulfide-isomerase A6; AltName: Full=Thioredoxin 
domain-containing protein 7; Flags: Precursor [Mus 
musculus]
Length=440

 Score =   161 bits (408),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 86/177 (49%), Positives = 118/177 (67%), Gaps = 7/177 (4%)
 Frame = +2

Query  152  NALYGPSTPVLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVLKGVAT  331
            + LY  S  V++L PSNF  +V+ S+G+ LVEF+APWCGHC+ LTP ++K A+ LK V  
Sbjct  18   SGLYSSSDDVIELTPSNFNREVIQSDGLWLVEFYAPWCGHCQRLTPEWKKAATALKDVVK  77

Query  332  VaaldadahsslaQEYGIKGFPTIKVFVPGK-QPVDYQGAREAKSMVDFVKAQIRNLLKD  508
            V A++AD H SL  +YG++GFPTIK+F   K +P DYQG R  +++VD   + +R L+KD
Sbjct  78   VGAVNADKHQSLGGQYGVQGFPTIKIFGANKNKPEDYQGGRTGEAIVDAALSALRQLVKD  137

Query  509  RLDGKATG------GSSQKSEPSASVELNSRNFDDLVVKSKDLWIVEFFAPWCGHCK  661
            RL G++ G      G    S     VEL    FD  V+ S+D+W+VEF+APWCGHCK
Sbjct  138  RLGGRSGGYSSGKQGRGDSSSKKDVVELTDDTFDKNVLDSEDVWMVEFYAPWCGHCK  194


 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 62/101 (61%), Gaps = 4/101 (4%)
 Frame = +2

Query  179  VLQLNPSNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTYEKVASVL----KGVATVaald  346
            V++L    F   VL+S  V +VEF+APWCGHCK L P +   A+ +    KG   +AA+D
Sbjct  162  VVELTDDTFDKNVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAATEVKEQTKGKVKLAAVD  221

Query  347  adahsslaQEYGIKGFPTIKVFVPGKQPVDYQGAREAKSMV  469
            A  +  LA  YGIKGFPTIK+F  G+ PVDY G R    +V
Sbjct  222  ATVNQVLASRYGIKGFPTIKIFQKGESPVDYDGGRTRSDIV  262



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1023687230320