BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF045O23

Length=754
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009796493.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    316   6e-99   Nicotiana sylvestris
ref|XP_009614011.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6    315   7e-99   Nicotiana tomentosiformis
ref|XP_009619763.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    308   3e-96   Nicotiana tomentosiformis
emb|CDO97777.1|  unnamed protein product                                308   4e-96   Coffea canephora [robusta coffee]
ref|XP_011072711.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7    306   3e-95   Sesamum indicum [beniseed]
ref|XP_004235517.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6    303   5e-94   
ref|XP_009788970.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    302   8e-94   Nicotiana sylvestris
ref|XP_009788969.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    302   1e-93   Nicotiana sylvestris
ref|XP_009777355.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    301   1e-93   Nicotiana sylvestris
ref|XP_009777352.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    301   1e-93   Nicotiana sylvestris
ref|XP_011079189.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    300   2e-93   Sesamum indicum [beniseed]
ref|XP_006357429.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    300   5e-93   
ref|XP_009591325.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    295   5e-91   Nicotiana tomentosiformis
ref|XP_004241858.2|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    293   2e-90   Solanum lycopersicum
gb|EYU21256.1|  hypothetical protein MIMGU_mgv1a002171mg                293   2e-90   Erythranthe guttata [common monkey flower]
gb|EYU21255.1|  hypothetical protein MIMGU_mgv1a002171mg                293   2e-90   Erythranthe guttata [common monkey flower]
ref|XP_006342885.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    290   3e-89   Solanum tuberosum [potatoes]
gb|ABO31100.1|  ovule receptor-like kinase 28                           288   2e-88   Solanum chacoense
gb|EPS61932.1|  ovule receptor-like kinase 28                           282   2e-86   Genlisea aurea
ref|XP_010654359.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6    280   2e-85   Vitis vinifera
ref|XP_004252624.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6    280   3e-85   Solanum lycopersicum
ref|XP_006362102.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    278   1e-84   Solanum tuberosum [potatoes]
emb|CBI35784.3|  unnamed protein product                                277   4e-84   Vitis vinifera
gb|KDP40614.1|  hypothetical protein JCGZ_24613                         257   1e-76   Jatropha curcas
ref|XP_010273793.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6    257   2e-76   Nelumbo nucifera [Indian lotus]
emb|CDY36601.1|  BnaC06g06540D                                          255   4e-76   Brassica napus [oilseed rape]
gb|AAG51973.1|AC024260_11  leucine-rich repeat transmembrane prot...    249   2e-75   Arabidopsis thaliana [mouse-ear cress]
emb|CDY24077.1|  BnaA06g00750D                                          254   2e-75   Brassica napus [oilseed rape]
ref|XP_010462281.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    254   2e-75   Camelina sativa [gold-of-pleasure]
ref|XP_009147586.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6    253   3e-75   Brassica rapa
ref|XP_010479951.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    253   3e-75   Camelina sativa [gold-of-pleasure]
ref|XP_010501035.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6    253   4e-75   Camelina sativa [gold-of-pleasure]
ref|XP_011048642.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6    252   8e-75   Populus euphratica
ref|XP_006392758.1|  hypothetical protein EUTSA_v10011271mg             252   8e-75   Eutrema salsugineum [saltwater cress]
ref|XP_010685195.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    251   2e-74   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006304699.1|  hypothetical protein CARUB_v10011957mg             250   6e-74   Capsella rubella
ref|XP_010542346.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7    250   6e-74   Tarenaya hassleriana [spider flower]
gb|ABB20817.1|  putative leucine-rich repeat transmembrane protei...    250   7e-74   Isatis tinctoria [woad]
ref|XP_010033635.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    249   9e-74   Eucalyptus grandis [rose gum]
ref|NP_175777.1|  STRUBBELIG-receptor family 6                          249   1e-73   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001077716.1|  STRUBBELIG-receptor family 6                       249   1e-73   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009106960.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6    249   1e-73   Brassica rapa
gb|KFK38799.1|  hypothetical protein AALP_AA3G161700                    249   1e-73   Arabis alpina [alpine rockcress]
ref|NP_974312.1|  STRUBBELIG-receptor family 7 protein                  246   1e-72   Arabidopsis thaliana [mouse-ear cress]
gb|KFK35699.1|  hypothetical protein AALP_AA4G025700                    246   2e-72   Arabis alpina [alpine rockcress]
ref|NP_188052.2|  STRUBBELIG-receptor family 7 protein                  246   2e-72   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008380807.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6    246   2e-72   
ref|XP_006392757.1|  hypothetical protein EUTSA_v10011271mg             246   2e-72   
ref|XP_008372915.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    246   2e-72   Malus domestica [apple tree]
emb|CDY02495.1|  BnaA08g01020D                                          246   3e-72   
ref|XP_006369070.1|  leucine-rich repeat transmembrane protein ki...    244   9e-72   
emb|CDY25686.1|  BnaC03g69890D                                          244   1e-71   Brassica napus [oilseed rape]
gb|KCW53999.1|  hypothetical protein EUGRSUZ_J03194                     243   3e-71   Eucalyptus grandis [rose gum]
ref|XP_010489831.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    235   5e-71   Camelina sativa [gold-of-pleasure]
ref|XP_010034888.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    242   5e-71   
ref|XP_004303773.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7    242   6e-71   Fragaria vesca subsp. vesca
ref|XP_002891770.1|  hypothetical protein ARALYDRAFT_474507             242   7e-71   
ref|XP_008465033.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    241   1e-70   
ref|XP_008465035.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    241   1e-70   Cucumis melo [Oriental melon]
ref|XP_006300068.1|  hypothetical protein CARUB_v10016296mg             241   1e-70   Capsella rubella
ref|XP_011011656.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    240   2e-70   Populus euphratica
ref|XP_002320001.2|  leucine-rich repeat transmembrane protein ki...    239   3e-70   
ref|XP_010655240.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    238   4e-70   
ref|XP_002513297.1|  strubbelig receptor, putative                      239   6e-70   
ref|XP_010501850.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7    239   6e-70   Camelina sativa [gold-of-pleasure]
ref|XP_010465325.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    239   7e-70   Camelina sativa [gold-of-pleasure]
ref|XP_006426818.1|  hypothetical protein CICLE_v10025011mg             239   8e-70   Citrus clementina [clementine]
ref|XP_008800485.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    239   8e-70   
ref|XP_004144448.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    238   1e-69   Cucumis sativus [cucumbers]
emb|CBI18374.3|  unnamed protein product                                238   1e-69   Vitis vinifera
ref|XP_010655239.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    238   1e-69   Vitis vinifera
ref|XP_004165988.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    238   1e-69   
ref|XP_010928729.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    238   2e-69   
ref|XP_011012291.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    238   2e-69   Populus euphratica
gb|KHN16389.1|  Protein STRUBBELIG-RECEPTOR FAMILY 6                    238   2e-69   Glycine soja [wild soybean]
ref|XP_010245765.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    238   3e-69   
ref|XP_006604928.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    237   4e-69   Glycine max [soybeans]
emb|CDX97567.1|  BnaA05g25120D                                          237   4e-69   
gb|KDO67050.1|  hypothetical protein CISIN_1g040888mg                   232   5e-69   Citrus sinensis [apfelsine]
ref|NP_974311.1|  STRUBBELIG-receptor family 7 protein                  235   9e-69   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007139054.1|  hypothetical protein PHAVU_009G260900g             233   1e-68   Phaseolus vulgaris [French bean]
ref|XP_008781708.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    235   2e-68   Phoenix dactylifera
ref|XP_009146380.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7    235   3e-68   Brassica rapa
ref|XP_009383597.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    234   5e-68   Musa acuminata subsp. malaccensis [pisang utan]
gb|AFQ91933.1|  leucine-rich repeat receptor-like kinase                233   7e-68   Brassica rapa subsp. oleifera [biennial turnip rape]
ref|XP_006465790.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    234   7e-68   Citrus sinensis [apfelsine]
ref|XP_007139053.1|  hypothetical protein PHAVU_009G260900g             233   9e-68   Phaseolus vulgaris [French bean]
ref|XP_011031832.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    233   1e-67   Populus euphratica
ref|XP_006488603.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    232   2e-67   Citrus sinensis [apfelsine]
ref|XP_002461023.1|  hypothetical protein SORBIDRAFT_02g039370          232   3e-67   Sorghum bicolor [broomcorn]
ref|XP_010534991.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    232   3e-67   Tarenaya hassleriana [spider flower]
gb|KHG25534.1|  protein strubbelig-receptor family 6                    231   5e-67   Gossypium arboreum [tree cotton]
gb|KHG12209.1|  Protein STRUBBELIG-RECEPTOR FAMILY 6                    231   6e-67   Gossypium arboreum [tree cotton]
ref|XP_003627481.1|  Protein STRUBBELIG-RECEPTOR FAMILY                 231   7e-67   Medicago truncatula
ref|XP_008465036.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    230   9e-67   
gb|KJB57112.1|  hypothetical protein B456_009G148500                    231   1e-66   Gossypium raimondii
ref|XP_010087069.1|  Protein STRUBBELIG-RECEPTOR FAMILY 5               229   2e-66   Morus notabilis
ref|XP_008668240.1|  PREDICTED: uncharacterized protein LOC100381...    229   2e-66   
gb|KDP25030.1|  hypothetical protein JCGZ_22565                         229   2e-66   Jatropha curcas
ref|XP_002885038.1|  hypothetical protein ARALYDRAFT_478852             229   2e-66   
ref|XP_002304260.2|  hypothetical protein POPTR_0003s07130g             229   3e-66   
ref|XP_008668239.1|  PREDICTED: uncharacterized protein LOC100381...    229   3e-66   Zea mays [maize]
gb|KJB67062.1|  hypothetical protein B456_010G172500                    226   7e-66   Gossypium raimondii
ref|XP_008228094.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7    228   7e-66   Prunus mume [ume]
gb|KJB67061.1|  hypothetical protein B456_010G172500                    227   7e-66   Gossypium raimondii
ref|XP_004958321.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    228   1e-65   Setaria italica
ref|XP_009116969.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    228   1e-65   Brassica rapa
gb|KGN45432.1|  hypothetical protein Csa_7G447940                       216   1e-65   
ref|XP_004159013.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    216   2e-65   
emb|CDX98445.1|  BnaC05g39300D                                          227   2e-65   
ref|XP_002468389.1|  hypothetical protein SORBIDRAFT_01g045010          227   3e-65   Sorghum bicolor [broomcorn]
ref|XP_008462231.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    226   3e-65   Cucumis melo [Oriental melon]
gb|KGN45433.1|  hypothetical protein Csa_7G447950                       226   3e-65   
ref|XP_004159012.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    226   3e-65   
emb|CDY39110.1|  BnaA01g29460D                                          226   3e-65   Brassica napus [oilseed rape]
ref|XP_004488910.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    226   4e-65   Cicer arietinum [garbanzo]
ref|XP_008445635.1|  PREDICTED: LOW QUALITY PROTEIN: protein STRU...    226   6e-65   
ref|XP_008653345.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    226   6e-65   Zea mays [maize]
ref|XP_004959657.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    225   8e-65   
ref|XP_009408730.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    225   1e-64   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001049184.1|  Os03g0183800                                       225   1e-64   
ref|XP_009386772.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    225   1e-64   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006407090.1|  hypothetical protein EUTSA_v10020162mg             224   2e-64   Eutrema salsugineum [saltwater cress]
ref|XP_006604929.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    224   2e-64   
gb|KGN45936.1|  hypothetical protein Csa_6G024930                       224   2e-64   Cucumis sativus [cucumbers]
ref|XP_002465165.1|  hypothetical protein SORBIDRAFT_01g033190          224   3e-64   Sorghum bicolor [broomcorn]
ref|XP_008651693.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    224   3e-64   
ref|XP_010252506.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    224   4e-64   Nelumbo nucifera [Indian lotus]
ref|XP_002310348.1|  leucine-rich repeat transmembrane protein ki...    223   4e-64   
ref|XP_007213628.1|  hypothetical protein PRUPE_ppa002088mg             223   6e-64   
ref|XP_006649512.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    223   8e-64   
ref|XP_010096526.1|  Protein STRUBBELIG-RECEPTOR FAMILY 6               222   8e-64   
gb|KHN38109.1|  Protein STRUBBELIG-RECEPTOR FAMILY 5                    222   1e-63   Glycine soja [wild soybean]
ref|XP_009398614.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    222   1e-63   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006586431.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    222   1e-63   
ref|XP_011031253.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5    221   1e-63   Populus euphratica
ref|XP_009388759.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    222   1e-63   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006583189.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    222   2e-63   Glycine max [soybeans]
ref|XP_009388758.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    222   2e-63   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006389935.1|  hypothetical protein EUTSA_v10019668mg             221   4e-63   Eutrema salsugineum [saltwater cress]
gb|KHG12210.1|  Protein STRUBBELIG-RECEPTOR FAMILY 6                    220   4e-63   Gossypium arboreum [tree cotton]
ref|XP_007024796.1|  Strubbelig-receptor family 6                       221   5e-63   
emb|CDY33226.1|  BnaC01g36990D                                          220   5e-63   Brassica napus [oilseed rape]
ref|XP_004138532.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    219   6e-63   Cucumis sativus [cucumbers]
gb|EPS68087.1|  hypothetical protein M569_06686                         219   6e-63   Genlisea aurea
ref|XP_010244139.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    220   8e-63   Nelumbo nucifera [Indian lotus]
ref|XP_011072790.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5    220   8e-63   Sesamum indicum [beniseed]
ref|XP_008224758.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8    220   9e-63   Prunus mume [ume]
ref|NP_001104882.1|  leucine-rich repeat transmembrane protein ki...    219   1e-62   Zea mays [maize]
ref|XP_004494892.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    219   1e-62   Cicer arietinum [garbanzo]
gb|AFW89442.1|  putative STRUBBELIG family receptor protein kinase      219   2e-62   
ref|XP_006598761.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    219   2e-62   
gb|KCW77015.1|  hypothetical protein EUGRSUZ_D01360                     219   2e-62   Eucalyptus grandis [rose gum]
gb|KJB69229.1|  hypothetical protein B456_011G011800                    216   2e-62   Gossypium raimondii
ref|XP_010537758.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    218   2e-62   Tarenaya hassleriana [spider flower]
ref|XP_010052883.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    218   3e-62   Eucalyptus grandis [rose gum]
ref|XP_010052884.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    218   3e-62   Eucalyptus grandis [rose gum]
ref|XP_003604115.1|  Protein STRUBBELIG-RECEPTOR FAMILY                 219   4e-62   
ref|XP_003562663.2|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    222   4e-62   Brachypodium distachyon [annual false brome]
ref|XP_009106613.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5    218   4e-62   Brassica rapa
emb|CDX87418.1|  BnaA07g34550D                                          218   5e-62   
ref|XP_007135873.1|  hypothetical protein PHAVU_010G165200g             218   5e-62   Phaseolus vulgaris [French bean]
emb|CDX88495.1|  BnaC06g39390D                                          217   5e-62   
ref|XP_010913801.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    216   6e-62   Elaeis guineensis
gb|EEC85048.1|  hypothetical protein OsI_32379                          217   6e-62   Oryza sativa Indica Group [Indian rice]
ref|NP_001060286.1|  Os07g0618400                                       218   7e-62   
gb|EYU33875.1|  hypothetical protein MIMGU_mgv1a002066mg                218   7e-62   Erythranthe guttata [common monkey flower]
dbj|BAC10113.1|  putative leucine-rich repeat transmembrane prote...    217   7e-62   Oryza sativa Japonica Group [Japonica rice]
gb|EEC82450.1|  hypothetical protein OsI_26884                          217   8e-62   Oryza sativa Indica Group [Indian rice]
gb|ADM07445.1|  leucine-rich repeat receptor-like protein kinase        217   8e-62   Glycine soja [wild soybean]
ref|XP_011460016.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8    217   9e-62   Fragaria vesca subsp. vesca
ref|XP_006657962.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    217   9e-62   
gb|EEC81030.1|  hypothetical protein OsI_23812                          217   9e-62   Oryza sativa Indica Group [Indian rice]
gb|KEH18524.1|  strubbelig-receptor family 6 protein                    216   1e-61   Medicago truncatula
ref|XP_004985465.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    217   1e-61   Setaria italica
gb|KJB69230.1|  hypothetical protein B456_011G011800                    216   1e-61   Gossypium raimondii
ref|XP_010913799.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    216   2e-61   Elaeis guineensis
ref|NP_001064502.1|  Os10g0389800                                       216   2e-61   
gb|AAC27894.1|  leucine-rich repeat transmembrane protein kinase 1      216   2e-61   Zea mays [maize]
gb|KHG18134.1|  protein strubbelig-receptor family 6                    216   2e-61   Gossypium arboreum [tree cotton]
gb|EEE70214.1|  hypothetical protein OsJ_30326                          216   2e-61   Oryza sativa Japonica Group [Japonica rice]
ref|NP_178019.2|  STRUBBELIG-receptor family 5                          216   2e-61   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001063921.1|  Os09g0559900                                       216   2e-61   
ref|XP_008649054.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    216   2e-61   Zea mays [maize]
ref|XP_008649053.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    216   2e-61   Zea mays [maize]
ref|XP_008653346.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    215   3e-61   
gb|KJB69228.1|  hypothetical protein B456_011G011800                    216   3e-61   Gossypium raimondii
gb|KJB70030.1|  hypothetical protein B456_011G054100                    215   3e-61   Gossypium raimondii
ref|XP_008649051.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    216   4e-61   Zea mays [maize]
ref|XP_008649052.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    216   4e-61   Zea mays [maize]
ref|XP_007023606.1|  Strubbelig-receptor family 5 isoform 2             216   5e-61   
ref|XP_007217016.1|  hypothetical protein PRUPE_ppa002092mg             215   6e-61   Prunus persica
ref|XP_007023605.1|  Strubbelig-receptor family 5 isoform 1             216   6e-61   
ref|XP_009344017.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    214   1e-60   Pyrus x bretschneideri [bai li]
ref|XP_009391183.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    214   1e-60   Musa acuminata subsp. malaccensis [pisang utan]
gb|KEH24658.1|  strubbelig-receptor family protein                      214   1e-60   Medicago truncatula
ref|XP_006836581.1|  hypothetical protein AMTR_s00131p00083660          214   1e-60   Amborella trichopoda
gb|KFK42269.1|  hypothetical protein AALP_AA2G233600                    213   2e-60   Arabis alpina [alpine rockcress]
tpg|DAA46921.1|  TPA: putative STRUBBELIG family receptor protein...    205   2e-60   
gb|KHG11352.1|  protein strubbelig-receptor family 8                    213   3e-60   Gossypium arboreum [tree cotton]
ref|XP_009346024.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    213   4e-60   Pyrus x bretschneideri [bai li]
ref|XP_003558655.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    213   4e-60   Brachypodium distachyon [annual false brome]
ref|XP_004983096.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    212   6e-60   Setaria italica
ref|XP_008228078.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5    212   8e-60   
gb|AAP12946.1|  putative leucine-rich repeat transmembrane protei...    211   2e-59   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010417514.1|  PREDICTED: LOW QUALITY PROTEIN: protein STRU...    210   2e-59   Camelina sativa [gold-of-pleasure]
gb|EAY90345.1|  hypothetical protein OsI_11922                          211   2e-59   Oryza sativa Indica Group [Indian rice]
gb|AFW70556.1|  putative STRUBBELIG family receptor protein kinase      210   2e-59   
ref|XP_008659801.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    210   3e-59   Zea mays [maize]
gb|AFW87368.1|  putative STRUBBELIG family receptor protein kinase      210   3e-59   
gb|EAZ27223.1|  hypothetical protein OsJ_11161                          211   4e-59   Oryza sativa Japonica Group [Japonica rice]
gb|AFW87367.1|  putative STRUBBELIG family receptor protein kinase      210   4e-59   
ref|XP_010474484.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    209   4e-59   
ref|XP_008645353.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    209   5e-59   Zea mays [maize]
gb|KDO78353.1|  hypothetical protein CISIN_1g005001mg                   204   6e-59   Citrus sinensis [apfelsine]
ref|XP_008380425.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    209   6e-59   
dbj|BAK07184.1|  predicted protein                                      209   6e-59   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002889223.1|  ATP binding protein                                209   6e-59   
ref|XP_010235400.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    209   7e-59   
ref|XP_009406399.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    209   8e-59   
ref|XP_002267170.2|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8    209   1e-58   Vitis vinifera
ref|XP_010429764.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    207   1e-58   
ref|XP_010099162.1|  Protein STRUBBELIG-RECEPTOR FAMILY 8               209   1e-58   
ref|XP_007217699.1|  hypothetical protein PRUPE_ppa002458mg             208   1e-58   
tpg|DAA46922.1|  TPA: putative STRUBBELIG family receptor protein...    207   2e-58   
ref|XP_004510591.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    208   2e-58   Cicer arietinum [garbanzo]
ref|XP_004965804.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    207   3e-58   Setaria italica
ref|XP_008659003.1|  PREDICTED: leucine-rich repeat transmembrane...    207   3e-58   
gb|KDO78351.1|  hypothetical protein CISIN_1g005001mg                   205   4e-58   Citrus sinensis [apfelsine]
ref|NP_001167741.1|  uncharacterized protein LOC100381429 precursor     207   4e-58   Zea mays [maize]
ref|XP_007135353.1|  hypothetical protein PHAVU_010G122100g             207   5e-58   Phaseolus vulgaris [French bean]
ref|XP_006597598.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    206   6e-58   Glycine max [soybeans]
ref|XP_006301930.1|  hypothetical protein CARUB_v10022406mg             206   6e-58   Capsella rubella
ref|XP_003571057.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8    206   6e-58   Brachypodium distachyon [annual false brome]
ref|XP_006650171.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    206   8e-58   Oryza brachyantha
gb|KDO78349.1|  hypothetical protein CISIN_1g005001mg                   205   8e-58   Citrus sinensis [apfelsine]
gb|KDO78348.1|  hypothetical protein CISIN_1g005001mg                   205   8e-58   Citrus sinensis [apfelsine]
ref|XP_006449792.1|  hypothetical protein CICLE_v10014418mg             205   8e-58   
emb|CDP04441.1|  unnamed protein product                                206   1e-57   Coffea canephora [robusta coffee]
ref|XP_010686780.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8    206   1e-57   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009781362.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    206   1e-57   Nicotiana sylvestris
ref|XP_004951618.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    206   1e-57   Setaria italica
ref|XP_010539255.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    205   2e-57   Tarenaya hassleriana [spider flower]
ref|XP_010539262.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    205   2e-57   Tarenaya hassleriana [spider flower]
ref|XP_010539270.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    205   2e-57   Tarenaya hassleriana [spider flower]
dbj|BAG99361.1|  unnamed protein product                                205   2e-57   Oryza sativa Japonica Group [Japonica rice]
dbj|BAK02781.1|  predicted protein                                      205   2e-57   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008458998.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    205   2e-57   Cucumis melo [Oriental melon]
ref|XP_009386651.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    205   2e-57   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006467380.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    205   2e-57   Citrus sinensis [apfelsine]
gb|KDO78347.1|  hypothetical protein CISIN_1g005001mg                   205   3e-57   Citrus sinensis [apfelsine]
gb|EMS47769.1|  Protein STRUBBELIG-RECEPTOR FAMILY 6                    204   3e-57   Triticum urartu
ref|XP_006449794.1|  hypothetical protein CICLE_v10014418mg             204   4e-57   Citrus clementina [clementine]
ref|XP_006648399.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    204   5e-57   
ref|XP_006586762.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    203   8e-57   Glycine max [soybeans]
ref|XP_004145432.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    203   1e-56   Cucumis sativus [cucumbers]
ref|XP_011002569.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    203   1e-56   Populus euphratica
gb|KJB56462.1|  hypothetical protein B456_009G120500                    203   1e-56   Gossypium raimondii
ref|XP_009777356.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    201   2e-56   Nicotiana sylvestris
gb|KHN01483.1|  Protein STRUBBELIG-RECEPTOR FAMILY 6                    202   3e-56   Glycine soja [wild soybean]
ref|XP_010538738.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    202   3e-56   Tarenaya hassleriana [spider flower]
ref|XP_009613682.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8    202   3e-56   Nicotiana tomentosiformis
ref|XP_008783422.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    202   4e-56   Phoenix dactylifera
ref|XP_002316561.2|  hypothetical protein POPTR_0011s01540g             201   4e-56   
ref|XP_006413689.1|  hypothetical protein EUTSA_v10024563mg             201   6e-56   Eutrema salsugineum [saltwater cress]
ref|XP_009357210.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    201   7e-56   Pyrus x bretschneideri [bai li]
ref|XP_003563583.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    201   8e-56   
ref|XP_004232684.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8    201   8e-56   Solanum lycopersicum
ref|XP_004985464.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    201   8e-56   Setaria italica
gb|KJB67277.1|  hypothetical protein B456_010G183400                    198   1e-55   Gossypium raimondii
gb|EEC66871.1|  hypothetical protein OsI_33412                          200   1e-55   Oryza sativa Indica Group [Indian rice]
ref|XP_008355924.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    200   2e-55   
gb|KJB67280.1|  hypothetical protein B456_010G183400                    198   2e-55   Gossypium raimondii
ref|XP_011467514.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5    199   2e-55   Fragaria vesca subsp. vesca
ref|XP_010939841.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    199   3e-55   Elaeis guineensis
ref|XP_007026173.1|  STRUBBELIG-receptor family 8 isoform 1             199   3e-55   
gb|EPS69681.1|  hypothetical protein M569_05081                         199   3e-55   Genlisea aurea
ref|XP_009146553.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 4    198   4e-55   Brassica rapa
gb|KJB67278.1|  hypothetical protein B456_010G183400                    198   5e-55   Gossypium raimondii
ref|XP_009777766.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8    198   7e-55   
gb|KJB67276.1|  hypothetical protein B456_010G183400                    198   8e-55   
ref|XP_009616310.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    197   1e-54   
ref|XP_002869840.1|  kinase                                             197   1e-54   
ref|XP_008651696.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    197   2e-54   
ref|XP_007147687.1|  hypothetical protein PHAVU_006G146100g             197   2e-54   
emb|CDO97730.1|  unnamed protein product                                197   2e-54   
ref|XP_006357453.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    196   2e-54   
emb|CDY43376.1|  BnaA01g30070D                                          196   2e-54   
ref|XP_009781363.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    196   3e-54   
ref|XP_006407265.1|  hypothetical protein EUTSA_v10020193mg             196   3e-54   
ref|XP_009124710.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    196   3e-54   
ref|XP_006300119.1|  hypothetical protein CARUB_v10016348mg             196   3e-54   
ref|XP_010696137.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    196   3e-54   
emb|CDY44024.1|  BnaA05g26190D                                          196   3e-54   
gb|KFK38641.1|  hypothetical protein AALP_AA3G141300                    196   5e-54   
ref|XP_010465107.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 4    195   6e-54   
ref|XP_010228524.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    195   6e-54   
gb|KDP20703.1|  hypothetical protein JCGZ_21174                         195   8e-54   
ref|XP_003557758.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    195   8e-54   
ref|XP_006348158.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    195   8e-54   
emb|CDY23563.1|  BnaC05g40310D                                          195   8e-54   
ref|XP_010322795.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    195   9e-54   
ref|XP_010937237.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    195   9e-54   
ref|NP_566444.4|  STRUBBELIG-receptor family 4                          195   1e-53   
gb|KCW90298.1|  hypothetical protein EUGRSUZ_A02440                     195   1e-53   
ref|XP_010057986.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 2    194   1e-53   
ref|XP_004241857.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    194   1e-53   
ref|XP_004164349.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    194   1e-53   
ref|XP_010487048.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    194   2e-53   
emb|CDX76385.1|  BnaA08g10150D                                          194   2e-53   
gb|ACG49227.1|  leucine-rich repeat transmembrane protein kinase 1      194   2e-53   
gb|AAC27896.1|  leucine-rich repeat transmembrane protein kinase 3      187   2e-53   
ref|XP_010552382.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 4    194   2e-53   
ref|XP_010499921.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    193   3e-53   
ref|XP_009108553.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8    193   4e-53   
ref|XP_010439362.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8    193   4e-53   
emb|CDY27444.1|  BnaC03g64840D                                          192   6e-53   
ref|XP_010434074.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    192   6e-53   
ref|XP_006661732.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    192   7e-53   
ref|XP_006850050.1|  hypothetical protein AMTR_s00022p00198910          192   7e-53   
ref|XP_008462232.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    192   8e-53   
ref|XP_010448928.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    192   8e-53   
ref|NP_193944.2|  STRUBBELIG-receptor family 8 protein                  192   1e-52   
ref|XP_002451696.1|  hypothetical protein SORBIDRAFT_04g006110          192   1e-52   
ref|XP_011046989.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    192   1e-52   
ref|XP_006284970.1|  hypothetical protein CARUB_v10006274mg             191   2e-52   
emb|CDX98961.1|  BnaC09g48740D                                          192   2e-52   
ref|XP_002532341.1|  Receptor protein kinase CLAVATA1 precursor, ...    191   3e-52   
emb|CDX70063.1|  BnaA10g24120D                                          191   3e-52   
ref|XP_011002570.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    191   3e-52   
emb|CDX79126.1|  BnaA01g11930D                                          191   3e-52   
ref|XP_009122296.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    191   4e-52   
ref|XP_009135627.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8    190   4e-52   
ref|XP_010696138.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    190   4e-52   
emb|CDX82908.1|  BnaC01g13580D                                          189   7e-52   
gb|KDP24601.1|  hypothetical protein JCGZ_25517                         189   1e-51   
ref|XP_011468063.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    189   1e-51   
gb|AAV64203.1|  leucine-rich repeat transmembrane protein kinase ...    188   2e-51   
ref|XP_006383865.1|  hypothetical protein POPTR_0004s00710g             185   2e-51   
gb|EYU39916.1|  hypothetical protein MIMGU_mgv1a001954mg                189   2e-51   
gb|AFW90526.1|  strubbelig-receptor family 6-like protein               188   2e-51   
ref|XP_007204855.1|  hypothetical protein PRUPE_ppa026263mg             188   2e-51   
gb|KDO50163.1|  hypothetical protein CISIN_1g039558mg                   187   4e-51   
ref|XP_006492890.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    187   4e-51   
ref|XP_009357487.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    187   4e-51   
ref|XP_006399158.1|  hypothetical protein EUTSA_v10012782mg             187   4e-51   
emb|CDP11378.1|  unnamed protein product                                180   5e-51   
ref|XP_006425179.1|  hypothetical protein CICLE_v10030356mg             186   5e-51   
gb|KFK25072.1|  hypothetical protein AALP_AA8G062600                    187   5e-51   
gb|EMT07607.1|  Protein STRUBBELIG-RECEPTOR FAMILY 7                    190   6e-51   
gb|KEH36931.1|  strubbelig-receptor family protein                      187   7e-51   
ref|XP_010943264.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    187   7e-51   
ref|XP_009385265.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    187   8e-51   
ref|XP_006383864.1|  hypothetical protein POPTR_0004s00710g             186   1e-50   
ref|XP_010943263.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    187   1e-50   
dbj|BAK05038.1|  predicted protein                                      186   1e-50   
ref|XP_008384096.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8    186   1e-50   
ref|XP_010928422.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    186   1e-50   
ref|XP_010534354.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    186   1e-50   
ref|XP_010534352.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    186   1e-50   
ref|XP_010914020.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8    186   2e-50   
ref|XP_002882805.1|  predicted protein                                  187   3e-50   
dbj|BAB01397.1|  protein kinase-like protein                            187   3e-50   
ref|XP_006429833.1|  hypothetical protein CICLE_v10013344mg             184   5e-50   
ref|XP_003576835.2|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5    184   6e-50   
ref|XP_011075267.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 2    184   1e-49   
ref|XP_008241034.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 2    184   1e-49   
gb|ACI49786.1|  At3g13065                                               183   1e-49   
ref|XP_011004818.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 2    182   3e-49   
ref|XP_008799289.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    182   4e-49   
ref|XP_010557935.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    181   6e-49   
gb|KFK28787.1|  hypothetical protein AALP_AA7G048200                    180   1e-48   
ref|XP_004136737.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    180   1e-48   
ref|XP_010672691.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 2    180   2e-48   
ref|XP_010928424.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    179   2e-48   
ref|XP_008443075.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 2    179   4e-48   
ref|XP_010456423.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    177   8e-48   
gb|EEC72655.1|  hypothetical protein OsI_06182                          178   9e-48   
gb|EMS56044.1|  Protein STRUBBELIG-RECEPTOR FAMILY 5                    177   1e-47   
ref|XP_002451714.1|  hypothetical protein SORBIDRAFT_04g006475          178   1e-47   
ref|XP_002467303.1|  hypothetical protein SORBIDRAFT_01g024160          177   1e-47   
ref|XP_009370199.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    177   2e-47   
gb|KGN59317.1|  hypothetical protein Csa_3G809930                       177   3e-47   
ref|NP_196300.1|  STRUBBELIG-receptor family 2                          176   3e-47   
ref|XP_002316560.2|  hypothetical protein POPTR_0011s01540g             174   4e-47   
gb|AAK52120.1|AC079936_16  Putative leucine-rich repeat transmemb...    176   4e-47   
ref|XP_010491264.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    176   5e-47   
emb|CDP20023.1|  unnamed protein product                                176   5e-47   
ref|XP_010423292.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    176   5e-47   
ref|XP_006287140.1|  hypothetical protein CARUB_v10000312mg             176   5e-47   
ref|XP_010423291.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    176   6e-47   
gb|EEE66066.1|  hypothetical protein OsJ_22073                          175   8e-47   
ref|XP_010257427.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    175   1e-46   
ref|XP_008392158.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 2    175   1e-46   
ref|XP_010257424.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    175   1e-46   
ref|XP_002871232.1|  hypothetical protein ARALYDRAFT_908613             175   1e-46   
ref|XP_010236315.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    175   1e-46   
ref|XP_009797583.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    174   2e-46   
emb|CAN80221.1|  hypothetical protein VITISV_027894                     174   2e-46   
ref|XP_011468043.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    171   3e-46   
ref|XP_002308374.2|  leucine-rich repeat transmembrane protein ki...    173   3e-46   
gb|KHN07244.1|  Protein STRUBBELIG-RECEPTOR FAMILY 2                    174   4e-46   
ref|XP_008803525.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    173   5e-46   
ref|XP_007028952.1|  STRUBBELIG-receptor family 2, putative             174   6e-46   
ref|XP_006845114.1|  hypothetical protein AMTR_s00005p00184180          162   7e-46   
ref|XP_009612111.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 2    173   7e-46   
ref|XP_009376134.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    172   8e-46   
ref|XP_010939842.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    172   1e-45   
gb|EMT01284.1|  Protein STRUBBELIG-RECEPTOR FAMILY 5                    172   1e-45   
gb|EEE67594.1|  hypothetical protein OsJ_25142                          171   2e-45   
ref|XP_006589916.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    171   2e-45   
ref|XP_002962278.1|  hypothetical protein SELMODRAFT_76873              171   2e-45   
ref|XP_010102562.1|  hypothetical protein L484_018034                   166   2e-45   
gb|KHN28754.1|  Protein STRUBBELIG-RECEPTOR FAMILY 2                    171   2e-45   
gb|EMT02096.1|  Protein STRUBBELIG-RECEPTOR FAMILY 6                    170   5e-45   
ref|NP_001046150.1|  Os02g0190500                                       170   6e-45   
ref|XP_010228525.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    169   8e-45   
ref|XP_010913800.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    168   2e-44   
ref|XP_004486188.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    168   3e-44   
ref|XP_006467381.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    167   4e-44   
gb|KEH41669.1|  strubbelig-receptor family 2 protein                    167   1e-43   
ref|XP_006661536.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    166   1e-43   
emb|CBI30038.3|  unnamed protein product                                166   1e-43   
ref|XP_006648415.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    166   3e-43   
gb|AFW66206.1|  putative STRUBBELIG family receptor protein kinase      162   7e-43   
gb|EPS64024.1|  hypothetical protein M569_10757                         164   7e-43   
ref|XP_010654321.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 2    164   9e-43   
ref|XP_006449793.1|  hypothetical protein CICLE_v10014418mg             164   1e-42   
ref|NP_001174920.1|  Os06g0634500                                       153   1e-42   
ref|XP_010533880.1|  PREDICTED: protein STRUBBELIG                      163   2e-42   
ref|XP_008679889.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    162   5e-42   
ref|XP_009781364.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    162   6e-42   
ref|XP_008783430.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    159   4e-41   
ref|XP_008465038.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    158   6e-41   
ref|XP_010526524.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    158   2e-40   
ref|XP_009385272.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    157   2e-40   
ref|XP_008439889.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    157   3e-40   
ref|XP_010476010.1|  PREDICTED: protein STRUBBELIG-like                 150   4e-40   
ref|XP_010905439.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    157   4e-40   
ref|XP_010905455.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    157   4e-40   
gb|KHG18089.1|  Protein STRUBBELIG -like protein                        157   4e-40   
ref|XP_011468044.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    153   5e-40   
ref|XP_006850999.1|  hypothetical protein AMTR_s00025p00216900          155   6e-40   
ref|XP_004507203.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    157   6e-40   
ref|NP_001046179.2|  Os02g0194600                                       156   1e-39   
ref|XP_006582789.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    154   3e-39   
ref|XP_011468064.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    154   4e-39   
gb|KJB69458.1|  hypothetical protein B456_011G024500                    153   4e-39   
gb|KHN41147.1|  Protein STRUBBELIG-RECEPTOR FAMILY 3                    154   5e-39   
gb|KHN22911.1|  Protein STRUBBELIG-RECEPTOR FAMILY 3                    154   5e-39   
ref|XP_009616311.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    153   5e-39   
gb|KJB69459.1|  hypothetical protein B456_011G024500                    154   6e-39   
ref|XP_008245351.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    147   2e-38   
ref|XP_008679890.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    151   2e-38   
ref|XP_008679888.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    152   2e-38   
ref|XP_010905434.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    150   7e-38   
ref|XP_010905397.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    150   8e-38   
ref|XP_010905417.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    150   8e-38   
ref|XP_010905426.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    150   8e-38   
ref|XP_010905405.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    150   8e-38   
ref|XP_010905390.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    150   8e-38   
ref|XP_010905411.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    150   9e-38   
gb|KEH39082.1|  strubbelig receptor family protein                      150   1e-37   
ref|XP_006467860.1|  PREDICTED: protein STRUBBELIG-like                 150   1e-37   
gb|AFW66318.1|  putative STRUBBELIG family receptor protein kinase      149   1e-37   
ref|XP_007132645.1|  hypothetical protein PHAVU_011G112700g             150   1e-37   
ref|XP_009797595.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    150   1e-37   
ref|XP_010317941.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 2    150   1e-37   
ref|XP_010458496.1|  PREDICTED: protein STRUBBELIG                      150   2e-37   
ref|XP_010278322.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    149   2e-37   
gb|KEH39081.1|  strubbelig receptor family protein                      149   2e-37   
ref|XP_010278328.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    149   2e-37   
ref|XP_001783845.1|  predicted protein                                  149   2e-37   
ref|XP_010557936.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    149   3e-37   
ref|XP_002453383.1|  hypothetical protein SORBIDRAFT_04g005115          149   3e-37   
ref|XP_010492393.1|  PREDICTED: protein STRUBBELIG-like                 149   3e-37   
gb|KEH29624.1|  strubbelig receptor family protein                      149   4e-37   
gb|KEH29625.1|  strubbelig receptor family protein                      149   4e-37   
ref|XP_002460659.1|  hypothetical protein SORBIDRAFT_02g032710          147   4e-37   
ref|XP_010556827.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 3    149   5e-37   
ref|XP_006396565.1|  hypothetical protein EUTSA_v100284770mg            144   5e-37   
ref|XP_006449268.1|  hypothetical protein CICLE_v10014419mg             148   5e-37   
emb|CDY65931.1|  BnaA03g55690D                                          148   5e-37   
ref|XP_010476014.1|  PREDICTED: protein STRUBBELIG-like                 148   5e-37   
ref|XP_008680888.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    149   6e-37   
ref|NP_001169655.1|  uncharacterized LOC100383536 precursor             149   6e-37   
ref|XP_008371312.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 3    148   6e-37   
ref|XP_004487313.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    148   6e-37   
ref|XP_009130964.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    148   6e-37   
ref|XP_004951728.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    148   6e-37   
ref|XP_009130963.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    147   7e-37   
gb|KDO51548.1|  hypothetical protein CISIN_1g003704mg                   146   9e-37   
gb|AFW76248.1|  putative STRUBBELIG family receptor protein kinase      148   1e-36   
ref|XP_009357082.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    147   1e-36   
gb|KDO51549.1|  hypothetical protein CISIN_1g003704mg                   147   1e-36   
ref|XP_007025732.1|  STRUBBELIG-receptor family 3, putative isofo...    145   2e-36   
gb|AFW76246.1|  putative STRUBBELIG family receptor protein kinas...    148   2e-36   
ref|XP_008658775.1|  PREDICTED: uncharacterized LOC100381650 isof...    147   2e-36   
ref|XP_003541551.2|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    146   2e-36   
ref|XP_008658773.1|  PREDICTED: uncharacterized LOC100381650 isof...    147   2e-36   



>ref|XP_009796493.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like [Nicotiana 
sylvestris]
Length=718

 Score =   316 bits (809),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 151/205 (74%), Positives = 175/205 (85%), Gaps = 1/205 (0%)
 Frame = +1

Query  142  IGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGN-  318
            IG L   P  A+ADTDP DAS LR ++ +LNSP QLTKWTANGGDPCGESWKG++CSGN 
Sbjct  15   IGILFYGPSYAIADTDPNDASALRVMYGALNSPGQLTKWTANGGDPCGESWKGITCSGNN  74

Query  319  RVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTG  498
            RVTEI++SGLQL+GS+G+QL  L SVT FDIS NNLGN LPYQLPPNVQ+LNLAGNGF G
Sbjct  75   RVTEIKLSGLQLSGSLGYQLASLTSVTNFDISNNNLGNQLPYQLPPNVQRLNLAGNGFNG  134

Query  499  GLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNM  678
            GLPYSISQM  L YLNVSHNQ+QG+VTV F SL++L+TLDFSFN++  N+PQ+F +LT+M
Sbjct  135  GLPYSISQMTSLRYLNVSHNQIQGQVTVAFDSLSSLNTLDFSFNAMTDNLPQSFKALTSM  194

Query  679  KNMYLQNNVFTGTIDVLANLPLDNL  753
              MYLQNN FTGTIDVLANLPLD+L
Sbjct  195  NKMYLQNNQFTGTIDVLANLPLDDL  219



>ref|XP_009614011.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6 [Nicotiana tomentosiformis]
Length=717

 Score =   315 bits (808),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 151/205 (74%), Positives = 175/205 (85%), Gaps = 1/205 (0%)
 Frame = +1

Query  142  IGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGN-  318
            IG L   P  A+ADTDP DAS LR ++ +LNSP QLTKWTANGGDPCGESWKG++CSGN 
Sbjct  15   IGILFYGPSYAIADTDPNDASALRVMYGALNSPGQLTKWTANGGDPCGESWKGITCSGNN  74

Query  319  RVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTG  498
            RVTEI++SGLQL+GS+G+QL  L SVT FDIS NNLGN LPYQLPPNVQ+LNLAGNGF G
Sbjct  75   RVTEIKLSGLQLSGSLGYQLASLTSVTNFDISNNNLGNQLPYQLPPNVQRLNLAGNGFNG  134

Query  499  GLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNM  678
            GLPYSISQM  L YLNVSHNQ+QG+VTV F SL++L+TLDFSFN++  N+PQ+F +LT+M
Sbjct  135  GLPYSISQMTSLRYLNVSHNQIQGQVTVAFDSLSSLNTLDFSFNAMTDNLPQSFKALTSM  194

Query  679  KNMYLQNNVFTGTIDVLANLPLDNL  753
              MYLQNN FTGTIDVLANLPLD+L
Sbjct  195  NKMYLQNNQFTGTIDVLANLPLDDL  219



>ref|XP_009619763.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like [Nicotiana 
tomentosiformis]
Length=707

 Score =   308 bits (790),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 147/191 (77%), Positives = 169/191 (88%), Gaps = 0/191 (0%)
 Frame = +1

Query  181  DTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTG  360
            DTDP+DASVLR L++SLNSP QLTKW+ANGGDPCGESW G++CSGNRVTEI+ISGL L+G
Sbjct  25   DTDPSDASVLRVLYTSLNSPAQLTKWSANGGDPCGESWTGITCSGNRVTEIKISGLGLSG  84

Query  361  SMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  540
            SMGFQLD LKSVT FDIS NN+G+ LP+QLPPNVQ+LNLA +GF GGLPYSISQM  L+Y
Sbjct  85   SMGFQLDSLKSVTNFDISNNNMGSQLPFQLPPNVQRLNLAASGFNGGLPYSISQMTSLQY  144

Query  541  LNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTI  720
            LNVSHNQ+QG VTV F SL+ L+TLDFSFNS+ GN+PQ+F SLT+M  MYLQNN FTGTI
Sbjct  145  LNVSHNQIQGSVTVAFDSLSALNTLDFSFNSMTGNLPQSFQSLTSMNKMYLQNNQFTGTI  204

Query  721  DVLANLPLDNL  753
            DVLANLPL +L
Sbjct  205  DVLANLPLGDL  215



>emb|CDO97777.1| unnamed protein product [Coffea canephora]
Length=712

 Score =   308 bits (789),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 154/218 (71%), Positives = 181/218 (83%), Gaps = 1/218 (0%)
 Frame = +1

Query  100  MRELMGLPWAVALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDP  279
            MRE+  L  AVALL   LL  P    ADTDP DA+VL  L+ SLNSP QLTKW  NGGDP
Sbjct  1    MREV-ELAAAVALLGCILLLGPSFTNADTDPNDAAVLFDLYKSLNSPSQLTKWNPNGGDP  59

Query  280  CGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPN  459
            C E+WKG++CSG+RVTEI++SGL LTGSMGF+LD+LKSVT FDIS NNLGN LP+QLP N
Sbjct  60   CNENWKGITCSGSRVTEIKLSGLGLTGSMGFELDKLKSVTNFDISNNNLGNQLPFQLPQN  119

Query  460  VQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLA  639
            VQ+LNLAGNGF GGLPYS+SQM  L+YLNVSHNQ QG+++ MF SLT+LSTLDFSFN ++
Sbjct  120  VQQLNLAGNGFNGGLPYSVSQMTSLKYLNVSHNQFQGQLSDMFASLTSLSTLDFSFNVMS  179

Query  640  GNIPQTFSSLTNMKNMYLQNNVFTGTIDVLANLPLDNL  753
            G++P++FSS T+M +M LQNN FTGTIDVLANLPLDNL
Sbjct  180  GDLPKSFSSCTSMTDMNLQNNQFTGTIDVLANLPLDNL  217



>ref|XP_011072711.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7 [Sesamum indicum]
Length=712

 Score =   306 bits (783),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 152/207 (73%), Positives = 173/207 (84%), Gaps = 4/207 (2%)
 Frame = +1

Query  133  ALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCS  312
            ALLIG     P S  ADTDPTDAS L  +++SLNSPP LT W  NGGDPCGESWKGVSCS
Sbjct  18   ALLIGI----PSSTNADTDPTDASTLNIMYTSLNSPPLLTNWKPNGGDPCGESWKGVSCS  73

Query  313  GNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGF  492
            G++VTEI+I GL LTG+MG+QLD+L SVTTFDIS NNLGN +P+QLPPNVQ+LNLAGNGF
Sbjct  74   GSKVTEIKIPGLGLTGNMGYQLDRLTSVTTFDISNNNLGNQIPFQLPPNVQRLNLAGNGF  133

Query  493  TGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLT  672
             GGLPYSIS M  L YLNVSHNQ+QG+V V F SLT+LSTLDFSFNSL  N+PQ+F SLT
Sbjct  134  NGGLPYSISLMTSLRYLNVSHNQIQGQVNVQFNSLTSLSTLDFSFNSLTDNLPQSFQSLT  193

Query  673  NMKNMYLQNNVFTGTIDVLANLPLDNL  753
            N+ +MYLQNN FTG++DVLANLPL NL
Sbjct  194  NINDMYLQNNQFTGSLDVLANLPLQNL  220



>ref|XP_004235517.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6 [Solanum lycopersicum]
Length=710

 Score =   303 bits (775),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 154/208 (74%), Positives = 177/208 (85%), Gaps = 0/208 (0%)
 Frame = +1

Query  130  VALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSC  309
            ++LLIG LL     A+ADTDP DAS LR L+SSLNSP QLTKW ANGGDPCGESW G++C
Sbjct  6    LSLLIGILLYCAYCAIADTDPNDASALRVLYSSLNSPGQLTKWNANGGDPCGESWTGITC  65

Query  310  SGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNG  489
            SGNRVTEI+ISGL L+GS+G+QL  L SVT FDIS NNLGN LP+QLPPNVQ+LNLA NG
Sbjct  66   SGNRVTEIKISGLGLSGSLGYQLTSLTSVTNFDISNNNLGNQLPFQLPPNVQRLNLAANG  125

Query  490  FTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSL  669
            F GGLPYSISQM  L YLNVSHNQ+QG+VTVMF SL++L TLDFSFNS+ G++PQ+F +L
Sbjct  126  FNGGLPYSISQMTSLRYLNVSHNQIQGQVTVMFDSLSSLDTLDFSFNSMTGDLPQSFKAL  185

Query  670  TNMKNMYLQNNVFTGTIDVLANLPLDNL  753
            T+M  MYLQNN FTGTIDVLANLPLD+L
Sbjct  186  TSMNKMYLQNNQFTGTIDVLANLPLDDL  213



>ref|XP_009788970.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like isoform 
X2 [Nicotiana sylvestris]
 ref|XP_009788971.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like isoform 
X2 [Nicotiana sylvestris]
Length=698

 Score =   302 bits (773),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 143/191 (75%), Positives = 168/191 (88%), Gaps = 0/191 (0%)
 Frame = +1

Query  181  DTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTG  360
            +TDP+DASVLR L++SLNSP QL KW+ANGGDPCGESW G++CSGNRVTEI+ISGL L+G
Sbjct  16   ETDPSDASVLRVLYTSLNSPAQLKKWSANGGDPCGESWTGITCSGNRVTEIKISGLALSG  75

Query  361  SMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  540
            SMGFQLD LKSVT FDIS NN+G+ LP+QLPPNVQ+LNLA +GF+GGLPYSISQM  L+Y
Sbjct  76   SMGFQLDSLKSVTNFDISNNNMGSQLPFQLPPNVQRLNLAASGFSGGLPYSISQMTSLQY  135

Query  541  LNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTI  720
            LNVSHNQ+QG VTV F SL+ L+TLDFSFNS+ GN+PQ+F  LT++  MYLQNN FTGTI
Sbjct  136  LNVSHNQIQGSVTVAFDSLSALNTLDFSFNSMTGNLPQSFQLLTSVNKMYLQNNQFTGTI  195

Query  721  DVLANLPLDNL  753
            DVLANLPL +L
Sbjct  196  DVLANLPLGDL  206



>ref|XP_009788969.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like isoform 
X1 [Nicotiana sylvestris]
Length=705

 Score =   302 bits (773),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 143/191 (75%), Positives = 168/191 (88%), Gaps = 0/191 (0%)
 Frame = +1

Query  181  DTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTG  360
            +TDP+DASVLR L++SLNSP QL KW+ANGGDPCGESW G++CSGNRVTEI+ISGL L+G
Sbjct  23   ETDPSDASVLRVLYTSLNSPAQLKKWSANGGDPCGESWTGITCSGNRVTEIKISGLALSG  82

Query  361  SMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  540
            SMGFQLD LKSVT FDIS NN+G+ LP+QLPPNVQ+LNLA +GF+GGLPYSISQM  L+Y
Sbjct  83   SMGFQLDSLKSVTNFDISNNNMGSQLPFQLPPNVQRLNLAASGFSGGLPYSISQMTSLQY  142

Query  541  LNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTI  720
            LNVSHNQ+QG VTV F SL+ L+TLDFSFNS+ GN+PQ+F  LT++  MYLQNN FTGTI
Sbjct  143  LNVSHNQIQGSVTVAFDSLSALNTLDFSFNSMTGNLPQSFQLLTSVNKMYLQNNQFTGTI  202

Query  721  DVLANLPLDNL  753
            DVLANLPL +L
Sbjct  203  DVLANLPLGDL  213



>ref|XP_009777355.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like isoform 
X2 [Nicotiana sylvestris]
Length=693

 Score =   301 bits (771),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 149/209 (71%), Positives = 174/209 (83%), Gaps = 4/209 (2%)
 Frame = +1

Query  130  VALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKW-TANGGDPCGESWKGVS  306
            VALL    +N+   A ADTDP+DAS LR ++SSLNSP QLT W +++G DPCGE WKG++
Sbjct  11   VALL---FVNSHSFANADTDPSDASALRVMYSSLNSPAQLTNWNSSDGSDPCGEFWKGIT  67

Query  307  CSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGN  486
            CSGNRVTEIQISGL L+GSMG+QL  L SVT FDIS NNLGN +PYQLPPNVQ+LNLA N
Sbjct  68   CSGNRVTEIQISGLGLSGSMGYQLTSLTSVTNFDISNNNLGNQIPYQLPPNVQRLNLAAN  127

Query  487  GFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSS  666
            GFTGGLPYSISQM  L+YLNVSHNQ+QGE+  MF SL++L+TLD SFNS+ G +PQ+F S
Sbjct  128  GFTGGLPYSISQMTSLQYLNVSHNQIQGELNDMFGSLSSLNTLDISFNSMTGKLPQSFQS  187

Query  667  LTNMKNMYLQNNVFTGTIDVLANLPLDNL  753
            LT+MK +YLQNN FTG IDVLANLPLDNL
Sbjct  188  LTSMKKIYLQNNQFTGNIDVLANLPLDNL  216



>ref|XP_009777352.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like isoform 
X1 [Nicotiana sylvestris]
 ref|XP_009777353.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like isoform 
X1 [Nicotiana sylvestris]
 ref|XP_009777354.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like isoform 
X1 [Nicotiana sylvestris]
Length=697

 Score =   301 bits (771),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 149/209 (71%), Positives = 174/209 (83%), Gaps = 4/209 (2%)
 Frame = +1

Query  130  VALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKW-TANGGDPCGESWKGVS  306
            VALL    +N+   A ADTDP+DAS LR ++SSLNSP QLT W +++G DPCGE WKG++
Sbjct  11   VALL---FVNSHSFANADTDPSDASALRVMYSSLNSPAQLTNWNSSDGSDPCGEFWKGIT  67

Query  307  CSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGN  486
            CSGNRVTEIQISGL L+GSMG+QL  L SVT FDIS NNLGN +PYQLPPNVQ+LNLA N
Sbjct  68   CSGNRVTEIQISGLGLSGSMGYQLTSLTSVTNFDISNNNLGNQIPYQLPPNVQRLNLAAN  127

Query  487  GFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSS  666
            GFTGGLPYSISQM  L+YLNVSHNQ+QGE+  MF SL++L+TLD SFNS+ G +PQ+F S
Sbjct  128  GFTGGLPYSISQMTSLQYLNVSHNQIQGELNDMFGSLSSLNTLDISFNSMTGKLPQSFQS  187

Query  667  LTNMKNMYLQNNVFTGTIDVLANLPLDNL  753
            LT+MK +YLQNN FTG IDVLANLPLDNL
Sbjct  188  LTSMKKIYLQNNQFTGNIDVLANLPLDNL  216



>ref|XP_011079189.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like [Sesamum 
indicum]
Length=688

 Score =   300 bits (769),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 144/192 (75%), Positives = 163/192 (85%), Gaps = 0/192 (0%)
 Frame = +1

Query  178  ADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLT  357
            ADTDP DAS L  L++SLNSP QLT W A+GGDPCGESWKG++CSG RVTEI ISGL L+
Sbjct  22   ADTDPADASALNILYTSLNSPQQLTNWKASGGDPCGESWKGITCSGTRVTEINISGLGLS  81

Query  358  GSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLE  537
            G+MG+QLD+L SVTTFDIS NNLGN +PYQLPPNVQ+LNLAGNGFT GLPYSIS M  L+
Sbjct  82   GNMGYQLDKLTSVTTFDISNNNLGNQIPYQLPPNVQRLNLAGNGFTAGLPYSISLMTSLK  141

Query  538  YLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGT  717
            YLNVSHNQ+QG V + F SLT LSTLDFSFNS+ G++PQ+  SLT MKNMYLQNN FTG 
Sbjct  142  YLNVSHNQIQGPVAISFGSLTALSTLDFSFNSMTGDLPQSLQSLTGMKNMYLQNNKFTGN  201

Query  718  IDVLANLPLDNL  753
            IDVL NLPL+NL
Sbjct  202  IDVLGNLPLENL  213



>ref|XP_006357429.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7-like [Solanum 
tuberosum]
Length=716

 Score =   300 bits (769),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 149/215 (69%), Positives = 178/215 (83%), Gaps = 2/215 (1%)
 Frame = +1

Query  112  MGLPWAVALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTA-NGGDPCGE  288
            M L   VALL  F+L+      ADTDP+D S LR ++SSLNSP QLTKW++ +GGDPCGE
Sbjct  26   MSLVVKVALLF-FILHGCSFINADTDPSDGSALRVMYSSLNSPGQLTKWSSSDGGDPCGE  84

Query  289  SWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQK  468
            SWKG++CSGNRVTEIQISGL L+GSMG+QL  L SVT FDIS NNLGN +PYQLPPNV++
Sbjct  85   SWKGITCSGNRVTEIQISGLGLSGSMGYQLMSLTSVTNFDISNNNLGNQIPYQLPPNVKR  144

Query  469  LNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNI  648
            LNLAGNGFTG LPYS+SQ+  L+YLNVSHNQ+QGE+  MF SL++L+TLD SFNS+ G +
Sbjct  145  LNLAGNGFTGVLPYSVSQITSLQYLNVSHNQIQGELNDMFGSLSSLNTLDISFNSMTGKL  204

Query  649  PQTFSSLTNMKNMYLQNNVFTGTIDVLANLPLDNL  753
            PQ+F SLT+MK +YLQNN FTG IDVLANLPLD+L
Sbjct  205  PQSFKSLTSMKKIYLQNNQFTGNIDVLANLPLDDL  239



>ref|XP_009591325.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like [Nicotiana 
tomentosiformis]
Length=701

 Score =   295 bits (754),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 142/195 (73%), Positives = 166/195 (85%), Gaps = 1/195 (1%)
 Frame = +1

Query  172  AVADTDPTDASVLRGLFSSLNSPPQLTKW-TANGGDPCGESWKGVSCSGNRVTEIQISGL  348
            A A TDP+DAS LR ++SSLNSP QLTKW +++G DPCGESWKG++C GNRV EI +SGL
Sbjct  22   ANAGTDPSDASALRVMYSSLNSPAQLTKWNSSDGSDPCGESWKGITCYGNRVNEIHLSGL  81

Query  349  QLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMA  528
             L+GSMG+QL  L SV  FDIS NNLGN +PYQLPPNVQKLNLAGNGFTGGLPYSISQMA
Sbjct  82   GLSGSMGYQLTSLTSVINFDISNNNLGNQIPYQLPPNVQKLNLAGNGFTGGLPYSISQMA  141

Query  529  PLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVF  708
             L+YLNVSHNQ+QGE+  MF SL++L+TLD SFNS+ G +PQ+F SLT+MK +YLQNN +
Sbjct  142  SLQYLNVSHNQIQGELNDMFGSLSSLNTLDISFNSMTGKLPQSFQSLTSMKKIYLQNNQY  201

Query  709  TGTIDVLANLPLDNL  753
            TG IDVLANLPLDNL
Sbjct  202  TGNIDVLANLPLDNL  216



>ref|XP_004241858.2| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7-like [Solanum 
lycopersicum]
Length=692

 Score =   293 bits (750),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 146/215 (68%), Positives = 174/215 (81%), Gaps = 2/215 (1%)
 Frame = +1

Query  112  MGLPWAVALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTA-NGGDPCGE  288
            M L   VALL  F+ N      ADTDP+D S LR ++SSLNSP QLTKW++  GGDPCGE
Sbjct  1    MSLVVKVALLF-FIFNGCSFINADTDPSDGSALRVMYSSLNSPGQLTKWSSSEGGDPCGE  59

Query  289  SWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQK  468
            SWKG++CSGNRVTEIQISGL L+GSMG+QL  L SVT FD+S NNLGN +PYQLPP V++
Sbjct  60   SWKGITCSGNRVTEIQISGLGLSGSMGYQLTSLTSVTNFDLSNNNLGNQIPYQLPPYVKR  119

Query  469  LNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNI  648
            LNLAGNGFTG LPYS+SQ+  L+YLNVSHNQ+QGE+  MF SL++L+TLD SFNS+ G +
Sbjct  120  LNLAGNGFTGVLPYSVSQITSLQYLNVSHNQIQGELNDMFGSLSSLNTLDISFNSMTGKL  179

Query  649  PQTFSSLTNMKNMYLQNNVFTGTIDVLANLPLDNL  753
            PQ+F SLT+MK +YLQNN FTG IDVLANLPL +L
Sbjct  180  PQSFKSLTSMKKIYLQNNQFTGNIDVLANLPLGDL  214



>gb|EYU21256.1| hypothetical protein MIMGU_mgv1a002171mg [Erythranthe guttata]
Length=704

 Score =   293 bits (751),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 147/214 (69%), Positives = 171/214 (80%), Gaps = 4/214 (2%)
 Frame = +1

Query  112  MGLPWAVALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGES  291
            M +  AVALLIG L        ADTDPTDAS L  L++SLNSP QLT W  +GGDPC ES
Sbjct  1    MAVVAAVALLIGIL----SFTGADTDPTDASTLNVLYTSLNSPQQLTNWKPSGGDPCAES  56

Query  292  WKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKL  471
            WKG++CSG++VTEI I GL L G+MGFQLD+L SVTTFDIS NNLGN +PYQLPPNV++L
Sbjct  57   WKGITCSGSKVTEINIPGLGLNGNMGFQLDKLTSVTTFDISNNNLGNQIPYQLPPNVERL  116

Query  472  NLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIP  651
            NLAGNGF  GLPYSIS M  L+YLN+SHNQ+QG+VTV F SLT L+TLDFSFNS   N+P
Sbjct  117  NLAGNGFNAGLPYSISLMGALKYLNLSHNQIQGQVTVQFTSLTGLTTLDFSFNSFTDNLP  176

Query  652  QTFSSLTNMKNMYLQNNVFTGTIDVLANLPLDNL  753
            Q+F SLT++ +MYLQNN FTGT+DVLA LPL NL
Sbjct  177  QSFQSLTSINDMYLQNNQFTGTLDVLALLPLQNL  210



>gb|EYU21255.1| hypothetical protein MIMGU_mgv1a002171mg [Erythranthe guttata]
Length=705

 Score =   293 bits (750),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 147/214 (69%), Positives = 171/214 (80%), Gaps = 4/214 (2%)
 Frame = +1

Query  112  MGLPWAVALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGES  291
            M +  AVALLIG L        ADTDPTDAS L  L++SLNSP QLT W  +GGDPC ES
Sbjct  1    MAVVAAVALLIGIL----SFTGADTDPTDASTLNVLYTSLNSPQQLTNWKPSGGDPCAES  56

Query  292  WKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKL  471
            WKG++CSG++VTEI I GL L G+MGFQLD+L SVTTFDIS NNLGN +PYQLPPNV++L
Sbjct  57   WKGITCSGSKVTEINIPGLGLNGNMGFQLDKLTSVTTFDISNNNLGNQIPYQLPPNVERL  116

Query  472  NLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIP  651
            NLAGNGF  GLPYSIS M  L+YLN+SHNQ+QG+VTV F SLT L+TLDFSFNS   N+P
Sbjct  117  NLAGNGFNAGLPYSISLMGALKYLNLSHNQIQGQVTVQFTSLTGLTTLDFSFNSFTDNLP  176

Query  652  QTFSSLTNMKNMYLQNNVFTGTIDVLANLPLDNL  753
            Q+F SLT++ +MYLQNN FTGT+DVLA LPL NL
Sbjct  177  QSFQSLTSINDMYLQNNQFTGTLDVLALLPLQNL  210



>ref|XP_006342885.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like [Solanum 
tuberosum]
Length=711

 Score =   290 bits (743),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 144/194 (74%), Positives = 168/194 (87%), Gaps = 0/194 (0%)
 Frame = +1

Query  172  AVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQ  351
            A+ADTDP DAS LR L+SSLNSP QLTKW ANGGDPCGESW G++CSGNRVTEI+ISGL 
Sbjct  21   AIADTDPNDASALRVLYSSLNSPGQLTKWNANGGDPCGESWTGITCSGNRVTEIKISGLG  80

Query  352  LTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAP  531
            L+GS+G+QL  L SVT FDIS NNLGN LPYQLPPNVQ+LNLA NGF G LPYS+SQM  
Sbjct  81   LSGSLGYQLASLTSVTNFDISNNNLGNQLPYQLPPNVQRLNLAANGFNGALPYSVSQMTS  140

Query  532  LEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFT  711
            L YLNVSHNQ+QG+VTV F SL++L+TLDFSFN++ G++PQ+F +LT+M  MYLQNN FT
Sbjct  141  LRYLNVSHNQIQGQVTVAFDSLSSLNTLDFSFNAMTGDLPQSFKALTSMNKMYLQNNQFT  200

Query  712  GTIDVLANLPLDNL  753
            GTID+LANLPLD+L
Sbjct  201  GTIDILANLPLDDL  214



>gb|ABO31100.1| ovule receptor-like kinase 28 [Solanum chacoense]
Length=711

 Score =   288 bits (737),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 143/194 (74%), Positives = 167/194 (86%), Gaps = 0/194 (0%)
 Frame = +1

Query  172  AVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQ  351
            A+ADTDP DAS LR L+SSLNSP QLTKW ANGG+PCGESW G++CSGNRVTEI+ISGL 
Sbjct  21   AIADTDPNDASALRVLYSSLNSPGQLTKWNANGGNPCGESWTGITCSGNRVTEIKISGLG  80

Query  352  LTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAP  531
            L+GS+G+QL  L SVT FDIS NNLGN LPYQLPPNVQ+LNLA NGF G LPYS+SQM  
Sbjct  81   LSGSLGYQLASLTSVTNFDISNNNLGNQLPYQLPPNVQRLNLAANGFNGALPYSVSQMTS  140

Query  532  LEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFT  711
            L YLNVSHNQ+QG+VTV F SL++L TLDFSFN++ G++PQ+F +LT+M  MYLQNN FT
Sbjct  141  LRYLNVSHNQIQGQVTVAFDSLSSLDTLDFSFNAMTGDLPQSFKALTSMNKMYLQNNQFT  200

Query  712  GTIDVLANLPLDNL  753
            GTID+LANLPLD+L
Sbjct  201  GTIDILANLPLDDL  214



>gb|EPS61932.1| ovule receptor-like kinase 28, partial [Genlisea aurea]
Length=704

 Score =   282 bits (722),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 145/206 (70%), Positives = 165/206 (80%), Gaps = 4/206 (2%)
 Frame = +1

Query  136  LLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSG  315
            LLIG       +A A TDPTDAS L  L++SLNSP QLT W + GGDPCGESW+GV+CSG
Sbjct  8    LLIGVF----SAAGATTDPTDASTLNALYASLNSPQQLTNWKSTGGDPCGESWRGVTCSG  63

Query  316  NRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFT  495
            +RVT+I ISGL LTG+MG+QL  L +VTTFDIS NNLGN +PYQLPPNVQ LNLAG  F 
Sbjct  64   SRVTQIVISGLGLTGNMGYQLLSLTAVTTFDISNNNLGNQIPYQLPPNVQTLNLAGCNFN  123

Query  496  GGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTN  675
             GLPYSIS M  L YLNVSHNQLQG+V V F SLT LSTLD SFN+L+  +PQ+F+SLT+
Sbjct  124  NGLPYSISYMNSLGYLNVSHNQLQGQVNVQFGSLTALSTLDLSFNALSDGLPQSFASLTS  183

Query  676  MKNMYLQNNVFTGTIDVLANLPLDNL  753
            MKNMYLQNN FTGTIDVL+NLPL NL
Sbjct  184  MKNMYLQNNQFTGTIDVLSNLPLVNL  209



>ref|XP_010654359.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6 [Vitis vinifera]
Length=714

 Score =   280 bits (716),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 133/210 (63%), Positives = 169/210 (80%), Gaps = 0/210 (0%)
 Frame = +1

Query  124  WAVALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGV  303
            W + +LI  L   P      TDP DAS LR +FSSLNSP QL KW++NGGDPCGESW+G+
Sbjct  5    WRMLVLICVLRWGPSFINGATDPQDASALRVMFSSLNSPSQLAKWSSNGGDPCGESWQGI  64

Query  304  SCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAG  483
            +C G+RVTEI++SGL+LTGSMG+QL  L SV   DIS NNLGN +PYQLPPN+Q+LNLAG
Sbjct  65   TCKGSRVTEIELSGLRLTGSMGYQLTSLTSVVNLDISNNNLGNQIPYQLPPNLQRLNLAG  124

Query  484  NGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFS  663
            NGF GG+PYSIS M  L+YLN+SHNQLQG++  MF  L++L+TLDFS NSL G++P++FS
Sbjct  125  NGFNGGIPYSISLMISLKYLNISHNQLQGQLGDMFSQLSSLTTLDFSLNSLTGDLPESFS  184

Query  664  SLTNMKNMYLQNNVFTGTIDVLANLPLDNL  753
            SL+++  M+LQNN FTG+I+VLA+LPL+ L
Sbjct  185  SLSSITTMFLQNNQFTGSINVLASLPLETL  214



>ref|XP_004252624.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6 [Solanum lycopersicum]
Length=706

 Score =   280 bits (715),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 141/191 (74%), Positives = 167/191 (87%), Gaps = 0/191 (0%)
 Frame = +1

Query  181  DTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTG  360
            DTDP+DASVLR L+++LNSP QLTKW+ANGGDPCGESW G++CSGN VTEI++SGL L+G
Sbjct  26   DTDPSDASVLRVLYTTLNSPGQLTKWSANGGDPCGESWTGITCSGNNVTEIKLSGLGLSG  85

Query  361  SMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  540
            S+G QLD LKSVT FDIS NN+G+ +PYQLPPNVQ+LNLA +GF+GGLPYSISQM  L+Y
Sbjct  86   SLGSQLDSLKSVTNFDISNNNMGSQIPYQLPPNVQRLNLASSGFSGGLPYSISQMTSLQY  145

Query  541  LNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTI  720
            LNVSHNQ+QG V V F  L+ L+TLDFSFNS+AGN+PQ+F SLT+M  MYLQNN F+GTI
Sbjct  146  LNVSHNQIQGSVIVSFDLLSALNTLDFSFNSMAGNLPQSFRSLTSMNKMYLQNNQFSGTI  205

Query  721  DVLANLPLDNL  753
            DVLANLPL NL
Sbjct  206  DVLANLPLGNL  216



>ref|XP_006362102.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7-like [Solanum 
tuberosum]
Length=706

 Score =   278 bits (711),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 142/191 (74%), Positives = 167/191 (87%), Gaps = 0/191 (0%)
 Frame = +1

Query  181  DTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTG  360
            DTDP+DASVLR L+++LNSP QLTKW ANGGDPCGESW G++CSGN+VTEI++SGL L+G
Sbjct  26   DTDPSDASVLRVLYTTLNSPGQLTKWNANGGDPCGESWTGITCSGNKVTEIKMSGLGLSG  85

Query  361  SMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  540
            S+G QLD LKSVT FDIS NN+G+ LPYQLPPNVQ+LNLA +GF+GGLPYSISQM  L+Y
Sbjct  86   SLGSQLDSLKSVTNFDISNNNMGSQLPYQLPPNVQRLNLASSGFSGGLPYSISQMTSLQY  145

Query  541  LNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTI  720
            LNVSHNQ+QG V V F SL+ L+TLDFSFNS+ GN+PQ+F SLT+M  MYLQNN F+GTI
Sbjct  146  LNVSHNQIQGSVVVSFDSLSALNTLDFSFNSMTGNLPQSFQSLTSMNKMYLQNNQFSGTI  205

Query  721  DVLANLPLDNL  753
            DVLANLPL NL
Sbjct  206  DVLANLPLGNL  216



>emb|CBI35784.3| unnamed protein product [Vitis vinifera]
Length=708

 Score =   277 bits (708),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 132/206 (64%), Positives = 167/206 (81%), Gaps = 0/206 (0%)
 Frame = +1

Query  136  LLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSG  315
            +LI  L   P      TDP DAS LR +FSSLNSP QL KW++NGGDPCGESW+G++C G
Sbjct  3    VLICVLRWGPSFINGATDPQDASALRVMFSSLNSPSQLAKWSSNGGDPCGESWQGITCKG  62

Query  316  NRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFT  495
            +RVTEI++SGL+LTGSMG+QL  L SV   DIS NNLGN +PYQLPPN+Q+LNLAGNGF 
Sbjct  63   SRVTEIELSGLRLTGSMGYQLTSLTSVVNLDISNNNLGNQIPYQLPPNLQRLNLAGNGFN  122

Query  496  GGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTN  675
            GG+PYSIS M  L+YLN+SHNQLQG++  MF  L++L+TLDFS NSL G++P++FSSL++
Sbjct  123  GGIPYSISLMISLKYLNISHNQLQGQLGDMFSQLSSLTTLDFSLNSLTGDLPESFSSLSS  182

Query  676  MKNMYLQNNVFTGTIDVLANLPLDNL  753
            +  M+LQNN FTG+I+VLA+LPL+ L
Sbjct  183  ITTMFLQNNQFTGSINVLASLPLETL  208



>gb|KDP40614.1| hypothetical protein JCGZ_24613 [Jatropha curcas]
Length=714

 Score =   257 bits (657),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 122/191 (64%), Positives = 154/191 (81%), Gaps = 0/191 (0%)
 Frame = +1

Query  181  DTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTG  360
            +TDP DAS LRG+F+SL SP QLT+W ANGGDPC ESWKGV+CSG RVTEI++SGL L+G
Sbjct  25   NTDPNDASALRGMFTSLGSPGQLTQWKANGGDPCEESWKGVTCSGPRVTEIKLSGLALSG  84

Query  361  SMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  540
             MG+QL  L ++T  D+S NN+G  +PY LPPN+ +LNLA N FTG +PYSIS M  L Y
Sbjct  85   QMGYQLASLTALTNLDMSNNNIGGGIPYGLPPNLTQLNLASNQFTGDIPYSISMMTKLTY  144

Query  541  LNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTI  720
            LN++HNQLQ ++  MF  L++LSTLD SFN L+GN+P++FS+L++M + YLQNN FTGTI
Sbjct  145  LNIAHNQLQNQLNDMFGKLSSLSTLDISFNQLSGNLPESFSNLSSMTSRYLQNNQFTGTI  204

Query  721  DVLANLPLDNL  753
            DVLA+LPL NL
Sbjct  205  DVLADLPLKNL  215



>ref|XP_010273793.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6 [Nelumbo nucifera]
Length=725

 Score =   257 bits (656),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 129/190 (68%), Positives = 156/190 (82%), Gaps = 0/190 (0%)
 Frame = +1

Query  184  TDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGS  363
            T+ TDAS LR ++SSLNS  QLT W++ GGDPCG SWKG++CSG  VTEI++SGL LTGS
Sbjct  35   TNETDASALRIMYSSLNSAAQLTGWSSAGGDPCGNSWKGITCSGQAVTEIKLSGLGLTGS  94

Query  364  MGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYL  543
            MG+QL  L S+TT DIS N LGN +PYQLPPNVQ+LNLAGN F GG+PYSISQM  L+YL
Sbjct  95   MGYQLSSLTSLTTLDISNNFLGNQIPYQLPPNVQQLNLAGNSFNGGIPYSISQMTSLKYL  154

Query  544  NVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTID  723
            N+SHNQLQG++  MF  L+ L+TLD SFNS  GN+P++FSSL+++  MYL+NN FTG ID
Sbjct  155  NISHNQLQGQLNDMFGQLSALTTLDLSFNSFTGNLPESFSSLSSLNTMYLENNQFTGPID  214

Query  724  VLANLPLDNL  753
            VLANLPLDNL
Sbjct  215  VLANLPLDNL  224



>emb|CDY36601.1| BnaC06g06540D [Brassica napus]
Length=698

 Score =   255 bits (652),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 117/205 (57%), Positives = 163/205 (80%), Gaps = 3/205 (1%)
 Frame = +1

Query  139  LIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGN  318
            ++GF L+    A   TD +D S L  LFSS++SP QLT+WTA+ GDPCG++W+GV+CSG 
Sbjct  16   IVGFELSFIHGA---TDASDTSALNTLFSSMHSPAQLTQWTASAGDPCGQNWRGVTCSGT  72

Query  319  RVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTG  498
            RVT+I+ISGL+L+G++G++LD L ++T  D+S+NNLG  LPYQ PPN+++LNLA N FTG
Sbjct  73   RVTQIKISGLELSGTLGYKLDSLTNLTELDVSSNNLGGDLPYQFPPNLERLNLAFNQFTG  132

Query  499  GLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNM  678
               YSISQ+ PL+YLN+ HNQ +G++ + F  LT+++TLDFSFNS   ++P TF+SLT++
Sbjct  133  AAQYSISQIVPLKYLNLGHNQFKGQIAIDFSKLTSITTLDFSFNSFTESLPGTFTSLTSL  192

Query  679  KNMYLQNNVFTGTIDVLANLPLDNL  753
            K++YLQNN F+GT+DVLA LPLD L
Sbjct  193  KSLYLQNNQFSGTVDVLAGLPLDTL  217



>gb|AAG51973.1|AC024260_11 leucine-rich repeat transmembrane protein kinase 1, putative; 
10414-7611 [Arabidopsis thaliana]
Length=516

 Score =   249 bits (636),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 123/224 (55%), Positives = 166/224 (74%), Gaps = 13/224 (6%)
 Frame = +1

Query  100  MRELMGLPWAVALL-----IGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTA  264
            MRE     WAV  L     +GF L     A   TD +D S L  LFS ++SP QLT+WTA
Sbjct  1    MRE----NWAVVALFTLCIVGFELRFIHGA---TDASDTSALNTLFSGMHSPAQLTQWTA  53

Query  265  NGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMG-FQLDQLKSVTTFDISTNNLGNSLP  441
              GDPCG++W+GV+CSG+RVT+I++SGL+L+G++G + LD+L S+T  D+S+NNLG  LP
Sbjct  54   AAGDPCGQNWRGVTCSGSRVTQIKLSGLELSGTLGGYMLDKLTSLTELDLSSNNLGGDLP  113

Query  442  YQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDF  621
            YQ PPN+Q+LNLA N FTG   YS+SQ+ PL+YLN+ HNQ +G++ + F  L +L+TLDF
Sbjct  114  YQFPPNLQRLNLANNQFTGAASYSLSQITPLKYLNLGHNQFKGQIAIDFSKLDSLTTLDF  173

Query  622  SFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTIDVLANLPLDNL  753
            SFNS   ++P TFSSLT++K++YLQNN F+GT+DVLA LPL+ L
Sbjct  174  SFNSFTNSLPATFSSLTSLKSLYLQNNQFSGTVDVLAGLPLETL  217



>emb|CDY24077.1| BnaA06g00750D [Brassica napus]
Length=719

 Score =   254 bits (648),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 117/205 (57%), Positives = 163/205 (80%), Gaps = 3/205 (1%)
 Frame = +1

Query  139  LIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGN  318
            ++GF L+    A   TD +D S L  LFSS++SP QLT+WTA+ GDPCG++W+GV+CSG 
Sbjct  16   IVGFELSFIHGA---TDASDTSALNTLFSSMHSPAQLTQWTASAGDPCGQNWRGVNCSGT  72

Query  319  RVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTG  498
            RVT+I+ISGL+L+G++G++LD L ++T  D+S+NNLG  LPYQ PPN+++LNLA N FTG
Sbjct  73   RVTQIKISGLELSGTLGYKLDSLTNLTELDVSSNNLGGDLPYQFPPNLERLNLAFNQFTG  132

Query  499  GLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNM  678
               YSISQ+ PL+YLN+ HNQ +G++ + F  LT+++TLDFSFNS   ++P TF+SLT++
Sbjct  133  AAQYSISQIVPLKYLNLGHNQFKGQIAIDFSKLTSITTLDFSFNSFTDSLPGTFTSLTSL  192

Query  679  KNMYLQNNVFTGTIDVLANLPLDNL  753
            K++YLQNN F+GT+DVLA LPLD L
Sbjct  193  KSLYLQNNQFSGTVDVLAGLPLDIL  217



>ref|XP_010462281.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like [Camelina 
sativa]
Length=721

 Score =   254 bits (648),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 121/215 (56%), Positives = 163/215 (76%), Gaps = 8/215 (4%)
 Frame = +1

Query  124  WAVALL-----IGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGE  288
            WAV  L     +GF L     A   TD +D S L  LFSS++SP QLT+WTA  GDPCG+
Sbjct  6    WAVVALFTVCIVGFELRFIHGA---TDASDTSALNTLFSSMHSPAQLTQWTAAAGDPCGQ  62

Query  289  SWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQK  468
            +W+GV+CSG+RVT+I++ GL+L+G++G+ LD+L S+T  D+S+NNLG  LPYQLPPN+Q+
Sbjct  63   NWRGVTCSGSRVTQIKLPGLELSGTLGYMLDKLTSLTELDLSSNNLGGDLPYQLPPNLQR  122

Query  469  LNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNI  648
            LNLA N FTG   YSIS M PL+YLN+ HNQ +G++ + F  L +L+TLDFSFNS   ++
Sbjct  123  LNLANNQFTGAAQYSISHMTPLKYLNLGHNQFKGQIAIDFSKLNSLTTLDFSFNSFTNSL  182

Query  649  PQTFSSLTNMKNMYLQNNVFTGTIDVLANLPLDNL  753
            P TF+SLT++K++YLQNN F+GT+DVLA LPL+ L
Sbjct  183  PGTFTSLTSLKSLYLQNNQFSGTVDVLAGLPLETL  217



>ref|XP_009147586.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6 [Brassica rapa]
Length=719

 Score =   253 bits (647),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 117/205 (57%), Positives = 163/205 (80%), Gaps = 3/205 (1%)
 Frame = +1

Query  139  LIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGN  318
            ++GF L+    A   TD +D S L  LFSS++SP QLT+WTA+ GDPCG++W+GV+CSG 
Sbjct  16   IVGFELSFIYGA---TDASDTSALNTLFSSMHSPAQLTQWTASAGDPCGQNWRGVNCSGT  72

Query  319  RVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTG  498
            RVT+I+ISGL+L+G++G++LD L ++T  D+S+NNLG  LPYQ PPN+++LNLA N FTG
Sbjct  73   RVTQIKISGLELSGTLGYKLDSLTNLTELDVSSNNLGGDLPYQFPPNLERLNLAFNQFTG  132

Query  499  GLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNM  678
               YSISQ+ PL+YLN+ HNQ +G++ + F  LT+++TLDFSFNS   ++P TF+SLT++
Sbjct  133  AAQYSISQIVPLKYLNLGHNQFKGQIAIDFSKLTSITTLDFSFNSFTDSLPGTFTSLTSL  192

Query  679  KNMYLQNNVFTGTIDVLANLPLDNL  753
            K++YLQNN F+GT+DVLA LPLD L
Sbjct  193  KSLYLQNNQFSGTVDVLAGLPLDIL  217



>ref|XP_010479951.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like [Camelina 
sativa]
Length=721

 Score =   253 bits (647),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 121/215 (56%), Positives = 163/215 (76%), Gaps = 8/215 (4%)
 Frame = +1

Query  124  WAVALL-----IGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGE  288
            WAV  L     +GF L     A   TD +D S L  LFSS++SP QLT+WTA  GDPCG+
Sbjct  6    WAVVALFTVCIVGFELRFIHGA---TDASDTSALNTLFSSMHSPAQLTQWTAAAGDPCGQ  62

Query  289  SWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQK  468
            +W+GV+CSG+RVT+I++ GL+L+G++G+ LD+L S+T  D+S+NNLG  LPYQLPPN+Q+
Sbjct  63   NWRGVTCSGSRVTQIKLPGLELSGTLGYMLDKLTSLTELDLSSNNLGGDLPYQLPPNLQR  122

Query  469  LNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNI  648
            LNLA N FTG   YSIS M PL+YLN+ HNQ +G++ + F  L +L+TLDFSFNS   ++
Sbjct  123  LNLANNQFTGAAQYSISHMTPLKYLNLGHNQFKGQIAIDFSKLNSLTTLDFSFNSFTNSL  182

Query  649  PQTFSSLTNMKNMYLQNNVFTGTIDVLANLPLDNL  753
            P TF+SLT++K++YLQNN F+GT+DVLA LPL+ L
Sbjct  183  PGTFTSLTSLKSLYLQNNQFSGTVDVLAGLPLETL  217



>ref|XP_010501035.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6 [Camelina sativa]
Length=721

 Score =   253 bits (647),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 121/215 (56%), Positives = 163/215 (76%), Gaps = 8/215 (4%)
 Frame = +1

Query  124  WAVALL-----IGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGE  288
            WAV  L     +GF L     A   TD +D S L  LFSS++SP QLT+WTA  GDPCG+
Sbjct  7    WAVVALFTVCIVGFELRFIHGA---TDASDTSALNTLFSSMHSPAQLTQWTAAAGDPCGQ  63

Query  289  SWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQK  468
            +W+GV+CSG+RVT+I++ GL+L+G++G+ LD+L S+T  D+S+NNLG  LPYQLPPN+Q+
Sbjct  64   NWRGVTCSGSRVTQIKLPGLELSGTLGYMLDKLTSLTELDLSSNNLGGDLPYQLPPNLQR  123

Query  469  LNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNI  648
            LNLA N FTG   YSIS M PL+YLN+ HNQ +G++ + F  L +L+TLDFSFNS   ++
Sbjct  124  LNLANNQFTGAAQYSISHMTPLKYLNLGHNQFKGQIAIDFSKLNSLTTLDFSFNSFTNSL  183

Query  649  PQTFSSLTNMKNMYLQNNVFTGTIDVLANLPLDNL  753
            P TF+SLT++K++YLQNN F+GT+DVLA LPL+ L
Sbjct  184  PGTFTSLTSLKSLYLQNNQFSGTVDVLAGLPLETL  218



>ref|XP_011048642.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6 [Populus euphratica]
Length=715

 Score =   252 bits (644),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 125/190 (66%), Positives = 160/190 (84%), Gaps = 0/190 (0%)
 Frame = +1

Query  184  TDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGS  363
            TDP DAS LR +FSS+NSP QLT+W+ANG DPCG++WKG++CSG+RVTEI++ GL L+GS
Sbjct  26   TDPNDASALRVMFSSMNSPAQLTQWSANGDDPCGQNWKGITCSGSRVTEIKLPGLGLSGS  85

Query  364  MGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYL  543
            +G+QLD LK+VT  D+S NNL  +LPYQLPPN+Q+LNLA N  +GG+PYSISQM  L YL
Sbjct  86   LGYQLDSLKAVTNLDLSNNNLAGALPYQLPPNLQRLNLANNRLSGGIPYSISQMPSLTYL  145

Query  544  NVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTID  723
            N+ HNQLQ ++  MF  LT+LSTLD SFN L G++P++FSSL+++K+MYLQ+N FTG ID
Sbjct  146  NLGHNQLQNQLGDMFGQLTSLSTLDVSFNLLTGDLPESFSSLSSVKSMYLQSNQFTGAID  205

Query  724  VLANLPLDNL  753
            VLANLPL+NL
Sbjct  206  VLANLPLENL  215



>ref|XP_006392758.1| hypothetical protein EUTSA_v10011271mg [Eutrema salsugineum]
 gb|ESQ30044.1| hypothetical protein EUTSA_v10011271mg [Eutrema salsugineum]
Length=719

 Score =   252 bits (644),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 125/224 (56%), Positives = 168/224 (75%), Gaps = 13/224 (6%)
 Frame = +1

Query  100  MRELMGLPWAVAL------LIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWT  261
            MRE     W V +      ++GF L     A   TD +D S L  LFSS++SP QLT+WT
Sbjct  1    MRE----NWVVVVALFSVCIVGFELRFIHGA---TDASDTSALNTLFSSMHSPAQLTQWT  53

Query  262  ANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLP  441
            A+ GDPCG++W+GV+CSG+RVT++++SGL+L+G++G+ LD+L S+T  D+S+NNLG  LP
Sbjct  54   ASAGDPCGQNWRGVTCSGSRVTQVKLSGLELSGTLGYMLDRLTSLTELDLSSNNLGGDLP  113

Query  442  YQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDF  621
            YQLPPN+Q+LNLA N FTG   YSISQM+ L+YLN+ HNQ +G+V V F  L +L+TLDF
Sbjct  114  YQLPPNLQRLNLAFNQFTGAAQYSISQMSSLKYLNLGHNQFKGQVAVDFTKLNSLTTLDF  173

Query  622  SFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTIDVLANLPLDNL  753
            SFNS    +P TF+SLT++K++YLQNN F+GTIDVLA LPL+ L
Sbjct  174  SFNSFTMPLPGTFTSLTSLKSLYLQNNQFSGTIDVLAGLPLETL  217



>ref|XP_010685195.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7-like [Beta vulgaris 
subsp. vulgaris]
Length=707

 Score =   251 bits (640),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 124/210 (59%), Positives = 159/210 (76%), Gaps = 1/210 (0%)
 Frame = +1

Query  124  WAVALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGV  303
            W + L+I  L+ +P S   DTD  DAS L G+F+S+N+P QLT WTA+GGDPCG+SWKGV
Sbjct  5    WRL-LIISILVLSPSSINGDTDQADASALNGMFTSMNNPAQLTGWTASGGDPCGQSWKGV  63

Query  304  SCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAG  483
            +CSG+RVT+I++  L LTGS+G+QL  L S+T FD+S NN G SL Y LPPN+Q+LNLA 
Sbjct  64   TCSGSRVTQIKLPNLGLTGSLGYQLQSLTSLTDFDLSHNNFGGSLTYNLPPNLQRLNLAN  123

Query  484  NGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFS  663
              F G +PYSIS M PLE+L++SHNQ  G++TV +  L +LST+D S N+L G +PQT S
Sbjct  124  CSFNGQIPYSISLMKPLEHLDLSHNQFNGQLTVDYSQLPSLSTMDLSSNALTGELPQTMS  183

Query  664  SLTNMKNMYLQNNVFTGTIDVLANLPLDNL  753
            SLT++  +YLQNN FTGTIDVL  LPL NL
Sbjct  184  SLTSLNTLYLQNNQFTGTIDVLGTLPLQNL  213



>ref|XP_006304699.1| hypothetical protein CARUB_v10011957mg [Capsella rubella]
 gb|EOA37597.1| hypothetical protein CARUB_v10011957mg [Capsella rubella]
Length=719

 Score =   250 bits (638),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 119/215 (55%), Positives = 161/215 (75%), Gaps = 8/215 (4%)
 Frame = +1

Query  124  WAVALL-----IGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGE  288
            W V  L     +GF L     A   TD +D S L  LFSS++SP QLT+WTA  GDPCG+
Sbjct  6    WVVVALFTVCIVGFELRFIHGA---TDASDTSALNTLFSSMHSPAQLTQWTAAAGDPCGQ  62

Query  289  SWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQK  468
            +W+GV+CSG+RVT+I++ GL+L+G++G+ LD+L S+T  D+S+NNLG  LPYQLPPN+Q+
Sbjct  63   NWRGVTCSGSRVTQIKLPGLELSGTLGYMLDKLTSLTELDLSSNNLGGDLPYQLPPNLQR  122

Query  469  LNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNI  648
            LNLA N FTG   YSIS M PL+YLN+ HNQ +G++ + F  L +L+TLDFSFNS   ++
Sbjct  123  LNLANNQFTGAAQYSISHMTPLKYLNLGHNQFKGQIPIDFTKLNSLTTLDFSFNSFTNSL  182

Query  649  PQTFSSLTNMKNMYLQNNVFTGTIDVLANLPLDNL  753
            P TF+SL ++K++YLQNN F+GT+DVLA LPL+ L
Sbjct  183  PGTFTSLKSLKSLYLQNNQFSGTVDVLAGLPLETL  217



>ref|XP_010542346.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7 [Tarenaya hassleriana]
Length=716

 Score =   250 bits (638),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 121/209 (58%), Positives = 161/209 (77%), Gaps = 1/209 (0%)
 Frame = +1

Query  130  VALLIGFLLNAPPSAV-ADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVS  306
            VALL   ++   P  +   TD +D S L  ++SS+NSP QL++W  +GGDPCGE WKGV+
Sbjct  9    VALLTLCIVGLEPRFINGATDSSDTSALNTMYSSMNSPSQLSEWKPSGGDPCGEHWKGVT  68

Query  307  CSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGN  486
            CSG+RVTE+++  L L+GS+G+ LD+L +VT FD+S NNLG  LPYQLPP VQ+LNLA N
Sbjct  69   CSGSRVTEVKLPNLGLSGSLGYMLDKLSAVTEFDLSNNNLGGDLPYQLPPAVQRLNLANN  128

Query  487  GFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSS  666
             FTG   YSIS MA L+YLN++HNQ +G++ V F  LT+L+ LD S NS +G++P +F+S
Sbjct  129  QFTGSAQYSISLMASLKYLNLAHNQFKGQLAVDFTKLTSLTFLDLSSNSFSGSLPSSFTS  188

Query  667  LTNMKNMYLQNNVFTGTIDVLANLPLDNL  753
            LT++K+MYLQNN FTGTIDVLA+LPL+NL
Sbjct  189  LTSIKSMYLQNNQFTGTIDVLASLPLENL  217



>gb|ABB20817.1| putative leucine-rich repeat transmembrane protein kinase [Isatis 
tinctoria]
 gb|ABF50792.1| leucine-rich repeat transmembrane protein kinase [Isatis tinctoria]
Length=719

 Score =   250 bits (638),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 120/215 (56%), Positives = 162/215 (75%), Gaps = 8/215 (4%)
 Frame = +1

Query  124  WAVALL-----IGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGE  288
            W V  L     +GF L     A   TD +D S L  LF+S++SP QLT+WTA+ GDPCG+
Sbjct  5    WVVVALFTLCIVGFELRFIHGA---TDASDTSALNTLFTSMHSPAQLTQWTASAGDPCGQ  61

Query  289  SWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQK  468
            +W+GV+CSG RVT+I+I  L+L+G++G+ LD+L ++T  D+S+NNLG  LPYQLPPN+Q+
Sbjct  62   NWRGVTCSGTRVTQIKIPSLELSGTLGYMLDRLTNLTELDLSSNNLGGDLPYQLPPNLQR  121

Query  469  LNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNI  648
            LNLA N FTG   YSISQMAPL+YLN+ HNQ +G++ V F  LT+L+  DFSFNS   ++
Sbjct  122  LNLAYNQFTGAAQYSISQMAPLKYLNLGHNQFKGQIAVDFSKLTSLTFADFSFNSFTNSL  181

Query  649  PQTFSSLTNMKNMYLQNNVFTGTIDVLANLPLDNL  753
            P TF+SLT++K++YLQNN F+GT+DVLA LPL+ L
Sbjct  182  PGTFTSLTSLKSLYLQNNQFSGTVDVLAGLPLETL  216



>ref|XP_010033635.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7-like [Eucalyptus 
grandis]
 gb|KCW53334.1| hypothetical protein EUGRSUZ_J02582 [Eucalyptus grandis]
Length=728

 Score =   249 bits (637),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 124/225 (55%), Positives = 171/225 (76%), Gaps = 2/225 (1%)
 Frame = +1

Query  82   ERASLKMRELMGLPWAVALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWT  261
            E    + +++M + + + L I  L +   S  ADTDP+DA+ L+ ++S LN P QLT+W+
Sbjct  2    ESVRRRKKKMMSV-FLIMLEICILGSTFTSINADTDPSDAAALQDMYSFLNQPSQLTQWS  60

Query  262  ANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGS-MGFQLDQLKSVTTFDISTNNLGNSL  438
            ++GGDPCG+SWKG++CSG+RVTEI++ GL L+GS +G++L  L SVT  D+S NNLG  L
Sbjct  61   SSGGDPCGQSWKGITCSGSRVTEIKLPGLGLSGSSIGYKLQSLTSVTNLDLSNNNLGGQL  120

Query  439  PYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLD  618
            PY +PPNVQ+LNLA N FTG +P+SI+Q++ L+YLN+ HNQLQG +  MF  L++L TLD
Sbjct  121  PYGVPPNVQRLNLANNQFTGQIPWSIAQLSSLKYLNLGHNQLQGALNDMFGQLSSLDTLD  180

Query  619  FSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTIDVLANLPLDNL  753
             S N L+GN+PQT SSL+++  MYLQNN FTG I+VLANLPL+NL
Sbjct  181  LSSNQLSGNLPQTISSLSSITTMYLQNNQFTGDINVLANLPLENL  225



>ref|NP_175777.1| STRUBBELIG-receptor family 6 [Arabidopsis thaliana]
 sp|Q9C8M9.1|SRF6_ARATH RecName: Full=Protein STRUBBELIG-RECEPTOR FAMILY 6; AltName: 
Full=Leucine-rich repeat receptor kinase-like protein SRF6; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAG51974.1|AC024260_12 leucine-rich repeat transmembrane protein kinase 1, putative; 
10414-6710 [Arabidopsis thaliana]
 gb|AAQ89622.1| At1g53730 [Arabidopsis thaliana]
 gb|AAR99874.1| strubbelig receptor family 6 [Arabidopsis thaliana]
 dbj|BAE99117.1| LRR receptor-like protein kinase like protein [Arabidopsis thaliana]
 gb|ACN59255.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AEE32990.1| STRUBBELIG-receptor family 6 [Arabidopsis thaliana]
Length=719

 Score =   249 bits (636),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 123/224 (55%), Positives = 166/224 (74%), Gaps = 13/224 (6%)
 Frame = +1

Query  100  MRELMGLPWAVALL-----IGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTA  264
            MRE     WAV  L     +GF L     A   TD +D S L  LFS ++SP QLT+WTA
Sbjct  1    MRE----NWAVVALFTLCIVGFELRFIHGA---TDASDTSALNTLFSGMHSPAQLTQWTA  53

Query  265  NGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMG-FQLDQLKSVTTFDISTNNLGNSLP  441
              GDPCG++W+GV+CSG+RVT+I++SGL+L+G++G + LD+L S+T  D+S+NNLG  LP
Sbjct  54   AAGDPCGQNWRGVTCSGSRVTQIKLSGLELSGTLGGYMLDKLTSLTELDLSSNNLGGDLP  113

Query  442  YQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDF  621
            YQ PPN+Q+LNLA N FTG   YS+SQ+ PL+YLN+ HNQ +G++ + F  L +L+TLDF
Sbjct  114  YQFPPNLQRLNLANNQFTGAASYSLSQITPLKYLNLGHNQFKGQIAIDFSKLDSLTTLDF  173

Query  622  SFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTIDVLANLPLDNL  753
            SFNS   ++P TFSSLT++K++YLQNN F+GT+DVLA LPL+ L
Sbjct  174  SFNSFTNSLPATFSSLTSLKSLYLQNNQFSGTVDVLAGLPLETL  217



>ref|NP_001077716.1| STRUBBELIG-receptor family 6 [Arabidopsis thaliana]
 gb|AEE32991.1| STRUBBELIG-receptor family 6 [Arabidopsis thaliana]
Length=720

 Score =   249 bits (636),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 123/224 (55%), Positives = 166/224 (74%), Gaps = 13/224 (6%)
 Frame = +1

Query  100  MRELMGLPWAVALL-----IGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTA  264
            MRE     WAV  L     +GF L     A   TD +D S L  LFS ++SP QLT+WTA
Sbjct  1    MRE----NWAVVALFTLCIVGFELRFIHGA---TDASDTSALNTLFSGMHSPAQLTQWTA  53

Query  265  NGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMG-FQLDQLKSVTTFDISTNNLGNSLP  441
              GDPCG++W+GV+CSG+RVT+I++SGL+L+G++G + LD+L S+T  D+S+NNLG  LP
Sbjct  54   AAGDPCGQNWRGVTCSGSRVTQIKLSGLELSGTLGGYMLDKLTSLTELDLSSNNLGGDLP  113

Query  442  YQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDF  621
            YQ PPN+Q+LNLA N FTG   YS+SQ+ PL+YLN+ HNQ +G++ + F  L +L+TLDF
Sbjct  114  YQFPPNLQRLNLANNQFTGAASYSLSQITPLKYLNLGHNQFKGQIAIDFSKLDSLTTLDF  173

Query  622  SFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTIDVLANLPLDNL  753
            SFNS   ++P TFSSLT++K++YLQNN F+GT+DVLA LPL+ L
Sbjct  174  SFNSFTNSLPATFSSLTSLKSLYLQNNQFSGTVDVLAGLPLETL  217



>ref|XP_009106960.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6 [Brassica rapa]
Length=716

 Score =   249 bits (635),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 119/205 (58%), Positives = 163/205 (80%), Gaps = 3/205 (1%)
 Frame = +1

Query  139  LIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGN  318
            ++GF L     A   TD +D S L  LFSS++SP QLT+WTA+GGDPCG++W+GV+CSG+
Sbjct  17   IVGFELRLIHGA---TDASDTSALNMLFSSMHSPGQLTQWTASGGDPCGQNWRGVTCSGS  73

Query  319  RVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTG  498
            RVT++++ GL+L+G++G+ LD+L S+T  D+S+NNLG  LPYQLPPN+Q+LNLA N FTG
Sbjct  74   RVTQLKLPGLELSGTLGYMLDKLTSLTELDLSSNNLGGDLPYQLPPNLQRLNLANNQFTG  133

Query  499  GLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNM  678
               YSIS MA L+YLN+ HNQ +G+V V F  LT+L+TLDFSFNS   ++P TF+SLT++
Sbjct  134  AAQYSISNMASLKYLNLGHNQFKGQVAVDFSKLTSLTTLDFSFNSFTLSLPGTFTSLTSL  193

Query  679  KNMYLQNNVFTGTIDVLANLPLDNL  753
            K++YLQNN F+GT++VLA LPL+ L
Sbjct  194  KSLYLQNNQFSGTLNVLAGLPLETL  218



>gb|KFK38799.1| hypothetical protein AALP_AA3G161700 [Arabis alpina]
Length=714

 Score =   249 bits (635),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 118/205 (58%), Positives = 163/205 (80%), Gaps = 4/205 (2%)
 Frame = +1

Query  139  LIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGN  318
            ++GF    P     DTD +D S L  +F+S+NSP QL++WTA+GGDPCG++WKG++CSG+
Sbjct  15   IVGF---EPTFINGDTDSSDTSALNTMFTSMNSPGQLSQWTASGGDPCGQNWKGITCSGS  71

Query  319  RVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTG  498
            RVT+I++SGL L+GS+GF LD+L SVT FD+S NNLG  +PYQLPPN+++LNLA N FTG
Sbjct  72   RVTQIKLSGLGLSGSIGFMLDKLTSVTEFDLSNNNLGGDIPYQLPPNLERLNLANNQFTG  131

Query  499  GLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNM  678
               YSIS M P++Y+N++HNQL+ ++ + F  LT+LS LD S N++ G++P T SSLT++
Sbjct  132  SAQYSISMMTPIKYINLAHNQLK-QLAIDFTKLTSLSILDLSSNAITGSLPNTISSLTSV  190

Query  679  KNMYLQNNVFTGTIDVLANLPLDNL  753
            K++YLQNN FTGTID+LA LPL+NL
Sbjct  191  KSIYLQNNQFTGTIDILATLPLENL  215



>ref|NP_974312.1| STRUBBELIG-receptor family 7 protein [Arabidopsis thaliana]
 gb|AEE75506.1| STRUBBELIG-receptor family 7 protein [Arabidopsis thaliana]
Length=689

 Score =   246 bits (628),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 122/209 (58%), Positives = 164/209 (78%), Gaps = 2/209 (1%)
 Frame = +1

Query  130  VALLIGFLLNAPPSAV-ADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVS  306
            +ALLI  ++   PS +   TD +D S L  +FSS+NSP QL++WTA+GGDPCG++WKG++
Sbjct  8    LALLILCIVGFEPSFIHGATDSSDTSALNIMFSSMNSPGQLSQWTASGGDPCGQNWKGIT  67

Query  307  CSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGN  486
            CSG+RVT+I++  L L+GS+GF LD+L SVT FD+S NNLG  LPYQLPPN+++LNLA N
Sbjct  68   CSGSRVTQIKLPSLGLSGSLGFMLDKLTSVTEFDMSNNNLGGDLPYQLPPNLERLNLANN  127

Query  487  GFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSS  666
             FTG   YSIS MAPL+YLN++HNQL+ ++ + F  LT+LS LD S N+  G++P T SS
Sbjct  128  QFTGSAQYSISMMAPLKYLNLAHNQLK-QLAIDFTKLTSLSILDLSSNAFIGSLPNTCSS  186

Query  667  LTNMKNMYLQNNVFTGTIDVLANLPLDNL  753
            LT+ K++YLQNN F+GTID+LA LPL+NL
Sbjct  187  LTSAKSIYLQNNQFSGTIDILATLPLENL  215



>gb|KFK35699.1| hypothetical protein AALP_AA4G025700 [Arabis alpina]
Length=721

 Score =   246 bits (628),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 119/205 (58%), Positives = 161/205 (79%), Gaps = 3/205 (1%)
 Frame = +1

Query  139  LIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGN  318
            ++GF L     A   TD +D S L  LFSS++SP QLT+WTA+ GDPCG++W+GV+CSG+
Sbjct  16   ILGFELRFIHGA---TDSSDTSALNMLFSSMHSPAQLTQWTASAGDPCGQNWRGVTCSGS  72

Query  319  RVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTG  498
            RVT+I+I GL+L+G++GF LD+L S+T  D+S+NNLG  LPY LPPN+++LNLA N FTG
Sbjct  73   RVTQIKIPGLELSGTLGFMLDRLTSLTELDLSSNNLGGDLPYPLPPNLEQLNLANNQFTG  132

Query  499  GLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNM  678
               YSISQMA L+YLN+ HNQ  G + V F  LT+L+TLDFSFNS  G++P +F+SLT++
Sbjct  133  TAQYSISQMASLKYLNLGHNQFTGNIGVDFTKLTSLTTLDFSFNSFTGSLPGSFTSLTSI  192

Query  679  KNMYLQNNVFTGTIDVLANLPLDNL  753
            K++YLQNN F+GT++VLA LPL+ L
Sbjct  193  KSLYLQNNQFSGTLNVLAGLPLETL  217



>ref|NP_188052.2| STRUBBELIG-receptor family 7 protein [Arabidopsis thaliana]
 sp|Q9LUL4.1|SRF7_ARATH RecName: Full=Protein STRUBBELIG-RECEPTOR FAMILY 7; AltName: 
Full=Leucine-rich repeat receptor kinase-like protein SRF7; 
Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB01040.1| serine/threonine protein kinase-like protein [Arabidopsis thaliana]
 gb|AAR99875.1| strubbelig receptor family 7 [Arabidopsis thaliana]
 gb|ACI49801.1| At3g14350 [Arabidopsis thaliana]
 gb|ACN59316.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AEE75505.1| STRUBBELIG-receptor family 7 protein [Arabidopsis thaliana]
Length=717

 Score =   246 bits (628),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 122/209 (58%), Positives = 164/209 (78%), Gaps = 2/209 (1%)
 Frame = +1

Query  130  VALLIGFLLNAPPSAV-ADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVS  306
            +ALLI  ++   PS +   TD +D S L  +FSS+NSP QL++WTA+GGDPCG++WKG++
Sbjct  8    LALLILCIVGFEPSFIHGATDSSDTSALNIMFSSMNSPGQLSQWTASGGDPCGQNWKGIT  67

Query  307  CSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGN  486
            CSG+RVT+I++  L L+GS+GF LD+L SVT FD+S NNLG  LPYQLPPN+++LNLA N
Sbjct  68   CSGSRVTQIKLPSLGLSGSLGFMLDKLTSVTEFDMSNNNLGGDLPYQLPPNLERLNLANN  127

Query  487  GFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSS  666
             FTG   YSIS MAPL+YLN++HNQL+ ++ + F  LT+LS LD S N+  G++P T SS
Sbjct  128  QFTGSAQYSISMMAPLKYLNLAHNQLK-QLAIDFTKLTSLSILDLSSNAFIGSLPNTCSS  186

Query  667  LTNMKNMYLQNNVFTGTIDVLANLPLDNL  753
            LT+ K++YLQNN F+GTID+LA LPL+NL
Sbjct  187  LTSAKSIYLQNNQFSGTIDILATLPLENL  215



>ref|XP_008380807.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6 [Malus domestica]
Length=740

 Score =   246 bits (629),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 127/214 (59%), Positives = 163/214 (76%), Gaps = 8/214 (4%)
 Frame = +1

Query  136  LLIGFLLN--------APPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGES  291
            L +GFLL         +P S  A TDPTD S L+ L+ SLNSPPQLT+W+ NG DPCG+S
Sbjct  30   LEVGFLLVFCICILGWSPSSINAATDPTDVSALKVLYGSLNSPPQLTQWSQNGDDPCGQS  89

Query  292  WKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKL  471
            WKGV CSG+RVTEI +SGLQL+G++G+QL  L ++T  D+S NNL   +PY LPPN+ +L
Sbjct  90   WKGVKCSGSRVTEIDLSGLQLSGTLGYQLQSLTALTNLDVSNNNLAGGIPYSLPPNMTRL  149

Query  472  NLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIP  651
            NL  N F   +PYSIS +  L+YLN+SHNQLQ +++ +F  L++LS LD SFNSL+GN+P
Sbjct  150  NLGHNNFNQDIPYSISMITTLKYLNISHNQLQNQLSDIFGKLSSLSVLDLSFNSLSGNLP  209

Query  652  QTFSSLTNMKNMYLQNNVFTGTIDVLANLPLDNL  753
            ++FSSL++MK M+LQNN  TGTIDVLANLPLDNL
Sbjct  210  ESFSSLSSMKTMFLQNNQLTGTIDVLANLPLDNL  243



>ref|XP_006392757.1| hypothetical protein EUTSA_v10011271mg [Eutrema salsugineum]
 gb|ESQ30043.1| hypothetical protein EUTSA_v10011271mg [Eutrema salsugineum]
Length=717

 Score =   246 bits (627),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 124/224 (55%), Positives = 167/224 (75%), Gaps = 15/224 (7%)
 Frame = +1

Query  100  MRELMGLPWAVAL------LIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWT  261
            MRE     W V +      ++GF L     A   TD +D   L  LFSS++SP QLT+WT
Sbjct  1    MRE----NWVVVVALFSVCIVGFELRFIHGA---TDASD--TLNTLFSSMHSPAQLTQWT  51

Query  262  ANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLP  441
            A+ GDPCG++W+GV+CSG+RVT++++SGL+L+G++G+ LD+L S+T  D+S+NNLG  LP
Sbjct  52   ASAGDPCGQNWRGVTCSGSRVTQVKLSGLELSGTLGYMLDRLTSLTELDLSSNNLGGDLP  111

Query  442  YQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDF  621
            YQLPPN+Q+LNLA N FTG   YSISQM+ L+YLN+ HNQ +G+V V F  L +L+TLDF
Sbjct  112  YQLPPNLQRLNLAFNQFTGAAQYSISQMSSLKYLNLGHNQFKGQVAVDFTKLNSLTTLDF  171

Query  622  SFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTIDVLANLPLDNL  753
            SFNS    +P TF+SLT++K++YLQNN F+GTIDVLA LPL+ L
Sbjct  172  SFNSFTMPLPGTFTSLTSLKSLYLQNNQFSGTIDVLAGLPLETL  215



>ref|XP_008372915.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like [Malus domestica]
 ref|XP_008372916.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like [Malus domestica]
Length=714

 Score =   246 bits (627),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 124/198 (63%), Positives = 157/198 (79%), Gaps = 0/198 (0%)
 Frame = +1

Query  160  APPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQI  339
            +P S  A TDPTD S L+ L+SSLNSP QLT+W  NG DPCG+SWKGV CSG+RVTEI +
Sbjct  20   SPSSINAATDPTDVSALKVLYSSLNSPSQLTQWIQNGDDPCGQSWKGVKCSGSRVTEIDL  79

Query  340  SGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSIS  519
            SGLQL+G++G+QL  L ++T  D+S NNL  ++PYQLPPN+ +LNL GN F   +PYSIS
Sbjct  80   SGLQLSGTLGYQLQTLTALTNLDMSNNNLAGTIPYQLPPNMTRLNLGGNNFNQDIPYSIS  139

Query  520  QMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQN  699
            Q+  L YLN+SHNQ+Q ++  MF  L++LS LD SFNSL+GN+P++FSSL++M  M+LQN
Sbjct  140  QITSLTYLNISHNQIQNQLGDMFGKLSSLSVLDLSFNSLSGNLPESFSSLSSMTTMFLQN  199

Query  700  NVFTGTIDVLANLPLDNL  753
            N  TGTIDVLANLPLDNL
Sbjct  200  NQLTGTIDVLANLPLDNL  217



>emb|CDY02495.1| BnaA08g01020D [Brassica napus]
Length=716

 Score =   246 bits (627),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 114/190 (60%), Positives = 156/190 (82%), Gaps = 0/190 (0%)
 Frame = +1

Query  184  TDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGS  363
            TD +D S L  LFSS++SP QLT+WTA+GGDPCG++W+GV+CS +RVT++++SGL+L+G+
Sbjct  29   TDASDTSALNMLFSSMHSPGQLTQWTASGGDPCGQNWRGVTCSRSRVTQLKLSGLELSGT  88

Query  364  MGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYL  543
            +G+ LD+L S+T  D+S+NNLG  LPYQLPPN+Q+LNLA N FTG   YSIS M  L+YL
Sbjct  89   LGYMLDKLTSLTELDLSSNNLGGDLPYQLPPNLQRLNLANNQFTGAAQYSISNMVSLKYL  148

Query  544  NVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTID  723
            N+ HNQ +G+V V F  LT+L+TLDFSFNS   ++P TF+SLT++K++YLQNN F+GT++
Sbjct  149  NLGHNQFKGQVAVDFSKLTSLTTLDFSFNSFTLSLPGTFTSLTSLKSLYLQNNQFSGTLN  208

Query  724  VLANLPLDNL  753
            VLA LPL+ L
Sbjct  209  VLAGLPLETL  218



>ref|XP_006369070.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
 gb|ERP65639.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
Length=715

 Score =   244 bits (623),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 122/190 (64%), Positives = 156/190 (82%), Gaps = 0/190 (0%)
 Frame = +1

Query  184  TDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGS  363
            TDP DAS LR +FSS+NSP QLT+W+ANG DPCG++WKG++CSG+RVTEI++ GL L+GS
Sbjct  26   TDPNDASALRVMFSSMNSPGQLTQWSANGDDPCGQNWKGITCSGSRVTEIKLPGLALSGS  85

Query  364  MGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYL  543
            +G+QLD L +    D+S NNL  +LPYQLPPN+Q+LNLA N  +GG+PYSIS M  L YL
Sbjct  86   LGYQLDSLTAAMNLDLSNNNLAGALPYQLPPNLQRLNLANNKLSGGIPYSISLMRSLTYL  145

Query  544  NVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTID  723
            N+ HNQLQ ++  MF  LT+LSTLD SFN L G++P++FSSL++MK+MYLQ+N FTG ID
Sbjct  146  NLGHNQLQSQLGDMFGQLTSLSTLDVSFNLLTGDLPESFSSLSSMKSMYLQSNQFTGAID  205

Query  724  VLANLPLDNL  753
            VLANLPL+NL
Sbjct  206  VLANLPLENL  215



>emb|CDY25686.1| BnaC03g69890D [Brassica napus]
Length=716

 Score =   244 bits (622),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 112/190 (59%), Positives = 156/190 (82%), Gaps = 0/190 (0%)
 Frame = +1

Query  184  TDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGS  363
            TD +D S L  LF+S++SP QLT+WTA+GGDPC ++W+GV+CS +R+T++++SGL+L+G+
Sbjct  29   TDASDTSALNMLFTSMHSPGQLTQWTASGGDPCVQNWRGVTCSKSRITQLKLSGLELSGT  88

Query  364  MGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYL  543
            +G+ LD+L S+T  D+S+NNLG  LPYQLPPN+Q+LNLA N FTG   YSIS MA L+YL
Sbjct  89   LGYMLDKLTSLTELDLSSNNLGGDLPYQLPPNLQRLNLANNQFTGAAQYSISNMASLKYL  148

Query  544  NVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTID  723
            N+ HNQ +G+V V F  LT+L+TLDFSFNS   ++P TF+SLT++K++YLQNN F+GT++
Sbjct  149  NLGHNQFKGQVAVDFSKLTSLTTLDFSFNSFTSSLPGTFTSLTSLKSLYLQNNQFSGTLN  208

Query  724  VLANLPLDNL  753
            VLA LPL+ L
Sbjct  209  VLAGLPLETL  218



>gb|KCW53999.1| hypothetical protein EUGRSUZ_J03194, partial [Eucalyptus grandis]
Length=708

 Score =   243 bits (619),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 116/208 (56%), Positives = 156/208 (75%), Gaps = 0/208 (0%)
 Frame = +1

Query  130  VALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSC  309
            +ALL+  +    PS  + TD  D S L  ++SSLNSP  LT W + GGDPCGESWKG+ C
Sbjct  13   LALLVTCIGTLIPSVHSKTDAPDVSALNVMYSSLNSPSALTGWKSGGGDPCGESWKGIKC  72

Query  310  SGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNG  489
            SG+ VTEI++S L LTGS+G+QL  LKSVT FD+S NNL   +PYQLPPN   ++L+ N 
Sbjct  73   SGSSVTEIKLSDLGLTGSIGYQLSSLKSVTYFDLSENNLRGDIPYQLPPNALHIDLSSNA  132

Query  490  FTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSL  669
            FTG +PYSISQM  L+YLN+ HNQ++G+++ MF  L  L+TLD S+NSL+GN+PQ+F SL
Sbjct  133  FTGNVPYSISQMTDLKYLNLGHNQVKGQLSDMFGKLPKLATLDLSYNSLSGNLPQSFGSL  192

Query  670  TNMKNMYLQNNVFTGTIDVLANLPLDNL  753
            +++  ++LQNN FTG I+VL +LPL++L
Sbjct  193  SSLTKLHLQNNQFTGPINVLTDLPLNDL  220



>ref|XP_010489831.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7-like [Camelina 
sativa]
Length=404

 Score =   235 bits (599),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 112/197 (57%), Positives = 156/197 (79%), Gaps = 1/197 (1%)
 Frame = +1

Query  163  PPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQIS  342
            P   +  TD +D S L  +F+S+NSP QL++WTA+GGDPCG++W+GV+CSG+RVT+I++ 
Sbjct  22   PSFILGATDASDTSALNIMFTSMNSPGQLSQWTASGGDPCGQNWRGVTCSGSRVTQIKLP  81

Query  343  GLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQ  522
             L L+G++G+ LD+L SVT FD+S NNLG  LPYQLPPN+++LNLA N FTG   YSIS 
Sbjct  82   SLGLSGTLGYTLDKLTSVTEFDLSNNNLGGDLPYQLPPNLERLNLANNQFTGSAQYSISL  141

Query  523  MAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNN  702
            MAPL+YLN++HNQL+ ++ + F  LT+LS LD S N++ G++P + S LT+ K++YLQNN
Sbjct  142  MAPLKYLNLAHNQLK-QLAIDFTKLTSLSILDLSSNAITGSLPNSCSFLTSAKSIYLQNN  200

Query  703  VFTGTIDVLANLPLDNL  753
             F+GTID+LA LPL+NL
Sbjct  201  QFSGTIDILATLPLENL  217



>ref|XP_010034888.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5-like [Eucalyptus 
grandis]
Length=716

 Score =   242 bits (617),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 116/208 (56%), Positives = 156/208 (75%), Gaps = 0/208 (0%)
 Frame = +1

Query  130  VALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSC  309
            +ALL+  +    PS  + TD  D S L  ++SSLNSP  LT W + GGDPCGESWKG+ C
Sbjct  26   LALLVTCIGTLIPSVHSKTDAPDVSALNVMYSSLNSPSALTGWKSGGGDPCGESWKGIKC  85

Query  310  SGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNG  489
            SG+ VTEI++S L LTGS+G+QL  LKSVT FD+S NNL   +PYQLPPN   ++L+ N 
Sbjct  86   SGSSVTEIKLSDLGLTGSIGYQLSSLKSVTYFDLSENNLRGDIPYQLPPNALHIDLSSNA  145

Query  490  FTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSL  669
            FTG +PYSISQM  L+YLN+ HNQ++G+++ MF  L  L+TLD S+NSL+GN+PQ+F SL
Sbjct  146  FTGNVPYSISQMTDLKYLNLGHNQVKGQLSDMFGKLPKLATLDLSYNSLSGNLPQSFGSL  205

Query  670  TNMKNMYLQNNVFTGTIDVLANLPLDNL  753
            +++  ++LQNN FTG I+VL +LPL++L
Sbjct  206  SSLTKLHLQNNQFTGPINVLTDLPLNDL  233



>ref|XP_004303773.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7 [Fragaria vesca 
subsp. vesca]
Length=717

 Score =   242 bits (617),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 115/198 (58%), Positives = 154/198 (78%), Gaps = 0/198 (0%)
 Frame = +1

Query  160  APPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQI  339
            +P S  ADTDP+D S L  ++SSLNSP QLT+W+A+ GDPCG+SWKGV C+ +RVTEI +
Sbjct  20   SPISINADTDPSDVSALTVMYSSLNSPSQLTQWSASSGDPCGQSWKGVKCTRSRVTEIDL  79

Query  340  SGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSIS  519
            SGL L+GS G+ L  L ++T  D+S NNL   +PY LPPN+ +LNL GN FT G+PYS+S
Sbjct  80   SGLGLSGSFGYNLQSLTALTNLDMSNNNLAGGIPYNLPPNLTRLNLGGNQFTQGIPYSVS  139

Query  520  QMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQN  699
             M  L+YLN+SHNQLQ  +  +F  L++L+TLD SFN++ G++P++FSSL+++K + LQN
Sbjct  140  MMTSLKYLNISHNQLQNTLDDVFGKLSSLTTLDLSFNTMPGSLPESFSSLSSLKTLDLQN  199

Query  700  NVFTGTIDVLANLPLDNL  753
            N  TGTIDVLANLPL+NL
Sbjct  200  NQLTGTIDVLANLPLENL  217



>ref|XP_002891770.1| hypothetical protein ARALYDRAFT_474507 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68029.1| hypothetical protein ARALYDRAFT_474507 [Arabidopsis lyrata subsp. 
lyrata]
Length=721

 Score =   242 bits (617),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 120/225 (53%), Positives = 164/225 (73%), Gaps = 14/225 (6%)
 Frame = +1

Query  100  MRELMGLPWAV------ALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWT  261
            MRE     WAV       +++GF L     A   TD +D S L  LFS ++SP QLT+WT
Sbjct  1    MRE----NWAVVALFTLCIVVGFELRFIHGA---TDASDTSALNTLFSGMHSPAQLTQWT  53

Query  262  ANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMG-FQLDQLKSVTTFDISTNNLGNSL  438
            A  GDPCG++W+GV+CSG+RVT+I++ GL+L+G++G + LD+L S+T  D+S+NNLG  L
Sbjct  54   AAAGDPCGQNWRGVTCSGSRVTQIKLPGLELSGTLGGYMLDKLTSLTELDLSSNNLGGDL  113

Query  439  PYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLD  618
            PYQ PPN+Q+L LA N FTG   YSISQ+  L+YLN+ HNQ +G++ + F  L +L+TLD
Sbjct  114  PYQFPPNLQRLYLANNQFTGAAAYSISQITTLKYLNLGHNQFKGQIAIDFTKLDSLTTLD  173

Query  619  FSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTIDVLANLPLDNL  753
            FSFNS   ++P TFSSLT++K++YLQNN F+GT+DVLA LPL+ L
Sbjct  174  FSFNSFTNSLPGTFSSLTSLKSLYLQNNQFSGTVDVLAGLPLETL  218



>ref|XP_008465033.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7 isoform X1 [Cucumis 
melo]
 ref|XP_008465034.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7 isoform X1 [Cucumis 
melo]
Length=726

 Score =   241 bits (616),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 117/190 (62%), Positives = 150/190 (79%), Gaps = 0/190 (0%)
 Frame = +1

Query  184  TDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGS  363
            TDP D S L  ++SSLNSPP LT+W+++GGDPCG+ WKG++C G RVTEI +SGL L+G+
Sbjct  30   TDPGDVSALNAMYSSLNSPPILTQWSSSGGDPCGQIWKGITCLGLRVTEISLSGLGLSGT  89

Query  364  MGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYL  543
            MG+QL  L S+T  D+S NNLG  +PYQLP N+QKLNL  N F+G +PYSISQM+ L  L
Sbjct  90   MGYQLSSLTSLTNLDVSNNNLGPDIPYQLPQNLQKLNLGWNNFSGSIPYSISQMSLLISL  149

Query  544  NVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTID  723
            N+SHNQLQ +V  MF  L++L+ LD SFN L+G +PQ+FS+LT++  M+LQNN F+GTID
Sbjct  150  NMSHNQLQNQVNDMFWKLSSLAMLDISFNFLSGALPQSFSNLTSLNAMFLQNNQFSGTID  209

Query  724  VLANLPLDNL  753
            VLANLPL NL
Sbjct  210  VLANLPLQNL  219



>ref|XP_008465035.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7 isoform X2 [Cucumis 
melo]
Length=722

 Score =   241 bits (615),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 117/190 (62%), Positives = 150/190 (79%), Gaps = 0/190 (0%)
 Frame = +1

Query  184  TDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGS  363
            TDP D S L  ++SSLNSPP LT+W+++GGDPCG+ WKG++C G RVTEI +SGL L+G+
Sbjct  30   TDPGDVSALNAMYSSLNSPPILTQWSSSGGDPCGQIWKGITCLGLRVTEISLSGLGLSGT  89

Query  364  MGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYL  543
            MG+QL  L S+T  D+S NNLG  +PYQLP N+QKLNL  N F+G +PYSISQM+ L  L
Sbjct  90   MGYQLSSLTSLTNLDVSNNNLGPDIPYQLPQNLQKLNLGWNNFSGSIPYSISQMSLLISL  149

Query  544  NVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTID  723
            N+SHNQLQ +V  MF  L++L+ LD SFN L+G +PQ+FS+LT++  M+LQNN F+GTID
Sbjct  150  NMSHNQLQNQVNDMFWKLSSLAMLDISFNFLSGALPQSFSNLTSLNAMFLQNNQFSGTID  209

Query  724  VLANLPLDNL  753
            VLANLPL NL
Sbjct  210  VLANLPLQNL  219



>ref|XP_006300068.1| hypothetical protein CARUB_v10016296mg [Capsella rubella]
 gb|EOA32966.1| hypothetical protein CARUB_v10016296mg [Capsella rubella]
Length=717

 Score =   241 bits (615),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 118/209 (56%), Positives = 164/209 (78%), Gaps = 2/209 (1%)
 Frame = +1

Query  130  VALLIGFLLNAPPSAV-ADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVS  306
            +AL++  ++   PS +  DTD +D S L  LF+S+NSP QL++WTA+GGDPCG++W+GV+
Sbjct  8    LALVLLCIVGFEPSFIHGDTDASDTSALNSLFTSMNSPGQLSQWTASGGDPCGQNWRGVT  67

Query  307  CSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGN  486
            CSG+RVT+I++  L L+GS+GF LD+L SVT  D+S NNLG  L YQLPPN+++LNLA N
Sbjct  68   CSGSRVTQIKLPSLGLSGSLGFMLDKLTSVTELDLSNNNLGGDLSYQLPPNLERLNLANN  127

Query  487  GFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSS  666
             FTG   YSIS MAPL+YLN++HNQL+ ++ + F  LT+LS LD S N++ G++P + SS
Sbjct  128  QFTGSAQYSISLMAPLKYLNLAHNQLK-QLAIDFTKLTSLSILDLSSNAITGSLPNSCSS  186

Query  667  LTNMKNMYLQNNVFTGTIDVLANLPLDNL  753
            LT+ K++YLQNN F+GTID+LA LPL+NL
Sbjct  187  LTSAKSIYLQNNQFSGTIDILATLPLENL  215



>ref|XP_011011656.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5-like [Populus 
euphratica]
Length=700

 Score =   240 bits (613),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 110/192 (57%), Positives = 151/192 (79%), Gaps = 0/192 (0%)
 Frame = +1

Query  178  ADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLT  357
            + TD  D S L  +F+SLNSP +L+ W + GGDPCG+SW+G+ CSG+ VT+I++SGL LT
Sbjct  28   SKTDSDDVSALNVMFTSLNSPSKLSGWKSRGGDPCGDSWEGIQCSGSSVTQIKLSGLGLT  87

Query  358  GSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLE  537
            GS+G+QL  LKSVT FD+S NNL N +PYQLPPN   L+L+ NGFTG +PYSISQM  L+
Sbjct  88   GSLGYQLSNLKSVTYFDVSKNNLNNDIPYQLPPNTVNLDLSNNGFTGNVPYSISQMTKLQ  147

Query  538  YLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGT  717
            YLN++HN++ G+++ MF  LT L T+D S NS++GN+PQ+FS+L ++  ++LQ+N FTGT
Sbjct  148  YLNLNHNKINGQLSDMFQKLTKLKTMDLSHNSISGNLPQSFSALKSLSTLHLQDNKFTGT  207

Query  718  IDVLANLPLDNL  753
            +DVLA LPL +L
Sbjct  208  LDVLAALPLKDL  219



>ref|XP_002320001.2| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
 gb|EEE98316.2| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
Length=681

 Score =   239 bits (611),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 110/192 (57%), Positives = 150/192 (78%), Gaps = 0/192 (0%)
 Frame = +1

Query  178  ADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLT  357
            + TD  D S L  +F+SLNSP +L+ W + GGDPCG+SW+G+ CSG+ VT+I++SGL LT
Sbjct  22   SKTDSDDVSALNVMFTSLNSPSKLSGWKSRGGDPCGDSWEGIQCSGSSVTQIKLSGLGLT  81

Query  358  GSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLE  537
            GS+G+QL  LKSVT FD+S NNL N +PYQLPPN   L+L+ NGFTG +PYSISQM  L+
Sbjct  82   GSLGYQLSNLKSVTYFDVSKNNLNNDIPYQLPPNTVNLDLSNNGFTGNVPYSISQMTKLQ  141

Query  538  YLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGT  717
            YLN++HN++ G+++ MF  LT L T+D S NS++GN+PQ+FS+L ++   +LQ+N FTGT
Sbjct  142  YLNLNHNKINGQLSDMFQKLTKLKTMDLSHNSISGNLPQSFSALKSLSTFHLQDNKFTGT  201

Query  718  IDVLANLPLDNL  753
            +DVLA LPL +L
Sbjct  202  LDVLAALPLKDL  213



>ref|XP_010655240.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5 isoform X2 [Vitis 
vinifera]
Length=611

 Score =   238 bits (606),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 114/196 (58%), Positives = 152/196 (78%), Gaps = 0/196 (0%)
 Frame = +1

Query  166  PSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISG  345
            P A + T   D S L  +++SLNSP QLT W ++GGDPCGESWKG+ CSG+ +TEI++SG
Sbjct  19   PIAHSTTVAPDVSALNVMYNSLNSPSQLTGWKSSGGDPCGESWKGIKCSGSSITEIKLSG  78

Query  346  LQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQM  525
            L LTGSMG+QL  L SVT FD+S NNL   +PYQLPPNV  L+L+ NGFTGG+PYSISQM
Sbjct  79   LGLTGSMGYQLSSLTSVTNFDMSKNNLKGDIPYQLPPNVLHLDLSRNGFTGGVPYSISQM  138

Query  526  APLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNV  705
              L+YLN+ HN+L G+++ MF  L  L+ +D SFN+L+ N+PQ+F SL+++  + LQNN 
Sbjct  139  TDLKYLNLGHNKLNGQLSDMFGQLPKLTLMDLSFNTLSDNLPQSFGSLSSLTTLRLQNNQ  198

Query  706  FTGTIDVLANLPLDNL  753
            FTG+I+VLA+LPL++L
Sbjct  199  FTGSINVLADLPLNDL  214



>ref|XP_002513297.1| strubbelig receptor, putative [Ricinus communis]
 gb|EEF48700.1| strubbelig receptor, putative [Ricinus communis]
Length=694

 Score =   239 bits (609),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 115/209 (55%), Positives = 158/209 (76%), Gaps = 4/209 (2%)
 Frame = +1

Query  139  LIGFLLNA----PPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVS  306
            L+GFL+ +       A + T+  D S L  +F+ LNSP QL+ W ++GGDPC +SW+G++
Sbjct  5    LVGFLIVSLGFLSTLAHSKTNSQDVSALNVMFTGLNSPSQLSGWKSSGGDPCDDSWEGIT  64

Query  307  CSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGN  486
            CSG+ VT+I++SGL L+GSMG+QL  LKSVT FD+S NNL N +PYQLPPN   L+L+ N
Sbjct  65   CSGSSVTQIKLSGLGLSGSMGYQLSNLKSVTYFDMSKNNLDNDIPYQLPPNTAHLDLSNN  124

Query  487  GFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSS  666
            GF+G +PYSISQM  LEYLN+ HNQL G+++ MF  L  L +LD S+NSL+GN+PQ+F+S
Sbjct  125  GFSGNVPYSISQMTDLEYLNLGHNQLNGQLSDMFQKLPKLKSLDLSYNSLSGNLPQSFAS  184

Query  667  LTNMKNMYLQNNVFTGTIDVLANLPLDNL  753
            L+++  + LQ+N FTG+I+VLA LPLD L
Sbjct  185  LSSLNTLRLQDNKFTGSINVLAGLPLDTL  213



>ref|XP_010501850.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7 [Camelina sativa]
Length=721

 Score =   239 bits (610),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 116/205 (57%), Positives = 160/205 (78%), Gaps = 4/205 (2%)
 Frame = +1

Query  139  LIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGN  318
            ++GF    P   +  TD +D S L  +F S+NSP QL++WTA+GGDPCG++WKGV+CSG+
Sbjct  18   IVGF---EPSFILGATDASDTSALNIMFISMNSPGQLSQWTASGGDPCGQNWKGVTCSGS  74

Query  319  RVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTG  498
            RVT+I++ GL L+G++G+ LD+L SVT FD+S NNLG  LPYQLPPN+++LNLA N FTG
Sbjct  75   RVTQIKLPGLGLSGTLGYTLDKLTSVTEFDLSNNNLGGDLPYQLPPNLERLNLANNQFTG  134

Query  499  GLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNM  678
               YSIS MAPL+YLN++HNQL+ ++ + F  LT+LS LD S N++ G++P + S LT+ 
Sbjct  135  SAQYSISLMAPLKYLNLAHNQLK-QLAIDFTKLTSLSILDLSSNAITGSLPNSCSFLTSA  193

Query  679  KNMYLQNNVFTGTIDVLANLPLDNL  753
            K++YLQNN F+GTID+LA LPL+NL
Sbjct  194  KSIYLQNNQFSGTIDILATLPLENL  218



>ref|XP_010465325.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7-like [Camelina 
sativa]
Length=721

 Score =   239 bits (610),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 114/190 (60%), Positives = 154/190 (81%), Gaps = 1/190 (1%)
 Frame = +1

Query  184  TDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGS  363
            TD +D S L  +F+S+NSP QL++WTA+GGDPCG++WKGV+CSG R+T+I++ GL L+GS
Sbjct  30   TDASDTSALNTMFNSMNSPGQLSQWTASGGDPCGQNWKGVTCSGLRITQIKLPGLGLSGS  89

Query  364  MGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYL  543
            +G+ LD+L SVT FD+S NNLG  LPYQLPPN+++LNLA N FTG   YSIS MAPL+YL
Sbjct  90   LGYMLDKLTSVTEFDLSNNNLGGDLPYQLPPNLERLNLANNQFTGSAQYSISLMAPLKYL  149

Query  544  NVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTID  723
            N++HNQL+ ++ + F  LT+LS LD S N++ G++P T S LT+ K++YLQNN F+GTID
Sbjct  150  NLAHNQLK-QLAIDFTKLTSLSILDLSSNAITGSLPNTCSFLTSAKSIYLQNNQFSGTID  208

Query  724  VLANLPLDNL  753
            +LA LPL+NL
Sbjct  209  ILATLPLENL  218



>ref|XP_006426818.1| hypothetical protein CICLE_v10025011mg [Citrus clementina]
 gb|ESR40058.1| hypothetical protein CICLE_v10025011mg [Citrus clementina]
Length=723

 Score =   239 bits (610),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 118/192 (61%), Positives = 159/192 (83%), Gaps = 0/192 (0%)
 Frame = +1

Query  178  ADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLT  357
            A TDP+DAS L+ ++SSLNSP QL++W+A G DPCG+SWKGV CSG RVTE+++SGL L+
Sbjct  30   AATDPSDASALKIMYSSLNSPSQLSQWSATGDDPCGQSWKGVICSGQRVTELKLSGLGLS  89

Query  358  GSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLE  537
            GS+G+QL  L ++T  D+S NN G  +PY +PPN+++L+L  N FTG +PYSISQM  L+
Sbjct  90   GSVGYQLSSLTALTNLDLSNNNFGGDIPYNIPPNLERLDLENNKFTGNVPYSISQMKTLK  149

Query  538  YLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGT  717
            Y+N++HNQLQG++  MF  L +LSTLD SFN+L+GN+PQ+FSSL+++ ++YLQNN F+GT
Sbjct  150  YVNIAHNQLQGQLNDMFGQLPSLSTLDLSFNTLSGNLPQSFSSLSSLSSLYLQNNQFSGT  209

Query  718  IDVLANLPLDNL  753
            IDVLANLPLDNL
Sbjct  210  IDVLANLPLDNL  221



>ref|XP_008800485.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like [Phoenix 
dactylifera]
Length=725

 Score =   239 bits (610),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 119/225 (53%), Positives = 168/225 (75%), Gaps = 5/225 (2%)
 Frame = +1

Query  85   RASLKMRELMGLPWAVALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTA  264
            R  ++ + ++G+ WAV   I ++ N P  A   TD  D S L  L+ SL SP QLT W +
Sbjct  3    REGVREKRMVGI-WAVLACI-WVWN-PSVANGATDSADVSALNVLYRSLQSPGQLTGWNS  59

Query  265  NGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLG--NSL  438
            +GGDPC +SW GV+CSG+ VT I++SGL+L+GS+G+Q+  + S+T  D+S NNLG    +
Sbjct  60   SGGDPCEQSWLGVTCSGSAVTAIKLSGLELSGSLGYQMSSMTSLTELDMSNNNLGGGQQI  119

Query  439  PYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLD  618
            PY LPPN+++LNLAGN F G +PYSIS++ PL+YLN+ HNQLQG ++ MF  LTNL+T+D
Sbjct  120  PYNLPPNLERLNLAGNQFAGNVPYSISRIVPLKYLNLGHNQLQGNLSDMFGQLTNLTTVD  179

Query  619  FSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTIDVLANLPLDNL  753
             SFNSL G++P++F+SL+++  +YLQNN  TG+I+VLANLPLD+L
Sbjct  180  LSFNSLTGDLPESFNSLSSLTTLYLQNNQLTGSINVLANLPLDDL  224



>ref|XP_004144448.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like [Cucumis 
sativus]
Length=726

 Score =   238 bits (608),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 115/190 (61%), Positives = 150/190 (79%), Gaps = 0/190 (0%)
 Frame = +1

Query  184  TDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGS  363
            TDP D S L  +++SLNSPP LT+W+++GGDPCG+ WKG++C G RVTEI +SGL L+G+
Sbjct  30   TDPGDVSALNAMYTSLNSPPILTQWSSSGGDPCGQIWKGITCLGLRVTEISLSGLGLSGT  89

Query  364  MGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYL  543
            +G+QL  L S+T  D+S NNLG  +PYQLP N+QKLNL  N F+G +PYSISQM+ L  L
Sbjct  90   LGYQLSSLTSLTNLDVSNNNLGPDIPYQLPQNLQKLNLGWNNFSGSIPYSISQMSLLISL  149

Query  544  NVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTID  723
            N+SHNQLQ +V  MF  L++L+ LD SFN L+G +PQ+FS+LT++  M+LQNN F+GTID
Sbjct  150  NMSHNQLQNQVNDMFWKLSSLAMLDVSFNFLSGALPQSFSNLTSLNAMFLQNNQFSGTID  209

Query  724  VLANLPLDNL  753
            VLANLPL NL
Sbjct  210  VLANLPLQNL  219



>emb|CBI18374.3| unnamed protein product [Vitis vinifera]
Length=694

 Score =   238 bits (607),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 114/196 (58%), Positives = 152/196 (78%), Gaps = 0/196 (0%)
 Frame = +1

Query  166  PSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISG  345
            P A + T   D S L  +++SLNSP QLT W ++GGDPCGESWKG+ CSG+ +TEI++SG
Sbjct  19   PIAHSTTVAPDVSALNVMYNSLNSPSQLTGWKSSGGDPCGESWKGIKCSGSSITEIKLSG  78

Query  346  LQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQM  525
            L LTGSMG+QL  L SVT FD+S NNL   +PYQLPPNV  L+L+ NGFTGG+PYSISQM
Sbjct  79   LGLTGSMGYQLSSLTSVTNFDMSKNNLKGDIPYQLPPNVLHLDLSRNGFTGGVPYSISQM  138

Query  526  APLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNV  705
              L+YLN+ HN+L G+++ MF  L  L+ +D SFN+L+ N+PQ+F SL+++  + LQNN 
Sbjct  139  TDLKYLNLGHNKLNGQLSDMFGQLPKLTLMDLSFNTLSDNLPQSFGSLSSLTTLRLQNNQ  198

Query  706  FTGTIDVLANLPLDNL  753
            FTG+I+VLA+LPL++L
Sbjct  199  FTGSINVLADLPLNDL  214



>ref|XP_010655239.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5 isoform X1 [Vitis 
vinifera]
Length=687

 Score =   238 bits (606),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 114/196 (58%), Positives = 152/196 (78%), Gaps = 0/196 (0%)
 Frame = +1

Query  166  PSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISG  345
            P A + T   D S L  +++SLNSP QLT W ++GGDPCGESWKG+ CSG+ +TEI++SG
Sbjct  19   PIAHSTTVAPDVSALNVMYNSLNSPSQLTGWKSSGGDPCGESWKGIKCSGSSITEIKLSG  78

Query  346  LQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQM  525
            L LTGSMG+QL  L SVT FD+S NNL   +PYQLPPNV  L+L+ NGFTGG+PYSISQM
Sbjct  79   LGLTGSMGYQLSSLTSVTNFDMSKNNLKGDIPYQLPPNVLHLDLSRNGFTGGVPYSISQM  138

Query  526  APLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNV  705
              L+YLN+ HN+L G+++ MF  L  L+ +D SFN+L+ N+PQ+F SL+++  + LQNN 
Sbjct  139  TDLKYLNLGHNKLNGQLSDMFGQLPKLTLMDLSFNTLSDNLPQSFGSLSSLTTLRLQNNQ  198

Query  706  FTGTIDVLANLPLDNL  753
            FTG+I+VLA+LPL++L
Sbjct  199  FTGSINVLADLPLNDL  214



>ref|XP_004165988.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like [Cucumis 
sativus]
Length=726

 Score =   238 bits (608),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 115/190 (61%), Positives = 150/190 (79%), Gaps = 0/190 (0%)
 Frame = +1

Query  184  TDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGS  363
            TDP D S L  +++SLNSPP LT+W+++GGDPCG+ WKG++C G RVTEI +SGL L+G+
Sbjct  30   TDPGDVSALNAMYTSLNSPPILTQWSSSGGDPCGQIWKGITCLGLRVTEISLSGLGLSGT  89

Query  364  MGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYL  543
            +G+QL  L S+T  D+S NNLG  +PYQLP N+QKLNL  N F+G +PYSISQM+ L  L
Sbjct  90   LGYQLSSLTSLTNLDVSNNNLGPDIPYQLPQNLQKLNLGWNNFSGSIPYSISQMSLLISL  149

Query  544  NVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTID  723
            N+SHNQLQ +V  MF  L++L+ LD SFN L+G +PQ+FS+LT++  M+LQNN F+GTID
Sbjct  150  NMSHNQLQNQVNDMFWKLSSLAMLDVSFNFLSGALPQSFSNLTSLNAMFLQNNQFSGTID  209

Query  724  VLANLPLDNL  753
            VLANLPL NL
Sbjct  210  VLANLPLQNL  219



>ref|XP_010928729.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5-like [Elaeis 
guineensis]
Length=684

 Score =   238 bits (606),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 119/212 (56%), Positives = 156/212 (74%), Gaps = 4/212 (2%)
 Frame = +1

Query  118  LPWAVALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWK  297
            LP  +A+ +G +     SA+A+TD  D S L  LF SLNSPPQLT W+++GGDPCGE WK
Sbjct  5    LPVLLAVALGLVF----SALAETDQDDVSALNVLFLSLNSPPQLTGWSSSGGDPCGEDWK  60

Query  298  GVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNL  477
            GV CS   VTEI ++ L LTGS+G+QL  L S+T FD+S NNL  ++PYQLPP V+ LNL
Sbjct  61   GVKCSDLSVTEISLADLGLTGSLGYQLSSLTSITYFDMSKNNLRGNIPYQLPPKVEHLNL  120

Query  478  AGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQT  657
            A N FTGG+PYSISQM  L+YLN+  NQL G++  +F  LT LS +  SFN L+GN+P +
Sbjct  121  AENAFTGGIPYSISQMTDLKYLNLGKNQLNGQLNDIFGKLTRLSEMYLSFNQLSGNLPHS  180

Query  658  FSSLTNMKNMYLQNNVFTGTIDVLANLPLDNL  753
              SL ++K ++LQNN F+G+I+VLANLPL++L
Sbjct  181  SQSLKSLKVLHLQNNQFSGSINVLANLPLEDL  212



>ref|XP_011012291.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5-like [Populus 
euphratica]
Length=694

 Score =   238 bits (606),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 109/192 (57%), Positives = 149/192 (78%), Gaps = 0/192 (0%)
 Frame = +1

Query  178  ADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLT  357
            + TD  D S L  +F+SLNSP +L+ W + GGDPCG+SW+G+ CSG+ VT+I++ GL LT
Sbjct  22   SKTDSDDVSALNVMFTSLNSPSKLSGWKSRGGDPCGDSWEGIHCSGSSVTQIKLPGLGLT  81

Query  358  GSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLE  537
            GS+G+QL  LKSVT FD+S NNL N +PYQLPPN   L+L+ NGFTG +PYSISQM  L+
Sbjct  82   GSLGYQLSNLKSVTYFDVSKNNLNNDIPYQLPPNTVNLDLSNNGFTGNVPYSISQMTKLQ  141

Query  538  YLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGT  717
            YLN++HN++ G+++ MF  LT L T+D S NS++GN+PQ+FS+L ++  ++LQ+N FTGT
Sbjct  142  YLNLNHNKINGQLSDMFQKLTKLKTMDLSHNSISGNLPQSFSALKSLSTLHLQDNKFTGT  201

Query  718  IDVLANLPLDNL  753
            +DVLA LPL  L
Sbjct  202  LDVLAALPLKEL  213



>gb|KHN16389.1| Protein STRUBBELIG-RECEPTOR FAMILY 6 [Glycine soja]
Length=722

 Score =   238 bits (607),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 122/197 (62%), Positives = 149/197 (76%), Gaps = 1/197 (1%)
 Frame = +1

Query  163  PPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQIS  342
            P SA A TDP DA+ +R LF ++NSPPQL  W  NG DPCG+SWKG++CSGNRVTEI++S
Sbjct  22   PNSATAATDPNDAAAVRFLFQNMNSPPQL-GWPPNGDDPCGQSWKGITCSGNRVTEIKLS  80

Query  343  GLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQ  522
             L LTGS+ + L  L S+   D+S+N LG S+PYQLPP +Q+LNLA N  TG +PYSIS 
Sbjct  81   NLGLTGSVPYGLQVLTSLNDLDMSSNRLGGSIPYQLPPYLQRLNLAYNNITGTVPYSISN  140

Query  523  MAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNN  702
            +  L  LN+ HNQLQ  + V F +L+ LSTLD SFNSL G++PQT SSL+ +  MYLQNN
Sbjct  141  LTALTDLNLGHNQLQQGLGVDFHNLSTLSTLDLSFNSLTGDLPQTMSSLSRITTMYLQNN  200

Query  703  VFTGTIDVLANLPLDNL  753
             FTGTIDVLANLPLDNL
Sbjct  201  QFTGTIDVLANLPLDNL  217



>ref|XP_010245765.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5-like [Nelumbo 
nucifera]
Length=760

 Score =   238 bits (607),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 110/185 (59%), Positives = 148/185 (80%), Gaps = 0/185 (0%)
 Frame = +1

Query  199  ASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQL  378
             S L  +++SLNSP +LT W ++GGDPCG+SWKG+ CSG+ V EI++SGL LTGS+G++L
Sbjct  81   VSALHVMYTSLNSPSKLTNWKSSGGDPCGDSWKGIKCSGSHVKEIKLSGLGLTGSLGYKL  140

Query  379  DQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHN  558
              L S+T FD+S NNL +S+PYQLPPNV  +NLAGN FTG +PYSISQM  L+YLN+ HN
Sbjct  141  SSLTSLTYFDLSNNNLKDSIPYQLPPNVLHINLAGNSFTGTVPYSISQMLNLKYLNLGHN  200

Query  559  QLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTIDVLANL  738
            QL G+++ MF  LT L  LD SFNSL+GN+PQ+F +L+++  +YLQNN FTG+I+VL +L
Sbjct  201  QLSGQLSDMFGHLTRLQFLDLSFNSLSGNLPQSFETLSSLSTLYLQNNKFTGSINVLTHL  260

Query  739  PLDNL  753
            P+D+L
Sbjct  261  PIDDL  265



>ref|XP_006604928.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like isoform 
X1 [Glycine max]
 gb|KHN11358.1| Protein STRUBBELIG-RECEPTOR FAMILY 6 [Glycine soja]
Length=721

 Score =   237 bits (605),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 124/208 (60%), Positives = 152/208 (73%), Gaps = 1/208 (0%)
 Frame = +1

Query  130  VALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSC  309
            V +    L   P  A A TDP DA+ +R LF ++NSPPQL  W  NG DPCG+SWKG++C
Sbjct  9    VCITTCILCWMPNGATAATDPNDAAAVRFLFQNMNSPPQL-GWPPNGDDPCGQSWKGITC  67

Query  310  SGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNG  489
            SGNRVTEI++S L LTGS+ + L  L S+T  D+S+N+LG S+PYQLPP +Q LNLA N 
Sbjct  68   SGNRVTEIKLSNLGLTGSLPYGLQVLTSLTYVDMSSNSLGGSIPYQLPPYLQHLNLAYNN  127

Query  490  FTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSL  669
             TG +PYSIS +  L  LN SHNQLQ  + V F++L+ LSTLD SFN L G++PQT SSL
Sbjct  128  ITGTVPYSISNLTALTDLNFSHNQLQQGLGVDFLNLSTLSTLDLSFNFLTGDLPQTMSSL  187

Query  670  TNMKNMYLQNNVFTGTIDVLANLPLDNL  753
            + +  MYLQNN FTGTIDVLANLPLDNL
Sbjct  188  SRITTMYLQNNQFTGTIDVLANLPLDNL  215



>emb|CDX97567.1| BnaA05g25120D [Brassica napus]
Length=723

 Score =   237 bits (605),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 126/209 (60%), Positives = 166/209 (79%), Gaps = 2/209 (1%)
 Frame = +1

Query  130  VALLIGFLLNAPPSAV-ADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVS  306
            +AL I  ++   PS +  DT+ +DA+ L  LFSSLNSP QL++WTA+GGDPCG++WKG++
Sbjct  14   LALFILCIVGLKPSFILGDTNASDAAALNNLFSSLNSPGQLSQWTASGGDPCGQNWKGIT  73

Query  307  CSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGN  486
            CS +RVT+I++SGL L+GS+GF LD+L SVT FD+S NNLG  LPYQLPPN+++LNLA N
Sbjct  74   CSNSRVTQIKLSGLGLSGSLGFMLDKLTSVTEFDLSNNNLGGDLPYQLPPNLERLNLANN  133

Query  487  GFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSS  666
             FTG   YSIS M PL+YLN++HNQL+ ++ + F  LT+LS LD S N++ G++P T SS
Sbjct  134  QFTGSAQYSISLMTPLKYLNLAHNQLK-QLAIDFTKLTSLSILDLSSNTITGSLPNTMSS  192

Query  667  LTNMKNMYLQNNVFTGTIDVLANLPLDNL  753
            LTN K++YLQNN FTGTIDVLA LPL+NL
Sbjct  193  LTNAKSIYLQNNQFTGTIDVLATLPLENL  221



>gb|KDO67050.1| hypothetical protein CISIN_1g040888mg, partial [Citrus sinensis]
Length=495

 Score =   232 bits (591),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 110/208 (53%), Positives = 152/208 (73%), Gaps = 0/208 (0%)
 Frame = +1

Query  130  VALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSC  309
            V   I +L +     ++ TD  DAS L  +++SL+SP QL+ W A GGDPCGE WKG++C
Sbjct  7    VGFFIFYLGSFSCHVLSKTDSQDASALNVMYTSLHSPSQLSNWKAGGGDPCGEHWKGITC  66

Query  310  SGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNG  489
            SG+ VTEI++SGL L G +G+QL  LKSV+  D+S NNL +S+PYQLPPN++ L+L+ N 
Sbjct  67   SGSSVTEIKLSGLGLNGQLGYQLTNLKSVSYLDVSNNNLKDSIPYQLPPNLKHLDLSENQ  126

Query  490  FTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSL  669
            F+G +PYSISQM+ L+YLN+  NQL G+++ MF     L TLD S N L G +P++F+SL
Sbjct  127  FSGTVPYSISQMSELKYLNLGSNQLNGQLSDMFQKNEKLETLDLSKNQLTGELPRSFASL  186

Query  670  TNMKNMYLQNNVFTGTIDVLANLPLDNL  753
            +++K +YLQNN FTG+I+VL  LPLD L
Sbjct  187  SSLKKLYLQNNQFTGSINVLGKLPLDEL  214



>ref|NP_974311.1| STRUBBELIG-receptor family 7 protein [Arabidopsis thaliana]
 gb|AEE75504.1| STRUBBELIG-receptor family 7 protein [Arabidopsis thaliana]
Length=680

 Score =   235 bits (600),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 111/179 (62%), Positives = 148/179 (83%), Gaps = 1/179 (1%)
 Frame = +1

Query  217  LFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSV  396
            +FSS+NSP QL++WTA+GGDPCG++WKG++CSG+RVT+I++  L L+GS+GF LD+L SV
Sbjct  1    MFSSMNSPGQLSQWTASGGDPCGQNWKGITCSGSRVTQIKLPSLGLSGSLGFMLDKLTSV  60

Query  397  TTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEV  576
            T FD+S NNLG  LPYQLPPN+++LNLA N FTG   YSIS MAPL+YLN++HNQL+ ++
Sbjct  61   TEFDMSNNNLGGDLPYQLPPNLERLNLANNQFTGSAQYSISMMAPLKYLNLAHNQLK-QL  119

Query  577  TVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTIDVLANLPLDNL  753
             + F  LT+LS LD S N+  G++P T SSLT+ K++YLQNN F+GTID+LA LPL+NL
Sbjct  120  AIDFTKLTSLSILDLSSNAFIGSLPNTCSSLTSAKSIYLQNNQFSGTIDILATLPLENL  178



>ref|XP_007139054.1| hypothetical protein PHAVU_009G260900g [Phaseolus vulgaris]
 gb|ESW11048.1| hypothetical protein PHAVU_009G260900g [Phaseolus vulgaris]
Length=575

 Score =   233 bits (594),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 119/197 (60%), Positives = 149/197 (76%), Gaps = 1/197 (1%)
 Frame = +1

Query  163  PPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQIS  342
            P      TDP DAS +R LF ++NSP QL  W ANG DPCG+SWKG++C+GNRVTEI++S
Sbjct  20   PNGDAVSTDPNDASAVRFLFQNMNSPSQL-GWPANGDDPCGQSWKGITCAGNRVTEIKLS  78

Query  343  GLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQ  522
             L LTGS+ + L  L S+T+ D+S+N+LG S+PYQLPP VQ+LNLA N  TG +PYSIS 
Sbjct  79   NLGLTGSLPYGLQVLTSLTSLDMSSNSLGGSIPYQLPPYVQRLNLAYNNITGTVPYSISN  138

Query  523  MAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNN  702
            +  L  LN+ HNQLQ  + V F++L+ LSTLD SFNSL G++PQT SSL+++  M LQNN
Sbjct  139  LTALTDLNLGHNQLQQGLAVNFLNLSTLSTLDLSFNSLTGDLPQTMSSLSHITTMNLQNN  198

Query  703  VFTGTIDVLANLPLDNL  753
             FTG IDVLANLPLDNL
Sbjct  199  QFTGPIDVLANLPLDNL  215



>ref|XP_008781708.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5-like [Phoenix 
dactylifera]
Length=686

 Score =   235 bits (599),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 113/194 (58%), Positives = 144/194 (74%), Gaps = 0/194 (0%)
 Frame = +1

Query  172  AVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQ  351
            A A+TD  D S +  LF SLN+PPQLT W++ GGDPCG+ WKGV CSG+ VTEI +SGL 
Sbjct  19   AFAETDQGDVSAVNVLFKSLNAPPQLTGWSSTGGDPCGDDWKGVKCSGSSVTEISLSGLG  78

Query  352  LTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAP  531
            LTGS+G+QL  L SVT FD+S NNL   +PYQLPP V+ LNLA N FTGG+PYSISQM  
Sbjct  79   LTGSLGYQLSSLTSVTYFDMSKNNLKGDIPYQLPPKVEHLNLAENAFTGGIPYSISQMTD  138

Query  532  LEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFT  711
            L+YLN+  NQL G++  +F  L  LS +  SFN L+GN+P +  SL ++K ++LQNN F+
Sbjct  139  LKYLNLHRNQLNGQLNDIFGKLDRLSEMYLSFNQLSGNLPPSLGSLKSLKTLHLQNNQFS  198

Query  712  GTIDVLANLPLDNL  753
            G+I  LANLPL++L
Sbjct  199  GSIKGLANLPLEDL  212



>ref|XP_009146380.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7 [Brassica rapa]
Length=723

 Score =   235 bits (599),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 125/226 (55%), Positives = 172/226 (76%), Gaps = 5/226 (2%)
 Frame = +1

Query  76   LSERASLKMRELMGLPWAVALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTK  255
            + ++ S K R + GL   +  ++G     P   + DT+ +DA+ L  LFSSLNSP QL++
Sbjct  1    MKKKMSEKNRHV-GLALFILCIVGL---KPSFILGDTNASDAAALNNLFSSLNSPGQLSQ  56

Query  256  WTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNS  435
            WTA+GGDPCG++WKG++CS +RVT+I++SGL L+GS+GF LD+L SVT FD+S NNLG  
Sbjct  57   WTASGGDPCGQNWKGITCSNSRVTQIKLSGLGLSGSLGFMLDKLTSVTEFDLSNNNLGGD  116

Query  436  LPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTL  615
            LPYQLPPN+++LNLA N FTG   YSIS M PL+YLN++HNQL+ ++ + F  LT+LS L
Sbjct  117  LPYQLPPNLERLNLANNQFTGSAQYSISLMTPLKYLNLAHNQLK-QLAIDFTKLTSLSIL  175

Query  616  DFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTIDVLANLPLDNL  753
            D S N++ G++P T +SLT+ K++YLQNN FTGTIDVLA LPL+N+
Sbjct  176  DLSSNTITGSLPNTMTSLTSAKSIYLQNNQFTGTIDVLATLPLENM  221



>ref|XP_009383597.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like [Musa acuminata 
subsp. malaccensis]
Length=720

 Score =   234 bits (597),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 119/225 (53%), Positives = 161/225 (72%), Gaps = 7/225 (3%)
 Frame = +1

Query  88   ASLKMRELMGLPWAVALLIGFLLNAPPSAVAD-TDPTDASVLRGLFSSLNSPPQLTKWTA  264
            A  + RE +    A+ +L   +L   P  V   TD  D S L  LF+SLNSP QLT W A
Sbjct  2    AKARGRETL----AIGVLFACILVGNPGGVGGATDQNDVSTLNVLFTSLNSPSQLTGWIA  57

Query  265  NGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGN--SL  438
            NGGDPCG+SW GV+C+G+ +T I++SGL L+G++G+ L  + S+   D+S NN+G+   L
Sbjct  58   NGGDPCGQSWLGVTCTGSAITTIKLSGLGLSGTLGYNLQTMTSLAELDMSNNNIGSGGQL  117

Query  439  PYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLD  618
            PY LPPN+Q LNL GN F+G +PYSIS M  L+YLN++HNQLQG +T MF  LTNL+T+D
Sbjct  118  PYNLPPNLQSLNLGGNQFSGNIPYSISLMVTLKYLNLAHNQLQGNLTEMFGGLTNLTTMD  177

Query  619  FSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTIDVLANLPLDNL  753
             SFN L G++PQ+FS+L+++  +YL+NN FTG ID+LANLPL +L
Sbjct  178  LSFNQLTGDLPQSFSNLSSLTTLYLENNQFTGHIDILANLPLQDL  222



>gb|AFQ91933.1| leucine-rich repeat receptor-like kinase [Brassica rapa subsp. 
oleifera]
Length=707

 Score =   233 bits (595),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 123/209 (59%), Positives = 166/209 (79%), Gaps = 2/209 (1%)
 Frame = +1

Query  130  VALLIGFLLNAPPSAV-ADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVS  306
            +AL I  ++   PS +  DT+ +DA+ L  LFSSLNSP QL++WTA+GGDPCG++WKG++
Sbjct  10   LALFILCIVGLKPSFILGDTNASDAAALNNLFSSLNSPGQLSQWTASGGDPCGQNWKGIT  69

Query  307  CSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGN  486
            CS +RVT+I++SGL L+GS+GF LD+L SVT FD+S NNLG  LPYQLPPN+++LNLA N
Sbjct  70   CSNSRVTQIKLSGLGLSGSLGFMLDKLTSVTEFDLSNNNLGGDLPYQLPPNLERLNLANN  129

Query  487  GFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSS  666
             FTG   YSIS M PL+YLN++HNQL+ ++ + F  LT+LS LD S N++ G++P T +S
Sbjct  130  QFTGSAQYSISLMTPLKYLNLAHNQLK-QLAIDFTKLTSLSILDLSSNTITGSLPNTMTS  188

Query  667  LTNMKNMYLQNNVFTGTIDVLANLPLDNL  753
            LT+ K++YLQNN FTGTIDVLA LPL+N+
Sbjct  189  LTSAKSIYLQNNQFTGTIDVLATLPLENM  217



>ref|XP_006465790.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like [Citrus 
sinensis]
Length=723

 Score =   234 bits (596),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 117/192 (61%), Positives = 156/192 (81%), Gaps = 0/192 (0%)
 Frame = +1

Query  178  ADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLT  357
            A TDP+DAS L+ ++SSLNSP QL++W+A G DPCG+SWKGV CSG RVTE+++SGL L+
Sbjct  30   AATDPSDASALKIMYSSLNSPSQLSQWSATGDDPCGQSWKGVICSGQRVTELKLSGLGLS  89

Query  358  GSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLE  537
            GSMG+QL  L ++T  D+S NN G  +PY +P N+++L+L  N FTG +PY  SQM  L+
Sbjct  90   GSMGYQLSSLTALTNLDLSNNNFGPDIPYNVPQNLERLDLGNNKFTGNVPYYFSQMKTLK  149

Query  538  YLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGT  717
            YLN++HNQLQG++  MF  L +LSTLD SFN+L+GN+PQ+FSSL+++ ++YLQNN F+GT
Sbjct  150  YLNIAHNQLQGQLNDMFGQLPSLSTLDLSFNTLSGNLPQSFSSLSSLSSLYLQNNQFSGT  209

Query  718  IDVLANLPLDNL  753
            IDVLANLPLDNL
Sbjct  210  IDVLANLPLDNL  221



>ref|XP_007139053.1| hypothetical protein PHAVU_009G260900g [Phaseolus vulgaris]
 gb|ESW11047.1| hypothetical protein PHAVU_009G260900g [Phaseolus vulgaris]
Length=720

 Score =   233 bits (595),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 119/197 (60%), Positives = 149/197 (76%), Gaps = 1/197 (1%)
 Frame = +1

Query  163  PPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQIS  342
            P      TDP DAS +R LF ++NSP QL  W ANG DPCG+SWKG++C+GNRVTEI++S
Sbjct  20   PNGDAVSTDPNDASAVRFLFQNMNSPSQL-GWPANGDDPCGQSWKGITCAGNRVTEIKLS  78

Query  343  GLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQ  522
             L LTGS+ + L  L S+T+ D+S+N+LG S+PYQLPP VQ+LNLA N  TG +PYSIS 
Sbjct  79   NLGLTGSLPYGLQVLTSLTSLDMSSNSLGGSIPYQLPPYVQRLNLAYNNITGTVPYSISN  138

Query  523  MAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNN  702
            +  L  LN+ HNQLQ  + V F++L+ LSTLD SFNSL G++PQT SSL+++  M LQNN
Sbjct  139  LTALTDLNLGHNQLQQGLAVNFLNLSTLSTLDLSFNSLTGDLPQTMSSLSHITTMNLQNN  198

Query  703  VFTGTIDVLANLPLDNL  753
             FTG IDVLANLPLDNL
Sbjct  199  QFTGPIDVLANLPLDNL  215



>ref|XP_011031832.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like [Populus 
euphratica]
Length=716

 Score =   233 bits (593),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 125/218 (57%), Positives = 165/218 (76%), Gaps = 3/218 (1%)
 Frame = +1

Query  100  MRELMGLPWAVALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDP  279
            M    G+   V+LLI  +      A   TDP DAS LR ++SSLNSP QLT+W+ NG DP
Sbjct  2    MENWRGVEVLVSLLIVCIFGCVNGA---TDPNDASALRIMYSSLNSPGQLTQWSPNGDDP  58

Query  280  CGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPN  459
            CG++WKG+ CSG RVTEI++  L L+GS+G+QL  L +VT  D+S NNL  ++P QLPPN
Sbjct  59   CGQNWKGIICSGLRVTEIKLPSLGLSGSLGYQLTSLTAVTNLDMSYNNLAGNIPDQLPPN  118

Query  460  VQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLA  639
            +Q+LNLA N F+GG+PYSISQ+  L+YLN+ HNQLQ ++  +F  L +LSTLD SFNSL 
Sbjct  119  LQQLNLANNQFSGGIPYSISQLPSLKYLNLGHNQLQNQLGDVFRQLPSLSTLDLSFNSLT  178

Query  640  GNIPQTFSSLTNMKNMYLQNNVFTGTIDVLANLPLDNL  753
            G++PQ+FSSL++M +MYLQNN FTG+I+VLA+LPL+NL
Sbjct  179  GDLPQSFSSLSSMTSMYLQNNQFTGSINVLASLPLENL  216



>ref|XP_006488603.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5-like [Citrus 
sinensis]
Length=696

 Score =   232 bits (591),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 111/210 (53%), Positives = 154/210 (73%), Gaps = 4/210 (2%)
 Frame = +1

Query  136  LLIGFLL----NAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGV  303
            LL+GF +    +     ++ TD  DAS L  +++SL+SP QL+ W A GGDPCGE WKG+
Sbjct  5    LLVGFFIFYLGSFSCHVLSKTDSQDASALNVMYTSLHSPSQLSNWKAGGGDPCGEHWKGI  64

Query  304  SCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAG  483
            +CSG+ VTEI++SGL L G +G+QL  LKSV+  D+S NNL +S+PYQLPPN++ L+L+ 
Sbjct  65   TCSGSSVTEIKLSGLGLNGQLGYQLTNLKSVSYLDVSNNNLKDSIPYQLPPNLKHLDLSE  124

Query  484  NGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFS  663
            N F+G +PYSISQM+ L+YLN+  NQL G+++ MF     L TLD S N L G +P++F+
Sbjct  125  NQFSGTVPYSISQMSELKYLNLGSNQLNGQLSDMFQKNEKLETLDLSKNQLTGELPRSFA  184

Query  664  SLTNMKNMYLQNNVFTGTIDVLANLPLDNL  753
            SL+++K +YLQNN FTG+I+VL  LPLD L
Sbjct  185  SLSSLKELYLQNNQFTGSINVLGKLPLDEL  214



>ref|XP_002461023.1| hypothetical protein SORBIDRAFT_02g039370 [Sorghum bicolor]
 gb|EER97544.1| hypothetical protein SORBIDRAFT_02g039370 [Sorghum bicolor]
Length=718

 Score =   232 bits (592),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 115/210 (55%), Positives = 154/210 (73%), Gaps = 2/210 (1%)
 Frame = +1

Query  127  AVALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVS  306
            A+ ++  FL  A   A A+TD  D + L   ++++NSPPQLT W +  GDPCG+SW GV+
Sbjct  5    AIGVVALFLAAASFGANANTDSNDVNALNVFYTTMNSPPQLTNWVSQNGDPCGQSWLGVT  64

Query  307  CSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNS-LPYQLPPNVQKLNLAG  483
            CSG+RVT I +SG++L G++G+ ++QL ++   D S NNLG S +PY LPPN+Q LNL G
Sbjct  65   CSGSRVTAINLSGMRLNGTLGYNMNQLTALVQLDASNNNLGGSDIPYNLPPNLQSLNLEG  124

Query  484  NGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFS  663
            N FTG +PYSISQM  L  LN+ HNQL   +  MF  LTNL+TLD S+N+ +GNIPQ+F+
Sbjct  125  NNFTGTVPYSISQMVALRNLNLGHNQL-SNINDMFSQLTNLTTLDLSYNTFSGNIPQSFN  183

Query  664  SLTNMKNMYLQNNVFTGTIDVLANLPLDNL  753
            SLT++K +YLQNN F+GTIDVL NLPL +L
Sbjct  184  SLTSLKTLYLQNNKFSGTIDVLTNLPLTDL  213



>ref|XP_010534991.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7 isoform X1 [Tarenaya 
hassleriana]
Length=718

 Score =   232 bits (591),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 114/210 (54%), Positives = 158/210 (75%), Gaps = 1/210 (0%)
 Frame = +1

Query  127  AVALLIGFLLNAPPSAV-ADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGV  303
             VALLI  ++   P  +   TD +D S L  + SS+NSP QL++W   GGDPCGE+W+G+
Sbjct  8    VVALLILCIVGLEPRFIHGATDSSDTSALNTMHSSMNSPSQLSQWKPWGGDPCGENWQGI  67

Query  304  SCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAG  483
            +C  +RVT++++  L L+GS+G+ LD+L +VT FD+S NNLG  LPY LPPNVQ+LNLA 
Sbjct  68   TCLDSRVTQVKLPNLGLSGSLGYMLDKLTAVTEFDLSNNNLGGDLPYNLPPNVQQLNLAN  127

Query  484  NGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFS  663
            N FTG   YSIS MA L+YL+++HNQ +G++ V F  LT+L+ LD S NS +G++P +F+
Sbjct  128  NQFTGNGQYSISLMASLKYLSLAHNQFKGQLAVDFTKLTSLTFLDLSSNSFSGSLPSSFT  187

Query  664  SLTNMKNMYLQNNVFTGTIDVLANLPLDNL  753
            SL+++K+MYLQNN FTGTID+LA LPL+NL
Sbjct  188  SLSSIKSMYLQNNQFTGTIDLLAGLPLENL  217



>gb|KHG25534.1| protein strubbelig-receptor family 6 [Gossypium arboreum]
Length=724

 Score =   231 bits (590),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 122/194 (63%), Positives = 151/194 (78%), Gaps = 0/194 (0%)
 Frame = +1

Query  172  AVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQ  351
            A A TD  DAS L  +FSSLNSP QLT WTAN GDPCG+SWKGV+CS  RVTEI++S L 
Sbjct  22   ANAATDQGDASALGVMFSSLNSPQQLTGWTANNGDPCGQSWKGVTCSDQRVTEIKLSNLA  81

Query  352  LTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAP  531
            L+GSMG+ L  L S+   D+S NNL   +PY +P N+Q+LNLA N FTG +PYSI+QM  
Sbjct  82   LSGSMGYSLQSLTSLKELDLSNNNLAGDIPYDIPQNLQRLNLAFNQFTGSVPYSINQMHS  141

Query  532  LEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFT  711
            L+YLN++HNQLQ +++ MF  L++LSTLD SFNSL G++P++F +LT+M  MYLQNN FT
Sbjct  142  LQYLNLAHNQLQNQLSDMFGPLSSLSTLDLSFNSLTGDLPESFKNLTSMNTMYLQNNQFT  201

Query  712  GTIDVLANLPLDNL  753
            GTIDVLANLPLD L
Sbjct  202  GTIDVLANLPLDIL  215



>gb|KHG12209.1| Protein STRUBBELIG-RECEPTOR FAMILY 6 [Gossypium arboreum]
Length=728

 Score =   231 bits (590),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 127/220 (58%), Positives = 159/220 (72%), Gaps = 3/220 (1%)
 Frame = +1

Query  94   LKMRELMGLPWAVALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGG  273
            +K R+ + L      ++GF    P  +   TD  DAS L  +FSSLNSP QLT WTAN G
Sbjct  2    MKWRKGLVLALFTVCILGF---KPRCSDGATDQGDASALGVMFSSLNSPQQLTGWTANNG  58

Query  274  DPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP  453
            DPCG+ WKGV+CSG RVTEI++S L L+GSMG+ L  L S+   D+S NNL   +PY +P
Sbjct  59   DPCGQPWKGVTCSGQRVTEIKLSNLGLSGSMGYSLQSLTSLKELDLSHNNLAGGIPYNIP  118

Query  454  PNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNS  633
             N+ + NLA N FTG +PYSI+QM  L+YLN+SHNQLQ ++  MF  L++LSTLD SFNS
Sbjct  119  LNLTRFNLAYNQFTGSVPYSINQMHSLQYLNLSHNQLQYQLNDMFGPLSSLSTLDLSFNS  178

Query  634  LAGNIPQTFSSLTNMKNMYLQNNVFTGTIDVLANLPLDNL  753
            L   +PQ+F +LT+MK+MYLQNN FTGTIDVLANLPLDNL
Sbjct  179  LTDALPQSFKNLTSMKSMYLQNNQFTGTIDVLANLPLDNL  218



>ref|XP_003627481.1| Protein STRUBBELIG-RECEPTOR FAMILY [Medicago truncatula]
 gb|AET01957.1| strubbelig-receptor family 6 protein [Medicago truncatula]
Length=716

 Score =   231 bits (589),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 119/213 (56%), Positives = 152/213 (71%), Gaps = 6/213 (3%)
 Frame = +1

Query  121  PWAVALLIGFLLNAPPSAV--ADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESW  294
            PW + +L+ F++++  + V   DTDP D S L  LF S+NSP QL  W  NG DPCG+SW
Sbjct  5    PWLMLMLM-FIISSSCTFVINGDTDPNDVSALMALFQSMNSPSQLN-W--NGNDPCGQSW  60

Query  295  KGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLN  474
             G++CSGNR+TEI++ G QLTG++GFQL  L SVT  D+S NNL  +LPYQ PPN+Q LN
Sbjct  61   TGITCSGNRITEIKLPGRQLTGTLGFQLQSLSSVTNLDLSNNNLAGTLPYQFPPNLQHLN  120

Query  475  LAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQ  654
            LA N F GG+PYS S    L  LN  HNQ Q  + + F  LT+L+T D SFNSL G++PQ
Sbjct  121  LANNNFNGGIPYSFSDTPSLISLNFGHNQFQQALNLNFQKLTSLTTFDVSFNSLTGDLPQ  180

Query  655  TFSSLTNMKNMYLQNNVFTGTIDVLANLPLDNL  753
            T +SL+++  M LQNN FTGTID+LA+LPLDNL
Sbjct  181  TMNSLSSISTMNLQNNQFTGTIDILADLPLDNL  213



>ref|XP_008465036.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7 isoform X3 [Cucumis 
melo]
 ref|XP_008465037.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7 isoform X3 [Cucumis 
melo]
Length=686

 Score =   230 bits (587),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 111/179 (62%), Positives = 144/179 (80%), Gaps = 0/179 (0%)
 Frame = +1

Query  217  LFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSV  396
            ++SSLNSPP LT+W+++GGDPCG+ WKG++C G RVTEI +SGL L+G+MG+QL  L S+
Sbjct  1    MYSSLNSPPILTQWSSSGGDPCGQIWKGITCLGLRVTEISLSGLGLSGTMGYQLSSLTSL  60

Query  397  TTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEV  576
            T  D+S NNLG  +PYQLP N+QKLNL  N F+G +PYSISQM+ L  LN+SHNQLQ +V
Sbjct  61   TNLDVSNNNLGPDIPYQLPQNLQKLNLGWNNFSGSIPYSISQMSLLISLNMSHNQLQNQV  120

Query  577  TVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTIDVLANLPLDNL  753
              MF  L++L+ LD SFN L+G +PQ+FS+LT++  M+LQNN F+GTIDVLANLPL NL
Sbjct  121  NDMFWKLSSLAMLDISFNFLSGALPQSFSNLTSLNAMFLQNNQFSGTIDVLANLPLQNL  179



>gb|KJB57112.1| hypothetical protein B456_009G148500 [Gossypium raimondii]
 gb|KJB57113.1| hypothetical protein B456_009G148500 [Gossypium raimondii]
Length=728

 Score =   231 bits (588),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 126/220 (57%), Positives = 159/220 (72%), Gaps = 3/220 (1%)
 Frame = +1

Query  94   LKMRELMGLPWAVALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGG  273
            +K R+ + L      ++GF    P  +   TD  DAS L  +FSSLNSP QLT WTAN G
Sbjct  2    MKWRKGLVLALFTVCILGF---KPRCSDGATDQGDASALGVMFSSLNSPQQLTGWTANNG  58

Query  274  DPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLP  453
            DPCG+ WKGV+CSG RVTEI++S L L+GSMG+ L  L S+   D+S NNL   +PY +P
Sbjct  59   DPCGQPWKGVTCSGQRVTEIKLSNLGLSGSMGYSLQSLTSLKELDLSHNNLAGDIPYNIP  118

Query  454  PNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNS  633
             N+ + NLA N FTG +PYSI+QM  L+YLN+SHNQLQ ++  MF  L++LSTLD SFNS
Sbjct  119  LNLTRFNLAYNQFTGSVPYSINQMHSLQYLNLSHNQLQYQLNDMFGPLSSLSTLDLSFNS  178

Query  634  LAGNIPQTFSSLTNMKNMYLQNNVFTGTIDVLANLPLDNL  753
            L   +PQ+F +LT++K+MYLQNN FTGTIDVLANLPLDNL
Sbjct  179  LTDALPQSFKNLTSLKSMYLQNNQFTGTIDVLANLPLDNL  218



>ref|XP_010087069.1| Protein STRUBBELIG-RECEPTOR FAMILY 5 [Morus notabilis]
 gb|EXB26124.1| Protein STRUBBELIG-RECEPTOR FAMILY 5 [Morus notabilis]
Length=697

 Score =   229 bits (585),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 111/208 (53%), Positives = 150/208 (72%), Gaps = 0/208 (0%)
 Frame = +1

Query  130  VALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSC  309
            + L I F        ++ T+  D S L  +++SLNSP QL+ W ++GGDPCG+SW+G+ C
Sbjct  6    LGLWIVFFGVIATRVLSKTNAPDVSALNVMYTSLNSPSQLSGWQSSGGDPCGDSWEGIKC  65

Query  310  SGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNG  489
            SG+ VTEI +S L L+GSMG+QL  L SVT FD+S NN+   +PYQLPPN Q ++L+ NG
Sbjct  66   SGSSVTEINLSNLGLSGSMGYQLSSLTSVTYFDLSKNNIKGEIPYQLPPNAQYIDLSENG  125

Query  490  FTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSL  669
            FT  +PYS SQM  LEYLN++HNQL G+++ MF  LT L  LD S NSL GN+PQ+F  L
Sbjct  126  FTNNVPYSFSQMTDLEYLNLAHNQLNGQLSDMFGKLTKLKELDLSSNSLTGNLPQSFGKL  185

Query  670  TNMKNMYLQNNVFTGTIDVLANLPLDNL  753
            +++  ++LQ+N FTG I+VLANLPLD+L
Sbjct  186  SSLIKLHLQDNKFTGPINVLANLPLDDL  213



>ref|XP_008668240.1| PREDICTED: uncharacterized protein LOC100381414 isoform X2 [Zea 
mays]
Length=671

 Score =   229 bits (584),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 111/206 (54%), Positives = 149/206 (72%), Gaps = 2/206 (1%)
 Frame = +1

Query  142  IGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGE--SWKGVSCSG  315
            +  L +A   AVA TD +D + L  +F+S+N P QL+ W ++GGDPC +   WKG+ CSG
Sbjct  16   LAVLFSAVAPAVAKTDKSDVAALNVMFNSMNKPSQLSGWKSSGGDPCDDDDEWKGIECSG  75

Query  316  NRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFT  495
            + VTEI +SGL+L+GS+G+QL  LKSVT FD+S NNL   LPYQLPPNV +LNL GN  T
Sbjct  76   SSVTEINLSGLELSGSLGYQLSSLKSVTKFDLSNNNLNGDLPYQLPPNVVELNLYGNSLT  135

Query  496  GGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTN  675
            GG+PYSISQM  LE LN+  N L G++T MF  L  LSTLD SFN  +G++P++F  L +
Sbjct  136  GGVPYSISQMGDLETLNLGKNHLSGQLTDMFSELPKLSTLDLSFNRFSGSLPKSFQHLKD  195

Query  676  MKNMYLQNNVFTGTIDVLANLPLDNL  753
            +K + +++N F+G IDVLA LPL++L
Sbjct  196  LKTLNVESNQFSGHIDVLAKLPLEDL  221



>gb|KDP25030.1| hypothetical protein JCGZ_22565 [Jatropha curcas]
Length=705

 Score =   229 bits (585),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 112/194 (58%), Positives = 152/194 (78%), Gaps = 0/194 (0%)
 Frame = +1

Query  172  AVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQ  351
            A + T+  D S L  +F+SLNSP QL+ W ++GGDPCG+SW+G++CSG+ VT I++SGL 
Sbjct  26   AHSKTNSQDVSALNVMFTSLNSPSQLSNWKSSGGDPCGDSWEGITCSGSSVTTIRLSGLG  85

Query  352  LTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAP  531
            L+GSMG+QL  LKSVT FD+S NNL N +PYQLPPN+  L+L+ N F+G +PYSISQM  
Sbjct  86   LSGSMGYQLSNLKSVTYFDMSKNNLKNDIPYQLPPNMAHLDLSNNDFSGSVPYSISQMND  145

Query  532  LEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFT  711
            LEYLN+ HN+L G+ + MF  L  L TLD S+NSL+GN+PQ+F+SL+ +  ++LQNN F+
Sbjct  146  LEYLNLGHNKLNGQASDMFQKLKKLKTLDLSYNSLSGNLPQSFASLSRLSTLHLQNNRFS  205

Query  712  GTIDVLANLPLDNL  753
            G+I+VLA LPLD+L
Sbjct  206  GSINVLAGLPLDDL  219



>ref|XP_002885038.1| hypothetical protein ARALYDRAFT_478852 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61297.1| hypothetical protein ARALYDRAFT_478852 [Arabidopsis lyrata subsp. 
lyrata]
Length=716

 Score =   229 bits (585),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 120/209 (57%), Positives = 165/209 (79%), Gaps = 2/209 (1%)
 Frame = +1

Query  130  VALLIGFLLNAPPSAV-ADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVS  306
            +ALLI  ++   PS +   TD +D S L  +FSS+NSP QL++WT +GGDPCG++WKG++
Sbjct  8    LALLILCIVGFEPSFIHGATDSSDTSALNTMFSSMNSPGQLSQWTTSGGDPCGQNWKGIT  67

Query  307  CSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGN  486
            CSG+RVT+I++SGL L+GS+G+ LD+L SVT FD+S NN+G  LPYQLPPN+++LNLA N
Sbjct  68   CSGSRVTQIKLSGLGLSGSLGYMLDKLTSVTEFDLSNNNIGGDLPYQLPPNLERLNLANN  127

Query  487  GFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSS  666
             FTG   YSIS MAPL+YLN++HNQL+ ++ + F  LT+LS LD S N+  G++P + SS
Sbjct  128  QFTGSAQYSISMMAPLKYLNLAHNQLK-QLAIDFTKLTSLSILDLSSNAFTGSLPNSCSS  186

Query  667  LTNMKNMYLQNNVFTGTIDVLANLPLDNL  753
            LT+ K++YLQNN F+GTID+LA LPL+NL
Sbjct  187  LTSAKSIYLQNNQFSGTIDILATLPLENL  215



>ref|XP_002304260.2| hypothetical protein POPTR_0003s07130g [Populus trichocarpa]
 gb|EEE79239.2| hypothetical protein POPTR_0003s07130g [Populus trichocarpa]
Length=716

 Score =   229 bits (585),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 117/190 (62%), Positives = 154/190 (81%), Gaps = 0/190 (0%)
 Frame = +1

Query  184  TDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGS  363
            TDP DAS LR ++ SL SP QLT+W+ANG DPCG++WKG+ CSG+RVTEI++  L L GS
Sbjct  27   TDPNDASALRVMYISLQSPGQLTQWSANGDDPCGQNWKGIICSGSRVTEIKLPSLGLPGS  86

Query  364  MGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYL  543
            +G+QL  L +VT  D+S NNL  ++P QLPPN+Q+LNLA N F+GG+PYSISQ+  L+YL
Sbjct  87   LGYQLTSLTAVTNLDMSYNNLAGNIPDQLPPNLQQLNLANNQFSGGIPYSISQLPSLKYL  146

Query  544  NVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTID  723
            N+ HNQLQ ++  +F  L +LSTLD SFNSL G++PQ+FSSL++M +MYLQNN FTG+I+
Sbjct  147  NLGHNQLQNQLGDVFGQLPSLSTLDLSFNSLTGDLPQSFSSLSSMTSMYLQNNQFTGSIN  206

Query  724  VLANLPLDNL  753
            VLA+LPL+NL
Sbjct  207  VLASLPLENL  216



>ref|XP_008668239.1| PREDICTED: uncharacterized protein LOC100381414 isoform X1 [Zea 
mays]
Length=685

 Score =   229 bits (583),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 111/206 (54%), Positives = 149/206 (72%), Gaps = 2/206 (1%)
 Frame = +1

Query  142  IGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGE--SWKGVSCSG  315
            +  L +A   AVA TD +D + L  +F+S+N P QL+ W ++GGDPC +   WKG+ CSG
Sbjct  16   LAVLFSAVAPAVAKTDKSDVAALNVMFNSMNKPSQLSGWKSSGGDPCDDDDEWKGIECSG  75

Query  316  NRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFT  495
            + VTEI +SGL+L+GS+G+QL  LKSVT FD+S NNL   LPYQLPPNV +LNL GN  T
Sbjct  76   SSVTEINLSGLELSGSLGYQLSSLKSVTKFDLSNNNLNGDLPYQLPPNVVELNLYGNSLT  135

Query  496  GGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTN  675
            GG+PYSISQM  LE LN+  N L G++T MF  L  LSTLD SFN  +G++P++F  L +
Sbjct  136  GGVPYSISQMGDLETLNLGKNHLSGQLTDMFSELPKLSTLDLSFNRFSGSLPKSFQHLKD  195

Query  676  MKNMYLQNNVFTGTIDVLANLPLDNL  753
            +K + +++N F+G IDVLA LPL++L
Sbjct  196  LKTLNVESNQFSGHIDVLAKLPLEDL  221



>gb|KJB67062.1| hypothetical protein B456_010G172500 [Gossypium raimondii]
Length=622

 Score =   226 bits (577),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 119/194 (61%), Positives = 150/194 (77%), Gaps = 0/194 (0%)
 Frame = +1

Query  172  AVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQ  351
            A A TD  DAS L  +FS LNSP QLT WTAN GDPCG+SWKGV+CS  RVTEI++S L 
Sbjct  22   ANAATDQGDASALGVMFSGLNSPQQLTGWTANNGDPCGQSWKGVTCSDRRVTEIKLSNLA  81

Query  352  LTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAP  531
            L+GS+G+ L  L S+   D+S NNL   +PY +P N+Q+LNLA N FTG +PYSI+QM  
Sbjct  82   LSGSVGYSLQSLTSLKELDLSNNNLAGDIPYDIPQNLQRLNLAFNQFTGSVPYSINQMHS  141

Query  532  LEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFT  711
            L+YLN++HNQLQ +++ MF  L++LSTLD SFNSL G++P++F +LT+M +MYLQNN  T
Sbjct  142  LQYLNLAHNQLQNQLSDMFGPLSSLSTLDLSFNSLTGDLPESFKNLTSMNSMYLQNNQLT  201

Query  712  GTIDVLANLPLDNL  753
            GTIDVLANLPLD L
Sbjct  202  GTIDVLANLPLDTL  215



>ref|XP_008228094.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7 [Prunus mume]
Length=717

 Score =   228 bits (582),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 125/211 (59%), Positives = 159/211 (75%), Gaps = 1/211 (0%)
 Frame = +1

Query  124  WAVALLIGFLLNAPPSAV-ADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKG  300
            W + +    +L   PS++ A TDP D S L+ L+SSLNSP QLT+W+ANG DPCG+SWKG
Sbjct  7    WVLLVFSICILGWSPSSINAATDPADVSALKALYSSLNSPSQLTQWSANGDDPCGQSWKG  66

Query  301  VSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLA  480
            V CSG+RVTEI +S LQL+GS+   L  L S+T  D+S NNL  S+PY LPPN+ +LNLA
Sbjct  67   VKCSGSRVTEIDVSNLQLSGSLWSSLQSLTSLTNLDMSHNNLAGSIPYSLPPNMTRLNLA  126

Query  481  GNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTF  660
             N F  G+PYSISQ+  LEYLN+SHNQLQ +V  +F  L++LSTLD SFNSL+GN+P++ 
Sbjct  127  ANNFNQGIPYSISQITSLEYLNISHNQLQNQVDDIFGKLSSLSTLDLSFNSLSGNLPESL  186

Query  661  SSLTNMKNMYLQNNVFTGTIDVLANLPLDNL  753
            SSL++M  M LQNN  TG I+VLANLPL+NL
Sbjct  187  SSLSSMTRMNLQNNQLTGNINVLANLPLENL  217



>gb|KJB67061.1| hypothetical protein B456_010G172500 [Gossypium raimondii]
Length=636

 Score =   227 bits (578),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 119/194 (61%), Positives = 150/194 (77%), Gaps = 0/194 (0%)
 Frame = +1

Query  172  AVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQ  351
            A A TD  DAS L  +FS LNSP QLT WTAN GDPCG+SWKGV+CS  RVTEI++S L 
Sbjct  22   ANAATDQGDASALGVMFSGLNSPQQLTGWTANNGDPCGQSWKGVTCSDRRVTEIKLSNLA  81

Query  352  LTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAP  531
            L+GS+G+ L  L S+   D+S NNL   +PY +P N+Q+LNLA N FTG +PYSI+QM  
Sbjct  82   LSGSVGYSLQSLTSLKELDLSNNNLAGDIPYDIPQNLQRLNLAFNQFTGSVPYSINQMHS  141

Query  532  LEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFT  711
            L+YLN++HNQLQ +++ MF  L++LSTLD SFNSL G++P++F +LT+M +MYLQNN  T
Sbjct  142  LQYLNLAHNQLQNQLSDMFGPLSSLSTLDLSFNSLTGDLPESFKNLTSMNSMYLQNNQLT  201

Query  712  GTIDVLANLPLDNL  753
            GTIDVLANLPLD L
Sbjct  202  GTIDVLANLPLDTL  215



>ref|XP_004958321.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7-like isoform 
X1 [Setaria italica]
 ref|XP_004958322.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7-like isoform 
X2 [Setaria italica]
Length=714

 Score =   228 bits (580),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 109/210 (52%), Positives = 157/210 (75%), Gaps = 2/210 (1%)
 Frame = +1

Query  127  AVALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVS  306
            A+ +++ FL  AP  A A+TD  D + L   ++++NSPPQLT W +  GDPCG+SW GV+
Sbjct  5    AIGVVVLFLAAAPFGANANTDSNDVNALNVFYTTMNSPPQLTNWVSQNGDPCGQSWLGVT  64

Query  307  CSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNS-LPYQLPPNVQKLNLAG  483
            CSG+RVT I++ G++L G++G+ ++Q+ ++   D+S NNLG S +PY LPPN++ LNLA 
Sbjct  65   CSGSRVTTIKLPGMRLNGTLGYNMNQMTALIQLDMSNNNLGGSDIPYNLPPNMEILNLAS  124

Query  484  NGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFS  663
            N FTG +PYSISQM  L+ LN+ HNQL   +  MF  LTNL+ +D S+N+ +GNIPQ+F+
Sbjct  125  NNFTGTVPYSISQMVALKNLNLGHNQL-SNINDMFNQLTNLTAMDLSYNNFSGNIPQSFN  183

Query  664  SLTNMKNMYLQNNVFTGTIDVLANLPLDNL  753
            SL ++K +YLQNN F+GT+DVLA+LPL +L
Sbjct  184  SLKSLKALYLQNNKFSGTVDVLADLPLTDL  213



>ref|XP_009116969.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7-like [Brassica 
rapa]
Length=723

 Score =   228 bits (580),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 122/210 (58%), Positives = 167/210 (80%), Gaps = 3/210 (1%)
 Frame = +1

Query  130  VALLIGFLLNAPPSAV-ADTDPTDASVLRGLFSSLNSPPQLTKWTAN-GGDPCGESWKGV  303
            +AL I  ++   PS + A TD +D S L  +FS++NSP QL++WT++ GGDPCG++WKGV
Sbjct  9    LALFILCIVGLKPSFILAATDASDTSALNYMFSAMNSPGQLSQWTSSSGGDPCGQNWKGV  68

Query  304  SCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAG  483
            +CS +RVT+I++SGL L+GS+G  LD+L SVT FD+S NNLG  LPYQLPPN+++LNLA 
Sbjct  69   TCSDSRVTQIKLSGLGLSGSLGSALDKLTSVTEFDLSNNNLGGDLPYQLPPNLERLNLAS  128

Query  484  NGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFS  663
            N FTG  PYS+SQM PL+YLN++HNQL+ ++++ F  LT+LS LD S N+L G++P + S
Sbjct  129  NQFTGSAPYSVSQMTPLKYLNLAHNQLK-QLSIDFTKLTSLSILDLSSNTLTGSLPNSMS  187

Query  664  SLTNMKNMYLQNNVFTGTIDVLANLPLDNL  753
            SLT+ K++YLQNN F+GTIDVLA LPL+NL
Sbjct  188  SLTSAKSIYLQNNQFSGTIDVLATLPLENL  217



>gb|KGN45432.1| hypothetical protein Csa_7G447940 [Cucumis sativus]
Length=263

 Score =   216 bits (550),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 120/219 (55%), Positives = 160/219 (73%), Gaps = 5/219 (2%)
 Frame = +1

Query  97   KMRELMGLPWAVALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGD  276
            + REL+       +++  L + P      T+PTDAS LR L+ SL+SP +LT+W ANGGD
Sbjct  4    RWRELISF-----IILCILWSKPICIQGTTNPTDASALRVLYISLDSPSRLTQWNANGGD  58

Query  277  PCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP  456
            PCG+SWKG++CS +RVTEI +SGL L+GS+G+QL  + SVT  D+S NN G  + Y LPP
Sbjct  59   PCGQSWKGITCSDSRVTEINLSGLGLSGSLGYQLGSMTSVTNLDVSNNNFGGEIVYNLPP  118

Query  457  NVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSL  636
            N+++LNL  N F   +PYSIS    L+YLN+SHNQLQ  +  ++  LT+LS LD SFN++
Sbjct  119  NLKRLNLGRNNFNKAIPYSISLTTSLQYLNISHNQLQDPLMDVYGQLTSLSILDLSFNAM  178

Query  637  AGNIPQTFSSLTNMKNMYLQNNVFTGTIDVLANLPLDNL  753
            +GN+PQ+FSSL+ + +MYLQNN FTGTIDVLA LPLDNL
Sbjct  179  SGNLPQSFSSLSGISSMYLQNNRFTGTIDVLATLPLDNL  217



>ref|XP_004159013.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7-like [Cucumis 
sativus]
Length=263

 Score =   216 bits (550),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 120/219 (55%), Positives = 160/219 (73%), Gaps = 5/219 (2%)
 Frame = +1

Query  97   KMRELMGLPWAVALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGD  276
            + REL+       +++  L + P      T+PTDAS LR L+ SL+SP +LT+W ANGGD
Sbjct  4    RWRELISF-----IILCILWSKPICIQGTTNPTDASALRVLYISLDSPSRLTQWNANGGD  58

Query  277  PCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP  456
            PCG+SWKG++CS +RVTEI +SGL L+GS+G+QL  + SVT  D+S NN G  + Y LPP
Sbjct  59   PCGQSWKGITCSDSRVTEINLSGLGLSGSLGYQLGSMTSVTNLDVSNNNFGGEIVYNLPP  118

Query  457  NVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSL  636
            N+++LNL  N F   +PYSIS    L+YLN+SHNQLQ  +  ++  LT+LS LD SFN++
Sbjct  119  NLKRLNLGRNNFNKAIPYSISLTTSLQYLNISHNQLQDPLMDVYGQLTSLSILDLSFNAM  178

Query  637  AGNIPQTFSSLTNMKNMYLQNNVFTGTIDVLANLPLDNL  753
            +GN+PQ+FSSL+ + +MYLQNN FTGTIDVLA LPLDNL
Sbjct  179  SGNLPQSFSSLSGISSMYLQNNRFTGTIDVLATLPLDNL  217



>emb|CDX98445.1| BnaC05g39300D [Brassica napus]
Length=722

 Score =   227 bits (578),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 121/209 (58%), Positives = 163/209 (78%), Gaps = 2/209 (1%)
 Frame = +1

Query  130  VALLIGFLLNAPPSAV-ADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVS  306
            +AL I  ++   PS +  DT+ +DA  L  LFSS+NSP QL++WTA+GGDPCG++WKG++
Sbjct  13   LALFILCIVGLKPSFILGDTNASDAVALNNLFSSMNSPGQLSQWTASGGDPCGQNWKGIT  72

Query  307  CSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGN  486
            CS +RV +I++SGL L+GS+GF LD+L SVT  D+S NNLG  LPYQLPPN+++LNLA N
Sbjct  73   CSVSRVIQIKLSGLGLSGSLGFMLDKLTSVTELDLSNNNLGGDLPYQLPPNLERLNLANN  132

Query  487  GFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSS  666
             FTG   YSIS M PL+YLN++HNQL+ ++ + F  LT+LS LD S N++ G++P T +S
Sbjct  133  QFTGSAQYSISLMTPLKYLNLAHNQLK-QLAIDFTKLTSLSILDLSSNTITGSLPNTMTS  191

Query  667  LTNMKNMYLQNNVFTGTIDVLANLPLDNL  753
            LT+ K++YLQNN FTGTIDVLA LPL+NL
Sbjct  192  LTSAKSIYLQNNQFTGTIDVLATLPLENL  220



>ref|XP_002468389.1| hypothetical protein SORBIDRAFT_01g045010 [Sorghum bicolor]
 gb|EER95387.1| hypothetical protein SORBIDRAFT_01g045010 [Sorghum bicolor]
Length=730

 Score =   227 bits (578),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 115/197 (58%), Positives = 152/197 (77%), Gaps = 3/197 (2%)
 Frame = +1

Query  172  AVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQ  351
            A ADTDP D +VL  LF+SLNSP QLT W ANGGDPCG+SWKG++CSG+ VT+I +  L 
Sbjct  39   AAADTDPNDLNVLNTLFTSLNSPGQLTGWQANGGDPCGQSWKGITCSGSGVTKIILPNLS  98

Query  352  LTGSMGFQLDQLKSVTTFDISTNNLGN--SLPYQLP-PNVQKLNLAGNGFTGGLPYSISQ  522
            LTG++ + ++ L S+   D+S NNLG+   +PY LP   ++KLNLAGN F G LPYSIS 
Sbjct  99   LTGTLAYNMNNLGSLVELDMSQNNLGSGAQIPYNLPNMKLEKLNLAGNQFGGNLPYSIST  158

Query  523  MAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNN  702
            M  L+YLN++HNQLQG ++ +F SL +LS LD SFNSL+G++PQ+F+ L+++K +YLQNN
Sbjct  159  MPNLKYLNLNHNQLQGNISDVFSSLYSLSELDLSFNSLSGDLPQSFTGLSSLKKIYLQNN  218

Query  703  VFTGTIDVLANLPLDNL  753
             FTG I+VLANLPL+ L
Sbjct  219  QFTGYINVLANLPLETL  235



>ref|XP_008462231.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7-like isoform 
X1 [Cucumis melo]
Length=716

 Score =   226 bits (577),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 123/219 (56%), Positives = 165/219 (75%), Gaps = 5/219 (2%)
 Frame = +1

Query  97   KMRELMGLPWAVALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGD  276
            + RE++ L     +++  L + P      TDPTDAS L+ L++SLNSP QLT+W ANG D
Sbjct  4    RWREVISL-----IILCILWSKPICIQGTTDPTDASALKVLYTSLNSPSQLTQWNANGDD  58

Query  277  PCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP  456
            PCG+SW+G++CSG+RVTEI +SGL L+GS+G+QL  + SVT  D+S NNLG  + Y LPP
Sbjct  59   PCGQSWRGITCSGSRVTEINLSGLGLSGSLGYQLGSMTSVTNLDVSNNNLGGEIGYNLPP  118

Query  457  NVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSL  636
             +++LNL  N F  G+PYS+S M  L+YLN+SHNQLQ  +  ++  LT+LS LD SFNS+
Sbjct  119  KLKRLNLGRNNFNKGIPYSVSLMTSLQYLNISHNQLQDPLNDVYGQLTSLSILDLSFNSM  178

Query  637  AGNIPQTFSSLTNMKNMYLQNNVFTGTIDVLANLPLDNL  753
            +GN+PQ+FSSL+ + +MYLQNN FTGTIDVLA+LPLDNL
Sbjct  179  SGNLPQSFSSLSGISSMYLQNNQFTGTIDVLASLPLDNL  217



>gb|KGN45433.1| hypothetical protein Csa_7G447950 [Cucumis sativus]
Length=715

 Score =   226 bits (577),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 120/191 (63%), Positives = 153/191 (80%), Gaps = 0/191 (0%)
 Frame = +1

Query  181  DTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTG  360
            +TDPTDAS LR L++SLNSP QLT+W ANG DPCG+SWKG++CSG+RVTEI +SGL L+G
Sbjct  27   NTDPTDASALRVLYTSLNSPSQLTQWNANGDDPCGQSWKGITCSGSRVTEINLSGLGLSG  86

Query  361  SMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  540
            S+G+QL  + SVT  D+S NN G  + Y LPPN+++LNL  N F  G+PYSIS M  L+Y
Sbjct  87   SLGYQLGSMTSVTNLDVSNNNFGGEIVYNLPPNLKRLNLGRNNFNKGIPYSISMMTSLQY  146

Query  541  LNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTI  720
            LN+SHNQLQ  +  ++  LT+LS LD SFN+++GN+PQ+FSSL+ + +MYLQNN FTGTI
Sbjct  147  LNISHNQLQDPLMDVYGQLTSLSILDLSFNAMSGNLPQSFSSLSGISSMYLQNNRFTGTI  206

Query  721  DVLANLPLDNL  753
            DVLA LPLDNL
Sbjct  207  DVLATLPLDNL  217



>ref|XP_004159012.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7-like [Cucumis 
sativus]
Length=715

 Score =   226 bits (577),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 120/191 (63%), Positives = 153/191 (80%), Gaps = 0/191 (0%)
 Frame = +1

Query  181  DTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTG  360
            +TDPTDAS LR L++SLNSP QLT+W ANG DPCG+SWKG++CSG+RVTEI +SGL L+G
Sbjct  27   NTDPTDASALRVLYTSLNSPSQLTQWNANGDDPCGQSWKGITCSGSRVTEINLSGLGLSG  86

Query  361  SMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  540
            S+G+QL  + SVT  D+S NN G  + Y LPPN+++LNL  N F  G+PYSIS M  L+Y
Sbjct  87   SLGYQLGSMTSVTNLDVSNNNFGGEIVYNLPPNLKRLNLGRNNFNKGIPYSISMMTSLQY  146

Query  541  LNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTI  720
            LN+SHNQLQ  +  ++  LT+LS LD SFN+++GN+PQ+FSSL+ + +MYLQNN FTGTI
Sbjct  147  LNISHNQLQDPLNDVYGQLTSLSILDLSFNAMSGNLPQSFSSLSGISSMYLQNNQFTGTI  206

Query  721  DVLANLPLDNL  753
            DVLA LPLDNL
Sbjct  207  DVLATLPLDNL  217



>emb|CDY39110.1| BnaA01g29460D [Brassica napus]
Length=724

 Score =   226 bits (577),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 121/210 (58%), Positives = 167/210 (80%), Gaps = 3/210 (1%)
 Frame = +1

Query  130  VALLIGFLLNAPPSAV-ADTDPTDASVLRGLFSSLNSPPQLTKWTAN-GGDPCGESWKGV  303
            +AL +  ++   PS + A TD +D S L  +FS++NSP QL++WT++ GGDPCG++WKGV
Sbjct  9    LALFMLCIVGLKPSFILAATDASDTSALNYMFSAMNSPGQLSQWTSSSGGDPCGQNWKGV  68

Query  304  SCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAG  483
            +CS +RVT+I++SGL L+GS+G  LD+L SVT FD+S NNLG  LPYQLPPN+++LNLA 
Sbjct  69   TCSDSRVTQIKLSGLGLSGSLGSALDKLTSVTEFDLSNNNLGGDLPYQLPPNLERLNLAS  128

Query  484  NGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFS  663
            N FTG  PYS+SQM PL+YLN++HNQL+ ++++ F  LT+LS LD S N+L G++P + S
Sbjct  129  NQFTGSAPYSVSQMTPLKYLNLAHNQLK-QLSIDFTKLTSLSILDLSSNTLTGSLPNSMS  187

Query  664  SLTNMKNMYLQNNVFTGTIDVLANLPLDNL  753
            SLT+ K++YLQNN F+GTIDVLA LPL+NL
Sbjct  188  SLTSAKSIYLQNNQFSGTIDVLATLPLENL  217



>ref|XP_004488910.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5-like [Cicer arietinum]
Length=706

 Score =   226 bits (576),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 109/207 (53%), Positives = 151/207 (73%), Gaps = 1/207 (0%)
 Frame = +1

Query  136  LLIGFLLNAPPSAV-ADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCS  312
            L I FL+    + V   T   D S L  +++SLNSP +L+ W ++GGDPCG+SW+G+ CS
Sbjct  11   LWIAFLIAVSTTTVHCKTSSQDVSALNVMYTSLNSPSKLSGWKSSGGDPCGDSWEGIKCS  70

Query  313  GNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGF  492
             + VTEI++S L L+GS+G+QL  L SVT FD+S NNL   +PYQLPPN + ++L+ N F
Sbjct  71   SSSVTEIKLSDLGLSGSVGYQLASLTSVTYFDLSNNNLKGDIPYQLPPNARDIDLSKNQF  130

Query  493  TGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLT  672
            +G +PYSISQM  L  LN++HNQL  ++  MF SLT L  LD SFNSL+GN+PQ+  SL 
Sbjct  131  SGSIPYSISQMKELNSLNLAHNQLNNQLGDMFGSLTKLKQLDVSFNSLSGNLPQSLKSLR  190

Query  673  NMKNMYLQNNVFTGTIDVLANLPLDNL  753
            N+K ++LQNN F+G+++VLANLPLD++
Sbjct  191  NLKKIHLQNNQFSGSLNVLANLPLDDV  217



>ref|XP_008445635.1| PREDICTED: LOW QUALITY PROTEIN: protein STRUBBELIG-RECEPTOR FAMILY 
5-like [Cucumis melo]
Length=706

 Score =   226 bits (575),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 104/192 (54%), Positives = 143/192 (74%), Gaps = 0/192 (0%)
 Frame = +1

Query  178  ADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLT  357
            + T   D S L  +FSSLNSP QLT W ++GGDPCG+SW+G+ CSG+ VTEI +S   L+
Sbjct  22   SKTKAPDVSALNVMFSSLNSPSQLTGWGSSGGDPCGDSWEGIKCSGSSVTEISLSDFGLS  81

Query  358  GSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLE  537
            GSMG+QL  L SVT FD+S N+L   +PYQLPPN   ++L+GN FTG +PYSISQM  LE
Sbjct  82   GSMGYQLSNLASVTYFDLSKNSLSGDIPYQLPPNAVHIDLSGNSFTGSVPYSISQMTELE  141

Query  538  YLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGT  717
            +LN+ HNQL  +++ MF  L  L  LD SFN ++GN+PQ+F  L+++  +++Q+N F+G+
Sbjct  142  FLNLGHNQLSNQLSDMFGKLAKLKRLDLSFNKISGNLPQSFKKLSSLTVLHIQDNKFSGS  201

Query  718  IDVLANLPLDNL  753
            I+VLA+LPLD+L
Sbjct  202  INVLADLPLDDL  213



>ref|XP_008653345.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like isoform 
X1 [Zea mays]
 tpg|DAA63620.1| TPA: putative STRUBBELIG family receptor protein kinase [Zea 
mays]
Length=716

 Score =   226 bits (575),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 111/203 (55%), Positives = 150/203 (74%), Gaps = 2/203 (1%)
 Frame = +1

Query  148  FLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVT  327
            FL  A   A A+TD  D + L   ++++NSPPQLT W +  GDPCG+SW GV+CSG+RVT
Sbjct  13   FLAAASFGANANTDSNDVNALNVFYTTMNSPPQLTNWVSQNGDPCGQSWLGVTCSGSRVT  72

Query  328  EIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNS-LPYQLPPNVQKLNLAGNGFTGGL  504
             I++SG++L G++G+ ++QL ++   D+S NNLG S +PY LPPN+Q LNLA N FTG +
Sbjct  73   AIKLSGMRLNGTLGYNMNQLTALVQLDMSNNNLGGSDIPYNLPPNLQSLNLAVNNFTGTV  132

Query  505  PYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKN  684
            PYSISQM  L  LN+ HNQL   +  MF  LTNL+TLD S+N+ +G+IP +F+SLT++K 
Sbjct  133  PYSISQMVALRDLNLDHNQL-SNINDMFSQLTNLTTLDLSYNTFSGDIPHSFNSLTSLKT  191

Query  685  MYLQNNVFTGTIDVLANLPLDNL  753
            +YLQNN F GTIDVL +LPL +L
Sbjct  192  LYLQNNKFNGTIDVLTDLPLTDL  214



>ref|XP_004959657.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5-like [Setaria 
italica]
Length=693

 Score =   225 bits (573),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 109/192 (57%), Positives = 141/192 (73%), Gaps = 2/192 (1%)
 Frame = +1

Query  184  TDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCG--ESWKGVSCSGNRVTEIQISGLQLT  357
            TD  D + L  +F+S+N P QL+ W ++GGDPCG  E WKG+ CSG+ VTEI +SGL L+
Sbjct  31   TDQPDVAALNVMFNSMNKPSQLSGWKSSGGDPCGGDEEWKGIECSGSSVTEINLSGLGLS  90

Query  358  GSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLE  537
            G++G+QL  LKSVT FD S NNL   +PYQLPPN+ +LNL GN FTGG+PYSISQM  LE
Sbjct  91   GTLGYQLSSLKSVTKFDASNNNLNGDIPYQLPPNMVQLNLYGNSFTGGVPYSISQMEDLE  150

Query  538  YLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGT  717
             LNV  N L G++T MF  L  LSTLD SFN  +G++PQ+F  L N+K + +++N F+G 
Sbjct  151  TLNVGKNHLNGQLTDMFSQLPKLSTLDLSFNRFSGSLPQSFQHLRNLKTLNVESNQFSGH  210

Query  718  IDVLANLPLDNL  753
            IDVLA LPL++L
Sbjct  211  IDVLAKLPLEDL  222



>ref|XP_009408730.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5-like [Musa acuminata 
subsp. malaccensis]
Length=703

 Score =   225 bits (573),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 113/191 (59%), Positives = 148/191 (77%), Gaps = 0/191 (0%)
 Frame = +1

Query  181  DTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTG  360
            +TD  D S L  ++SSLNSPPQLT W+++GGDPCG +WKG+ CSG+ VT+I +SGLQLTG
Sbjct  24   NTDQADVSALNVMYSSLNSPPQLTGWSSSGGDPCGNNWKGIKCSGSSVTKITLSGLQLTG  83

Query  361  SMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  540
            +MG+QL  L SVT FD+S NNL   +PYQLPPN   LNLAGN  TGG+PYS+SQM  L+Y
Sbjct  84   TMGYQLSSLISVTYFDLSKNNLNGDIPYQLPPNTTHLNLAGNALTGGIPYSVSQMNHLKY  143

Query  541  LNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTI  720
            LN++ NQL G++T MF  L++LS LD SFN  +GN+P +F SL+++K + LQNN  +G++
Sbjct  144  LNLASNQLSGQLTDMFGELSSLSLLDLSFNRFSGNLPNSFGSLSSLKTLNLQNNQLSGSV  203

Query  721  DVLANLPLDNL  753
            DVLA L L+NL
Sbjct  204  DVLATLSLENL  214



>ref|NP_001049184.1| Os03g0183800 [Oryza sativa Japonica Group]
 gb|AAK92627.1|AC079633_7 Putative leucine-rich repeat transmembrane protein kinase 1 [Oryza 
sativa Japonica Group]
 gb|ABF94338.1| leucine-rich repeat transmembrane protein kinase 1, putative, 
expressed [Oryza sativa Japonica Group]
 dbj|BAF11098.1| Os03g0183800 [Oryza sativa Japonica Group]
 gb|EAY88809.1| hypothetical protein OsI_10282 [Oryza sativa Indica Group]
 gb|EAZ25839.1| hypothetical protein OsJ_09681 [Oryza sativa Japonica Group]
 dbj|BAG94684.1| unnamed protein product [Oryza sativa Japonica Group]
Length=718

 Score =   225 bits (573),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 112/196 (57%), Positives = 152/196 (78%), Gaps = 3/196 (2%)
 Frame = +1

Query  175  VADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQL  354
             ADTDP D +VL  LF+SLNSP QL  W A+GGDPCG+SW+G++CSG+ VT I++  L L
Sbjct  31   AADTDPNDVTVLNTLFTSLNSPGQLKGWQASGGDPCGQSWQGITCSGSSVTAIKLPSLGL  90

Query  355  TGSMGFQLDQLKSVTTFDISTNNLG--NSLPYQLPPN-VQKLNLAGNGFTGGLPYSISQM  525
            +G++ + ++ + S+   D+S NNLG    + Y LP N +++LNLAGN FTG LPYSI  M
Sbjct  91   SGNLAYNMNTMGSLIEIDMSQNNLGGGQQIQYNLPTNKLERLNLAGNQFTGNLPYSIFSM  150

Query  526  APLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNV  705
            + L+YLN++HNQLQG +T +F SL +L+TLD SFNSLAG++PQ F+SL+++K +YLQNN 
Sbjct  151  SNLKYLNLNHNQLQGNITDVFSSLYSLTTLDLSFNSLAGDLPQGFTSLSSLKKLYLQNNQ  210

Query  706  FTGTIDVLANLPLDNL  753
            FTG I+VLANLPLD+L
Sbjct  211  FTGYINVLANLPLDDL  226



>ref|XP_009386772.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like [Musa acuminata 
subsp. malaccensis]
Length=731

 Score =   225 bits (573),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 113/209 (54%), Positives = 152/209 (73%), Gaps = 3/209 (1%)
 Frame = +1

Query  136  LLIGFLLNAPPSAVAD-TDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCS  312
            +L+  +L   P  V   TD TDAS L  LF+SLNSP QLT W  +GGDPCG+SW GV+C+
Sbjct  14   VLLACILAGDPGGVGGITDETDASSLNILFTSLNSPSQLTGWVPSGGDPCGDSWLGVTCT  73

Query  313  GNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLG--NSLPYQLPPNVQKLNLAGN  486
            G+ VT I++SGL+L G+ G+ L  + S+   D+S NNLG  + +PY LPPN+Q LN  GN
Sbjct  74   GSAVTAIKLSGLELAGTPGYNLASMSSLAELDMSNNNLGGGDPIPYNLPPNLQSLNFGGN  133

Query  487  GFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSS  666
             F   +PYSI QM  L+YLN++HNQLQG ++ MF SL+NL+T+D SFN L G +PQ+F++
Sbjct  134  QFGANIPYSIFQMVTLKYLNLAHNQLQGNLSDMFGSLSNLTTMDLSFNQLTGELPQSFNN  193

Query  667  LTNMKNMYLQNNVFTGTIDVLANLPLDNL  753
            L+++  +YL+NN FTG IDVLANLPL +L
Sbjct  194  LSSLTTLYLENNQFTGQIDVLANLPLQDL  222



>ref|XP_006407090.1| hypothetical protein EUTSA_v10020162mg [Eutrema salsugineum]
 gb|ESQ48543.1| hypothetical protein EUTSA_v10020162mg [Eutrema salsugineum]
Length=714

 Score =   224 bits (572),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 119/212 (56%), Positives = 162/212 (76%), Gaps = 4/212 (2%)
 Frame = +1

Query  118  LPWAVALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWK  297
            LP  +  ++GF    P      TD +D S L  +FSS+ SP QL++WTA+GGDPCG++WK
Sbjct  8    LPLFILCIVGF---EPSLIHGATDASDTSALNTMFSSMGSPGQLSQWTASGGDPCGQNWK  64

Query  298  GVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNL  477
            G++CSG+RVT+I++SGL L+GS+G+ LD+L SVT FD+S+NNLG  LPYQLPPNV++LNL
Sbjct  65   GITCSGSRVTQIKLSGLGLSGSLGYMLDKLTSVTEFDLSSNNLGGDLPYQLPPNVERLNL  124

Query  478  AGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQT  657
            A N FTG   YSIS M PL+YLN++HNQL+ ++ + F  LT+L+ LD S NS+ G++P T
Sbjct  125  ANNQFTGSAQYSISLMTPLKYLNLAHNQLK-QLAIDFTKLTSLTILDLSSNSITGSLPST  183

Query  658  FSSLTNMKNMYLQNNVFTGTIDVLANLPLDNL  753
               LT+ K++YLQNN F+GTIDVLA+L L+NL
Sbjct  184  CRFLTSAKSIYLQNNQFSGTIDVLASLSLENL  215



>ref|XP_006604929.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like isoform 
X2 [Glycine max]
Length=708

 Score =   224 bits (572),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 115/185 (62%), Positives = 142/185 (77%), Gaps = 1/185 (1%)
 Frame = +1

Query  199  ASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQL  378
            A+ +R LF ++NSPPQL  W  NG DPCG+SWKG++CSGNRVTEI++S L LTGS+ + L
Sbjct  19   AAAVRFLFQNMNSPPQL-GWPPNGDDPCGQSWKGITCSGNRVTEIKLSNLGLTGSLPYGL  77

Query  379  DQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHN  558
              L S+T  D+S+N+LG S+PYQLPP +Q LNLA N  TG +PYSIS +  L  LN SHN
Sbjct  78   QVLTSLTYVDMSSNSLGGSIPYQLPPYLQHLNLAYNNITGTVPYSISNLTALTDLNFSHN  137

Query  559  QLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTIDVLANL  738
            QLQ  + V F++L+ LSTLD SFN L G++PQT SSL+ +  MYLQNN FTGTIDVLANL
Sbjct  138  QLQQGLGVDFLNLSTLSTLDLSFNFLTGDLPQTMSSLSRITTMYLQNNQFTGTIDVLANL  197

Query  739  PLDNL  753
            PLDNL
Sbjct  198  PLDNL  202



>gb|KGN45936.1| hypothetical protein Csa_6G024930 [Cucumis sativus]
Length=696

 Score =   224 bits (570),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 103/192 (54%), Positives = 143/192 (74%), Gaps = 0/192 (0%)
 Frame = +1

Query  178  ADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLT  357
            + T   D S L  +FSSLNSP QL+ W ++GGDPCG SW+G+ CSG+ VTEI +S   L+
Sbjct  22   SKTKAPDVSALNVMFSSLNSPSQLSGWGSSGGDPCGNSWEGIQCSGSSVTEISLSDFGLS  81

Query  358  GSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLE  537
            GSMG+QL  L SVT FD+S NNL   +PYQLPPN   ++L+GN FTG +PYSISQM+ LE
Sbjct  82   GSMGYQLSNLASVTYFDLSKNNLNGEIPYQLPPNAVHIDLSGNSFTGSVPYSISQMSELE  141

Query  538  YLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGT  717
            +LN+ HN+L  +++ MF  L  L  LD SFNS++GN+PQ+F  L+++  +++Q+N F+G+
Sbjct  142  FLNLGHNKLSNQLSDMFGKLAKLKRLDLSFNSISGNLPQSFKKLSSLTVLHIQDNKFSGS  201

Query  718  IDVLANLPLDNL  753
            I+ LA+LPLD+L
Sbjct  202  INFLADLPLDDL  213



>ref|XP_002465165.1| hypothetical protein SORBIDRAFT_01g033190 [Sorghum bicolor]
 gb|EER92163.1| hypothetical protein SORBIDRAFT_01g033190 [Sorghum bicolor]
Length=718

 Score =   224 bits (570),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 106/194 (55%), Positives = 147/194 (76%), Gaps = 2/194 (1%)
 Frame = +1

Query  175  VADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQL  354
             ADT+  D + L   ++++NSP QLT W    GDPCG+SW GV+CSG+RVT I++ G+ L
Sbjct  22   TADTNSDDVTALNTFYTTVNSPSQLTNWAPQNGDPCGQSWLGVTCSGSRVTTIKVPGMGL  81

Query  355  TGSMGFQLDQLKSVTTFDISTNNLGNS-LPYQLPPNVQKLNLAGNGFTGGLPYSISQMAP  531
             G++G+ ++ L  ++  D+S NNLG S +PY LPPN+++LNL  N F G LPYSISQMA 
Sbjct  82   KGTLGYNMNLLTELSELDVSNNNLGGSDIPYNLPPNLERLNLEKNNFIGTLPYSISQMAA  141

Query  532  LEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFT  711
            L+YLN+ HNQL  ++ VMF  LTNL+TLDFS+NS +GN+P++F+SLT++  +YLQ+N FT
Sbjct  142  LKYLNLGHNQL-SDINVMFDQLTNLTTLDFSYNSFSGNLPESFNSLTSLSTLYLQDNQFT  200

Query  712  GTIDVLANLPLDNL  753
            GTIDVL +LPL +L
Sbjct  201  GTIDVLTDLPLTDL  214



>ref|XP_008651693.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7 isoform X1 [Zea 
mays]
 tpg|DAA43732.1| TPA: putative STRUBBELIG family receptor protein kinase [Zea 
mays]
Length=736

 Score =   224 bits (571),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 114/197 (58%), Positives = 150/197 (76%), Gaps = 3/197 (2%)
 Frame = +1

Query  172  AVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQ  351
            A ADTDP D +VL  LF+SLNSP QLT W ANGGDPCG+SWKG++CSG+ VT+IQ+  L 
Sbjct  48   AAADTDPNDLNVLNTLFTSLNSPGQLTGWQANGGDPCGQSWKGITCSGSGVTKIQLPNLS  107

Query  352  LTGSMGFQLDQLKSVTTFDISTNNLGN--SLPYQLP-PNVQKLNLAGNGFTGGLPYSISQ  522
            LTG++ + ++ L S+   D+S NNLG    + Y LP   ++KLNLAGN F G LPYSIS 
Sbjct  108  LTGNLAYNMNNLGSLVELDMSQNNLGGGGQIQYNLPNMKLEKLNLAGNQFGGNLPYSIST  167

Query  523  MAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNN  702
            M  L+YLN++HNQLQG ++ +F +L +LS LD SFNSL G++PQ+F+ L+++K +YLQNN
Sbjct  168  MPNLKYLNLNHNQLQGNISDVFSNLYSLSELDLSFNSLTGDLPQSFTGLSSLKKVYLQNN  227

Query  703  VFTGTIDVLANLPLDNL  753
             FTG I+VLANLPL+ L
Sbjct  228  QFTGNINVLANLPLETL  244



>ref|XP_010252506.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like [Nelumbo 
nucifera]
Length=730

 Score =   224 bits (570),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 111/225 (49%), Positives = 152/225 (68%), Gaps = 1/225 (0%)
 Frame = +1

Query  82   ERASLKMRELMGLPWAVALL-IGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKW  258
             R SL       +  A+AL  +  ++  PP   A TDP D   L+ L+ SLNSPP+LT W
Sbjct  5    RRTSLSTSRFFTVSSAIALATLTTVIFTPPLVRATTDPLDVQSLQVLYVSLNSPPRLTGW  64

Query  259  TANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSL  438
             + GGDPCGESWKGV C G+ V  IQ+ GL L+G++G+ L  L S+ T D+S NN+ +S+
Sbjct  65   KSGGGDPCGESWKGVICQGSAVVAIQLPGLGLSGTLGYMLSSLFSLRTLDLSDNNIHDSI  124

Query  439  PYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLD  618
            PYQLPPN+  LNLA N  +G LPYSIS M  L YLN+SHN +   +  +F +L  LS LD
Sbjct  125  PYQLPPNLTSLNLASNNLSGNLPYSISSMVSLNYLNLSHNSIFQSIGDIFANLQGLSILD  184

Query  619  FSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTIDVLANLPLDNL  753
             SFN+ +G++P +F SL+N+  +YLQ+N  TG++++LA+LPLDNL
Sbjct  185  LSFNNFSGDLPNSFGSLSNLSTLYLQSNQLTGSVNILADLPLDNL  229



>ref|XP_002310348.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
 gb|EEE90798.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
Length=672

 Score =   223 bits (567),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 110/192 (57%), Positives = 151/192 (79%), Gaps = 0/192 (0%)
 Frame = +1

Query  178  ADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLT  357
            + TD  D S L  +F+SLNSP +L+ W ++GGDPCG+SW+G+ CSG+ VT+I++SGL LT
Sbjct  22   SKTDSEDVSALNVMFTSLNSPSKLSGWQSSGGDPCGDSWEGIQCSGSSVTQIKLSGLGLT  81

Query  358  GSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLE  537
            GS+G+QL  LKSVT FD+S NNL N +PYQLPPN   L+L+ NGFTG +PYSISQM  L+
Sbjct  82   GSLGYQLSNLKSVTYFDVSKNNLKNDIPYQLPPNAATLDLSNNGFTGSVPYSISQMTKLQ  141

Query  538  YLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGT  717
             LN++ N+L G+++ MF  L+ L TLD S NS++GN+PQ+FS+L+++  ++LQ+N FTGT
Sbjct  142  NLNLNQNKLNGQLSDMFQKLSKLKTLDLSHNSISGNLPQSFSALSSLSTLHLQDNEFTGT  201

Query  718  IDVLANLPLDNL  753
            IDVLA LPL +L
Sbjct  202  IDVLARLPLKDL  213



>ref|XP_007213628.1| hypothetical protein PRUPE_ppa002088mg [Prunus persica]
 gb|EMJ14827.1| hypothetical protein PRUPE_ppa002088mg [Prunus persica]
Length=718

 Score =   223 bits (568),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 113/211 (54%), Positives = 147/211 (70%), Gaps = 5/211 (2%)
 Frame = +1

Query  136  LLIGFLLNAPPSAV-----ADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKG  300
            LL GF+L A   AV       TD +D   L+ L++S+NSP QLT W  +GGDPCGESWKG
Sbjct  15   LLTGFVLIASTFAVLPLVSGTTDASDVQALQVLYTSVNSPSQLTGWKISGGDPCGESWKG  74

Query  301  VSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLA  480
            V+C G+ V  I++SGL L+G+MG+ L  L S+  FD+S NN  ++LPYQLPPN+  LNLA
Sbjct  75   VTCEGSAVVSIEVSGLGLSGTMGYLLSDLLSLRKFDLSDNNFHDTLPYQLPPNLTSLNLA  134

Query  481  GNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTF  660
             N FTG LPYSI+ M  L YLNVSHN L   V  MF +L  L+TLD S N+ +G+IP +F
Sbjct  135  RNNFTGNLPYSIANMVSLGYLNVSHNSLSQSVGDMFANLVGLATLDLSLNNFSGDIPNSF  194

Query  661  SSLTNMKNMYLQNNVFTGTIDVLANLPLDNL  753
            +SLTN+ ++Y+QNN  TG+++VL  LPL  L
Sbjct  195  TSLTNLSSLYVQNNQLTGSLNVLTGLPLTTL  225



>ref|XP_006649512.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7-like [Oryza brachyantha]
Length=717

 Score =   223 bits (567),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 111/196 (57%), Positives = 150/196 (77%), Gaps = 3/196 (2%)
 Frame = +1

Query  175  VADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQL  354
             ADTDP D +VL  LF+SLNSP QL  W A+GGDPCG+SW+G++CSG+ VT I++S L L
Sbjct  28   AADTDPNDVTVLNTLFTSLNSPGQLKGWQASGGDPCGQSWQGITCSGSSVTAIKLSSLGL  87

Query  355  TGSMGFQLDQLKSVTTFDISTNNLG--NSLPYQLP-PNVQKLNLAGNGFTGGLPYSISQM  525
            +G++ + ++ + S+   D+S NNLG    + Y LP   +++LNLAGN FTG LPYSI  M
Sbjct  88   SGNLAYNMNTMGSLIEIDMSQNNLGGGQQIQYNLPTSKLERLNLAGNQFTGNLPYSIFSM  147

Query  526  APLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNV  705
              L+YLN++HNQLQG +T +F SL +L+TLD SFNSL G++PQ F+SL+++K +YLQNN 
Sbjct  148  NNLKYLNLNHNQLQGNITDVFSSLYSLTTLDLSFNSLTGDLPQGFTSLSSLKKLYLQNNQ  207

Query  706  FTGTIDVLANLPLDNL  753
            FTG I+VLANLPLD+L
Sbjct  208  FTGYINVLANLPLDDL  223



>ref|XP_010096526.1| Protein STRUBBELIG-RECEPTOR FAMILY 6 [Morus notabilis]
 gb|EXB64646.1| Protein STRUBBELIG-RECEPTOR FAMILY 6 [Morus notabilis]
Length=689

 Score =   222 bits (566),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 116/216 (54%), Positives = 145/216 (67%), Gaps = 26/216 (12%)
 Frame = +1

Query  112  MGLPWAVALLIGF-LLNAPPSAV-ADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCG  285
            M   W + +     +L   PS + A TDP DA+ LR +++S+NSPPQLT W ANG DPCG
Sbjct  1    MSEIWRILVFFSVCILGFKPSFINAATDPQDAAALRNMYTSMNSPPQLTGWNANGDDPCG  60

Query  286  ESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQ  465
            +SWKGV+CSG RVTEI++S L L+GS G+QL  L SVT  D+S NNLG  +PY +PPN+ 
Sbjct  61   QSWKGVTCSGQRVTEIKLSDLGLSGSFGYQLQSLTSVTILDLSNNNLGGGMPYGIPPNLT  120

Query  466  KLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGN  645
            +LN                        +SHNQLQ ++  MF  LT+LSTLD SFNS+ GN
Sbjct  121  RLN------------------------ISHNQLQNQLDNMFDKLTSLSTLDLSFNSIQGN  156

Query  646  IPQTFSSLTNMKNMYLQNNVFTGTIDVLANLPLDNL  753
            +PQ+FSSL++M  MYLQNN FTGTIDVLANLPLD L
Sbjct  157  LPQSFSSLSSMNKMYLQNNQFTGTIDVLANLPLDVL  192



>gb|KHN38109.1| Protein STRUBBELIG-RECEPTOR FAMILY 5 [Glycine soja]
Length=690

 Score =   222 bits (566),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 104/206 (50%), Positives = 148/206 (72%), Gaps = 0/206 (0%)
 Frame = +1

Query  136  LLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSG  315
            L I  L  +       T   D S L  +++SLNSP +L+ W ++GGDPCG+SW+G+ CSG
Sbjct  12   LWIALLAVSTTVVHCKTASQDVSALNVMYTSLNSPSKLSGWKSSGGDPCGDSWEGIKCSG  71

Query  316  NRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFT  495
            + VTEI +S L L+GSMG+QL  LKSVT FD+S NN    +PYQLPPN + ++L+ N FT
Sbjct  72   SSVTEINLSDLGLSGSMGYQLSSLKSVTDFDLSNNNFKGDIPYQLPPNARYIDLSKNDFT  131

Query  496  GGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTN  675
            G +PYS S+M  L YLN++HNQL+ ++  MF  L+ L  LD SFNSL+G++PQ+  SL +
Sbjct  132  GSIPYSFSEMDDLNYLNLAHNQLKNQLGDMFGKLSKLKQLDVSFNSLSGDLPQSLKSLKS  191

Query  676  MKNMYLQNNVFTGTIDVLANLPLDNL  753
            ++ ++LQNN FTG+++VLA+LPL++L
Sbjct  192  LEKLHLQNNQFTGSVNVLASLPLEDL  217



>ref|XP_009398614.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=694

 Score =   222 bits (565),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 110/190 (58%), Positives = 149/190 (78%), Gaps = 0/190 (0%)
 Frame = +1

Query  184  TDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGS  363
            TD +D S L  ++SSL+SP +LT W++ GGDPCG  WKG+ CSG+ VTEI++SGL LTG+
Sbjct  26   TDSSDVSALNVMYSSLSSPSKLTGWSSGGGDPCGNDWKGIKCSGSSVTEIKLSGLGLTGT  85

Query  364  MGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYL  543
            MG+QL  L SVT FD+S NNL   +PYQLPPNV  +NLAGNG TGG+PYSISQM+ L+YL
Sbjct  86   MGYQLASLTSVTYFDLSKNNLNGDIPYQLPPNVTHINLAGNGLTGGIPYSISQMSDLKYL  145

Query  544  NVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTID  723
            N+++NQL G++  MF  L +LS LD SFN  +G++PQ+F SLT++K + L+NN F+G++D
Sbjct  146  NLANNQLSGQLIDMFGKLPSLSLLDLSFNRFSGSLPQSFGSLTHLKTLNLENNQFSGSLD  205

Query  724  VLANLPLDNL  753
            VL+ L L++L
Sbjct  206  VLSTLSLEDL  215



>ref|XP_006586431.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5-like [Glycine 
max]
Length=725

 Score =   222 bits (566),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 104/206 (50%), Positives = 148/206 (72%), Gaps = 0/206 (0%)
 Frame = +1

Query  136  LLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSG  315
            L I  L  +       T   D S L  +++SLNSP +L+ W ++GGDPCG+SW+G+ CSG
Sbjct  47   LWIALLAVSTTVVHCKTASQDVSALNVMYTSLNSPSKLSGWKSSGGDPCGDSWEGIKCSG  106

Query  316  NRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFT  495
            + VTEI +S L L+GSMG+QL  LKSVT FD+S NN    +PYQLPPN + ++L+ N FT
Sbjct  107  SSVTEINLSDLGLSGSMGYQLSSLKSVTDFDLSNNNFKGDIPYQLPPNARYIDLSKNDFT  166

Query  496  GGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTN  675
            G +PYS S+M  L YLN++HNQL+ ++  MF  L+ L  LD SFNSL+G++PQ+  SL +
Sbjct  167  GSIPYSFSEMDDLNYLNLAHNQLKNQLGDMFGKLSKLKQLDVSFNSLSGDLPQSLKSLKS  226

Query  676  MKNMYLQNNVFTGTIDVLANLPLDNL  753
            ++ ++LQNN FTG+++VLA+LPL++L
Sbjct  227  LEKLHLQNNQFTGSVNVLASLPLEDL  252



>ref|XP_011031253.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5 [Populus euphratica]
Length=672

 Score =   221 bits (564),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 109/192 (57%), Positives = 150/192 (78%), Gaps = 0/192 (0%)
 Frame = +1

Query  178  ADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLT  357
            + TD  D S L  +F+SLNSP +L+ W ++GGDPCG+SW+G+ CSG+ VT+I++SG  LT
Sbjct  22   SKTDSEDVSALNVMFTSLNSPSKLSGWQSSGGDPCGDSWEGIQCSGSSVTQIKLSGFGLT  81

Query  358  GSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLE  537
            GS+G+QL  LKSVT FD+S NNL N +PYQLPPN   L+L+ NGFTG +PYSISQM  L+
Sbjct  82   GSLGYQLSNLKSVTYFDVSKNNLKNDMPYQLPPNAATLDLSNNGFTGSVPYSISQMTKLQ  141

Query  538  YLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGT  717
             LN++ N+L G+++ MF  L+ L TLD S NS++GN+PQ+FS+L+++  ++LQ+N FTGT
Sbjct  142  NLNLNQNKLNGQLSDMFQKLSKLKTLDLSHNSISGNLPQSFSALSSLSTLHLQDNEFTGT  201

Query  718  IDVLANLPLDNL  753
            IDVLA LPL +L
Sbjct  202  IDVLARLPLKDL  213



>ref|XP_009388759.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=703

 Score =   222 bits (565),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 118/193 (61%), Positives = 151/193 (78%), Gaps = 2/193 (1%)
 Frame = +1

Query  181  DTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTG  360
            DTD  DAS L  LFSSLNS  QLT W  +GGDPCGESW G++CSG+ VT I++SGL LTG
Sbjct  30   DTDSNDASALSVLFSSLNSASQLTGWKQSGGDPCGESWLGITCSGSSVTAIKLSGLGLTG  89

Query  361  SMGFQLDQLKSVTTFDISTNNLGN--SLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPL  534
            ++G+ ++QL S+T  D+S NNLGN  S+PY LPPN+ +L+L+ N + G LPYSIS M  L
Sbjct  90   TLGYNMNQLSSLTELDLSKNNLGNKSSIPYNLPPNLHRLDLSNNQYGGSLPYSISPMVTL  149

Query  535  EYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTG  714
            EYLN++HNQLQG +  MF SL+NL+T+D S NSL G++PQ+FSSLT++ ++YL+NN FTG
Sbjct  150  EYLNLAHNQLQGNLGDMFGSLSNLATIDLSSNSLTGDLPQSFSSLTSLTSLYLENNQFTG  209

Query  715  TIDVLANLPLDNL  753
             IDVLA LPL NL
Sbjct  210  HIDVLAGLPLQNL  222



>ref|XP_006583189.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like [Glycine 
max]
Length=713

 Score =   222 bits (565),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 117/191 (61%), Positives = 148/191 (77%), Gaps = 3/191 (2%)
 Frame = +1

Query  181  DTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTG  360
            DTDP D + L+ LF S+NSP QL  W  NG DPCG+SW+G++CSGNRVTEI++ G  L+G
Sbjct  23   DTDPNDVASLKVLFQSMNSPSQLN-W--NGDDPCGQSWQGITCSGNRVTEIKLPGRSLSG  79

Query  361  SMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  540
            S+G+QL+ + SVT  D+S NNLG ++PYQLPPN+Q LNLA N F G +PYS+S+   L  
Sbjct  80   SLGYQLEPMSSVTNLDLSNNNLGGTIPYQLPPNLQYLNLANNNFNGAIPYSLSEKTSLIV  139

Query  541  LNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTI  720
            LN+ HNQLQ  + V F  L++LSTLD SFNSL G++PQT SSL++++ MYLQNN FTGTI
Sbjct  140  LNLGHNQLQQALNVDFQKLSSLSTLDLSFNSLTGDLPQTMSSLSSIRTMYLQNNQFTGTI  199

Query  721  DVLANLPLDNL  753
            DVLANLPLD L
Sbjct  200  DVLANLPLDTL  210



>ref|XP_009388758.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=705

 Score =   222 bits (565),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 118/193 (61%), Positives = 151/193 (78%), Gaps = 2/193 (1%)
 Frame = +1

Query  181  DTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTG  360
            DTD  DAS L  LFSSLNS  QLT W  +GGDPCGESW G++CSG+ VT I++SGL LTG
Sbjct  30   DTDSNDASALSVLFSSLNSASQLTGWKQSGGDPCGESWLGITCSGSSVTAIKLSGLGLTG  89

Query  361  SMGFQLDQLKSVTTFDISTNNLGN--SLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPL  534
            ++G+ ++QL S+T  D+S NNLGN  S+PY LPPN+ +L+L+ N + G LPYSIS M  L
Sbjct  90   TLGYNMNQLSSLTELDLSKNNLGNKSSIPYNLPPNLHRLDLSNNQYGGSLPYSISPMVTL  149

Query  535  EYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTG  714
            EYLN++HNQLQG +  MF SL+NL+T+D S NSL G++PQ+FSSLT++ ++YL+NN FTG
Sbjct  150  EYLNLAHNQLQGNLGDMFGSLSNLATIDLSSNSLTGDLPQSFSSLTSLTSLYLENNQFTG  209

Query  715  TIDVLANLPLDNL  753
             IDVLA LPL NL
Sbjct  210  HIDVLAGLPLQNL  222



>ref|XP_006389935.1| hypothetical protein EUTSA_v10019668mg [Eutrema salsugineum]
 gb|ESQ27221.1| hypothetical protein EUTSA_v10019668mg [Eutrema salsugineum]
Length=699

 Score =   221 bits (562),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 106/208 (51%), Positives = 149/208 (72%), Gaps = 0/208 (0%)
 Frame = +1

Query  130  VALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSC  309
            V L I  L      A A T+  + S L  +F+SLNSP +L  W ++GGDPC  SW+GV C
Sbjct  6    VRLFIASLAIIVTLAQAKTENQEVSALNVMFTSLNSPSKLKGWKSSGGDPCDGSWEGVKC  65

Query  310  SGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNG  489
             G+ VTE+Q+SGL+L+GS+G+ L  LKS+TTFD+S NNL  ++PYQLPPN+  L+L+ N 
Sbjct  66   KGSSVTELQLSGLELSGSLGYLLSNLKSLTTFDLSKNNLKGNIPYQLPPNIANLDLSENE  125

Query  490  FTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSL  669
              G +PYS+SQM  LE +N+ HN++ GE++ MF  L+ L TLD SFN L+G +PQ+F++L
Sbjct  126  LDGNVPYSLSQMNRLESINLGHNKINGELSDMFQKLSKLETLDLSFNKLSGKLPQSFANL  185

Query  670  TNMKNMYLQNNVFTGTIDVLANLPLDNL  753
            T++K ++LQ N FTG I+VL NL +D+L
Sbjct  186  TSLKKLHLQENRFTGDINVLRNLAIDDL  213



>gb|KHG12210.1| Protein STRUBBELIG-RECEPTOR FAMILY 6 [Gossypium arboreum]
Length=689

 Score =   220 bits (561),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 115/179 (64%), Positives = 141/179 (79%), Gaps = 0/179 (0%)
 Frame = +1

Query  217  LFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSV  396
            +FSSLNSP QLT WTAN GDPCG+ WKGV+CSG RVTEI++S L L+GSMG+ L  L S+
Sbjct  1    MFSSLNSPQQLTGWTANNGDPCGQPWKGVTCSGQRVTEIKLSNLGLSGSMGYSLQSLTSL  60

Query  397  TTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEV  576
               D+S NNL   +PY +P N+ + NLA N FTG +PYSI+QM  L+YLN+SHNQLQ ++
Sbjct  61   KELDLSHNNLAGGIPYNIPLNLTRFNLAYNQFTGSVPYSINQMHSLQYLNLSHNQLQYQL  120

Query  577  TVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTIDVLANLPLDNL  753
              MF  L++LSTLD SFNSL   +PQ+F +LT+MK+MYLQNN FTGTIDVLANLPLDNL
Sbjct  121  NDMFGPLSSLSTLDLSFNSLTDALPQSFKNLTSMKSMYLQNNQFTGTIDVLANLPLDNL  179



>ref|XP_007024796.1| Strubbelig-receptor family 6 [Theobroma cacao]
 gb|EOY27418.1| Strubbelig-receptor family 6 [Theobroma cacao]
Length=721

 Score =   221 bits (562),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 118/205 (58%), Positives = 153/205 (75%), Gaps = 4/205 (2%)
 Frame = +1

Query  139  LIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGN  318
            ++GF    P  A   TD  DAS L G+FSSLNSP QLT WT++ GDPCG+SWKGV+CSG 
Sbjct  18   ILGF---KPRCANGATDQGDASALGGMFSSLNSPQQLTGWTSSNGDPCGQSWKGVTCSGQ  74

Query  319  RVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTG  498
            RVTEI++S L L+GS+ + L  L S+   D+S NN+   +PY LPPN+Q+LNLA N FTG
Sbjct  75   RVTEIKLSNLGLSGSI-YNLQSLTSLKELDMSQNNIAGEIPYNLPPNLQQLNLAFNQFTG  133

Query  499  GLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNM  678
             +PY    M  L+YLN+ HNQLQ ++  MF  L++LSTLD SFN+L G++P++F +L+++
Sbjct  134  SVPYVFHDMPSLQYLNLGHNQLQNQLNDMFAPLSSLSTLDLSFNALTGDLPESFKNLSSV  193

Query  679  KNMYLQNNVFTGTIDVLANLPLDNL  753
             +MYLQNN FTGTIDVLANLPLDNL
Sbjct  194  NSMYLQNNQFTGTIDVLANLPLDNL  218



>emb|CDY33226.1| BnaC01g36990D [Brassica napus]
Length=711

 Score =   220 bits (561),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 116/206 (56%), Positives = 162/206 (79%), Gaps = 5/206 (2%)
 Frame = +1

Query  139  LIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTAN-GGDPCGESWKGVSCSG  315
            ++GF    P   +A T+ +D S L  +FS++NSP QL+ WT++ GGDPC ++WKG++C G
Sbjct  4    IVGF---KPSLILAATNASDTSALNFMFSAMNSPGQLSHWTSSSGGDPCEQNWKGITCFG  60

Query  316  NRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFT  495
            +RVT+I++SGL L+GS+G+ LD L SVT  D+S NNLG  LPYQLPPN+++LNLA N FT
Sbjct  61   SRVTQIKLSGLGLSGSLGYALDNLTSVTELDLSNNNLGGDLPYQLPPNLERLNLASNQFT  120

Query  496  GGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTN  675
            G LPYS+SQM PL+YLN++HNQL+ ++++ F  LT+LS LD S N++ G++P + SSLT+
Sbjct  121  GSLPYSVSQMTPLKYLNLAHNQLK-QLSIDFTKLTSLSILDLSSNTITGSLPNSMSSLTS  179

Query  676  MKNMYLQNNVFTGTIDVLANLPLDNL  753
             K++YLQNN F+GTIDVLA LPL+NL
Sbjct  180  AKSIYLQNNQFSGTIDVLATLPLENL  205



>ref|XP_004138532.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5-like [Cucumis 
sativus]
 ref|XP_004160222.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5-like [Cucumis 
sativus]
Length=662

 Score =   219 bits (559),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 99/179 (55%), Positives = 138/179 (77%), Gaps = 0/179 (0%)
 Frame = +1

Query  217  LFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSV  396
            +FSSLNSP QL+ W ++GGDPCG SW+G+ CSG+ VTEI +S   L+GSMG+QL  L SV
Sbjct  1    MFSSLNSPSQLSGWGSSGGDPCGNSWEGIQCSGSSVTEISLSDFGLSGSMGYQLSNLASV  60

Query  397  TTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEV  576
            T FD+S NNL   +PYQLPPN   ++L+GN FTG +PYSISQM+ LE+LN+ HN+L  ++
Sbjct  61   TYFDLSKNNLNGEIPYQLPPNAVHIDLSGNSFTGSVPYSISQMSELEFLNLGHNKLSNQL  120

Query  577  TVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTIDVLANLPLDNL  753
            + MF  L  L  LD SFNS++GN+PQ+F  L+++  +++Q+N F+G+I+ LA+LPLD+L
Sbjct  121  SDMFGKLAKLKRLDLSFNSISGNLPQSFKKLSSLTVLHIQDNKFSGSINFLADLPLDDL  179



>gb|EPS68087.1| hypothetical protein M569_06686, partial [Genlisea aurea]
Length=632

 Score =   219 bits (558),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 102/184 (55%), Positives = 143/184 (78%), Gaps = 0/184 (0%)
 Frame = +1

Query  202  SVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLD  381
            S L  +F+++NSP QL  W ++GGDPC +SWKG+SCSG++VTEI +SGL LTGS+G+ L 
Sbjct  2    SALNVMFATMNSPSQLDGWKSSGGDPCHDSWKGISCSGSKVTEIDLSGLGLTGSIGYMLS  61

Query  382  QLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQ  561
             LKSV  FD+S N   +S+PYQLPPNVQ+++L+GN F G +PYSIS+M+ L+ +  S+N+
Sbjct  62   DLKSVVNFDVSKNKFKSSIPYQLPPNVQRIDLSGNEFQGTVPYSISEMSHLKQIYFSNNK  121

Query  562  LQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTIDVLANLP  741
            L G++  MFV LT L+ LD SFN L+G++P +F +L+++  + LQNN F+GTIDVL NLP
Sbjct  122  LNGQLNDMFVKLTKLTDLDLSFNLLSGDLPHSFMNLSSLSMLNLQNNKFSGTIDVLTNLP  181

Query  742  LDNL  753
            LD+L
Sbjct  182  LDDL  185



>ref|XP_010244139.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like [Nelumbo 
nucifera]
Length=729

 Score =   220 bits (561),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 110/208 (53%), Positives = 146/208 (70%), Gaps = 3/208 (1%)
 Frame = +1

Query  130  VALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSC  309
            VAL + F L   P   + TD +D   L+ L+SSLNS P LT W +N GDPCGESWKGV+C
Sbjct  24   VALTVIFTL---PLVRSATDSSDVQALQVLYSSLNSSPLLTGWKSNAGDPCGESWKGVTC  80

Query  310  SGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNG  489
             G+ V  IQISGL L+G++G+ L  L S+   D+S NN+ +S+PYQLPPN+  LNLA N 
Sbjct  81   QGSSVVAIQISGLGLSGTLGYMLSSLFSLKALDLSGNNIHDSIPYQLPPNLTSLNLANNN  140

Query  490  FTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSL  669
             +G LPYSIS M  L YLN+ HN +   +  +F +L +LS LD SFN+ +GN+P +F SL
Sbjct  141  LSGNLPYSISTMVSLNYLNLGHNSISQSIGDIFANLQSLSVLDLSFNNFSGNLPNSFGSL  200

Query  670  TNMKNMYLQNNVFTGTIDVLANLPLDNL  753
            +N+  +YLQNN  TG+I++LA+LPLDNL
Sbjct  201  SNLSTLYLQNNQLTGSINLLADLPLDNL  228



>ref|XP_011072790.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5 [Sesamum indicum]
Length=717

 Score =   220 bits (560),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 102/192 (53%), Positives = 149/192 (78%), Gaps = 0/192 (0%)
 Frame = +1

Query  178  ADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLT  357
              TD +D S L  +++S+NSP  L  WT++GGDPCGESWKG+SCSG++VTEI +SGL LT
Sbjct  40   CKTDSSDVSGLNVMYTSMNSPSVLDGWTSSGGDPCGESWKGISCSGSKVTEINLSGLGLT  99

Query  358  GSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLE  537
            GS G++L  LKSVT FD+S N+   ++PYQLPPN+Q ++L+GN F G +PYSISQM  L+
Sbjct  100  GSFGYKLSDLKSVTRFDLSKNSFKGNIPYQLPPNLQLIDLSGNEFDGNVPYSISQMTDLK  159

Query  538  YLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGT  717
             +++++N+L G+++ MF  L+ L+ +D S NSL+G +PQ+F +L+++  + LQ+N FTG+
Sbjct  160  EMDLNNNKLNGQLSDMFGKLSKLTKMDLSSNSLSGELPQSFKNLSSLTTLRLQDNKFTGS  219

Query  718  IDVLANLPLDNL  753
            I+VLANLP+D L
Sbjct  220  INVLANLPVDEL  231



>ref|XP_008224758.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8 [Prunus mume]
Length=721

 Score =   220 bits (560),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 111/211 (53%), Positives = 147/211 (70%), Gaps = 5/211 (2%)
 Frame = +1

Query  136  LLIGFLLNAPPSAV-----ADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKG  300
            LL GF+L A   AV       TD +D   L+ L++S+NSP QLT W  +GGDPCGESWKG
Sbjct  15   LLTGFVLIASTFAVLPLVSGTTDASDVQALQVLYTSVNSPSQLTGWKISGGDPCGESWKG  74

Query  301  VSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLA  480
            V+C G+ V  I++SGL L+G+MG+ L  L S+  FD+S NN  ++LPYQLPPN+  LN+A
Sbjct  75   VTCEGSAVVSIEVSGLGLSGTMGYLLSDLLSLRKFDLSDNNFHDTLPYQLPPNLTSLNIA  134

Query  481  GNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTF  660
             N FTG LPYSI+ M  L YLNVSHN L   V  +F +L  L+TLD S N+ +G+IP +F
Sbjct  135  RNNFTGNLPYSIANMVSLGYLNVSHNSLSQSVGDIFANLVGLATLDLSLNNFSGDIPNSF  194

Query  661  SSLTNMKNMYLQNNVFTGTIDVLANLPLDNL  753
            +SLTN+ ++Y+QNN  TG+++VL  LPL  L
Sbjct  195  TSLTNLSSLYVQNNQLTGSLNVLTGLPLTTL  225



>ref|NP_001104882.1| leucine-rich repeat transmembrane protein kinase 2 precursor 
[Zea mays]
 gb|AAC27895.1| leucine-rich repeat transmembrane protein kinase 2 [Zea mays]
Length=725

 Score =   219 bits (559),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 112/196 (57%), Positives = 147/196 (75%), Gaps = 3/196 (2%)
 Frame = +1

Query  175  VADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQL  354
             ADTDP D +VL  LF+SLNSP QL  W ANGGDPCG+SW+G++CSG+ VT+I +  L L
Sbjct  36   AADTDPNDLNVLNTLFTSLNSPGQLRAWRANGGDPCGQSWQGITCSGSGVTKILLPNLSL  95

Query  355  TGSMGFQLDQLKSVTTFDISTNNLGN--SLPYQLP-PNVQKLNLAGNGFTGGLPYSISQM  525
            TG++ + ++ L S+   D+S NNLG    + Y LP   ++KLNLAGN F G LPYSIS M
Sbjct  96   TGNLAYNMNNLGSLVELDLSQNNLGGGGQIQYNLPNVKLEKLNLAGNQFGGNLPYSISTM  155

Query  526  APLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNV  705
              L+YLN++HNQLQG +T +F +L +LS LD SFNSL G++PQ+F+ L+++K MYLQNN 
Sbjct  156  PNLKYLNLNHNQLQGNITDVFSNLYSLSELDLSFNSLTGDLPQSFTGLSSLKRMYLQNNQ  215

Query  706  FTGTIDVLANLPLDNL  753
            FTG I+VLANLPL+ L
Sbjct  216  FTGYINVLANLPLETL  231



>ref|XP_004494892.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like [Cicer arietinum]
Length=722

 Score =   219 bits (559),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 115/198 (58%), Positives = 140/198 (71%), Gaps = 6/198 (3%)
 Frame = +1

Query  169  SAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGL  348
            S  A TDPT  + L+ +F S+NSP QL  W  N  DPCG+SWKG++CS N VT+I +S L
Sbjct  25   STAATTDPTHVAALKAMFQSMNSPSQL-GWPTNADDPCGQSWKGITCSANSVTQIVLSNL  83

Query  349  QLTGSM---GFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSIS  519
             LTG++   GFQ   L S+T  DIS NNL   +PYQLPPNVQ+LN A N  TG +PYSIS
Sbjct  84   ALTGTLLPYGFQ--DLTSLTNLDISNNNLFGPIPYQLPPNVQRLNFAHNNLTGAVPYSIS  141

Query  520  QMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQN  699
             +  L  LN+SHNQLQ  + V F  L+ LS LD SFNSLAG++PQT SSL+ +  MYLQN
Sbjct  142  NLTSLTDLNLSHNQLQQALNVNFQYLSTLSKLDLSFNSLAGDLPQTMSSLSGITTMYLQN  201

Query  700  NVFTGTIDVLANLPLDNL  753
            N FTGTID+LANLPL +L
Sbjct  202  NQFTGTIDILANLPLHSL  219



>gb|AFW89442.1| putative STRUBBELIG family receptor protein kinase [Zea mays]
Length=725

 Score =   219 bits (558),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 112/196 (57%), Positives = 147/196 (75%), Gaps = 3/196 (2%)
 Frame = +1

Query  175  VADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQL  354
             ADTDP D +VL  LF+SLNSP QL  W ANGGDPCG+SW+G++CSG+ VT+I +  L L
Sbjct  36   AADTDPNDLNVLNTLFTSLNSPGQLRAWQANGGDPCGQSWQGITCSGSGVTKILLPNLSL  95

Query  355  TGSMGFQLDQLKSVTTFDISTNNLGN--SLPYQLP-PNVQKLNLAGNGFTGGLPYSISQM  525
            TG++ + ++ L S+   D+S NNLG    + Y LP   ++KLNLAGN F G LPYSIS M
Sbjct  96   TGNLAYNMNNLGSLVELDLSQNNLGGGGQIQYNLPNVKLEKLNLAGNQFGGNLPYSISTM  155

Query  526  APLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNV  705
              L+YLN++HNQLQG +T +F +L +LS LD SFNSL G++PQ+F+ L+++K MYLQNN 
Sbjct  156  PNLKYLNLNHNQLQGNITDVFSNLYSLSELDLSFNSLTGDLPQSFTGLSSLKRMYLQNNQ  215

Query  706  FTGTIDVLANLPLDNL  753
            FTG I+VLANLPL+ L
Sbjct  216  FTGYINVLANLPLETL  231



>ref|XP_006598761.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like isoform 
X1 [Glycine max]
 gb|KHN15854.1| Protein STRUBBELIG-RECEPTOR FAMILY 6 [Glycine soja]
Length=715

 Score =   219 bits (557),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 116/191 (61%), Positives = 147/191 (77%), Gaps = 3/191 (2%)
 Frame = +1

Query  181  DTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTG  360
            DTDP D + L+ LF S+NSP QL  W  NG DPCG+SW+G++CSGNRVTEI++ G  L+G
Sbjct  24   DTDPNDVTSLKVLFQSMNSPSQLN-W--NGDDPCGQSWQGITCSGNRVTEIKLPGRSLSG  80

Query  361  SMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  540
            S+G+QL+ L SVT  D+S NN+G ++PYQLPPN+Q LNLA N F G +PYS+S+   L  
Sbjct  81   SLGYQLEPLSSVTNLDLSNNNIGGTIPYQLPPNLQYLNLANNNFNGAIPYSLSEKTSLVI  140

Query  541  LNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTI  720
            LN+ HNQLQ  + V F  L++LSTLD SFNSL G++PQT SSL++++ MYLQNN FTGTI
Sbjct  141  LNLGHNQLQQALNVDFQKLSSLSTLDLSFNSLTGDLPQTMSSLSSIRTMYLQNNQFTGTI  200

Query  721  DVLANLPLDNL  753
            DVLANLPL  L
Sbjct  201  DVLANLPLGTL  211



>gb|KCW77015.1| hypothetical protein EUGRSUZ_D01360 [Eucalyptus grandis]
Length=696

 Score =   219 bits (557),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 107/214 (50%), Positives = 150/214 (70%), Gaps = 4/214 (2%)
 Frame = +1

Query  124  WAVALLIGFLLNAPPSAV----ADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGES  291
            +AV    GFL+ A  SA+      TDP+D   L+ L++SLNSP QLT W ++GGDPC ES
Sbjct  11   FAVHFRSGFLVLAVISALRGARGTTDPSDVQALQTLYTSLNSPSQLTNWKSSGGDPCAES  70

Query  292  WKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKL  471
            WKG++C G+ V  I++SGL L G+MG+ L  L S+  FD+S NN+ + +PYQLPPN+  L
Sbjct  71   WKGITCEGSAVVSIEVSGLGLNGTMGYLLTNLVSLKKFDLSNNNIHDGIPYQLPPNLTNL  130

Query  472  NLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIP  651
            NLAGN  TG LPYSIS M  L Y+NVS N L   +  +F +++NL+T DFS+N+ +G++P
Sbjct  131  NLAGNNLTGNLPYSISNMVNLNYMNVSRNSLSLSLGDIFANVSNLTTADFSYNNFSGDLP  190

Query  652  QTFSSLTNMKNMYLQNNVFTGTIDVLANLPLDNL  753
             +FS+L N+ ++Y+QNN  TG+++VL  LPL  L
Sbjct  191  ASFSALANLSSLYMQNNQLTGSLNVLVGLPLTTL  224



>gb|KJB69229.1| hypothetical protein B456_011G011800 [Gossypium raimondii]
Length=537

 Score =   216 bits (549),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 105/206 (51%), Positives = 149/206 (72%), Gaps = 0/206 (0%)
 Frame = +1

Query  136  LLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSG  315
            +L+G +++    A   TD TD   L+ L++SLNSP +LT W ++G DPC ESWKGV+C G
Sbjct  26   ILLGLMISVFIPAQCFTDATDVQALQVLYTSLNSPTELTNWNSDGNDPCEESWKGVACEG  85

Query  316  NRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFT  495
            + V  I +SGL L+G+MG+ L+ L S+ T D+S NN+ +++PYQLPPN+  LN+AGN  +
Sbjct  86   SAVVSIDVSGLGLSGTMGYLLNDLMSLKTLDLSNNNIHDTIPYQLPPNLTSLNVAGNNLS  145

Query  496  GGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTN  675
            G LPYSIS M  L YLNVS N L   V  +F +LT+L TLD SFN+ +G++P +FSSLTN
Sbjct  146  GSLPYSISTMVTLTYLNVSFNSLSPSVGDVFANLTDLGTLDLSFNNFSGDLPVSFSSLTN  205

Query  676  MKNMYLQNNVFTGTIDVLANLPLDNL  753
            +  +Y+QNN F+G+++VL+ LPL+ L
Sbjct  206  LSALYMQNNQFSGSLNVLSGLPLNTL  231



>ref|XP_010537758.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010537760.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5 isoform X3 [Tarenaya 
hassleriana]
Length=700

 Score =   218 bits (556),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 99/208 (48%), Positives = 149/208 (72%), Gaps = 7/208 (3%)
 Frame = +1

Query  130  VALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSC  309
            +A+ + F+        A TD  + S L  +F+SLNSP +L  W ++GGDPC ++W G+ C
Sbjct  15   IAVFVAFVR-------AKTDSQEVSALNVMFTSLNSPSKLKGWKSSGGDPCNDAWDGIKC  67

Query  310  SGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNG  489
             GN+V EIQ+S LQL+GS+G+QL  LKS+TT D+S N L  ++PYQLPPN+  L+ + N 
Sbjct  68   DGNKVIEIQLSELQLSGSLGYQLSNLKSLTTLDLSKNKLSGNMPYQLPPNIVHLDFSENE  127

Query  490  FTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSL  669
              G +PYS+SQM  L+ +N+ HN+L+G++  MF  L+ L +LD SFN L+GN+PQ+F++L
Sbjct  128  IDGNVPYSLSQMNHLQSVNLGHNKLEGDLQDMFQKLSKLESLDLSFNQLSGNLPQSFANL  187

Query  670  TNMKNMYLQNNVFTGTIDVLANLPLDNL  753
            T++K ++LQ N F G+I++L +LPLD+L
Sbjct  188  TSLKKLHLQENKFKGSINMLRDLPLDDL  215



>ref|XP_010052883.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8 isoform X1 [Eucalyptus 
grandis]
 gb|KCW77013.1| hypothetical protein EUGRSUZ_D01360 [Eucalyptus grandis]
Length=721

 Score =   218 bits (556),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 107/214 (50%), Positives = 150/214 (70%), Gaps = 4/214 (2%)
 Frame = +1

Query  124  WAVALLIGFLLNAPPSAV----ADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGES  291
            +AV    GFL+ A  SA+      TDP+D   L+ L++SLNSP QLT W ++GGDPC ES
Sbjct  11   FAVHFRSGFLVLAVISALRGARGTTDPSDVQALQTLYTSLNSPSQLTNWKSSGGDPCAES  70

Query  292  WKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKL  471
            WKG++C G+ V  I++SGL L G+MG+ L  L S+  FD+S NN+ + +PYQLPPN+  L
Sbjct  71   WKGITCEGSAVVSIEVSGLGLNGTMGYLLTNLVSLKKFDLSNNNIHDGIPYQLPPNLTNL  130

Query  472  NLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIP  651
            NLAGN  TG LPYSIS M  L Y+NVS N L   +  +F +++NL+T DFS+N+ +G++P
Sbjct  131  NLAGNNLTGNLPYSISNMVNLNYMNVSRNSLSLSLGDIFANVSNLTTADFSYNNFSGDLP  190

Query  652  QTFSSLTNMKNMYLQNNVFTGTIDVLANLPLDNL  753
             +FS+L N+ ++Y+QNN  TG+++VL  LPL  L
Sbjct  191  ASFSALANLSSLYMQNNQLTGSLNVLVGLPLTTL  224



>ref|XP_010052884.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8 isoform X2 [Eucalyptus 
grandis]
 gb|KCW77014.1| hypothetical protein EUGRSUZ_D01360 [Eucalyptus grandis]
Length=720

 Score =   218 bits (556),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 107/214 (50%), Positives = 150/214 (70%), Gaps = 4/214 (2%)
 Frame = +1

Query  124  WAVALLIGFLLNAPPSAV----ADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGES  291
            +AV    GFL+ A  SA+      TDP+D   L+ L++SLNSP QLT W ++GGDPC ES
Sbjct  11   FAVHFRSGFLVLAVISALRGARGTTDPSDVQALQTLYTSLNSPSQLTNWKSSGGDPCAES  70

Query  292  WKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKL  471
            WKG++C G+ V  I++SGL L G+MG+ L  L S+  FD+S NN+ + +PYQLPPN+  L
Sbjct  71   WKGITCEGSAVVSIEVSGLGLNGTMGYLLTNLVSLKKFDLSNNNIHDGIPYQLPPNLTNL  130

Query  472  NLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIP  651
            NLAGN  TG LPYSIS M  L Y+NVS N L   +  +F +++NL+T DFS+N+ +G++P
Sbjct  131  NLAGNNLTGNLPYSISNMVNLNYMNVSRNSLSLSLGDIFANVSNLTTADFSYNNFSGDLP  190

Query  652  QTFSSLTNMKNMYLQNNVFTGTIDVLANLPLDNL  753
             +FS+L N+ ++Y+QNN  TG+++VL  LPL  L
Sbjct  191  ASFSALANLSSLYMQNNQLTGSLNVLVGLPLTTL  224



>ref|XP_003604115.1| Protein STRUBBELIG-RECEPTOR FAMILY [Medicago truncatula]
 gb|AES86312.1| strubbelig-receptor family 6 protein [Medicago truncatula]
Length=790

 Score =   219 bits (558),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 106/218 (49%), Positives = 151/218 (69%), Gaps = 0/218 (0%)
 Frame = +1

Query  100  MRELMGLPWAVALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDP  279
            +R+ M +   ++ L   +L +  S    T   D S L  +++SLNSP QL+ W ++GGDP
Sbjct  87   LRKKMHINHNLSWLWIIVLISTASVQCKTSSQDVSALNVMYTSLNSPSQLSGWKSSGGDP  146

Query  280  CGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPN  459
            CGE+W+G+ CSG+ VTEI +S L L+GS+G+QL QL SVT FD+S NN    +PYQLPPN
Sbjct  147  CGENWEGIKCSGSSVTEINLSDLGLSGSLGYQLSQLTSVTDFDLSNNNFKGDIPYQLPPN  206

Query  460  VQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLA  639
             + ++L+ N FTG +PYSI QM  L  LN++HN+L  ++  MF +LT L  LD SFNSL+
Sbjct  207  ARNVDLSKNAFTGNIPYSIGQMKELTSLNLAHNKLNNQLGDMFTTLTKLKQLDVSFNSLS  266

Query  640  GNIPQTFSSLTNMKNMYLQNNVFTGTIDVLANLPLDNL  753
            G +PQ+  S T++K +YLQNN  +G+I+VLA  PLD++
Sbjct  267  GELPQSLKSATSLKKIYLQNNQLSGSINVLAYPPLDDV  304



>ref|XP_003562663.2| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7-like isoform 
X3 [Brachypodium distachyon]
Length=1217

 Score =   222 bits (565),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 111/215 (52%), Positives = 156/215 (73%), Gaps = 4/215 (2%)
 Frame = +1

Query  112  MGLPWAVALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGES  291
            +G+   V LL  FL  A   A A+TD  D + L   ++++NSPPQL  W +   DPCG+S
Sbjct  14   VGIGAGVVLL--FLATASLGANANTDSNDVTALNVFYTTMNSPPQLKNWVSQNADPCGQS  71

Query  292  WKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNS-LPYQLPPNVQK  468
            W G++C G+RVT I++SG+ L G++G+ ++ L ++   D+S NNLG S +PY LPPN++K
Sbjct  72   WNGITCLGSRVTTIKLSGMGLNGTLGYNMNLLTALVQLDMSNNNLGGSDIPYNLPPNLEK  131

Query  469  LNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNI  648
            LNLAGN FTG  PYSISQM  L+ LN++HNQ+   ++ MF  LTNL+T+D S+N+ + NI
Sbjct  132  LNLAGNHFTGTTPYSISQMFALKDLNLAHNQI-STISDMFNQLTNLTTMDLSYNAFSANI  190

Query  649  PQTFSSLTNMKNMYLQNNVFTGTIDVLANLPLDNL  753
            PQ+F+SLT++  +YLQNN F+GTIDVLANLPL +L
Sbjct  191  PQSFNSLTSLTTLYLQNNQFSGTIDVLANLPLTDL  225



>ref|XP_009106613.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5 [Brassica rapa]
Length=692

 Score =   218 bits (554),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 99/194 (51%), Positives = 143/194 (74%), Gaps = 0/194 (0%)
 Frame = +1

Query  172  AVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQ  351
            A A T+  + S L  +F+SLNSPP+L  W ++GGDPC  SW+GV C G+ VTE+Q+SG +
Sbjct  16   AHAKTEKQEVSALNVMFTSLNSPPKLKGWKSSGGDPCDGSWEGVKCKGSSVTELQLSGYE  75

Query  352  LTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAP  531
            L+GS+G+ L  LKS+TTFD+S NNL  ++PYQLPPN+  L+ + N   G +PYS+SQM  
Sbjct  76   LSGSLGYLLSNLKSLTTFDLSKNNLKGNIPYQLPPNIANLDFSDNELDGNVPYSLSQMNK  135

Query  532  LEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFT  711
            L+ +N+  N+L GE++ MF  L+ L T+DFS N L+G +P +F++LT++K ++LQ N FT
Sbjct  136  LKSINLGQNKLDGELSDMFQKLSKLETVDFSLNKLSGKLPHSFANLTSLKKLHLQENRFT  195

Query  712  GTIDVLANLPLDNL  753
            G I+VL NLP+D+L
Sbjct  196  GDINVLRNLPIDDL  209



>emb|CDX87418.1| BnaA07g34550D [Brassica napus]
Length=692

 Score =   218 bits (554),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 99/194 (51%), Positives = 143/194 (74%), Gaps = 0/194 (0%)
 Frame = +1

Query  172  AVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQ  351
            A A T+  + S L  +F+SLNSPP+L  W ++GGDPC  SW+GV C G+ VTE+Q+SG +
Sbjct  16   AHAKTEKQEVSALNVMFTSLNSPPKLKGWKSSGGDPCDGSWEGVKCKGSSVTELQLSGYE  75

Query  352  LTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAP  531
            L+GS+G+ L  LKS+TTFD+S NNL  ++PYQLPPN+  L+ + N   G +PYS+SQM  
Sbjct  76   LSGSLGYLLSNLKSLTTFDLSKNNLKGNIPYQLPPNIANLDFSDNELDGNVPYSLSQMNK  135

Query  532  LEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFT  711
            L+ +N+  N+L GE++ MF  L+ L T+DFS N L+G +P +F++LT++K ++LQ N FT
Sbjct  136  LKSINLGQNKLDGELSDMFQKLSKLETVDFSLNKLSGKLPHSFANLTSLKKLHLQENRFT  195

Query  712  GTIDVLANLPLDNL  753
            G I+VL NLP+D+L
Sbjct  196  GDINVLRNLPIDDL  209



>ref|XP_007135873.1| hypothetical protein PHAVU_010G165200g [Phaseolus vulgaris]
 gb|ESW07867.1| hypothetical protein PHAVU_010G165200g [Phaseolus vulgaris]
Length=689

 Score =   218 bits (554),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 110/206 (53%), Positives = 146/206 (71%), Gaps = 0/206 (0%)
 Frame = +1

Query  136  LLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSG  315
            L +  L  +  S    T   D + L  ++SSLNSP +L+ W ++GGDPCGESWKG+ CSG
Sbjct  10   LWLALLAVSTTSVHCKTSSEDVAALNVMYSSLNSPSKLSGWKSSGGDPCGESWKGIKCSG  69

Query  316  NRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFT  495
            + VTEI +S + L+GS G+QL  L SVT FD+S NNL   +PYQLPP  + ++L+ NGFT
Sbjct  70   SSVTEINLSDMGLSGSTGYQLSSLSSVTYFDLSNNNLKGDIPYQLPPKARHIDLSNNGFT  129

Query  496  GGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTN  675
            G +P+S+SQM  L  LN+ HNQLQ ++  MF  LT L  LD SFNSL+GN+PQ+  SL N
Sbjct  130  GSIPFSVSQMDELSQLNLGHNQLQNQLGDMFEKLTKLKLLDVSFNSLSGNLPQSLKSLKN  189

Query  676  MKNMYLQNNVFTGTIDVLANLPLDNL  753
            +K ++LQNN FTG+I+VLANLPL+ L
Sbjct  190  LKKLHLQNNQFTGSINVLANLPLEEL  215



>emb|CDX88495.1| BnaC06g39390D [Brassica napus]
Length=692

 Score =   217 bits (553),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 103/208 (50%), Positives = 148/208 (71%), Gaps = 0/208 (0%)
 Frame = +1

Query  130  VALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSC  309
            + LLI  L      A A T+  + S L  +F+SLNSPP+L  W ++GGDPC  SW+GV C
Sbjct  2    MRLLIASLAIIVTLAHAKTEKQEVSALNVMFTSLNSPPKLKGWKSSGGDPCDGSWEGVKC  61

Query  310  SGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNG  489
             G+ VTE+Q+SG +L+GS+G+ L  LKS+TTFD+S NNL  ++PYQLPPN+  L+ + N 
Sbjct  62   KGSSVTELQLSGYELSGSLGYLLSNLKSLTTFDLSKNNLKGNIPYQLPPNIANLDFSENE  121

Query  490  FTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSL  669
              G +PYS+SQM  L+ +N+  N+L GE++ MF  L+ L T+DFS N L+G +PQ+F++L
Sbjct  122  LDGNVPYSLSQMNKLKSINLGQNKLDGELSDMFQKLSKLETVDFSLNKLSGKLPQSFANL  181

Query  670  TNMKNMYLQNNVFTGTIDVLANLPLDNL  753
            T++K ++LQ N F G I+VL NLP+D+L
Sbjct  182  TSLKKLHLQENRFKGDINVLRNLPIDDL  209



>ref|XP_010913801.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5-like isoform 
X3 [Elaeis guineensis]
Length=589

 Score =   216 bits (549),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 111/194 (57%), Positives = 143/194 (74%), Gaps = 0/194 (0%)
 Frame = +1

Query  172  AVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQ  351
            + A+TD  D S L  LF SLNSPPQLT W++ GGDPCG+ WKGV CS + VTEI +SGL 
Sbjct  19   SFAETDQDDVSALNVLFKSLNSPPQLTGWSSTGGDPCGDDWKGVKCSDSSVTEISLSGLG  78

Query  352  LTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAP  531
            LTG +G+QL  L SVT FD+S NNL   +PYQLPP V+ LNLA N FTGG+PYSISQM  
Sbjct  79   LTGLLGYQLSSLTSVTYFDMSKNNLKGDIPYQLPPKVEHLNLAENAFTGGIPYSISQMTD  138

Query  532  LEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFT  711
            +EY+N+  NQL G++  +F  L+ LS +  SFN L+GN+P +  SL  +K ++LQNN  +
Sbjct  139  IEYINLQRNQLNGQLNDVFGKLSRLSEMYLSFNQLSGNLPPSLRSLKGLKTLHLQNNQLS  198

Query  712  GTIDVLANLPLDNL  753
            G+I+VLANLPL++L
Sbjct  199  GSINVLANLPLEDL  212



>gb|EEC85048.1| hypothetical protein OsI_32379 [Oryza sativa Indica Group]
Length=677

 Score =   217 bits (552),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 104/192 (54%), Positives = 140/192 (73%), Gaps = 2/192 (1%)
 Frame = +1

Query  184  TDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGE--SWKGVSCSGNRVTEIQISGLQLT  357
            TD  D + L  +F S+N P +L  W A+GGDPCG+   WKG+ CS + VTEI++SGL L+
Sbjct  31   TDQPDVAALNVMFESMNKPSELLGWKASGGDPCGDDDEWKGIECSDSSVTEIKLSGLGLS  90

Query  358  GSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLE  537
            G++G+QL  LKSVT FD+S NNL   +PYQLPPNV +LNL GN F+GG+PYSISQM  LE
Sbjct  91   GTLGYQLSSLKSVTKFDVSKNNLNGEIPYQLPPNVVQLNLRGNAFSGGVPYSISQMTDLE  150

Query  538  YLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGT  717
             LN+  NQL G++T MF  L  L+T+D SFNS +GN+P +F  L N+K + +++N F+G 
Sbjct  151  TLNLGKNQLSGQLTDMFSQLPKLTTMDLSFNSFSGNLPPSFQYLKNLKTLDVESNQFSGH  210

Query  718  IDVLANLPLDNL  753
            I+VLA L L++L
Sbjct  211  INVLAKLSLEDL  222



>ref|NP_001060286.1| Os07g0618400 [Oryza sativa Japonica Group]
 dbj|BAF22200.1| Os07g0618400 [Oryza sativa Japonica Group]
Length=732

 Score =   218 bits (554),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 107/193 (55%), Positives = 144/193 (75%), Gaps = 2/193 (1%)
 Frame = +1

Query  178  ADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLT  357
            A+TD  D + L  L++S+NSP QLT W +  GDPCG+SW G++CSG+RVT I++SG+ + 
Sbjct  33   ANTDSDDVNALNVLYTSMNSPSQLTNWVSQNGDPCGQSWLGITCSGSRVTAIKLSGMGIN  92

Query  358  GSMGFQLDQLKSVTTFDISTNNLGNS-LPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPL  534
            G++G+ ++ L S+   D S NNLG S +PY LPPN+++LNLA N FTG +PYSISQM  L
Sbjct  93   GTLGYNMNLLTSLVELDTSKNNLGGSDIPYNLPPNLERLNLAENNFTGSIPYSISQMIAL  152

Query  535  EYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTG  714
              LN+ HN L      MF  LTNL+TLD S+N+L+GNIPQ+F+SLTN++ + LQNN F G
Sbjct  153  RILNLGHNHL-ATTNDMFNQLTNLTTLDLSYNTLSGNIPQSFNSLTNLRKLNLQNNGFNG  211

Query  715  TIDVLANLPLDNL  753
            TIDVLA+LPL +L
Sbjct  212  TIDVLADLPLTDL  224



>gb|EYU33875.1| hypothetical protein MIMGU_mgv1a002066mg [Erythranthe guttata]
Length=720

 Score =   218 bits (554),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 105/192 (55%), Positives = 140/192 (73%), Gaps = 0/192 (0%)
 Frame = +1

Query  178  ADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLT  357
            A TDP+D   L+ L++SLNSP QLT W ++GGDPCGESWKG++C G+ V  IQISGL +T
Sbjct  31   AATDPSDVQGLQVLYTSLNSPSQLTGWKSSGGDPCGESWKGITCQGSSVVSIQISGLGIT  90

Query  358  GSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLE  537
            GSMG+ L  L S+ T D+S NN+ +S+PYQLPPN+  LNLAGN FTG +PYSI+ M  L 
Sbjct  91   GSMGYLLSNLASLKTLDMSNNNIHDSIPYQLPPNLTSLNLAGNNFTGNIPYSIATMGSLN  150

Query  538  YLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGT  717
            YLN+S N L   +  MF + + L+TLD S NS  G++P +F+SL+N+  + +QNN  TG+
Sbjct  151  YLNISRNMLSQGIGDMFANHSALATLDLSSNSFTGDLPPSFTSLSNLSTLQVQNNQLTGS  210

Query  718  IDVLANLPLDNL  753
            ++VL  LPL NL
Sbjct  211  LNVLVGLPLTNL  222



>dbj|BAC10113.1| putative leucine-rich repeat transmembrane protein kinase 2 [Oryza 
sativa Japonica Group]
 dbj|BAC16030.1| putative leucine-rich repeat transmembrane protein kinase 2 [Oryza 
sativa Japonica Group]
 dbj|BAC21507.1| putative leucine-rich repeat transmembrane protein kinase 2 [Oryza 
sativa Japonica Group]
Length=720

 Score =   217 bits (553),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 110/210 (52%), Positives = 149/210 (71%), Gaps = 2/210 (1%)
 Frame = +1

Query  127  AVALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVS  306
            A   ++ FL        A+TD  D + L  L++S+NSP QLT W +  GDPCG+SW G++
Sbjct  4    ATGAVMLFLAATLSGVSANTDSDDVNALNVLYTSMNSPSQLTNWVSQNGDPCGQSWLGIT  63

Query  307  CSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNS-LPYQLPPNVQKLNLAG  483
            CSG+RVT I++SG+ + G++G+ ++ L S+   D S NNLG S +PY LPPN+++LNLA 
Sbjct  64   CSGSRVTAIKLSGMGINGTLGYNMNLLTSLVELDTSKNNLGGSDIPYNLPPNLERLNLAE  123

Query  484  NGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFS  663
            N FTG +PYSISQM  L  LN+ HN L      MF  LTNL+TLD S+N+L+GNIPQ+F+
Sbjct  124  NNFTGSIPYSISQMIALRILNLGHNHL-ATTNDMFNQLTNLTTLDLSYNTLSGNIPQSFN  182

Query  664  SLTNMKNMYLQNNVFTGTIDVLANLPLDNL  753
            SLTN++ + LQNN F GTIDVLA+LPL +L
Sbjct  183  SLTNLRKLNLQNNGFNGTIDVLADLPLTDL  212



>gb|EEC82450.1| hypothetical protein OsI_26884 [Oryza sativa Indica Group]
Length=720

 Score =   217 bits (553),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 110/210 (52%), Positives = 148/210 (70%), Gaps = 2/210 (1%)
 Frame = +1

Query  127  AVALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVS  306
            A   ++ FL        A TD  D + L  L++S+NSP QLT W +  GDPCG+SW G++
Sbjct  4    ATGAVMLFLAATLSGVSAHTDSDDVNALNVLYTSMNSPSQLTNWVSQNGDPCGQSWLGIT  63

Query  307  CSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNS-LPYQLPPNVQKLNLAG  483
            CSG+RVT I++SG+ + G++G+ ++ L S+   D S NNLG S +PY LPPN+++LNLA 
Sbjct  64   CSGSRVTAIKLSGMGINGTLGYNMNLLTSLVELDTSKNNLGGSDIPYNLPPNLERLNLAE  123

Query  484  NGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFS  663
            N FTG +PYSISQM  L  LN+ HN L      MF  LTNL+TLD S+N+L+GNIPQ+F+
Sbjct  124  NNFTGSIPYSISQMIALRILNLGHNHL-ATTNDMFNQLTNLTTLDLSYNTLSGNIPQSFN  182

Query  664  SLTNMKNMYLQNNVFTGTIDVLANLPLDNL  753
            SLTN++ + LQNN F GTIDVLA+LPL +L
Sbjct  183  SLTNLRKLNLQNNGFNGTIDVLADLPLTDL  212



>gb|ADM07445.1| leucine-rich repeat receptor-like protein kinase [Glycine soja]
Length=714

 Score =   217 bits (553),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 115/191 (60%), Positives = 146/191 (76%), Gaps = 3/191 (2%)
 Frame = +1

Query  181  DTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTG  360
            DTDP D + L+ LF S+NSP QL  W  NG DPCG+SW+G++CSGNRVTEI++ G  L+G
Sbjct  23   DTDPNDVTSLKVLFQSMNSPSQLN-W--NGDDPCGQSWQGITCSGNRVTEIKLPGRSLSG  79

Query  361  SMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  540
            S+G+QL+ L SVT  D+S NN+G ++PYQ PPN+Q LNLA N F G +PYS+S+   L  
Sbjct  80   SLGYQLEPLSSVTNLDLSNNNIGGTIPYQFPPNLQYLNLANNNFNGAIPYSLSEKTSLVI  139

Query  541  LNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTI  720
            LN+ HNQLQ  + V F  L++LSTLD SFNSL G++PQT SSL++++ MYLQNN FTGTI
Sbjct  140  LNLGHNQLQQALNVDFQKLSSLSTLDLSFNSLTGDLPQTMSSLSSIRTMYLQNNQFTGTI  199

Query  721  DVLANLPLDNL  753
            DVLANLPL  L
Sbjct  200  DVLANLPLGTL  210



>ref|XP_011460016.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8 [Fragaria vesca 
subsp. vesca]
Length=730

 Score =   217 bits (553),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 105/206 (51%), Positives = 144/206 (70%), Gaps = 1/206 (0%)
 Frame = +1

Query  136  LLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSG  315
            +L+G +  A P     TD +D   L+ +++S+NSPPQLT W ++GGDPCGESWKGV+C G
Sbjct  31   VLLGLVFAALPRISGTTDASDVQALQVMYTSVNSPPQLTNWKSSGGDPCGESWKGVTCEG  90

Query  316  NRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFT  495
              V  I++SGL L+G+MG+ L  L S+  FD+S NN  + +PYQLPPN+  LNLA N F+
Sbjct  91   TAVVAIEVSGLGLSGTMGYLLSDLLSLRKFDLSDNNFHDIIPYQLPPNLTSLNLARNNFS  150

Query  496  GGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTN  675
            G LPYSIS M  L YLNVSHN L   +  +F +L+ L+TLD S N+ +G+IP +FSSL+N
Sbjct  151  GNLPYSISAMGSLNYLNVSHNSLSQSIQDIFANLS-LATLDLSLNNFSGDIPVSFSSLSN  209

Query  676  MKNMYLQNNVFTGTIDVLANLPLDNL  753
            +  +Y+QNN  TG+++ L  LPL  L
Sbjct  210  LSALYVQNNQLTGSLNALTGLPLTTL  235



>ref|XP_006657962.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7-like [Oryza brachyantha]
Length=721

 Score =   217 bits (553),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 107/195 (55%), Positives = 145/195 (74%), Gaps = 2/195 (1%)
 Frame = +1

Query  172  AVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQ  351
            A A+TD  D + L  L++S+NSP  LT W +  GDPCG+SW G++CS +RVT I++SG++
Sbjct  20   ASANTDSDDVNALNVLYTSMNSPALLTNWVSQNGDPCGQSWLGITCSNSRVTTIKLSGMR  79

Query  352  LTGSMGFQLDQLKSVTTFDISTNNLGNS-LPYQLPPNVQKLNLAGNGFTGGLPYSISQMA  528
            L G++G+ ++ L ++   D S NNLG S +PY LPPN+++LNLA N FTG +PYSISQM 
Sbjct  80   LNGTLGYNMNLLTALVELDTSKNNLGGSDIPYNLPPNLERLNLAENNFTGSIPYSISQMI  139

Query  529  PLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVF  708
             L  LN+ HN L      MF  LTNL+TLD S+NSL+GNIPQ+F+SLT+++ +YLQNN F
Sbjct  140  ALRILNLGHNHLT-TTNDMFNQLTNLTTLDLSYNSLSGNIPQSFNSLTSLRKLYLQNNRF  198

Query  709  TGTIDVLANLPLDNL  753
             GTIDVLA+LPL +L
Sbjct  199  NGTIDVLADLPLTDL  213



>gb|EEC81030.1| hypothetical protein OsI_23812 [Oryza sativa Indica Group]
Length=712

 Score =   217 bits (552),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 109/191 (57%), Positives = 141/191 (74%), Gaps = 0/191 (0%)
 Frame = +1

Query  181  DTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTG  360
            DTD  DA+ L  L+SS NSP QLT W+A GGDPCG +W GVSC G+ VT I++SG+ L G
Sbjct  21   DTDGGDAAALGNLYSSWNSPAQLTGWSAGGGDPCGAAWMGVSCVGSAVTSIKLSGMGLNG  80

Query  361  SMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  540
            ++G+QL  L ++ T D+S+NNL +S+PYQLPPN+  LNLAGN F+G LPYSIS M  L Y
Sbjct  81   TLGYQLSNLLALKTMDLSSNNLHDSIPYQLPPNLAYLNLAGNNFSGNLPYSISNMVSLNY  140

Query  541  LNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTI  720
            LN+SHN L  E+  MF +LT LS LD SFN+L GN+P +  SL+N+  +YLQNN  +GT+
Sbjct  141  LNLSHNLLFQEIGEMFGNLTALSELDVSFNNLNGNLPISLRSLSNISGIYLQNNQLSGTV  200

Query  721  DVLANLPLDNL  753
            +VL+NL L  L
Sbjct  201  NVLSNLSLTTL  211



>gb|KEH18524.1| strubbelig-receptor family 6 protein [Medicago truncatula]
Length=685

 Score =   216 bits (551),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 109/184 (59%), Positives = 134/184 (73%), Gaps = 3/184 (2%)
 Frame = +1

Query  202  SVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLD  381
            S L  LF S+NSP QL  W  NG DPCG+SW G++CSGNR+TEI++ G QLTG++GFQL 
Sbjct  2    SALMALFQSMNSPSQLN-W--NGNDPCGQSWTGITCSGNRITEIKLPGRQLTGTLGFQLQ  58

Query  382  QLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQ  561
             L SVT  D+S NNL  +LPYQ PPN+Q LNLA N F GG+PYS S    L  LN  HNQ
Sbjct  59   SLSSVTNLDLSNNNLAGTLPYQFPPNLQHLNLANNNFNGGIPYSFSDTPSLISLNFGHNQ  118

Query  562  LQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTIDVLANLP  741
             Q  + + F  LT+L+T D SFNSL G++PQT +SL+++  M LQNN FTGTID+LA+LP
Sbjct  119  FQQALNLNFQKLTSLTTFDVSFNSLTGDLPQTMNSLSSISTMNLQNNQFTGTIDILADLP  178

Query  742  LDNL  753
            LDNL
Sbjct  179  LDNL  182



>ref|XP_004985465.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like isoform 
X2 [Setaria italica]
Length=722

 Score =   217 bits (553),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 109/197 (55%), Positives = 152/197 (77%), Gaps = 3/197 (2%)
 Frame = +1

Query  172  AVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQ  351
            A ADTDP+D +VL  LF+SLNSP QL  W ANGGDPCG+SWKG++CSG+ VT+I +S L 
Sbjct  38   AAADTDPSDLNVLNTLFTSLNSPGQLNGWQANGGDPCGQSWKGITCSGSGVTKILLSNLG  97

Query  352  LTGSMGFQLDQLKSVTTFDISTNNLG--NSLPYQLPP-NVQKLNLAGNGFTGGLPYSISQ  522
            L+G++ + ++ L S+   D+S N+LG  + + Y LP   +++LNLAGN F G LPYSIS 
Sbjct  98   LSGNLAYNMNNLGSLVELDMSQNSLGGGSQIQYNLPYMKLERLNLAGNQFGGNLPYSIST  157

Query  523  MAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNN  702
            M  L+YLN++HNQLQG ++ +F SL +L+ +D SFNSL G++PQ+F+ L+++K++YLQNN
Sbjct  158  MTNLKYLNLNHNQLQGNISDVFSSLYSLTDVDLSFNSLTGDLPQSFTGLSSLKHLYLQNN  217

Query  703  VFTGTIDVLANLPLDNL  753
             FTG I+VLANLPL+ L
Sbjct  218  QFTGYINVLANLPLEAL  234



>gb|KJB69230.1| hypothetical protein B456_011G011800 [Gossypium raimondii]
Length=684

 Score =   216 bits (550),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 105/206 (51%), Positives = 149/206 (72%), Gaps = 0/206 (0%)
 Frame = +1

Query  136  LLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSG  315
            +L+G +++    A   TD TD   L+ L++SLNSP +LT W ++G DPC ESWKGV+C G
Sbjct  26   ILLGLMISVFIPAQCFTDATDVQALQVLYTSLNSPTELTNWNSDGNDPCEESWKGVACEG  85

Query  316  NRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFT  495
            + V  I +SGL L+G+MG+ L+ L S+ T D+S NN+ +++PYQLPPN+  LN+AGN  +
Sbjct  86   SAVVSIDVSGLGLSGTMGYLLNDLMSLKTLDLSNNNIHDTIPYQLPPNLTSLNVAGNNLS  145

Query  496  GGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTN  675
            G LPYSIS M  L YLNVS N L   V  +F +LT+L TLD SFN+ +G++P +FSSLTN
Sbjct  146  GSLPYSISTMVTLTYLNVSFNSLSPSVGDVFANLTDLGTLDLSFNNFSGDLPVSFSSLTN  205

Query  676  MKNMYLQNNVFTGTIDVLANLPLDNL  753
            +  +Y+QNN F+G+++VL+ LPL+ L
Sbjct  206  LSALYMQNNQFSGSLNVLSGLPLNTL  231



>ref|XP_010913799.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5-like isoform 
X1 [Elaeis guineensis]
Length=685

 Score =   216 bits (550),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 111/194 (57%), Positives = 143/194 (74%), Gaps = 0/194 (0%)
 Frame = +1

Query  172  AVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQ  351
            + A+TD  D S L  LF SLNSPPQLT W++ GGDPCG+ WKGV CS + VTEI +SGL 
Sbjct  19   SFAETDQDDVSALNVLFKSLNSPPQLTGWSSTGGDPCGDDWKGVKCSDSSVTEISLSGLG  78

Query  352  LTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAP  531
            LTG +G+QL  L SVT FD+S NNL   +PYQLPP V+ LNLA N FTGG+PYSISQM  
Sbjct  79   LTGLLGYQLSSLTSVTYFDMSKNNLKGDIPYQLPPKVEHLNLAENAFTGGIPYSISQMTD  138

Query  532  LEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFT  711
            +EY+N+  NQL G++  +F  L+ LS +  SFN L+GN+P +  SL  +K ++LQNN  +
Sbjct  139  IEYINLQRNQLNGQLNDVFGKLSRLSEMYLSFNQLSGNLPPSLRSLKGLKTLHLQNNQLS  198

Query  712  GTIDVLANLPLDNL  753
            G+I+VLANLPL++L
Sbjct  199  GSINVLANLPLEDL  212



>ref|NP_001064502.1| Os10g0389800 [Oryza sativa Japonica Group]
 gb|AAO72637.1| putative leucine-rich repeat transmembrane protein kinase [Oryza 
sativa Japonica Group]
 gb|ABB47491.1| leucine-rich repeat transmembrane protein kinase, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF26416.1| Os10g0389800 [Oryza sativa Japonica Group]
 gb|EEE50892.1| hypothetical protein OsJ_31383 [Oryza sativa Japonica Group]
Length=719

 Score =   216 bits (551),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 107/196 (55%), Positives = 148/196 (76%), Gaps = 3/196 (2%)
 Frame = +1

Query  175  VADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQL  354
             A TD  D +VL  LF+SLNSP QL  W  NGGDPCG SW+G++CSG+ VT I++  L L
Sbjct  26   AATTDANDVTVLNALFTSLNSPGQLRGWQVNGGDPCGASWQGITCSGSSVTAIKLPSLGL  85

Query  355  TGSMGFQLDQLKSVTTFDISTNNLG--NSLPYQLP-PNVQKLNLAGNGFTGGLPYSISQM  525
            +G++ + ++ ++S+   D+S NNLG   ++ Y LP   +++LNLAGN F G +PYSIS M
Sbjct  86   SGNLAYNMNTMESLVELDMSQNNLGGGQNIQYNLPNKKLERLNLAGNQFAGNVPYSISTM  145

Query  526  APLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNV  705
              L+YLN++HNQLQG +T +F +L +LSTLD S NSL G++PQ+F+SL+++K +YLQNN 
Sbjct  146  PKLKYLNLNHNQLQGNMTDVFSNLPSLSTLDLSLNSLTGDLPQSFTSLSSLKTLYLQNNQ  205

Query  706  FTGTIDVLANLPLDNL  753
            FTG+I+VLANLPLDNL
Sbjct  206  FTGSINVLANLPLDNL  221



>gb|AAC27894.1| leucine-rich repeat transmembrane protein kinase 1 [Zea mays]
Length=684

 Score =   216 bits (550),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 110/192 (57%), Positives = 146/192 (76%), Gaps = 3/192 (2%)
 Frame = +1

Query  187  DPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSM  366
            DP D +VL  LF+SLNSP QLT W ANGGDPCG+SWKG++CSG+ VT+IQ+  L LTG++
Sbjct  1    DPNDLNVLNTLFTSLNSPGQLTGWQANGGDPCGQSWKGITCSGSGVTKIQLPNLSLTGNL  60

Query  367  GFQLDQLKSVTTFDISTNNLGN--SLPYQLPP-NVQKLNLAGNGFTGGLPYSISQMAPLE  537
             + ++ L S+   D+S NNLG    + Y LP   ++KLNLAGN F G LPYSIS M  L+
Sbjct  61   AYNMNNLGSLVELDMSQNNLGGGGQVQYNLPNMKLEKLNLAGNQFGGNLPYSISTMPNLK  120

Query  538  YLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGT  717
            YLN++HNQLQG ++ +F +L +LS LD SFNSL G++PQ+F+ L+++K +YLQNN FTG 
Sbjct  121  YLNLNHNQLQGNISDVFSNLYSLSELDLSFNSLTGDLPQSFTGLSSLKKVYLQNNQFTGN  180

Query  718  IDVLANLPLDNL  753
            I+VLANLPL+ L
Sbjct  181  INVLANLPLETL  192



>gb|KHG18134.1| protein strubbelig-receptor family 6 [Gossypium arboreum]
Length=721

 Score =   216 bits (550),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 116/215 (54%), Positives = 153/215 (71%), Gaps = 5/215 (2%)
 Frame = +1

Query  124  WAVALL-----IGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGE  288
            W  AL+     +  L   P   + +TD  DAS L  +++SLNSP QLT WTA+ GDPCG+
Sbjct  5    WKKALILVLFTVCILGFKPRCVIGETDQADASALGVMYTSLNSPQQLTGWTASNGDPCGQ  64

Query  289  SWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQK  468
            SWKGV+CS  RVTEI++S L L+GS+G+    L S+   D+S NN    +PY   PN+Q+
Sbjct  65   SWKGVTCSNKRVTEIKLSNLGLSGSVGYSFQSLTSLKELDLSHNNFAGDIPYFTLPNLQR  124

Query  469  LNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNI  648
            LNL  N FTG +P++ISQM  L+YLN++HNQLQ  +T MF  L++LSTLD SFNSL G +
Sbjct  125  LNLEYNQFTGSVPFAISQMPSLQYLNLAHNQLQNALTDMFGPLSSLSTLDLSFNSLNGGL  184

Query  649  PQTFSSLTNMKNMYLQNNVFTGTIDVLANLPLDNL  753
            P++F +LT++ +MYLQNN F+GTIDVLANLPLD L
Sbjct  185  PESFKNLTSINSMYLQNNQFSGTIDVLANLPLDTL  219



>gb|EEE70214.1| hypothetical protein OsJ_30326 [Oryza sativa Japonica Group]
Length=676

 Score =   216 bits (549),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 104/192 (54%), Positives = 139/192 (72%), Gaps = 2/192 (1%)
 Frame = +1

Query  184  TDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGE--SWKGVSCSGNRVTEIQISGLQLT  357
            TD  D + L  +F S+N P +L  W A+GGDPCG+   WKG+ CS + VTEI +SGL L+
Sbjct  29   TDQPDVAALNVMFESMNKPSELLGWKASGGDPCGDDDEWKGIECSDSSVTEINLSGLGLS  88

Query  358  GSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLE  537
            G++G+QL  LKSVT FD+S NNL   +PYQLPPNV +LNL GN F+GG+PYSISQM  LE
Sbjct  89   GTLGYQLSSLKSVTKFDVSKNNLNGEIPYQLPPNVVQLNLRGNAFSGGVPYSISQMTDLE  148

Query  538  YLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGT  717
             LN+  NQL G++T MF  L  L+T+D SFNS +GN+P +F  L N+K + +++N F+G 
Sbjct  149  TLNLGKNQLSGQLTDMFSQLPKLTTMDLSFNSFSGNLPPSFQYLKNLKTLDVESNQFSGH  208

Query  718  IDVLANLPLDNL  753
            I+VLA L L++L
Sbjct  209  INVLAKLSLEDL  220



>ref|NP_178019.2| STRUBBELIG-receptor family 5 [Arabidopsis thaliana]
 sp|Q6R2K1.1|SRF5_ARATH RecName: Full=Protein STRUBBELIG-RECEPTOR FAMILY 5; AltName: 
Full=Leucine-rich repeat receptor kinase-like protein SRF5; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAR99873.1| strubbelig receptor family 5 [Arabidopsis thaliana]
 gb|ACN59278.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AEE36188.1| STRUBBELIG-receptor family 5 [Arabidopsis thaliana]
Length=699

 Score =   216 bits (549),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 101/192 (53%), Positives = 140/192 (73%), Gaps = 0/192 (0%)
 Frame = +1

Query  178  ADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLT  357
            A TD  + S L  +F+SLNSP +L  W ANGGDPC +SW+GV C G+ VTE+Q+SG +L 
Sbjct  22   AKTDNQEVSALNVMFTSLNSPSKLKGWKANGGDPCEDSWEGVKCKGSSVTELQLSGFELG  81

Query  358  GSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLE  537
            GS G+ L  LKS+TTFD+S NNL  ++PYQLPPN+  L+ + N   G +PYS+SQM  L+
Sbjct  82   GSRGYLLSNLKSLTTFDLSKNNLKGNIPYQLPPNIANLDFSENELDGNVPYSLSQMKNLQ  141

Query  538  YLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGT  717
             +N+  N+L GE+  MF  L+ L TLDFS N L+G +PQ+F++LT++K ++LQ+N FTG 
Sbjct  142  SINLGQNKLNGELPDMFQKLSKLETLDFSLNKLSGKLPQSFANLTSLKKLHLQDNRFTGD  201

Query  718  IDVLANLPLDNL  753
            I+VL NL +D+L
Sbjct  202  INVLRNLAIDDL  213



>ref|NP_001063921.1| Os09g0559900 [Oryza sativa Japonica Group]
 dbj|BAF25835.1| Os09g0559900 [Oryza sativa Japonica Group]
Length=685

 Score =   216 bits (549),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 104/192 (54%), Positives = 139/192 (72%), Gaps = 2/192 (1%)
 Frame = +1

Query  184  TDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGE--SWKGVSCSGNRVTEIQISGLQLT  357
            TD  D + L  +F S+N P +L  W A+GGDPCG+   WKG+ CS + VTEI +SGL L+
Sbjct  53   TDQPDVAALNVMFESMNKPSELLGWKASGGDPCGDDDEWKGIECSDSSVTEINLSGLGLS  112

Query  358  GSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLE  537
            G++G+QL  LKSVT FD+S NNL   +PYQLPPNV +LNL GN F+GG+PYSISQM  LE
Sbjct  113  GTLGYQLSSLKSVTKFDVSKNNLNGEIPYQLPPNVVQLNLRGNAFSGGVPYSISQMTDLE  172

Query  538  YLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGT  717
             LN+  NQL G++T MF  L  L+T+D SFNS +GN+P +F  L N+K + +++N F+G 
Sbjct  173  TLNLGKNQLSGQLTDMFSQLPKLTTMDLSFNSFSGNLPPSFQYLKNLKTLDVESNQFSGH  232

Query  718  IDVLANLPLDNL  753
            I+VLA L L++L
Sbjct  233  INVLAKLSLEDL  244



>ref|XP_008649054.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like isoform 
X4 [Zea mays]
Length=719

 Score =   216 bits (550),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 103/192 (54%), Positives = 143/192 (74%), Gaps = 0/192 (0%)
 Frame = +1

Query  178  ADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLT  357
            ADTD  D + L  L+SS NSP QLT W+A+GGDPCG +W GVSCSG+ VT I++SG++L 
Sbjct  24   ADTDAGDVAALGNLYSSWNSPAQLTGWSASGGDPCGAAWAGVSCSGSAVTSIKLSGMELN  83

Query  358  GSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLE  537
            G++G+QL  L+++ T D+S N+L +S+PYQLP N+  LNLA N F+G LPYSIS +  LE
Sbjct  84   GTLGYQLSSLQALKTMDLSNNHLHDSIPYQLPSNLTYLNLAKNNFSGNLPYSISNLVSLE  143

Query  538  YLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGT  717
            YLN+SHN L  E+  +F SL +LS LD SFN+L GN+P +  +L+ + ++Y+QNN  +GT
Sbjct  144  YLNLSHNSLFQEIGELFGSLNSLSELDVSFNNLTGNLPFSMGALSKLSSLYMQNNQLSGT  203

Query  718  IDVLANLPLDNL  753
            +DVL+N+ L  L
Sbjct  204  VDVLSNISLATL  215



>ref|XP_008649053.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like isoform 
X3 [Zea mays]
Length=720

 Score =   216 bits (550),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 103/192 (54%), Positives = 143/192 (74%), Gaps = 0/192 (0%)
 Frame = +1

Query  178  ADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLT  357
            ADTD  D + L  L+SS NSP QLT W+A+GGDPCG +W GVSCSG+ VT I++SG++L 
Sbjct  24   ADTDAGDVAALGNLYSSWNSPAQLTGWSASGGDPCGAAWAGVSCSGSAVTSIKLSGMELN  83

Query  358  GSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLE  537
            G++G+QL  L+++ T D+S N+L +S+PYQLP N+  LNLA N F+G LPYSIS +  LE
Sbjct  84   GTLGYQLSSLQALKTMDLSNNHLHDSIPYQLPSNLTYLNLAKNNFSGNLPYSISNLVSLE  143

Query  538  YLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGT  717
            YLN+SHN L  E+  +F SL +LS LD SFN+L GN+P +  +L+ + ++Y+QNN  +GT
Sbjct  144  YLNLSHNSLFQEIGELFGSLNSLSELDVSFNNLTGNLPFSMGALSKLSSLYMQNNQLSGT  203

Query  718  IDVLANLPLDNL  753
            +DVL+N+ L  L
Sbjct  204  VDVLSNISLATL  215



>ref|XP_008653346.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like isoform 
X2 [Zea mays]
Length=687

 Score =   215 bits (548),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 102/180 (57%), Positives = 139/180 (77%), Gaps = 2/180 (1%)
 Frame = +1

Query  217  LFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSV  396
             ++++NSPPQLT W +  GDPCG+SW GV+CSG+RVT I++SG++L G++G+ ++QL ++
Sbjct  7    FYTTMNSPPQLTNWVSQNGDPCGQSWLGVTCSGSRVTAIKLSGMRLNGTLGYNMNQLTAL  66

Query  397  TTFDISTNNLGNS-LPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGE  573
               D+S NNLG S +PY LPPN+Q LNLA N FTG +PYSISQM  L  LN+ HNQL   
Sbjct  67   VQLDMSNNNLGGSDIPYNLPPNLQSLNLAVNNFTGTVPYSISQMVALRDLNLDHNQL-SN  125

Query  574  VTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTIDVLANLPLDNL  753
            +  MF  LTNL+TLD S+N+ +G+IP +F+SLT++K +YLQNN F GTIDVL +LPL +L
Sbjct  126  INDMFSQLTNLTTLDLSYNTFSGDIPHSFNSLTSLKTLYLQNNKFNGTIDVLTDLPLTDL  185



>gb|KJB69228.1| hypothetical protein B456_011G011800 [Gossypium raimondii]
Length=726

 Score =   216 bits (549),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 105/206 (51%), Positives = 149/206 (72%), Gaps = 0/206 (0%)
 Frame = +1

Query  136  LLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSG  315
            +L+G +++    A   TD TD   L+ L++SLNSP +LT W ++G DPC ESWKGV+C G
Sbjct  26   ILLGLMISVFIPAQCFTDATDVQALQVLYTSLNSPTELTNWNSDGNDPCEESWKGVACEG  85

Query  316  NRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFT  495
            + V  I +SGL L+G+MG+ L+ L S+ T D+S NN+ +++PYQLPPN+  LN+AGN  +
Sbjct  86   SAVVSIDVSGLGLSGTMGYLLNDLMSLKTLDLSNNNIHDTIPYQLPPNLTSLNVAGNNLS  145

Query  496  GGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTN  675
            G LPYSIS M  L YLNVS N L   V  +F +LT+L TLD SFN+ +G++P +FSSLTN
Sbjct  146  GSLPYSISTMVTLTYLNVSFNSLSPSVGDVFANLTDLGTLDLSFNNFSGDLPVSFSSLTN  205

Query  676  MKNMYLQNNVFTGTIDVLANLPLDNL  753
            +  +Y+QNN F+G+++VL+ LPL+ L
Sbjct  206  LSALYMQNNQFSGSLNVLSGLPLNTL  231



>gb|KJB70030.1| hypothetical protein B456_011G054100 [Gossypium raimondii]
Length=709

 Score =   215 bits (548),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 118/219 (54%), Positives = 155/219 (71%), Gaps = 5/219 (2%)
 Frame = +1

Query  112  MGLPWAVALLIGF----LLNAPPSAV-ADTDPTDASVLRGLFSSLNSPPQLTKWTANGGD  276
            M   W  AL++      +L   P  V  +TD  DAS L  +++SLNSP QLT WTA+ GD
Sbjct  1    MVKKWKKALILVLFTVCILGFKPRCVNGETDQADASALGVMYTSLNSPQQLTGWTASNGD  60

Query  277  PCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPP  456
            PCG+SWKGV+CS  RVTEI++S L L+GS+G+    L S+   D+S NN    +PY   P
Sbjct  61   PCGQSWKGVTCSNKRVTEIKLSNLGLSGSVGYSFQSLTSLKELDLSHNNFAGDIPYFTLP  120

Query  457  NVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSL  636
            N+Q+LNL  N FTG +P++ISQM  L+YLN++HNQLQ  +T MF  L++LSTLD SFNSL
Sbjct  121  NLQRLNLEYNQFTGSIPFAISQMPSLQYLNLAHNQLQNALTDMFGPLSSLSTLDLSFNSL  180

Query  637  AGNIPQTFSSLTNMKNMYLQNNVFTGTIDVLANLPLDNL  753
             G +P++F +LT++ +MYLQNN F+GTIDVLANLPLD L
Sbjct  181  NGGLPESFKNLTSISSMYLQNNQFSGTIDVLANLPLDTL  219



>ref|XP_008649051.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like isoform 
X1 [Zea mays]
Length=735

 Score =   216 bits (549),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 103/192 (54%), Positives = 143/192 (74%), Gaps = 0/192 (0%)
 Frame = +1

Query  178  ADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLT  357
            ADTD  D + L  L+SS NSP QLT W+A+GGDPCG +W GVSCSG+ VT I++SG++L 
Sbjct  24   ADTDAGDVAALGNLYSSWNSPAQLTGWSASGGDPCGAAWAGVSCSGSAVTSIKLSGMELN  83

Query  358  GSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLE  537
            G++G+QL  L+++ T D+S N+L +S+PYQLP N+  LNLA N F+G LPYSIS +  LE
Sbjct  84   GTLGYQLSSLQALKTMDLSNNHLHDSIPYQLPSNLTYLNLAKNNFSGNLPYSISNLVSLE  143

Query  538  YLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGT  717
            YLN+SHN L  E+  +F SL +LS LD SFN+L GN+P +  +L+ + ++Y+QNN  +GT
Sbjct  144  YLNLSHNSLFQEIGELFGSLNSLSELDVSFNNLTGNLPFSMGALSKLSSLYMQNNQLSGT  203

Query  718  IDVLANLPLDNL  753
            +DVL+N+ L  L
Sbjct  204  VDVLSNISLATL  215



>ref|XP_008649052.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like isoform 
X2 [Zea mays]
Length=734

 Score =   216 bits (549),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 103/192 (54%), Positives = 143/192 (74%), Gaps = 0/192 (0%)
 Frame = +1

Query  178  ADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLT  357
            ADTD  D + L  L+SS NSP QLT W+A+GGDPCG +W GVSCSG+ VT I++SG++L 
Sbjct  24   ADTDAGDVAALGNLYSSWNSPAQLTGWSASGGDPCGAAWAGVSCSGSAVTSIKLSGMELN  83

Query  358  GSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLE  537
            G++G+QL  L+++ T D+S N+L +S+PYQLP N+  LNLA N F+G LPYSIS +  LE
Sbjct  84   GTLGYQLSSLQALKTMDLSNNHLHDSIPYQLPSNLTYLNLAKNNFSGNLPYSISNLVSLE  143

Query  538  YLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGT  717
            YLN+SHN L  E+  +F SL +LS LD SFN+L GN+P +  +L+ + ++Y+QNN  +GT
Sbjct  144  YLNLSHNSLFQEIGELFGSLNSLSELDVSFNNLTGNLPFSMGALSKLSSLYMQNNQLSGT  203

Query  718  IDVLANLPLDNL  753
            +DVL+N+ L  L
Sbjct  204  VDVLSNISLATL  215



>ref|XP_007023606.1| Strubbelig-receptor family 5 isoform 2 [Theobroma cacao]
 gb|EOY26228.1| Strubbelig-receptor family 5 isoform 2 [Theobroma cacao]
Length=818

 Score =   216 bits (550),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 100/192 (52%), Positives = 142/192 (74%), Gaps = 0/192 (0%)
 Frame = +1

Query  178  ADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLT  357
            + TD  D S L  +F SLN+P QL+ W ANGGDPC +SW+G+ CSG+ VTEI++S  +L+
Sbjct  228  SKTDSPDVSALNVMFKSLNTPSQLSGWRANGGDPCDDSWEGIKCSGSSVTEIKLSDYELS  287

Query  358  GSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLE  537
            G +G+QL  L SVTTFD+S NNL   +PYQLPPN   ++L+ N F+G +PYSISQM  LE
Sbjct  288  GQLGYQLSSLTSVTTFDLSKNNLEGDIPYQLPPNAVHIDLSENKFSGTVPYSISQMTSLE  347

Query  538  YLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGT  717
             +N+SHNQL G+++ MF  L  L + D SFN L+  +P +F++L ++  ++LQ+N FTG+
Sbjct  348  DINLSHNQLNGQLSDMFGKLQKLKSFDVSFNQLSDKLPNSFANLASINTLHLQDNQFTGS  407

Query  718  IDVLANLPLDNL  753
            I+VLA+LPL++L
Sbjct  408  INVLADLPLNDL  419



>ref|XP_007217016.1| hypothetical protein PRUPE_ppa002092mg [Prunus persica]
 gb|EMJ18215.1| hypothetical protein PRUPE_ppa002092mg [Prunus persica]
Length=717

 Score =   215 bits (547),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 122/211 (58%), Positives = 158/211 (75%), Gaps = 1/211 (0%)
 Frame = +1

Query  124  WAVALLIGFLLNAPPSAV-ADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKG  300
            W + +L   +L   P ++ A TDP D S L+ L+SSLNSP QLT+W+A+G DPCG+SWKG
Sbjct  7    WVLLVLSICILGWSPGSINAATDPADVSALKTLYSSLNSPSQLTQWSASGDDPCGQSWKG  66

Query  301  VSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLA  480
            V CSG+RVTEI +S LQL+GS+   L  L ++T  D+S NNL  S+PY LPPN+ +LNLA
Sbjct  67   VKCSGSRVTEIDVSNLQLSGSLWSSLQSLTALTNLDMSHNNLAGSIPYSLPPNMTRLNLA  126

Query  481  GNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTF  660
             N F  G+PYSIS +  LEYLN+SHNQLQ +V  +F  L++LSTLD SFNSL+GN+P++ 
Sbjct  127  ANNFNQGIPYSISLITSLEYLNISHNQLQNQVDDIFGKLSSLSTLDLSFNSLSGNLPESL  186

Query  661  SSLTNMKNMYLQNNVFTGTIDVLANLPLDNL  753
            SSL++M  M LQNN  TG I+VLANLPL+NL
Sbjct  187  SSLSSMTTMNLQNNQLTGPINVLANLPLENL  217



>ref|XP_007023605.1| Strubbelig-receptor family 5 isoform 1 [Theobroma cacao]
 gb|EOY26227.1| Strubbelig-receptor family 5 isoform 1 [Theobroma cacao]
Length=908

 Score =   216 bits (550),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 100/192 (52%), Positives = 142/192 (74%), Gaps = 0/192 (0%)
 Frame = +1

Query  178  ADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLT  357
            + TD  D S L  +F SLN+P QL+ W ANGGDPC +SW+G+ CSG+ VTEI++S  +L+
Sbjct  228  SKTDSPDVSALNVMFKSLNTPSQLSGWRANGGDPCDDSWEGIKCSGSSVTEIKLSDYELS  287

Query  358  GSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLE  537
            G +G+QL  L SVTTFD+S NNL   +PYQLPPN   ++L+ N F+G +PYSISQM  LE
Sbjct  288  GQLGYQLSSLTSVTTFDLSKNNLEGDIPYQLPPNAVHIDLSENKFSGTVPYSISQMTSLE  347

Query  538  YLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGT  717
             +N+SHNQL G+++ MF  L  L + D SFN L+  +P +F++L ++  ++LQ+N FTG+
Sbjct  348  DINLSHNQLNGQLSDMFGKLQKLKSFDVSFNQLSDKLPNSFANLASINTLHLQDNQFTGS  407

Query  718  IDVLANLPLDNL  753
            I+VLA+LPL++L
Sbjct  408  INVLADLPLNDL  419



>ref|XP_009344017.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5-like isoform 
X1 [Pyrus x bretschneideri]
Length=697

 Score =   214 bits (545),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 103/210 (49%), Positives = 145/210 (69%), Gaps = 5/210 (2%)
 Frame = +1

Query  124  WAVALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGV  303
            W V  L+GF         + T+  D S L  +++S  S  +L  W ++GGDPCGESWKG+
Sbjct  11   WVV--LLGFFATG---VYSKTNSQDVSALNVMYNSFQSRSKLKGWKSSGGDPCGESWKGI  65

Query  304  SCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAG  483
            +CSG+ VTEI +S L L+GSMG+QL  L SVT FD+S NNL   +PYQLPP+ + ++L+ 
Sbjct  66   TCSGSSVTEIDLSDLGLSGSMGYQLASLTSVTKFDLSKNNLNGDIPYQLPPSAKYIDLSQ  125

Query  484  NGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFS  663
            NGF+  +PYS+SQM+ LE LN+  N+L G+++ MF  LT L  LD S+NS+ GN+PQ+F 
Sbjct  126  NGFSNTVPYSVSQMSGLETLNLGRNKLNGQLSDMFGKLTKLKELDLSYNSITGNLPQSFG  185

Query  664  SLTNMKNMYLQNNVFTGTIDVLANLPLDNL  753
             L+++K +YLQNN  TG I+VL N P++ L
Sbjct  186  KLSSLKKLYLQNNQLTGQINVLVNTPVEEL  215



>ref|XP_009391183.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5-like [Musa acuminata 
subsp. malaccensis]
Length=689

 Score =   214 bits (544),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 109/190 (57%), Positives = 143/190 (75%), Gaps = 0/190 (0%)
 Frame = +1

Query  184  TDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGS  363
            TDP D S L  L+ SLNSP QLT W+++GGDPCG  W+G+ CSG+ VTEI +SGL LTG+
Sbjct  24   TDPPDVSALNDLYRSLNSPSQLTGWSSSGGDPCGNDWQGIKCSGSSVTEIILSGLGLTGT  83

Query  364  MGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYL  543
            +G+QL  L SVT FD+S NNL   +PYQLPPN   ++L+GN FTGG+ YSISQM  L YL
Sbjct  84   IGYQLSSLTSVTYFDLSKNNLHGDIPYQLPPNAIHIDLSGNVFTGGISYSISQMTDLNYL  143

Query  544  NVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTID  723
            N+++NQL G++T MF  L +LS LD SFN  +G +PQ+F SL+++K + LQNN F+G++ 
Sbjct  144  NLANNQLSGQLTDMFRKLPSLSLLDLSFNHFSGTLPQSFGSLSSLKTLRLQNNQFSGSLG  203

Query  724  VLANLPLDNL  753
            VLA L LD+L
Sbjct  204  VLATLSLDDL  213



>gb|KEH24658.1| strubbelig-receptor family protein [Medicago truncatula]
Length=723

 Score =   214 bits (545),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 110/197 (56%), Positives = 141/197 (72%), Gaps = 4/197 (2%)
 Frame = +1

Query  172  AVADTDPTDASVLRGLFSSLNSPPQLTKWTANGG---DPCGESWKGVSCSGNRVTEIQIS  342
            A A TDPTD + ++ +F S NS PQL  W ANG    DPCG+SWKG++CS NRVT+I +S
Sbjct  22   ATAATDPTDVASVKAIFQSANSAPQL-GWPANGDTDDDPCGQSWKGITCSDNRVTQINLS  80

Query  343  GLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQ  522
             L LTG++ + L    S+T  D+S NNL  ++PYQLPPN+ +LN A N  TG LPYSIS 
Sbjct  81   NLALTGTLPYGLQGFTSLTILDMSNNNLVGTIPYQLPPNLHRLNFANNNLTGPLPYSISN  140

Query  523  MAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNN  702
            +  L  LN++HNQLQ  + V F +L+ LS LD SFNSL G++PQT SSLT +  MYLQNN
Sbjct  141  LTSLTDLNLNHNQLQQALNVNFQNLSTLSKLDLSFNSLTGDLPQTMSSLTGITTMYLQNN  200

Query  703  VFTGTIDVLANLPLDNL  753
             FTG ID+LA+LPL++L
Sbjct  201  QFTGAIDILADLPLNSL  217



>ref|XP_006836581.1| hypothetical protein AMTR_s00131p00083660 [Amborella trichopoda]
 gb|ERM99434.1| hypothetical protein AMTR_s00131p00083660 [Amborella trichopoda]
Length=721

 Score =   214 bits (544),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 114/190 (60%), Positives = 154/190 (81%), Gaps = 0/190 (0%)
 Frame = +1

Query  184  TDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGS  363
            TD  D S L  +++SLNSP QL+ WT+NGGDPCG++W+GV+CSG+ VTE+++SGL L+GS
Sbjct  28   TDAADVSALNVMYNSLNSPGQLSGWTSNGGDPCGQNWRGVTCSGSSVTELKLSGLGLSGS  87

Query  364  MGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYL  543
            +G+QL  L S+TTFD+S NN GN +PYQLPPN+ +LNLA N FTG + YSI+QM+ L+YL
Sbjct  88   LGYQLTSLTSLTTFDVSNNNFGNDIPYQLPPNLSRLNLAENSFTGNIQYSIAQMSALQYL  147

Query  544  NVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTID  723
            N+ HNQLQG+++ +F  L++L+TLD S N L GN+P++FSSLT++  + LQ+N FTG ID
Sbjct  148  NIGHNQLQGQLSDIFGQLSSLTTLDLSSNRLNGNLPESFSSLTSLTTLSLQDNQFTGPID  207

Query  724  VLANLPLDNL  753
            VLANLPL NL
Sbjct  208  VLANLPLQNL  217



>gb|KFK42269.1| hypothetical protein AALP_AA2G233600 [Arabis alpina]
Length=698

 Score =   213 bits (543),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 98/192 (51%), Positives = 141/192 (73%), Gaps = 0/192 (0%)
 Frame = +1

Query  178  ADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLT  357
            A TD  + S L  +F+SLNSP +L  W +NGGDPCG+SW+GV C G+ V+E+Q+SG +L+
Sbjct  22   AKTDSQEVSALNVMFTSLNSPSKLKGWKSNGGDPCGDSWEGVKCKGSSVSELQLSGFELS  81

Query  358  GSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLE  537
            GS+G+ L  LKS+TTFD+S NNL  ++PYQLPP +  L+ + N   G +PYS+SQM  L+
Sbjct  82   GSLGYLLSNLKSLTTFDLSKNNLKGNIPYQLPPKLANLDFSENEIDGNVPYSLSQMNHLQ  141

Query  538  YLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGT  717
             +N+  N+L G++  MF  ++ L TLD SFN L+G +PQ+F++LT++K ++LQ N FTG 
Sbjct  142  SVNLGQNKLNGDLPDMFQKMSKLETLDLSFNKLSGKLPQSFANLTSLKKLHLQENRFTGD  201

Query  718  IDVLANLPLDNL  753
            I+VL NL LD+L
Sbjct  202  INVLRNLALDDL  213



>tpg|DAA46921.1| TPA: putative STRUBBELIG family receptor protein kinase [Zea 
mays]
Length=348

 Score =   205 bits (522),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 100/197 (51%), Positives = 146/197 (74%), Gaps = 3/197 (2%)
 Frame = +1

Query  172  AVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQ  351
              A TD  D + L  LF+S+NSP QL  W  +GGDPCGESW+G++CSG+ VT I++  L 
Sbjct  26   VAAATDANDVTALNTLFTSMNSPGQLQGWKVSGGDPCGESWQGITCSGSSVTAIKLPNLG  85

Query  352  LTGSMGFQLDQLKSVTTFDISTNNLG--NSLPYQLP-PNVQKLNLAGNGFTGGLPYSISQ  522
            L+G++ + ++ + S+   D+S NNLG    +PY LP   +++LNLA N F+G +PYSIS 
Sbjct  86   LSGNLAYNMNTMDSLVELDMSHNNLGGGQQIPYNLPNKKLERLNLAENQFSGSVPYSIST  145

Query  523  MAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNN  702
            M  ++YLN++HNQL G++T +F +L +L+T+D S NSL GN+PQ+F+SL+++K +YLQNN
Sbjct  146  MPNIKYLNLNHNQLSGDITDIFSNLPSLTTVDLSSNSLTGNLPQSFTSLSSLKTLYLQNN  205

Query  703  VFTGTIDVLANLPLDNL  753
              TG+I+VLANLPLD+L
Sbjct  206  QLTGSINVLANLPLDDL  222



>gb|KHG11352.1| protein strubbelig-receptor family 8 [Gossypium arboreum]
Length=726

 Score =   213 bits (543),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 104/206 (50%), Positives = 147/206 (71%), Gaps = 0/206 (0%)
 Frame = +1

Query  136  LLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSG  315
            +L+G +++    A   TD TD   L+ L++SLNSP +LT W ++G DPC ESWKGV+C G
Sbjct  26   ILVGLVISVFIPAQCFTDSTDVQALQVLYTSLNSPTELTNWNSDGNDPCEESWKGVACEG  85

Query  316  NRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFT  495
            + V  I +SGL L+G+MG+ L+ L S+ T D+S NN+ + +PYQLPP +  LN+AGN  +
Sbjct  86   SAVVSIDVSGLGLSGTMGYLLNDLMSLKTLDLSNNNIHDMIPYQLPPILTSLNVAGNNLS  145

Query  496  GGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTN  675
            G LPYSIS M  L YLNVSHN L   V  +F +LT+L TLD SFN+ +G++P +FSSLT 
Sbjct  146  GSLPYSISTMVTLTYLNVSHNSLSPSVGDVFANLTDLGTLDISFNNFSGDLPVSFSSLTT  205

Query  676  MKNMYLQNNVFTGTIDVLANLPLDNL  753
            +  +Y+QNN F+G+++VL+ LPL+ L
Sbjct  206  LSALYMQNNQFSGSLNVLSGLPLNTL  231



>ref|XP_009346024.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5-like isoform 
X1 [Pyrus x bretschneideri]
Length=698

 Score =   213 bits (541),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 103/210 (49%), Positives = 146/210 (70%), Gaps = 5/210 (2%)
 Frame = +1

Query  124  WAVALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGV  303
            W V  L+GF         + T+  D S L  +++SL S  +L+ W ++GGDPCG+SWKG+
Sbjct  11   WVV--LLGFFATG---VYSKTNSQDVSALNVMYNSLQSRSKLSGWKSSGGDPCGDSWKGI  65

Query  304  SCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAG  483
            +CSG+ VT+I +S L L+GSMG+QL  L SVT FD+S NNL   +PYQLPPN + ++L+ 
Sbjct  66   TCSGSSVTQIDLSDLGLSGSMGYQLASLTSVTKFDLSKNNLNGDIPYQLPPNAKYIDLSQ  125

Query  484  NGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFS  663
            NGF+  +PYS+SQM+ LE LN+  N+L G+++ MF  LT L  LD S+NSL GN+PQ+F 
Sbjct  126  NGFSNTVPYSVSQMSDLETLNLGRNKLNGQLSDMFGKLTKLKELDLSYNSLTGNLPQSFG  185

Query  664  SLTNMKNMYLQNNVFTGTIDVLANLPLDNL  753
             L+++K +YLQNN  TG I+VL   P++ L
Sbjct  186  KLSSLKKLYLQNNQLTGQINVLMYTPVEEL  215



>ref|XP_003558655.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7-like [Brachypodium 
distachyon]
Length=720

 Score =   213 bits (541),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 108/221 (49%), Positives = 162/221 (73%), Gaps = 7/221 (3%)
 Frame = +1

Query  109  LMGLPWAVALLIGFLLNAPPSAV---ADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDP  279
            ++  PW + LL+      P   +   ADT+  D +VL  LF+SLNSP QL  W A+GGDP
Sbjct  10   MLDAPW-LPLLLLVCCAWPQKQILVSADTNANDVTVLNTLFTSLNSPGQLKGWQASGGDP  68

Query  280  CGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLG--NSLPYQLP  453
            CG+SW+G++CSG+ VT I++  L L+G++ + ++ + SV   D+S NNLG   ++ Y LP
Sbjct  69   CGQSWQGITCSGSSVTAIKLPSLGLSGNLAYNMNTMGSVVEIDMSQNNLGGGQAIQYNLP  128

Query  454  PN-VQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFN  630
             + +++LNLAGN FTG LPYSI  M+ L+YLN++HNQLQG++T +F +L +L+T+D SFN
Sbjct  129  TDKLERLNLAGNQFTGNLPYSIFSMSKLKYLNLNHNQLQGKMTDVFSNLDSLTTVDLSFN  188

Query  631  SLAGNIPQTFSSLTNMKNMYLQNNVFTGTIDVLANLPLDNL  753
            SL G++P +F++L+++K +YLQNN F+G+I+VLANLPL +L
Sbjct  189  SLTGDLPDSFTALSSLKTLYLQNNQFSGSINVLANLPLTDL  229



>ref|XP_004983096.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like [Setaria 
italica]
Length=719

 Score =   212 bits (540),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 102/195 (52%), Positives = 148/195 (76%), Gaps = 3/195 (2%)
 Frame = +1

Query  178  ADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLT  357
            A TD  D + L  LF+S++SP QL  W A+GGDPC ESW+G++CSG+ VT I++ GL L+
Sbjct  28   AATDANDVTALNTLFTSMSSPGQLQGWKASGGDPCSESWQGITCSGSSVTAIKLPGLGLS  87

Query  358  GSMGFQLDQLKSVTTFDISTNNLG--NSLPYQLP-PNVQKLNLAGNGFTGGLPYSISQMA  528
            G++ + ++ + S+   D+S NNLG    +PY LP   +++LNLAGN F+G +PYSIS M 
Sbjct  88   GTLAYNMNTMDSLVELDLSQNNLGGGQQIPYNLPNKKLERLNLAGNQFSGAVPYSISTMP  147

Query  529  PLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVF  708
             L+YLN++HNQL G++T +F +L +L+T+D S NSL GN+PQ+F+SL+++K +YLQNN  
Sbjct  148  KLQYLNLNHNQLSGDITDIFSNLPSLTTVDLSSNSLTGNLPQSFTSLSSLKTLYLQNNQL  207

Query  709  TGTIDVLANLPLDNL  753
            TG+I+VLANLPLD+L
Sbjct  208  TGSINVLANLPLDDL  222



>ref|XP_008228078.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5 [Prunus mume]
Length=719

 Score =   212 bits (539),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 104/210 (50%), Positives = 145/210 (69%), Gaps = 5/210 (2%)
 Frame = +1

Query  124  WAVALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGV  303
            W V  L GF         + T+  D S L  +++S+NS  +L+ W ++GGDPCG+SWKG+
Sbjct  21   WVV--LFGFFTTG---VYSKTNSQDVSSLNVMYNSINSRSKLSGWKSSGGDPCGDSWKGI  75

Query  304  SCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAG  483
             CSG+ VTEI ++ L L+GSMG+QL  L SVT FD+S NNL   +PYQLPPN + ++L+ 
Sbjct  76   KCSGSSVTEIDLADLGLSGSMGYQLASLTSVTRFDLSKNNLNGDIPYQLPPNAKYIDLSQ  135

Query  484  NGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFS  663
            NGFT  +PYSISQM+ LE LN+  N+L G++T MF  LT L  LD S+NS+ GN+PQ+F 
Sbjct  136  NGFTNTVPYSISQMSDLETLNLGRNKLNGQLTDMFGKLTKLKELDLSYNSMTGNLPQSFG  195

Query  664  SLTNMKNMYLQNNVFTGTIDVLANLPLDNL  753
             L+++K + LQNN FTG I +L   P+++L
Sbjct  196  KLSSLKKLNLQNNQFTGQITLLVYTPVEDL  225



>gb|AAP12946.1| putative leucine-rich repeat transmembrane protein kinase [Oryza 
sativa Japonica Group]
 gb|ABF96436.1| leucine-rich repeat transmembrane protein kinase 1, putative, 
expressed [Oryza sativa Japonica Group]
Length=753

 Score =   211 bits (537),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 107/215 (50%), Positives = 150/215 (70%), Gaps = 4/215 (2%)
 Frame = +1

Query  112  MGLPWAVALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGES  291
            +G    VA+L+  +  A     ADT   D + L   ++SLNSP QLT W A  GDPCG+S
Sbjct  20   VGFTGVVAMLL--MATAFLGVTADTSSDDVTALNTFYTSLNSPSQLTNWVAQNGDPCGQS  77

Query  292  WKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNL-GNSLPYQLPPNVQK  468
            W G++CSG+RV  I++ G+ L G++G+ ++ + ++   D S NNL G  +PY LPPN+++
Sbjct  78   WLGITCSGSRVITIKLPGMGLKGTLGYNMNVMTALVELDASNNNLGGGDIPYNLPPNLER  137

Query  469  LNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNI  648
            LNL  N FTG LPYSISQMA L+YLN+ HNQL   + VMF  LTNL+TLD S N+ +G +
Sbjct  138  LNLENNSFTGTLPYSISQMASLKYLNLGHNQL-SSINVMFNQLTNLATLDLSDNTFSGTL  196

Query  649  PQTFSSLTNMKNMYLQNNVFTGTIDVLANLPLDNL  753
            P +FS+LT++  ++LQ+N FTGTIDVL++LPL +L
Sbjct  197  PDSFSNLTSLTMLHLQDNRFTGTIDVLSDLPLTDL  231



>ref|XP_010417514.1| PREDICTED: LOW QUALITY PROTEIN: protein STRUBBELIG-RECEPTOR FAMILY 
5-like [Camelina sativa]
Length=697

 Score =   210 bits (535),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 97/192 (51%), Positives = 141/192 (73%), Gaps = 0/192 (0%)
 Frame = +1

Query  178  ADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLT  357
            A TD  + S L  +F+SLNSP +L  W ++GGDPC  SW+GV C G+ VTE+Q+SGL+L+
Sbjct  22   AKTDNQEVSALNVMFTSLNSPSKLKGWKSSGGDPCDGSWEGVKCKGSSVTELQLSGLELS  81

Query  358  GSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLE  537
            GS+G+ L  LKS+TTFD+S NNL  ++PYQLPPN+  L+ + N   G +PYS+SQM  ++
Sbjct  82   GSLGYLLSNLKSLTTFDLSKNNLKGNIPYQLPPNLANLDFSENELDGNVPYSLSQMKSIQ  141

Query  538  YLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGT  717
             +N+  N+L G++  MF  L+ L TLD S N L+G +PQ+F++LT++K ++LQ+N FTG 
Sbjct  142  SINLGQNKLNGDLPHMFQKLSKLETLDLSLNQLSGKLPQSFANLTSLKKLHLQDNRFTGD  201

Query  718  IDVLANLPLDNL  753
            I+VL NL +D+L
Sbjct  202  INVLRNLAIDDL  213



>gb|EAY90345.1| hypothetical protein OsI_11922 [Oryza sativa Indica Group]
Length=753

 Score =   211 bits (537),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 107/215 (50%), Positives = 150/215 (70%), Gaps = 4/215 (2%)
 Frame = +1

Query  112  MGLPWAVALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGES  291
            +G    VA+L+  +  A     ADT   D + L   ++SLNSP QLT W A  GDPCG+S
Sbjct  20   VGFTGVVAMLL--MATAFLGVTADTSSDDVTALNTFYTSLNSPSQLTNWVAQNGDPCGQS  77

Query  292  WKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNL-GNSLPYQLPPNVQK  468
            W G++CSG+RV  I++ G+ L G++G+ ++ + ++   D S NNL G  +PY LPPN+++
Sbjct  78   WLGITCSGSRVITIKLPGMGLKGTLGYNMNVMTALVELDASNNNLGGGDIPYNLPPNLER  137

Query  469  LNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNI  648
            LNL  N FTG LPYSISQMA L+YLN+ HNQL   + VMF  LTNL+TLD S N+ +G +
Sbjct  138  LNLENNSFTGTLPYSISQMASLKYLNLGHNQL-SSINVMFNQLTNLATLDLSDNTFSGTL  196

Query  649  PQTFSSLTNMKNMYLQNNVFTGTIDVLANLPLDNL  753
            P +FS+LT++  ++LQ+N FTGTIDVL++LPL +L
Sbjct  197  PDSFSNLTSLTMLHLQDNRFTGTIDVLSDLPLTDL  231



>gb|AFW70556.1| putative STRUBBELIG family receptor protein kinase [Zea mays]
Length=668

 Score =   210 bits (534),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 101/191 (53%), Positives = 137/191 (72%), Gaps = 0/191 (0%)
 Frame = +1

Query  181  DTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTG  360
            +TDP DA+ L  L++S NSP QL  W+A+GGDPCG +W+GV+CSG  VTEI++ G  L G
Sbjct  24   ETDPDDAAALANLYTSWNSPSQLAGWSASGGDPCGAAWQGVACSGAGVTEIKLPGTGLDG  83

Query  361  SMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  540
            S+G++L  L S+ T D+S NNL  S+PYQLPPN+  LNL  N F G LPYSIS MA +EY
Sbjct  84   SLGYELSNLFSLKTLDLSNNNLHGSIPYQLPPNLTNLNLGSNNFNGNLPYSISNMASIEY  143

Query  541  LNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTI  720
            LN+SHN +  ++  +F SL +LS LD SFN L G++P +  SL+N+ ++Y+QNN  TG++
Sbjct  144  LNLSHNSISQQLGDIFGSLNSLSDLDVSFNKLTGDLPNSIGSLSNLSSLYMQNNQLTGSV  203

Query  721  DVLANLPLDNL  753
            +VL  L L  L
Sbjct  204  NVLRGLSLTTL  214



>ref|XP_008659801.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like isoform 
X2 [Zea mays]
Length=724

 Score =   210 bits (535),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 100/191 (52%), Positives = 141/191 (74%), Gaps = 0/191 (0%)
 Frame = +1

Query  181  DTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTG  360
            DTD  D + L  L+SS NSP +L  W+A+GGDPCG +W GVSCSG+ VT I++SG++L G
Sbjct  25   DTDAGDVAALGNLYSSWNSPARLAGWSASGGDPCGAAWTGVSCSGSAVTSIKLSGMELNG  84

Query  361  SMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  540
            ++G+QL  L+++ T D+S N L +S+PYQLP N+  LNLA N F+G LPYSIS +  LEY
Sbjct  85   TLGYQLSSLQALKTMDLSNNYLHDSIPYQLPSNLTYLNLAKNNFSGNLPYSISNLVSLEY  144

Query  541  LNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTI  720
            LN+SHN L  E+  +F SL++LS LD SFN+L GN+P +  SL+ + ++Y+QNN  +GT+
Sbjct  145  LNLSHNSLFQEIGELFGSLSSLSELDISFNNLTGNLPFSMGSLSKLSSLYMQNNQLSGTV  204

Query  721  DVLANLPLDNL  753
            DV++N+ L  L
Sbjct  205  DVISNISLATL  215



>gb|AFW87368.1| putative STRUBBELIG family receptor protein kinase [Zea mays]
Length=734

 Score =   210 bits (535),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 100/191 (52%), Positives = 141/191 (74%), Gaps = 0/191 (0%)
 Frame = +1

Query  181  DTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTG  360
            DTD  D + L  L+SS NSP +L  W+A+GGDPCG +W GVSCSG+ VT I++SG++L G
Sbjct  25   DTDAGDVAALGNLYSSWNSPARLAGWSASGGDPCGAAWTGVSCSGSAVTSIKLSGMELNG  84

Query  361  SMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  540
            ++G+QL  L+++ T D+S N L +S+PYQLP N+  LNLA N F+G LPYSIS +  LEY
Sbjct  85   TLGYQLSSLQALKTMDLSNNYLHDSIPYQLPSNLTYLNLAKNNFSGNLPYSISNLVSLEY  144

Query  541  LNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTI  720
            LN+SHN L  E+  +F SL++LS LD SFN+L GN+P +  SL+ + ++Y+QNN  +GT+
Sbjct  145  LNLSHNSLFQEIGELFGSLSSLSELDISFNNLTGNLPFSMGSLSKLSSLYMQNNQLSGTV  204

Query  721  DVLANLPLDNL  753
            DV++N+ L  L
Sbjct  205  DVISNISLATL  215



>gb|EAZ27223.1| hypothetical protein OsJ_11161 [Oryza sativa Japonica Group]
Length=831

 Score =   211 bits (537),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 107/215 (50%), Positives = 150/215 (70%), Gaps = 4/215 (2%)
 Frame = +1

Query  112  MGLPWAVALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGES  291
            +G    VA+L+  +  A     ADT   D + L   ++SLNSP QLT W A  GDPCG+S
Sbjct  20   VGFTGVVAMLL--MATAFLGVTADTSSDDVTALNTFYTSLNSPSQLTNWVAQNGDPCGQS  77

Query  292  WKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNL-GNSLPYQLPPNVQK  468
            W G++CSG+RV  I++ G+ L G++G+ ++ + ++   D S NNL G  +PY LPPN+++
Sbjct  78   WLGITCSGSRVITIKLPGMGLKGTLGYNMNVMTALVELDASNNNLGGGDIPYNLPPNLER  137

Query  469  LNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNI  648
            LNL  N FTG LPYSISQMA L+YLN+ HNQL   + VMF  LTNL+TLD S N+ +G +
Sbjct  138  LNLENNSFTGTLPYSISQMASLKYLNLGHNQL-SSINVMFNQLTNLATLDLSDNTFSGTL  196

Query  649  PQTFSSLTNMKNMYLQNNVFTGTIDVLANLPLDNL  753
            P +FS+LT++  ++LQ+N FTGTIDVL++LPL +L
Sbjct  197  PDSFSNLTSLTMLHLQDNRFTGTIDVLSDLPLTDL  231



>gb|AFW87367.1| putative STRUBBELIG family receptor protein kinase, partial [Zea 
mays]
Length=743

 Score =   210 bits (535),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 100/191 (52%), Positives = 141/191 (74%), Gaps = 0/191 (0%)
 Frame = +1

Query  181  DTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTG  360
            DTD  D + L  L+SS NSP +L  W+A+GGDPCG +W GVSCSG+ VT I++SG++L G
Sbjct  25   DTDAGDVAALGNLYSSWNSPARLAGWSASGGDPCGAAWTGVSCSGSAVTSIKLSGMELNG  84

Query  361  SMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  540
            ++G+QL  L+++ T D+S N L +S+PYQLP N+  LNLA N F+G LPYSIS +  LEY
Sbjct  85   TLGYQLSSLQALKTMDLSNNYLHDSIPYQLPSNLTYLNLAKNNFSGNLPYSISNLVSLEY  144

Query  541  LNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTI  720
            LN+SHN L  E+  +F SL++LS LD SFN+L GN+P +  SL+ + ++Y+QNN  +GT+
Sbjct  145  LNLSHNSLFQEIGELFGSLSSLSELDISFNNLTGNLPFSMGSLSKLSSLYMQNNQLSGTV  204

Query  721  DVLANLPLDNL  753
            DV++N+ L  L
Sbjct  205  DVISNISLATL  215



>ref|XP_010474484.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5-like [Camelina 
sativa]
Length=701

 Score =   209 bits (533),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 97/192 (51%), Positives = 140/192 (73%), Gaps = 0/192 (0%)
 Frame = +1

Query  178  ADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLT  357
            A TD  + S L  +F+SLNSP +L  W ++GGDPC  SW+GV C G+ VTE+Q+SGL+L+
Sbjct  22   AKTDNQEVSALNVMFTSLNSPSKLKGWKSSGGDPCDGSWEGVKCKGSSVTELQLSGLELS  81

Query  358  GSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLE  537
            GS+G+ L  LKS+TTFD+S NNL  ++PYQLPPN+  L+ + N   G +PYS+SQM  ++
Sbjct  82   GSLGYLLSNLKSLTTFDLSKNNLKGNIPYQLPPNLANLDFSENELDGNVPYSLSQMKSIQ  141

Query  538  YLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGT  717
             +N+  N+L G++  MF  L+ L TLD S N L+G +PQ+F++LT++K ++LQ N FTG 
Sbjct  142  SINLGQNKLNGDLPHMFQKLSKLETLDLSLNQLSGKLPQSFANLTSLKKLHLQENRFTGD  201

Query  718  IDVLANLPLDNL  753
            I+VL NL +D+L
Sbjct  202  INVLRNLAVDDL  213



>ref|XP_008645353.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like [Zea mays]
 gb|AFW70555.1| putative STRUBBELIG family receptor protein kinase [Zea mays]
Length=717

 Score =   209 bits (533),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 101/191 (53%), Positives = 137/191 (72%), Gaps = 0/191 (0%)
 Frame = +1

Query  181  DTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTG  360
            +TDP DA+ L  L++S NSP QL  W+A+GGDPCG +W+GV+CSG  VTEI++ G  L G
Sbjct  24   ETDPDDAAALANLYTSWNSPSQLAGWSASGGDPCGAAWQGVACSGAGVTEIKLPGTGLDG  83

Query  361  SMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  540
            S+G++L  L S+ T D+S NNL  S+PYQLPPN+  LNL  N F G LPYSIS MA +EY
Sbjct  84   SLGYELSNLFSLKTLDLSNNNLHGSIPYQLPPNLTNLNLGSNNFNGNLPYSISNMASIEY  143

Query  541  LNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTI  720
            LN+SHN +  ++  +F SL +LS LD SFN L G++P +  SL+N+ ++Y+QNN  TG++
Sbjct  144  LNLSHNSISQQLGDIFGSLNSLSDLDVSFNKLTGDLPNSIGSLSNLSSLYMQNNQLTGSV  203

Query  721  DVLANLPLDNL  753
            +VL  L L  L
Sbjct  204  NVLRGLSLTTL  214



>gb|KDO78353.1| hypothetical protein CISIN_1g005001mg [Citrus sinensis]
Length=442

 Score =   204 bits (519),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 99/190 (52%), Positives = 135/190 (71%), Gaps = 0/190 (0%)
 Frame = +1

Query  184  TDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGS  363
            TD +D   L+ L++SLNSP  LT W  N GDPCGESWKGV+C G+ V  I ISGL L+G+
Sbjct  39   TDSSDVQALQVLYTSLNSPSVLTNWKGNEGDPCGESWKGVACEGSAVVSIDISGLGLSGT  98

Query  364  MGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYL  543
            MG+ L  L S+  FD+S N++ +++PYQLPPN+  LNLA N F+G LPYSI+ M  L YL
Sbjct  99   MGYLLSDLLSLRKFDLSGNSIHDTIPYQLPPNLTSLNLASNNFSGNLPYSIASMVSLSYL  158

Query  544  NVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTID  723
            NVS N L   +  +F +L  L+TLD SFN+ +G++P +F SL+N+ ++YLQNN  TG+++
Sbjct  159  NVSRNSLTQSIGDIFGNLAGLATLDLSFNNFSGDLPNSFISLSNISSLYLQNNQVTGSLN  218

Query  724  VLANLPLDNL  753
            V + LPL  L
Sbjct  219  VFSGLPLTTL  228



>ref|XP_008380425.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5-like isoform 
X1 [Malus domestica]
Length=697

 Score =   209 bits (532),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 101/210 (48%), Positives = 143/210 (68%), Gaps = 5/210 (2%)
 Frame = +1

Query  124  WAVALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGV  303
            W V  L+GF         + T+  D S L  +++S  S  +L  W ++GGDPCGESWKG+
Sbjct  11   WVV--LLGFFATG---VYSKTNSQDVSALNVMYNSFQSRSKLKGWKSSGGDPCGESWKGI  65

Query  304  SCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAG  483
            +CSG+ VTEI +  L L+GSMG+QL  L SVT FD+S NNL   +PYQLPP+ + ++L+ 
Sbjct  66   TCSGSSVTEIDLXDLGLSGSMGYQLASLTSVTXFDLSKNNLNGDIPYQLPPSAKYIDLSQ  125

Query  484  NGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFS  663
            NGF+  +PYS+SQM+ LE LN+  N+L G+++ MF  LT L  LD S+NS+ GN+PQ+F 
Sbjct  126  NGFSNTVPYSVSQMSGLETLNLGRNKLNGQLSDMFGKLTKLKELDLSYNSITGNLPQSFG  185

Query  664  SLTNMKNMYLQNNVFTGTIDVLANLPLDNL  753
             L+++K +YLQNN  TG I+VL   P++ L
Sbjct  186  KLSSLKKLYLQNNQLTGQINVLVYTPVEEL  215



>dbj|BAK07184.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=713

 Score =   209 bits (533),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 99/191 (52%), Positives = 143/191 (75%), Gaps = 0/191 (0%)
 Frame = +1

Query  181  DTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTG  360
            +T+ +D++ L  L++S NSPPQL  W+A+GGDPCG  W+GVSC+G+ VTEI+++G  L G
Sbjct  23   NTESSDSAALGNLYTSWNSPPQLAGWSASGGDPCGAGWQGVSCTGSGVTEIKLAGTGLNG  82

Query  361  SMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  540
            S+G++L  L S+ T D+S N++  S+PYQLPPN+  LNLA N F+G LPYSIS MA +EY
Sbjct  83   SLGYELSNLFSLKTLDLSNNHIQGSIPYQLPPNLTYLNLATNNFSGNLPYSISNMASIEY  142

Query  541  LNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTI  720
            LN+SHN L  ++  +F +LT+LS LD SFN L G++P +  SL+N+ ++Y+QNN  TG++
Sbjct  143  LNLSHNALAQQIGDLFGNLTSLSELDVSFNKLTGDLPTSIGSLSNISSLYMQNNQLTGSV  202

Query  721  DVLANLPLDNL  753
            +VL+ L L  L
Sbjct  203  NVLSGLGLTTL  213



>ref|XP_002889223.1| ATP binding protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65482.1| ATP binding protein [Arabidopsis lyrata subsp. lyrata]
Length=699

 Score =   209 bits (532),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 99/192 (52%), Positives = 138/192 (72%), Gaps = 0/192 (0%)
 Frame = +1

Query  178  ADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLT  357
            A TD  + S L  +F+SLNSP +L  W  NGGDPC  SW+GV C G+ VTE+Q+SG +L+
Sbjct  22   AKTDNQEVSGLNVMFTSLNSPSKLKGWKPNGGDPCDGSWEGVKCKGSSVTELQLSGFELS  81

Query  358  GSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLE  537
            GS+G+ L  LKS+TTFD+S NNL  ++PYQLPPN+  L+ + N   G +PYS+SQM  L+
Sbjct  82   GSLGYLLSNLKSLTTFDLSKNNLKGNIPYQLPPNIVNLDFSENELDGNVPYSLSQMKSLQ  141

Query  538  YLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGT  717
             +N+  N+L GE+  MF  L+ L TLD S N L+G +PQ+F++LT++K ++LQ N FTG 
Sbjct  142  SINLGQNKLNGELPDMFQKLSKLVTLDLSLNQLSGKLPQSFANLTSLKKLHLQENRFTGD  201

Query  718  IDVLANLPLDNL  753
            I+VL NL +D+L
Sbjct  202  INVLRNLAIDDL  213



>ref|XP_010235400.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7-like isoform 
X1 [Brachypodium distachyon]
Length=712

 Score =   209 bits (532),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 99/185 (54%), Positives = 141/185 (76%), Gaps = 2/185 (1%)
 Frame = +1

Query  202  SVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLD  381
            + L   ++++NSPPQL  W +   DPCG+SW G++C G+RVT I++SG+ L G++G+ ++
Sbjct  34   TALNVFYTTMNSPPQLKNWVSQNADPCGQSWNGITCLGSRVTTIKLSGMGLNGTLGYNMN  93

Query  382  QLKSVTTFDISTNNLGNS-LPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHN  558
             L ++   D+S NNLG S +PY LPPN++KLNLAGN FTG  PYSISQM  L+ LN++HN
Sbjct  94   LLTALVQLDMSNNNLGGSDIPYNLPPNLEKLNLAGNHFTGTTPYSISQMFALKDLNLAHN  153

Query  559  QLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTIDVLANL  738
            Q+   ++ MF  LTNL+T+D S+N+ + NIPQ+F+SLT++  +YLQNN F+GTIDVLANL
Sbjct  154  QI-STISDMFNQLTNLTTMDLSYNAFSANIPQSFNSLTSLTTLYLQNNQFSGTIDVLANL  212

Query  739  PLDNL  753
            PL +L
Sbjct  213  PLTDL  217



>ref|XP_009406399.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5-like [Musa acuminata 
subsp. malaccensis]
Length=723

 Score =   209 bits (532),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 112/204 (55%), Positives = 149/204 (73%), Gaps = 8/204 (4%)
 Frame = +1

Query  142  IGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNR  321
            +G LL +P S+         S L  ++SSLNSP QLT W ++GGDPCG  WKG+ CSG+ 
Sbjct  45   VGTLLLSPTSSF--------SALNVMYSSLNSPSQLTGWGSSGGDPCGNDWKGIKCSGSS  96

Query  322  VTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGG  501
            VTEI++SGL LTG+MG+QL  L SVT FD+S NNL   +PYQLPPN   +NLAGN  TGG
Sbjct  97   VTEIKLSGLGLTGTMGYQLSSLTSVTYFDLSKNNLQGDVPYQLPPNAIHINLAGNALTGG  156

Query  502  LPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMK  681
            +PYSISQM  L YLN+++NQL G++T +F  L +LS LD SFN  +GN+PQ+F SL+++K
Sbjct  157  VPYSISQMTDLNYLNLANNQLSGQLTDVFGKLHSLSLLDLSFNHFSGNLPQSFGSLSSLK  216

Query  682  NMYLQNNVFTGTIDVLANLPLDNL  753
             + +QNN F+G++ VLA L L++L
Sbjct  217  TLNIQNNQFSGSLGVLAPLSLEDL  240



>ref|XP_002267170.2| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8 [Vitis vinifera]
 emb|CBI32991.3| unnamed protein product [Vitis vinifera]
Length=729

 Score =   209 bits (532),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 106/210 (50%), Positives = 139/210 (66%), Gaps = 3/210 (1%)
 Frame = +1

Query  133  ALLIGFLLNA---PPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGV  303
            ALL+ F  +A   P S    TDP+D   L+ +++SLN P QLT WT + GDPCGESWKGV
Sbjct  21   ALLVLFSFSAILPPLSVYGATDPSDVQGLQVIYNSLNGPSQLTGWTNSSGDPCGESWKGV  80

Query  304  SCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAG  483
            +C G+ V  IQISGL L G+MG+ L    S+ T D+S NN+ +++PYQLPPN+  LNLA 
Sbjct  81   TCEGSAVVSIQISGLGLNGTMGYLLSNFLSLRTLDMSDNNIHDTIPYQLPPNLTNLNLAS  140

Query  484  NGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFS  663
            N  TG  PYSIS M  L YLNVSHN +   +  +F  L  L+ LD S N+  G++P +F+
Sbjct  141  NNLTGSFPYSISTMVSLNYLNVSHNSISQSIGDIFAKLAGLTILDLSVNNFTGDLPNSFT  200

Query  664  SLTNMKNMYLQNNVFTGTIDVLANLPLDNL  753
            SL+N+  +YLQNN  TG + VL  LPL +L
Sbjct  201  SLSNLSTLYLQNNQLTGPLSVLTGLPLTDL  230



>ref|XP_010429764.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5-like [Camelina 
sativa]
Length=621

 Score =   207 bits (528),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 96/192 (50%), Positives = 139/192 (72%), Gaps = 0/192 (0%)
 Frame = +1

Query  178  ADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLT  357
            A TD  + S L  +F+SLNSP +L  W ++GGDPC  SW+GV C G+ VTE+Q+SGL+L+
Sbjct  22   AKTDNQEVSALNVMFTSLNSPSKLKGWKSSGGDPCDGSWEGVKCKGSSVTELQLSGLELS  81

Query  358  GSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLE  537
            GS+G+ L  LKS+T FD+S NNL  ++PYQLPPN+  L+ + N   G +PYS+SQM  ++
Sbjct  82   GSLGYLLSNLKSLTNFDLSKNNLKGNIPYQLPPNLANLDFSENELDGNVPYSLSQMKSIQ  141

Query  538  YLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGT  717
             +N+  N+L G++  MF  L+ L TLD S N L+G +PQ+F++LT++K ++LQ N FTG 
Sbjct  142  SINLGQNKLNGDLQDMFQKLSKLETLDLSLNQLSGKLPQSFANLTSLKKLHLQENRFTGD  201

Query  718  IDVLANLPLDNL  753
            I+VL NL +D+L
Sbjct  202  INVLRNLAIDDL  213



>ref|XP_010099162.1| Protein STRUBBELIG-RECEPTOR FAMILY 8 [Morus notabilis]
 gb|EXB77034.1| Protein STRUBBELIG-RECEPTOR FAMILY 8 [Morus notabilis]
Length=728

 Score =   209 bits (531),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 103/206 (50%), Positives = 143/206 (69%), Gaps = 1/206 (0%)
 Frame = +1

Query  139  LIGFLLNAPPSAVADTDPTD-ASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSG  315
            L+G   +A     A   P +    L+ +++SLNSP QLT WT+NGGDPCGESWKG++C G
Sbjct  28   LVGAFTDASDEIFATAYPDNFVQALQVMYTSLNSPSQLTGWTSNGGDPCGESWKGITCEG  87

Query  316  NRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFT  495
            + V  I+ISGL L+G+MG+ L  L S+  FD+S NN+ +++PYQLPPN+  LNLA N  +
Sbjct  88   SAVVSIEISGLGLSGTMGYMLANLVSLRKFDLSDNNIHDTIPYQLPPNLTSLNLAKNNLS  147

Query  496  GGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTN  675
            G LPYS S M+ L YLNVS N L   +  +FV+L++L TLD SFN+ +G++P T  SL N
Sbjct  148  GNLPYSFSTMSSLNYLNVSRNSLAQSIGDVFVNLSSLGTLDLSFNNFSGDLPNTLGSLFN  207

Query  676  MKNMYLQNNVFTGTIDVLANLPLDNL  753
            + ++Y+QNN  TG+++VL  LPL  L
Sbjct  208  LSSLYMQNNQLTGSLNVLTGLPLTTL  233



>ref|XP_007217699.1| hypothetical protein PRUPE_ppa002458mg [Prunus persica]
 gb|EMJ18898.1| hypothetical protein PRUPE_ppa002458mg [Prunus persica]
Length=670

 Score =   208 bits (529),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 96/179 (54%), Positives = 134/179 (75%), Gaps = 0/179 (0%)
 Frame = +1

Query  217  LFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSV  396
            +++S+NS  +L+ W ++GGDPCG+SWKG+ CSG+ VTEI +S L L+GSMG+QL  L SV
Sbjct  1    MYNSINSRSKLSGWKSSGGDPCGDSWKGIKCSGSSVTEIDLSDLGLSGSMGYQLASLTSV  60

Query  397  TTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEV  576
            T FD+S NNL   +PYQLPPN + ++L+ NGFT  +PYSISQM+ LE LN+  N+L G++
Sbjct  61   TRFDLSKNNLNGDIPYQLPPNAKYIDLSQNGFTNTVPYSISQMSDLETLNLGRNKLNGQL  120

Query  577  TVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTIDVLANLPLDNL  753
            T MF  LT L  LD S+NS+ GN+PQ+F  L+++K + LQNN FTG I +L   P+++L
Sbjct  121  TDMFGKLTKLKVLDLSYNSMTGNLPQSFGKLSSLKKLNLQNNQFTGQITLLVYTPVEDL  179



>tpg|DAA46922.1| TPA: putative STRUBBELIG family receptor protein kinase [Zea 
mays]
Length=632

 Score =   207 bits (526),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 100/196 (51%), Positives = 146/196 (74%), Gaps = 3/196 (2%)
 Frame = +1

Query  175  VADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQL  354
             A TD  D + L  LF+S+NSP QL  W  +GGDPCGESW+G++CSG+ VT I++  L L
Sbjct  27   AAATDANDVTALNTLFTSMNSPGQLQGWKVSGGDPCGESWQGITCSGSSVTAIKLPNLGL  86

Query  355  TGSMGFQLDQLKSVTTFDISTNNLG--NSLPYQLP-PNVQKLNLAGNGFTGGLPYSISQM  525
            +G++ + ++ + S+   D+S NNLG    +PY LP   +++LNLA N F+G +PYSIS M
Sbjct  87   SGNLAYNMNTMDSLVELDMSHNNLGGGQQIPYNLPNKKLERLNLAENQFSGSVPYSISTM  146

Query  526  APLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNV  705
              ++YLN++HNQL G++T +F +L +L+T+D S NSL GN+PQ+F+SL+++K +YLQNN 
Sbjct  147  PNIKYLNLNHNQLSGDITDIFSNLPSLTTVDLSSNSLTGNLPQSFTSLSSLKTLYLQNNQ  206

Query  706  FTGTIDVLANLPLDNL  753
             TG+I+VLANLPLD+L
Sbjct  207  LTGSINVLANLPLDDL  222



>ref|XP_004510591.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like [Cicer arietinum]
Length=711

 Score =   208 bits (529),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 112/191 (59%), Positives = 149/191 (78%), Gaps = 2/191 (1%)
 Frame = +1

Query  181  DTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTG  360
            DTDP DA+ L  LF SLNSP QL  W ANG DPCG+SWKG++CSGNR+TEI++ GL L+G
Sbjct  22   DTDPNDAAALTLLFQSLNSPAQLN-WPANGNDPCGQSWKGITCSGNRITEIKLPGLGLSG  80

Query  361  SMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  540
            ++G+QL  L ++TT D+S NN+G+++PY LP N+Q LNLA N   GG+PYS+S +  L  
Sbjct  81   TLGYQL-SLSALTTLDLSNNNIGSNIPYSLPQNLQHLNLANNNLNGGIPYSLSDITSLIS  139

Query  541  LNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTI  720
            +N+ HNQLQ  +T+ F  LT+LSTLD SFNSL G++PQT +SL+++  MYLQNN  TGTI
Sbjct  140  MNLGHNQLQQGLTLNFQKLTSLSTLDLSFNSLTGDLPQTMNSLSSITTMYLQNNQLTGTI  199

Query  721  DVLANLPLDNL  753
            +VLA+LPL++L
Sbjct  200  NVLADLPLESL  210



>ref|XP_004965804.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like [Setaria 
italica]
Length=716

 Score =   207 bits (528),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 101/191 (53%), Positives = 138/191 (72%), Gaps = 0/191 (0%)
 Frame = +1

Query  181  DTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTG  360
            DTD  D + L  L+SS NSP QLT W+A GGDPCG +W GV+CSG  VT I++SG++L G
Sbjct  26   DTDAGDVAALGNLYSSWNSPAQLTGWSAAGGDPCGAAWAGVTCSGTAVTSIKLSGMELNG  85

Query  361  SMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  540
            ++G++L  L+++ T D+S N L +S+PYQLP N+  LNLA N  +G LPYSIS M  LEY
Sbjct  86   TLGYELSSLQALKTMDLSNNFLHDSIPYQLPSNLTYLNLAKNNLSGNLPYSISTMVSLEY  145

Query  541  LNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTI  720
            LN+SHN L  E+  +F SL +LS LD SFN+L G++P +  SL+ + ++Y+QNN  +GT+
Sbjct  146  LNLSHNSLFQEIGELFGSLNSLSELDISFNNLTGSLPISMGSLSKVSSLYMQNNQLSGTV  205

Query  721  DVLANLPLDNL  753
            DVL+NL L  L
Sbjct  206  DVLSNLSLATL  216



>ref|XP_008659003.1| PREDICTED: leucine-rich repeat transmembrane protein kinase 2 
isoform X1 [Zea mays]
Length=684

 Score =   207 bits (526),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 106/186 (57%), Positives = 140/186 (75%), Gaps = 3/186 (2%)
 Frame = +1

Query  205  VLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQ  384
            VL  LF+SLNSP QL  W ANGGDPCG+SW+G++CSG+ VT+I +  L LTG++ + ++ 
Sbjct  5    VLNTLFTSLNSPGQLRAWQANGGDPCGQSWQGITCSGSGVTKILLPNLSLTGNLAYNMNN  64

Query  385  LKSVTTFDISTNNLGN--SLPYQLP-PNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSH  555
            L S+   D+S NNLG    + Y LP   ++KLNLAGN F G LPYSIS M  L+YLN++H
Sbjct  65   LGSLVELDLSQNNLGGGGQIQYNLPNVKLEKLNLAGNQFGGNLPYSISTMPNLKYLNLNH  124

Query  556  NQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTIDVLAN  735
            NQLQG +T +F +L +LS LD SFNSL G++PQ+F+ L+++K MYLQNN FTG I+VLAN
Sbjct  125  NQLQGNITDVFSNLYSLSELDLSFNSLTGDLPQSFTGLSSLKRMYLQNNQFTGYINVLAN  184

Query  736  LPLDNL  753
            LPL+ L
Sbjct  185  LPLETL  190



>gb|KDO78351.1| hypothetical protein CISIN_1g005001mg [Citrus sinensis]
 gb|KDO78352.1| hypothetical protein CISIN_1g005001mg [Citrus sinensis]
Length=577

 Score =   205 bits (521),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 99/190 (52%), Positives = 135/190 (71%), Gaps = 0/190 (0%)
 Frame = +1

Query  184  TDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGS  363
            TD +D   L+ L++SLNSP  LT W  N GDPCGESWKGV+C G+ V  I ISGL L+G+
Sbjct  39   TDSSDVQALQVLYTSLNSPSVLTNWKGNEGDPCGESWKGVACEGSAVVSIDISGLGLSGT  98

Query  364  MGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYL  543
            MG+ L  L S+  FD+S N++ +++PYQLPPN+  LNLA N F+G LPYSI+ M  L YL
Sbjct  99   MGYLLSDLLSLRKFDLSGNSIHDTIPYQLPPNLTSLNLASNNFSGNLPYSIASMVSLSYL  158

Query  544  NVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTID  723
            NVS N L   +  +F +L  L+TLD SFN+ +G++P +F SL+N+ ++YLQNN  TG+++
Sbjct  159  NVSRNSLTQSIGDIFGNLAGLATLDLSFNNFSGDLPNSFISLSNISSLYLQNNQVTGSLN  218

Query  724  VLANLPLDNL  753
            V + LPL  L
Sbjct  219  VFSGLPLTTL  228



>ref|NP_001167741.1| uncharacterized protein LOC100381429 precursor [Zea mays]
 gb|ACN25932.1| unknown [Zea mays]
Length=720

 Score =   207 bits (527),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 100/196 (51%), Positives = 146/196 (74%), Gaps = 3/196 (2%)
 Frame = +1

Query  175  VADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQL  354
             A TD  D + L  LF+S+NSP QL  W  +GGDPCGESW+G++CSG+ VT I++  L L
Sbjct  27   AAATDANDVTALNTLFTSMNSPGQLQGWKVSGGDPCGESWQGITCSGSSVTAIKLPNLGL  86

Query  355  TGSMGFQLDQLKSVTTFDISTNNLG--NSLPYQLP-PNVQKLNLAGNGFTGGLPYSISQM  525
            +G++ + ++ + S+   D+S NNLG    +PY LP   +++LNLA N F+G +PYSIS M
Sbjct  87   SGNLAYNMNTMDSLVELDMSHNNLGGGQQIPYNLPNKKLERLNLAENQFSGSVPYSISTM  146

Query  526  APLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNV  705
              ++YLN++HNQL G++T +F +L +L+T+D S NSL GN+PQ+F+SL+++K +YLQNN 
Sbjct  147  PNIKYLNLNHNQLSGDITDIFSNLPSLTTVDLSSNSLTGNLPQSFTSLSSLKTLYLQNNQ  206

Query  706  FTGTIDVLANLPLDNL  753
             TG+I+VLANLPLD+L
Sbjct  207  LTGSINVLANLPLDDL  222



>ref|XP_007135353.1| hypothetical protein PHAVU_010G122100g [Phaseolus vulgaris]
 gb|ESW07347.1| hypothetical protein PHAVU_010G122100g [Phaseolus vulgaris]
Length=718

 Score =   207 bits (526),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 115/192 (60%), Positives = 147/192 (77%), Gaps = 3/192 (2%)
 Frame = +1

Query  178  ADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLT  357
             +TDP D + L+ +F S+NSPPQL  W  NG DPCG+SW+G++CSGNRVTEI++ G  L+
Sbjct  23   GETDPNDVASLKVMFQSMNSPPQLN-W--NGDDPCGQSWQGITCSGNRVTEIKLPGRSLS  79

Query  358  GSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLE  537
            GS+G+QL+ L  VT  D+S NNLG ++PYQLPPN+Q LNLA N F G +PYS+SQ   L 
Sbjct  80   GSLGYQLESLSLVTNLDLSNNNLGGTIPYQLPPNLQYLNLANNNFNGEVPYSLSQKTSLV  139

Query  538  YLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGT  717
             +N+ HNQLQ  + V F  L++LSTLD SFNSL GN+PQT SSL+++  MYLQNN FTGT
Sbjct  140  VVNLGHNQLQQALNVDFQKLSSLSTLDLSFNSLTGNLPQTLSSLSSISTMYLQNNQFTGT  199

Query  718  IDVLANLPLDNL  753
            I+VLANLPL+ L
Sbjct  200  INVLANLPLETL  211



>ref|XP_006597598.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like [Glycine 
max]
 gb|KHN32995.1| Protein STRUBBELIG-RECEPTOR FAMILY 8 [Glycine soja]
Length=710

 Score =   206 bits (525),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 99/210 (47%), Positives = 144/210 (69%), Gaps = 0/210 (0%)
 Frame = +1

Query  124  WAVALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGV  303
            + +++L+  +  A P ++A+TDP+D   L  ++++LNSP QLT W   GGDPCGESWKGV
Sbjct  6    FPLSILLSLVFVALPLSLANTDPSDVQALEVMYNALNSPTQLTGWKIGGGDPCGESWKGV  65

Query  304  SCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAG  483
            +C G+ V  I++SGL L G++G+ L  L S+   D+S N + +++PYQLPPN+  LN A 
Sbjct  66   TCEGSAVVSIKLSGLGLDGTLGYLLSDLMSLRELDLSDNKIHDTIPYQLPPNLTSLNFAR  125

Query  484  NGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFS  663
            N  +G LPYSIS M  L YLN+S+N L   V  +F SL +L TLD SFN+ +G++P +F 
Sbjct  126  NNLSGNLPYSISAMVSLNYLNLSNNALSMTVGDIFASLQDLGTLDLSFNNFSGDLPPSFV  185

Query  664  SLTNMKNMYLQNNVFTGTIDVLANLPLDNL  753
            +L N+ +++LQ N  TG++ VL  LPLD L
Sbjct  186  ALANLSSLFLQKNQLTGSLGVLVGLPLDTL  215



>ref|XP_006301930.1| hypothetical protein CARUB_v10022406mg [Capsella rubella]
 gb|EOA34828.1| hypothetical protein CARUB_v10022406mg [Capsella rubella]
Length=696

 Score =   206 bits (525),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 104/218 (48%), Positives = 149/218 (68%), Gaps = 6/218 (3%)
 Frame = +1

Query  100  MRELMGLPWAVALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDP  279
            M++L+ L   V+L I F L       A TD  + S L  +F+SLNSP +L  W ++GGDP
Sbjct  2    MQKLVSL-LIVSLAILFTL-----VQAKTDNQEVSALNVMFTSLNSPSKLKGWKSSGGDP  55

Query  280  CGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPN  459
            C  SW+GV C G+ VTE+Q+S  +L+GS+G+ L  LKS+TTFD+S NNL  ++PYQLPPN
Sbjct  56   CDGSWEGVKCKGSSVTELQLSSFELSGSLGYLLSNLKSLTTFDLSKNNLKGNIPYQLPPN  115

Query  460  VQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLA  639
            +  L+ + N   G +PYS+SQM  L+ +N+  N+L GE+  MF  L+ L TLD S N L+
Sbjct  116  LANLDFSENELDGNVPYSLSQMKSLQSINLGQNKLNGELPDMFQKLSKLETLDLSLNQLS  175

Query  640  GNIPQTFSSLTNMKNMYLQNNVFTGTIDVLANLPLDNL  753
            G +PQ+F++LT++K ++LQ N F G I+VL NL +D+L
Sbjct  176  GKLPQSFANLTSLKKLHLQENRFKGDINVLRNLAIDDL  213



>ref|XP_003571057.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8 [Brachypodium 
distachyon]
Length=715

 Score =   206 bits (525),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 98/189 (52%), Positives = 138/189 (73%), Gaps = 0/189 (0%)
 Frame = +1

Query  187  DPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSM  366
            + +DA+ L  L++S NSP QL  W+A+GGDPCG  W+GVSC+G+ VTEI+++G  L GS+
Sbjct  23   ESSDAAALGNLYTSWNSPSQLAGWSASGGDPCGAGWQGVSCNGSGVTEIKLAGTGLNGSL  82

Query  367  GFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYLN  546
            G++L  L S+ T D+S NN+  S+PYQLPPN+  LNLA N F+G LPYSIS MA +EYLN
Sbjct  83   GYELSNLYSLKTLDLSNNNIHGSIPYQLPPNLTYLNLATNNFSGNLPYSISNMASIEYLN  142

Query  547  VSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTIDV  726
            +SHN L  ++  +F +L +LS LD SFN L G++P +  SL+N+ ++Y+QNN  TG ++V
Sbjct  143  ISHNSLSQQIGDLFRNLNSLSELDISFNKLTGDLPNSIGSLSNISSLYMQNNQLTGPVNV  202

Query  727  LANLPLDNL  753
            L+ L L  L
Sbjct  203  LSGLGLTTL  211



>ref|XP_006650171.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7-like [Oryza brachyantha]
Length=741

 Score =   206 bits (525),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 100/193 (52%), Positives = 140/193 (73%), Gaps = 2/193 (1%)
 Frame = +1

Query  178  ADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLT  357
            ADT   D + L   +++LNSP  LT W A  GDPCG+SW G++CSG+RV  I++  + L 
Sbjct  37   ADTTSDDVTALNTFYTTLNSPSPLTNWVAQNGDPCGQSWLGITCSGSRVITIKLPSMGLQ  96

Query  358  GSMGFQLDQLKSVTTFDISTNNLGNS-LPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPL  534
            G++G+ ++ L ++   D+S NNLG S +PY LPPN+++LNL  N F+G LPYSISQM+ L
Sbjct  97   GTLGYNMNILTALVELDVSNNNLGGSDIPYNLPPNLERLNLENNSFSGTLPYSISQMSSL  156

Query  535  EYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTG  714
            +YLN+ HNQL G + VMF  LTNL+TLD S N  +G +P + SS+T++  ++LQNN FTG
Sbjct  157  KYLNIGHNQLSG-INVMFNQLTNLTTLDLSDNKFSGTLPDSLSSVTSLTMLHLQNNQFTG  215

Query  715  TIDVLANLPLDNL  753
            TIDVL++LPL +L
Sbjct  216  TIDVLSDLPLTDL  228



>gb|KDO78349.1| hypothetical protein CISIN_1g005001mg [Citrus sinensis]
 gb|KDO78350.1| hypothetical protein CISIN_1g005001mg [Citrus sinensis]
Length=618

 Score =   205 bits (521),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 99/190 (52%), Positives = 135/190 (71%), Gaps = 0/190 (0%)
 Frame = +1

Query  184  TDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGS  363
            TD +D   L+ L++SLNSP  LT W  N GDPCGESWKGV+C G+ V  I ISGL L+G+
Sbjct  39   TDSSDVQALQVLYTSLNSPSVLTNWKGNEGDPCGESWKGVACEGSAVVSIDISGLGLSGT  98

Query  364  MGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYL  543
            MG+ L  L S+  FD+S N++ +++PYQLPPN+  LNLA N F+G LPYSI+ M  L YL
Sbjct  99   MGYLLSDLLSLRKFDLSGNSIHDTIPYQLPPNLTSLNLASNNFSGNLPYSIASMVSLSYL  158

Query  544  NVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTID  723
            NVS N L   +  +F +L  L+TLD SFN+ +G++P +F SL+N+ ++YLQNN  TG+++
Sbjct  159  NVSRNSLTQSIGDIFGNLAGLATLDLSFNNFSGDLPNSFISLSNISSLYLQNNQVTGSLN  218

Query  724  VLANLPLDNL  753
            V + LPL  L
Sbjct  219  VFSGLPLTTL  228



>gb|KDO78348.1| hypothetical protein CISIN_1g005001mg [Citrus sinensis]
Length=621

 Score =   205 bits (521),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 99/190 (52%), Positives = 135/190 (71%), Gaps = 0/190 (0%)
 Frame = +1

Query  184  TDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGS  363
            TD +D   L+ L++SLNSP  LT W  N GDPCGESWKGV+C G+ V  I ISGL L+G+
Sbjct  39   TDSSDVQALQVLYTSLNSPSVLTNWKGNEGDPCGESWKGVACEGSAVVSIDISGLGLSGT  98

Query  364  MGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYL  543
            MG+ L  L S+  FD+S N++ +++PYQLPPN+  LNLA N F+G LPYSI+ M  L YL
Sbjct  99   MGYLLSDLLSLRKFDLSGNSIHDTIPYQLPPNLTSLNLASNNFSGNLPYSIASMVSLSYL  158

Query  544  NVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTID  723
            NVS N L   +  +F +L  L+TLD SFN+ +G++P +F SL+N+ ++YLQNN  TG+++
Sbjct  159  NVSRNSLTQSIGDIFGNLAGLATLDLSFNNFSGDLPNSFISLSNISSLYLQNNQVTGSLN  218

Query  724  VLANLPLDNL  753
            V + LPL  L
Sbjct  219  VFSGLPLTTL  228



>ref|XP_006449792.1| hypothetical protein CICLE_v10014418mg [Citrus clementina]
 gb|ESR63032.1| hypothetical protein CICLE_v10014418mg [Citrus clementina]
Length=618

 Score =   205 bits (521),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 99/190 (52%), Positives = 134/190 (71%), Gaps = 0/190 (0%)
 Frame = +1

Query  184  TDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGS  363
            TD +D   L+ L++SLNSP  LT W  NGGDPCGESWKGV+C G+ V  I +SGL L G+
Sbjct  39   TDSSDVLALQVLYTSLNSPSVLTNWKGNGGDPCGESWKGVACEGSAVVSIDVSGLGLNGT  98

Query  364  MGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYL  543
            MG+ L  L S+  FD+S N + +++PYQLPPN+  LNLA N F+G LPYSI+ M  L YL
Sbjct  99   MGYLLSDLLSLRKFDLSGNGIHDTIPYQLPPNLTSLNLASNNFSGNLPYSIASMVSLSYL  158

Query  544  NVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTID  723
            NVS N L   +  +F +L  L+TLD SFN+ +G++P +F SL+N+ ++YLQNN  TG+++
Sbjct  159  NVSRNWLTQSIGDIFGTLACLATLDLSFNNFSGDLPNSFISLSNISSLYLQNNQLTGSLN  218

Query  724  VLANLPLDNL  753
            V + LPL  L
Sbjct  219  VFSGLPLTTL  228



>emb|CDP04441.1| unnamed protein product [Coffea canephora]
Length=721

 Score =   206 bits (524),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 103/208 (50%), Positives = 144/208 (69%), Gaps = 5/208 (2%)
 Frame = +1

Query  130  VALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSC  309
            VA+L G L     +   +TD  D + L+ L++ LNSPPQLT W +NGGDPC ESWKG++C
Sbjct  23   VAILSGLL-----AVDGNTDQNDLTALQVLYNVLNSPPQLTGWKSNGGDPCAESWKGITC  77

Query  310  SGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNG  489
             G+ V  +Q+SGL L G+MG+ L+ L S+ T D+S N + + +PYQLPPN+  LNLA N 
Sbjct  78   QGSAVVSLQLSGLGLNGTMGYSLNSLMSLKTLDLSGNMIYDPIPYQLPPNLTSLNLAYNN  137

Query  490  FTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSL  669
             +G LPYS+S MA L YLNVSHN L   +  +F + ++++ LD S N+L G++PQ+F SL
Sbjct  138  ISGNLPYSLSGMAALSYLNVSHNSLSQSIVDVFNNHSDMAVLDLSSNNLTGDLPQSFISL  197

Query  670  TNMKNMYLQNNVFTGTIDVLANLPLDNL  753
            +N+  +YLQNN  TG++D L  LPL +L
Sbjct  198  SNLSTLYLQNNQLTGSLDSLVGLPLTDL  225



>ref|XP_010686780.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8 [Beta vulgaris 
subsp. vulgaris]
Length=712

 Score =   206 bits (523),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 99/192 (52%), Positives = 134/192 (70%), Gaps = 0/192 (0%)
 Frame = +1

Query  178  ADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLT  357
            A+TD  DA  L  L+ +LN+P QLT W A+GGDPCGESWKGV C G+ V  + ISGL ++
Sbjct  23   ANTDANDAQALHVLYGALNNPSQLTGWKADGGDPCGESWKGVKCDGSAVVSLDISGLGVS  82

Query  358  GSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLE  537
            G+MG+ L  L S+ T D+S NN+ +++P+QLPPN+  LNLA N  +GGLPYSI  M  L 
Sbjct  83   GTMGYLLTNLASLKTLDMSDNNIHDAIPFQLPPNLTSLNLAHNNLSGGLPYSIVSMVSLA  142

Query  538  YLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGT  717
            YLNVS N L   +  +F + T L+T+D S N+ +G IP TF +LTN+  + +QNN  TG+
Sbjct  143  YLNVSSNSLSQPIADVFSNHTALATIDLSHNNFSGEIPPTFRNLTNISTLEIQNNQLTGS  202

Query  718  IDVLANLPLDNL  753
            +D+L +LPLD L
Sbjct  203  LDILTSLPLDTL  214



>ref|XP_009781362.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5-like isoform 
X1 [Nicotiana sylvestris]
Length=724

 Score =   206 bits (524),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 100/197 (51%), Positives = 149/197 (76%), Gaps = 1/197 (1%)
 Frame = +1

Query  166  PSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGE-SWKGVSCSGNRVTEIQIS  342
            P  ++ TD    S L  ++  L    +L  W  +GGDPCG+ SW+G+ CSG+ + EI +S
Sbjct  31   PVVLSKTDSRQVSALNNMYQYLKPSSKLEGWKKDGGDPCGDDSWQGIKCSGSDIIEIDLS  90

Query  343  GLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQ  522
            GL L+GS+GFQLD+L+ VT FD+S NNL +++PYQLPP  Q L+L+GN F+G +PYSISQ
Sbjct  91   GLGLSGSLGFQLDKLEKVTYFDVSKNNLKDNIPYQLPPRTQHLDLSGNQFSGTVPYSISQ  150

Query  523  MAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNN  702
            MA L++LN++HN++ G ++ MF  LT L+ +D SFNS++G++PQ+F SL+++  +++QNN
Sbjct  151  MADLKFLNLNHNKISGSLSDMFGQLTKLTEMDLSFNSISGSLPQSFRSLSSLSKLHMQNN  210

Query  703  VFTGTIDVLANLPLDNL  753
             FTG+I+VLA+LPLD+L
Sbjct  211  QFTGSINVLADLPLDDL  227



>ref|XP_004951618.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like [Setaria 
italica]
Length=720

 Score =   206 bits (523),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 97/186 (52%), Positives = 137/186 (74%), Gaps = 0/186 (0%)
 Frame = +1

Query  181  DTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTG  360
            +TD  DA+ L  L++S N P QL  W+A GGDPCG +W+GV+CSG  VTEI++ G+ L G
Sbjct  24   NTDSADAAALGNLYASWNGPSQLAGWSAGGGDPCGAAWQGVTCSGAGVTEIKLPGIGLNG  83

Query  361  SMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEY  540
            S+G++L  L S+ T D+S NNL  S+PYQLPPN+  LNLA N F+G LPYSI+ +A +EY
Sbjct  84   SLGYELSNLFSLKTLDLSNNNLHGSIPYQLPPNLTYLNLASNDFSGNLPYSITNLASIEY  143

Query  541  LNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTI  720
            LN+SHN L  ++  +F +L++LS LD SFN L G++P +  SL+N+ ++Y+QNN FTG++
Sbjct  144  LNLSHNSLLNQMGELFGNLSSLSELDVSFNKLTGDLPNSIGSLSNLSSLYMQNNQFTGSV  203

Query  721  DVLANL  738
            +VL  L
Sbjct  204  NVLRGL  209



>ref|XP_010539255.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8 isoform X1 [Tarenaya 
hassleriana]
Length=702

 Score =   205 bits (522),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 103/208 (50%), Positives = 140/208 (67%), Gaps = 5/208 (2%)
 Frame = +1

Query  130  VALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSC  309
            V  ++GF      S    TDP+D   L+ L++SLNSP QLT W + GGDPCGESWKGV+C
Sbjct  16   VVWILGF-----SSVHCATDPSDVQALQVLYTSLNSPSQLTNWKSGGGDPCGESWKGVTC  70

Query  310  SGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNG  489
             G+ V  I IS L ++G++G+ L  L S+   D++ NN+ + +PYQLPPN+  LNLA N 
Sbjct  71   EGSAVVSIDISELGVSGTLGYLLSDLMSLRNLDVNGNNIHDIIPYQLPPNLTSLNLARNN  130

Query  490  FTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSL  669
             +G LPYSIS M  L Y+NVSHN L   +  +F +  +LSTLD S N+L G++P +FS+L
Sbjct  131  LSGNLPYSISTMVSLSYMNVSHNSLSMSIGDIFGTHDSLSTLDLSHNNLTGDLPSSFSTL  190

Query  670  TNMKNMYLQNNVFTGTIDVLANLPLDNL  753
            T +  +Y+QNN  TG+IDVL+ LPL  L
Sbjct  191  TKLSVLYVQNNQLTGSIDVLSGLPLTTL  218



>ref|XP_010539262.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8 isoform X2 [Tarenaya 
hassleriana]
Length=699

 Score =   205 bits (521),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 103/208 (50%), Positives = 140/208 (67%), Gaps = 5/208 (2%)
 Frame = +1

Query  130  VALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSC  309
            V  ++GF      S    TDP+D   L+ L++SLNSP QLT W + GGDPCGESWKGV+C
Sbjct  16   VVWILGF-----SSVHCATDPSDVQALQVLYTSLNSPSQLTNWKSGGGDPCGESWKGVTC  70

Query  310  SGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNG  489
             G+ V  I IS L ++G++G+ L  L S+   D++ NN+ + +PYQLPPN+  LNLA N 
Sbjct  71   EGSAVVSIDISELGVSGTLGYLLSDLMSLRNLDVNGNNIHDIIPYQLPPNLTSLNLARNN  130

Query  490  FTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSL  669
             +G LPYSIS M  L Y+NVSHN L   +  +F +  +LSTLD S N+L G++P +FS+L
Sbjct  131  LSGNLPYSISTMVSLSYMNVSHNSLSMSIGDIFGTHDSLSTLDLSHNNLTGDLPSSFSTL  190

Query  670  TNMKNMYLQNNVFTGTIDVLANLPLDNL  753
            T +  +Y+QNN  TG+IDVL+ LPL  L
Sbjct  191  TKLSVLYVQNNQLTGSIDVLSGLPLTTL  218



>ref|XP_010539270.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8 isoform X3 [Tarenaya 
hassleriana]
Length=685

 Score =   205 bits (521),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 103/208 (50%), Positives = 140/208 (67%), Gaps = 5/208 (2%)
 Frame = +1

Query  130  VALLIGFLLNAPPSAVADTDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSC  309
            V  ++GF      S    TDP+D   L+ L++SLNSP QLT W + GGDPCGESWKGV+C
Sbjct  16   VVWILGF-----SSVHCATDPSDVQALQVLYTSLNSPSQLTNWKSGGGDPCGESWKGVTC  70

Query  310  SGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNG  489
             G+ V  I IS L ++G++G+ L  L S+   D++ NN+ + +PYQLPPN+  LNLA N 
Sbjct  71   EGSAVVSIDISELGVSGTLGYLLSDLMSLRNLDVNGNNIHDIIPYQLPPNLTSLNLARNN  130

Query  490  FTGGLPYSISQMAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSL  669
             +G LPYSIS M  L Y+NVSHN L   +  +F +  +LSTLD S N+L G++P +FS+L
Sbjct  131  LSGNLPYSISTMVSLSYMNVSHNSLSMSIGDIFGTHDSLSTLDLSHNNLTGDLPSSFSTL  190

Query  670  TNMKNMYLQNNVFTGTIDVLANLPLDNL  753
            T +  +Y+QNN  TG+IDVL+ LPL  L
Sbjct  191  TKLSVLYVQNNQLTGSIDVLSGLPLTTL  218



>dbj|BAG99361.1| unnamed protein product [Oryza sativa Japonica Group]
Length=683

 Score =   205 bits (521),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 100/176 (57%), Positives = 133/176 (76%), Gaps = 2/176 (1%)
 Frame = +1

Query  229  LNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGSMGFQLDQLKSVTTFD  408
            +NSP QLT W +  GDPCG+SW G++CSG+RVT I++SG+ + G++G+ ++ L S+   D
Sbjct  1    MNSPSQLTNWVSQNGDPCGQSWLGITCSGSRVTAIKLSGMGINGTLGYNMNLLTSLVELD  60

Query  409  ISTNNLGNS-LPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYLNVSHNQLQGEVTVM  585
             S NNLG S +PY LPPN+++LNLA N FTG +PYSISQM  L  LN+ HN L      M
Sbjct  61   TSKNNLGGSDIPYNLPPNLERLNLAENNFTGSIPYSISQMIALRILNLGHNHL-ATTNDM  119

Query  586  FVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTIDVLANLPLDNL  753
            F  LTNL+TLD S+N+L+GNIPQ+F+SLTN++ + LQNN F GTIDVLA+LPL +L
Sbjct  120  FNQLTNLTTLDLSYNTLSGNIPQSFNSLTNLRKLNLQNNGFNGTIDVLADLPLTDL  175



>dbj|BAK02781.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=715

 Score =   205 bits (522),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 104/197 (53%), Positives = 140/197 (71%), Gaps = 1/197 (1%)
 Frame = +1

Query  166  PSAVADTDPTDASVLRGLFSSLNSPPQLTKWTA-NGGDPCGESWKGVSCSGNRVTEIQIS  342
            P   ADTD    + L  L++S NSP QL  W+A  GGDPCG +W GVSCSG+ +T I +S
Sbjct  19   PVVGADTDAAGVAALGNLYTSWNSPAQLVGWSAAGGGDPCGAAWTGVSCSGSAITSINLS  78

Query  343  GLQLTGSMGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQ  522
            G+ L G++G+QL  L ++TT D+S N+L + +PYQLPPN+  LNLA N F+G LPYSIS 
Sbjct  79   GMGLNGTLGYQLASLVALTTMDLSNNSLHDVIPYQLPPNLIHLNLARNNFSGDLPYSISN  138

Query  523  MAPLEYLNVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNN  702
            +  L YLNVSHN L  E+  +F  L +LS LD SFN+L+GN+P +F SL+N+ ++Y+QNN
Sbjct  139  ILSLGYLNVSHNSLFQEIGELFGGLNSLSVLDLSFNNLSGNLPVSFVSLSNLSSLYMQNN  198

Query  703  VFTGTIDVLANLPLDNL  753
              TGT++VL+NL L  L
Sbjct  199  QLTGTVNVLSNLSLTTL  215



>ref|XP_008458998.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8 isoform X1 [Cucumis 
melo]
Length=711

 Score =   205 bits (522),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 95/190 (50%), Positives = 135/190 (71%), Gaps = 0/190 (0%)
 Frame = +1

Query  184  TDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGS  363
            TD +D   L+ +++SL+SPPQLT WT +GGDPC ESWKGV+C G+ V  I+ISGL L G+
Sbjct  25   TDASDVQALQVMYTSLDSPPQLTGWTVSGGDPCAESWKGVTCEGSAVVSIEISGLGLNGT  84

Query  364  MGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYL  543
            MG+ L    S+   D+S NN+ +++PYQLPPN+  LN+A N   G LPYS S MA L YL
Sbjct  85   MGYALSSFLSLKKLDMSDNNIHDAIPYQLPPNLTSLNMAKNSLIGNLPYSFSTMASLNYL  144

Query  544  NVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTID  723
            N+SHN L   +  +F +LT L TLD SFN+  G++P++  +L+N+ +++LQNN  TG+++
Sbjct  145  NMSHNLLSQVIGDVFTNLTTLETLDLSFNNFTGDLPKSLGTLSNVSSLFLQNNGLTGSLN  204

Query  724  VLANLPLDNL  753
            +L +LPL  L
Sbjct  205  ILIDLPLTTL  214



>ref|XP_009386651.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like [Musa acuminata 
subsp. malaccensis]
Length=735

 Score =   205 bits (522),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 103/190 (54%), Positives = 131/190 (69%), Gaps = 0/190 (0%)
 Frame = +1

Query  184  TDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGS  363
            TD  D   L  L++SLNSP QL+ WT +GGDPCG SW GVSCSG+ V  I +SGL L GS
Sbjct  43   TDSLDVPALGVLYASLNSPRQLSGWTRSGGDPCGTSWLGVSCSGSAVVAIHLSGLGLNGS  102

Query  364  MGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYL  543
            +G+ L  L S+ T D+S NN+  ++PYQLPPN+  LNLAGN  +G LPYSIS M  L YL
Sbjct  103  LGYLLSDLLSLKTLDLSNNNIHETIPYQLPPNLTYLNLAGNDLSGNLPYSISSMVSLNYL  162

Query  544  NVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTID  723
            N+SHN L   V  +F  L +LS LD SFNS  G++P +F SL+N+ N+YLQ+N F G ++
Sbjct  163  NLSHNLLSQTVGDIFSDLQDLSELDLSFNSFTGDLPNSFGSLSNLSNLYLQDNQFMGPVN  222

Query  724  VLANLPLDNL  753
            +L NL L  L
Sbjct  223  ILVNLDLTTL  232



>ref|XP_006467380.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like isoform 
X1 [Citrus sinensis]
Length=720

 Score =   205 bits (521),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 99/190 (52%), Positives = 135/190 (71%), Gaps = 0/190 (0%)
 Frame = +1

Query  184  TDPTDASVLRGLFSSLNSPPQLTKWTANGGDPCGESWKGVSCSGNRVTEIQISGLQLTGS  363
            TD +D   L+ L++SLNSP  LT W  N GDPCGESWKGV+C G+ V  I ISGL L+G+
Sbjct  39   TDSSDVQALQVLYTSLNSPSVLTNWKGNEGDPCGESWKGVACEGSAVVSIDISGLGLSGT  98

Query  364  MGFQLDQLKSVTTFDISTNNLGNSLPYQLPPNVQKLNLAGNGFTGGLPYSISQMAPLEYL  543
            MG+ L  L S+  FD+S N++ +++PYQLPPN+  LNLA N F+G LPYSI+ M  L YL
Sbjct  99   MGYLLSDLLSLRKFDLSGNSIHDTIPYQLPPNLTSLNLASNNFSGNLPYSIASMVSLSYL  158

Query  544  NVSHNQLQGEVTVMFVSLTNLSTLDFSFNSLAGNIPQTFSSLTNMKNMYLQNNVFTGTID  723
            NVS N L   +  +F +L  L+TLD SFN+ +G++P +F SL+N+ ++YLQNN  TG+++
Sbjct  159  NVSRNSLTQSIGDIFGNLAGLATLDLSFNNFSGDLPNSFISLSNISSLYLQNNQLTGSLN  218

Query  724  VLANLPLDNL  753
            V + LPL  L
Sbjct  219  VFSGLPLTTL  228



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1401010927050