BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF045O04

Length=731
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009627792.1|  PREDICTED: calnexin homolog 1-like                 365   3e-120   Nicotiana tomentosiformis
ref|XP_009796698.1|  PREDICTED: calnexin homolog 1-like                 365   5e-120   Nicotiana sylvestris
ref|XP_009627797.1|  PREDICTED: calnexin homolog 1-like                 363   1e-119   Nicotiana tomentosiformis
gb|AIL30503.1|  calnexin-like protein                                   363   3e-119   Nicotiana tabacum [American tobacco]
ref|NP_001234129.1|  calnexin-like protein precursor                    362   4e-119   Solanum lycopersicum
ref|XP_009792195.1|  PREDICTED: calnexin homolog 1-like                 362   8e-119   Nicotiana sylvestris
ref|XP_006341454.1|  PREDICTED: calnexin homolog                        358   1e-117   Solanum tuberosum [potatoes]
ref|XP_006366282.1|  PREDICTED: calnexin homolog                        353   1e-115   Solanum tuberosum [potatoes]
ref|XP_004241643.1|  PREDICTED: calnexin homolog 1-like isoform X2      351   9e-115   
ref|XP_010322635.1|  PREDICTED: calnexin homolog 1-like isoform X1      351   2e-114   
ref|XP_011082819.1|  PREDICTED: calnexin homolog 1                      345   3e-112   Sesamum indicum [beniseed]
emb|CDO98285.1|  unnamed protein product                                344   4e-112   Coffea canephora [robusta coffee]
sp|Q39994.1|CALX_HELTU  RecName: Full=Calnexin homolog; Flags: Pr...    337   2e-109   Helianthus tuberosus [Jerusalem artichoke]
ref|XP_010112005.1|  Calnexin-1-like protein                            333   7e-108   Morus notabilis
gb|KDO57649.1|  hypothetical protein CISIN_1g009287mg                   328   4e-107   Citrus sinensis [apfelsine]
ref|XP_010929516.1|  PREDICTED: calnexin homolog                        330   1e-106   Elaeis guineensis
gb|KDO57646.1|  hypothetical protein CISIN_1g009287mg                   328   2e-106   Citrus sinensis [apfelsine]
ref|XP_006436992.1|  hypothetical protein CICLE_v10031185mg             328   3e-106   
gb|KDO57647.1|  hypothetical protein CISIN_1g009287mg                   329   4e-106   Citrus sinensis [apfelsine]
gb|KDO57648.1|  hypothetical protein CISIN_1g009287mg                   329   5e-106   Citrus sinensis [apfelsine]
ref|XP_006436993.1|  hypothetical protein CICLE_v10031185mg             328   5e-106   Citrus clementina [clementine]
gb|KJB38820.1|  hypothetical protein B456_006G273500                    325   6e-106   Gossypium raimondii
gb|KJB38814.1|  hypothetical protein B456_006G273500                    325   1e-105   Gossypium raimondii
gb|KJB38816.1|  hypothetical protein B456_006G273500                    325   1e-105   Gossypium raimondii
emb|CAN83091.1|  hypothetical protein VITISV_041895                     327   3e-105   Vitis vinifera
ref|XP_002277666.1|  PREDICTED: calnexin homolog                        327   3e-105   Vitis vinifera
ref|XP_007159940.1|  hypothetical protein PHAVU_002G280200g             326   4e-105   Phaseolus vulgaris [French bean]
ref|XP_006485059.1|  PREDICTED: calnexin homolog                        326   5e-105   Citrus sinensis [apfelsine]
gb|KJB38817.1|  hypothetical protein B456_006G273500                    325   5e-105   Gossypium raimondii
ref|XP_008797088.1|  PREDICTED: calnexin homolog                        326   5e-105   Phoenix dactylifera
gb|KJB38818.1|  hypothetical protein B456_006G273500                    325   5e-105   Gossypium raimondii
gb|KJB38815.1|  hypothetical protein B456_006G273500                    325   1e-104   Gossypium raimondii
ref|XP_004503810.1|  PREDICTED: calnexin homolog isoform X2             323   5e-104   Cicer arietinum [garbanzo]
ref|XP_011040303.1|  PREDICTED: calnexin homolog                        323   5e-104   Populus euphratica
ref|XP_002321768.1|  Calnexin precursor family protein                  323   6e-104   Populus trichocarpa [western balsam poplar]
ref|XP_007159942.1|  hypothetical protein PHAVU_002G280300g             323   6e-104   Phaseolus vulgaris [French bean]
ref|XP_007159941.1|  hypothetical protein PHAVU_002G280300g             323   7e-104   Phaseolus vulgaris [French bean]
ref|XP_010942328.1|  PREDICTED: calnexin homolog                        323   7e-104   Elaeis guineensis
ref|XP_008807839.1|  PREDICTED: calnexin homolog                        323   1e-103   Phoenix dactylifera
gb|KJB38819.1|  hypothetical protein B456_006G273500                    322   1e-103   Gossypium raimondii
gb|AFK41331.1|  unknown                                                 311   2e-103   Lotus japonicus
ref|XP_004503809.1|  PREDICTED: calnexin homolog isoform X1             323   3e-103   
ref|XP_003523183.1|  PREDICTED: calnexin homolog                        321   5e-103   Glycine max [soybeans]
ref|XP_010695743.1|  PREDICTED: calnexin homolog                        320   9e-103   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008245696.1|  PREDICTED: calnexin homolog 1-like                 320   1e-102   Prunus mume [ume]
gb|KDP22513.1|  hypothetical protein JCGZ_26344                         320   1e-102   Jatropha curcas
ref|NP_001235116.1|  calnexin homolog precursor                         320   1e-102   Glycine max [soybeans]
ref|XP_010249367.1|  PREDICTED: calnexin homolog                        320   2e-102   Nelumbo nucifera [Indian lotus]
gb|KHG05799.1|  Calnexin                                                320   2e-102   Gossypium arboreum [tree cotton]
gb|KHN31239.1|  Calnexin like                                           320   2e-102   Glycine soja [wild soybean]
dbj|BAD81043.1|  calnexin                                               320   2e-102   Glycine max [soybeans]
gb|KHG01556.1|  Calnexin                                                319   3e-102   Gossypium arboreum [tree cotton]
gb|AGV54271.1|  calnexin-like protein                                   319   4e-102   Phaseolus vulgaris [French bean]
ref|XP_010044902.1|  PREDICTED: calnexin homolog                        318   6e-102   Eucalyptus grandis [rose gum]
ref|XP_008375429.1|  PREDICTED: calnexin homolog                        318   7e-102   
ref|XP_007209878.1|  hypothetical protein PRUPE_ppa003899mg             318   7e-102   Prunus persica
ref|XP_002273708.1|  PREDICTED: calnexin homolog                        317   1e-101   Vitis vinifera
ref|XP_011003527.1|  PREDICTED: calnexin homolog                        317   1e-101   Populus euphratica
gb|ACN41018.1|  unknown                                                 317   2e-101   Picea sitchensis
gb|KJB07903.1|  hypothetical protein B456_001G053400                    314   2e-101   Gossypium raimondii
ref|XP_007038183.1|  Calnexin 1                                         316   4e-101   
ref|XP_002511066.1|  calnexin, putative                                 316   4e-101   Ricinus communis
gb|KCW87020.1|  hypothetical protein EUGRSUZ_B03570                     318   4e-101   Eucalyptus grandis [rose gum]
gb|KJB07904.1|  hypothetical protein B456_001G053400                    316   4e-101   Gossypium raimondii
gb|KJB07906.1|  hypothetical protein B456_001G053400                    316   5e-101   Gossypium raimondii
gb|KCW87019.1|  hypothetical protein EUGRSUZ_B03570                     318   5e-101   Eucalyptus grandis [rose gum]
ref|XP_008360201.1|  PREDICTED: calnexin homolog 1-like                 316   6e-101   
ref|XP_010044903.1|  PREDICTED: calnexin homolog                        316   6e-101   Eucalyptus grandis [rose gum]
ref|XP_008369590.1|  PREDICTED: calnexin homolog                        316   6e-101   
ref|XP_004309487.1|  PREDICTED: calnexin homolog                        315   2e-100   Fragaria vesca subsp. vesca
ref|XP_010249364.1|  PREDICTED: calnexin homolog                        314   2e-100   Nelumbo nucifera [Indian lotus]
ref|XP_008440191.1|  PREDICTED: calnexin homolog                        314   3e-100   Cucumis melo [Oriental melon]
ref|XP_008392683.1|  PREDICTED: calnexin homolog                        313   5e-100   
ref|XP_004975494.1|  PREDICTED: calnexin homolog                        313   6e-100   Setaria italica
ref|XP_003532294.1|  PREDICTED: calnexin homolog                        313   6e-100   Glycine max [soybeans]
ref|XP_009359843.1|  PREDICTED: calnexin homolog 1-like                 313   8e-100   Pyrus x bretschneideri [bai li]
ref|XP_006399216.1|  hypothetical protein EUTSA_v10013223mg             310   8e-100   
gb|KFK25123.1|  hypothetical protein AALP_AA8G068700                    312   9e-100   Arabis alpina [alpine rockcress]
ref|XP_010452695.1|  PREDICTED: calnexin homolog 2-like                 310   1e-99    Camelina sativa [gold-of-pleasure]
ref|XP_003525166.1|  PREDICTED: calnexin homolog                        312   2e-99    Glycine max [soybeans]
gb|EMS59517.1|  Calnexin-like protein 1                                 311   2e-99    Triticum urartu
ref|XP_006399217.1|  hypothetical protein EUTSA_v10013223mg             311   3e-99    Eutrema salsugineum [saltwater cress]
ref|XP_009353485.1|  PREDICTED: calnexin homolog 1-like                 311   5e-99    Pyrus x bretschneideri [bai li]
ref|XP_009380017.1|  PREDICTED: calnexin homolog                        310   7e-99    Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001150317.1|  calnexin precursor                                 310   8e-99    Zea mays [maize]
ref|XP_009360274.1|  PREDICTED: calnexin homolog                        310   8e-99    Pyrus x bretschneideri [bai li]
ref|XP_007222238.1|  hypothetical protein PRUPE_ppa003823mg             310   1e-98    Prunus persica
ref|XP_002318189.1|  Calnexin precursor family protein                  310   1e-98    
ref|XP_004503036.1|  PREDICTED: calnexin homolog                        310   1e-98    Cicer arietinum [garbanzo]
ref|XP_010423220.1|  PREDICTED: calnexin homolog 2                      309   2e-98    Camelina sativa [gold-of-pleasure]
gb|KHN17447.1|  Calnexin like                                           310   2e-98    Glycine soja [wild soybean]
ref|XP_003602731.1|  Calnexin-like protein                              309   2e-98    Medicago truncatula
ref|XP_002866454.1|  calnexin 1                                         309   2e-98    
gb|KEH35681.1|  Calnexin 2                                              309   2e-98    Medicago truncatula
ref|XP_008663173.1|  PREDICTED: calnexin homolog                        308   3e-98    
dbj|BAK00820.1|  predicted protein                                      308   3e-98    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008222288.1|  PREDICTED: calnexin homolog                        309   3e-98    Prunus mume [ume]
dbj|BAJ94182.1|  predicted protein                                      308   4e-98    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009404191.1|  PREDICTED: calnexin homolog                        308   5e-98    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003630450.1|  Calnexin-like protein                              308   6e-98    Medicago truncatula
ref|NP_200987.1|  calnexin 1                                            307   1e-97    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010491342.1|  PREDICTED: calnexin homolog 2-like                 307   1e-97    Camelina sativa [gold-of-pleasure]
gb|KJB51312.1|  hypothetical protein B456_008G211600                    307   1e-97    Gossypium raimondii
ref|XP_009373671.1|  PREDICTED: calnexin homolog isoform X2             307   1e-97    Pyrus x bretschneideri [bai li]
ref|XP_009373670.1|  PREDICTED: calnexin homolog isoform X1             307   2e-97    
gb|EMT03767.1|  Calnexin-like protein                                   306   2e-97    
ref|XP_006287793.1|  hypothetical protein CARUB_v10001009mg             303   3e-97    
ref|XP_006280507.1|  hypothetical protein CARUB_v10026443mg             303   3e-97    
gb|EMT07009.1|  Calnexin-like protein                                   305   5e-97    
dbj|BAJ89767.1|  predicted protein                                      305   5e-97    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KHG01051.1|  Calnexin                                                305   6e-97    Gossypium arboreum [tree cotton]
ref|NP_001052692.1|  Os04g0402100                                       305   6e-97    
ref|XP_004145138.1|  PREDICTED: calnexin homolog 1-like                 305   6e-97    
gb|ACJ85683.1|  unknown                                                 304   2e-96    Medicago truncatula
ref|XP_006652238.1|  PREDICTED: calnexin homolog                        304   2e-96    Oryza brachyantha
emb|CDY16801.1|  BnaA09g05810D                                          303   3e-96    Brassica napus [oilseed rape]
ref|XP_010536572.1|  PREDICTED: calnexin homolog 1-like                 304   3e-96    Tarenaya hassleriana [spider flower]
emb|CDX87226.1|  BnaC09g05410D                                          303   4e-96    
ref|XP_009130175.1|  PREDICTED: calnexin homolog 1-like                 303   4e-96    Brassica rapa
gb|AAK84429.1|  putative papillar cell-specific calnexin                303   4e-96    Brassica napus [oilseed rape]
gb|EAY93972.1|  hypothetical protein OsI_15749                          303   5e-96    Oryza sativa Indica Group [Indian rice]
ref|XP_009390827.1|  PREDICTED: calnexin homolog 1-like                 303   5e-96    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006844691.1|  hypothetical protein AMTR_s00016p00245620          303   5e-96    Amborella trichopoda
ref|XP_009112002.1|  PREDICTED: calnexin homolog 1-like                 303   6e-96    Brassica rapa
ref|XP_009150122.1|  PREDICTED: calnexin homolog 1                      302   7e-96    Brassica rapa
gb|EAZ30613.1|  hypothetical protein OsJ_14665                          303   8e-96    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010555592.1|  PREDICTED: calnexin homolog 1-like                 302   1e-95    Tarenaya hassleriana [spider flower]
ref|XP_009380018.1|  PREDICTED: calnexin homolog 1-like                 303   1e-95    
emb|CDY00229.1|  BnaA06g21300D                                          302   1e-95    
ref|XP_010457723.1|  PREDICTED: calnexin homolog 1-like                 301   2e-95    Camelina sativa [gold-of-pleasure]
emb|CDX86955.1|  BnaC03g52250D                                          300   5e-95    
emb|CDY42878.1|  BnaAnng07030D                                          300   7e-95    Brassica napus [oilseed rape]
ref|XP_010444005.1|  PREDICTED: calnexin homolog 1-like                 300   8e-95    Camelina sativa [gold-of-pleasure]
ref|XP_010523385.1|  PREDICTED: calnexin homolog 1-like                 298   2e-94    Tarenaya hassleriana [spider flower]
ref|XP_010546112.1|  PREDICTED: calnexin homolog 1-like                 298   3e-94    Tarenaya hassleriana [spider flower]
ref|XP_010483861.1|  PREDICTED: calnexin homolog 1                      298   3e-94    Camelina sativa [gold-of-pleasure]
gb|KJB40065.1|  hypothetical protein B456_007G045500                    298   5e-94    Gossypium raimondii
gb|KJB40063.1|  hypothetical protein B456_007G045500                    298   5e-94    Gossypium raimondii
gb|KJB40064.1|  hypothetical protein B456_007G045500                    298   7e-94    Gossypium raimondii
sp|O82709.1|CALX_PEA  RecName: Full=Calnexin homolog; Flags: Prec...    297   1e-93    Pisum sativum [garden pea]
gb|KJB40062.1|  hypothetical protein B456_007G045500                    295   5e-93    Gossypium raimondii
ref|XP_008778288.1|  PREDICTED: calnexin homolog                        295   5e-93    
ref|XP_003567632.1|  PREDICTED: calnexin homolog                        294   2e-92    Brachypodium distachyon [annual false brome]
ref|XP_002866455.1|  hypothetical protein ARALYDRAFT_496347             305   1e-91    
gb|AGE09565.1|  CNX1-like protein                                       290   1e-91    Eucalyptus cladocalyx
ref|XP_006478659.1|  PREDICTED: calnexin homolog                        293   2e-91    
gb|AAA17742.1|  calnexin homolog                                        291   2e-91    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010230383.1|  PREDICTED: calnexin homolog isoform X2             291   2e-91    
gb|KDP23235.1|  hypothetical protein JCGZ_23068                         291   2e-91    Jatropha curcas
ref|XP_010230382.1|  PREDICTED: calnexin homolog isoform X1             291   2e-91    Brachypodium distachyon [annual false brome]
ref|NP_001190249.1|  calnexin2                                          290   3e-91    Arabidopsis thaliana [mouse-ear cress]
gb|EPS68494.1|  calnexin-like protein                                   288   3e-91    Genlisea aurea
ref|NP_196351.1|  calnexin2                                             289   1e-90    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006423842.1|  hypothetical protein CICLE_v10028154mg             284   1e-88    
gb|KDO47053.1|  hypothetical protein CISIN_1g041813mg                   281   2e-87    Citrus sinensis [apfelsine]
ref|XP_001773029.1|  predicted protein                                  274   1e-84    
emb|CDY72297.1|  BnaAnng40540D                                          269   1e-83    Brassica napus [oilseed rape]
ref|XP_001773069.1|  predicted protein                                  264   3e-81    
ref|XP_001756944.1|  predicted protein                                  260   4e-80    
ref|XP_010910131.1|  PREDICTED: calnexin homolog                        251   4e-76    Elaeis guineensis
gb|KJB51311.1|  hypothetical protein B456_008G211600                    229   6e-68    Gossypium raimondii
ref|XP_001765831.1|  predicted protein                                  211   6e-62    
ref|XP_006368843.1|  hypothetical protein POPTR_0001s12690g             200   3e-57    
emb|CBI35623.3|  unnamed protein product                                169   4e-48    Vitis vinifera
ref|XP_005646109.1|  Calreticulin/calnexin                              172   4e-47    Coccomyxa subellipsoidea C-169
emb|CAA54678.1|  calnexin                                               170   3e-46    Zea mays [maize]
ref|XP_008722789.1|  hypothetical protein G647_01166                    172   6e-46    Cladophialophora carrionii CBS 160.54
ref|XP_007753338.1|  calnexin                                           172   6e-46    Cladophialophora yegresii CBS 114405
gb|KIW50413.1|  hypothetical protein PV05_12002                         171   7e-46    Exophiala xenobiotica
gb|KIW15177.1|  hypothetical protein PV08_05222                         170   2e-45    Exophiala spinifera
gb|KIW44450.1|  hypothetical protein PV06_02919                         169   4e-45    Exophiala oligosperma
ref|XP_008023635.1|  hypothetical protein SETTUDRAFT_168222             169   4e-45    Exserohilum turcica Et28A
gb|KEF58120.1|  calnexin                                                169   4e-45    Exophiala aquamarina CBS 119918
ref|XP_007750022.1|  calnexin                                           169   4e-45    Cladophialophora psammophila CBS 110553
gb|KIW77661.1|  hypothetical protein Z517_07493                         169   5e-45    Fonsecaea pedrosoi CBS 271.37
gb|KIW35677.1|  hypothetical protein PV07_02362                         169   6e-45    Cladophialophora immunda
gb|KIV88448.1|  hypothetical protein PV10_08131                         168   9e-45    Exophiala mesophila
gb|KIW72703.1|  hypothetical protein PV04_00879                         168   1e-44    Phialophora americana
gb|KIW90174.1|  hypothetical protein Z519_08817                         168   1e-44    Cladophialophora bantiana CBS 173.52
ref|XP_001794804.1|  hypothetical protein SNOG_04385                    167   1e-44    Parastagonospora nodorum SN15
gb|KIX97224.1|  hypothetical protein Z520_07339                         167   2e-44    Fonsecaea multimorphosa CBS 102226
gb|KIV80781.1|  hypothetical protein PV11_08258                         167   2e-44    Exophiala sideris
gb|EKG22397.1|  Calreticulin/calnexin                                   166   7e-44    Macrophomina phaseolina MS6
ref|XP_009155238.1|  calnexin                                           166   8e-44    Exophiala dermatitidis NIH/UT8656
ref|XP_007805590.1|  Calnexin                                           166   9e-44    Endocarpon pusillum Z07020
gb|KIX07491.1|  hypothetical protein Z518_02144                         165   1e-43    Rhinocladiella mackenziei CBS 650.93
emb|CCF46037.1|  calreticulin                                           159   1e-43    Colletotrichum higginsianum
ref|XP_007736137.1|  calnexin                                           165   2e-43    Capronia epimyces CBS 606.96
ref|XP_003839005.1|  similar to calnexin                                165   2e-43    Leptosphaeria maculans JN3
dbj|GAE00076.1|  calnexin precursor                                     165   2e-43    Byssochlamys spectabilis No. 5
ref|XP_002851011.1|  calnexin                                           164   2e-43    Microsporum canis CBS 113480
ref|XP_007689046.1|  hypothetical protein COCMIDRAFT_98137              164   2e-43    Bipolaris oryzae ATCC 44560
gb|EMD94330.1|  hypothetical protein COCHEDRAFT_1130883                 164   2e-43    Bipolaris maydis C5
ref|XP_003177596.1|  calnexin                                           164   2e-43    Nannizzia gypsea CBS 118893
ref|XP_007582295.1|  putative calnexin protein                          164   2e-43    
gb|KDB27473.1|  hypothetical protein H109_00736                         164   2e-43    Trichophyton interdigitale MR816
ref|XP_010757501.1|  hypothetical protein PADG_01565                    164   2e-43    Paracoccidioides brasiliensis Pb18
gb|EZF33950.1|  hypothetical protein H101_02494                         164   2e-43    Trichophyton interdigitale H6
ref|XP_007709681.1|  hypothetical protein COCCADRAFT_24118              164   3e-43    Bipolaris zeicola 26-R-13
gb|EEH20809.1|  hypothetical protein PABG_03040                         164   3e-43    Paracoccidioides brasiliensis Pb03
ref|XP_007701102.1|  hypothetical protein COCSADRAFT_38208              164   3e-43    Bipolaris sorokiniana ND90Pr
ref|XP_003013696.1|  hypothetical protein ARB_00147                     164   3e-43    Trichophyton benhamiae CBS 112371
ref|XP_003024212.1|  hypothetical protein TRV_01645                     164   4e-43    Trichophyton verrucosum HKI 0517
ref|XP_001816793.1|  calnexin protein                                   164   5e-43    Aspergillus oryzae RIB40
ref|XP_003324724.1|  calnexin                                           163   5e-43    Puccinia graminis f. sp. tritici CRL 75-36-700-3
ref|XP_002383280.1|  calnexin                                           163   5e-43    Aspergillus flavus NRRL3357
gb|EGE03014.1|  calnexin                                                163   5e-43    Trichophyton equinum CBS 127.97
gb|EGE00302.1|  calnexin                                                163   5e-43    Trichophyton tonsurans CBS 112818
gb|EMF10900.1|  calreticulin precursor                                  163   7e-43    Sphaerulina musiva SO2202
ref|XP_001212344.1|  calnexin precursor                                 163   8e-43    Aspergillus terreus NIH2624
gb|EYE92779.1|  calnexin precursor                                      162   9e-43    Aspergillus ruber CBS 135680
ref|XP_003231908.1|  calnexin                                           162   1e-42    Trichophyton rubrum CBS 118892
ref|XP_007724797.1|  calnexin                                           162   2e-42    Capronia coronata CBS 617.96
emb|CCX15881.1|  Similar to Calnexin homolog; acc. no. Q6Q487           162   2e-42    Pyronema omphalodes CBS 100304
ref|XP_001938332.1|  calreticulin precursor                             162   2e-42    Pyrenophora tritici-repentis Pt-1C-BFP
ref|XP_007413029.1|  hypothetical protein MELLADRAFT_72534              162   2e-42    Melampsora larici-populina 98AG31
ref|XP_002791126.1|  calnexin                                           161   3e-42    Paracoccidioides lutzii Pb01
ref|XP_003295857.1|  hypothetical protein PTT_03528                     161   3e-42    
ref|XP_002627579.1|  calnexin                                           160   5e-42    Blastomyces gilchristii SLH14081
gb|KFH43003.1|  Calnexin-like protein                                   160   6e-42    Acremonium chrysogenum ATCC 11550
gb|EEQ88189.1|  calnexin                                                160   6e-42    Blastomyces dermatitidis ER-3
emb|CCJ28173.1|  unnamed protein product                                160   1e-41    Pneumocystis jirovecii
ref|XP_002840340.1|  hypothetical protein                               159   1e-41    Tuber melanosporum Mel28
gb|ACI30657.1|  calreticulin                                            159   2e-41    Beauveria bassiana
ref|XP_008603048.1|  calreticulin family protein                        159   2e-41    Beauveria bassiana ARSEF 2860
gb|KGQ11752.1|  Calnexin                                                159   2e-41    Beauveria bassiana D1-5
tpe|CBF75819.1|  TPA: calnexin, putative (Eurofung)                     159   2e-41    Aspergillus nidulans FGSC A4
ref|XP_661196.1|  hypothetical protein AN3592.2                         159   2e-41    Aspergillus nidulans FGSC A4
gb|EWG37268.1|  calnexin                                                159   3e-41    Fusarium verticillioides 7600
emb|CCT62441.1|  probable calcium-binding protein precursor cnx1        159   3e-41    Fusarium fujikuroi IMI 58289
gb|ESA03120.1|  hypothetical protein GLOINDRAFT_336953                  158   3e-41    
gb|EGU80626.1|  hypothetical protein FOXB_08849                         158   4e-41    Fusarium oxysporum Fo5176
gb|EXK48260.1|  calnexin                                                158   4e-41    Fusarium oxysporum f. sp. melonis 26406
gb|EMT61884.1|  Calnexin like protein                                   158   4e-41    Fusarium oxysporum f. sp. cubense race 4
gb|ENH61055.1|  Calnexin like protein                                   158   4e-41    Fusarium oxysporum f. sp. cubense race 1
ref|XP_001389264.1|  calnexin protein                                   158   4e-41    Aspergillus niger CBS 513.88
dbj|GAA81928.1|  calnexin precursor                                     158   5e-41    Aspergillus kawachii IFO 4308
ref|XP_003853151.1|  calnexin protein                                   158   5e-41    Zymoseptoria tritici IPO323
gb|KEQ69874.1|  calnexin-like protein                                   158   6e-41    Aureobasidium namibiae CBS 147.97
ref|XP_007827647.1|  Calnexin                                           157   6e-41    Pestalotiopsis fici W106-1
gb|ENH88310.1|  calnexin precursor                                      157   6e-41    
ref|XP_002151134.1|  calnexin                                           157   7e-41    Talaromyces marneffei ATCC 18224
ref|XP_002341910.1|  calnexin                                           157   8e-41    Talaromyces stipitatus ATCC 10500
gb|EQB45337.1|  hypothetical protein CGLO_15805                         157   8e-41    Colletotrichum gloeosporioides Cg-14
gb|KFH63342.1|  calnexin                                                157   1e-40    Mortierella verticillata NRRL 6337
ref|XP_005824254.1|  hypothetical protein GUITHDRAFT_165512             157   1e-40    Guillardia theta CCMP2712
ref|XP_007281341.1|  calnexin precursor                                 157   1e-40    
gb|KEQ88681.1|  calnexin-like protein                                   156   2e-40    Aureobasidium pullulans EXF-150
ref|XP_011316164.1|  hypothetical protein FGSG_00491                    156   2e-40    Fusarium graminearum PH-1
ref|XP_009252752.1|  hypothetical protein FPSE_01357                    156   2e-40    Fusarium pseudograminearum CS3096
dbj|GAM41818.1|  ER-associated protein catabolism-related protein       156   2e-40    Talaromyces cellulolyticus
gb|KEQ65971.1|  Calreticulin-domain-containing protein                  155   3e-40    Aureobasidium melanogenum CBS 110374
ref|XP_007677414.1|  hypothetical protein BAUCODRAFT_35122              156   3e-40    Baudoinia panamericana UAMH 10762
emb|CCG81941.1|  Calnexin                                               155   3e-40    Taphrina deformans PYCC 5710
ref|XP_001272136.1|  calnexin                                           155   3e-40    Aspergillus clavatus NRRL 1
gb|EPS33667.1|  hypothetical protein PDE_08629                          155   4e-40    Penicillium oxalicum 114-2
gb|KEQ92935.1|  hypothetical protein AUEXF2481DRAFT_42635               155   4e-40    Aureobasidium subglaciale EXF-2481
gb|KIL95020.1|  calnexin                                                155   4e-40    Fusarium avenaceum
ref|XP_007779475.1|  hypothetical protein W97_03388                     155   5e-40    Coniosporium apollinis CBS 100218
gb|EKV07146.1|  hypothetical protein PDIG_74200                         155   5e-40    Penicillium digitatum PHI26
gb|KFH62471.1|  calnexin                                                155   5e-40    Mortierella verticillata NRRL 6337
ref|XP_002541105.1|  calnexin                                           155   6e-40    Uncinocarpus reesii 1704
gb|KFG87612.1|  calreticulin                                            155   6e-40    Metarhizium anisopliae
gb|KDB14801.1|  calreticulin                                            155   6e-40    Ustilaginoidea virens
gb|KGO37689.1|  Concanavalin A-like lectin/glucanase, subgroup          155   6e-40    Penicillium expansum
ref|XP_007596657.1|  calreticulin family protein                        155   7e-40    
ref|XP_007820406.1|  calreticulin                                       154   7e-40    Metarhizium robertsii ARSEF 23
gb|KID77010.1|  calreticulin                                            154   8e-40    Metarhizium brunneum ARSEF 3297
gb|KID90160.1|  calreticulin                                            154   8e-40    Metarhizium guizhouense ARSEF 977
gb|EFX05243.1|  calnexin precursor                                      154   8e-40    Grosmannia clavigera kw1407
gb|KDN61775.1|  putative calreticulin family protein                    154   9e-40    Colletotrichum sublineola
gb|KGO73367.1|  Concanavalin A-like lectin/glucanases superfamily       154   1e-39    Penicillium italicum
emb|CCA18171.1|  calciumdependent protein 2 putative                    154   1e-39    Albugo laibachii Nc14
gb|EFQ26293.1|  calreticulin family protein                             154   1e-39    Colletotrichum graminicola M1.001
gb|EEH07274.1|  calnexin                                                154   1e-39    Histoplasma capsulatum G186AR
gb|EER45416.1|  calnexin                                                154   1e-39    Histoplasma capsulatum H143
ref|XP_007929717.1|  hypothetical protein MYCFIDRAFT_50886              154   1e-39    Pseudocercospora fijiensis CIRAD86
gb|EGC41358.1|  calnexin                                                154   1e-39    Histoplasma capsulatum H88
dbj|GAM85986.1|  hypothetical protein ANO11243_039960                   154   1e-39    fungal sp. No.11243
emb|CEJ90531.1|  Putative Calnexin                                      154   2e-39    
gb|KHO00046.1|  calreticulin                                            154   2e-39    
ref|XP_003053601.1|  predicted protein                                  154   2e-39    
ref|XP_001538455.1|  hypothetical protein HCAG_06060                    153   2e-39    
ref|XP_007810134.1|  calreticulin                                       153   2e-39    
ref|XP_001266757.1|  calnexin                                           153   3e-39    
gb|EME43956.1|  hypothetical protein DOTSEDRAFT_71690                   153   3e-39    
ref|XP_002499895.1|  predicted protein                                  150   3e-39    
ref|XP_002564324.1|  Pc22g02800                                         152   4e-39    
ref|XP_008710607.1|  hypothetical protein HMPREF1541_00076              152   4e-39    
emb|CCE30657.1|  probable calcium-binding protein precursor cnx1        152   4e-39    
ref|XP_001246842.1|  calnexin homolog precursor                         152   4e-39    
ref|XP_003066418.1|  Calreticulin family protein                        152   5e-39    
gb|AAX45072.1|  calreticulin                                            152   6e-39    
ref|XP_003714591.1|  calnexin                                           152   6e-39    
ref|XP_006671496.1|  calnexin precursor                                 152   6e-39    
gb|ABF50964.1|  calnexin                                                152   7e-39    
ref|XP_008082646.1|  Concanavalin A-like lectins/glucanase              152   7e-39    
gb|EQK97868.1|  calreticulin                                            152   8e-39    
gb|KFA70495.1|  hypothetical protein S40285_00599                       151   9e-39    
gb|KEY64928.1|  hypothetical protein S7711_08927                        151   9e-39    
ref|XP_007872324.1|  hypothetical protein PNEG_00446                    151   1e-38    
gb|ERS98008.1|  hypothetical protein HMPREF1624_06181                   151   1e-38    
gb|KIH90408.1|  calnexin                                                151   1e-38    
gb|KEZ43169.1|  Calnexin-like protein                                   151   1e-38    
gb|KIE03263.1|  calreticulin                                            151   1e-38    
ref|XP_005774014.1|  hypothetical protein EMIHUDRAFT_50222              144   2e-38    
emb|CCF52833.1|  probable calnexin                                      151   2e-38    
gb|EPE04709.1|  calcium-binding protein precursor cnx1                  150   2e-38    
gb|ELR08206.1|  hypothetical protein GMDG_03017                         150   2e-38    
gb|KFY40668.1|  hypothetical protein V494_03387                         150   2e-38    
gb|KFX88415.1|  hypothetical protein V490_07668                         150   2e-38    
gb|KFY58743.1|  hypothetical protein V497_04663                         150   2e-38    
gb|KFY12288.1|  hypothetical protein V492_03970                         150   2e-38    
emb|CDI53472.1|  probable calnexin (C-terminal fragment)                150   3e-38    
gb|KFY43452.1|  hypothetical protein V495_03949                         150   3e-38    
ref|XP_964700.3|  calreticulin                                          150   3e-38    
gb|KFY88709.1|  hypothetical protein V500_06176                         150   3e-38    
gb|KFZ10762.1|  hypothetical protein V502_07938                         150   3e-38    
ref|XP_011389173.1|  putative calnexin                                  149   3e-38    
dbj|GAC71845.1|  calnexin                                               150   4e-38    
ref|XP_003284899.1|  hypothetical protein DICPUDRAFT_91409              144   4e-38    
ref|XP_001560997.1|  calnexin precursor                                 150   4e-38    
dbj|GAC94159.1|  hypothetical protein PHSY_001728                       150   4e-38    
gb|KFA72521.1|  hypothetical protein S40288_07875                       149   4e-38    
gb|KDN53407.1|  Calreticulin-domain-containing protein                  149   4e-38    
ref|XP_003347545.1|  calcium-binding protein precursor cnx1             149   4e-38    
ref|XP_009217593.1|  calnexin                                           149   5e-38    
ref|XP_001220707.1|  hypothetical protein CHGG_01486                    149   5e-38    
ref|XP_001912989.1|  hypothetical protein                               149   6e-38    
emb|CBQ72992.1|  probable calnexin                                      149   6e-38    
ref|XP_004355969.1|  hypothetical protein DFA_08481                     152   7e-38    
ref|XP_009857315.1|  hypothetical protein NEUTE1DRAFT_74601             149   7e-38    
gb|KFY49299.1|  hypothetical protein V496_10119                         149   7e-38    
dbj|GAK64473.1|  conserved hypothetical protein                         150   7e-38    
gb|EST05575.1|  hypothetical protein PSEUBRA_SCAF5g02416                150   8e-38    
gb|KFY19185.1|  hypothetical protein V493_08094                         149   8e-38    
ref|XP_006676061.1|  hypothetical protein BATDEDRAFT_84872              149   8e-38    
ref|XP_002491218.1|  Calnexin                                           149   8e-38    
ref|XP_006683250.1|  hypothetical protein BATDEDRAFT_93009              149   8e-38    
ref|XP_007918440.1|  putative calcium-binding protein precursor c...    149   8e-38    
emb|CAB92410.1|  calreticulin-like protein                              148   1e-37    
ref|XP_006956133.1|  Calreticulin-domain-containing protein             148   1e-37    
gb|KFZ14968.1|  hypothetical protein V501_02956                         148   1e-37    
gb|KIY34555.1|  calnexin                                                148   1e-37    
dbj|GAA96853.1|  hypothetical protein E5Q_03526                         148   1e-37    
emb|CAL64800.1|  calnexin homologue                                     148   2e-37    
gb|KIR85688.1|  calnexin                                                148   2e-37    
ref|XP_003194070.1|  ER-associated protein catabolism-related pro...    147   2e-37    
gb|ESW97477.1|  Calnexin                                                147   2e-37    
gb|KIR47002.1|  calnexin                                                147   2e-37    
gb|KFY74256.1|  hypothetical protein V499_05712                         147   2e-37    
emb|CCI42589.1|  unnamed protein product                                147   2e-37    
gb|KIW07741.1|  hypothetical protein PV09_01671                         147   3e-37    
ref|XP_011400668.1|  Calnexin-like protein 1                            147   3e-37    
gb|KDE03231.1|  hypothetical protein MVLG_06288                         147   3e-37    
ref|XP_005845247.1|  hypothetical protein CHLNCDRAFT_136909             147   4e-37    
ref|XP_008910920.1|  hypothetical protein PPTG_15911                    146   5e-37    
gb|ETI39239.1|  hypothetical protein F443_15186                         146   5e-37    
ref|XP_003656746.1|  hypothetical protein THITE_2121824                 146   5e-37    
gb|ESZ98300.1|  calreticulin                                            146   6e-37    
gb|AFR95332.1|  calnexin                                                146   6e-37    
ref|XP_570776.1|  ER-associated protein catabolism-related protein      146   6e-37    
ref|XP_007789611.1|  putative calnexin precursor protein                146   7e-37    
ref|XP_005758760.1|  Calnexin                                           145   8e-37    
ref|XP_001594877.1|  calreticulin                                       146   1e-36    
emb|CEF97192.1|  Concanavalin A-like lectin/glucanases superfamily      145   1e-36    
ref|XP_011121725.1|  hypothetical protein AOL_s00078g160                145   1e-36    
ref|XP_006961171.1|  calnexin                                           145   1e-36    
ref|XP_007290301.1|  calreticulin                                       145   1e-36    
gb|KIN04066.1|  hypothetical protein OIDMADRAFT_159196                  145   2e-36    
gb|KHJ30535.1|  putative calnexin precursor                             145   2e-36    
ref|XP_007877575.1|  hypothetical protein PFL1_01872                    144   2e-36    
gb|EWC45165.1|  calnexin-like protein                                   144   3e-36    
gb|EKD02066.1|  ER-associated protein catabolism-related protein        144   5e-36    
gb|EHK48053.1|  calnexin                                                144   5e-36    
gb|EJT53275.1|  ER-associated protein catabolism-related protein        144   5e-36    
gb|KGB78111.1|  calnexin                                                143   8e-36    
ref|XP_002997004.1|  calnexin, putative                                 143   8e-36    
emb|CDR38455.1|  RHTO0S03e09692g1_1                                     143   1e-35    
gb|EMS26034.1|  calnexin                                                143   1e-35    
ref|XP_005536371.1|  calnexin                                           143   1e-35    
gb|EHK24760.1|  calnexin                                                142   1e-35    
ref|XP_001299721.1|  Calreticulin family protein                        142   2e-35    
gb|EIF46712.1|  calnexin                                                142   2e-35    
ref|XP_006695695.1|  hypothetical protein CTHT_0053590                  142   2e-35    
ref|XP_003658780.1|  hypothetical protein MYCTH_2295005                 142   2e-35    
ref|XP_007511042.1|  calnexin                                           141   4e-35    
ref|XP_009060914.1|  hypothetical protein LOTGIDRAFT_219285             141   4e-35    
gb|EPZ36059.1|  Concanavalin A-like lectin/glucanase, subgroup do...    141   4e-35    
ref|XP_751547.1|  calnexin                                              140   8e-35    
gb|AAS68033.1|  calnexin                                                140   8e-35    
emb|CDR42027.1|  CYFA0S08e02762g1_1                                     139   2e-34    
ref|XP_011273103.1|  Calnexin                                           139   2e-34    
dbj|BAJ86965.1|  predicted protein                                      139   2e-34    
gb|AEM89091.1|  calreticulin                                            132   2e-34    
ref|NP_001079415.1|  calnexin precursor                                 139   2e-34    
ref|XP_011111038.1|  hypothetical protein H072_5152                     139   2e-34    
ref|XP_009516789.1|  hypothetical protein PHYSODRAFT_294643             139   3e-34    
ref|XP_007906325.1|  PREDICTED: calnexin                                139   3e-34    
gb|AEM89089.1|  calreticulin                                            132   4e-34    
ref|XP_005995398.1|  PREDICTED: calnexin isoform X3                     137   8e-34    
emb|CDK24692.1|  unnamed protein product                                137   9e-34    
ref|XP_005097558.1|  PREDICTED: calnexin-like isoform X1                137   9e-34    
ref|XP_001729030.1|  hypothetical protein MGL_3818                      137   1e-33    
ref|XP_005995396.1|  PREDICTED: calnexin isoform X1                     138   1e-33    
ref|XP_005097559.1|  PREDICTED: calnexin-like isoform X2                137   1e-33    
emb|CCU99115.1|  unnamed protein product                                137   1e-33    
ref|XP_001416987.1|  predicted protein                                  134   2e-33    
ref|XP_500829.1|  YALI0B13156p                                          136   2e-33    
emb|CAC14219.1|  calnexin                                               136   2e-33    
gb|EPQ66287.1|  hypothetical protein BGT96224_ASP20100                  136   3e-33    
ref|XP_005707368.1|  calnexin                                           136   3e-33    
ref|XP_007002009.1|  hypothetical protein TREMEDRAFT_70669              135   4e-33    
ref|NP_001292307.1|  uncharacterized protein LOC105344505 precursor     135   5e-33    
ref|XP_007527184.1|  PREDICTED: calnexin isoform X2                     134   7e-33    
emb|CCU78909.1|  calnexin precursor                                     135   8e-33    
gb|KJB07905.1|  hypothetical protein B456_001G053400                    133   1e-32    
ref|NP_001005668.1|  calnexin precursor                                 135   1e-32    
ref|NP_001080326.1|  calnexin precursor                                 135   1e-32    
ref|XP_008488526.1|  PREDICTED: calmegin                                135   1e-32    
gb|KFM72861.1|  Calnexin                                                132   1e-32    
ref|XP_011370269.1|  PREDICTED: calnexin                                134   2e-32    
ref|XP_006923311.1|  PREDICTED: calnexin isoform X1                     134   2e-32    
gb|ELK03201.1|  Calnexin                                                134   2e-32    
gb|ACB72404.1|  calnexin alpha                                          133   2e-32    
gb|KFO98173.1|  Calmegin                                                133   2e-32    
gb|EFA78842.1|  calnexin                                                133   2e-32    
gb|ACB72403.1|  calnexin alpha                                          133   2e-32    
dbj|BAA11426.1|  calnexin                                               134   2e-32    
ref|XP_009019390.1|  hypothetical protein HELRODRAFT_184962             133   2e-32    
gb|ACB72405.1|  calnexin beta                                           132   3e-32    
ref|XP_001325490.1|  Calreticulin family protein                        133   3e-32    
gb|KFW78550.1|  Calnexin                                                133   4e-32    
ref|XP_006775448.1|  PREDICTED: LOW QUALITY PROTEIN: calnexin           132   4e-32    
ref|XP_005893495.1|  PREDICTED: calnexin isoform X2                     132   4e-32    
ref|XP_010084186.1|  PREDICTED: calnexin                                133   4e-32    
ref|XP_010174762.1|  PREDICTED: calnexin                                131   5e-32    
gb|KFZ49237.1|  Calnexin                                                131   5e-32    
ref|XP_004927743.1|  PREDICTED: calnexin-like                           132   5e-32    
gb|KFV17397.1|  Calnexin                                                133   5e-32    
ref|XP_008919276.1|  PREDICTED: calnexin isoform X2                     133   5e-32    
ref|XP_008919275.1|  PREDICTED: calnexin isoform X1                     133   5e-32    
ref|XP_005044741.1|  PREDICTED: calmegin isoform X3                     132   5e-32    
ref|XP_005845246.1|  hypothetical protein CHLNCDRAFT_136908             131   5e-32    
gb|KFZ60402.1|  Calnexin                                                132   5e-32    
ref|XP_007337680.1|  Calreticulin-domain-containing protein             132   5e-32    
ref|XP_010128680.1|  PREDICTED: LOW QUALITY PROTEIN: calnexin           132   5e-32    
ref|XP_009687590.1|  PREDICTED: calmegin                                133   5e-32    
ref|XP_006102599.1|  PREDICTED: calnexin                                132   5e-32    
ref|XP_008938003.1|  PREDICTED: calnexin isoform X2                     132   6e-32    
ref|XP_008938002.1|  PREDICTED: calnexin isoform X1                     132   6e-32    
ref|XP_008156898.1|  PREDICTED: calnexin isoform X1                     132   6e-32    
gb|KFQ18502.1|  Calnexin                                                132   6e-32    
ref|XP_005710568.1|  Calnexin                                           132   7e-32    
gb|EOA97896.1|  Calnexin                                                132   7e-32    
ref|XP_008548369.1|  PREDICTED: calnexin-like                           132   7e-32    
gb|ETE69501.1|  Calnexin                                                132   7e-32    
gb|KFW66140.1|  Calnexin                                                132   7e-32    
ref|XP_008627128.1|  PREDICTED: calnexin                                132   7e-32    
ref|XP_005523614.1|  PREDICTED: calnexin                                132   7e-32    
ref|XP_006874512.1|  PREDICTED: calnexin isoform X1                     132   7e-32    
gb|KFO55456.1|  Calnexin                                                132   7e-32    
gb|KGL99297.1|  Calnexin                                                132   7e-32    
ref|XP_009503170.1|  PREDICTED: LOW QUALITY PROTEIN: calnexin           132   7e-32    
ref|XP_009320934.1|  PREDICTED: calnexin                                132   7e-32    
ref|XP_009993420.1|  PREDICTED: calnexin                                132   7e-32    
gb|KFM12042.1|  Calnexin                                                132   8e-32    
gb|KFQ75007.1|  Calnexin                                                132   8e-32    
ref|XP_009585925.1|  PREDICTED: LOW QUALITY PROTEIN: calnexin-like      132   8e-32    
ref|XP_009816656.1|  PREDICTED: calnexin                                132   8e-32    
ref|XP_009284137.1|  PREDICTED: calnexin                                132   8e-32    
gb|KFP25177.1|  Calnexin                                                132   8e-32    
ref|XP_002735033.1|  PREDICTED: calnexin-like                           132   8e-32    
gb|KFV45416.1|  Calnexin                                                132   8e-32    
ref|XP_008500173.1|  PREDICTED: calnexin                                132   8e-32    
gb|KFQ36031.1|  Calnexin                                                132   8e-32    
gb|KFP94164.1|  Calnexin                                                132   8e-32    
ref|XP_009890874.1|  PREDICTED: calnexin                                132   8e-32    
gb|KFP78131.1|  Calnexin                                                132   8e-32    
gb|KFQ66770.1|  Calnexin                                                132   8e-32    
gb|KFO96405.1|  Calnexin                                                132   8e-32    
ref|XP_009980189.1|  PREDICTED: LOW QUALITY PROTEIN: calnexin-like      132   8e-32    
ref|XP_010299852.1|  PREDICTED: calnexin                                132   8e-32    
ref|XP_006987150.1|  PREDICTED: calnexin                                132   8e-32    
ref|XP_009974455.1|  PREDICTED: calnexin                                132   8e-32    
gb|KFW91097.1|  Calnexin                                                132   9e-32    
ref|XP_005503466.1|  PREDICTED: calnexin                                132   9e-32    
ref|XP_005242774.1|  PREDICTED: calnexin                                132   9e-32    
gb|KFW10934.1|  Calnexin                                                132   9e-32    
ref|XP_009697896.1|  PREDICTED: LOW QUALITY PROTEIN: calnexin           132   9e-32    
ref|XP_009916906.1|  PREDICTED: calnexin isoform X2                     132   9e-32    
ref|XP_009916905.1|  PREDICTED: calnexin isoform X1                     132   9e-32    
ref|XP_009872189.1|  PREDICTED: LOW QUALITY PROTEIN: calnexin           132   9e-32    
ref|XP_009970028.1|  PREDICTED: calmegin                                132   9e-32    
ref|XP_005440676.1|  PREDICTED: calnexin isoform X2                     132   9e-32    
ref|XP_009070696.1|  PREDICTED: calnexin                                132   9e-32    
ref|XP_005440675.1|  PREDICTED: calnexin isoform X1                     132   9e-32    
ref|XP_005024343.1|  PREDICTED: calnexin                                132   9e-32    
ref|XP_009930028.1|  PREDICTED: calnexin isoform X2                     132   9e-32    
ref|XP_010577211.1|  PREDICTED: calnexin isoform X2                     132   9e-32    



>ref|XP_009627792.1| PREDICTED: calnexin homolog 1-like [Nicotiana tomentosiformis]
Length=539

 Score =   365 bits (937),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 167/201 (83%), Positives = 188/201 (94%), Gaps = 0/201 (0%)
 Frame = +2

Query  128  MEEKKRKIWTQSVLLLVIGCFFSQLSASSDVKLYESFEEAFEGRWIVSEKEDYKGVWKHS  307
            MEE+ R++WTQ  LLL+ GCF SQL ASSDVK YESF+EAF+GRWI SEKEDY GVWKH+
Sbjct  1    MEERNRRMWTQYALLLLAGCFVSQLYASSDVKFYESFDEAFDGRWIASEKEDYNGVWKHA  60

Query  308  KSEGHEDHGLLVSEPARKYAIVKELDEVVNLKDGTVVLQYEVRLQNGLECGGAYIKYLRP  487
            KSEGH+DHGLLVSE ARKYAIVKELD+VV+LKDGTVVLQYEVRLQ+GLECGGAY+KYLRP
Sbjct  61   KSEGHDDHGLLVSEKARKYAIVKELDDVVDLKDGTVVLQYEVRLQDGLECGGAYLKYLRP  120

Query  488  QDAGWVAKEFDNESPYSIMFGPDKCGATNKVHFIFKHKNPKSGEYVEHHLKYPPSVPSDK  667
            Q+AGW+ KEF+NESPY+IMFGPDKCGATNKVHFI KHKNPKSGEY+EHHLK+PPSVPSDK
Sbjct  121  QEAGWIPKEFNNESPYTIMFGPDKCGATNKVHFILKHKNPKSGEYIEHHLKFPPSVPSDK  180

Query  668  LTHVYTAVLKPDNEVSILIDG  730
            LTHVYTAVL+P+NE+ ILIDG
Sbjct  181  LTHVYTAVLRPNNELLILIDG  201



>ref|XP_009796698.1| PREDICTED: calnexin homolog 1-like [Nicotiana sylvestris]
Length=539

 Score =   365 bits (936),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 167/201 (83%), Positives = 189/201 (94%), Gaps = 0/201 (0%)
 Frame = +2

Query  128  MEEKKRKIWTQSVLLLVIGCFFSQLSASSDVKLYESFEEAFEGRWIVSEKEDYKGVWKHS  307
            MEE+ R++WT+  LLL+ GCF SQL ASSDVK YESF+EAF+GRWIVSEKE+Y GVWKH+
Sbjct  1    MEERSRRMWTRYALLLLAGCFVSQLYASSDVKFYESFDEAFDGRWIVSEKEEYNGVWKHA  60

Query  308  KSEGHEDHGLLVSEPARKYAIVKELDEVVNLKDGTVVLQYEVRLQNGLECGGAYIKYLRP  487
            KSEGH+DHGLLVSE ARKYAIVKELD+VV+LKDGTVVLQYEVRLQ+GLECGGAY+KYLRP
Sbjct  61   KSEGHDDHGLLVSEKARKYAIVKELDDVVDLKDGTVVLQYEVRLQDGLECGGAYLKYLRP  120

Query  488  QDAGWVAKEFDNESPYSIMFGPDKCGATNKVHFIFKHKNPKSGEYVEHHLKYPPSVPSDK  667
            Q+AGW+ KEF+NESPY+IMFGPD+CGATNKVHFI KHKNPKSGEY+EHHLK+PPSVPSDK
Sbjct  121  QEAGWIPKEFNNESPYTIMFGPDRCGATNKVHFILKHKNPKSGEYIEHHLKFPPSVPSDK  180

Query  668  LTHVYTAVLKPDNEVSILIDG  730
            LTHVYTAVLKPDNE+ ILIDG
Sbjct  181  LTHVYTAVLKPDNELLILIDG  201



>ref|XP_009627797.1| PREDICTED: calnexin homolog 1-like [Nicotiana tomentosiformis]
Length=540

 Score =   363 bits (933),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 167/201 (83%), Positives = 189/201 (94%), Gaps = 0/201 (0%)
 Frame = +2

Query  128  MEEKKRKIWTQSVLLLVIGCFFSQLSASSDVKLYESFEEAFEGRWIVSEKEDYKGVWKHS  307
            M+E+ R++WTQ  LLL+ GCF SQL ASSDVK+YESF+EAF+GRWIVSEKEDY GVWKH+
Sbjct  1    MKEQNRRMWTQYALLLLAGCFVSQLYASSDVKIYESFDEAFDGRWIVSEKEDYNGVWKHA  60

Query  308  KSEGHEDHGLLVSEPARKYAIVKELDEVVNLKDGTVVLQYEVRLQNGLECGGAYIKYLRP  487
            KSEGH+D+GLLVSE ARKYAIVKELD+VV+LKDG VVLQYEVRLQ+GLECGGAY+KYLRP
Sbjct  61   KSEGHDDYGLLVSEKARKYAIVKELDDVVDLKDGAVVLQYEVRLQDGLECGGAYLKYLRP  120

Query  488  QDAGWVAKEFDNESPYSIMFGPDKCGATNKVHFIFKHKNPKSGEYVEHHLKYPPSVPSDK  667
            Q+AGW+ KEF+NESPY+IMFGPDKCGATNKVHFI KHKNPKSGEY+EHHLK+PPSVPSDK
Sbjct  121  QEAGWIPKEFNNESPYTIMFGPDKCGATNKVHFILKHKNPKSGEYIEHHLKFPPSVPSDK  180

Query  668  LTHVYTAVLKPDNEVSILIDG  730
            LTHVYTAVLKPDNE+ ILIDG
Sbjct  181  LTHVYTAVLKPDNELLILIDG  201



>gb|AIL30503.1| calnexin-like protein [Nicotiana tabacum]
Length=539

 Score =   363 bits (931),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 166/201 (83%), Positives = 188/201 (94%), Gaps = 0/201 (0%)
 Frame = +2

Query  128  MEEKKRKIWTQSVLLLVIGCFFSQLSASSDVKLYESFEEAFEGRWIVSEKEDYKGVWKHS  307
            MEE+ R++WT+  LLL+ GCF SQL ASSDVK YESF+EAF+GRWIVSEKE+Y GVWKH+
Sbjct  1    MEERSRRMWTRYALLLLAGCFVSQLYASSDVKFYESFDEAFDGRWIVSEKEEYNGVWKHA  60

Query  308  KSEGHEDHGLLVSEPARKYAIVKELDEVVNLKDGTVVLQYEVRLQNGLECGGAYIKYLRP  487
            KSEGH+DHGLLVSE ARKYAIVKELD+VV+LKDGTVVLQYEVRLQ+GLECGGAY+KYLRP
Sbjct  61   KSEGHDDHGLLVSEKARKYAIVKELDDVVDLKDGTVVLQYEVRLQDGLECGGAYLKYLRP  120

Query  488  QDAGWVAKEFDNESPYSIMFGPDKCGATNKVHFIFKHKNPKSGEYVEHHLKYPPSVPSDK  667
            Q+AGW+ KEF+NESPY+IMFGPD+CGATNKVHFI KHKNPKSGEY+EHHL +PPSVPSDK
Sbjct  121  QEAGWIPKEFNNESPYTIMFGPDRCGATNKVHFILKHKNPKSGEYIEHHLNFPPSVPSDK  180

Query  668  LTHVYTAVLKPDNEVSILIDG  730
            LTHVYTAVLKPDNE+ ILIDG
Sbjct  181  LTHVYTAVLKPDNELLILIDG  201



>ref|NP_001234129.1| calnexin-like protein precursor [Solanum lycopersicum]
 dbj|BAD99512.1| calnexin-like protein [Solanum lycopersicum]
Length=538

 Score =   362 bits (930),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 169/201 (84%), Positives = 185/201 (92%), Gaps = 0/201 (0%)
 Frame = +2

Query  128  MEEKKRKIWTQSVLLLVIGCFFSQLSASSDVKLYESFEEAFEGRWIVSEKEDYKGVWKHS  307
            MEE +RKIW Q   LL+  CFFSQL A+SDVK YESF+EAF+GRWIVSEKEDY GVWKH+
Sbjct  1    MEETRRKIWAQYAFLLLACCFFSQLYATSDVKFYESFDEAFDGRWIVSEKEDYSGVWKHA  60

Query  308  KSEGHEDHGLLVSEPARKYAIVKELDEVVNLKDGTVVLQYEVRLQNGLECGGAYIKYLRP  487
            KSEGH+D+GLLVSE ARKYAIVKELD VV+LKDGTVVLQYEVRLQ+GLECGGAYIKYLRP
Sbjct  61   KSEGHDDYGLLVSEKARKYAIVKELDNVVDLKDGTVVLQYEVRLQDGLECGGAYIKYLRP  120

Query  488  QDAGWVAKEFDNESPYSIMFGPDKCGATNKVHFIFKHKNPKSGEYVEHHLKYPPSVPSDK  667
            Q+AGW AK FDNESPY+IMFGPDKCGATNKVHFI KHKNPKSGEYVEHHLK+PPSVP+DK
Sbjct  121  QEAGWTAKGFDNESPYTIMFGPDKCGATNKVHFILKHKNPKSGEYVEHHLKFPPSVPADK  180

Query  668  LTHVYTAVLKPDNEVSILIDG  730
            LTHVYTAVLKPDN+V IL+DG
Sbjct  181  LTHVYTAVLKPDNDVLILVDG  201



>ref|XP_009792195.1| PREDICTED: calnexin homolog 1-like [Nicotiana sylvestris]
Length=539

 Score =   362 bits (928),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 167/201 (83%), Positives = 189/201 (94%), Gaps = 0/201 (0%)
 Frame = +2

Query  128  MEEKKRKIWTQSVLLLVIGCFFSQLSASSDVKLYESFEEAFEGRWIVSEKEDYKGVWKHS  307
            MEE+ R+IWTQ  LLL+ GCF SQL ASSDVK YESF++AF+GRWIVSEKE+Y GVWKH+
Sbjct  1    MEERNRRIWTQYSLLLLAGCFVSQLYASSDVKFYESFDKAFDGRWIVSEKEEYNGVWKHA  60

Query  308  KSEGHEDHGLLVSEPARKYAIVKELDEVVNLKDGTVVLQYEVRLQNGLECGGAYIKYLRP  487
            KSEGH+D+GLLVSE ARKYAIVKEL++VV+LKDGTVVLQYEVRLQ+GLECGGAY+KYLRP
Sbjct  61   KSEGHDDYGLLVSEKARKYAIVKELNDVVDLKDGTVVLQYEVRLQDGLECGGAYLKYLRP  120

Query  488  QDAGWVAKEFDNESPYSIMFGPDKCGATNKVHFIFKHKNPKSGEYVEHHLKYPPSVPSDK  667
            Q+AGW+ KEF+NESPY+IMFGPDKCGATNKVHFI KHKNPKSGEY+EHHLK+PPSVPSDK
Sbjct  121  QEAGWIPKEFNNESPYTIMFGPDKCGATNKVHFILKHKNPKSGEYIEHHLKFPPSVPSDK  180

Query  668  LTHVYTAVLKPDNEVSILIDG  730
            LTHVYTAVLKPDNE+ ILIDG
Sbjct  181  LTHVYTAVLKPDNELLILIDG  201



>ref|XP_006341454.1| PREDICTED: calnexin homolog [Solanum tuberosum]
Length=541

 Score =   358 bits (920),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 167/201 (83%), Positives = 185/201 (92%), Gaps = 0/201 (0%)
 Frame = +2

Query  128  MEEKKRKIWTQSVLLLVIGCFFSQLSASSDVKLYESFEEAFEGRWIVSEKEDYKGVWKHS  307
            MEE +RKIW Q   LL+  CFFSQL A+SDVK +ESF+EAF+GRWIVSEKE+Y GVWKH+
Sbjct  1    MEETRRKIWAQYAFLLLACCFFSQLYATSDVKFFESFDEAFDGRWIVSEKEEYSGVWKHA  60

Query  308  KSEGHEDHGLLVSEPARKYAIVKELDEVVNLKDGTVVLQYEVRLQNGLECGGAYIKYLRP  487
            KSEGH+D+GLLVSE ARKYAIVKELD VV+LKDGTVVLQYEVRLQ+GLECGGAYIKYLRP
Sbjct  61   KSEGHDDYGLLVSEKARKYAIVKELDNVVDLKDGTVVLQYEVRLQDGLECGGAYIKYLRP  120

Query  488  QDAGWVAKEFDNESPYSIMFGPDKCGATNKVHFIFKHKNPKSGEYVEHHLKYPPSVPSDK  667
            Q+AGW AK FDNESPY+IMFGPDKCGATNKVHFI KHKNPKSGEYVEHHLK+PPSVP+DK
Sbjct  121  QEAGWTAKGFDNESPYTIMFGPDKCGATNKVHFILKHKNPKSGEYVEHHLKFPPSVPADK  180

Query  668  LTHVYTAVLKPDNEVSILIDG  730
            LTHVYTAVLKPDN+V IL+DG
Sbjct  181  LTHVYTAVLKPDNDVLILVDG  201



>ref|XP_006366282.1| PREDICTED: calnexin homolog [Solanum tuberosum]
Length=538

 Score =   353 bits (907),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 160/201 (80%), Positives = 185/201 (92%), Gaps = 0/201 (0%)
 Frame = +2

Query  128  MEEKKRKIWTQSVLLLVIGCFFSQLSASSDVKLYESFEEAFEGRWIVSEKEDYKGVWKHS  307
            MEE+ R++WTQ  LLL+ GCF SQL ASSDVK YESF+EAF+GRWIVSEKE++ GVWKH+
Sbjct  1    MEERNRRMWTQYALLLLAGCFVSQLCASSDVKFYESFDEAFDGRWIVSEKEEFNGVWKHA  60

Query  308  KSEGHEDHGLLVSEPARKYAIVKELDEVVNLKDGTVVLQYEVRLQNGLECGGAYIKYLRP  487
            KSEGH+DHGLLVSE A+KYAIVKELD VV+L DGT+VLQYEVRLQ GLECGGAY+KYLRP
Sbjct  61   KSEGHDDHGLLVSEKAKKYAIVKELDNVVSLNDGTMVLQYEVRLQEGLECGGAYLKYLRP  120

Query  488  QDAGWVAKEFDNESPYSIMFGPDKCGATNKVHFIFKHKNPKSGEYVEHHLKYPPSVPSDK  667
            Q+AGW+ KEF NESPY+IMFGPD+CGAT+K+HFI KHKNPKSGEY+EHHLK+PPSVPSDK
Sbjct  121  QEAGWIPKEFSNESPYTIMFGPDRCGATDKIHFILKHKNPKSGEYIEHHLKFPPSVPSDK  180

Query  668  LTHVYTAVLKPDNEVSILIDG  730
            LTHVYTAVLKP+NE+ IL+DG
Sbjct  181  LTHVYTAVLKPNNELLILVDG  201



>ref|XP_004241643.1| PREDICTED: calnexin homolog 1-like isoform X2 [Solanum lycopersicum]
Length=538

 Score =   351 bits (901),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 158/201 (79%), Positives = 184/201 (92%), Gaps = 0/201 (0%)
 Frame = +2

Query  128  MEEKKRKIWTQSVLLLVIGCFFSQLSASSDVKLYESFEEAFEGRWIVSEKEDYKGVWKHS  307
            MEE+ R++WTQ  LLL+ GCF SQL ASSDVK YESF+E F+GRWIVS+KE++ GVWKH+
Sbjct  1    MEERNRRMWTQYALLLLAGCFVSQLYASSDVKFYESFDETFDGRWIVSQKEEFNGVWKHA  60

Query  308  KSEGHEDHGLLVSEPARKYAIVKELDEVVNLKDGTVVLQYEVRLQNGLECGGAYIKYLRP  487
            KSEGH+DHGLLVSE A+KYAIVKELD VV+L DGT+VLQYEVRLQ GLECGGAY+KYLRP
Sbjct  61   KSEGHDDHGLLVSEKAKKYAIVKELDNVVSLNDGTMVLQYEVRLQEGLECGGAYLKYLRP  120

Query  488  QDAGWVAKEFDNESPYSIMFGPDKCGATNKVHFIFKHKNPKSGEYVEHHLKYPPSVPSDK  667
            Q+AGW+ KEF NESPY+IMFGPD+CGAT+K+HFI KHKNPKSGEY+EHHLK+PPSVPSDK
Sbjct  121  QEAGWIPKEFSNESPYTIMFGPDRCGATDKIHFILKHKNPKSGEYIEHHLKFPPSVPSDK  180

Query  668  LTHVYTAVLKPDNEVSILIDG  730
            LTHVYTAVLKP+NE+ IL+DG
Sbjct  181  LTHVYTAVLKPNNELLILVDG  201



>ref|XP_010322635.1| PREDICTED: calnexin homolog 1-like isoform X1 [Solanum lycopersicum]
Length=552

 Score =   351 bits (900),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 158/208 (76%), Positives = 187/208 (90%), Gaps = 0/208 (0%)
 Frame = +2

Query  107  FRVRFSAMEEKKRKIWTQSVLLLVIGCFFSQLSASSDVKLYESFEEAFEGRWIVSEKEDY  286
            + + +  MEE+ R++WTQ  LLL+ GCF SQL ASSDVK YESF+E F+GRWIVS+KE++
Sbjct  8    YYIPYLIMEERNRRMWTQYALLLLAGCFVSQLYASSDVKFYESFDETFDGRWIVSQKEEF  67

Query  287  KGVWKHSKSEGHEDHGLLVSEPARKYAIVKELDEVVNLKDGTVVLQYEVRLQNGLECGGA  466
             GVWKH+KSEGH+DHGLLVSE A+KYAIVKELD VV+L DGT+VLQYEVRLQ GLECGGA
Sbjct  68   NGVWKHAKSEGHDDHGLLVSEKAKKYAIVKELDNVVSLNDGTMVLQYEVRLQEGLECGGA  127

Query  467  YIKYLRPQDAGWVAKEFDNESPYSIMFGPDKCGATNKVHFIFKHKNPKSGEYVEHHLKYP  646
            Y+KYLRPQ+AGW+ KEF NESPY+IMFGPD+CGAT+K+HFI KHKNPKSGEY+EHHLK+P
Sbjct  128  YLKYLRPQEAGWIPKEFSNESPYTIMFGPDRCGATDKIHFILKHKNPKSGEYIEHHLKFP  187

Query  647  PSVPSDKLTHVYTAVLKPDNEVSILIDG  730
            PSVPSDKLTHVYTAVLKP+NE+ IL+DG
Sbjct  188  PSVPSDKLTHVYTAVLKPNNELLILVDG  215



>ref|XP_011082819.1| PREDICTED: calnexin homolog 1 [Sesamum indicum]
Length=536

 Score =   345 bits (884),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 160/202 (79%), Positives = 176/202 (87%), Gaps = 1/202 (0%)
 Frame = +2

Query  128  MEEKKRKIW-TQSVLLLVIGCFFSQLSASSDVKLYESFEEAFEGRWIVSEKEDYKGVWKH  304
            ME+  RKIW  Q +LLL I CF  QL AS DVK YE F+E F+GRWIVSEK DY GVWKH
Sbjct  1    MEDPNRKIWIMQCLLLLSIACFVVQLYASDDVKFYEPFDEKFDGRWIVSEKSDYTGVWKH  60

Query  305  SKSEGHEDHGLLVSEPARKYAIVKELDEVVNLKDGTVVLQYEVRLQNGLECGGAYIKYLR  484
             KSEGH+DHGLLVSE ARKYAIVKELDE V LKDGT+VLQYEVRLQNGLECGGAYIKYLR
Sbjct  61   EKSEGHDDHGLLVSEKARKYAIVKELDEPVKLKDGTIVLQYEVRLQNGLECGGAYIKYLR  120

Query  485  PQDAGWVAKEFDNESPYSIMFGPDKCGATNKVHFIFKHKNPKSGEYVEHHLKYPPSVPSD  664
            PQDAGW  KEFDNESPY+IMFGPDKCG TNKVHFI KH+NPK+G+++EHHLK+PPSVP D
Sbjct  121  PQDAGWAPKEFDNESPYTIMFGPDKCGVTNKVHFILKHENPKTGKFIEHHLKFPPSVPLD  180

Query  665  KLTHVYTAVLKPDNEVSILIDG  730
            KLTHVYTA+LKPDNE+ IL+DG
Sbjct  181  KLTHVYTAILKPDNELRILVDG  202



>emb|CDO98285.1| unnamed protein product [Coffea canephora]
Length=541

 Score =   344 bits (883),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 161/202 (80%), Positives = 182/202 (90%), Gaps = 1/202 (0%)
 Frame = +2

Query  128  MEEKKRKIWTQSVLL-LVIGCFFSQLSASSDVKLYESFEEAFEGRWIVSEKEDYKGVWKH  304
            ME  KRK   + +LL LV+GCFFS+L ASS+ + YESFEEA EGRW+VS+KEDYKGVWK 
Sbjct  1    MERMKRKPNLRYLLLMLVVGCFFSELKASSNSEFYESFEEAIEGRWVVSQKEDYKGVWKR  60

Query  305  SKSEGHEDHGLLVSEPARKYAIVKELDEVVNLKDGTVVLQYEVRLQNGLECGGAYIKYLR  484
             KSEGH+D+GLLVSE A+KYAIVKELDE  +LKDGTVVLQYEVRLQ GLECGGAY+KYLR
Sbjct  61   EKSEGHDDYGLLVSEKAKKYAIVKELDEPADLKDGTVVLQYEVRLQEGLECGGAYLKYLR  120

Query  485  PQDAGWVAKEFDNESPYSIMFGPDKCGATNKVHFIFKHKNPKSGEYVEHHLKYPPSVPSD  664
            PQDAGW +KEFDNESPYSIMFGPDKCGATNKVHFI KHKNPK+GE++EHHLK+PPSVPSD
Sbjct  121  PQDAGWTSKEFDNESPYSIMFGPDKCGATNKVHFILKHKNPKTGEFIEHHLKFPPSVPSD  180

Query  665  KLTHVYTAVLKPDNEVSILIDG  730
            KLTH+YTA+LKPDNE+ ILIDG
Sbjct  181  KLTHIYTAILKPDNELRILIDG  202



>sp|Q39994.1|CALX_HELTU RecName: Full=Calnexin homolog; Flags: Precursor [Helianthus 
tuberosus]
 emb|CAA84491.1| calnexin [Helianthus tuberosus]
Length=540

 Score =   337 bits (865),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 160/203 (79%), Positives = 179/203 (88%), Gaps = 2/203 (1%)
 Frame = +2

Query  128  MEEKKRKI--WTQSVLLLVIGCFFSQLSASSDVKLYESFEEAFEGRWIVSEKEDYKGVWK  301
            ME  +RK+  + Q    ++IGCF SQ+ ASSD   YESF+E+FEG WIVSEKEDY G WK
Sbjct  1    MELSRRKMCCYIQFCCFVLIGCFISQICASSDAIFYESFDESFEGSWIVSEKEDYPGEWK  60

Query  302  HSKSEGHEDHGLLVSEPARKYAIVKELDEVVNLKDGTVVLQYEVRLQNGLECGGAYIKYL  481
            HSKSEGH+D+GLLVS+ ARKYAIVKEL++ V LKDGT+VLQYEVRLQNGLECGGAY+KYL
Sbjct  61   HSKSEGHDDYGLLVSDKARKYAIVKELEKPVELKDGTIVLQYEVRLQNGLECGGAYLKYL  120

Query  482  RPQDAGWVAKEFDNESPYSIMFGPDKCGATNKVHFIFKHKNPKSGEYVEHHLKYPPSVPS  661
            RPQDAGW AK FDNESPYSIMFGPDKCGATNKVHFI KHKNPKSG+YVEHHLK+PPSVPS
Sbjct  121  RPQDAGWTAKGFDNESPYSIMFGPDKCGATNKVHFILKHKNPKSGDYVEHHLKFPPSVPS  180

Query  662  DKLTHVYTAVLKPDNEVSILIDG  730
            DKLTHVYTAV+KPDNE+ ILIDG
Sbjct  181  DKLTHVYTAVIKPDNELVILIDG  203



>ref|XP_010112005.1| Calnexin-1-like protein [Morus notabilis]
 gb|EXC32350.1| Calnexin-1-like protein [Morus notabilis]
Length=548

 Score =   333 bits (855),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 153/198 (77%), Positives = 176/198 (89%), Gaps = 0/198 (0%)
 Frame = +2

Query  137  KKRKIWTQSVLLLVIGCFFSQLSASSDVKLYESFEEAFEGRWIVSEKEDYKGVWKHSKSE  316
            + R +    +L L+I CF  Q+ +SSD  LYESFE++FEGRWIVS+K+DY GVWKHSKSE
Sbjct  5    QPRNMMIPQLLFLLISCFAFQIRSSSDAILYESFEDSFEGRWIVSQKDDYNGVWKHSKSE  64

Query  317  GHEDHGLLVSEPARKYAIVKELDEVVNLKDGTVVLQYEVRLQNGLECGGAYIKYLRPQDA  496
            GH+D+GLLVSE ARKYAIVKELDE ++L D T+VLQYEVRLQNGLECGGAY+KYLRPQ+A
Sbjct  65   GHDDYGLLVSEKARKYAIVKELDEPLSLTDKTIVLQYEVRLQNGLECGGAYLKYLRPQEA  124

Query  497  GWVAKEFDNESPYSIMFGPDKCGATNKVHFIFKHKNPKSGEYVEHHLKYPPSVPSDKLTH  676
            GW AKEFDNESPYSIMFGPDKCG+TNKVHFI KHKNPK+GEYVEHHLK+PPSVPSDKLTH
Sbjct  125  GWKAKEFDNESPYSIMFGPDKCGSTNKVHFILKHKNPKNGEYVEHHLKFPPSVPSDKLTH  184

Query  677  VYTAVLKPDNEVSILIDG  730
            VYTA+L P+NE+ ILIDG
Sbjct  185  VYTAILSPNNELRILIDG  202



>gb|KDO57649.1| hypothetical protein CISIN_1g009287mg [Citrus sinensis]
Length=434

 Score =   328 bits (841),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 155/191 (81%), Positives = 173/191 (91%), Gaps = 1/191 (1%)
 Frame = +2

Query  161  SVLLLVIGCFFSQLSASSDVK-LYESFEEAFEGRWIVSEKEDYKGVWKHSKSEGHEDHGL  337
            ++LL      F  +SAS D   LYESF+E+FEGRWIVS+K++YKGVWKHSKSEGHED+GL
Sbjct  12   ALLLFAAFVSFQLISASDDATILYESFDESFEGRWIVSQKDEYKGVWKHSKSEGHEDYGL  71

Query  338  LVSEPARKYAIVKELDEVVNLKDGTVVLQYEVRLQNGLECGGAYIKYLRPQDAGWVAKEF  517
            LV EPA+KYAIVKELDE ++LKDGTVVLQYEVRLQNGLECGGAY+KYLRPQ+AGWV+KEF
Sbjct  72   LVGEPAKKYAIVKELDEPLSLKDGTVVLQYEVRLQNGLECGGAYLKYLRPQEAGWVSKEF  131

Query  518  DNESPYSIMFGPDKCGATNKVHFIFKHKNPKSGEYVEHHLKYPPSVPSDKLTHVYTAVLK  697
            DNESPY IMFGPDKCGATNKVHFI KHKNPKSGEY+EHHLK PPSVPSDKLTHVYTA+LK
Sbjct  132  DNESPYMIMFGPDKCGATNKVHFILKHKNPKSGEYIEHHLKNPPSVPSDKLTHVYTAILK  191

Query  698  PDNEVSILIDG  730
            PDNE+ ILIDG
Sbjct  192  PDNELRILIDG  202



>ref|XP_010929516.1| PREDICTED: calnexin homolog [Elaeis guineensis]
Length=539

 Score =   330 bits (846),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 157/189 (83%), Positives = 172/189 (91%), Gaps = 1/189 (1%)
 Frame = +2

Query  164  VLLLVIGCFFSQLSASSDVKLYESFEEAFEGRWIVSEKEDYKGVWKHSKSEGHEDHGLLV  343
            +LLL+I  F  Q+ A+ D   YESF+EAFEGRWIVSEKEDYKGVWKHSKSEGHED+GLLV
Sbjct  10   LLLLLIASFVLQIWAA-DPLFYESFDEAFEGRWIVSEKEDYKGVWKHSKSEGHEDYGLLV  68

Query  344  SEPARKYAIVKELDEVVNLKDGTVVLQYEVRLQNGLECGGAYIKYLRPQDAGWVAKEFDN  523
            SE ARKYAIVKELDE V LKDGTVVLQ EVRLQNGLECGGAY+KYLRPQ+AGW+ K FDN
Sbjct  69   SEKARKYAIVKELDEPVTLKDGTVVLQSEVRLQNGLECGGAYLKYLRPQEAGWIPKAFDN  128

Query  524  ESPYSIMFGPDKCGATNKVHFIFKHKNPKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKPD  703
            ESPY+IMFGPDKCG+TNKVHFI KHKNPKSG+++EHHLKYPPSVPSDKLTHVYTAVLKPD
Sbjct  129  ESPYTIMFGPDKCGSTNKVHFILKHKNPKSGKFIEHHLKYPPSVPSDKLTHVYTAVLKPD  188

Query  704  NEVSILIDG  730
            NE+ ILIDG
Sbjct  189  NELKILIDG  197



>gb|KDO57646.1| hypothetical protein CISIN_1g009287mg [Citrus sinensis]
Length=470

 Score =   328 bits (840),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 155/191 (81%), Positives = 173/191 (91%), Gaps = 1/191 (1%)
 Frame = +2

Query  161  SVLLLVIGCFFSQLSASSDVK-LYESFEEAFEGRWIVSEKEDYKGVWKHSKSEGHEDHGL  337
            ++LL      F  +SAS D   LYESF+E+FEGRWIVS+K++YKGVWKHSKSEGHED+GL
Sbjct  12   ALLLFAAFVSFQLISASDDATILYESFDESFEGRWIVSQKDEYKGVWKHSKSEGHEDYGL  71

Query  338  LVSEPARKYAIVKELDEVVNLKDGTVVLQYEVRLQNGLECGGAYIKYLRPQDAGWVAKEF  517
            LV EPA+KYAIVKELDE ++LKDGTVVLQYEVRLQNGLECGGAY+KYLRPQ+AGWV+KEF
Sbjct  72   LVGEPAKKYAIVKELDEPLSLKDGTVVLQYEVRLQNGLECGGAYLKYLRPQEAGWVSKEF  131

Query  518  DNESPYSIMFGPDKCGATNKVHFIFKHKNPKSGEYVEHHLKYPPSVPSDKLTHVYTAVLK  697
            DNESPY IMFGPDKCGATNKVHFI KHKNPKSGEY+EHHLK PPSVPSDKLTHVYTA+LK
Sbjct  132  DNESPYMIMFGPDKCGATNKVHFILKHKNPKSGEYIEHHLKNPPSVPSDKLTHVYTAILK  191

Query  698  PDNEVSILIDG  730
            PDNE+ ILIDG
Sbjct  192  PDNELRILIDG  202



>ref|XP_006436992.1| hypothetical protein CICLE_v10031185mg [Citrus clementina]
 gb|ESR50232.1| hypothetical protein CICLE_v10031185mg [Citrus clementina]
Length=498

 Score =   328 bits (841),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 155/191 (81%), Positives = 173/191 (91%), Gaps = 1/191 (1%)
 Frame = +2

Query  161  SVLLLVIGCFFSQLSASSDVK-LYESFEEAFEGRWIVSEKEDYKGVWKHSKSEGHEDHGL  337
            ++LL      F  +SAS D   LYESF+E+FEGRWIVS+K++YKGVWKHSKSEGHED+GL
Sbjct  12   ALLLFAAFVSFQLISASDDATILYESFDESFEGRWIVSQKDEYKGVWKHSKSEGHEDYGL  71

Query  338  LVSEPARKYAIVKELDEVVNLKDGTVVLQYEVRLQNGLECGGAYIKYLRPQDAGWVAKEF  517
            LV EPA+KYAIVKELDE ++LKDGTVVLQYEVRLQNGLECGGAY+KYLRPQ+AGWV+KEF
Sbjct  72   LVGEPAKKYAIVKELDEPLSLKDGTVVLQYEVRLQNGLECGGAYLKYLRPQEAGWVSKEF  131

Query  518  DNESPYSIMFGPDKCGATNKVHFIFKHKNPKSGEYVEHHLKYPPSVPSDKLTHVYTAVLK  697
            DNESPY IMFGPDKCGATNKVHFI KHKNPKSGEY+EHHLK PPSVPSDKLTHVYTA+LK
Sbjct  132  DNESPYMIMFGPDKCGATNKVHFILKHKNPKSGEYIEHHLKNPPSVPSDKLTHVYTAILK  191

Query  698  PDNEVSILIDG  730
            PDNE+ ILIDG
Sbjct  192  PDNELRILIDG  202



>gb|KDO57647.1| hypothetical protein CISIN_1g009287mg [Citrus sinensis]
Length=538

 Score =   329 bits (843),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 155/191 (81%), Positives = 173/191 (91%), Gaps = 1/191 (1%)
 Frame = +2

Query  161  SVLLLVIGCFFSQLSASSDVK-LYESFEEAFEGRWIVSEKEDYKGVWKHSKSEGHEDHGL  337
            ++LL      F  +SAS D   LYESF+E+FEGRWIVS+K++YKGVWKHSKSEGHED+GL
Sbjct  12   ALLLFAAFVSFQLISASDDATILYESFDESFEGRWIVSQKDEYKGVWKHSKSEGHEDYGL  71

Query  338  LVSEPARKYAIVKELDEVVNLKDGTVVLQYEVRLQNGLECGGAYIKYLRPQDAGWVAKEF  517
            LV EPA+KYAIVKELDE ++LKDGTVVLQYEVRLQNGLECGGAY+KYLRPQ+AGWV+KEF
Sbjct  72   LVGEPAKKYAIVKELDEPLSLKDGTVVLQYEVRLQNGLECGGAYLKYLRPQEAGWVSKEF  131

Query  518  DNESPYSIMFGPDKCGATNKVHFIFKHKNPKSGEYVEHHLKYPPSVPSDKLTHVYTAVLK  697
            DNESPY IMFGPDKCGATNKVHFI KHKNPKSGEY+EHHLK PPSVPSDKLTHVYTA+LK
Sbjct  132  DNESPYMIMFGPDKCGATNKVHFILKHKNPKSGEYIEHHLKNPPSVPSDKLTHVYTAILK  191

Query  698  PDNEVSILIDG  730
            PDNE+ ILIDG
Sbjct  192  PDNELRILIDG  202



>gb|KDO57648.1| hypothetical protein CISIN_1g009287mg [Citrus sinensis]
Length=537

 Score =   329 bits (843),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 155/191 (81%), Positives = 173/191 (91%), Gaps = 1/191 (1%)
 Frame = +2

Query  161  SVLLLVIGCFFSQLSASSDVK-LYESFEEAFEGRWIVSEKEDYKGVWKHSKSEGHEDHGL  337
            ++LL      F  +SAS D   LYESF+E+FEGRWIVS+K++YKGVWKHSKSEGHED+GL
Sbjct  12   ALLLFAAFVSFQLISASDDATILYESFDESFEGRWIVSQKDEYKGVWKHSKSEGHEDYGL  71

Query  338  LVSEPARKYAIVKELDEVVNLKDGTVVLQYEVRLQNGLECGGAYIKYLRPQDAGWVAKEF  517
            LV EPA+KYAIVKELDE ++LKDGTVVLQYEVRLQNGLECGGAY+KYLRPQ+AGWV+KEF
Sbjct  72   LVGEPAKKYAIVKELDEPLSLKDGTVVLQYEVRLQNGLECGGAYLKYLRPQEAGWVSKEF  131

Query  518  DNESPYSIMFGPDKCGATNKVHFIFKHKNPKSGEYVEHHLKYPPSVPSDKLTHVYTAVLK  697
            DNESPY IMFGPDKCGATNKVHFI KHKNPKSGEY+EHHLK PPSVPSDKLTHVYTA+LK
Sbjct  132  DNESPYMIMFGPDKCGATNKVHFILKHKNPKSGEYIEHHLKNPPSVPSDKLTHVYTAILK  191

Query  698  PDNEVSILIDG  730
            PDNE+ ILIDG
Sbjct  192  PDNELRILIDG  202



>ref|XP_006436993.1| hypothetical protein CICLE_v10031185mg [Citrus clementina]
 gb|ESR50233.1| hypothetical protein CICLE_v10031185mg [Citrus clementina]
Length=538

 Score =   328 bits (842),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 155/191 (81%), Positives = 173/191 (91%), Gaps = 1/191 (1%)
 Frame = +2

Query  161  SVLLLVIGCFFSQLSASSDVK-LYESFEEAFEGRWIVSEKEDYKGVWKHSKSEGHEDHGL  337
            ++LL      F  +SAS D   LYESF+E+FEGRWIVS+K++YKGVWKHSKSEGHED+GL
Sbjct  12   ALLLFAAFVSFQLISASDDATILYESFDESFEGRWIVSQKDEYKGVWKHSKSEGHEDYGL  71

Query  338  LVSEPARKYAIVKELDEVVNLKDGTVVLQYEVRLQNGLECGGAYIKYLRPQDAGWVAKEF  517
            LV EPA+KYAIVKELDE ++LKDGTVVLQYEVRLQNGLECGGAY+KYLRPQ+AGWV+KEF
Sbjct  72   LVGEPAKKYAIVKELDEPLSLKDGTVVLQYEVRLQNGLECGGAYLKYLRPQEAGWVSKEF  131

Query  518  DNESPYSIMFGPDKCGATNKVHFIFKHKNPKSGEYVEHHLKYPPSVPSDKLTHVYTAVLK  697
            DNESPY IMFGPDKCGATNKVHFI KHKNPKSGEY+EHHLK PPSVPSDKLTHVYTA+LK
Sbjct  132  DNESPYMIMFGPDKCGATNKVHFILKHKNPKSGEYIEHHLKNPPSVPSDKLTHVYTAILK  191

Query  698  PDNEVSILIDG  730
            PDNE+ ILIDG
Sbjct  192  PDNELRILIDG  202



>gb|KJB38820.1| hypothetical protein B456_006G273500 [Gossypium raimondii]
Length=431

 Score =   325 bits (833),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 152/182 (84%), Positives = 166/182 (91%), Gaps = 4/182 (2%)
 Frame = +2

Query  185  CFFSQLSASSDVKLYESFEEAFEGRWIVSEKEDYKGVWKHSKSEGHEDHGLLVSEPARKY  364
            CF    +A  DV  Y+SFEE+F+GRWIVS+K+DYKGVWKHSKSEGH+D+GLLVSE A+KY
Sbjct  22   CF----AADDDVVFYDSFEESFDGRWIVSDKDDYKGVWKHSKSEGHDDYGLLVSEMAKKY  77

Query  365  AIVKELDEVVNLKDGTVVLQYEVRLQNGLECGGAYIKYLRPQDAGWVAKEFDNESPYSIM  544
            AIVKELDE VNLKDGT VLQ+E RLQ GLECGGAY+KYLRPQDAGW  KEFDNESPYSIM
Sbjct  78   AIVKELDEAVNLKDGTTVLQFETRLQGGLECGGAYLKYLRPQDAGWKPKEFDNESPYSIM  137

Query  545  FGPDKCGATNKVHFIFKHKNPKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKPDNEVSILI  724
            FGPDKCGATNK+HFI KHKNPKSGEY+EHHLKYPPSVPSDKLTHVYTA+LKPDNEVSILI
Sbjct  138  FGPDKCGATNKLHFILKHKNPKSGEYIEHHLKYPPSVPSDKLTHVYTAILKPDNEVSILI  197

Query  725  DG  730
            DG
Sbjct  198  DG  199



>gb|KJB38814.1| hypothetical protein B456_006G273500 [Gossypium raimondii]
 gb|KJB38821.1| hypothetical protein B456_006G273500 [Gossypium raimondii]
Length=440

 Score =   325 bits (832),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 152/182 (84%), Positives = 166/182 (91%), Gaps = 4/182 (2%)
 Frame = +2

Query  185  CFFSQLSASSDVKLYESFEEAFEGRWIVSEKEDYKGVWKHSKSEGHEDHGLLVSEPARKY  364
            CF    +A  DV  Y+SFEE+F+GRWIVS+K+DYKGVWKHSKSEGH+D+GLLVSE A+KY
Sbjct  22   CF----AADDDVVFYDSFEESFDGRWIVSDKDDYKGVWKHSKSEGHDDYGLLVSEMAKKY  77

Query  365  AIVKELDEVVNLKDGTVVLQYEVRLQNGLECGGAYIKYLRPQDAGWVAKEFDNESPYSIM  544
            AIVKELDE VNLKDGT VLQ+E RLQ GLECGGAY+KYLRPQDAGW  KEFDNESPYSIM
Sbjct  78   AIVKELDEAVNLKDGTTVLQFETRLQGGLECGGAYLKYLRPQDAGWKPKEFDNESPYSIM  137

Query  545  FGPDKCGATNKVHFIFKHKNPKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKPDNEVSILI  724
            FGPDKCGATNK+HFI KHKNPKSGEY+EHHLKYPPSVPSDKLTHVYTA+LKPDNEVSILI
Sbjct  138  FGPDKCGATNKLHFILKHKNPKSGEYIEHHLKYPPSVPSDKLTHVYTAILKPDNEVSILI  197

Query  725  DG  730
            DG
Sbjct  198  DG  199



>gb|KJB38816.1| hypothetical protein B456_006G273500 [Gossypium raimondii]
Length=457

 Score =   325 bits (833),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 152/182 (84%), Positives = 166/182 (91%), Gaps = 4/182 (2%)
 Frame = +2

Query  185  CFFSQLSASSDVKLYESFEEAFEGRWIVSEKEDYKGVWKHSKSEGHEDHGLLVSEPARKY  364
            CF    +A  DV  Y+SFEE+F+GRWIVS+K+DYKGVWKHSKSEGH+D+GLLVSE A+KY
Sbjct  22   CF----AADDDVVFYDSFEESFDGRWIVSDKDDYKGVWKHSKSEGHDDYGLLVSEMAKKY  77

Query  365  AIVKELDEVVNLKDGTVVLQYEVRLQNGLECGGAYIKYLRPQDAGWVAKEFDNESPYSIM  544
            AIVKELDE VNLKDGT VLQ+E RLQ GLECGGAY+KYLRPQDAGW  KEFDNESPYSIM
Sbjct  78   AIVKELDEAVNLKDGTTVLQFETRLQGGLECGGAYLKYLRPQDAGWKPKEFDNESPYSIM  137

Query  545  FGPDKCGATNKVHFIFKHKNPKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKPDNEVSILI  724
            FGPDKCGATNK+HFI KHKNPKSGEY+EHHLKYPPSVPSDKLTHVYTA+LKPDNEVSILI
Sbjct  138  FGPDKCGATNKLHFILKHKNPKSGEYIEHHLKYPPSVPSDKLTHVYTAILKPDNEVSILI  197

Query  725  DG  730
            DG
Sbjct  198  DG  199



>emb|CAN83091.1| hypothetical protein VITISV_041895 [Vitis vinifera]
Length=539

 Score =   327 bits (837),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 154/189 (81%), Positives = 169/189 (89%), Gaps = 1/189 (1%)
 Frame = +2

Query  164  VLLLVIGCFFSQLSASSDVKLYESFEEAFEGRWIVSEKEDYKGVWKHSKSEGHEDHGLLV  343
            V+  VI C   QL AS  +  YESF++ FEGRWIVSEKEDYKGVWKH+KS+GHEDHGLLV
Sbjct  14   VVFAVIACASLQLCASDSI-FYESFDDDFEGRWIVSEKEDYKGVWKHAKSDGHEDHGLLV  72

Query  344  SEPARKYAIVKELDEVVNLKDGTVVLQYEVRLQNGLECGGAYIKYLRPQDAGWVAKEFDN  523
            SE ARKYAIVKELDE V+LKDGT VLQ+E RLQNGLECGGAY+KYLRPQDA W +KEFDN
Sbjct  73   SEKARKYAIVKELDEAVSLKDGTAVLQFETRLQNGLECGGAYLKYLRPQDATWKSKEFDN  132

Query  524  ESPYSIMFGPDKCGATNKVHFIFKHKNPKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKPD  703
            ESPYSIMFGPDKCG+TNKVHFI KHKNPKSGEY+EHHLKYPPSVPSDKL+HVYTA+LKPD
Sbjct  133  ESPYSIMFGPDKCGSTNKVHFIVKHKNPKSGEYIEHHLKYPPSVPSDKLSHVYTAILKPD  192

Query  704  NEVSILIDG  730
            +EV ILIDG
Sbjct  193  HEVRILIDG  201



>ref|XP_002277666.1| PREDICTED: calnexin homolog [Vitis vinifera]
Length=539

 Score =   327 bits (837),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 154/189 (81%), Positives = 169/189 (89%), Gaps = 1/189 (1%)
 Frame = +2

Query  164  VLLLVIGCFFSQLSASSDVKLYESFEEAFEGRWIVSEKEDYKGVWKHSKSEGHEDHGLLV  343
            V+  VI C   QL AS  +  YESF++ FEGRWIVSEKEDYKGVWKH+KS+GHEDHGLLV
Sbjct  14   VVFAVIACASLQLCASDSI-FYESFDDDFEGRWIVSEKEDYKGVWKHAKSDGHEDHGLLV  72

Query  344  SEPARKYAIVKELDEVVNLKDGTVVLQYEVRLQNGLECGGAYIKYLRPQDAGWVAKEFDN  523
            SE ARKYAIVKELDE V+LKDGT VLQ+E RLQNGLECGGAY+KYLRPQDA W +KEFDN
Sbjct  73   SEKARKYAIVKELDEAVSLKDGTAVLQFETRLQNGLECGGAYLKYLRPQDATWKSKEFDN  132

Query  524  ESPYSIMFGPDKCGATNKVHFIFKHKNPKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKPD  703
            ESPYSIMFGPDKCG+TNKVHFI KHKNPKSGEY+EHHLKYPPSVPSDKL+HVYTA+LKPD
Sbjct  133  ESPYSIMFGPDKCGSTNKVHFIVKHKNPKSGEYIEHHLKYPPSVPSDKLSHVYTAILKPD  192

Query  704  NEVSILIDG  730
            +EV ILIDG
Sbjct  193  HEVRILIDG  201



>ref|XP_007159940.1| hypothetical protein PHAVU_002G280200g [Phaseolus vulgaris]
 gb|ESW31934.1| hypothetical protein PHAVU_002G280200g [Phaseolus vulgaris]
Length=541

 Score =   326 bits (836),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 157/203 (77%), Positives = 175/203 (86%), Gaps = 3/203 (1%)
 Frame = +2

Query  131  EEKKRKIWTQSVLLLVIGCFFSQLSASSDVK---LYESFEEAFEGRWIVSEKEDYKGVWK  301
            E+K+  +   +VLLL+    F  L AS D      YESF+E FEGRWIVS+K++Y GVWK
Sbjct  3    EQKRIPLGIFAVLLLIAASSFQLLRASEDADDAIFYESFDEDFEGRWIVSQKDEYSGVWK  62

Query  302  HSKSEGHEDHGLLVSEPARKYAIVKELDEVVNLKDGTVVLQYEVRLQNGLECGGAYIKYL  481
            H+KSEGH+DHGLLVSE ARKYAIVKELD  V+LKDGTVVLQ+E RLQNGLECGGAYIKYL
Sbjct  63   HAKSEGHDDHGLLVSEKARKYAIVKELDGAVSLKDGTVVLQFETRLQNGLECGGAYIKYL  122

Query  482  RPQDAGWVAKEFDNESPYSIMFGPDKCGATNKVHFIFKHKNPKSGEYVEHHLKYPPSVPS  661
            RPQDAGW +KEFDNESPYSIMFGPDKCGATNKVHFIFKHKNPK+GEYVEHHLK PPSVPS
Sbjct  123  RPQDAGWKSKEFDNESPYSIMFGPDKCGATNKVHFIFKHKNPKTGEYVEHHLKNPPSVPS  182

Query  662  DKLTHVYTAVLKPDNEVSILIDG  730
            DKLTHVYTA+LKP+NEV IL+DG
Sbjct  183  DKLTHVYTAILKPNNEVLILLDG  205



>ref|XP_006485059.1| PREDICTED: calnexin homolog [Citrus sinensis]
Length=538

 Score =   326 bits (836),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 153/191 (80%), Positives = 173/191 (91%), Gaps = 1/191 (1%)
 Frame = +2

Query  161  SVLLLVIGCFFSQLSASSDVK-LYESFEEAFEGRWIVSEKEDYKGVWKHSKSEGHEDHGL  337
            ++LL      F  +SAS D   LYES++E+F+GRWIVS+K++YKGVWKHSKSEGHED+GL
Sbjct  12   ALLLFAAFVSFQLISASDDATILYESYDESFDGRWIVSQKDEYKGVWKHSKSEGHEDYGL  71

Query  338  LVSEPARKYAIVKELDEVVNLKDGTVVLQYEVRLQNGLECGGAYIKYLRPQDAGWVAKEF  517
            LV EPA+KYAIVKELDE ++LKDGTVVLQYEVRLQNGLECGGAY+KYLRPQ+AGWV+KEF
Sbjct  72   LVGEPAKKYAIVKELDEPLSLKDGTVVLQYEVRLQNGLECGGAYLKYLRPQEAGWVSKEF  131

Query  518  DNESPYSIMFGPDKCGATNKVHFIFKHKNPKSGEYVEHHLKYPPSVPSDKLTHVYTAVLK  697
            DNESPY IMFGPDKCGATNKVHFI KHKNPKSGEY+EHHLK PPSVPSDKLTHVYTA+LK
Sbjct  132  DNESPYMIMFGPDKCGATNKVHFILKHKNPKSGEYIEHHLKNPPSVPSDKLTHVYTAILK  191

Query  698  PDNEVSILIDG  730
            PDNE+ ILIDG
Sbjct  192  PDNELRILIDG  202



>gb|KJB38817.1| hypothetical protein B456_006G273500 [Gossypium raimondii]
Length=494

 Score =   325 bits (832),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 152/182 (84%), Positives = 166/182 (91%), Gaps = 4/182 (2%)
 Frame = +2

Query  185  CFFSQLSASSDVKLYESFEEAFEGRWIVSEKEDYKGVWKHSKSEGHEDHGLLVSEPARKY  364
            CF    +A  DV  Y+SFEE+F+GRWIVS+K+DYKGVWKHSKSEGH+D+GLLVSE A+KY
Sbjct  22   CF----AADDDVVFYDSFEESFDGRWIVSDKDDYKGVWKHSKSEGHDDYGLLVSEMAKKY  77

Query  365  AIVKELDEVVNLKDGTVVLQYEVRLQNGLECGGAYIKYLRPQDAGWVAKEFDNESPYSIM  544
            AIVKELDE VNLKDGT VLQ+E RLQ GLECGGAY+KYLRPQDAGW  KEFDNESPYSIM
Sbjct  78   AIVKELDEAVNLKDGTTVLQFETRLQGGLECGGAYLKYLRPQDAGWKPKEFDNESPYSIM  137

Query  545  FGPDKCGATNKVHFIFKHKNPKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKPDNEVSILI  724
            FGPDKCGATNK+HFI KHKNPKSGEY+EHHLKYPPSVPSDKLTHVYTA+LKPDNEVSILI
Sbjct  138  FGPDKCGATNKLHFILKHKNPKSGEYIEHHLKYPPSVPSDKLTHVYTAILKPDNEVSILI  197

Query  725  DG  730
            DG
Sbjct  198  DG  199



>ref|XP_008797088.1| PREDICTED: calnexin homolog [Phoenix dactylifera]
Length=535

 Score =   326 bits (835),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 153/189 (81%), Positives = 170/189 (90%), Gaps = 1/189 (1%)
 Frame = +2

Query  164  VLLLVIGCFFSQLSASSDVKLYESFEEAFEGRWIVSEKEDYKGVWKHSKSEGHEDHGLLV  343
            +LL++I  F  Q+ AS D   YESF+E  +GRWIVSEKEDY GVWKHSKSEGHED+GLLV
Sbjct  10   LLLILIASFVLQIWAS-DPLFYESFDETLDGRWIVSEKEDYTGVWKHSKSEGHEDYGLLV  68

Query  344  SEPARKYAIVKELDEVVNLKDGTVVLQYEVRLQNGLECGGAYIKYLRPQDAGWVAKEFDN  523
            SE ARKYAIVKELDE V LKDGT+VLQYE RLQNGLECGGAY+KYLRPQ+AGW+ KEFDN
Sbjct  69   SEKARKYAIVKELDEPVMLKDGTIVLQYEARLQNGLECGGAYLKYLRPQEAGWIPKEFDN  128

Query  524  ESPYSIMFGPDKCGATNKVHFIFKHKNPKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKPD  703
            ESPY+IMFGPDKCG+TNKVHFI KHKNPKSG+++EHHLKYPPSVPSDKLTHVYTAVLKPD
Sbjct  129  ESPYTIMFGPDKCGSTNKVHFILKHKNPKSGKFIEHHLKYPPSVPSDKLTHVYTAVLKPD  188

Query  704  NEVSILIDG  730
            NE+ ILIDG
Sbjct  189  NELRILIDG  197



>gb|KJB38818.1| hypothetical protein B456_006G273500 [Gossypium raimondii]
Length=515

 Score =   325 bits (834),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 152/182 (84%), Positives = 166/182 (91%), Gaps = 4/182 (2%)
 Frame = +2

Query  185  CFFSQLSASSDVKLYESFEEAFEGRWIVSEKEDYKGVWKHSKSEGHEDHGLLVSEPARKY  364
            CF    +A  DV  Y+SFEE+F+GRWIVS+K+DYKGVWKHSKSEGH+D+GLLVSE A+KY
Sbjct  22   CF----AADDDVVFYDSFEESFDGRWIVSDKDDYKGVWKHSKSEGHDDYGLLVSEMAKKY  77

Query  365  AIVKELDEVVNLKDGTVVLQYEVRLQNGLECGGAYIKYLRPQDAGWVAKEFDNESPYSIM  544
            AIVKELDE VNLKDGT VLQ+E RLQ GLECGGAY+KYLRPQDAGW  KEFDNESPYSIM
Sbjct  78   AIVKELDEAVNLKDGTTVLQFETRLQGGLECGGAYLKYLRPQDAGWKPKEFDNESPYSIM  137

Query  545  FGPDKCGATNKVHFIFKHKNPKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKPDNEVSILI  724
            FGPDKCGATNK+HFI KHKNPKSGEY+EHHLKYPPSVPSDKLTHVYTA+LKPDNEVSILI
Sbjct  138  FGPDKCGATNKLHFILKHKNPKSGEYIEHHLKYPPSVPSDKLTHVYTAILKPDNEVSILI  197

Query  725  DG  730
            DG
Sbjct  198  DG  199



>gb|KJB38815.1| hypothetical protein B456_006G273500 [Gossypium raimondii]
 gb|KJB38822.1| hypothetical protein B456_006G273500 [Gossypium raimondii]
Length=532

 Score =   325 bits (833),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 152/182 (84%), Positives = 166/182 (91%), Gaps = 4/182 (2%)
 Frame = +2

Query  185  CFFSQLSASSDVKLYESFEEAFEGRWIVSEKEDYKGVWKHSKSEGHEDHGLLVSEPARKY  364
            CF    +A  DV  Y+SFEE+F+GRWIVS+K+DYKGVWKHSKSEGH+D+GLLVSE A+KY
Sbjct  22   CF----AADDDVVFYDSFEESFDGRWIVSDKDDYKGVWKHSKSEGHDDYGLLVSEMAKKY  77

Query  365  AIVKELDEVVNLKDGTVVLQYEVRLQNGLECGGAYIKYLRPQDAGWVAKEFDNESPYSIM  544
            AIVKELDE VNLKDGT VLQ+E RLQ GLECGGAY+KYLRPQDAGW  KEFDNESPYSIM
Sbjct  78   AIVKELDEAVNLKDGTTVLQFETRLQGGLECGGAYLKYLRPQDAGWKPKEFDNESPYSIM  137

Query  545  FGPDKCGATNKVHFIFKHKNPKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKPDNEVSILI  724
            FGPDKCGATNK+HFI KHKNPKSGEY+EHHLKYPPSVPSDKLTHVYTA+LKPDNEVSILI
Sbjct  138  FGPDKCGATNKLHFILKHKNPKSGEYIEHHLKYPPSVPSDKLTHVYTAILKPDNEVSILI  197

Query  725  DG  730
            DG
Sbjct  198  DG  199



>ref|XP_004503810.1| PREDICTED: calnexin homolog isoform X2 [Cicer arietinum]
Length=538

 Score =   323 bits (829),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 153/191 (80%), Positives = 169/191 (88%), Gaps = 1/191 (1%)
 Frame = +2

Query  161  SVLLLVIGCFFSQL-SASSDVKLYESFEEAFEGRWIVSEKEDYKGVWKHSKSEGHEDHGL  337
            +VLL VI     QL  AS D   Y+SF+EAF+GRWIVSEK++Y GVWKH+KSEGH+D+GL
Sbjct  13   AVLLFVISTASLQLLRASDDAIFYDSFDEAFDGRWIVSEKDEYNGVWKHAKSEGHDDYGL  72

Query  338  LVSEPARKYAIVKELDEVVNLKDGTVVLQYEVRLQNGLECGGAYIKYLRPQDAGWVAKEF  517
            LVSE ARKYAIVKELDE  NLKD T VLQ+E RLQNGLECGGAY+KYLRPQ+AGW  KEF
Sbjct  73   LVSEKARKYAIVKELDEPANLKDETAVLQFETRLQNGLECGGAYLKYLRPQEAGWKPKEF  132

Query  518  DNESPYSIMFGPDKCGATNKVHFIFKHKNPKSGEYVEHHLKYPPSVPSDKLTHVYTAVLK  697
            DN+SPYSIMFGPDKCGATNKVHFIFKHKNPKSGEYVEHHLKYPPSVPSDKL+HVYTA+LK
Sbjct  133  DNDSPYSIMFGPDKCGATNKVHFIFKHKNPKSGEYVEHHLKYPPSVPSDKLSHVYTAILK  192

Query  698  PDNEVSILIDG  730
            PDNE+ ILIDG
Sbjct  193  PDNELQILIDG  203



>ref|XP_011040303.1| PREDICTED: calnexin homolog [Populus euphratica]
Length=533

 Score =   323 bits (829),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 151/201 (75%), Positives = 173/201 (86%), Gaps = 0/201 (0%)
 Frame = +2

Query  128  MEEKKRKIWTQSVLLLVIGCFFSQLSASSDVKLYESFEEAFEGRWIVSEKEDYKGVWKHS  307
            M E +R     +++LL+    F+QL A  D  LYESF+++F+GRWIVSEKE Y G WKH 
Sbjct  1    MREAERVSLGLAIVLLLAFISFNQLFAEDDTILYESFDKSFDGRWIVSEKEGYNGEWKHE  60

Query  308  KSEGHEDHGLLVSEPARKYAIVKELDEVVNLKDGTVVLQYEVRLQNGLECGGAYIKYLRP  487
            KSEGH+D+GLLVSEPARKYAIVKELDE+V+LKDGT+VLQ+E RLQ GLECGGAY+KYLRP
Sbjct  61   KSEGHDDYGLLVSEPARKYAIVKELDELVSLKDGTIVLQFETRLQKGLECGGAYLKYLRP  120

Query  488  QDAGWVAKEFDNESPYSIMFGPDKCGATNKVHFIFKHKNPKSGEYVEHHLKYPPSVPSDK  667
            Q+AGWV K FDNESPYSIMFGPDKCG TNKVHFI KHKNPKSGEYVEHHLK+PPSVP DK
Sbjct  121  QEAGWVPKGFDNESPYSIMFGPDKCGTTNKVHFILKHKNPKSGEYVEHHLKFPPSVPHDK  180

Query  668  LTHVYTAVLKPDNEVSILIDG  730
            LTHVYTA+LKPDNE+ IL+DG
Sbjct  181  LTHVYTAILKPDNELQILVDG  201



>ref|XP_002321768.1| Calnexin precursor family protein [Populus trichocarpa]
 gb|EEF05895.1| Calnexin precursor family protein [Populus trichocarpa]
Length=533

 Score =   323 bits (828),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 151/201 (75%), Positives = 171/201 (85%), Gaps = 0/201 (0%)
 Frame = +2

Query  128  MEEKKRKIWTQSVLLLVIGCFFSQLSASSDVKLYESFEEAFEGRWIVSEKEDYKGVWKHS  307
            M E KR     +++LL+    F+QL A  D  LYESF+++F+GRWIVSEKE Y G WKH 
Sbjct  1    MREAKRVSLRLAIVLLLAFISFNQLFAEDDTILYESFDKSFDGRWIVSEKEGYNGEWKHE  60

Query  308  KSEGHEDHGLLVSEPARKYAIVKELDEVVNLKDGTVVLQYEVRLQNGLECGGAYIKYLRP  487
            KSEGH+D+GLLVSEPARKYAIVKELDE  +LKDGT+VLQ+E RLQ GLECGGAY+KYLRP
Sbjct  61   KSEGHDDYGLLVSEPARKYAIVKELDEPASLKDGTIVLQFETRLQKGLECGGAYLKYLRP  120

Query  488  QDAGWVAKEFDNESPYSIMFGPDKCGATNKVHFIFKHKNPKSGEYVEHHLKYPPSVPSDK  667
            Q+AGWV K FDNESPYSIMFGPDKCG TNKVHFI KHKNPKSGEYVEHHLK+PPSVP DK
Sbjct  121  QEAGWVPKGFDNESPYSIMFGPDKCGTTNKVHFILKHKNPKSGEYVEHHLKFPPSVPHDK  180

Query  668  LTHVYTAVLKPDNEVSILIDG  730
            LTHVYTA+LKPDNE+ IL+DG
Sbjct  181  LTHVYTAILKPDNELQILVDG  201



>ref|XP_007159942.1| hypothetical protein PHAVU_002G280300g [Phaseolus vulgaris]
 gb|ESW31936.1| hypothetical protein PHAVU_002G280300g [Phaseolus vulgaris]
Length=547

 Score =   323 bits (829),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 156/205 (76%), Positives = 176/205 (86%), Gaps = 4/205 (2%)
 Frame = +2

Query  128  MEEKKR-KIWTQSVLLLVIGCFFSQLSASSDVK---LYESFEEAFEGRWIVSEKEDYKGV  295
            M E+KR  +   +VLLL+  C F  L A+ D      YESF+E F+ RWIVS+KE+Y GV
Sbjct  1    MGERKRIPLGMFAVLLLISACSFQFLCATEDADDAIFYESFDEDFQDRWIVSQKEEYSGV  60

Query  296  WKHSKSEGHEDHGLLVSEPARKYAIVKELDEVVNLKDGTVVLQYEVRLQNGLECGGAYIK  475
            WKH+KSEGH+DHGLLVSE ARKYAIVKELD+ V+L+DGTVVLQ+E RLQNGLECGGAYIK
Sbjct  61   WKHAKSEGHDDHGLLVSEKARKYAIVKELDKAVSLRDGTVVLQFETRLQNGLECGGAYIK  120

Query  476  YLRPQDAGWVAKEFDNESPYSIMFGPDKCGATNKVHFIFKHKNPKSGEYVEHHLKYPPSV  655
            YLRPQDAGW +KEFDNESPYSIMFGPDKCGATNKVHFIFKHKNPK+GEYVEHHLK P SV
Sbjct  121  YLRPQDAGWKSKEFDNESPYSIMFGPDKCGATNKVHFIFKHKNPKTGEYVEHHLKNPSSV  180

Query  656  PSDKLTHVYTAVLKPDNEVSILIDG  730
            PSDKLTHVYTA+LKP+NEV IL+DG
Sbjct  181  PSDKLTHVYTAILKPNNEVQILLDG  205



>ref|XP_007159941.1| hypothetical protein PHAVU_002G280300g [Phaseolus vulgaris]
 gb|ESW31935.1| hypothetical protein PHAVU_002G280300g [Phaseolus vulgaris]
Length=548

 Score =   323 bits (829),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 156/205 (76%), Positives = 176/205 (86%), Gaps = 4/205 (2%)
 Frame = +2

Query  128  MEEKKR-KIWTQSVLLLVIGCFFSQLSASSDVK---LYESFEEAFEGRWIVSEKEDYKGV  295
            M E+KR  +   +VLLL+  C F  L A+ D      YESF+E F+ RWIVS+KE+Y GV
Sbjct  1    MGERKRIPLGMFAVLLLISACSFQFLCATEDADDAIFYESFDEDFQDRWIVSQKEEYSGV  60

Query  296  WKHSKSEGHEDHGLLVSEPARKYAIVKELDEVVNLKDGTVVLQYEVRLQNGLECGGAYIK  475
            WKH+KSEGH+DHGLLVSE ARKYAIVKELD+ V+L+DGTVVLQ+E RLQNGLECGGAYIK
Sbjct  61   WKHAKSEGHDDHGLLVSEKARKYAIVKELDKAVSLRDGTVVLQFETRLQNGLECGGAYIK  120

Query  476  YLRPQDAGWVAKEFDNESPYSIMFGPDKCGATNKVHFIFKHKNPKSGEYVEHHLKYPPSV  655
            YLRPQDAGW +KEFDNESPYSIMFGPDKCGATNKVHFIFKHKNPK+GEYVEHHLK P SV
Sbjct  121  YLRPQDAGWKSKEFDNESPYSIMFGPDKCGATNKVHFIFKHKNPKTGEYVEHHLKNPSSV  180

Query  656  PSDKLTHVYTAVLKPDNEVSILIDG  730
            PSDKLTHVYTA+LKP+NEV IL+DG
Sbjct  181  PSDKLTHVYTAILKPNNEVQILLDG  205



>ref|XP_010942328.1| PREDICTED: calnexin homolog [Elaeis guineensis]
Length=537

 Score =   323 bits (828),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 151/189 (80%), Positives = 168/189 (89%), Gaps = 1/189 (1%)
 Frame = +2

Query  164  VLLLVIGCFFSQLSASSDVKLYESFEEAFEGRWIVSEKEDYKGVWKHSKSEGHEDHGLLV  343
            +LLL I  F  Q+ AS D   YESF+E FEGRWI+S KEDY+GVWKHSKSEGHED+GLLV
Sbjct  10   LLLLFIASFVLQIWAS-DPLFYESFDETFEGRWILSGKEDYQGVWKHSKSEGHEDYGLLV  68

Query  344  SEPARKYAIVKELDEVVNLKDGTVVLQYEVRLQNGLECGGAYIKYLRPQDAGWVAKEFDN  523
            SE ARKYAIVKELDE + LKDGT+VLQYE RLQNGLECGGAY+KYLRPQD  W  KEFDN
Sbjct  69   SEKARKYAIVKELDEPITLKDGTIVLQYETRLQNGLECGGAYLKYLRPQDGDWTPKEFDN  128

Query  524  ESPYSIMFGPDKCGATNKVHFIFKHKNPKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKPD  703
            ESPY+IMFGPDKCG+TNKVHFIFKHKNPKSG++VEHHLK+PPSVPSDKL+HVYTA+LKPD
Sbjct  129  ESPYTIMFGPDKCGSTNKVHFIFKHKNPKSGQFVEHHLKFPPSVPSDKLSHVYTAILKPD  188

Query  704  NEVSILIDG  730
            NE+ ILIDG
Sbjct  189  NELRILIDG  197



>ref|XP_008807839.1| PREDICTED: calnexin homolog [Phoenix dactylifera]
Length=538

 Score =   323 bits (827),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 149/174 (86%), Positives = 162/174 (93%), Gaps = 0/174 (0%)
 Frame = +2

Query  209  SSDVKLYESFEEAFEGRWIVSEKEDYKGVWKHSKSEGHEDHGLLVSEPARKYAIVKELDE  388
            +SD   YESF+E FEGRWIVS+KEDY+GVWKHSKSEGHED+GLLVSE ARKYAIVKELDE
Sbjct  24   ASDPLFYESFDETFEGRWIVSDKEDYQGVWKHSKSEGHEDYGLLVSEKARKYAIVKELDE  83

Query  389  VVNLKDGTVVLQYEVRLQNGLECGGAYIKYLRPQDAGWVAKEFDNESPYSIMFGPDKCGA  568
             V LKDGT+VLQYE RLQNGLECGGAY+KYLRPQDAGW  KEFDNESPYSIMFGPDKCG+
Sbjct  84   PVTLKDGTIVLQYETRLQNGLECGGAYLKYLRPQDAGWAPKEFDNESPYSIMFGPDKCGS  143

Query  569  TNKVHFIFKHKNPKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKPDNEVSILIDG  730
            TNKVHFI KHKNPK+G+YVEHHLKYPPSVPSDKL+HVYTA+LKPDNE+ ILIDG
Sbjct  144  TNKVHFILKHKNPKTGKYVEHHLKYPPSVPSDKLSHVYTAILKPDNELRILIDG  197



>gb|KJB38819.1| hypothetical protein B456_006G273500 [Gossypium raimondii]
Length=531

 Score =   322 bits (825),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 151/182 (83%), Positives = 165/182 (91%), Gaps = 5/182 (3%)
 Frame = +2

Query  185  CFFSQLSASSDVKLYESFEEAFEGRWIVSEKEDYKGVWKHSKSEGHEDHGLLVSEPARKY  364
            CF     A+ D   Y+SFEE+F+GRWIVS+K+DYKGVWKHSKSEGH+D+GLLVSE A+KY
Sbjct  22   CF-----AADDDVFYDSFEESFDGRWIVSDKDDYKGVWKHSKSEGHDDYGLLVSEMAKKY  76

Query  365  AIVKELDEVVNLKDGTVVLQYEVRLQNGLECGGAYIKYLRPQDAGWVAKEFDNESPYSIM  544
            AIVKELDE VNLKDGT VLQ+E RLQ GLECGGAY+KYLRPQDAGW  KEFDNESPYSIM
Sbjct  77   AIVKELDEAVNLKDGTTVLQFETRLQGGLECGGAYLKYLRPQDAGWKPKEFDNESPYSIM  136

Query  545  FGPDKCGATNKVHFIFKHKNPKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKPDNEVSILI  724
            FGPDKCGATNK+HFI KHKNPKSGEY+EHHLKYPPSVPSDKLTHVYTA+LKPDNEVSILI
Sbjct  137  FGPDKCGATNKLHFILKHKNPKSGEYIEHHLKYPPSVPSDKLTHVYTAILKPDNEVSILI  196

Query  725  DG  730
            DG
Sbjct  197  DG  198



>gb|AFK41331.1| unknown [Lotus japonicus]
Length=216

 Score =   311 bits (796),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 149/197 (76%), Positives = 168/197 (85%), Gaps = 0/197 (0%)
 Frame = +2

Query  131  EEKKRKIWTQSVLLLVIGCFFSQLSASSDVKLYESFEEAFEGRWIVSEKEDYKGVWKHSK  310
            E K+  +   +VLL++       LSAS D   YESF+E FEGRWIVS+K++Y G WKH K
Sbjct  3    EPKRTPLLIFAVLLVISTSSLQFLSASDDAIFYESFDEDFEGRWIVSQKDEYNGAWKHDK  62

Query  311  SEGHEDHGLLVSEPARKYAIVKELDEVVNLKDGTVVLQYEVRLQNGLECGGAYIKYLRPQ  490
            SEGH+D+GLLVSE ARKYAIVKELDE V LKD +VVLQ+E RLQNGLE GGAY+KYLRPQ
Sbjct  63   SEGHDDYGLLVSEKARKYAIVKELDEPVKLKDESVVLQFETRLQNGLEYGGAYLKYLRPQ  122

Query  491  DAGWVAKEFDNESPYSIMFGPDKCGATNKVHFIFKHKNPKSGEYVEHHLKYPPSVPSDKL  670
            +AGW +KEFDNESPYSIMFGPDKCGATNKVHFIFKHKNPKSGEYVEHHLK+PPSVPSDKL
Sbjct  123  EAGWKSKEFDNESPYSIMFGPDKCGATNKVHFIFKHKNPKSGEYVEHHLKFPPSVPSDKL  182

Query  671  THVYTAVLKPDNEVSIL  721
            +HVYTAVLKPDNE+ IL
Sbjct  183  SHVYTAVLKPDNELEIL  199



>ref|XP_004503809.1| PREDICTED: calnexin homolog isoform X1 [Cicer arietinum]
Length=577

 Score =   323 bits (827),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 153/191 (80%), Positives = 169/191 (88%), Gaps = 1/191 (1%)
 Frame = +2

Query  161  SVLLLVIGCFFSQL-SASSDVKLYESFEEAFEGRWIVSEKEDYKGVWKHSKSEGHEDHGL  337
            +VLL VI     QL  AS D   Y+SF+EAF+GRWIVSEK++Y GVWKH+KSEGH+D+GL
Sbjct  13   AVLLFVISTASLQLLRASDDAIFYDSFDEAFDGRWIVSEKDEYNGVWKHAKSEGHDDYGL  72

Query  338  LVSEPARKYAIVKELDEVVNLKDGTVVLQYEVRLQNGLECGGAYIKYLRPQDAGWVAKEF  517
            LVSE ARKYAIVKELDE  NLKD T VLQ+E RLQNGLECGGAY+KYLRPQ+AGW  KEF
Sbjct  73   LVSEKARKYAIVKELDEPANLKDETAVLQFETRLQNGLECGGAYLKYLRPQEAGWKPKEF  132

Query  518  DNESPYSIMFGPDKCGATNKVHFIFKHKNPKSGEYVEHHLKYPPSVPSDKLTHVYTAVLK  697
            DN+SPYSIMFGPDKCGATNKVHFIFKHKNPKSGEYVEHHLKYPPSVPSDKL+HVYTA+LK
Sbjct  133  DNDSPYSIMFGPDKCGATNKVHFIFKHKNPKSGEYVEHHLKYPPSVPSDKLSHVYTAILK  192

Query  698  PDNEVSILIDG  730
            PDNE+ ILIDG
Sbjct  193  PDNELQILIDG  203



>ref|XP_003523183.1| PREDICTED: calnexin homolog [Glycine max]
Length=543

 Score =   321 bits (823),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 156/207 (75%), Positives = 175/207 (85%), Gaps = 10/207 (5%)
 Frame = +2

Query  140  KRKIWTQSVLLLVIGCFFSQLSASS----------DVKLYESFEEAFEGRWIVSEKEDYK  289
            +RK    ++ LL +  FF   S+SS          D   YESF+E F+GRWIVS+KEDY 
Sbjct  3    ERKGIPIALGLLAMLLFFIASSSSSHLVRASDDADDAIFYESFDEDFDGRWIVSDKEDYN  62

Query  290  GVWKHSKSEGHEDHGLLVSEPARKYAIVKELDEVVNLKDGTVVLQYEVRLQNGLECGGAY  469
            GVWKH+KS+GH+D+GLLVSE ARKYAIVK+LDE V+LKDGTVVLQ+E RLQNGLECGGAY
Sbjct  63   GVWKHAKSDGHDDYGLLVSEQARKYAIVKKLDEPVSLKDGTVVLQFETRLQNGLECGGAY  122

Query  470  IKYLRPQDAGWVAKEFDNESPYSIMFGPDKCGATNKVHFIFKHKNPKSGEYVEHHLKYPP  649
            IKYLRPQ++GW  KEFDNESPYSIMFGPDKCGATNKVHFIFKHKNPKSGEYVEHHLKYPP
Sbjct  123  IKYLRPQESGWKPKEFDNESPYSIMFGPDKCGATNKVHFIFKHKNPKSGEYVEHHLKYPP  182

Query  650  SVPSDKLTHVYTAVLKPDNEVSILIDG  730
            SVPSDKLTHVYTA+LKPDNE+ ILIDG
Sbjct  183  SVPSDKLTHVYTAILKPDNELQILIDG  209



>ref|XP_010695743.1| PREDICTED: calnexin homolog [Beta vulgaris subsp. vulgaris]
Length=539

 Score =   320 bits (821),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 150/199 (75%), Positives = 174/199 (87%), Gaps = 1/199 (1%)
 Frame = +2

Query  134  EKKRKIWTQSVLLLVIGCFFSQLSASSDVKLYESFEEAFEGRWIVSEKEDYKGVWKHSKS  313
            E +++   Q V  L++ CF  QL A+  +  YESF+++F+GRWIVSEKE+Y GVWKHSKS
Sbjct  2    ETRKRFKNQLVSFLLVACFAIQLCATDPI-FYESFDDSFDGRWIVSEKEEYNGVWKHSKS  60

Query  314  EGHEDHGLLVSEPARKYAIVKELDEVVNLKDGTVVLQYEVRLQNGLECGGAYIKYLRPQD  493
            EGHED+GLLVSE ARKYAIVKEL++ V LKD TVVLQ+E RLQNGLECGGAY+KYLRPQ+
Sbjct  61   EGHEDYGLLVSEKARKYAIVKELEKPVELKDKTVVLQFETRLQNGLECGGAYLKYLRPQE  120

Query  494  AGWVAKEFDNESPYSIMFGPDKCGATNKVHFIFKHKNPKSGEYVEHHLKYPPSVPSDKLT  673
            AGWV KEFDNESPYSIMFGPDKCG+TNKVHFI KHKNPKSGE+VEHHLK+PPSVPSDKL+
Sbjct  121  AGWVPKEFDNESPYSIMFGPDKCGSTNKVHFILKHKNPKSGEFVEHHLKFPPSVPSDKLS  180

Query  674  HVYTAVLKPDNEVSILIDG  730
            HVYTA+L PDNEV IL+DG
Sbjct  181  HVYTAILTPDNEVWILVDG  199



>ref|XP_008245696.1| PREDICTED: calnexin homolog 1-like [Prunus mume]
Length=541

 Score =   320 bits (820),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 149/190 (78%), Positives = 166/190 (87%), Gaps = 1/190 (1%)
 Frame = +2

Query  164  VLLLVIGCF-FSQLSASSDVKLYESFEEAFEGRWIVSEKEDYKGVWKHSKSEGHEDHGLL  340
            VL L++ C  F QL AS D   Y+SF+E FEGRW VS K+DY+GVW HSKSEGHED+GLL
Sbjct  11   VLFLLVACLSFQQLCASDDTVFYDSFDETFEGRWTVSSKDDYQGVWTHSKSEGHEDYGLL  70

Query  341  VSEPARKYAIVKELDEVVNLKDGTVVLQYEVRLQNGLECGGAYIKYLRPQDAGWVAKEFD  520
            VSE A+KYAIVKEL+E V+LKDGTVVLQ+E RLQNGLECGGAY+KYLRPQ+AGW  K FD
Sbjct  71   VSEKAKKYAIVKELEEPVSLKDGTVVLQFETRLQNGLECGGAYLKYLRPQEAGWEPKIFD  130

Query  521  NESPYSIMFGPDKCGATNKVHFIFKHKNPKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKP  700
            NESPYSIMFGPDKCG TNKVHFIFKHKNPKSGEYVEHHL  PPSVPSDKL+HVYTA+LKP
Sbjct  131  NESPYSIMFGPDKCGLTNKVHFIFKHKNPKSGEYVEHHLTTPPSVPSDKLSHVYTAILKP  190

Query  701  DNEVSILIDG  730
            DNE+ IL+DG
Sbjct  191  DNELQILVDG  200



>gb|KDP22513.1| hypothetical protein JCGZ_26344 [Jatropha curcas]
Length=538

 Score =   320 bits (820),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 153/202 (76%), Positives = 175/202 (87%), Gaps = 1/202 (0%)
 Frame = +2

Query  128  MEEKKRKIWTQSVLLLVIGCFFSQLSASSDVKL-YESFEEAFEGRWIVSEKEDYKGVWKH  304
            M E KR     +V+ LV    F+QL AS D K+ YESFEE+FEGRW VS K+DY+GVWKH
Sbjct  1    MGEAKRISLRLAVVFLVACVSFNQLLASDDDKIFYESFEESFEGRWTVSGKDDYQGVWKH  60

Query  305  SKSEGHEDHGLLVSEPARKYAIVKELDEVVNLKDGTVVLQYEVRLQNGLECGGAYIKYLR  484
            +KSEGH+++GLLVSE ARKYAIVKELD+  +LKDGT+VLQYEVR Q GLECGGAY+KYLR
Sbjct  61   AKSEGHDEYGLLVSEKARKYAIVKELDKPASLKDGTIVLQYEVRFQEGLECGGAYLKYLR  120

Query  485  PQDAGWVAKEFDNESPYSIMFGPDKCGATNKVHFIFKHKNPKSGEYVEHHLKYPPSVPSD  664
            PQ+AGW  K+FDNESPYSIMFGPDKCGATNKVHFI KHKNPKSG+Y+EHHLK+PPSVPSD
Sbjct  121  PQEAGWTPKDFDNESPYSIMFGPDKCGATNKVHFIVKHKNPKSGKYIEHHLKFPPSVPSD  180

Query  665  KLTHVYTAVLKPDNEVSILIDG  730
            KLTHVYTA+LKPDNE+ ILIDG
Sbjct  181  KLTHVYTAILKPDNELQILIDG  202



>ref|NP_001235116.1| calnexin homolog precursor [Glycine max]
 sp|Q39817.1|CALX_SOYBN RecName: Full=Calnexin homolog; Flags: Precursor [Glycine max]
 gb|AAA80588.1| calnexin [Glycine max]
 gb|KHN09695.1| Calnexin like [Glycine soja]
Length=546

 Score =   320 bits (820),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 155/206 (75%), Positives = 173/206 (84%), Gaps = 9/206 (4%)
 Frame = +2

Query  140  KRKIWTQSVLLLVIGCFFSQLSAS---------SDVKLYESFEEAFEGRWIVSEKEDYKG  292
            +RK    ++ LL +  FF   S+S          D   YESF+E F+GRWIVS+KEDY G
Sbjct  3    ERKGIPMALGLLAMILFFIASSSSHLVRASDDADDAIFYESFDEDFDGRWIVSDKEDYNG  62

Query  293  VWKHSKSEGHEDHGLLVSEPARKYAIVKELDEVVNLKDGTVVLQYEVRLQNGLECGGAYI  472
            VWKH+KS+GH+D+GLLVSE ARKYAIVKEL E V+LKDGTVVLQ+E RLQNGLECGGAYI
Sbjct  63   VWKHAKSDGHDDYGLLVSEQARKYAIVKELAESVSLKDGTVVLQFETRLQNGLECGGAYI  122

Query  473  KYLRPQDAGWVAKEFDNESPYSIMFGPDKCGATNKVHFIFKHKNPKSGEYVEHHLKYPPS  652
            KYLRPQ++GW  KEFDNESPYSIMFGPDKCGATNKVHFIFKHKNPKSGEYVEHHLKYPPS
Sbjct  123  KYLRPQESGWKPKEFDNESPYSIMFGPDKCGATNKVHFIFKHKNPKSGEYVEHHLKYPPS  182

Query  653  VPSDKLTHVYTAVLKPDNEVSILIDG  730
            VPSDKLTHVYTA+LKPDNE+ ILIDG
Sbjct  183  VPSDKLTHVYTAILKPDNELQILIDG  208



>ref|XP_010249367.1| PREDICTED: calnexin homolog [Nelumbo nucifera]
Length=535

 Score =   320 bits (819),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 149/189 (79%), Positives = 168/189 (89%), Gaps = 1/189 (1%)
 Frame = +2

Query  164  VLLLVIGCFFSQLSASSDVKLYESFEEAFEGRWIVSEKEDYKGVWKHSKSEGHEDHGLLV  343
            ++ L+I C   +L AS D   YESF+E FEGRW VS KEDYKGVWKH+KSEGH+D+GLLV
Sbjct  10   LIFLLIACATVRLGAS-DALFYESFDEPFEGRWTVSVKEDYKGVWKHAKSEGHDDYGLLV  68

Query  344  SEPARKYAIVKELDEVVNLKDGTVVLQYEVRLQNGLECGGAYIKYLRPQDAGWVAKEFDN  523
            SE ARKYAIV ELD+ V+LKDGTVVLQ+EVRLQNGLECGGAY+KYLRPQ+AGW  KEFDN
Sbjct  69   SEKARKYAIVNELDKPVDLKDGTVVLQFEVRLQNGLECGGAYLKYLRPQEAGWKPKEFDN  128

Query  524  ESPYSIMFGPDKCGATNKVHFIFKHKNPKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKPD  703
            ESPYSIMFGPDKCG+TNKVHFI KHKNPKSG ++EHHLKYPPSVPSDKL+HVYTA+LKPD
Sbjct  129  ESPYSIMFGPDKCGSTNKVHFILKHKNPKSGNFIEHHLKYPPSVPSDKLSHVYTAILKPD  188

Query  704  NEVSILIDG  730
            NE+ ILIDG
Sbjct  189  NELRILIDG  197



>gb|KHG05799.1| Calnexin [Gossypium arboreum]
Length=533

 Score =   320 bits (819),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 149/182 (82%), Positives = 164/182 (90%), Gaps = 4/182 (2%)
 Frame = +2

Query  185  CFFSQLSASSDVKLYESFEEAFEGRWIVSEKEDYKGVWKHSKSEGHEDHGLLVSEPARKY  364
            CF    +A  D   Y+SF+E F+GRWIVS+K+DYKGVWKHSKSEGH+D+GLLVSE ARKY
Sbjct  19   CF----AADDDTVFYDSFDEPFDGRWIVSDKDDYKGVWKHSKSEGHDDYGLLVSEKARKY  74

Query  365  AIVKELDEVVNLKDGTVVLQYEVRLQNGLECGGAYIKYLRPQDAGWVAKEFDNESPYSIM  544
            AIVKEL+E V+LKDG+ VLQ+E R QNGLECGGAY+KYLRPQ+AGW AKEFDNESPYSIM
Sbjct  75   AIVKELNEPVSLKDGSTVLQFETRFQNGLECGGAYLKYLRPQEAGWKAKEFDNESPYSIM  134

Query  545  FGPDKCGATNKVHFIFKHKNPKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKPDNEVSILI  724
            FGPDKCGATNKVHFI KHKNPKSGEYVEHHLKYPPSVPSDKLTHVYTA+LKPDNEV ILI
Sbjct  135  FGPDKCGATNKVHFILKHKNPKSGEYVEHHLKYPPSVPSDKLTHVYTAILKPDNEVRILI  194

Query  725  DG  730
            DG
Sbjct  195  DG  196



>gb|KHN31239.1| Calnexin like [Glycine soja]
Length=543

 Score =   320 bits (819),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 156/207 (75%), Positives = 174/207 (84%), Gaps = 10/207 (5%)
 Frame = +2

Query  140  KRKIWTQSVLLLVIGCFFSQLSASS----------DVKLYESFEEAFEGRWIVSEKEDYK  289
            +RK    ++ LL +  FF   S+SS          D   YESF+E F+GRWIVS+KEDY 
Sbjct  3    ERKGIPIALGLLAMLLFFIASSSSSHLVRASEDADDAIFYESFDEDFDGRWIVSDKEDYN  62

Query  290  GVWKHSKSEGHEDHGLLVSEPARKYAIVKELDEVVNLKDGTVVLQYEVRLQNGLECGGAY  469
            GVWKH+KS+GH+D+GLLVSE ARKYAIVK+LDE V+LKDGTVVLQ+E RLQNGLECGGAY
Sbjct  63   GVWKHAKSDGHDDYGLLVSEQARKYAIVKKLDEPVSLKDGTVVLQFETRLQNGLECGGAY  122

Query  470  IKYLRPQDAGWVAKEFDNESPYSIMFGPDKCGATNKVHFIFKHKNPKSGEYVEHHLKYPP  649
            IKYLRPQ++GW  KEFDNESPYSIMFGPDKCGATNKVHFIFKHKNPKSGEYVEHHLKYPP
Sbjct  123  IKYLRPQESGWKPKEFDNESPYSIMFGPDKCGATNKVHFIFKHKNPKSGEYVEHHLKYPP  182

Query  650  SVPSDKLTHVYTAVLKPDNEVSILIDG  730
            SVPSDKLTHVYTA LKPDNE+ ILIDG
Sbjct  183  SVPSDKLTHVYTAFLKPDNELQILIDG  209



>dbj|BAD81043.1| calnexin [Glycine max]
Length=546

 Score =   320 bits (819),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 155/206 (75%), Positives = 173/206 (84%), Gaps = 9/206 (4%)
 Frame = +2

Query  140  KRKIWTQSVLLLVIGCFFSQLSAS---------SDVKLYESFEEAFEGRWIVSEKEDYKG  292
            +RK    ++ LL +  FF   S+S          D   YESF+E F+GRWIVS+KEDY G
Sbjct  3    ERKGIPMALGLLAMILFFIASSSSHLVRASGDADDAIFYESFDEDFDGRWIVSDKEDYNG  62

Query  293  VWKHSKSEGHEDHGLLVSEPARKYAIVKELDEVVNLKDGTVVLQYEVRLQNGLECGGAYI  472
            VWKH+KS+GH+D+GLLVSE ARKYAIVKEL E V+LKDGTVVLQ+E RLQNGLECGGAYI
Sbjct  63   VWKHAKSDGHDDYGLLVSEQARKYAIVKELAESVSLKDGTVVLQFETRLQNGLECGGAYI  122

Query  473  KYLRPQDAGWVAKEFDNESPYSIMFGPDKCGATNKVHFIFKHKNPKSGEYVEHHLKYPPS  652
            KYLRPQ++GW  KEFDNESPYSIMFGPDKCGATNKVHFIFKHKNPKSGEYVEHHLKYPPS
Sbjct  123  KYLRPQESGWKPKEFDNESPYSIMFGPDKCGATNKVHFIFKHKNPKSGEYVEHHLKYPPS  182

Query  653  VPSDKLTHVYTAVLKPDNEVSILIDG  730
            VPSDKLTHVYTA+LKPDNE+ ILIDG
Sbjct  183  VPSDKLTHVYTAILKPDNELQILIDG  208



>gb|KHG01556.1| Calnexin [Gossypium arboreum]
Length=532

 Score =   319 bits (817),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 148/182 (81%), Positives = 166/182 (91%), Gaps = 4/182 (2%)
 Frame = +2

Query  185  CFFSQLSASSDVKLYESFEEAFEGRWIVSEKEDYKGVWKHSKSEGHEDHGLLVSEPARKY  364
            CF    +A  DV  Y+SFEE+F+GRWIVS+K+DYKGVWKHSKSEGH+D+GLLVSE A+KY
Sbjct  22   CF----AADVDVVFYDSFEESFDGRWIVSDKDDYKGVWKHSKSEGHDDYGLLVSEMAQKY  77

Query  365  AIVKELDEVVNLKDGTVVLQYEVRLQNGLECGGAYIKYLRPQDAGWVAKEFDNESPYSIM  544
            AIVKELDE VNLK+GT VLQ+E RLQ+GLECGGAY+KYLRPQDAGW   EFDNESPYSIM
Sbjct  78   AIVKELDEAVNLKEGTTVLQFETRLQSGLECGGAYLKYLRPQDAGWKPNEFDNESPYSIM  137

Query  545  FGPDKCGATNKVHFIFKHKNPKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKPDNEVSILI  724
            FGPDKCGATNKVHFI +HKNPKSGEY+EHHLKYPPSVPSDKLTHV+TA+LKPDNEVSIL+
Sbjct  138  FGPDKCGATNKVHFILRHKNPKSGEYIEHHLKYPPSVPSDKLTHVFTAILKPDNEVSILV  197

Query  725  DG  730
            DG
Sbjct  198  DG  199



>gb|AGV54271.1| calnexin-like protein [Phaseolus vulgaris]
Length=546

 Score =   319 bits (817),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 156/205 (76%), Positives = 173/205 (84%), Gaps = 4/205 (2%)
 Frame = +2

Query  128  MEEKKR-KIWTQSVLLLVIGCFFSQLSASSDVK---LYESFEEAFEGRWIVSEKEDYKGV  295
            M E+KR  +   +VLLL+    F  L A+ D      YESF+E F+ RWIVS KE+Y GV
Sbjct  1    MGERKRIPLGMFAVLLLISASSFQFLCATEDADDAIFYESFDEDFQDRWIVSHKEEYSGV  60

Query  296  WKHSKSEGHEDHGLLVSEPARKYAIVKELDEVVNLKDGTVVLQYEVRLQNGLECGGAYIK  475
            WKH+KSEGH+DHGLLVSE ARKYAIVKELD  V+LKDGTVVLQ+E RLQNGLECGGAYIK
Sbjct  61   WKHAKSEGHDDHGLLVSEKARKYAIVKELDGAVSLKDGTVVLQFETRLQNGLECGGAYIK  120

Query  476  YLRPQDAGWVAKEFDNESPYSIMFGPDKCGATNKVHFIFKHKNPKSGEYVEHHLKYPPSV  655
            YLRPQDAGW +KEFDNESPYSIMFGPDKCGATNKVHFIFKHKNPK+GEYVEHHLK PPSV
Sbjct  121  YLRPQDAGWKSKEFDNESPYSIMFGPDKCGATNKVHFIFKHKNPKTGEYVEHHLKNPPSV  180

Query  656  PSDKLTHVYTAVLKPDNEVSILIDG  730
            PSDKLT VYTA+LKP+NEV IL+DG
Sbjct  181  PSDKLTQVYTAILKPNNEVQILLDG  205



>ref|XP_010044902.1| PREDICTED: calnexin homolog [Eucalyptus grandis]
Length=541

 Score =   318 bits (815),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 155/196 (79%), Positives = 176/196 (90%), Gaps = 2/196 (1%)
 Frame = +2

Query  143  RKIWTQSVLLLVIGCFFSQLSASSDVKLYESFEEAFEGRWIVSEKEDYKGVWKHSKSEGH  322
            R+I   +  L V+   F Q+ AS DV  +ESF+E+FEGRW+VSEKE+Y+GVWKHSKSEGH
Sbjct  5    RRIRQLARALTVLLLSF-QICAS-DVIFHESFDESFEGRWVVSEKEEYQGVWKHSKSEGH  62

Query  323  EDHGLLVSEPARKYAIVKELDEVVNLKDGTVVLQYEVRLQNGLECGGAYIKYLRPQDAGW  502
            +D+GLLVSE ARKYAIVKELD+VV+LKDGTVVLQYEVRLQ+GLECGGAY+KYLRPQDAGW
Sbjct  63   DDYGLLVSEKARKYAIVKELDDVVSLKDGTVVLQYEVRLQDGLECGGAYLKYLRPQDAGW  122

Query  503  VAKEFDNESPYSIMFGPDKCGATNKVHFIFKHKNPKSGEYVEHHLKYPPSVPSDKLTHVY  682
              KEFDNESPY+IMFGPDKCGATNKVHFIFKHKNPK+GEYVEHHLK+P SVP DKL+HVY
Sbjct  123  KVKEFDNESPYTIMFGPDKCGATNKVHFIFKHKNPKTGEYVEHHLKHPASVPYDKLSHVY  182

Query  683  TAVLKPDNEVSILIDG  730
            TAVLKPDNE+ ILIDG
Sbjct  183  TAVLKPDNELRILIDG  198



>ref|XP_008375429.1| PREDICTED: calnexin homolog [Malus domestica]
Length=543

 Score =   318 bits (815),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 147/190 (77%), Positives = 168/190 (88%), Gaps = 1/190 (1%)
 Frame = +2

Query  164  VLLLVIGCF-FSQLSASSDVKLYESFEEAFEGRWIVSEKEDYKGVWKHSKSEGHEDHGLL  340
            VLL+++ CF F QLSAS D   Y+SF++ FEGRWIVS KE+Y+GVW HSKSEGHED+GLL
Sbjct  11   VLLMLVACFAFQQLSASDDTVFYDSFDDTFEGRWIVSSKEEYQGVWSHSKSEGHEDYGLL  70

Query  341  VSEPARKYAIVKELDEVVNLKDGTVVLQYEVRLQNGLECGGAYIKYLRPQDAGWVAKEFD  520
            VSEPA+KYAIVKEL++  +L DGT+VLQ+E RLQNGLECGGAY+KYLRPQ+AGW  K FD
Sbjct  71   VSEPAKKYAIVKELEKPESLNDGTIVLQFETRLQNGLECGGAYLKYLRPQEAGWEPKIFD  130

Query  521  NESPYSIMFGPDKCGATNKVHFIFKHKNPKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKP  700
            NESPYSIMFGPDKCG TNKVHFIFKHKNPKSGEYVEHHL  PPSVP DKLTHVYTA+LKP
Sbjct  131  NESPYSIMFGPDKCGLTNKVHFIFKHKNPKSGEYVEHHLTTPPSVPVDKLTHVYTAILKP  190

Query  701  DNEVSILIDG  730
            +NE+ IL+DG
Sbjct  191  NNELVILVDG  200



>ref|XP_007209878.1| hypothetical protein PRUPE_ppa003899mg [Prunus persica]
 gb|EMJ11077.1| hypothetical protein PRUPE_ppa003899mg [Prunus persica]
Length=541

 Score =   318 bits (815),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 147/190 (77%), Positives = 167/190 (88%), Gaps = 1/190 (1%)
 Frame = +2

Query  164  VLLLVIGCF-FSQLSASSDVKLYESFEEAFEGRWIVSEKEDYKGVWKHSKSEGHEDHGLL  340
            VL L++ CF F QL AS D   Y+SF+E FEGRW VS K+DY+GVW HSKSEGHED+GLL
Sbjct  11   VLFLLVACFSFQQLFASDDTVFYDSFDETFEGRWTVSSKDDYQGVWTHSKSEGHEDYGLL  70

Query  341  VSEPARKYAIVKELDEVVNLKDGTVVLQYEVRLQNGLECGGAYIKYLRPQDAGWVAKEFD  520
            VSE A+KYAIV+EL++ V+LKDGTVVLQ+E RLQNGLECGGAY+KYLRPQ+AGW  K FD
Sbjct  71   VSEKAKKYAIVRELEKPVSLKDGTVVLQFETRLQNGLECGGAYLKYLRPQEAGWEPKIFD  130

Query  521  NESPYSIMFGPDKCGATNKVHFIFKHKNPKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKP  700
            NESPYSIMFGPDKCG TNKVHFIFKHKNPK+GEYVEHHL  PPSVPSDKL+HVYTA+LKP
Sbjct  131  NESPYSIMFGPDKCGLTNKVHFIFKHKNPKTGEYVEHHLTTPPSVPSDKLSHVYTAILKP  190

Query  701  DNEVSILIDG  730
            DNE+ IL+DG
Sbjct  191  DNELRILVDG  200



>ref|XP_002273708.1| PREDICTED: calnexin homolog [Vitis vinifera]
 emb|CBI29286.3| unnamed protein product [Vitis vinifera]
Length=536

 Score =   317 bits (813),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 147/189 (78%), Positives = 171/189 (90%), Gaps = 1/189 (1%)
 Frame = +2

Query  164  VLLLVIGCFFSQLSASSDVKLYESFEEAFEGRWIVSEKEDYKGVWKHSKSEGHEDHGLLV  343
            ++L+VI C   Q+ AS  +   ESF+E+F+GRWIVSEK+DYKG+WKHSKSEGH+D+GLLV
Sbjct  10   LVLVVISCVGFQIRASDPI-FIESFDESFDGRWIVSEKDDYKGIWKHSKSEGHDDYGLLV  68

Query  344  SEPARKYAIVKELDEVVNLKDGTVVLQYEVRLQNGLECGGAYIKYLRPQDAGWVAKEFDN  523
            SE A+KYAIVKELDE V+LKDGT+VLQ+EVRLQ GLECGGAY+KYLRPQ+AGW   EFDN
Sbjct  69   SEQAKKYAIVKELDEAVSLKDGTIVLQFEVRLQKGLECGGAYLKYLRPQEAGWKPAEFDN  128

Query  524  ESPYSIMFGPDKCGATNKVHFIFKHKNPKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKPD  703
            +SPYSIMFGPDKCG+TNKVHFI KHKNPKSG+YVEHHLKYPPSVPSDKL+HVYTA+LKPD
Sbjct  129  DSPYSIMFGPDKCGSTNKVHFILKHKNPKSGKYVEHHLKYPPSVPSDKLSHVYTAILKPD  188

Query  704  NEVSILIDG  730
            NE+ ILIDG
Sbjct  189  NELRILIDG  197



>ref|XP_011003527.1| PREDICTED: calnexin homolog [Populus euphratica]
Length=539

 Score =   317 bits (813),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 150/201 (75%), Positives = 171/201 (85%), Gaps = 1/201 (0%)
 Frame = +2

Query  128  MEEKKRKIWTQSVLLLVIGCFFSQLSASSDVKLYESFEEAFEGRWIVSEKEDYKGVWKHS  307
            M E KR     +++LL+    F+QL A  D   YE+F+++F GRWIVSEKEDYKG WKH 
Sbjct  1    MREAKRITLRLAIVLLLAFVSFNQLFADDDTIFYETFDKSFSGRWIVSEKEDYKGEWKHE  60

Query  308  KSEGHEDHGLLVSEPARKYAIVKELDEVVNLKDGTVVLQYEVRLQNGLECGGAYIKYLRP  487
            KSEGH+D+GLLVSEPA+KYAIVKELDE V+LKDG +VLQ+E RLQNGLECGGAY+KYLRP
Sbjct  61   KSEGHDDYGLLVSEPAKKYAIVKELDEPVSLKDG-IVLQFETRLQNGLECGGAYLKYLRP  119

Query  488  QDAGWVAKEFDNESPYSIMFGPDKCGATNKVHFIFKHKNPKSGEYVEHHLKYPPSVPSDK  667
            QDAGWV K FD+ESPYSIMFGPDKCG TNKVHFI KHKNPKSGEYVEHHLK+PPSVP DK
Sbjct  120  QDAGWVPKGFDSESPYSIMFGPDKCGTTNKVHFILKHKNPKSGEYVEHHLKFPPSVPHDK  179

Query  668  LTHVYTAVLKPDNEVSILIDG  730
            LTHVYTA+LK DNE+ IL+DG
Sbjct  180  LTHVYTAILKSDNELQILVDG  200



>gb|ACN41018.1| unknown [Picea sitchensis]
Length=549

 Score =   317 bits (813),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 150/196 (77%), Positives = 169/196 (86%), Gaps = 5/196 (3%)
 Frame = +2

Query  152  WTQSVLLLVIGCFFSQLS---ASSDVKLYESFEEAFEGRWIVSEKEDYKGVWKHSKSEGH  322
            W  S+L  V  C  S L+   ++S+   YESF+E+F+GRWI S+KEDYKGVWKH KSEGH
Sbjct  8    WIPSLLAAV--CLISSLNVLVSASEQTFYESFDESFDGRWIASQKEDYKGVWKHEKSEGH  65

Query  323  EDHGLLVSEPARKYAIVKELDEVVNLKDGTVVLQYEVRLQNGLECGGAYIKYLRPQDAGW  502
            ED+GLLVSE A+KYAIV+EL E ++ KDG VVLQYEVRLQNGLECGGAY+KYLRPQ+AGW
Sbjct  66   EDYGLLVSEVAKKYAIVRELPETIDPKDGLVVLQYEVRLQNGLECGGAYLKYLRPQEAGW  125

Query  503  VAKEFDNESPYSIMFGPDKCGATNKVHFIFKHKNPKSGEYVEHHLKYPPSVPSDKLTHVY  682
               EFDNESPYSIMFGPDKCGATNKVHFI+KHKNPKSGEYVEHHLKYPPS PSDKLTHVY
Sbjct  126  KPAEFDNESPYSIMFGPDKCGATNKVHFIYKHKNPKSGEYVEHHLKYPPSTPSDKLTHVY  185

Query  683  TAVLKPDNEVSILIDG  730
            TA+LKP+NEV ILIDG
Sbjct  186  TAILKPNNEVRILIDG  201



>gb|KJB07903.1| hypothetical protein B456_001G053400 [Gossypium raimondii]
Length=447

 Score =   314 bits (804),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 147/182 (81%), Positives = 162/182 (89%), Gaps = 4/182 (2%)
 Frame = +2

Query  185  CFFSQLSASSDVKLYESFEEAFEGRWIVSEKEDYKGVWKHSKSEGHEDHGLLVSEPARKY  364
            CF    +A  D   Y+SF+E F+GRWIVS+K+DYKGVWKHSKSEGH+D+GLLVSE ARKY
Sbjct  19   CF----AADDDTAFYDSFDEPFDGRWIVSDKDDYKGVWKHSKSEGHDDYGLLVSEKARKY  74

Query  365  AIVKELDEVVNLKDGTVVLQYEVRLQNGLECGGAYIKYLRPQDAGWVAKEFDNESPYSIM  544
            AIV EL+E V+LKDG+ VLQ+E R QNGLECGGAY+KYLRPQ+AGW AK FDNESPYSIM
Sbjct  75   AIVNELNEPVSLKDGSTVLQFETRFQNGLECGGAYLKYLRPQEAGWKAKLFDNESPYSIM  134

Query  545  FGPDKCGATNKVHFIFKHKNPKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKPDNEVSILI  724
            FGPDKCGATNKVHFI KHKNPKSGEYVEHHLKYPPSVPSDKLTHVYTA+LKPDNEV ILI
Sbjct  135  FGPDKCGATNKVHFILKHKNPKSGEYVEHHLKYPPSVPSDKLTHVYTAILKPDNEVRILI  194

Query  725  DG  730
            DG
Sbjct  195  DG  196



>ref|XP_007038183.1| Calnexin 1 [Theobroma cacao]
 gb|EOY22684.1| Calnexin 1 [Theobroma cacao]
Length=531

 Score =   316 bits (809),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 146/182 (80%), Positives = 163/182 (90%), Gaps = 4/182 (2%)
 Frame = +2

Query  185  CFFSQLSASSDVKLYESFEEAFEGRWIVSEKEDYKGVWKHSKSEGHEDHGLLVSEPARKY  364
            CF    +A  D   Y+SF+E+F+GRWIVS+K+DYKGVWKHSKSEGH+D+GLLVSE ARKY
Sbjct  21   CF----AADDDAVFYDSFDESFDGRWIVSDKDDYKGVWKHSKSEGHDDYGLLVSEKARKY  76

Query  365  AIVKELDEVVNLKDGTVVLQYEVRLQNGLECGGAYIKYLRPQDAGWVAKEFDNESPYSIM  544
            AIV ELDE V+L DGT VLQ+E RLQNGLECGGAY+KYLRPQ+AGW  KEFDN+SPYSIM
Sbjct  77   AIVNELDEPVSLTDGTTVLQFETRLQNGLECGGAYLKYLRPQEAGWKPKEFDNDSPYSIM  136

Query  545  FGPDKCGATNKVHFIFKHKNPKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKPDNEVSILI  724
            FGPDKCGATNKVHFI KHKNPKSG+YVEHHLKYPPSVPSDKLTHVYTA+LKPDNEV IL+
Sbjct  137  FGPDKCGATNKVHFILKHKNPKSGDYVEHHLKYPPSVPSDKLTHVYTAILKPDNEVRILV  196

Query  725  DG  730
            DG
Sbjct  197  DG  198



>ref|XP_002511066.1| calnexin, putative [Ricinus communis]
 gb|EEF51668.1| calnexin, putative [Ricinus communis]
Length=542

 Score =   316 bits (810),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 149/203 (73%), Positives = 170/203 (84%), Gaps = 2/203 (1%)
 Frame = +2

Query  128  MEEKKRKIWTQSVLLLVIGCFFSQLSASSDVK--LYESFEEAFEGRWIVSEKEDYKGVWK  301
            M E KR     +++ LV    F QL A SD     YESFE++FEGRW +S K+DYKG WK
Sbjct  1    MGEAKRISLRLALVFLVAFVSFVQLRADSDDNKIFYESFEDSFEGRWTLSAKDDYKGEWK  60

Query  302  HSKSEGHEDHGLLVSEPARKYAIVKELDEVVNLKDGTVVLQYEVRLQNGLECGGAYIKYL  481
            H+KSEGH+++GLLVSE ARKYAIVKELDE   LKDGT+VLQ+E R QNGLECGGAY+KYL
Sbjct  61   HAKSEGHDEYGLLVSEKARKYAIVKELDEPATLKDGTIVLQFETRFQNGLECGGAYLKYL  120

Query  482  RPQDAGWVAKEFDNESPYSIMFGPDKCGATNKVHFIFKHKNPKSGEYVEHHLKYPPSVPS  661
            RPQ+AGW  K+FDN+SPYSIMFGPDKCGATNKVHFI KHKNPKSGEY+EHHLKYPPSVPS
Sbjct  121  RPQEAGWTPKDFDNDSPYSIMFGPDKCGATNKVHFILKHKNPKSGEYIEHHLKYPPSVPS  180

Query  662  DKLTHVYTAVLKPDNEVSILIDG  730
            DKLTHVYTA+LKPDNE+ IL+DG
Sbjct  181  DKLTHVYTAILKPDNELRILVDG  203



>gb|KCW87020.1| hypothetical protein EUGRSUZ_B03570 [Eucalyptus grandis]
Length=607

 Score =   318 bits (815),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 153/213 (72%), Positives = 179/213 (84%), Gaps = 3/213 (1%)
 Frame = +2

Query  98   FQLFRVRFS--AMEEKKRKIWTQSVLLLVIGCFFSQLSASSDVKLYESFEEAFEGRWIVS  271
            FQ+ R   +  AME  +      ++ L++I   F Q+ AS DV  Y+SF++ F GRW+VS
Sbjct  54   FQIERPSTAQLAMEGSRIPRLVPALALVLISFAFLQIRAS-DVIFYDSFDQPFVGRWVVS  112

Query  272  EKEDYKGVWKHSKSEGHEDHGLLVSEPARKYAIVKELDEVVNLKDGTVVLQYEVRLQNGL  451
             K+DY G WKHSKSEGH+D+GLLVSE ARKYAIVKELDE+V+LKDGT+ LQYEVRLQNGL
Sbjct  113  VKDDYTGEWKHSKSEGHDDYGLLVSEKARKYAIVKELDEIVSLKDGTIALQYEVRLQNGL  172

Query  452  ECGGAYIKYLRPQDAGWVAKEFDNESPYSIMFGPDKCGATNKVHFIFKHKNPKSGEYVEH  631
            ECGGAY+KYLRPQDAGW  KEFDN+SPY+IMFGPDKCG+TNKVHFIFKHKNPK+GEYVEH
Sbjct  173  ECGGAYLKYLRPQDAGWKVKEFDNDSPYTIMFGPDKCGSTNKVHFIFKHKNPKTGEYVEH  232

Query  632  HLKYPPSVPSDKLTHVYTAVLKPDNEVSILIDG  730
            HLK+PPSVP DKL+HVYTAVLKPDNE+ ILIDG
Sbjct  233  HLKFPPSVPYDKLSHVYTAVLKPDNELRILIDG  265



>gb|KJB07904.1| hypothetical protein B456_001G053400 [Gossypium raimondii]
Length=534

 Score =   316 bits (809),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 147/182 (81%), Positives = 162/182 (89%), Gaps = 4/182 (2%)
 Frame = +2

Query  185  CFFSQLSASSDVKLYESFEEAFEGRWIVSEKEDYKGVWKHSKSEGHEDHGLLVSEPARKY  364
            CF    +A  D   Y+SF+E F+GRWIVS+K+DYKGVWKHSKSEGH+D+GLLVSE ARKY
Sbjct  19   CF----AADDDTAFYDSFDEPFDGRWIVSDKDDYKGVWKHSKSEGHDDYGLLVSEKARKY  74

Query  365  AIVKELDEVVNLKDGTVVLQYEVRLQNGLECGGAYIKYLRPQDAGWVAKEFDNESPYSIM  544
            AIV EL+E V+LKDG+ VLQ+E R QNGLECGGAY+KYLRPQ+AGW AK FDNESPYSIM
Sbjct  75   AIVNELNEPVSLKDGSTVLQFETRFQNGLECGGAYLKYLRPQEAGWKAKLFDNESPYSIM  134

Query  545  FGPDKCGATNKVHFIFKHKNPKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKPDNEVSILI  724
            FGPDKCGATNKVHFI KHKNPKSGEYVEHHLKYPPSVPSDKLTHVYTA+LKPDNEV ILI
Sbjct  135  FGPDKCGATNKVHFILKHKNPKSGEYVEHHLKYPPSVPSDKLTHVYTAILKPDNEVRILI  194

Query  725  DG  730
            DG
Sbjct  195  DG  196



>gb|KJB07906.1| hypothetical protein B456_001G053400 [Gossypium raimondii]
 gb|KJB07907.1| hypothetical protein B456_001G053400 [Gossypium raimondii]
Length=535

 Score =   316 bits (809),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 147/182 (81%), Positives = 162/182 (89%), Gaps = 4/182 (2%)
 Frame = +2

Query  185  CFFSQLSASSDVKLYESFEEAFEGRWIVSEKEDYKGVWKHSKSEGHEDHGLLVSEPARKY  364
            CF    +A  D   Y+SF+E F+GRWIVS+K+DYKGVWKHSKSEGH+D+GLLVSE ARKY
Sbjct  19   CF----AADDDTAFYDSFDEPFDGRWIVSDKDDYKGVWKHSKSEGHDDYGLLVSEKARKY  74

Query  365  AIVKELDEVVNLKDGTVVLQYEVRLQNGLECGGAYIKYLRPQDAGWVAKEFDNESPYSIM  544
            AIV EL+E V+LKDG+ VLQ+E R QNGLECGGAY+KYLRPQ+AGW AK FDNESPYSIM
Sbjct  75   AIVNELNEPVSLKDGSTVLQFETRFQNGLECGGAYLKYLRPQEAGWKAKLFDNESPYSIM  134

Query  545  FGPDKCGATNKVHFIFKHKNPKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKPDNEVSILI  724
            FGPDKCGATNKVHFI KHKNPKSGEYVEHHLKYPPSVPSDKLTHVYTA+LKPDNEV ILI
Sbjct  135  FGPDKCGATNKVHFILKHKNPKSGEYVEHHLKYPPSVPSDKLTHVYTAILKPDNEVRILI  194

Query  725  DG  730
            DG
Sbjct  195  DG  196



>gb|KCW87019.1| hypothetical protein EUGRSUZ_B03570 [Eucalyptus grandis]
Length=608

 Score =   318 bits (814),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 153/213 (72%), Positives = 179/213 (84%), Gaps = 3/213 (1%)
 Frame = +2

Query  98   FQLFRVRFS--AMEEKKRKIWTQSVLLLVIGCFFSQLSASSDVKLYESFEEAFEGRWIVS  271
            FQ+ R   +  AME  +      ++ L++I   F Q+ AS DV  Y+SF++ F GRW+VS
Sbjct  54   FQIERPSTAQLAMEGSRIPRLVPALALVLISFAFLQIRAS-DVIFYDSFDQPFVGRWVVS  112

Query  272  EKEDYKGVWKHSKSEGHEDHGLLVSEPARKYAIVKELDEVVNLKDGTVVLQYEVRLQNGL  451
             K+DY G WKHSKSEGH+D+GLLVSE ARKYAIVKELDE+V+LKDGT+ LQYEVRLQNGL
Sbjct  113  VKDDYTGEWKHSKSEGHDDYGLLVSEKARKYAIVKELDEIVSLKDGTIALQYEVRLQNGL  172

Query  452  ECGGAYIKYLRPQDAGWVAKEFDNESPYSIMFGPDKCGATNKVHFIFKHKNPKSGEYVEH  631
            ECGGAY+KYLRPQDAGW  KEFDN+SPY+IMFGPDKCG+TNKVHFIFKHKNPK+GEYVEH
Sbjct  173  ECGGAYLKYLRPQDAGWKVKEFDNDSPYTIMFGPDKCGSTNKVHFIFKHKNPKTGEYVEH  232

Query  632  HLKYPPSVPSDKLTHVYTAVLKPDNEVSILIDG  730
            HLK+PPSVP DKL+HVYTAVLKPDNE+ ILIDG
Sbjct  233  HLKFPPSVPYDKLSHVYTAVLKPDNELRILIDG  265



>ref|XP_008360201.1| PREDICTED: calnexin homolog 1-like [Malus domestica]
Length=547

 Score =   316 bits (809),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 155/200 (78%), Positives = 176/200 (88%), Gaps = 4/200 (2%)
 Frame = +2

Query  143  RKIWTQSVLLLVIGCFFSQLSASS----DVKLYESFEEAFEGRWIVSEKEDYKGVWKHSK  310
            R+I    +LLL+IGC  SQ+ ASS    D   YE F E+FEGRWIVS K++Y+GVWK SK
Sbjct  7    RRITDLLLLLLLIGCSASQIHASSEYEVDSIFYEPFSESFEGRWIVSSKDEYQGVWKLSK  66

Query  311  SEGHEDHGLLVSEPARKYAIVKELDEVVNLKDGTVVLQYEVRLQNGLECGGAYIKYLRPQ  490
            SEGH+D+GLLVSE ARKYA+VKE+D+ V+L DGTVVLQ+EVRLQNGLECGGAY+KYLRPQ
Sbjct  67   SEGHDDYGLLVSEKARKYAVVKEMDKAVSLADGTVVLQFEVRLQNGLECGGAYLKYLRPQ  126

Query  491  DAGWVAKEFDNESPYSIMFGPDKCGATNKVHFIFKHKNPKSGEYVEHHLKYPPSVPSDKL  670
            +AGW A+EFDNESPYSIMFGPDKCG+TNKVHFIFKHKNPKSGEYVEHHLK PPSVPSDKL
Sbjct  127  EAGWKAEEFDNESPYSIMFGPDKCGSTNKVHFIFKHKNPKSGEYVEHHLKDPPSVPSDKL  186

Query  671  THVYTAVLKPDNEVSILIDG  730
            +HVYTA+LKPDNEV ILIDG
Sbjct  187  SHVYTAILKPDNEVRILIDG  206



>ref|XP_010044903.1| PREDICTED: calnexin homolog [Eucalyptus grandis]
Length=542

 Score =   316 bits (809),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 149/201 (74%), Positives = 173/201 (86%), Gaps = 1/201 (0%)
 Frame = +2

Query  128  MEEKKRKIWTQSVLLLVIGCFFSQLSASSDVKLYESFEEAFEGRWIVSEKEDYKGVWKHS  307
            ME  +      ++ L++I   F Q+ AS DV  Y+SF++ F GRW+VS K+DY G WKHS
Sbjct  1    MEGSRIPRLVPALALVLISFAFLQIRAS-DVIFYDSFDQPFVGRWVVSVKDDYTGEWKHS  59

Query  308  KSEGHEDHGLLVSEPARKYAIVKELDEVVNLKDGTVVLQYEVRLQNGLECGGAYIKYLRP  487
            KSEGH+D+GLLVSE ARKYAIVKELDE+V+LKDGT+ LQYEVRLQNGLECGGAY+KYLRP
Sbjct  60   KSEGHDDYGLLVSEKARKYAIVKELDEIVSLKDGTIALQYEVRLQNGLECGGAYLKYLRP  119

Query  488  QDAGWVAKEFDNESPYSIMFGPDKCGATNKVHFIFKHKNPKSGEYVEHHLKYPPSVPSDK  667
            QDAGW  KEFDN+SPY+IMFGPDKCG+TNKVHFIFKHKNPK+GEYVEHHLK+PPSVP DK
Sbjct  120  QDAGWKVKEFDNDSPYTIMFGPDKCGSTNKVHFIFKHKNPKTGEYVEHHLKFPPSVPYDK  179

Query  668  LTHVYTAVLKPDNEVSILIDG  730
            L+HVYTAVLKPDNE+ ILIDG
Sbjct  180  LSHVYTAVLKPDNELRILIDG  200



>ref|XP_008369590.1| PREDICTED: calnexin homolog [Malus domestica]
Length=550

 Score =   316 bits (809),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 150/188 (80%), Positives = 169/188 (90%), Gaps = 4/188 (2%)
 Frame = +2

Query  179  IGCFFSQLSASS----DVKLYESFEEAFEGRWIVSEKEDYKGVWKHSKSEGHEDHGLLVS  346
            IGC  SQ+ ASS    D   YE F E+FEGRWIVS K++Y+GVWK SKSEGH+D+GLLVS
Sbjct  21   IGCSASQIRASSEHEVDSIFYEPFSESFEGRWIVSSKDEYQGVWKLSKSEGHDDYGLLVS  80

Query  347  EPARKYAIVKELDEVVNLKDGTVVLQYEVRLQNGLECGGAYIKYLRPQDAGWVAKEFDNE  526
            E ARKYA+VKELD+ V+LKDGTVVLQ+EVRLQNGLECGGAY+KYLRPQDAGW A+EFDNE
Sbjct  81   EKARKYAVVKELDKAVSLKDGTVVLQFEVRLQNGLECGGAYLKYLRPQDAGWKAEEFDNE  140

Query  527  SPYSIMFGPDKCGATNKVHFIFKHKNPKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKPDN  706
            SPYSIMFGPDKCG+TNKVHFIFKHKNP+SGE+VEHHLK PPSVPSDKL+HVYTA+LKPDN
Sbjct  141  SPYSIMFGPDKCGSTNKVHFIFKHKNPRSGEFVEHHLKDPPSVPSDKLSHVYTAILKPDN  200

Query  707  EVSILIDG  730
            +V ILIDG
Sbjct  201  QVRILIDG  208



>ref|XP_004309487.1| PREDICTED: calnexin homolog [Fragaria vesca subsp. vesca]
Length=543

 Score =   315 bits (806),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 147/191 (77%), Positives = 167/191 (87%), Gaps = 1/191 (1%)
 Frame = +2

Query  161  SVLLLVIGCF-FSQLSASSDVKLYESFEEAFEGRWIVSEKEDYKGVWKHSKSEGHEDHGL  337
            SVL ++  CF F  LSAS D   Y+SF+E+FEGRW VS K++Y+GVWKHSKSEGHED GL
Sbjct  10   SVLFVLFACFAFQHLSASDDTVFYDSFDESFEGRWTVSGKDEYQGVWKHSKSEGHEDFGL  69

Query  338  LVSEPARKYAIVKELDEVVNLKDGTVVLQYEVRLQNGLECGGAYIKYLRPQDAGWVAKEF  517
            LVSE A+KYAIV E+DE V+LKDGTVVLQ+E RLQNGLECGGAY+KYLRPQ+AGW  K F
Sbjct  70   LVSEKAKKYAIVTEVDEPVSLKDGTVVLQFETRLQNGLECGGAYLKYLRPQEAGWEPKIF  129

Query  518  DNESPYSIMFGPDKCGATNKVHFIFKHKNPKSGEYVEHHLKYPPSVPSDKLTHVYTAVLK  697
            DNESPYSIMFGPDKCG TNKVHFIFKHKNPKSGEYVEHHL  PPSVP+DKL+HVYTA++K
Sbjct  130  DNESPYSIMFGPDKCGLTNKVHFIFKHKNPKSGEYVEHHLTTPPSVPADKLSHVYTAIIK  189

Query  698  PDNEVSILIDG  730
            PDNE+ IL+DG
Sbjct  190  PDNELIILVDG  200



>ref|XP_010249364.1| PREDICTED: calnexin homolog [Nelumbo nucifera]
 ref|XP_010249365.1| PREDICTED: calnexin homolog [Nelumbo nucifera]
Length=535

 Score =   314 bits (804),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 145/188 (77%), Positives = 168/188 (89%), Gaps = 1/188 (1%)
 Frame = +2

Query  167  LLLVIGCFFSQLSASSDVKLYESFEEAFEGRWIVSEKEDYKGVWKHSKSEGHEDHGLLVS  346
            + L+I C   +L AS D   YESF+E+FEGRW+VSEK DY GVWKH+KS+G++D+GLLVS
Sbjct  11   IFLLIACTTVRLGAS-DALFYESFDESFEGRWVVSEKGDYNGVWKHAKSDGYDDYGLLVS  69

Query  347  EPARKYAIVKELDEVVNLKDGTVVLQYEVRLQNGLECGGAYIKYLRPQDAGWVAKEFDNE  526
            E ARKYAIV ELD+ V+LKDGTVVLQ+EVRLQNGLECGGAY+KYLRPQ+AGW  KEFDNE
Sbjct  70   EKARKYAIVNELDKPVDLKDGTVVLQFEVRLQNGLECGGAYLKYLRPQEAGWKPKEFDNE  129

Query  527  SPYSIMFGPDKCGATNKVHFIFKHKNPKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKPDN  706
            SPYSIMFGPDKCG+T+KVHFI KHKNPKSG ++EHHLKYPPSVPSDKL+HVYTA+LKPDN
Sbjct  130  SPYSIMFGPDKCGSTDKVHFILKHKNPKSGNFIEHHLKYPPSVPSDKLSHVYTAILKPDN  189

Query  707  EVSILIDG  730
            E+ ILIDG
Sbjct  190  ELRILIDG  197



>ref|XP_008440191.1| PREDICTED: calnexin homolog [Cucumis melo]
Length=539

 Score =   314 bits (804),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 147/180 (82%), Positives = 163/180 (91%), Gaps = 0/180 (0%)
 Frame = +2

Query  191  FSQLSASSDVKLYESFEEAFEGRWIVSEKEDYKGVWKHSKSEGHEDHGLLVSEPARKYAI  370
            F QL AS+D   Y+SF+E+FEGRWIVSEK+DY+GVWKHSKSEGH+D+GLLVSE ARKYAI
Sbjct  19   FVQLRASNDEIFYDSFDESFEGRWIVSEKDDYQGVWKHSKSEGHDDYGLLVSEKARKYAI  78

Query  371  VKELDEVVNLKDGTVVLQYEVRLQNGLECGGAYIKYLRPQDAGWVAKEFDNESPYSIMFG  550
            V ELDE V+LKDGTVVLQ+E RLQNGLECGGAY+KYLRPQDAGW AKEFDNESPYSIMFG
Sbjct  79   VNELDEPVSLKDGTVVLQFETRLQNGLECGGAYLKYLRPQDAGWKAKEFDNESPYSIMFG  138

Query  551  PDKCGATNKVHFIFKHKNPKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKPDNEVSILIDG  730
            PDKCGATNKVHFI KHKNPK+GEY EHHLK PPSVP+DKL+HVYTA+L+  N V ILIDG
Sbjct  139  PDKCGATNKVHFIVKHKNPKTGEYAEHHLKNPPSVPADKLSHVYTAILESGNSVRILIDG  198



>ref|XP_008392683.1| PREDICTED: calnexin homolog [Malus domestica]
Length=544

 Score =   313 bits (803),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 146/190 (77%), Positives = 166/190 (87%), Gaps = 1/190 (1%)
 Frame = +2

Query  164  VLLLVIGCF-FSQLSASSDVKLYESFEEAFEGRWIVSEKEDYKGVWKHSKSEGHEDHGLL  340
            VLL++  CF F QLSAS D   Y+SF+  FEGRW+VS KE+Y+GVW HSKSEGHED+GLL
Sbjct  8    VLLVLAACFAFQQLSASDDTVFYDSFDNPFEGRWVVSSKEEYQGVWSHSKSEGHEDYGLL  67

Query  341  VSEPARKYAIVKELDEVVNLKDGTVVLQYEVRLQNGLECGGAYIKYLRPQDAGWVAKEFD  520
            VSE A+KYAIVKEL++  +L DGT+VLQ+E RLQNGLECGGAY+KYLRPQ+AGW  K FD
Sbjct  68   VSEKAKKYAIVKELEKPESLNDGTIVLQFETRLQNGLECGGAYLKYLRPQEAGWEPKIFD  127

Query  521  NESPYSIMFGPDKCGATNKVHFIFKHKNPKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKP  700
            NESPYSIMFGPDKCG TNKVHFIFKHKNPKSGEYVEHHL  PPSVPSDKLTHVYTA+LKP
Sbjct  128  NESPYSIMFGPDKCGLTNKVHFIFKHKNPKSGEYVEHHLTTPPSVPSDKLTHVYTAILKP  187

Query  701  DNEVSILIDG  730
            +NE+ IL+DG
Sbjct  188  NNELVILVDG  197



>ref|XP_004975494.1| PREDICTED: calnexin homolog [Setaria italica]
Length=533

 Score =   313 bits (802),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 143/174 (82%), Positives = 163/174 (94%), Gaps = 0/174 (0%)
 Frame = +2

Query  209  SSDVKLYESFEEAFEGRWIVSEKEDYKGVWKHSKSEGHEDHGLLVSEPARKYAIVKELDE  388
            +SD  LYESF+E FEGRW+VS K++Y+GVWKH+KS+GHED+GLLVSE ARKYAI+KELDE
Sbjct  21   ASDPLLYESFDEDFEGRWVVSRKDEYQGVWKHAKSDGHEDYGLLVSEKARKYAIIKELDE  80

Query  389  VVNLKDGTVVLQYEVRLQNGLECGGAYIKYLRPQDAGWVAKEFDNESPYSIMFGPDKCGA  568
             V LKDGTVVLQ+EVRLQNGLECGGAYIKY+RPQDAGW AKEFDNE+PY+IMFGPDKCG+
Sbjct  81   PVTLKDGTVVLQFEVRLQNGLECGGAYIKYIRPQDAGWDAKEFDNETPYTIMFGPDKCGS  140

Query  569  TNKVHFIFKHKNPKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKPDNEVSILIDG  730
            TNKVHFI KHKNPK+G+YVEHHLK+PPSVP DKL+HVYTA+LKPDNEV ILIDG
Sbjct  141  TNKVHFILKHKNPKTGKYVEHHLKFPPSVPYDKLSHVYTAILKPDNEVRILIDG  194



>ref|XP_003532294.1| PREDICTED: calnexin homolog [Glycine max]
 gb|KHN16898.1| Calnexin like [Glycine soja]
Length=538

 Score =   313 bits (802),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 147/190 (77%), Positives = 164/190 (86%), Gaps = 0/190 (0%)
 Frame = +2

Query  161  SVLLLVIGCFFSQLSASSDVKLYESFEEAFEGRWIVSEKEDYKGVWKHSKSEGHEDHGLL  340
            ++LL +    F  L A  D   YESF+E FE RWIVS+K++Y GVWKH+KSEGH+D+GLL
Sbjct  13   ALLLFISASSFQLLRAFDDAIFYESFDEDFEDRWIVSQKDEYNGVWKHAKSEGHDDYGLL  72

Query  341  VSEPARKYAIVKELDEVVNLKDGTVVLQYEVRLQNGLECGGAYIKYLRPQDAGWVAKEFD  520
            VSE  RKYAIVKELDE V LKD TVVLQ+E RLQNGLECGGAY+KYLRPQ+AGW +KEFD
Sbjct  73   VSEKVRKYAIVKELDEAVGLKDETVVLQFETRLQNGLECGGAYLKYLRPQEAGWKSKEFD  132

Query  521  NESPYSIMFGPDKCGATNKVHFIFKHKNPKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKP  700
            NESPYSIMFGPDKCGATNKVHFIFKHKNPKSGEYVEHHLK PPSVPSDKL+HVYTA+LK 
Sbjct  133  NESPYSIMFGPDKCGATNKVHFIFKHKNPKSGEYVEHHLKNPPSVPSDKLSHVYTAILKS  192

Query  701  DNEVSILIDG  730
            DNE+ ILIDG
Sbjct  193  DNELQILIDG  202



>ref|XP_009359843.1| PREDICTED: calnexin homolog 1-like [Pyrus x bretschneideri]
Length=549

 Score =   313 bits (802),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 149/188 (79%), Positives = 167/188 (89%), Gaps = 4/188 (2%)
 Frame = +2

Query  179  IGCFFSQLSASS----DVKLYESFEEAFEGRWIVSEKEDYKGVWKHSKSEGHEDHGLLVS  346
            IGC  SQ+ ASS    D   YE F E+FEGRWIVS K++Y+GVWK SKSEGH+D+GLLVS
Sbjct  21   IGCSASQIRASSEHEVDSIFYEPFSESFEGRWIVSSKDEYQGVWKLSKSEGHDDYGLLVS  80

Query  347  EPARKYAIVKELDEVVNLKDGTVVLQYEVRLQNGLECGGAYIKYLRPQDAGWVAKEFDNE  526
            E  RKYA+VK+LD+ V+LKDGTVVLQ+EVRLQNGLECGGAY+KYLRPQ AGW A+EFDNE
Sbjct  81   EKVRKYAVVKQLDKAVSLKDGTVVLQFEVRLQNGLECGGAYLKYLRPQQAGWKAEEFDNE  140

Query  527  SPYSIMFGPDKCGATNKVHFIFKHKNPKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKPDN  706
            SPYSIMFGPDKCG+TNKVHFIFKHKNPKSGEYVEHHLK PPSVPSDKL+HVYTA+LKPDN
Sbjct  141  SPYSIMFGPDKCGSTNKVHFIFKHKNPKSGEYVEHHLKDPPSVPSDKLSHVYTAILKPDN  200

Query  707  EVSILIDG  730
            +V ILIDG
Sbjct  201  QVRILIDG  208



>ref|XP_006399216.1| hypothetical protein EUTSA_v10013223mg [Eutrema salsugineum]
 gb|ESQ40669.1| hypothetical protein EUTSA_v10013223mg [Eutrema salsugineum]
Length=441

 Score =   310 bits (793),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 146/198 (74%), Positives = 166/198 (84%), Gaps = 0/198 (0%)
 Frame = +2

Query  137  KKRKIWTQSVLLLVIGCFFSQLSASSDVKLYESFEEAFEGRWIVSEKEDYKGVWKHSKSE  316
            ++R +   SVLL+ +  F S         LYESF+E F+GRWIVSEK +Y+G WKH KS+
Sbjct  2    RERTLTFVSVLLVALVSFQSLCYCDEQTILYESFDEPFDGRWIVSEKPEYQGAWKHEKSQ  61

Query  317  GHEDHGLLVSEPARKYAIVKELDEVVNLKDGTVVLQYEVRLQNGLECGGAYIKYLRPQDA  496
            GH+D+GLLVSE ARKY IVKELDE +NLK+GT+VLQYE R Q GLECGGAYIKYLRPQ+A
Sbjct  62   GHDDYGLLVSEKARKYGIVKELDEPLNLKEGTIVLQYEARFQEGLECGGAYIKYLRPQEA  121

Query  497  GWVAKEFDNESPYSIMFGPDKCGATNKVHFIFKHKNPKSGEYVEHHLKYPPSVPSDKLTH  676
            GWV K FDNESPYSIMFGPDKCGATNKVHFI KHKNPKSGEYVEHHLK+PPSVP DKL+H
Sbjct  122  GWVPKGFDNESPYSIMFGPDKCGATNKVHFILKHKNPKSGEYVEHHLKFPPSVPFDKLSH  181

Query  677  VYTAVLKPDNEVSILIDG  730
            VYTA+LKPDNEV IL+DG
Sbjct  182  VYTAILKPDNEVRILVDG  199



>gb|KFK25123.1| hypothetical protein AALP_AA8G068700 [Arabis alpina]
Length=532

 Score =   312 bits (800),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 148/199 (74%), Positives = 169/199 (85%), Gaps = 1/199 (1%)
 Frame = +2

Query  137  KKRKIWTQSVLLLVIGCFFSQLSASSD-VKLYESFEEAFEGRWIVSEKEDYKGVWKHSKS  313
            ++ +I+T S+LLLV       L    D   LYESF+E F+GRWIVSEKE+Y+GVWKH KS
Sbjct  2    RRERIFTVSLLLLVALFSIQNLCYCDDQTVLYESFDEPFDGRWIVSEKEEYQGVWKHEKS  61

Query  314  EGHEDHGLLVSEPARKYAIVKELDEVVNLKDGTVVLQYEVRLQNGLECGGAYIKYLRPQD  493
            EGHED+GL+VSE ARKY IVK LDE +NLK+GT+VLQYE R Q GLECGGAYIKYLRPQ+
Sbjct  62   EGHEDYGLVVSEKARKYGIVKVLDEPLNLKEGTIVLQYEARFQQGLECGGAYIKYLRPQE  121

Query  494  AGWVAKEFDNESPYSIMFGPDKCGATNKVHFIFKHKNPKSGEYVEHHLKYPPSVPSDKLT  673
            AGWV + FDNESPYSIMFGPDKCGATNKVHFI KHKNPKSGE+VEHHLK+PPSVP DKL+
Sbjct  122  AGWVPQGFDNESPYSIMFGPDKCGATNKVHFILKHKNPKSGEFVEHHLKFPPSVPHDKLS  181

Query  674  HVYTAVLKPDNEVSILIDG  730
            HVYTA+LKPDNEV IL+DG
Sbjct  182  HVYTAILKPDNEVRILVDG  200



>ref|XP_010452695.1| PREDICTED: calnexin homolog 2-like [Camelina sativa]
Length=457

 Score =   310 bits (793),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 147/198 (74%), Positives = 170/198 (86%), Gaps = 1/198 (1%)
 Frame = +2

Query  140  KRKIWTQSVLLLVIGCFFSQLSASSD-VKLYESFEEAFEGRWIVSEKEDYKGVWKHSKSE  316
            + +++T   LLLV    FS L    D   LYESF+E+F+GRWIVSEK +Y+GVWKH KSE
Sbjct  2    RERVFTFVSLLLVALFSFSSLCYCDDQTVLYESFDESFDGRWIVSEKPEYQGVWKHEKSE  61

Query  317  GHEDHGLLVSEPARKYAIVKELDEVVNLKDGTVVLQYEVRLQNGLECGGAYIKYLRPQDA  496
            GH+D+GLLVSE A+KY IVKELDE +NLKDGTVVLQYE R Q GLECGGAY+KYLRPQ+A
Sbjct  62   GHDDYGLLVSEKAKKYGIVKELDEPLNLKDGTVVLQYEARFQEGLECGGAYLKYLRPQEA  121

Query  497  GWVAKEFDNESPYSIMFGPDKCGATNKVHFIFKHKNPKSGEYVEHHLKYPPSVPSDKLTH  676
            GWV + FDN+SPYSIMFGPDKCGATNKVHFI KHKNPKSGE+VEHHLK+PPSVP DKL+H
Sbjct  122  GWVPQGFDNDSPYSIMFGPDKCGATNKVHFILKHKNPKSGEFVEHHLKFPPSVPFDKLSH  181

Query  677  VYTAVLKPDNEVSILIDG  730
            VYTA+LKPDNEV+IL+DG
Sbjct  182  VYTAILKPDNEVTILVDG  199



>ref|XP_003525166.1| PREDICTED: calnexin homolog [Glycine max]
Length=541

 Score =   312 bits (799),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 149/194 (77%), Positives = 169/194 (87%), Gaps = 4/194 (2%)
 Frame = +2

Query  161  SVLLLVIGCFFSQLSASSDVK----LYESFEEAFEGRWIVSEKEDYKGVWKHSKSEGHED  328
            ++LLL+    F  L AS D       Y+SF+E FE RW+VS+K++Y GVWKH+KSEGH+D
Sbjct  13   ALLLLISTSSFQLLRASDDADDDAIFYDSFDEDFEDRWVVSQKDEYSGVWKHAKSEGHDD  72

Query  329  HGLLVSEPARKYAIVKELDEVVNLKDGTVVLQYEVRLQNGLECGGAYIKYLRPQDAGWVA  508
            +GLLVSE ARKYAIVKELDE V+LKD TVVLQ+E RLQNGLECGGAY+KYLRPQ+AGW +
Sbjct  73   YGLLVSEKARKYAIVKELDEAVSLKDETVVLQFETRLQNGLECGGAYLKYLRPQEAGWKS  132

Query  509  KEFDNESPYSIMFGPDKCGATNKVHFIFKHKNPKSGEYVEHHLKYPPSVPSDKLTHVYTA  688
            KEFDNESPYSIMFGPDKCGATNKVHFIFKHKNPKSGEYVEHHLK PPSVPSDKL+HVYTA
Sbjct  133  KEFDNESPYSIMFGPDKCGATNKVHFIFKHKNPKSGEYVEHHLKNPPSVPSDKLSHVYTA  192

Query  689  VLKPDNEVSILIDG  730
            +LKPDNE+ ILIDG
Sbjct  193  ILKPDNELQILIDG  206



>gb|EMS59517.1| Calnexin-like protein 1 [Triticum urartu]
Length=529

 Score =   311 bits (797),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 145/191 (76%), Positives = 169/191 (88%), Gaps = 1/191 (1%)
 Frame = +2

Query  158  QSVLLLVIGCFFSQLSASSDVKLYESFEEAFEGRWIVSEKEDYKGVWKHSKSEGHEDHGL  337
            ++VLLLVI   F+Q+ AS D   +ESF E+F+G WIVS KE+YKGVWKH+KS+GHED+GL
Sbjct  5    RAVLLLVISALFAQIGAS-DPLFHESFNESFDGSWIVSGKEEYKGVWKHAKSDGHEDYGL  63

Query  338  LVSEPARKYAIVKELDEVVNLKDGTVVLQYEVRLQNGLECGGAYIKYLRPQDAGWVAKEF  517
            LVSEPARKYAI+KELD  V LKD TVVLQ+EVRLQNGLECGGAYIKY+RPQ  GW AK+F
Sbjct  64   LVSEPARKYAIIKELDHPVILKDETVVLQFEVRLQNGLECGGAYIKYIRPQATGWNAKDF  123

Query  518  DNESPYSIMFGPDKCGATNKVHFIFKHKNPKSGEYVEHHLKYPPSVPSDKLTHVYTAVLK  697
            DN++PY+IMFGPDKCG+TNKVHFI KHKNPK+G+YVEHHLK PPSVP DKL+HVYTA+LK
Sbjct  124  DNDTPYTIMFGPDKCGSTNKVHFILKHKNPKTGKYVEHHLKSPPSVPYDKLSHVYTAILK  183

Query  698  PDNEVSILIDG  730
            PDNEV IL+DG
Sbjct  184  PDNEVRILVDG  194



>ref|XP_006399217.1| hypothetical protein EUTSA_v10013223mg [Eutrema salsugineum]
 gb|ESQ40670.1| hypothetical protein EUTSA_v10013223mg [Eutrema salsugineum]
Length=531

 Score =   311 bits (797),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 146/198 (74%), Positives = 166/198 (84%), Gaps = 0/198 (0%)
 Frame = +2

Query  137  KKRKIWTQSVLLLVIGCFFSQLSASSDVKLYESFEEAFEGRWIVSEKEDYKGVWKHSKSE  316
            ++R +   SVLL+ +  F S         LYESF+E F+GRWIVSEK +Y+G WKH KS+
Sbjct  2    RERTLTFVSVLLVALVSFQSLCYCDEQTILYESFDEPFDGRWIVSEKPEYQGAWKHEKSQ  61

Query  317  GHEDHGLLVSEPARKYAIVKELDEVVNLKDGTVVLQYEVRLQNGLECGGAYIKYLRPQDA  496
            GH+D+GLLVSE ARKY IVKELDE +NLK+GT+VLQYE R Q GLECGGAYIKYLRPQ+A
Sbjct  62   GHDDYGLLVSEKARKYGIVKELDEPLNLKEGTIVLQYEARFQEGLECGGAYIKYLRPQEA  121

Query  497  GWVAKEFDNESPYSIMFGPDKCGATNKVHFIFKHKNPKSGEYVEHHLKYPPSVPSDKLTH  676
            GWV K FDNESPYSIMFGPDKCGATNKVHFI KHKNPKSGEYVEHHLK+PPSVP DKL+H
Sbjct  122  GWVPKGFDNESPYSIMFGPDKCGATNKVHFILKHKNPKSGEYVEHHLKFPPSVPFDKLSH  181

Query  677  VYTAVLKPDNEVSILIDG  730
            VYTA+LKPDNEV IL+DG
Sbjct  182  VYTAILKPDNEVRILVDG  199



>ref|XP_009353485.1| PREDICTED: calnexin homolog 1-like [Pyrus x bretschneideri]
Length=545

 Score =   311 bits (796),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 154/200 (77%), Positives = 176/200 (88%), Gaps = 5/200 (3%)
 Frame = +2

Query  143  RKIWTQSVLLLVIGCFFSQLSASS----DVKLYESFEEAFEGRWIVSEKEDYKGVWKHSK  310
            R+I T  +LLL+IGC  SQ+ ASS    D   YE F E+FEGRWIVS K++Y+GVWK SK
Sbjct  7    RRI-TDLLLLLLIGCSASQIHASSEYEVDSIFYEPFSESFEGRWIVSSKDEYQGVWKLSK  65

Query  311  SEGHEDHGLLVSEPARKYAIVKELDEVVNLKDGTVVLQYEVRLQNGLECGGAYIKYLRPQ  490
            SEGH+D+GLL+SE ARKYA+VK++D+ V+L DGTVVLQ+EVRLQNGLECGGAY+KYLRPQ
Sbjct  66   SEGHDDYGLLMSEKARKYAVVKKMDKAVSLADGTVVLQFEVRLQNGLECGGAYLKYLRPQ  125

Query  491  DAGWVAKEFDNESPYSIMFGPDKCGATNKVHFIFKHKNPKSGEYVEHHLKYPPSVPSDKL  670
            +AGW A+EFDNESPYSIMFGPDKCG+TNKVHFI KHKNPKSGEYVEHHLK PPSVPSDKL
Sbjct  126  EAGWKAEEFDNESPYSIMFGPDKCGSTNKVHFILKHKNPKSGEYVEHHLKDPPSVPSDKL  185

Query  671  THVYTAVLKPDNEVSILIDG  730
            +HVYTAVLKPDNEV ILIDG
Sbjct  186  SHVYTAVLKPDNEVRILIDG  205



>ref|XP_009380017.1| PREDICTED: calnexin homolog [Musa acuminata subsp. malaccensis]
Length=535

 Score =   310 bits (794),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 142/174 (82%), Positives = 162/174 (93%), Gaps = 0/174 (0%)
 Frame = +2

Query  209  SSDVKLYESFEEAFEGRWIVSEKEDYKGVWKHSKSEGHEDHGLLVSEPARKYAIVKELDE  388
            +SD   YESF+E FEGRWIVSEKEDY G+WKHSKS+GHED+GLLVSE ARKYAIVKELDE
Sbjct  24   ASDPLFYESFDEPFEGRWIVSEKEDYTGLWKHSKSDGHEDYGLLVSEKARKYAIVKELDE  83

Query  389  VVNLKDGTVVLQYEVRLQNGLECGGAYIKYLRPQDAGWVAKEFDNESPYSIMFGPDKCGA  568
             + LKDGTVVLQ+EVRLQNGLECGGAY+KYLRPQ+AGW +K FDN+SPYSIMFGPDKCG+
Sbjct  84   PIILKDGTVVLQFEVRLQNGLECGGAYLKYLRPQEAGWTSKGFDNDSPYSIMFGPDKCGS  143

Query  569  TNKVHFIFKHKNPKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKPDNEVSILIDG  730
            TNKVHFI +HKNPK+G++VEHH+KYPPSVPSDKL+HVYTA+LKPDNE+ ILIDG
Sbjct  144  TNKVHFILQHKNPKTGKFVEHHVKYPPSVPSDKLSHVYTAILKPDNELRILIDG  197



>ref|NP_001150317.1| calnexin precursor [Zea mays]
 gb|ACG38634.1| calnexin precursor [Zea mays]
 gb|ACN26095.1| unknown [Zea mays]
 tpg|DAA38019.1| TPA: calnexin [Zea mays]
Length=534

 Score =   310 bits (794),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 140/174 (80%), Positives = 163/174 (94%), Gaps = 0/174 (0%)
 Frame = +2

Query  209  SSDVKLYESFEEAFEGRWIVSEKEDYKGVWKHSKSEGHEDHGLLVSEPARKYAIVKELDE  388
            +SD  LYE F+E FEGRW+VS+K++Y+GVW+H+KS+GHED+GLLVSE ARKYAI+KELDE
Sbjct  21   ASDPLLYEPFDEDFEGRWVVSKKDEYQGVWRHAKSDGHEDYGLLVSEKARKYAIIKELDE  80

Query  389  VVNLKDGTVVLQYEVRLQNGLECGGAYIKYLRPQDAGWVAKEFDNESPYSIMFGPDKCGA  568
             V LKDGTVVLQ+EVRLQNGLECGGAYIKY+RPQDAGW AKEFDNE+PY+IMFGPDKCG+
Sbjct  81   PVTLKDGTVVLQFEVRLQNGLECGGAYIKYIRPQDAGWDAKEFDNETPYTIMFGPDKCGS  140

Query  569  TNKVHFIFKHKNPKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKPDNEVSILIDG  730
            TNKVHFI KHKNPK+G+YVEHHLK+PPSVP DKL+HVYTA+LKPDNEV IL+DG
Sbjct  141  TNKVHFILKHKNPKTGKYVEHHLKFPPSVPYDKLSHVYTAILKPDNEVKILVDG  194



>ref|XP_009360274.1| PREDICTED: calnexin homolog [Pyrus x bretschneideri]
 ref|XP_009360292.1| PREDICTED: calnexin homolog [Pyrus x bretschneideri]
Length=543

 Score =   310 bits (795),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 143/184 (78%), Positives = 162/184 (88%), Gaps = 1/184 (1%)
 Frame = +2

Query  182  GCF-FSQLSASSDVKLYESFEEAFEGRWIVSEKEDYKGVWKHSKSEGHEDHGLLVSEPAR  358
             CF F QLSAS D   Y+SF++ FEGRWIVS KE+Y+GVW HSKSEGHED+GLLVSEPA+
Sbjct  17   ACFAFQQLSASDDTVFYDSFDDTFEGRWIVSSKEEYQGVWSHSKSEGHEDYGLLVSEPAK  76

Query  359  KYAIVKELDEVVNLKDGTVVLQYEVRLQNGLECGGAYIKYLRPQDAGWVAKEFDNESPYS  538
            KYAIVKEL++  +L DGT+VLQ+E RLQNGLECGGAY+KYLRPQ+AGW  K FDNESPYS
Sbjct  77   KYAIVKELEKPESLNDGTIVLQFETRLQNGLECGGAYLKYLRPQEAGWEPKIFDNESPYS  136

Query  539  IMFGPDKCGATNKVHFIFKHKNPKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKPDNEVSI  718
            IMFGPDKCG TNKVHFIFKHKNPKSGEYVEHHL  PPSVP+DKLTH YTA+LKP+NE+ I
Sbjct  137  IMFGPDKCGLTNKVHFIFKHKNPKSGEYVEHHLTTPPSVPTDKLTHAYTAILKPNNELVI  196

Query  719  LIDG  730
            L+DG
Sbjct  197  LVDG  200



>ref|XP_007222238.1| hypothetical protein PRUPE_ppa003823mg [Prunus persica]
 gb|EMJ23437.1| hypothetical protein PRUPE_ppa003823mg [Prunus persica]
Length=546

 Score =   310 bits (794),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 152/205 (74%), Positives = 176/205 (86%), Gaps = 4/205 (2%)
 Frame = +2

Query  128  MEEKKRKIWTQSVLLLVIGCFFSQLSASS----DVKLYESFEEAFEGRWIVSEKEDYKGV  295
            + E +RKI    +LLL+IGC  SQ+ ASS    D   YE F E+FEGRWIVS K++YKGV
Sbjct  3    LMEGRRKITELMLLLLLIGCSASQIQASSENEPDAIFYEPFSESFEGRWIVSSKDEYKGV  62

Query  296  WKHSKSEGHEDHGLLVSEPARKYAIVKELDEVVNLKDGTVVLQYEVRLQNGLECGGAYIK  475
            WK SKSEGH+D+GLLVSE ARKYA+VK+L + V+LK GT+VLQ+EVR QNGLECGGAY+K
Sbjct  63   WKLSKSEGHDDYGLLVSEKARKYAVVKDLGKAVSLKYGTIVLQFEVRFQNGLECGGAYLK  122

Query  476  YLRPQDAGWVAKEFDNESPYSIMFGPDKCGATNKVHFIFKHKNPKSGEYVEHHLKYPPSV  655
            YLRPQ+AGW  KEFDN+SPYSIMFGPDKCG+TNKVHFIFKHKNPKSGEYVEHHLK PPSV
Sbjct  123  YLRPQEAGWKPKEFDNDSPYSIMFGPDKCGSTNKVHFIFKHKNPKSGEYVEHHLKDPPSV  182

Query  656  PSDKLTHVYTAVLKPDNEVSILIDG  730
            PSDKL+HVYTA+LKP+NEV I+IDG
Sbjct  183  PSDKLSHVYTAILKPNNEVRIIIDG  207



>ref|XP_002318189.1| Calnexin precursor family protein [Populus trichocarpa]
 gb|ABK95759.1| unknown [Populus trichocarpa]
 gb|EEE96409.1| Calnexin precursor family protein [Populus trichocarpa]
Length=538

 Score =   310 bits (793),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 147/201 (73%), Positives = 170/201 (85%), Gaps = 1/201 (0%)
 Frame = +2

Query  128  MEEKKRKIWTQSVLLLVIGCFFSQLSASSDVKLYESFEEAFEGRWIVSEKEDYKGVWKHS  307
            M E KR     +++LL+    F+QL A  D   +E+F+E+F GRWIVSEKEDYKGVWK  
Sbjct  1    MREAKRITLRLAIVLLLAFVSFNQLFADDDTIFHETFDESFSGRWIVSEKEDYKGVWKRE  60

Query  308  KSEGHEDHGLLVSEPARKYAIVKELDEVVNLKDGTVVLQYEVRLQNGLECGGAYIKYLRP  487
            KSEGH+D+GLLVSEPA+KYAIVKELDE V+LKDG +VLQ+E RLQ+GLECGGAY+KYLRP
Sbjct  61   KSEGHDDYGLLVSEPAKKYAIVKELDEPVSLKDG-IVLQFETRLQSGLECGGAYLKYLRP  119

Query  488  QDAGWVAKEFDNESPYSIMFGPDKCGATNKVHFIFKHKNPKSGEYVEHHLKYPPSVPSDK  667
            Q+AGWV K FD+ESPYSIMFGPDKCG TNKVHFI KHKNPKSGEYVEHHLK+PPSVP DK
Sbjct  120  QEAGWVPKGFDSESPYSIMFGPDKCGTTNKVHFILKHKNPKSGEYVEHHLKFPPSVPHDK  179

Query  668  LTHVYTAVLKPDNEVSILIDG  730
             THVYTA+LK DNE+ IL+DG
Sbjct  180  HTHVYTAILKSDNELQILVDG  200



>ref|XP_004503036.1| PREDICTED: calnexin homolog [Cicer arietinum]
Length=545

 Score =   310 bits (793),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 144/192 (75%), Positives = 167/192 (87%), Gaps = 3/192 (2%)
 Frame = +2

Query  164  VLLLVIGCFFSQLSASSDVK---LYESFEEAFEGRWIVSEKEDYKGVWKHSKSEGHEDHG  334
            +L  V    F  + AS D +    YESF+E FEGRWIVSEK++Y GVWKHSKS+GH+DHG
Sbjct  17   LLFFVASSSFHLVRASDDAEDAIFYESFDEDFEGRWIVSEKDEYNGVWKHSKSDGHDDHG  76

Query  335  LLVSEPARKYAIVKELDEVVNLKDGTVVLQYEVRLQNGLECGGAYIKYLRPQDAGWVAKE  514
            LLVSEPARKYAIVKELDE V+LKDGTVVLQ+E RLQNGLECGGAY+KYL+PQ++GW  K 
Sbjct  77   LLVSEPARKYAIVKELDESVSLKDGTVVLQFETRLQNGLECGGAYLKYLQPQESGWKPKG  136

Query  515  FDNESPYSIMFGPDKCGATNKVHFIFKHKNPKSGEYVEHHLKYPPSVPSDKLTHVYTAVL  694
            FDNESPYSIMFGPD+CGATNKVHFIF+HKNPK+G++VEHH+KYPPSVPSDKL+HVYTA++
Sbjct  137  FDNESPYSIMFGPDRCGATNKVHFIFRHKNPKTGKHVEHHIKYPPSVPSDKLSHVYTAII  196

Query  695  KPDNEVSILIDG  730
              DNEV ILIDG
Sbjct  197  GNDNEVRILIDG  208



>ref|XP_010423220.1| PREDICTED: calnexin homolog 2 [Camelina sativa]
Length=533

 Score =   309 bits (792),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 142/190 (75%), Positives = 165/190 (87%), Gaps = 0/190 (0%)
 Frame = +2

Query  161  SVLLLVIGCFFSQLSASSDVKLYESFEEAFEGRWIVSEKEDYKGVWKHSKSEGHEDHGLL  340
            S+LL+ +  F S         LYESF+E+F+GRWIVSEK +Y+GVWKH KSEGH+D+GLL
Sbjct  10   SLLLVALFSFSSLCYCDDQTVLYESFDESFDGRWIVSEKPEYQGVWKHEKSEGHDDYGLL  69

Query  341  VSEPARKYAIVKELDEVVNLKDGTVVLQYEVRLQNGLECGGAYIKYLRPQDAGWVAKEFD  520
            VSE A+KY IVKELDE +NLKDGTVVLQYE R Q GLECGGAY+KYLRPQ+AGWV + FD
Sbjct  70   VSEKAKKYGIVKELDEPLNLKDGTVVLQYEARFQEGLECGGAYLKYLRPQEAGWVPQGFD  129

Query  521  NESPYSIMFGPDKCGATNKVHFIFKHKNPKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKP  700
            N+SPYS+MFGPDKCGATNKVHFI KHKNPKSGE+VEHHLK+PPSVP DKL+HVYTA+LKP
Sbjct  130  NDSPYSVMFGPDKCGATNKVHFILKHKNPKSGEFVEHHLKFPPSVPFDKLSHVYTAILKP  189

Query  701  DNEVSILIDG  730
            DNEV+IL+DG
Sbjct  190  DNEVTILVDG  199



>gb|KHN17447.1| Calnexin like [Glycine soja]
Length=542

 Score =   310 bits (793),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 148/194 (76%), Positives = 167/194 (86%), Gaps = 4/194 (2%)
 Frame = +2

Query  161  SVLLLVIGCFFSQLSASSDVK----LYESFEEAFEGRWIVSEKEDYKGVWKHSKSEGHED  328
            ++LLL+    F  L AS D       Y+SF+E FE RW+VS+K++Y GVWKH+KSEGH+D
Sbjct  13   ALLLLISTSSFQLLRASDDADDDAIFYDSFDEDFEDRWVVSQKDEYSGVWKHAKSEGHDD  72

Query  329  HGLLVSEPARKYAIVKELDEVVNLKDGTVVLQYEVRLQNGLECGGAYIKYLRPQDAGWVA  508
            +GLLVSE  RKYAIVKELDE V LKD TVVLQ+E RLQNGLECGGAY+KYLRPQ+AGW +
Sbjct  73   YGLLVSEKVRKYAIVKELDEAVGLKDETVVLQFETRLQNGLECGGAYLKYLRPQEAGWKS  132

Query  509  KEFDNESPYSIMFGPDKCGATNKVHFIFKHKNPKSGEYVEHHLKYPPSVPSDKLTHVYTA  688
            KEFDNESPYSIMFGPDKCGATNKVHFIFKHKNPKSGEYVEHHLK PPSVPSDKL+HVYTA
Sbjct  133  KEFDNESPYSIMFGPDKCGATNKVHFIFKHKNPKSGEYVEHHLKNPPSVPSDKLSHVYTA  192

Query  689  VLKPDNEVSILIDG  730
            +LKPDNE+ ILIDG
Sbjct  193  ILKPDNELQILIDG  206



>ref|XP_003602731.1| Calnexin-like protein [Medicago truncatula]
 gb|AES72982.1| Calnexin 2 [Medicago truncatula]
Length=541

 Score =   309 bits (792),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 145/200 (73%), Positives = 169/200 (85%), Gaps = 9/200 (5%)
 Frame = +2

Query  158  QSVLLLVIGCFFSQLSASS---------DVKLYESFEEAFEGRWIVSEKEDYKGVWKHSK  310
            + V+ + I   F  +++SS         D   YESF+E F+ RWIVSEKE+Y GVWKHSK
Sbjct  4    RKVIPIAIAVLFFFIASSSFVHASDEADDAIFYESFDEDFDSRWIVSEKEEYNGVWKHSK  63

Query  311  SEGHEDHGLLVSEPARKYAIVKELDEVVNLKDGTVVLQYEVRLQNGLECGGAYIKYLRPQ  490
            SEGH+D GLLVSEPARKYAIVKELDE V LKDG+VVLQ+E RLQNGLECGGAYIKYL+PQ
Sbjct  64   SEGHDDFGLLVSEPARKYAIVKELDEPVILKDGSVVLQFETRLQNGLECGGAYIKYLQPQ  123

Query  491  DAGWVAKEFDNESPYSIMFGPDKCGATNKVHFIFKHKNPKSGEYVEHHLKYPPSVPSDKL  670
            ++GW  K FDNESPYS+MFGPDKCGATNKVHFIF+HKNPK+G+YVEHHLK+PPSVPSDKL
Sbjct  124  ESGWKPKGFDNESPYSVMFGPDKCGATNKVHFIFRHKNPKTGKYVEHHLKFPPSVPSDKL  183

Query  671  THVYTAVLKPDNEVSILIDG  730
            +HVYTA+LKPDNE+ IL+DG
Sbjct  184  SHVYTAILKPDNELRILVDG  203



>ref|XP_002866454.1| calnexin 1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH42713.1| calnexin 1 [Arabidopsis lyrata subsp. lyrata]
Length=529

 Score =   309 bits (791),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 144/198 (73%), Positives = 167/198 (84%), Gaps = 0/198 (0%)
 Frame = +2

Query  137  KKRKIWTQSVLLLVIGCFFSQLSASSDVKLYESFEEAFEGRWIVSEKEDYKGVWKHSKSE  316
            ++R++++  +LLL    F           LYESF+E F+GRWIVS+  DY+GVWKH+KSE
Sbjct  2    RQRQLFSGFLLLLAFVSFQKLCYCDDQTVLYESFDEPFDGRWIVSKNSDYEGVWKHAKSE  61

Query  317  GHEDHGLLVSEPARKYAIVKELDEVVNLKDGTVVLQYEVRLQNGLECGGAYIKYLRPQDA  496
            GHED+GLLVSE ARKY IVKELDE +NLK+GTVVLQYEVR Q GLECGGAY+KYLRPQ+A
Sbjct  62   GHEDYGLLVSEKARKYGIVKELDEPLNLKEGTVVLQYEVRFQEGLECGGAYLKYLRPQEA  121

Query  497  GWVAKEFDNESPYSIMFGPDKCGATNKVHFIFKHKNPKSGEYVEHHLKYPPSVPSDKLTH  676
            GW  + FD+ESPYSIMFGPDKCGATNKVHFI KHKNPKSGEYVEHHLK+PPSVP DKL+H
Sbjct  122  GWTPQGFDSESPYSIMFGPDKCGATNKVHFILKHKNPKSGEYVEHHLKFPPSVPYDKLSH  181

Query  677  VYTAVLKPDNEVSILIDG  730
            VYTA+LKPDNEV IL+DG
Sbjct  182  VYTAILKPDNEVRILVDG  199



>gb|KEH35681.1| Calnexin 2 [Medicago truncatula]
Length=546

 Score =   309 bits (792),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 145/200 (73%), Positives = 169/200 (85%), Gaps = 9/200 (5%)
 Frame = +2

Query  158  QSVLLLVIGCFFSQLSASS---------DVKLYESFEEAFEGRWIVSEKEDYKGVWKHSK  310
            + V+ + I   F  +++SS         D   YESF+E F+ RWIVSEKE+Y GVWKHSK
Sbjct  4    RKVIPIAIAVLFFFIASSSFVHASDEADDAIFYESFDEDFDSRWIVSEKEEYNGVWKHSK  63

Query  311  SEGHEDHGLLVSEPARKYAIVKELDEVVNLKDGTVVLQYEVRLQNGLECGGAYIKYLRPQ  490
            SEGH+D GLLVSEPARKYAIVKELDE V LKDG+VVLQ+E RLQNGLECGGAYIKYL+PQ
Sbjct  64   SEGHDDFGLLVSEPARKYAIVKELDEPVILKDGSVVLQFETRLQNGLECGGAYIKYLQPQ  123

Query  491  DAGWVAKEFDNESPYSIMFGPDKCGATNKVHFIFKHKNPKSGEYVEHHLKYPPSVPSDKL  670
            ++GW  K FDNESPYS+MFGPDKCGATNKVHFIF+HKNPK+G+YVEHHLK+PPSVPSDKL
Sbjct  124  ESGWKPKGFDNESPYSVMFGPDKCGATNKVHFIFRHKNPKTGKYVEHHLKFPPSVPSDKL  183

Query  671  THVYTAVLKPDNEVSILIDG  730
            +HVYTA+LKPDNE+ IL+DG
Sbjct  184  SHVYTAILKPDNELRILVDG  203



>ref|XP_008663173.1| PREDICTED: calnexin homolog [Zea mays]
 gb|ACF79151.1| unknown [Zea mays]
 gb|ACF79172.1| unknown [Zea mays]
 gb|AFW58149.1| hypothetical protein ZEAMMB73_760338 [Zea mays]
Length=532

 Score =   308 bits (790),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 141/174 (81%), Positives = 162/174 (93%), Gaps = 0/174 (0%)
 Frame = +2

Query  209  SSDVKLYESFEEAFEGRWIVSEKEDYKGVWKHSKSEGHEDHGLLVSEPARKYAIVKELDE  388
            +SD  LYE F+E FEGRWIVS+K++Y+GVWKH+KS+GHED+GLLVS+ ARKYAI+KELDE
Sbjct  21   ASDPLLYEPFDEDFEGRWIVSKKDEYQGVWKHAKSDGHEDYGLLVSDKARKYAIIKELDE  80

Query  389  VVNLKDGTVVLQYEVRLQNGLECGGAYIKYLRPQDAGWVAKEFDNESPYSIMFGPDKCGA  568
             V L DGTVVLQ+EVRLQNGLECGGAYIKY+RPQDAGW AKEFDNE+PY+IMFGPDKCG+
Sbjct  81   PVTLNDGTVVLQFEVRLQNGLECGGAYIKYIRPQDAGWDAKEFDNETPYTIMFGPDKCGS  140

Query  569  TNKVHFIFKHKNPKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKPDNEVSILIDG  730
            TNKVHFI KHKNPK+G+YVEHHLK+PPSVP DKL+HVYTA+LKPDNEV ILIDG
Sbjct  141  TNKVHFILKHKNPKTGKYVEHHLKFPPSVPYDKLSHVYTAILKPDNEVRILIDG  194



>dbj|BAK00820.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=535

 Score =   308 bits (790),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 143/187 (76%), Positives = 166/187 (89%), Gaps = 1/187 (1%)
 Frame = +2

Query  170  LLVIGCFFSQLSASSDVKLYESFEEAFEGRWIVSEKEDYKGVWKHSKSEGHEDHGLLVSE  349
            LLVI   F+Q+SAS D   +ESF+E+F+G WIVS K++YKG WKHSKS+GHED+GLLVSE
Sbjct  12   LLVISALFAQISAS-DPLFHESFDESFDGSWIVSGKDEYKGAWKHSKSDGHEDYGLLVSE  70

Query  350  PARKYAIVKELDEVVNLKDGTVVLQYEVRLQNGLECGGAYIKYLRPQDAGWVAKEFDNES  529
            PARKYAI+KELD  V LKD TVVLQ+EVRLQNGLECGGAYIKY+RPQ  GW AK+FDN++
Sbjct  71   PARKYAIIKELDYPVTLKDKTVVLQFEVRLQNGLECGGAYIKYIRPQAVGWNAKDFDNDT  130

Query  530  PYSIMFGPDKCGATNKVHFIFKHKNPKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKPDNE  709
            PY+IMFGPDKCG+TNKVHFI KHKNPK+G+YVEHHLK PPSVP DKL+HVYTA+LKPDNE
Sbjct  131  PYTIMFGPDKCGSTNKVHFILKHKNPKTGKYVEHHLKSPPSVPYDKLSHVYTAILKPDNE  190

Query  710  VSILIDG  730
            V IL+DG
Sbjct  191  VRILVDG  197



>ref|XP_008222288.1| PREDICTED: calnexin homolog [Prunus mume]
Length=550

 Score =   309 bits (791),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 146/188 (78%), Positives = 166/188 (88%), Gaps = 4/188 (2%)
 Frame = +2

Query  179  IGCFFSQLSASS----DVKLYESFEEAFEGRWIVSEKEDYKGVWKHSKSEGHEDHGLLVS  346
            IGC  SQ+ ASS    D   YE F E+FEGRWIVS K++YKGVWK SKSEGH+D+GLLVS
Sbjct  24   IGCSASQIQASSENEPDAIFYEPFSESFEGRWIVSSKDEYKGVWKLSKSEGHDDYGLLVS  83

Query  347  EPARKYAIVKELDEVVNLKDGTVVLQYEVRLQNGLECGGAYIKYLRPQDAGWVAKEFDNE  526
            E ARKYA+VK+L + V+LKDGT+VLQ+EVR QNGLECGGAY+KYLRPQ+AGW  +EFDN+
Sbjct  84   EKARKYAVVKDLGKAVSLKDGTIVLQFEVRFQNGLECGGAYLKYLRPQEAGWKPEEFDND  143

Query  527  SPYSIMFGPDKCGATNKVHFIFKHKNPKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKPDN  706
            SPYSIMFGPDKCG+TNKVHFIFKHKNPKSGEYVEHHLK PPSVPSDKL+HVYTA+LKP+N
Sbjct  144  SPYSIMFGPDKCGSTNKVHFIFKHKNPKSGEYVEHHLKDPPSVPSDKLSHVYTAILKPNN  203

Query  707  EVSILIDG  730
            EV ILIDG
Sbjct  204  EVRILIDG  211



>dbj|BAJ94182.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=535

 Score =   308 bits (790),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 143/187 (76%), Positives = 166/187 (89%), Gaps = 1/187 (1%)
 Frame = +2

Query  170  LLVIGCFFSQLSASSDVKLYESFEEAFEGRWIVSEKEDYKGVWKHSKSEGHEDHGLLVSE  349
            LLVI   F+Q+SAS D   +ESF+E+F+G WIVS K++YKG WKHSKS+GHED+GLLVSE
Sbjct  12   LLVISALFAQISAS-DPLFHESFDESFDGSWIVSGKDEYKGAWKHSKSDGHEDYGLLVSE  70

Query  350  PARKYAIVKELDEVVNLKDGTVVLQYEVRLQNGLECGGAYIKYLRPQDAGWVAKEFDNES  529
            PARKYAI+KELD  V LKD TVVLQ+EVRLQNGLECGGAYIKY+RPQ  GW AK+FDN++
Sbjct  71   PARKYAIIKELDYPVTLKDKTVVLQFEVRLQNGLECGGAYIKYIRPQAVGWNAKDFDNDT  130

Query  530  PYSIMFGPDKCGATNKVHFIFKHKNPKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKPDNE  709
            PY+IMFGPDKCG+TNKVHFI KHKNPK+G+YVEHHLK PPSVP DKL+HVYTA+LKPDNE
Sbjct  131  PYTIMFGPDKCGSTNKVHFILKHKNPKTGKYVEHHLKSPPSVPYDKLSHVYTAILKPDNE  190

Query  710  VSILIDG  730
            V IL+DG
Sbjct  191  VRILVDG  197



>ref|XP_009404191.1| PREDICTED: calnexin homolog [Musa acuminata subsp. malaccensis]
Length=539

 Score =   308 bits (789),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 142/174 (82%), Positives = 161/174 (93%), Gaps = 0/174 (0%)
 Frame = +2

Query  209  SSDVKLYESFEEAFEGRWIVSEKEDYKGVWKHSKSEGHEDHGLLVSEPARKYAIVKELDE  388
            +SD   YESF+E FEGRWIV+EKEDYKG+W+HSKS+GHED+GLLVSE ARKYAIVKELDE
Sbjct  24   ASDPLFYESFDEPFEGRWIVAEKEDYKGLWEHSKSDGHEDYGLLVSEKARKYAIVKELDE  83

Query  389  VVNLKDGTVVLQYEVRLQNGLECGGAYIKYLRPQDAGWVAKEFDNESPYSIMFGPDKCGA  568
             V LKDGTVVLQ+EVRLQNGLECGGAY+KYLRPQ AGW  K FDNESPY+IMFGPDKCG+
Sbjct  84   PVILKDGTVVLQFEVRLQNGLECGGAYLKYLRPQGAGWSPKGFDNESPYTIMFGPDKCGS  143

Query  569  TNKVHFIFKHKNPKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKPDNEVSILIDG  730
            TNKVHFI +HKNPK+G++VEHHLKYPPSVPSDKL+HVYTA+LKPDNE+ IL+DG
Sbjct  144  TNKVHFILQHKNPKTGKFVEHHLKYPPSVPSDKLSHVYTAILKPDNELRILVDG  197



>ref|XP_003630450.1| Calnexin-like protein [Medicago truncatula]
 gb|AET04926.1| Calnexin 2 [Medicago truncatula]
Length=540

 Score =   308 bits (788),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 150/206 (73%), Positives = 171/206 (83%), Gaps = 5/206 (2%)
 Frame = +2

Query  128  MEEKKRKIWTQSVLLLVIGCFFSQ--LSASSDVK---LYESFEEAFEGRWIVSEKEDYKG  292
            M E+KR       ++  + C  S   L AS D      YESF+E F+ RWIVS+K++Y G
Sbjct  1    MGERKRIPLGIFAVIFFVICSSSLHLLRASDDADDAIFYESFDEDFDDRWIVSDKDEYNG  60

Query  293  VWKHSKSEGHEDHGLLVSEPARKYAIVKELDEVVNLKDGTVVLQYEVRLQNGLECGGAYI  472
            +WKHSKSEGHED+GLLVSE ARKYA+VKELDE V LKD +VVLQ+E RLQNGLECGGAY+
Sbjct  61   IWKHSKSEGHEDYGLLVSEKARKYAVVKELDEPVILKDESVVLQFETRLQNGLECGGAYL  120

Query  473  KYLRPQDAGWVAKEFDNESPYSIMFGPDKCGATNKVHFIFKHKNPKSGEYVEHHLKYPPS  652
            KYLRPQ+AGW  KEFDN+SPYSIMFGPDKCGATNKVHFIFKHKNPKSGEYVEHHLK+PPS
Sbjct  121  KYLRPQEAGWKPKEFDNDSPYSIMFGPDKCGATNKVHFIFKHKNPKSGEYVEHHLKFPPS  180

Query  653  VPSDKLTHVYTAVLKPDNEVSILIDG  730
            VPSDKL+HVYTA+LKPDNE+ ILIDG
Sbjct  181  VPSDKLSHVYTAILKPDNELQILIDG  206



>ref|NP_200987.1| calnexin 1 [Arabidopsis thaliana]
 sp|P29402.1|CALX1_ARATH RecName: Full=Calnexin homolog 1; Flags: Precursor [Arabidopsis 
thaliana]
 emb|CAA79144.1| calnexin homolog [Arabidopsis thaliana]
 dbj|BAB10079.1| calnexin homolog precursor [Arabidopsis thaliana]
 gb|AAL24362.1| calnexin homolog precursor [Arabidopsis thaliana]
 gb|AAM47988.1| calnexin-like protein precursor [Arabidopsis thaliana]
 gb|AAM63911.1| calnexin-like protein [Arabidopsis thaliana]
 gb|AED97518.1| calnexin 1 [Arabidopsis thaliana]
Length=530

 Score =   307 bits (786),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 143/198 (72%), Positives = 166/198 (84%), Gaps = 0/198 (0%)
 Frame = +2

Query  137  KKRKIWTQSVLLLVIGCFFSQLSASSDVKLYESFEEAFEGRWIVSEKEDYKGVWKHSKSE  316
            ++R++++  +LLL    F           LYESF+E F+GRWIVS+  DY+GVWKH+KSE
Sbjct  2    RQRQLFSVFLLLLAFVSFQKLCYCDDQTVLYESFDEPFDGRWIVSKNSDYEGVWKHAKSE  61

Query  317  GHEDHGLLVSEPARKYAIVKELDEVVNLKDGTVVLQYEVRLQNGLECGGAYIKYLRPQDA  496
            GHED+GLLVSE ARKY IVKELDE +NLK+GTVVLQYEVR Q GLECGGAY+KYLRPQ+A
Sbjct  62   GHEDYGLLVSEKARKYGIVKELDEPLNLKEGTVVLQYEVRFQEGLECGGAYLKYLRPQEA  121

Query  497  GWVAKEFDNESPYSIMFGPDKCGATNKVHFIFKHKNPKSGEYVEHHLKYPPSVPSDKLTH  676
            GW  + FD+ESPYSIMFGPDKCG TNKVHFI KHKNPKSGEYVEHHLK+PPSVP DKL+H
Sbjct  122  GWTPQGFDSESPYSIMFGPDKCGGTNKVHFILKHKNPKSGEYVEHHLKFPPSVPYDKLSH  181

Query  677  VYTAVLKPDNEVSILIDG  730
            VYTA+LKPDNEV IL+DG
Sbjct  182  VYTAILKPDNEVRILVDG  199



>ref|XP_010491342.1| PREDICTED: calnexin homolog 2-like [Camelina sativa]
Length=532

 Score =   307 bits (786),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 145/198 (73%), Positives = 168/198 (85%), Gaps = 1/198 (1%)
 Frame = +2

Query  140  KRKIWTQSVLLLVIGCFFSQLSASSD-VKLYESFEEAFEGRWIVSEKEDYKGVWKHSKSE  316
            + +++T   LLLV    FS L    D   LYESF+E+F+GRWIVSEK +Y+GVWKH KSE
Sbjct  2    RERVFTYVSLLLVALFSFSSLCYCDDQTVLYESFDESFDGRWIVSEKPEYQGVWKHEKSE  61

Query  317  GHEDHGLLVSEPARKYAIVKELDEVVNLKDGTVVLQYEVRLQNGLECGGAYIKYLRPQDA  496
            GH+D+GLLVSE A+KY IVKELDE + LKDGTVVLQYE R Q GLECGGAY+KYLRPQ+A
Sbjct  62   GHDDYGLLVSEKAKKYGIVKELDEPLYLKDGTVVLQYEARFQEGLECGGAYLKYLRPQEA  121

Query  497  GWVAKEFDNESPYSIMFGPDKCGATNKVHFIFKHKNPKSGEYVEHHLKYPPSVPSDKLTH  676
            GWV + FDN+SPYSIMFGPDKCGATNKVHFI KHKNPKSGE+VEHHLK+PPSVP DKL+H
Sbjct  122  GWVPQSFDNDSPYSIMFGPDKCGATNKVHFILKHKNPKSGEFVEHHLKFPPSVPFDKLSH  181

Query  677  VYTAVLKPDNEVSILIDG  730
            VYT +LKPDNEV+IL+DG
Sbjct  182  VYTVILKPDNEVTILVDG  199



>gb|KJB51312.1| hypothetical protein B456_008G211600 [Gossypium raimondii]
Length=539

 Score =   307 bits (786),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 145/182 (80%), Positives = 160/182 (88%), Gaps = 0/182 (0%)
 Frame = +2

Query  185  CFFSQLSASSDVKLYESFEEAFEGRWIVSEKEDYKGVWKHSKSEGHEDHGLLVSEPARKY  364
            CF    +   DV  YESFEE+FEGRWIVS K+DYKG+WKHSKSEGHED+GLLVSE ARKY
Sbjct  21   CFADDDNNDDDVVFYESFEESFEGRWIVSNKDDYKGLWKHSKSEGHEDYGLLVSEKARKY  80

Query  365  AIVKELDEVVNLKDGTVVLQYEVRLQNGLECGGAYIKYLRPQDAGWVAKEFDNESPYSIM  544
            AIVK +DE V+LKDGT VLQ+E RLQ+G+ECGGAYIK+LRPQ+AGW  +EFDNESPYSIM
Sbjct  81   AIVKVVDEPVSLKDGTTVLQFETRLQSGIECGGAYIKFLRPQEAGWKPEEFDNESPYSIM  140

Query  545  FGPDKCGATNKVHFIFKHKNPKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKPDNEVSILI  724
            FGPDKCG TNKVHFIFKHKNPK+GEYVEHHLKYPPSVPSDKLTHVYTA LK D EV I+I
Sbjct  141  FGPDKCGTTNKVHFIFKHKNPKNGEYVEHHLKYPPSVPSDKLTHVYTATLKRDKEVKIMI  200

Query  725  DG  730
            DG
Sbjct  201  DG  202



>ref|XP_009373671.1| PREDICTED: calnexin homolog isoform X2 [Pyrus x bretschneideri]
Length=546

 Score =   307 bits (786),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 143/183 (78%), Positives = 161/183 (88%), Gaps = 1/183 (1%)
 Frame = +2

Query  185  CF-FSQLSASSDVKLYESFEEAFEGRWIVSEKEDYKGVWKHSKSEGHEDHGLLVSEPARK  361
            CF F QLSAS D   Y+SF++ FEGRWIVS KE+Y+GVW HSKSEGHED+GLLVSE A+K
Sbjct  18   CFAFQQLSASDDTVFYDSFDDTFEGRWIVSSKEEYQGVWSHSKSEGHEDYGLLVSEKAKK  77

Query  362  YAIVKELDEVVNLKDGTVVLQYEVRLQNGLECGGAYIKYLRPQDAGWVAKEFDNESPYSI  541
            YAIVKEL++  +L DGT+VLQ+E RLQNGLECGGAY+KYLRPQ+AGW  K FDNESPYSI
Sbjct  78   YAIVKELEKPESLNDGTIVLQFETRLQNGLECGGAYLKYLRPQEAGWEPKIFDNESPYSI  137

Query  542  MFGPDKCGATNKVHFIFKHKNPKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKPDNEVSIL  721
            MFGPDKCG TNKVHFIFKHKNP SGEYVEHHL  PPSVP+DKLTHVYTA+LKP+NEV IL
Sbjct  138  MFGPDKCGLTNKVHFIFKHKNPNSGEYVEHHLTTPPSVPADKLTHVYTAILKPNNEVVIL  197

Query  722  IDG  730
            +DG
Sbjct  198  VDG  200



>ref|XP_009373670.1| PREDICTED: calnexin homolog isoform X1 [Pyrus x bretschneideri]
Length=557

 Score =   307 bits (786),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 143/183 (78%), Positives = 161/183 (88%), Gaps = 1/183 (1%)
 Frame = +2

Query  185  CF-FSQLSASSDVKLYESFEEAFEGRWIVSEKEDYKGVWKHSKSEGHEDHGLLVSEPARK  361
            CF F QLSAS D   Y+SF++ FEGRWIVS KE+Y+GVW HSKSEGHED+GLLVSE A+K
Sbjct  18   CFAFQQLSASDDTVFYDSFDDTFEGRWIVSSKEEYQGVWSHSKSEGHEDYGLLVSEKAKK  77

Query  362  YAIVKELDEVVNLKDGTVVLQYEVRLQNGLECGGAYIKYLRPQDAGWVAKEFDNESPYSI  541
            YAIVKEL++  +L DGT+VLQ+E RLQNGLECGGAY+KYLRPQ+AGW  K FDNESPYSI
Sbjct  78   YAIVKELEKPESLNDGTIVLQFETRLQNGLECGGAYLKYLRPQEAGWEPKIFDNESPYSI  137

Query  542  MFGPDKCGATNKVHFIFKHKNPKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKPDNEVSIL  721
            MFGPDKCG TNKVHFIFKHKNP SGEYVEHHL  PPSVP+DKLTHVYTA+LKP+NEV IL
Sbjct  138  MFGPDKCGLTNKVHFIFKHKNPNSGEYVEHHLTTPPSVPADKLTHVYTAILKPNNEVVIL  197

Query  722  IDG  730
            +DG
Sbjct  198  VDG  200



>gb|EMT03767.1| Calnexin-like protein [Aegilops tauschii]
Length=535

 Score =   306 bits (785),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 141/182 (77%), Positives = 162/182 (89%), Gaps = 1/182 (1%)
 Frame = +2

Query  185  CFFSQLSASSDVKLYESFEEAFEGRWIVSEKEDYKGVWKHSKSEGHEDHGLLVSEPARKY  364
              F+Q+ AS D   +ESF+E FEG W+VS KE+Y GVWKH KS+GHED+GLLVSEPARKY
Sbjct  18   ALFAQIRAS-DPLFHESFDEGFEGSWVVSGKEEYSGVWKHEKSDGHEDYGLLVSEPARKY  76

Query  365  AIVKELDEVVNLKDGTVVLQYEVRLQNGLECGGAYIKYLRPQDAGWVAKEFDNESPYSIM  544
            AIVKELD  V LKDGTVVLQ+EVRLQNGLECGGAY+KY+RPQ+AGW AKEFDN++PY+IM
Sbjct  77   AIVKELDSPVTLKDGTVVLQFEVRLQNGLECGGAYLKYIRPQEAGWDAKEFDNDTPYTIM  136

Query  545  FGPDKCGATNKVHFIFKHKNPKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKPDNEVSILI  724
            FGPDKCG+TNKVHFI KHKNPK+G+YVEHHLK PPSVP DKL+HVYTA+LKPDNEV IL+
Sbjct  137  FGPDKCGSTNKVHFILKHKNPKTGKYVEHHLKSPPSVPYDKLSHVYTAILKPDNEVRILV  196

Query  725  DG  730
            DG
Sbjct  197  DG  198



>ref|XP_006287793.1| hypothetical protein CARUB_v10001009mg [Capsella rubella]
 gb|EOA20691.1| hypothetical protein CARUB_v10001009mg [Capsella rubella]
Length=431

 Score =   303 bits (775),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 139/169 (82%), Positives = 155/169 (92%), Gaps = 0/169 (0%)
 Frame = +2

Query  224  LYESFEEAFEGRWIVSEKEDYKGVWKHSKSEGHEDHGLLVSEPARKYAIVKELDEVVNLK  403
            LYESFEE F+GRWIVSEK +Y+GVWKH KSEGH+DHGLLVSE A+KY IVKELDE +NLK
Sbjct  31   LYESFEEPFDGRWIVSEKAEYQGVWKHEKSEGHDDHGLLVSEKAKKYGIVKELDEPLNLK  90

Query  404  DGTVVLQYEVRLQNGLECGGAYIKYLRPQDAGWVAKEFDNESPYSIMFGPDKCGATNKVH  583
            +GTVVLQYE R Q GLECGGAY+KYLRPQ+AGWV + FDN+SPYSIMFGPDKCGATNKVH
Sbjct  91   EGTVVLQYEARFQQGLECGGAYLKYLRPQEAGWVPQGFDNDSPYSIMFGPDKCGATNKVH  150

Query  584  FIFKHKNPKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKPDNEVSILIDG  730
            FI KHKNPKSGE+VEHHLK+PPSVP DKL+HVYTA+LKPDNEV IL+DG
Sbjct  151  FILKHKNPKSGEFVEHHLKFPPSVPFDKLSHVYTAILKPDNEVRILVDG  199



>ref|XP_006280507.1| hypothetical protein CARUB_v10026443mg [Capsella rubella]
 gb|EOA13405.1| hypothetical protein CARUB_v10026443mg [Capsella rubella]
Length=431

 Score =   303 bits (775),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 142/198 (72%), Positives = 167/198 (84%), Gaps = 0/198 (0%)
 Frame = +2

Query  137  KKRKIWTQSVLLLVIGCFFSQLSASSDVKLYESFEEAFEGRWIVSEKEDYKGVWKHSKSE  316
            ++R++++  +LLL    F           LYESF+E F+GRWIVS+  +Y+GVWKH+KSE
Sbjct  2    RERQLFSVFLLLLAFVSFQKLCYCDDQTVLYESFDEPFDGRWIVSKNGEYEGVWKHAKSE  61

Query  317  GHEDHGLLVSEPARKYAIVKELDEVVNLKDGTVVLQYEVRLQNGLECGGAYIKYLRPQDA  496
            GH+D+GLLVSE ARKY IVKELDE +NLK+GTVVLQYEVR Q GLECGGAY+KYLRPQ+A
Sbjct  62   GHDDYGLLVSEKARKYGIVKELDEPLNLKEGTVVLQYEVRFQEGLECGGAYLKYLRPQEA  121

Query  497  GWVAKEFDNESPYSIMFGPDKCGATNKVHFIFKHKNPKSGEYVEHHLKYPPSVPSDKLTH  676
            GW  + FD+ESPYSIMFGPDKCGATNKVHFI KHKNPKSGEYVEHHLK+PPSVP DKL+H
Sbjct  122  GWTPQGFDSESPYSIMFGPDKCGATNKVHFILKHKNPKSGEYVEHHLKFPPSVPYDKLSH  181

Query  677  VYTAVLKPDNEVSILIDG  730
            VYTA+LKPDNEV IL+DG
Sbjct  182  VYTAILKPDNEVRILVDG  199



>gb|EMT07009.1| Calnexin-like protein [Aegilops tauschii]
Length=529

 Score =   305 bits (782),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 142/189 (75%), Positives = 166/189 (88%), Gaps = 1/189 (1%)
 Frame = +2

Query  164  VLLLVIGCFFSQLSASSDVKLYESFEEAFEGRWIVSEKEDYKGVWKHSKSEGHEDHGLLV  343
            +LLLVI   F+Q+ AS D   +ESF E+F+G WIVS KE+YKGVWKH+KS+GHED+GLLV
Sbjct  7    LLLLVISALFAQIHAS-DPLFHESFNESFDGSWIVSGKEEYKGVWKHAKSDGHEDYGLLV  65

Query  344  SEPARKYAIVKELDEVVNLKDGTVVLQYEVRLQNGLECGGAYIKYLRPQDAGWVAKEFDN  523
            SEPARKYAI+KELD  V LK  TVVLQ+EVRLQNGLECGGAYIKY+RPQ  GW AK+FDN
Sbjct  66   SEPARKYAIIKELDYPVTLKGETVVLQFEVRLQNGLECGGAYIKYIRPQATGWNAKDFDN  125

Query  524  ESPYSIMFGPDKCGATNKVHFIFKHKNPKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKPD  703
            ++PY+IMFGPDKCG+TNKVHFI KHKNPK+G+YVEHH+K PPSVP DKL+HVYTA+LKPD
Sbjct  126  DTPYTIMFGPDKCGSTNKVHFILKHKNPKTGKYVEHHIKSPPSVPYDKLSHVYTAILKPD  185

Query  704  NEVSILIDG  730
            NEV IL+DG
Sbjct  186  NEVRILVDG  194



>dbj|BAJ89767.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=538

 Score =   305 bits (782),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 142/180 (79%), Positives = 162/180 (90%), Gaps = 1/180 (1%)
 Frame = +2

Query  191  FSQLSASSDVKLYESFEEAFEGRWIVSEKEDYKGVWKHSKSEGHEDHGLLVSEPARKYAI  370
            F+Q+ AS D   +ESF+E FEG WIVS KE+Y GVWKH KS+GHED+GLLVSEPARKYAI
Sbjct  20   FAQIHAS-DPLFHESFDEGFEGSWIVSGKEEYSGVWKHEKSDGHEDYGLLVSEPARKYAI  78

Query  371  VKELDEVVNLKDGTVVLQYEVRLQNGLECGGAYIKYLRPQDAGWVAKEFDNESPYSIMFG  550
            VKELD  V LKDGTVVLQ+EVRLQNGLECGGAY+KY+RPQ+AGW AKEFDN++PY+IMFG
Sbjct  79   VKELDSPVTLKDGTVVLQFEVRLQNGLECGGAYLKYIRPQEAGWDAKEFDNDTPYTIMFG  138

Query  551  PDKCGATNKVHFIFKHKNPKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKPDNEVSILIDG  730
            PDKCG+TNKVHFI KHKNPK+G+YVEHHLK PPSVP DKL+HVYTA+LKPDNEV IL+DG
Sbjct  139  PDKCGSTNKVHFILKHKNPKTGKYVEHHLKSPPSVPYDKLSHVYTAILKPDNEVRILVDG  198



>gb|KHG01051.1| Calnexin [Gossypium arboreum]
Length=538

 Score =   305 bits (782),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 145/182 (80%), Positives = 159/182 (87%), Gaps = 0/182 (0%)
 Frame = +2

Query  185  CFFSQLSASSDVKLYESFEEAFEGRWIVSEKEDYKGVWKHSKSEGHEDHGLLVSEPARKY  364
            C     +   DV  YESFEE+FEGRWIVS K+DYKG+WKHSKSEGHED+GLLVSE ARKY
Sbjct  20   CVADDDNNDDDVVFYESFEESFEGRWIVSNKDDYKGLWKHSKSEGHEDYGLLVSEKARKY  79

Query  365  AIVKELDEVVNLKDGTVVLQYEVRLQNGLECGGAYIKYLRPQDAGWVAKEFDNESPYSIM  544
            AIVK +DE V+LKDGT VLQ+E RLQ+GLECGGAYIK+LRPQ+AGW  +EFDNESPYSIM
Sbjct  80   AIVKVVDEPVSLKDGTTVLQFETRLQSGLECGGAYIKFLRPQEAGWKPEEFDNESPYSIM  139

Query  545  FGPDKCGATNKVHFIFKHKNPKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKPDNEVSILI  724
            FGPDKCG TNKVHFIFKHKNPK+GEYVEHHLKYPPSVPSDKLTHVYTA LK D EV I+I
Sbjct  140  FGPDKCGTTNKVHFIFKHKNPKNGEYVEHHLKYPPSVPSDKLTHVYTATLKRDKEVKIMI  199

Query  725  DG  730
            DG
Sbjct  200  DG  201



>ref|NP_001052692.1| Os04g0402100 [Oryza sativa Japonica Group]
 emb|CAD40786.1| OSJNBb0012E08.10 [Oryza sativa Japonica Group]
 dbj|BAF14606.1| Os04g0402100 [Oryza sativa Japonica Group]
 dbj|BAG91264.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|ACS13098.1| calnexin [Oryza sativa Indica Group]
 gb|AGT42319.1| calnexin [Oryza sativa Japonica Group]
Length=537

 Score =   305 bits (781),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 138/174 (79%), Positives = 160/174 (92%), Gaps = 0/174 (0%)
 Frame = +2

Query  209  SSDVKLYESFEEAFEGRWIVSEKEDYKGVWKHSKSEGHEDHGLLVSEPARKYAIVKELDE  388
            +SD   YE F+E+FEGRW++S K+DYKGVWKH KS+GHED+GLLVSE A+KYAI+KELDE
Sbjct  22   ASDPLFYEPFDESFEGRWVLSGKDDYKGVWKHEKSDGHEDYGLLVSEKAKKYAIIKELDE  81

Query  389  VVNLKDGTVVLQYEVRLQNGLECGGAYIKYLRPQDAGWVAKEFDNESPYSIMFGPDKCGA  568
             V LKDGTVVLQ+EVRLQNGLECGGAY+KY+RPQDA W AKEFDNE+PY+IMFGPDKCG+
Sbjct  82   PVTLKDGTVVLQFEVRLQNGLECGGAYLKYIRPQDAAWDAKEFDNETPYTIMFGPDKCGS  141

Query  569  TNKVHFIFKHKNPKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKPDNEVSILIDG  730
            TNKVHFI KHKNPK+G+YVEHHLK+PPSVP DKL+HVYTA+LKPDNEV IL+DG
Sbjct  142  TNKVHFILKHKNPKTGKYVEHHLKFPPSVPYDKLSHVYTAILKPDNEVRILVDG  195



>ref|XP_004145138.1| PREDICTED: calnexin homolog 1-like [Cucumis sativus]
 ref|XP_004154010.1| PREDICTED: calnexin homolog 1-like [Cucumis sativus]
 ref|XP_004169924.1| PREDICTED: calnexin homolog 1-like [Cucumis sativus]
 gb|KGN64444.1| Calnexin [Cucumis sativus]
Length=539

 Score =   305 bits (782),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 143/178 (80%), Positives = 159/178 (89%), Gaps = 0/178 (0%)
 Frame = +2

Query  197  QLSASSDVKLYESFEEAFEGRWIVSEKEDYKGVWKHSKSEGHEDHGLLVSEPARKYAIVK  376
            QL AS D   YESF+ +F+GRWIVSEK+DY+GVWKH+KSEGH+D+GLLVSE ARKYAIV 
Sbjct  21   QLRASDDEIFYESFDVSFQGRWIVSEKDDYQGVWKHAKSEGHDDYGLLVSEKARKYAIVS  80

Query  377  ELDEVVNLKDGTVVLQYEVRLQNGLECGGAYIKYLRPQDAGWVAKEFDNESPYSIMFGPD  556
            ELDE  +LKDGTVVLQ+E RLQNGLECGGAY+KYLRPQDAGW AKEFDNESPYSIMFGPD
Sbjct  81   ELDEPASLKDGTVVLQFETRLQNGLECGGAYLKYLRPQDAGWKAKEFDNESPYSIMFGPD  140

Query  557  KCGATNKVHFIFKHKNPKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKPDNEVSILIDG  730
            KCGATNKVHFI KHKNPK+GEY EHHLK PPSVP+DKL+HVYTA+L+  N V ILIDG
Sbjct  141  KCGATNKVHFIVKHKNPKTGEYGEHHLKNPPSVPADKLSHVYTAILESGNNVRILIDG  198



>gb|ACJ85683.1| unknown [Medicago truncatula]
 gb|AFK41123.1| unknown [Medicago truncatula]
Length=541

 Score =   304 bits (779),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 142/200 (71%), Positives = 168/200 (84%), Gaps = 9/200 (5%)
 Frame = +2

Query  158  QSVLLLVIGCFFSQLSASS---------DVKLYESFEEAFEGRWIVSEKEDYKGVWKHSK  310
            + V+ + I   F  +++SS         D   YESF+  F+ RWIVSEKE+Y GVWKHSK
Sbjct  4    RKVIPIAIAVLFFFIASSSFVHASDEADDAIFYESFDGDFDSRWIVSEKEEYNGVWKHSK  63

Query  311  SEGHEDHGLLVSEPARKYAIVKELDEVVNLKDGTVVLQYEVRLQNGLECGGAYIKYLRPQ  490
            SEGH+D GLLVSEPARKYAIVKELDE V LKDG+VVL++E RLQNGLECGGAYIKYL+PQ
Sbjct  64   SEGHDDFGLLVSEPARKYAIVKELDEPVILKDGSVVLRFETRLQNGLECGGAYIKYLQPQ  123

Query  491  DAGWVAKEFDNESPYSIMFGPDKCGATNKVHFIFKHKNPKSGEYVEHHLKYPPSVPSDKL  670
            ++GW  K FDNESPYS+MFGPD+CGATNKVHFIF+HKNPK+G+YVEHHLK+PPSVPSDKL
Sbjct  124  ESGWKPKGFDNESPYSVMFGPDRCGATNKVHFIFRHKNPKTGKYVEHHLKFPPSVPSDKL  183

Query  671  THVYTAVLKPDNEVSILIDG  730
            +HVYTA+LKPDNE+ IL+DG
Sbjct  184  SHVYTAILKPDNELRILVDG  203



>ref|XP_006652238.1| PREDICTED: calnexin homolog [Oryza brachyantha]
Length=538

 Score =   304 bits (778),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 137/174 (79%), Positives = 160/174 (92%), Gaps = 0/174 (0%)
 Frame = +2

Query  209  SSDVKLYESFEEAFEGRWIVSEKEDYKGVWKHSKSEGHEDHGLLVSEPARKYAIVKELDE  388
            +SD   YE F+E+FEG+W+VS K+DYKG+WKH KS+GHED+GLLVSE A+KYAI+KELDE
Sbjct  23   ASDPLFYEPFDESFEGKWVVSGKDDYKGLWKHEKSDGHEDYGLLVSEKAKKYAIIKELDE  82

Query  389  VVNLKDGTVVLQYEVRLQNGLECGGAYIKYLRPQDAGWVAKEFDNESPYSIMFGPDKCGA  568
             V LKDGTVVLQ+EVRLQNGLECGGAYIKY+RPQDA W AKEFDN++PY+IMFGPDKCG+
Sbjct  83   PVTLKDGTVVLQFEVRLQNGLECGGAYIKYIRPQDAAWDAKEFDNDTPYTIMFGPDKCGS  142

Query  569  TNKVHFIFKHKNPKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKPDNEVSILIDG  730
            TNKVHFI KHKNPK+G+YVEHHLK+PPSVP DKL+HVYTA+LKPDNEV IL+DG
Sbjct  143  TNKVHFILKHKNPKTGKYVEHHLKFPPSVPYDKLSHVYTAILKPDNEVRILVDG  196



>emb|CDY16801.1| BnaA09g05810D [Brassica napus]
Length=533

 Score =   303 bits (777),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 141/198 (71%), Positives = 164/198 (83%), Gaps = 0/198 (0%)
 Frame = +2

Query  137  KKRKIWTQSVLLLVIGCFFSQLSASSDVKLYESFEEAFEGRWIVSEKEDYKGVWKHSKSE  316
            + R++++  +L+L                LYESF+EAF+GRWIVS+  DY+GVWKH KSE
Sbjct  2    RDRQLFSAVLLILAFVSLQKLCYCDDQTVLYESFDEAFDGRWIVSKNGDYEGVWKHEKSE  61

Query  317  GHEDHGLLVSEPARKYAIVKELDEVVNLKDGTVVLQYEVRLQNGLECGGAYIKYLRPQDA  496
            GH+D+GLLVSE ARKY IVK LDE +NLKDGT+VLQYEVR Q GLECGGAY+KYLRPQ+A
Sbjct  62   GHDDYGLLVSEKARKYGIVKVLDEPLNLKDGTIVLQYEVRFQEGLECGGAYLKYLRPQEA  121

Query  497  GWVAKEFDNESPYSIMFGPDKCGATNKVHFIFKHKNPKSGEYVEHHLKYPPSVPSDKLTH  676
            GW  + FD+ESPYSIMFGPDKCGATNKVHFI KHKNPKSGEYVEHHLK+PPSVP DKL+H
Sbjct  122  GWTPEGFDSESPYSIMFGPDKCGATNKVHFILKHKNPKSGEYVEHHLKFPPSVPYDKLSH  181

Query  677  VYTAVLKPDNEVSILIDG  730
            VYTA+LKPDNEV IL+DG
Sbjct  182  VYTAILKPDNEVRILVDG  199



>ref|XP_010536572.1| PREDICTED: calnexin homolog 1-like [Tarenaya hassleriana]
Length=545

 Score =   304 bits (778),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 139/169 (82%), Positives = 157/169 (93%), Gaps = 0/169 (0%)
 Frame = +2

Query  224  LYESFEEAFEGRWIVSEKEDYKGVWKHSKSEGHEDHGLLVSEPARKYAIVKELDEVVNLK  403
             YESF++ F+GRW+VSEKE+Y+GVWKH KSEGH+D+GLLVSE ARKY IVKELDE V+LK
Sbjct  33   FYESFDKPFDGRWVVSEKEEYQGVWKHEKSEGHDDYGLLVSEKARKYGIVKELDEPVSLK  92

Query  404  DGTVVLQYEVRLQNGLECGGAYIKYLRPQDAGWVAKEFDNESPYSIMFGPDKCGATNKVH  583
            DGTVVLQY+VR QNGLECGGAYIKYLRPQ+AGW +K FDN+SPYSIMFGPDKCGATNKVH
Sbjct  93   DGTVVLQYDVRFQNGLECGGAYIKYLRPQEAGWTSKGFDNDSPYSIMFGPDKCGATNKVH  152

Query  584  FIFKHKNPKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKPDNEVSILIDG  730
            FI KHKNPKSGEYVEHHLK+PPSVP DKL+HVYTAV+KPDNE+ IL+DG
Sbjct  153  FILKHKNPKSGEYVEHHLKFPPSVPFDKLSHVYTAVIKPDNELQILVDG  201



>emb|CDX87226.1| BnaC09g05410D [Brassica napus]
Length=533

 Score =   303 bits (776),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 141/198 (71%), Positives = 164/198 (83%), Gaps = 0/198 (0%)
 Frame = +2

Query  137  KKRKIWTQSVLLLVIGCFFSQLSASSDVKLYESFEEAFEGRWIVSEKEDYKGVWKHSKSE  316
            + R++++  +L+L                LYESF+EAF+GRWIVS+  DY+GVWKH KSE
Sbjct  3    RDRQLFSAVLLILAFVSLQKLCYCDDQTVLYESFDEAFDGRWIVSKNGDYEGVWKHEKSE  62

Query  317  GHEDHGLLVSEPARKYAIVKELDEVVNLKDGTVVLQYEVRLQNGLECGGAYIKYLRPQDA  496
            GH+D+GLLVSE ARKY IVK LDE +NLKDGT+VLQYEVR Q GLECGGAY+KYLRPQ+A
Sbjct  63   GHDDYGLLVSEKARKYGIVKVLDEPLNLKDGTIVLQYEVRFQEGLECGGAYLKYLRPQEA  122

Query  497  GWVAKEFDNESPYSIMFGPDKCGATNKVHFIFKHKNPKSGEYVEHHLKYPPSVPSDKLTH  676
            GW  + FD+ESPYSIMFGPDKCGATNKVHFI KHKNPKSGEYVEHHLK+PPSVP DKL+H
Sbjct  123  GWTPEGFDSESPYSIMFGPDKCGATNKVHFILKHKNPKSGEYVEHHLKFPPSVPYDKLSH  182

Query  677  VYTAVLKPDNEVSILIDG  730
            VYTA+LKPDNEV IL+DG
Sbjct  183  VYTAILKPDNEVRILVDG  200



>ref|XP_009130175.1| PREDICTED: calnexin homolog 1-like [Brassica rapa]
Length=535

 Score =   303 bits (776),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 139/169 (82%), Positives = 156/169 (92%), Gaps = 0/169 (0%)
 Frame = +2

Query  224  LYESFEEAFEGRWIVSEKEDYKGVWKHSKSEGHEDHGLLVSEPARKYAIVKELDEVVNLK  403
            LYESF+EAF+GRWIVS+  DY+GVWKH+KSEGH+D+GLLVSE ARKY IVKELDE +NLK
Sbjct  32   LYESFDEAFDGRWIVSKNGDYEGVWKHAKSEGHDDYGLLVSEKARKYGIVKELDEPLNLK  91

Query  404  DGTVVLQYEVRLQNGLECGGAYIKYLRPQDAGWVAKEFDNESPYSIMFGPDKCGATNKVH  583
            DGT+VLQYEVR Q GLECGGAY+KYLRPQ+AGW  + FD+ESPYSIMFGPDKCGATNKVH
Sbjct  92   DGTIVLQYEVRFQEGLECGGAYLKYLRPQEAGWTPEGFDSESPYSIMFGPDKCGATNKVH  151

Query  584  FIFKHKNPKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKPDNEVSILIDG  730
            FI KHKNPKSGEYVEHHLK+PPSVP DKL+HVYTA+LKPDNEV IL+DG
Sbjct  152  FILKHKNPKSGEYVEHHLKFPPSVPYDKLSHVYTAILKPDNEVRILVDG  200



>gb|AAK84429.1| putative papillar cell-specific calnexin [Brassica napus]
Length=533

 Score =   303 bits (776),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 141/198 (71%), Positives = 164/198 (83%), Gaps = 0/198 (0%)
 Frame = +2

Query  137  KKRKIWTQSVLLLVIGCFFSQLSASSDVKLYESFEEAFEGRWIVSEKEDYKGVWKHSKSE  316
            + R++++  +L+L                LYESF+EAF+GRWIVS+  DY+GVWKH KSE
Sbjct  2    RDRQLFSAVLLVLAFVSLQKLCYCDDQTVLYESFDEAFDGRWIVSKNGDYEGVWKHEKSE  61

Query  317  GHEDHGLLVSEPARKYAIVKELDEVVNLKDGTVVLQYEVRLQNGLECGGAYIKYLRPQDA  496
            GH+D+GLLVSE ARKY IVK LDE +NLKDGT+VLQYEVR Q GLECGGAY+KYLRPQ+A
Sbjct  62   GHDDYGLLVSEKARKYGIVKVLDEPLNLKDGTIVLQYEVRFQEGLECGGAYLKYLRPQEA  121

Query  497  GWVAKEFDNESPYSIMFGPDKCGATNKVHFIFKHKNPKSGEYVEHHLKYPPSVPSDKLTH  676
            GW  + FD+ESPYSIMFGPDKCGATNKVHFI KHKNPKSGEYVEHHLK+PPSVP DKL+H
Sbjct  122  GWTPEGFDSESPYSIMFGPDKCGATNKVHFILKHKNPKSGEYVEHHLKFPPSVPYDKLSH  181

Query  677  VYTAVLKPDNEVSILIDG  730
            VYTA+LKPDNEV IL+DG
Sbjct  182  VYTAILKPDNEVRILVDG  199



>gb|EAY93972.1| hypothetical protein OsI_15749 [Oryza sativa Indica Group]
Length=537

 Score =   303 bits (776),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 137/174 (79%), Positives = 160/174 (92%), Gaps = 0/174 (0%)
 Frame = +2

Query  209  SSDVKLYESFEEAFEGRWIVSEKEDYKGVWKHSKSEGHEDHGLLVSEPARKYAIVKELDE  388
            +SD   YE F+E+FEGRW++S K+DYKGVWKH KS+GHED+GLLVSE A+KYAI+KELDE
Sbjct  22   ASDPLFYEPFDESFEGRWVLSGKDDYKGVWKHEKSDGHEDYGLLVSEKAKKYAIIKELDE  81

Query  389  VVNLKDGTVVLQYEVRLQNGLECGGAYIKYLRPQDAGWVAKEFDNESPYSIMFGPDKCGA  568
             V LKDGTVVLQ+EVRLQ+GLECGGAY+KY+RPQDA W AKEFDNE+PY+IMFGPDKCG+
Sbjct  82   PVTLKDGTVVLQFEVRLQSGLECGGAYLKYIRPQDAAWDAKEFDNETPYTIMFGPDKCGS  141

Query  569  TNKVHFIFKHKNPKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKPDNEVSILIDG  730
            TNKVHFI KHKNPK+G+YVEHHLK+PPSVP DKL+HVYTA+LKPDNEV IL+DG
Sbjct  142  TNKVHFILKHKNPKTGKYVEHHLKFPPSVPYDKLSHVYTAILKPDNEVRILVDG  195



>ref|XP_009390827.1| PREDICTED: calnexin homolog 1-like [Musa acuminata subsp. malaccensis]
Length=538

 Score =   303 bits (775),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 138/174 (79%), Positives = 159/174 (91%), Gaps = 0/174 (0%)
 Frame = +2

Query  209  SSDVKLYESFEEAFEGRWIVSEKEDYKGVWKHSKSEGHEDHGLLVSEPARKYAIVKELDE  388
            +SD   YESF+E FEGRWIVSEK+DY+G+WKHSKS+GHED+GLLVSE ARKYAIVKELD 
Sbjct  24   ASDPWFYESFDEPFEGRWIVSEKDDYQGLWKHSKSDGHEDYGLLVSENARKYAIVKELDG  83

Query  389  VVNLKDGTVVLQYEVRLQNGLECGGAYIKYLRPQDAGWVAKEFDNESPYSIMFGPDKCGA  568
             + LKDGTVVLQ+EVRLQNGLECGGAY+KYLR Q+ GW+ K FDNESPYSIMFGPDKCGA
Sbjct  84   PITLKDGTVVLQFEVRLQNGLECGGAYLKYLRAQETGWIPKGFDNESPYSIMFGPDKCGA  143

Query  569  TNKVHFIFKHKNPKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKPDNEVSILIDG  730
            TNKVHFI +HKNPK+G++VEHHLK+PPSVP D+L+HVYTA+LKPDNE+ ILIDG
Sbjct  144  TNKVHFILQHKNPKTGKFVEHHLKFPPSVPHDRLSHVYTAILKPDNELKILIDG  197



>ref|XP_006844691.1| hypothetical protein AMTR_s00016p00245620 [Amborella trichopoda]
 gb|ERN06366.1| hypothetical protein AMTR_s00016p00245620 [Amborella trichopoda]
Length=535

 Score =   303 bits (775),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 137/175 (78%), Positives = 160/175 (91%), Gaps = 0/175 (0%)
 Frame = +2

Query  206  ASSDVKLYESFEEAFEGRWIVSEKEDYKGVWKHSKSEGHEDHGLLVSEPARKYAIVKELD  385
            ++S    YESF+E+F+GRWIVSEK+DY+GVWKHSKSEGH+D+GLLVSE ARKYAIVKELD
Sbjct  20   STSMPTFYESFDESFDGRWIVSEKDDYQGVWKHSKSEGHDDYGLLVSEKARKYAIVKELD  79

Query  386  EVVNLKDGTVVLQYEVRLQNGLECGGAYIKYLRPQDAGWVAKEFDNESPYSIMFGPDKCG  565
            + V  KDG +VLQ+E RLQNGLECGGAY+KYLRPQ+AGW  KEFDNE+PYSIMFGPDKCG
Sbjct  80   KPVEFKDGELVLQFETRLQNGLECGGAYLKYLRPQEAGWKPKEFDNEAPYSIMFGPDKCG  139

Query  566  ATNKVHFIFKHKNPKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKPDNEVSILIDG  730
            +TNKVHFI KHKNP+SGE+VEHHLKYPPSVPSDKLTHVYTA+LKP+N+  ++IDG
Sbjct  140  STNKVHFILKHKNPRSGEFVEHHLKYPPSVPSDKLTHVYTAILKPNNDFVVVIDG  194



>ref|XP_009112002.1| PREDICTED: calnexin homolog 1-like [Brassica rapa]
Length=535

 Score =   303 bits (775),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 141/198 (71%), Positives = 164/198 (83%), Gaps = 0/198 (0%)
 Frame = +2

Query  137  KKRKIWTQSVLLLVIGCFFSQLSASSDVKLYESFEEAFEGRWIVSEKEDYKGVWKHSKSE  316
            + R++++  +L+L                LYESF+EAF+GRWIVS+  DY+GVWKH KSE
Sbjct  3    RDRQLFSAVLLVLAFVSLQKLCYCDDQTVLYESFDEAFDGRWIVSKNGDYEGVWKHEKSE  62

Query  317  GHEDHGLLVSEPARKYAIVKELDEVVNLKDGTVVLQYEVRLQNGLECGGAYIKYLRPQDA  496
            GH+D+GLLVSE ARKY IVK LDE +NLKDGT+VLQYEVR Q GLECGGAY+KYLRPQ+A
Sbjct  63   GHDDYGLLVSEKARKYGIVKVLDEPLNLKDGTIVLQYEVRFQEGLECGGAYLKYLRPQEA  122

Query  497  GWVAKEFDNESPYSIMFGPDKCGATNKVHFIFKHKNPKSGEYVEHHLKYPPSVPSDKLTH  676
            GW  + FD+ESPYSIMFGPDKCGATNKVHFI KHKNPKSGEYVEHHLK+PPSVP DKL+H
Sbjct  123  GWTPEGFDSESPYSIMFGPDKCGATNKVHFILKHKNPKSGEYVEHHLKFPPSVPYDKLSH  182

Query  677  VYTAVLKPDNEVSILIDG  730
            VYTA+LKPDNEV IL+DG
Sbjct  183  VYTAILKPDNEVRILVDG  200



>ref|XP_009150122.1| PREDICTED: calnexin homolog 1 [Brassica rapa]
Length=531

 Score =   302 bits (774),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 140/169 (83%), Positives = 156/169 (92%), Gaps = 0/169 (0%)
 Frame = +2

Query  224  LYESFEEAFEGRWIVSEKEDYKGVWKHSKSEGHEDHGLLVSEPARKYAIVKELDEVVNLK  403
            LYESF+E FEG WIVS+  DY+GVWKH+KSEGH+D+GLLVSE ARKY IVKEL+E +NLK
Sbjct  32   LYESFDEPFEGSWIVSKNGDYEGVWKHAKSEGHDDYGLLVSEKARKYGIVKELEEPLNLK  91

Query  404  DGTVVLQYEVRLQNGLECGGAYIKYLRPQDAGWVAKEFDNESPYSIMFGPDKCGATNKVH  583
            DGTVVLQYEVR Q GLECGGAY+KYLRPQDAGW A+ F++ESPYSIMFGPDKCGATNKVH
Sbjct  92   DGTVVLQYEVRFQEGLECGGAYLKYLRPQDAGWTAEGFNSESPYSIMFGPDKCGATNKVH  151

Query  584  FIFKHKNPKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKPDNEVSILIDG  730
            FI KHKNPKSGEYVEHHLK+PPSVP DKL+HVYTA+LKPDNEVSIL+DG
Sbjct  152  FILKHKNPKSGEYVEHHLKFPPSVPHDKLSHVYTAILKPDNEVSILVDG  200



>gb|EAZ30613.1| hypothetical protein OsJ_14665 [Oryza sativa Japonica Group]
Length=569

 Score =   303 bits (776),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 136/169 (80%), Positives = 157/169 (93%), Gaps = 0/169 (0%)
 Frame = +2

Query  224  LYESFEEAFEGRWIVSEKEDYKGVWKHSKSEGHEDHGLLVSEPARKYAIVKELDEVVNLK  403
             YE F+E+FEGRW++S K+DYKGVWKH KS+GHED+GLLVSE A+KYAI+KELDE V LK
Sbjct  59   FYEPFDESFEGRWVLSGKDDYKGVWKHEKSDGHEDYGLLVSEKAKKYAIIKELDEPVTLK  118

Query  404  DGTVVLQYEVRLQNGLECGGAYIKYLRPQDAGWVAKEFDNESPYSIMFGPDKCGATNKVH  583
            DGTVVLQ+EVRLQNGLECGGAY+KY+RPQDA W AKEFDNE+PY+IMFGPDKCG+TNKVH
Sbjct  119  DGTVVLQFEVRLQNGLECGGAYLKYIRPQDAAWDAKEFDNETPYTIMFGPDKCGSTNKVH  178

Query  584  FIFKHKNPKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKPDNEVSILIDG  730
            FI KHKNPK+G+YVEHHLK+PPSVP DKL+HVYTA+LKPDNEV IL+DG
Sbjct  179  FILKHKNPKTGKYVEHHLKFPPSVPYDKLSHVYTAILKPDNEVRILVDG  227



>ref|XP_010555592.1| PREDICTED: calnexin homolog 1-like [Tarenaya hassleriana]
Length=540

 Score =   302 bits (773),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 141/190 (74%), Positives = 161/190 (85%), Gaps = 1/190 (1%)
 Frame = +2

Query  164  VLLLVIGCFFSQLSASSDVKL-YESFEEAFEGRWIVSEKEDYKGVWKHSKSEGHEDHGLL  340
            + LL +           D  + YESF+E+F+GRW+VS  EDY+GVWKH KSEGH+D+GLL
Sbjct  11   LFLLAVAPLLQLCFCDGDATVFYESFDESFDGRWVVSANEDYQGVWKHEKSEGHDDYGLL  70

Query  341  VSEPARKYAIVKELDEVVNLKDGTVVLQYEVRLQNGLECGGAYIKYLRPQDAGWVAKEFD  520
            VSE ARKY IVKELDE V+LKDGTVVLQY+VR Q+GLECGGAYIKYLRPQ+AGW  K FD
Sbjct  71   VSEKARKYGIVKELDEPVSLKDGTVVLQYDVRFQDGLECGGAYIKYLRPQEAGWTPKGFD  130

Query  521  NESPYSIMFGPDKCGATNKVHFIFKHKNPKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKP  700
            +ESPYSIMFGPDKCGATNKVHFI KHKNPKSGEYVEHHLK+PPSVP DKL+HVYTAV+KP
Sbjct  131  SESPYSIMFGPDKCGATNKVHFILKHKNPKSGEYVEHHLKFPPSVPYDKLSHVYTAVIKP  190

Query  701  DNEVSILIDG  730
            DNE+ IL+DG
Sbjct  191  DNELRILVDG  200



>ref|XP_009380018.1| PREDICTED: calnexin homolog 1-like [Musa acuminata subsp. malaccensis]
Length=556

 Score =   303 bits (775),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 141/188 (75%), Positives = 167/188 (89%), Gaps = 1/188 (1%)
 Frame = +2

Query  167  LLLVIGCFFSQLSASSDVKLYESFEEAFEGRWIVSEKEDYKGVWKHSKSEGHEDHGLLVS  346
            +LL+I   F Q+ AS D   YESF+E FEGRWIVS+KEDY+G+W+HSKS+GHED+GLLVS
Sbjct  6    VLLLIASSFLQIWAS-DPLYYESFDEPFEGRWIVSKKEDYEGLWRHSKSDGHEDYGLLVS  64

Query  347  EPARKYAIVKELDEVVNLKDGTVVLQYEVRLQNGLECGGAYIKYLRPQDAGWVAKEFDNE  526
            E  RK+AIVKELDE + LKDGTV+LQ+EVRLQNGLECGGAY+KYLRPQ AGW A+EFDNE
Sbjct  65   EKGRKHAIVKELDEPIILKDGTVILQFEVRLQNGLECGGAYLKYLRPQKAGWTAREFDNE  124

Query  527  SPYSIMFGPDKCGATNKVHFIFKHKNPKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKPDN  706
            SPY+IMFGPDKCG T+KVHFIF HKNPK+G++VEHHLKY P++P DKL+HVYTA+LKPDN
Sbjct  125  SPYTIMFGPDKCGGTDKVHFIFLHKNPKTGQFVEHHLKYAPTIPYDKLSHVYTAILKPDN  184

Query  707  EVSILIDG  730
            E+ ILIDG
Sbjct  185  ELRILIDG  192



>emb|CDY00229.1| BnaA06g21300D [Brassica napus]
Length=538

 Score =   302 bits (773),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 140/169 (83%), Positives = 156/169 (92%), Gaps = 0/169 (0%)
 Frame = +2

Query  224  LYESFEEAFEGRWIVSEKEDYKGVWKHSKSEGHEDHGLLVSEPARKYAIVKELDEVVNLK  403
            LYESF+E FEG WIVS+  DY+GVWKH+KSEGH+D+GLLVSE ARKY IVKEL+E +NLK
Sbjct  32   LYESFDEPFEGSWIVSKNGDYEGVWKHAKSEGHDDYGLLVSEKARKYGIVKELEEPLNLK  91

Query  404  DGTVVLQYEVRLQNGLECGGAYIKYLRPQDAGWVAKEFDNESPYSIMFGPDKCGATNKVH  583
            DGTVVLQYEVR Q GLECGGAY+KYLRPQDAGW A+ F++ESPYSIMFGPDKCGATNKVH
Sbjct  92   DGTVVLQYEVRFQEGLECGGAYLKYLRPQDAGWTAEGFNSESPYSIMFGPDKCGATNKVH  151

Query  584  FIFKHKNPKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKPDNEVSILIDG  730
            FI KHKNPKSGEYVEHHLK+PPSVP DKL+HVYTA+LKPDNEVSIL+DG
Sbjct  152  FILKHKNPKSGEYVEHHLKFPPSVPHDKLSHVYTAILKPDNEVSILVDG  200



>ref|XP_010457723.1| PREDICTED: calnexin homolog 1-like [Camelina sativa]
Length=531

 Score =   301 bits (772),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 139/169 (82%), Positives = 156/169 (92%), Gaps = 0/169 (0%)
 Frame = +2

Query  224  LYESFEEAFEGRWIVSEKEDYKGVWKHSKSEGHEDHGLLVSEPARKYAIVKELDEVVNLK  403
            LYESF+EAF+GRWIVS+  +Y+GVWKH+KSEGHED+GLLVSE ARKY IVKELDE +NLK
Sbjct  31   LYESFDEAFDGRWIVSKNGEYEGVWKHAKSEGHEDYGLLVSEKARKYGIVKELDEPLNLK  90

Query  404  DGTVVLQYEVRLQNGLECGGAYIKYLRPQDAGWVAKEFDNESPYSIMFGPDKCGATNKVH  583
            +GTVVLQYEVR Q GLECGGAY+KYLRPQ+AGW  + FD+ESPYSIMFGPDKCGATNKVH
Sbjct  91   EGTVVLQYEVRFQEGLECGGAYLKYLRPQEAGWTPQGFDSESPYSIMFGPDKCGATNKVH  150

Query  584  FIFKHKNPKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKPDNEVSILIDG  730
            FI KHKNPKSGEYVEHHLK+PPSVP DKL+HVYTA+LKPDNEV IL+DG
Sbjct  151  FILKHKNPKSGEYVEHHLKFPPSVPYDKLSHVYTAILKPDNEVRILVDG  199



>emb|CDX86955.1| BnaC03g52250D [Brassica napus]
Length=531

 Score =   300 bits (768),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 138/169 (82%), Positives = 156/169 (92%), Gaps = 0/169 (0%)
 Frame = +2

Query  224  LYESFEEAFEGRWIVSEKEDYKGVWKHSKSEGHEDHGLLVSEPARKYAIVKELDEVVNLK  403
            LYESF+E FEGRWIVS+  DY+GVWKH+KSEGH+D+GLLVSE ARKY IVKELDE ++LK
Sbjct  32   LYESFDEPFEGRWIVSKNGDYEGVWKHAKSEGHDDYGLLVSEKARKYGIVKELDEPLSLK  91

Query  404  DGTVVLQYEVRLQNGLECGGAYIKYLRPQDAGWVAKEFDNESPYSIMFGPDKCGATNKVH  583
            DGTVVLQYEVR Q GLECGGAY+KYLRPQ+AGW A+ F++ESPYSIMFGPDKCGATNKVH
Sbjct  92   DGTVVLQYEVRFQEGLECGGAYLKYLRPQEAGWTAEGFNSESPYSIMFGPDKCGATNKVH  151

Query  584  FIFKHKNPKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKPDNEVSILIDG  730
            FI KHKNPKSGEYVEHHLK+PPSVP DKL+HVYTA++KPDNEV IL+DG
Sbjct  152  FILKHKNPKSGEYVEHHLKFPPSVPHDKLSHVYTAIVKPDNEVRILVDG  200



>emb|CDY42878.1| BnaAnng07030D [Brassica napus]
Length=535

 Score =   300 bits (768),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 138/169 (82%), Positives = 156/169 (92%), Gaps = 0/169 (0%)
 Frame = +2

Query  224  LYESFEEAFEGRWIVSEKEDYKGVWKHSKSEGHEDHGLLVSEPARKYAIVKELDEVVNLK  403
            LYESF+E FEGRWIVS+  DY+GVWKH+KSEGH+D+GLLVSE ARKY IVKELDE ++LK
Sbjct  32   LYESFDEPFEGRWIVSKNGDYEGVWKHAKSEGHDDYGLLVSEKARKYGIVKELDEPLSLK  91

Query  404  DGTVVLQYEVRLQNGLECGGAYIKYLRPQDAGWVAKEFDNESPYSIMFGPDKCGATNKVH  583
            DGTVVLQYEVR Q GLECGGAY+KYLRPQ+AGW A+ F++ESPYSIMFGPDKCGATNKVH
Sbjct  92   DGTVVLQYEVRFQEGLECGGAYLKYLRPQEAGWTAEGFNSESPYSIMFGPDKCGATNKVH  151

Query  584  FIFKHKNPKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKPDNEVSILIDG  730
            FI KHKNPKSGEYVEHHLK+PPSVP DKL+HVYTA++KPDNEV IL+DG
Sbjct  152  FILKHKNPKSGEYVEHHLKFPPSVPHDKLSHVYTAIVKPDNEVRILVDG  200



>ref|XP_010444005.1| PREDICTED: calnexin homolog 1-like [Camelina sativa]
Length=530

 Score =   300 bits (767),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 137/169 (81%), Positives = 156/169 (92%), Gaps = 0/169 (0%)
 Frame = +2

Query  224  LYESFEEAFEGRWIVSEKEDYKGVWKHSKSEGHEDHGLLVSEPARKYAIVKELDEVVNLK  403
            LYESF+EAF+GRWIVS+  +Y+GVWKH+KSEGHED+GLLVSE ARKY IV+ELDE +NLK
Sbjct  31   LYESFDEAFDGRWIVSKNGEYEGVWKHAKSEGHEDYGLLVSEKARKYGIVRELDEPLNLK  90

Query  404  DGTVVLQYEVRLQNGLECGGAYIKYLRPQDAGWVAKEFDNESPYSIMFGPDKCGATNKVH  583
            +GTVVLQYEVR Q GLECGGAY+KYLRPQ++GW  + FD+ESPYSIMFGPDKCGATNKVH
Sbjct  91   EGTVVLQYEVRFQEGLECGGAYLKYLRPQESGWTPQGFDSESPYSIMFGPDKCGATNKVH  150

Query  584  FIFKHKNPKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKPDNEVSILIDG  730
            FI KHKNPKSGEYVEHHLK+PPSVP DKL+HVYTA+LKPDNEV IL+DG
Sbjct  151  FILKHKNPKSGEYVEHHLKFPPSVPYDKLSHVYTAILKPDNEVRILVDG  199



>ref|XP_010523385.1| PREDICTED: calnexin homolog 1-like [Tarenaya hassleriana]
Length=531

 Score =   298 bits (764),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 142/199 (71%), Positives = 165/199 (83%), Gaps = 2/199 (1%)
 Frame = +2

Query  137  KKRKIWTQSVLLLVIGCFFSQLSASSD-VKLYESFEEAFEGRWIVSEKEDYKGVWKHSKS  313
            + RK+ T ++LLLV    F +L    D    YE F+E+F+GRW+VSEK +Y+GVWKH KS
Sbjct  2    RGRKL-TFALLLLVAFVSFQKLCFCDDQTVFYEPFDESFDGRWVVSEKGEYQGVWKHGKS  60

Query  314  EGHEDHGLLVSEPARKYAIVKELDEVVNLKDGTVVLQYEVRLQNGLECGGAYIKYLRPQD  493
            EGH+D+GLLVSE ARKY IVKELD+ +NLKDGTVVLQYE R Q GLECGGAY+KYLRPQ+
Sbjct  61   EGHDDYGLLVSEKARKYGIVKELDKPLNLKDGTVVLQYEARFQEGLECGGAYLKYLRPQE  120

Query  494  AGWVAKEFDNESPYSIMFGPDKCGATNKVHFIFKHKNPKSGEYVEHHLKYPPSVPSDKLT  673
            AGW  + FDNESPYSIMFGPDKCG TNKVHFI KHKNPKSGEYVEHHLK+PPSVP DKL+
Sbjct  121  AGWTPQGFDNESPYSIMFGPDKCGVTNKVHFILKHKNPKSGEYVEHHLKFPPSVPFDKLS  180

Query  674  HVYTAVLKPDNEVSILIDG  730
            HVYT +L PDNEV +L+DG
Sbjct  181  HVYTVILTPDNEVRVLVDG  199



>ref|XP_010546112.1| PREDICTED: calnexin homolog 1-like [Tarenaya hassleriana]
Length=526

 Score =   298 bits (763),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 139/191 (73%), Positives = 163/191 (85%), Gaps = 1/191 (1%)
 Frame = +2

Query  161  SVLLLVIGCFFSQLSASSDVKL-YESFEEAFEGRWIVSEKEDYKGVWKHSKSEGHEDHGL  337
            ++LLLV    F +L    D  + YE F+E+F+GRW+VSEK +Y+GVWKH+KSEGH+D+GL
Sbjct  9    ALLLLVTFGSFQKLCVCDDQTVFYEPFDESFDGRWVVSEKGEYQGVWKHAKSEGHDDYGL  68

Query  338  LVSEPARKYAIVKELDEVVNLKDGTVVLQYEVRLQNGLECGGAYIKYLRPQDAGWVAKEF  517
            LVSE ARKY IVKELDE +NLKD T+VLQYE R Q GLECGGAY+KYLRPQ+AGW+ +EF
Sbjct  69   LVSEKARKYGIVKELDEPLNLKDTTIVLQYEARFQEGLECGGAYLKYLRPQEAGWMPQEF  128

Query  518  DNESPYSIMFGPDKCGATNKVHFIFKHKNPKSGEYVEHHLKYPPSVPSDKLTHVYTAVLK  697
            DNESPYSIMFGPDKCG TNKVHFI KHKNPKSG+Y+EHHLK+PPSVP DKL+HVYTAVL 
Sbjct  129  DNESPYSIMFGPDKCGVTNKVHFILKHKNPKSGKYLEHHLKFPPSVPFDKLSHVYTAVLT  188

Query  698  PDNEVSILIDG  730
             DNEV IL+DG
Sbjct  189  TDNEVRILVDG  199



>ref|XP_010483861.1| PREDICTED: calnexin homolog 1 [Camelina sativa]
Length=530

 Score =   298 bits (763),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 138/169 (82%), Positives = 155/169 (92%), Gaps = 0/169 (0%)
 Frame = +2

Query  224  LYESFEEAFEGRWIVSEKEDYKGVWKHSKSEGHEDHGLLVSEPARKYAIVKELDEVVNLK  403
            LYESF+EAF+GRWIVS+  +Y+GVWKH+KSEGHED+GLLVSE ARKY IVKELDE +NLK
Sbjct  31   LYESFDEAFDGRWIVSKNGEYEGVWKHAKSEGHEDYGLLVSEKARKYGIVKELDEPLNLK  90

Query  404  DGTVVLQYEVRLQNGLECGGAYIKYLRPQDAGWVAKEFDNESPYSIMFGPDKCGATNKVH  583
            +GTVVLQYEVR Q GLECGGAY+KYLRPQ+AGW  + FD+ESPYSIMFGPDKCGATNKVH
Sbjct  91   EGTVVLQYEVRFQEGLECGGAYLKYLRPQEAGWTPQGFDSESPYSIMFGPDKCGATNKVH  150

Query  584  FIFKHKNPKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKPDNEVSILIDG  730
            FI KHKNPKSGEYVEHHLK+ PSVP DKL+HVYTA+LKPDNEV IL+DG
Sbjct  151  FILKHKNPKSGEYVEHHLKFSPSVPYDKLSHVYTAILKPDNEVRILVDG  199



>gb|KJB40065.1| hypothetical protein B456_007G045500 [Gossypium raimondii]
Length=540

 Score =   298 bits (762),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 143/192 (74%), Positives = 161/192 (84%), Gaps = 5/192 (3%)
 Frame = +2

Query  170  LLVIGCFFSQ----LSASSDVKL-YESFEEAFEGRWIVSEKEDYKGVWKHSKSEGHEDHG  334
            LLV   F S     ++A  D  + Y+SFEE F GRWIVS+K+DYKG+W+HSKSEGH+D+G
Sbjct  9    LLVFLAFASMQLLCIAADHDAAIFYDSFEEPFNGRWIVSDKDDYKGIWEHSKSEGHDDYG  68

Query  335  LLVSEPARKYAIVKELDEVVNLKDGTVVLQYEVRLQNGLECGGAYIKYLRPQDAGWVAKE  514
            LLV+E ARKYAIVKEL+E VNL+DGT VLQYE R QNGLECGGAY+KYLRPQ+AGW  KE
Sbjct  69   LLVTEKARKYAIVKELEEPVNLRDGTTVLQYEARFQNGLECGGAYLKYLRPQEAGWKPKE  128

Query  515  FDNESPYSIMFGPDKCGATNKVHFIFKHKNPKSGEYVEHHLKYPPSVPSDKLTHVYTAVL  694
            FDN SPYSIMFGPD CG TNKVHFI K KNPKSGEYVEHHL  PP VPSDKL+HVYTA+L
Sbjct  129  FDNGSPYSIMFGPDICGLTNKVHFILKQKNPKSGEYVEHHLIDPPRVPSDKLSHVYTAIL  188

Query  695  KPDNEVSILIDG  730
            KPDNE+SILIDG
Sbjct  189  KPDNEISILIDG  200



>gb|KJB40063.1| hypothetical protein B456_007G045500 [Gossypium raimondii]
Length=540

 Score =   298 bits (762),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 143/192 (74%), Positives = 161/192 (84%), Gaps = 5/192 (3%)
 Frame = +2

Query  170  LLVIGCFFSQ----LSASSDVKL-YESFEEAFEGRWIVSEKEDYKGVWKHSKSEGHEDHG  334
            LLV   F S     ++A  D  + Y+SFEE F GRWIVS+K+DYKG+W+HSKSEGH+D+G
Sbjct  9    LLVFLAFASMQLLCIAADHDAAIFYDSFEEPFNGRWIVSDKDDYKGIWEHSKSEGHDDYG  68

Query  335  LLVSEPARKYAIVKELDEVVNLKDGTVVLQYEVRLQNGLECGGAYIKYLRPQDAGWVAKE  514
            LLV+E ARKYAIVKEL+E VNL+DGT VLQYE R QNGLECGGAY+KYLRPQ+AGW  KE
Sbjct  69   LLVTEKARKYAIVKELEEPVNLRDGTTVLQYEARFQNGLECGGAYLKYLRPQEAGWKPKE  128

Query  515  FDNESPYSIMFGPDKCGATNKVHFIFKHKNPKSGEYVEHHLKYPPSVPSDKLTHVYTAVL  694
            FDN SPYSIMFGPD CG TNKVHFI K KNPKSGEYVEHHL  PP VPSDKL+HVYTA+L
Sbjct  129  FDNGSPYSIMFGPDICGLTNKVHFILKQKNPKSGEYVEHHLIDPPRVPSDKLSHVYTAIL  188

Query  695  KPDNEVSILIDG  730
            KPDNE+SILIDG
Sbjct  189  KPDNEISILIDG  200



>gb|KJB40064.1| hypothetical protein B456_007G045500 [Gossypium raimondii]
Length=541

 Score =   298 bits (762),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 143/192 (74%), Positives = 161/192 (84%), Gaps = 5/192 (3%)
 Frame = +2

Query  170  LLVIGCFFSQ----LSASSDVKL-YESFEEAFEGRWIVSEKEDYKGVWKHSKSEGHEDHG  334
            LLV   F S     ++A  D  + Y+SFEE F GRWIVS+K+DYKG+W+HSKSEGH+D+G
Sbjct  9    LLVFLAFASMQLLCIAADHDAAIFYDSFEEPFNGRWIVSDKDDYKGIWEHSKSEGHDDYG  68

Query  335  LLVSEPARKYAIVKELDEVVNLKDGTVVLQYEVRLQNGLECGGAYIKYLRPQDAGWVAKE  514
            LLV+E ARKYAIVKEL+E VNL+DGT VLQYE R QNGLECGGAY+KYLRPQ+AGW  KE
Sbjct  69   LLVTEKARKYAIVKELEEPVNLRDGTTVLQYEARFQNGLECGGAYLKYLRPQEAGWKPKE  128

Query  515  FDNESPYSIMFGPDKCGATNKVHFIFKHKNPKSGEYVEHHLKYPPSVPSDKLTHVYTAVL  694
            FDN SPYSIMFGPD CG TNKVHFI K KNPKSGEYVEHHL  PP VPSDKL+HVYTA+L
Sbjct  129  FDNGSPYSIMFGPDICGLTNKVHFILKQKNPKSGEYVEHHLIDPPRVPSDKLSHVYTAIL  188

Query  695  KPDNEVSILIDG  730
            KPDNE+SILIDG
Sbjct  189  KPDNEISILIDG  200



>sp|O82709.1|CALX_PEA RecName: Full=Calnexin homolog; Flags: Precursor [Pisum sativum]
 emb|CAA76741.1| calnexin [Pisum sativum]
Length=551

 Score =   297 bits (761),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 147/206 (71%), Positives = 167/206 (81%), Gaps = 10/206 (5%)
 Frame = +2

Query  143  RKIWTQSVLLLVIGCFFSQLSAS----------SDVKLYESFEEAFEGRWIVSEKEDYKG  292
            RK    ++ LL +  FF   S+S           D   YESF+E F+ RWIVS KE+Y G
Sbjct  4    RKEIPLAMGLLAVLLFFVASSSSFHLVRASDEVDDAIFYESFDEDFDNRWIVSGKEEYNG  63

Query  293  VWKHSKSEGHEDHGLLVSEPARKYAIVKELDEVVNLKDGTVVLQYEVRLQNGLECGGAYI  472
            VWKHSKSEGH+D GLLVSEPARKYAIVKELD  V+LKDGTVVLQ+E RLQNGLECGGAYI
Sbjct  64   VWKHSKSEGHDDFGLLVSEPARKYAIVKELDAPVSLKDGTVVLQFETRLQNGLECGGAYI  123

Query  473  KYLRPQDAGWVAKEFDNESPYSIMFGPDKCGATNKVHFIFKHKNPKSGEYVEHHLKYPPS  652
            KYL+ Q++GW  K FDNES YSIMFGPD+CGATNKVHFIF+HKNPK+G++VEHHLK+PPS
Sbjct  124  KYLQTQESGWKPKGFDNESGYSIMFGPDRCGATNKVHFIFRHKNPKTGKHVEHHLKFPPS  183

Query  653  VPSDKLTHVYTAVLKPDNEVSILIDG  730
            VPSDKL+HVYTAVLK DNEVSILIDG
Sbjct  184  VPSDKLSHVYTAVLKDDNEVSILIDG  209



>gb|KJB40062.1| hypothetical protein B456_007G045500 [Gossypium raimondii]
Length=530

 Score =   295 bits (755),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 136/169 (80%), Positives = 151/169 (89%), Gaps = 0/169 (0%)
 Frame = +2

Query  224  LYESFEEAFEGRWIVSEKEDYKGVWKHSKSEGHEDHGLLVSEPARKYAIVKELDEVVNLK  403
             Y+SFEE F GRWIVS+K+DYKG+W+HSKSEGH+D+GLLV+E ARKYAIVKEL+E VNL+
Sbjct  22   FYDSFEEPFNGRWIVSDKDDYKGIWEHSKSEGHDDYGLLVTEKARKYAIVKELEEPVNLR  81

Query  404  DGTVVLQYEVRLQNGLECGGAYIKYLRPQDAGWVAKEFDNESPYSIMFGPDKCGATNKVH  583
            DGT VLQYE R QNGLECGGAY+KYLRPQ+AGW  KEFDN SPYSIMFGPD CG TNKVH
Sbjct  82   DGTTVLQYEARFQNGLECGGAYLKYLRPQEAGWKPKEFDNGSPYSIMFGPDICGLTNKVH  141

Query  584  FIFKHKNPKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKPDNEVSILIDG  730
            FI K KNPKSGEYVEHHL  PP VPSDKL+HVYTA+LKPDNE+SILIDG
Sbjct  142  FILKQKNPKSGEYVEHHLIDPPRVPSDKLSHVYTAILKPDNEISILIDG  190



>ref|XP_008778288.1| PREDICTED: calnexin homolog, partial [Phoenix dactylifera]
Length=542

 Score =   295 bits (756),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 137/182 (75%), Positives = 157/182 (86%), Gaps = 1/182 (1%)
 Frame = +2

Query  185  CFFSQLSASSDVKLYESFEEAFEGRWIVSEKEDYKGVWKHSKSEGHEDHGLLVSEPARKY  364
            CF  QL AS D+ LYE F+ +FE  W+VS KEDY G+WKHS+S+GHED+GLLVSE A+KY
Sbjct  23   CFALQLRAS-DLLLYEPFDVSFEKNWVVSGKEDYNGIWKHSQSDGHEDYGLLVSEKAKKY  81

Query  365  AIVKELDEVVNLKDGTVVLQYEVRLQNGLECGGAYIKYLRPQDAGWVAKEFDNESPYSIM  544
            AIVK+LDE VN+KD T+V QYE R QNGLECGGAY+KYLRPQDAGW  +EFDNESPYSIM
Sbjct  82   AIVKDLDEPVNIKDRTLVFQYETRFQNGLECGGAYLKYLRPQDAGWTPREFDNESPYSIM  141

Query  545  FGPDKCGATNKVHFIFKHKNPKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKPDNEVSILI  724
            FGPDKCG+TNKVHFI KHK+PK+G +VEHHLK PPSVP DK THVYTA LKPDNE++ILI
Sbjct  142  FGPDKCGSTNKVHFILKHKSPKTGVFVEHHLKNPPSVPYDKFTHVYTASLKPDNELTILI  201

Query  725  DG  730
            DG
Sbjct  202  DG  203



>ref|XP_003567632.1| PREDICTED: calnexin homolog [Brachypodium distachyon]
Length=538

 Score =   294 bits (752),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 137/178 (77%), Positives = 161/178 (90%), Gaps = 1/178 (1%)
 Frame = +2

Query  197  QLSASSDVKLYESFEEAFEGRWIVSEKEDYKGVWKHSKSEGHEDHGLLVSEPARKYAIVK  376
            Q+ AS  + LYE F+E+FEGRW+VS K++YKGVWKH+KS+GHED+GLLVSE A+KYAI+K
Sbjct  19   QIRASEPL-LYEPFDESFEGRWVVSGKDEYKGVWKHAKSDGHEDYGLLVSEKAKKYAIIK  77

Query  377  ELDEVVNLKDGTVVLQYEVRLQNGLECGGAYIKYLRPQDAGWVAKEFDNESPYSIMFGPD  556
            ELD  V LKD TVVLQ+EVRLQNGLECGG+Y+KY+R QD+ W AKEFDNE+PYSIMFGPD
Sbjct  78   ELDFPVTLKDETVVLQFEVRLQNGLECGGSYLKYIRLQDSTWDAKEFDNETPYSIMFGPD  137

Query  557  KCGATNKVHFIFKHKNPKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKPDNEVSILIDG  730
            KCG+TNKVHFI KHKNPK+G+YVEHHLK+PPSVP DKL+HVYTA+LKPDNEV ILIDG
Sbjct  138  KCGSTNKVHFILKHKNPKTGKYVEHHLKFPPSVPYDKLSHVYTAILKPDNEVRILIDG  195



>ref|XP_002866455.1| hypothetical protein ARALYDRAFT_496347 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42714.1| hypothetical protein ARALYDRAFT_496347 [Arabidopsis lyrata subsp. 
lyrata]
Length=1401

 Score =   305 bits (780),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 139/169 (82%), Positives = 155/169 (92%), Gaps = 0/169 (0%)
 Frame = +2

Query  224   LYESFEEAFEGRWIVSEKEDYKGVWKHSKSEGHEDHGLLVSEPARKYAIVKELDEVVNLK  403
             LYESF+E F+GRWIVS+  DY+GVWKH+KSEGHED+GLLVSE ARKY IVKELDE +NLK
Sbjct  903   LYESFDEPFDGRWIVSKNSDYEGVWKHAKSEGHEDYGLLVSEKARKYGIVKELDEPLNLK  962

Query  404   DGTVVLQYEVRLQNGLECGGAYIKYLRPQDAGWVAKEFDNESPYSIMFGPDKCGATNKVH  583
             +GTVVLQYEVR Q GLECGGAY+KYLRPQ+AGW  + FD+ESPYSIMFGPDKCGATNKVH
Sbjct  963   EGTVVLQYEVRFQEGLECGGAYLKYLRPQEAGWTPQGFDSESPYSIMFGPDKCGATNKVH  1022

Query  584   FIFKHKNPKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKPDNEVSILIDG  730
             FI KHKNPKSGEYVEHHLK+PPSVP DKL+HVYTA+LKPDNEV IL+DG
Sbjct  1023  FILKHKNPKSGEYVEHHLKFPPSVPYDKLSHVYTAILKPDNEVRILVDG  1071



>gb|AGE09565.1| CNX1-like protein, partial [Eucalyptus cladocalyx]
Length=489

 Score =   290 bits (742),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 133/158 (84%), Positives = 149/158 (94%), Gaps = 0/158 (0%)
 Frame = +2

Query  257  RWIVSEKEDYKGVWKHSKSEGHEDHGLLVSEPARKYAIVKELDEVVNLKDGTVVLQYEVR  436
            RW+VS K+DY G WKHSKSEGH+D+GLLVSE ARKYAIVKELDE+V+LKDGT+ LQYEVR
Sbjct  1    RWVVSVKDDYTGEWKHSKSEGHDDYGLLVSEKARKYAIVKELDEIVSLKDGTIALQYEVR  60

Query  437  LQNGLECGGAYIKYLRPQDAGWVAKEFDNESPYSIMFGPDKCGATNKVHFIFKHKNPKSG  616
            LQNGLECGGAY+KYLRPQDAGW  KEFDN+SPY+IMFGPDKCG+TNKVHFIFKHKNPK+G
Sbjct  61   LQNGLECGGAYLKYLRPQDAGWKVKEFDNDSPYTIMFGPDKCGSTNKVHFIFKHKNPKTG  120

Query  617  EYVEHHLKYPPSVPSDKLTHVYTAVLKPDNEVSILIDG  730
            EYVEHHLK+PPSVP DKL+HVYTAVLKPD+E+ ILIDG
Sbjct  121  EYVEHHLKFPPSVPYDKLSHVYTAVLKPDSELRILIDG  158



>ref|XP_006478659.1| PREDICTED: calnexin homolog [Citrus sinensis]
Length=586

 Score =   293 bits (749),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 137/197 (70%), Positives = 163/197 (83%), Gaps = 2/197 (1%)
 Frame = +2

Query  146  KIWTQSVLLLVIGC--FFSQLSASSDVKLYESFEEAFEGRWIVSEKEDYKGVWKHSKSEG  319
            K+   +V  L+ GC  F+   +++SD   YE F++ F+GRW+VSE +DYKGVWKHSKSEG
Sbjct  17   KMQVNAVFGLLFGCCVFYKIQASASDAIFYEPFDDPFDGRWVVSENDDYKGVWKHSKSEG  76

Query  320  HEDHGLLVSEPARKYAIVKELDEVVNLKDGTVVLQYEVRLQNGLECGGAYIKYLRPQDAG  499
            H+D+GLLVSE ARKYAIVKEL+E +N+K   V+LQY+VRLQN LECGGAY+K+L+ Q  G
Sbjct  77   HDDYGLLVSEKARKYAIVKELNENLNIKSQKVILQYDVRLQNELECGGAYLKFLQQQSTG  136

Query  500  WVAKEFDNESPYSIMFGPDKCGATNKVHFIFKHKNPKSGEYVEHHLKYPPSVPSDKLTHV  679
            W  +EFDN SPYSIMFGPDKCG TNKVHFIFKHKNPKSGEYVEHHLK PPSVPSDK +HV
Sbjct  137  WKPQEFDNNSPYSIMFGPDKCGNTNKVHFIFKHKNPKSGEYVEHHLKDPPSVPSDKFSHV  196

Query  680  YTAVLKPDNEVSILIDG  730
            YTAVL+PDN + ILIDG
Sbjct  197  YTAVLQPDNILQILIDG  213



>gb|AAA17742.1| calnexin homolog [Arabidopsis thaliana]
Length=528

 Score =   291 bits (744),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 135/171 (79%), Positives = 153/171 (89%), Gaps = 2/171 (1%)
 Frame = +2

Query  224  LYESFEEAFEGRWIVSEKEDYKGVWKHSKSEGHEDHGLLVSEPARKYAIVKELD--EVVN  397
            LYESF+E F+GRW+VSEK +Y+GVWKH KSEGH+D+GLLVSE A+KY IVKELD  E +N
Sbjct  31   LYESFDEPFDGRWVVSEKAEYQGVWKHEKSEGHDDYGLLVSEKAKKYGIVKELDVDEPLN  90

Query  398  LKDGTVVLQYEVRLQNGLECGGAYIKYLRPQDAGWVAKEFDNESPYSIMFGPDKCGATNK  577
            L +GTVVLQYE R Q GLECGGAY+KYLRPQ+AGWV + FDN+SPYSIMFGPDKCGATNK
Sbjct  91   LNEGTVVLQYEARFQEGLECGGAYLKYLRPQEAGWVPQGFDNDSPYSIMFGPDKCGATNK  150

Query  578  VHFIFKHKNPKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKPDNEVSILIDG  730
            VHFI KHKNPKSGE+VEHHLK+PPSVP DKL+HVYTAVLK DNEV IL+DG
Sbjct  151  VHFILKHKNPKSGEFVEHHLKFPPSVPFDKLSHVYTAVLKSDNEVRILVDG  201



>ref|XP_010230383.1| PREDICTED: calnexin homolog isoform X2 [Brachypodium distachyon]
Length=531

 Score =   291 bits (744),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 133/174 (76%), Positives = 158/174 (91%), Gaps = 0/174 (0%)
 Frame = +2

Query  209  SSDVKLYESFEEAFEGRWIVSEKEDYKGVWKHSKSEGHEDHGLLVSEPARKYAIVKELDE  388
            +SD  LYESF+++FEGRW+VS K++Y GVWKH+KS+GHED+GLLVSE A+KYAI+KELD 
Sbjct  26   ASDPLLYESFDDSFEGRWVVSGKDEYTGVWKHAKSDGHEDYGLLVSEVAKKYAIIKELDV  85

Query  389  VVNLKDGTVVLQYEVRLQNGLECGGAYIKYLRPQDAGWVAKEFDNESPYSIMFGPDKCGA  568
             V LKD TVVLQ+EVRLQNGLECGG+Y+KY+RPQ   W AKEFDNE+PY+IMFGPDKCG+
Sbjct  86   PVILKDETVVLQFEVRLQNGLECGGSYLKYIRPQADTWDAKEFDNETPYTIMFGPDKCGS  145

Query  569  TNKVHFIFKHKNPKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKPDNEVSILIDG  730
            TNKVHFI KH+NPK+G+YVEHHLK+PPSVP DKL+HVYTA+LKPDNEV ILIDG
Sbjct  146  TNKVHFILKHRNPKTGKYVEHHLKFPPSVPHDKLSHVYTAILKPDNEVRILIDG  199



>gb|KDP23235.1| hypothetical protein JCGZ_23068 [Jatropha curcas]
Length=533

 Score =   291 bits (744),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 131/176 (74%), Positives = 158/176 (90%), Gaps = 0/176 (0%)
 Frame = +2

Query  203  SASSDVKLYESFEEAFEGRWIVSEKEDYKGVWKHSKSEGHEDHGLLVSEPARKYAIVKEL  382
            S S +V  YE F+E F+G WIVSEK++Y+GVWK SKSEGH+DHGLL+SE ARKYAIVKEL
Sbjct  29   SGSDNVIFYEPFDEPFDGSWIVSEKDEYQGVWKLSKSEGHDDHGLLISEKARKYAIVKEL  88

Query  383  DEVVNLKDGTVVLQYEVRLQNGLECGGAYIKYLRPQDAGWVAKEFDNESPYSIMFGPDKC  562
            +++++L+DGT++LQ+EVRLQNGLECGGAY+KYL+ Q+ GW  + FDNESPYSIMFGPDKC
Sbjct  89   NKILSLRDGTIILQFEVRLQNGLECGGAYLKYLQQQEDGWKPEGFDNESPYSIMFGPDKC  148

Query  563  GATNKVHFIFKHKNPKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKPDNEVSILIDG  730
            G+TNKVHFI KHKNPK+G +VEHHL+YPPSVPSDKLTHVYTA+LKPDN + ILIDG
Sbjct  149  GSTNKVHFILKHKNPKNGAFVEHHLRYPPSVPSDKLTHVYTAILKPDNGLQILIDG  204



>ref|XP_010230382.1| PREDICTED: calnexin homolog isoform X1 [Brachypodium distachyon]
Length=535

 Score =   291 bits (744),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 133/174 (76%), Positives = 158/174 (91%), Gaps = 0/174 (0%)
 Frame = +2

Query  209  SSDVKLYESFEEAFEGRWIVSEKEDYKGVWKHSKSEGHEDHGLLVSEPARKYAIVKELDE  388
            +SD  LYESF+++FEGRW+VS K++Y GVWKH+KS+GHED+GLLVSE A+KYAI+KELD 
Sbjct  26   ASDPLLYESFDDSFEGRWVVSGKDEYTGVWKHAKSDGHEDYGLLVSEVAKKYAIIKELDV  85

Query  389  VVNLKDGTVVLQYEVRLQNGLECGGAYIKYLRPQDAGWVAKEFDNESPYSIMFGPDKCGA  568
             V LKD TVVLQ+EVRLQNGLECGG+Y+KY+RPQ   W AKEFDNE+PY+IMFGPDKCG+
Sbjct  86   PVILKDETVVLQFEVRLQNGLECGGSYLKYIRPQADTWDAKEFDNETPYTIMFGPDKCGS  145

Query  569  TNKVHFIFKHKNPKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKPDNEVSILIDG  730
            TNKVHFI KH+NPK+G+YVEHHLK+PPSVP DKL+HVYTA+LKPDNEV ILIDG
Sbjct  146  TNKVHFILKHRNPKTGKYVEHHLKFPPSVPHDKLSHVYTAILKPDNEVRILIDG  199



>ref|NP_001190249.1| calnexin2 [Arabidopsis thaliana]
 gb|AED91139.1| calnexin2 [Arabidopsis thaliana]
Length=540

 Score =   290 bits (743),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 138/187 (74%), Positives = 158/187 (84%), Gaps = 9/187 (5%)
 Frame = +2

Query  176  VIGCFFSQLSASSDVKLYESFEEAFEGRWIVSEKEDYKGVWKHSKSEGHEDHGLLVSEPA  355
            VIG F  ++       LYESF+E F+GRW+VSEK +Y+GVWKH KSEGH+D+GLLVSE A
Sbjct  30   VIGHFLEKI-------LYESFDEPFDGRWVVSEKAEYQGVWKHEKSEGHDDYGLLVSEKA  82

Query  356  RKYAIVKELD--EVVNLKDGTVVLQYEVRLQNGLECGGAYIKYLRPQDAGWVAKEFDNES  529
            +KY IVKELD  E +NL +GTVVLQYE R Q GLECGGAY+KYLRPQ+AGWV + FDN+S
Sbjct  83   KKYGIVKELDVDEPLNLNEGTVVLQYEARFQEGLECGGAYLKYLRPQEAGWVPQGFDNDS  142

Query  530  PYSIMFGPDKCGATNKVHFIFKHKNPKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKPDNE  709
            PYSIMFGPDKCGATNKVHFI KHKNPKSGE+VEHHLK+PPSVP D L+HVYTAVLK DNE
Sbjct  143  PYSIMFGPDKCGATNKVHFILKHKNPKSGEFVEHHLKFPPSVPFDMLSHVYTAVLKSDNE  202

Query  710  VSILIDG  730
            V IL+DG
Sbjct  203  VRILVDG  209



>gb|EPS68494.1| calnexin-like protein, partial [Genlisea aurea]
Length=460

 Score =   288 bits (737),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 130/170 (76%), Positives = 152/170 (89%), Gaps = 0/170 (0%)
 Frame = +2

Query  221  KLYESFEEAFEGRWIVSEKEDYKGVWKHSKSEGHEDHGLLVSEPARKYAIVKELDEVVNL  400
            K YESF+E F+GRW+VSE +DY GVWKH+KSEGH+D GLLVSE ARKYAIVKE+D+ V L
Sbjct  1    KFYESFDEDFKGRWVVSENKDYTGVWKHAKSEGHDDLGLLVSEKARKYAIVKEVDKAVEL  60

Query  401  KDGTVVLQYEVRLQNGLECGGAYIKYLRPQDAGWVAKEFDNESPYSIMFGPDKCGATNKV  580
             D T+VLQ+EVRLQ GLECGGAY+K+LRPQ  GW  K+F+NESPY+IMFGPDKCG+TNKV
Sbjct  61   GDDTIVLQFEVRLQEGLECGGAYLKFLRPQSEGWTPKDFNNESPYTIMFGPDKCGSTNKV  120

Query  581  HFIFKHKNPKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKPDNEVSILIDG  730
            HFI  HKNPK+G++VEHHLK+PPSVP DKLTHVYTA+LKPDNE+SILIDG
Sbjct  121  HFILNHKNPKTGKFVEHHLKFPPSVPFDKLTHVYTAILKPDNELSILIDG  170



>ref|NP_196351.1| calnexin2 [Arabidopsis thaliana]
 sp|Q38798.2|CALX2_ARATH RecName: Full=Calnexin homolog 2; Flags: Precursor [Arabidopsis 
thaliana]
 emb|CAB87923.1| calnexin homolog [Arabidopsis thaliana]
 gb|AAN72010.1| calnexin homolog [Arabidopsis thaliana]
 gb|AAQ56828.1| At5g07340 [Arabidopsis thaliana]
 gb|AED91138.1| calnexin2 [Arabidopsis thaliana]
Length=532

 Score =   289 bits (739),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 134/171 (78%), Positives = 152/171 (89%), Gaps = 2/171 (1%)
 Frame = +2

Query  224  LYESFEEAFEGRWIVSEKEDYKGVWKHSKSEGHEDHGLLVSEPARKYAIVKELD--EVVN  397
            LYESF+E F+GRW+VSEK +Y+GVWKH KSEGH+D+GLLVSE A+KY IVKELD  E +N
Sbjct  31   LYESFDEPFDGRWVVSEKAEYQGVWKHEKSEGHDDYGLLVSEKAKKYGIVKELDVDEPLN  90

Query  398  LKDGTVVLQYEVRLQNGLECGGAYIKYLRPQDAGWVAKEFDNESPYSIMFGPDKCGATNK  577
            L +GTVVLQYE R Q GLECGGAY+KYLRPQ+AGWV + FDN+SPYSIMFGPDKCGATNK
Sbjct  91   LNEGTVVLQYEARFQEGLECGGAYLKYLRPQEAGWVPQGFDNDSPYSIMFGPDKCGATNK  150

Query  578  VHFIFKHKNPKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKPDNEVSILIDG  730
            VHFI KHKNPKSGE+VEHHLK+PPSVP D L+HVYTAVLK DNEV IL+DG
Sbjct  151  VHFILKHKNPKSGEFVEHHLKFPPSVPFDMLSHVYTAVLKSDNEVRILVDG  201



>ref|XP_006423842.1| hypothetical protein CICLE_v10028154mg [Citrus clementina]
 gb|ESR37082.1| hypothetical protein CICLE_v10028154mg [Citrus clementina]
Length=539

 Score =   284 bits (727),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 133/193 (69%), Positives = 159/193 (82%), Gaps = 2/193 (1%)
 Frame = +2

Query  158  QSVLLLVIGC--FFSQLSASSDVKLYESFEEAFEGRWIVSEKEDYKGVWKHSKSEGHEDH  331
             +V  L+ GC  F+   +++SD   YE F++ F+GRW+VSE +DYKGVWKHSKSEGH+D+
Sbjct  4    NAVFGLLFGCCVFYKIQASASDAIFYEPFDDPFDGRWVVSENDDYKGVWKHSKSEGHDDY  63

Query  332  GLLVSEPARKYAIVKELDEVVNLKDGTVVLQYEVRLQNGLECGGAYIKYLRPQDAGWVAK  511
            GLLVSE ARKYAIVK+L+E +N+K   V+LQY+VRLQN LECGGAY+K+LR Q  GW  +
Sbjct  64   GLLVSEKARKYAIVKDLNENLNIKSQKVILQYDVRLQNELECGGAYLKFLRQQSTGWKPQ  123

Query  512  EFDNESPYSIMFGPDKCGATNKVHFIFKHKNPKSGEYVEHHLKYPPSVPSDKLTHVYTAV  691
            EFDN SPYSIMFGPDKCG TNKVHFIFK+KN K GEYVEHHLK PPSVPSDK +HVYTAV
Sbjct  124  EFDNNSPYSIMFGPDKCGNTNKVHFIFKNKNLKGGEYVEHHLKDPPSVPSDKFSHVYTAV  183

Query  692  LKPDNEVSILIDG  730
            L+PDN + ILIDG
Sbjct  184  LQPDNILRILIDG  196



>gb|KDO47053.1| hypothetical protein CISIN_1g041813mg, partial [Citrus sinensis]
Length=543

 Score =   281 bits (718),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 129/169 (76%), Positives = 148/169 (88%), Gaps = 0/169 (0%)
 Frame = +2

Query  224  LYESFEEAFEGRWIVSEKEDYKGVWKHSKSEGHEDHGLLVSEPARKYAIVKELDEVVNLK  403
             YE F++ F+GRW+VSE +DYKGVWKHSKSEGH+D+GLLVSE ARKYAIVKEL+E +N+K
Sbjct  2    FYEPFDDPFDGRWVVSENDDYKGVWKHSKSEGHDDYGLLVSEKARKYAIVKELNENLNIK  61

Query  404  DGTVVLQYEVRLQNGLECGGAYIKYLRPQDAGWVAKEFDNESPYSIMFGPDKCGATNKVH  583
               V+LQY+VRLQN LECGGAY+K+L+ Q  GW  +EFDN SPYSIMFGPDKCG TNKVH
Sbjct  62   SQKVILQYDVRLQNELECGGAYLKFLQQQSTGWKPQEFDNNSPYSIMFGPDKCGNTNKVH  121

Query  584  FIFKHKNPKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKPDNEVSILIDG  730
            FIFKHKNPKSGEYVEHHLK PPSVPSDK +HVYTAVL+PDN + ILIDG
Sbjct  122  FIFKHKNPKSGEYVEHHLKDPPSVPSDKFSHVYTAVLQPDNILQILIDG  170



>ref|XP_001773029.1| predicted protein [Physcomitrella patens]
 gb|EDQ62069.1| predicted protein [Physcomitrella patens]
Length=545

 Score =   274 bits (700),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 122/187 (65%), Positives = 155/187 (83%), Gaps = 0/187 (0%)
 Frame = +2

Query  170  LLVIGCFFSQLSASSDVKLYESFEEAFEGRWIVSEKEDYKGVWKHSKSEGHEDHGLLVSE  349
            LLV+   F+  ++ SD   YE+F+E FEGRW+VS+  DY G WKH+KS+GH+D+GLLVSE
Sbjct  11   LLVLFACFAIAASLSDTVFYENFDEDFEGRWVVSQNSDYGGTWKHAKSDGHDDYGLLVSE  70

Query  350  PARKYAIVKELDEVVNLKDGTVVLQYEVRLQNGLECGGAYIKYLRPQDAGWVAKEFDNES  529
             A+KY I  +L E V+ KDG++VLQY++RLQNGLECGGAY+K+L+PQ+AGW A +F+NES
Sbjct  71   KAKKYGIAVDLPEKVDPKDGSLVLQYDLRLQNGLECGGAYLKFLQPQEAGWTANDFNNES  130

Query  530  PYSIMFGPDKCGATNKVHFIFKHKNPKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKPDNE  709
            PYSIMFGPDKCGATNKVHFIF+HKNP +G+YVEHHLK PP    DKL+HVYTA++ P+N 
Sbjct  131  PYSIMFGPDKCGATNKVHFIFRHKNPTTGKYVEHHLKNPPVPAGDKLSHVYTAIIYPNNT  190

Query  710  VSILIDG  730
            + ILIDG
Sbjct  191  LRILIDG  197



>emb|CDY72297.1| BnaAnng40540D, partial [Brassica napus]
Length=456

 Score =   269 bits (687),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 123/147 (84%), Positives = 136/147 (93%), Gaps = 0/147 (0%)
 Frame = +2

Query  290  GVWKHSKSEGHEDHGLLVSEPARKYAIVKELDEVVNLKDGTVVLQYEVRLQNGLECGGAY  469
            GVWKH+KSEGH+D+GLLVSE ARKY IVKELDE +NLKDGT+VLQYEVR Q GLECGGAY
Sbjct  12   GVWKHAKSEGHDDYGLLVSEKARKYGIVKELDEPLNLKDGTIVLQYEVRFQEGLECGGAY  71

Query  470  IKYLRPQDAGWVAKEFDNESPYSIMFGPDKCGATNKVHFIFKHKNPKSGEYVEHHLKYPP  649
            +KYLRPQ+AGW  + FD+ESPYSIMFGPDKCGATNKVHFI KHKNPKSGEYVEHHLK+PP
Sbjct  72   LKYLRPQEAGWTPEGFDSESPYSIMFGPDKCGATNKVHFILKHKNPKSGEYVEHHLKFPP  131

Query  650  SVPSDKLTHVYTAVLKPDNEVSILIDG  730
            SVP DKL+HVYTA+LKPDNEV IL+DG
Sbjct  132  SVPYDKLSHVYTAILKPDNEVRILVDG  158



>ref|XP_001773069.1| predicted protein [Physcomitrella patens]
 gb|EDQ62109.1| predicted protein [Physcomitrella patens]
Length=522

 Score =   264 bits (675),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 116/169 (69%), Positives = 145/169 (86%), Gaps = 0/169 (0%)
 Frame = +2

Query  224  LYESFEEAFEGRWIVSEKEDYKGVWKHSKSEGHEDHGLLVSEPARKYAIVKELDEVVNLK  403
             YE+F+E FEGRW+VS+  DY G WKH+KS+GH+D+GLLVSE A+KY I  +L E V+ K
Sbjct  11   FYENFDEDFEGRWVVSQNSDYGGTWKHAKSDGHDDYGLLVSEKAKKYGIAVDLPEKVDPK  70

Query  404  DGTVVLQYEVRLQNGLECGGAYIKYLRPQDAGWVAKEFDNESPYSIMFGPDKCGATNKVH  583
            DG++VLQY++RLQNGLECGGAY+K+L+PQ+AGW A +F+NESPYSIMFGPDKCGATNKVH
Sbjct  71   DGSLVLQYDLRLQNGLECGGAYLKFLQPQEAGWTANDFNNESPYSIMFGPDKCGATNKVH  130

Query  584  FIFKHKNPKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKPDNEVSILIDG  730
            FIF+HKNP +G+YVEHHLK PP    DKL+HVYTA++ P+N + ILIDG
Sbjct  131  FIFRHKNPTTGKYVEHHLKNPPVPAGDKLSHVYTAIIYPNNTLRILIDG  179



>ref|XP_001756944.1| predicted protein [Physcomitrella patens]
 gb|EDQ78175.1| predicted protein [Physcomitrella patens]
Length=499

 Score =   260 bits (665),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 116/169 (69%), Positives = 144/169 (85%), Gaps = 0/169 (0%)
 Frame = +2

Query  224  LYESFEEAFEGRWIVSEKEDYKGVWKHSKSEGHEDHGLLVSEPARKYAIVKELDEVVNLK  403
             YESF+E FEGRW+VS+  +Y G WKH+KSEGH+D+GLLVSE A+KY I  +L E V+ K
Sbjct  5    FYESFDEDFEGRWVVSQNSEYGGTWKHAKSEGHDDYGLLVSEKAKKYGIAVDLPEKVDPK  64

Query  404  DGTVVLQYEVRLQNGLECGGAYIKYLRPQDAGWVAKEFDNESPYSIMFGPDKCGATNKVH  583
            DG +VLQY++RLQ+GLECGGAY+K+L+PQ+AGW A +F+NESPYSIMFGPDKCGATNKVH
Sbjct  65   DGALVLQYDLRLQSGLECGGAYLKFLQPQEAGWTANDFNNESPYSIMFGPDKCGATNKVH  124

Query  584  FIFKHKNPKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKPDNEVSILIDG  730
            FIF+HKNP +G+YVEHHLK PP    DKL+HVYTA++ P+N + ILIDG
Sbjct  125  FIFRHKNPVTGKYVEHHLKNPPVPAGDKLSHVYTAIIYPNNTLRILIDG  173



>ref|XP_010910131.1| PREDICTED: calnexin homolog [Elaeis guineensis]
Length=523

 Score =   251 bits (641),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 112/157 (71%), Positives = 133/157 (85%), Gaps = 0/157 (0%)
 Frame = +2

Query  260  WIVSEKEDYKGVWKHSKSEGHEDHGLLVSEPARKYAIVKELDEVVNLKDGTVVLQYEVRL  439
            W+V+  +  +GVWKHS+S+GHED+GLLV E ARKYAIVK+LDE V+  D T+V QYE R 
Sbjct  18   WVVNRIDKMRGVWKHSQSDGHEDYGLLVIEKARKYAIVKDLDEPVDFTDRTMVFQYETRF  77

Query  440  QNGLECGGAYIKYLRPQDAGWVAKEFDNESPYSIMFGPDKCGATNKVHFIFKHKNPKSGE  619
            QNGL+CGG Y+KYLRPQDAGW  +EF+NESP+SIMFGPDKCG+TNKVHFI KHKNP +G 
Sbjct  78   QNGLDCGGCYLKYLRPQDAGWSPREFENESPFSIMFGPDKCGSTNKVHFILKHKNPITGV  137

Query  620  YVEHHLKYPPSVPSDKLTHVYTAVLKPDNEVSILIDG  730
            +VEHHL  PPSVP DK THVYTA+LKPDNE+ I+IDG
Sbjct  138  FVEHHLNNPPSVPHDKFTHVYTAILKPDNELKIMIDG  174



>gb|KJB51311.1| hypothetical protein B456_008G211600 [Gossypium raimondii]
Length=509

 Score =   229 bits (584),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 116/182 (64%), Positives = 130/182 (71%), Gaps = 30/182 (16%)
 Frame = +2

Query  185  CFFSQLSASSDVKLYESFEEAFEGRWIVSEKEDYKGVWKHSKSEGHEDHGLLVSEPARKY  364
            CF    +   DV  YESFEE+FEGRWIVS K+DYKG+WKHSKSEGHED+GLLVSE ARKY
Sbjct  21   CFADDDNNDDDVVFYESFEESFEGRWIVSNKDDYKGLWKHSKSEGHEDYGLLVSEKARKY  80

Query  365  AIVKELDEVVNLKDGTVVLQYEVRLQNGLECGGAYIKYLRPQDAGWVAKEFDNESPYSIM  544
            AIVK +DE V+LKDGT VLQ+E RLQ+G+ECGGAYIK+LRPQ+AGW  +EFDNESPYSIM
Sbjct  81   AIVKVVDEPVSLKDGTTVLQFETRLQSGIECGGAYIKFLRPQEAGWKPEEFDNESPYSIM  140

Query  545  FGPDKCGATNKVHFIFKHKNPKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKPDNEVSILI  724
            FGPDKCG TN                              KLTHVYTA LK D EV I+I
Sbjct  141  FGPDKCGTTN------------------------------KLTHVYTATLKRDKEVKIMI  170

Query  725  DG  730
            DG
Sbjct  171  DG  172



>ref|XP_001765831.1| predicted protein [Physcomitrella patens]
 gb|EDQ69422.1| predicted protein, partial [Physcomitrella patens]
Length=412

 Score =   211 bits (537),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 94/168 (56%), Positives = 129/168 (77%), Gaps = 0/168 (0%)
 Frame = +2

Query  227  YESFEEAFEGRWIVSEKEDYKGVWKHSKSEGHEDHGLLVSEPARKYAIVKELDEVVNLKD  406
            YE+FE +++GRWIV++ ++YKG WKH KS+GH D+GLLVS+ A+KYAI+  L +VV+  +
Sbjct  1    YENFESSWKGRWIVTKNQEYKGKWKHEKSQGHNDYGLLVSQKAKKYAIMYNLPKVVDPNE  60

Query  407  GTVVLQYEVRLQNGLECGGAYIKYLRPQDAGWVAKEFDNESPYSIMFGPDKCGATNKVHF  586
            GT+ LQY+VR QNG+ CGGAY+K+L P+       E ++E+PYSIMFG DKCG+TNKVHF
Sbjct  61   GTLTLQYDVRFQNGITCGGAYLKFLVPEVRENKRNEMNSETPYSIMFGADKCGSTNKVHF  120

Query  587  IFKHKNPKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKPDNEVSILIDG  730
            IF HKNP + EY+EHH+  P  V  D+ THVYTA + P+N + + +DG
Sbjct  121  IFHHKNPVTREYIEHHMVNPALVEVDRFTHVYTATIYPNNTIMVFVDG  168



>ref|XP_006368843.1| hypothetical protein POPTR_0001s12690g [Populus trichocarpa]
 gb|ERP65412.1| hypothetical protein POPTR_0001s12690g [Populus trichocarpa]
Length=479

 Score =   200 bits (509),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 100/169 (59%), Positives = 119/169 (70%), Gaps = 34/169 (20%)
 Frame = +2

Query  224  LYESFEEAFEGRWIVSEKEDYKGVWKHSKSEGHEDHGLLVSEPARKYAIVKELDEVVNLK  403
             YE F+E+FEG+WI SEK+ Y+GVWK SKSEGH+D+GLLVSE A++YAIVKELD V +L 
Sbjct  2    FYEPFDESFEGKWIFSEKDYYQGVWKLSKSEGHDDYGLLVSEKAKRYAIVKELDSVFSLN  61

Query  404  DGTVVLQYEVRLQNGLECGGAYIKYLRPQDAGWVAKEFDNESPYSIMFGPDKCGATNKVH  583
            DGTVVLQ+EVRLQNGLECGGAY+KYLRPQ+ GW  KEFDNE+P                 
Sbjct  62   DGTVVLQFEVRLQNGLECGGAYLKYLRPQEVGWKPKEFDNEAPS----------------  105

Query  584  FIFKHKNPKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKPDNEVSILIDG  730
                              + PPSVPSDK +HVYTA+LKPDNE+ I+IDG
Sbjct  106  ------------------QAPPSVPSDKFSHVYTAILKPDNELKIIIDG  136



>emb|CBI35623.3| unnamed protein product [Vitis vinifera]
Length=193

 Score =   169 bits (427),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 87/132 (66%), Positives = 95/132 (72%), Gaps = 23/132 (17%)
 Frame = +2

Query  164  VLLLVIGCFFSQLSASSDVKLYESFEEAFEGRWIVSEKEDYKGVWKHSKSEGHEDHGLLV  343
            V+  VI C   QL AS  +  YESF++ FEGRWIVSEKEDYKGVWKH+KS+GHEDHGLLV
Sbjct  14   VVFAVIACASLQLCASDSI-FYESFDDDFEGRWIVSEKEDYKGVWKHAKSDGHEDHGLLV  72

Query  344  SEPARKYAIVKELDEVVNLKDGTVVLQYEVRLQNGLECGGAYIKYLRPQDAGWVAKEFDN  523
            SE ARKYAIVKELD                      ECGGAY+KYLRPQDA W +KEFDN
Sbjct  73   SEKARKYAIVKELD----------------------ECGGAYLKYLRPQDATWKSKEFDN  110

Query  524  ESPYSIMFGPDK  559
            ESPYSIMFGPDK
Sbjct  111  ESPYSIMFGPDK  122



>ref|XP_005646109.1| Calreticulin/calnexin [Coccomyxa subellipsoidea C-169]
 gb|EIE21565.1| Calreticulin/calnexin [Coccomyxa subellipsoidea C-169]
Length=435

 Score =   172 bits (437),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 87/186 (47%), Positives = 116/186 (62%), Gaps = 2/186 (1%)
 Frame = +2

Query  173  LVIGCFFSQLSASSDVKLYESFEEAFEGRWIVSEKEDYKGVWKHSKSEGHEDHGLLVSEP  352
            L+I       +  +  + +E F   +E RW  S  + Y G +     EG  D GL V E 
Sbjct  9    LLIVALVGAAACVASAEFFEDFSSGWENRWAYSADDKYSGRFVADTPEGWPDAGLKVPEK  68

Query  353  ARKYAIVKELDEVVNLKDGTVVLQYEVRLQNGLECGGAYIKYLRPQDAGWVAKEFDNESP  532
            A+ Y +  +LD  V+   G +VLQYE++L +GL CGGAY+K+L  + A +   E  + +P
Sbjct  69   AKHYGLTAKLDTPVDPAKG-LVLQYELKLTDGLTCGGAYLKFLT-ETADFDPAELTDGTP  126

Query  533  YSIMFGPDKCGATNKVHFIFKHKNPKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKPDNEV  712
            Y++MFGPDKCG TNKVH I KHK+PK+GE  E HLK PP V SDK THVYT V+KPDN  
Sbjct  127  YTVMFGPDKCGGTNKVHLILKHKSPKTGEIEEKHLKSPPMVESDKGTHVYTVVIKPDNTY  186

Query  713  SILIDG  730
            ++LIDG
Sbjct  187  ALLIDG  192



>emb|CAA54678.1| calnexin [Zea mays]
Length=428

 Score =   170 bits (431),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 75/88 (85%), Positives = 84/88 (95%), Gaps = 0/88 (0%)
 Frame = +2

Query  467  YIKYLRPQDAGWVAKEFDNESPYSIMFGPDKCGATNKVHFIFKHKNPKSGEYVEHHLKYP  646
            YIKY+RPQDAGW AKEFDNE+PY+IMFGPDKCG+TNKVHFI KHKNPK+G+YVEHHLK+P
Sbjct  1    YIKYIRPQDAGWDAKEFDNETPYTIMFGPDKCGSTNKVHFILKHKNPKTGKYVEHHLKFP  60

Query  647  PSVPSDKLTHVYTAVLKPDNEVSILIDG  730
            PSVP DKL+HVYTA+LKPDNEV ILIDG
Sbjct  61   PSVPYDKLSHVYTAILKPDNEVRILIDG  88



>ref|XP_008722789.1| hypothetical protein G647_01166 [Cladophialophora carrionii CBS 
160.54]
 gb|ETI28715.1| hypothetical protein G647_01166 [Cladophialophora carrionii CBS 
160.54]
Length=571

 Score =   172 bits (435),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 88/162 (54%), Positives = 108/162 (67%), Gaps = 9/162 (6%)
 Frame = +2

Query  245  AFEGRWIVSEKEDYKGVWKHSKSEGHEDHGLLVSEPARKYAIVKELDEVVNLKDGTVVLQ  424
            A+ G W V E     G+          D GL+V   A  +AI  +   V+N KD T+V+Q
Sbjct  77   AYVGEWSVEEPTVLPGIIG--------DKGLVVKNAAAHHAISAKFPAVINNKDKTLVVQ  128

Query  425  YEVRLQNGLECGGAYIKYLRPQDAGWVAKEFDNESPYSIMFGPDKCGATNKVHFIFKHKN  604
            YEV+LQNGLECGGAY+K LR ++    A+EF N SPY IMFGPDKCGATNKVHFIF+HKN
Sbjct  129  YEVKLQNGLECGGAYMKLLR-ENKELHAEEFSNASPYVIMFGPDKCGATNKVHFIFQHKN  187

Query  605  PKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKPDNEVSILIDG  730
            PK+GEY E HLK PP   + KLT +YT ++KPDN   +LID 
Sbjct  188  PKTGEYEEKHLKSPPQAKTGKLTTLYTLIVKPDNTFEMLIDN  229



>ref|XP_007753338.1| calnexin [Cladophialophora yegresii CBS 114405]
 gb|EXJ64771.1| calnexin [Cladophialophora yegresii CBS 114405]
Length=571

 Score =   172 bits (435),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 88/162 (54%), Positives = 107/162 (66%), Gaps = 9/162 (6%)
 Frame = +2

Query  245  AFEGRWIVSEKEDYKGVWKHSKSEGHEDHGLLVSEPARKYAIVKELDEVVNLKDGTVVLQ  424
            A+ G W V E     G+          D GL+V   A  +AI  +    VN KD T+V+Q
Sbjct  77   AYVGEWSVEEPTALPGIVG--------DKGLVVKNAAAHHAISAKFPTAVNNKDKTLVVQ  128

Query  425  YEVRLQNGLECGGAYIKYLRPQDAGWVAKEFDNESPYSIMFGPDKCGATNKVHFIFKHKN  604
            YEV+LQNGLECGGAY+K LR ++    A+EF N SPY IMFGPDKCGATNKVHFIF+HKN
Sbjct  129  YEVKLQNGLECGGAYMKLLR-ENKELHAEEFSNASPYVIMFGPDKCGATNKVHFIFQHKN  187

Query  605  PKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKPDNEVSILIDG  730
            PK+GEY E HLK PP   + KLT +YT ++KPDN   +LID 
Sbjct  188  PKTGEYEEKHLKSPPQAKTGKLTTLYTLIVKPDNTFEMLIDN  229



>gb|KIW50413.1| hypothetical protein PV05_12002 [Exophiala xenobiotica]
Length=570

 Score =   171 bits (434),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 88/162 (54%), Positives = 109/162 (67%), Gaps = 9/162 (6%)
 Frame = +2

Query  245  AFEGRWIVSEKEDYKGVWKHSKSEGHEDHGLLVSEPARKYAIVKELDEVVNLKDGTVVLQ  424
            A+ G W V E     G+          D GL+V   A  +AI  +   V++ K  T+V+Q
Sbjct  77   AYVGEWSVEEPTVLPGLVG--------DKGLVVKNAAAHHAISAKFPSVIDNKGKTLVVQ  128

Query  425  YEVRLQNGLECGGAYIKYLRPQDAGWVAKEFDNESPYSIMFGPDKCGATNKVHFIFKHKN  604
            YEV+LQNGLECGGAY+K L+ ++    A+EF N SPY IMFGPDKCGATNKVHFIFKHKN
Sbjct  129  YEVKLQNGLECGGAYMKLLK-ENKELHAEEFSNTSPYVIMFGPDKCGATNKVHFIFKHKN  187

Query  605  PKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKPDNEVSILIDG  730
            PK+GEY E HLK PP   +DKLTH+YT ++KPDN   +LID 
Sbjct  188  PKTGEYEEKHLKSPPQAKNDKLTHLYTLIVKPDNTFEMLIDN  229



>gb|KIW15177.1| hypothetical protein PV08_05222 [Exophiala spinifera]
Length=570

 Score =   170 bits (431),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 87/162 (54%), Positives = 108/162 (67%), Gaps = 9/162 (6%)
 Frame = +2

Query  245  AFEGRWIVSEKEDYKGVWKHSKSEGHEDHGLLVSEPARKYAIVKELDEVVNLKDGTVVLQ  424
            A+ G W V E     G+          D GL+V   A  +AI  +   V++ K  T+V+Q
Sbjct  77   AYVGEWSVEEPTVLPGIVG--------DKGLVVKNAAAHHAISAKFPSVIDNKGKTLVVQ  128

Query  425  YEVRLQNGLECGGAYIKYLRPQDAGWVAKEFDNESPYSIMFGPDKCGATNKVHFIFKHKN  604
            YEV+LQNGLECGGAY+K L+ ++    A+EF N SPY IMFGPDKCGATNKVHFIFKHKN
Sbjct  129  YEVKLQNGLECGGAYMKLLK-ENKELHAEEFSNTSPYVIMFGPDKCGATNKVHFIFKHKN  187

Query  605  PKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKPDNEVSILIDG  730
            PK+GEY E HLK PP   +DKLTH+YT ++ PDN   +LID 
Sbjct  188  PKTGEYEEKHLKSPPQAKNDKLTHLYTLIVNPDNTFEMLIDN  229



>gb|KIW44450.1| hypothetical protein PV06_02919 [Exophiala oligosperma]
Length=570

 Score =   169 bits (429),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 86/162 (53%), Positives = 107/162 (66%), Gaps = 9/162 (6%)
 Frame = +2

Query  245  AFEGRWIVSEKEDYKGVWKHSKSEGHEDHGLLVSEPARKYAIVKELDEVVNLKDGTVVLQ  424
            A+ G W V E     G+          D GL+V   A  +AI  +   V++ K  T+V+Q
Sbjct  77   AYVGEWSVEEPSVLPGIVG--------DKGLVVKNAAAHHAISAKFPSVIDNKGKTLVVQ  128

Query  425  YEVRLQNGLECGGAYIKYLRPQDAGWVAKEFDNESPYSIMFGPDKCGATNKVHFIFKHKN  604
            YEV+LQNGLECGGAY+K L+ ++    A+EF N SPY IMFGPDKCGATNKVHFIFKHKN
Sbjct  129  YEVKLQNGLECGGAYMKLLK-ENKKLHAEEFSNTSPYVIMFGPDKCGATNKVHFIFKHKN  187

Query  605  PKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKPDNEVSILIDG  730
            PK+GEY E HL  PP   +DKLTH+YT ++ PDN   +LID 
Sbjct  188  PKTGEYEEKHLTSPPQAKNDKLTHLYTLIVNPDNTFEMLIDN  229



>ref|XP_008023635.1| hypothetical protein SETTUDRAFT_168222 [Setosphaeria turcica 
Et28A]
 gb|EOA89024.1| hypothetical protein SETTUDRAFT_168222 [Setosphaeria turcica 
Et28A]
Length=567

 Score =   169 bits (428),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 93/180 (52%), Positives = 120/180 (67%), Gaps = 11/180 (6%)
 Frame = +2

Query  191  FSQLSASSDVKLYESFEEAFEGRWIVSEKEDYKGVWKHSKSEGHEDHGLLVSEPARKYAI  370
            +S+  A  +VK  E +  A+ G W V E   +KG+      EG  D GL+V + A  +AI
Sbjct  61   WSRSHAKKEVKDEEEW--AYVGTWAVEEPSVFKGM------EG--DKGLIVKDKAAHHAI  110

Query  371  VKELDEVVNLKDGTVVLQYEVRLQNGLECGGAYIKYLRPQDAGWVAKEFDNESPYSIMFG  550
              +  +V++ KD T+V+QYEV+LQNGL+CGGAY+K L+  +A   A+EF N SPY IMFG
Sbjct  111  SAKFPKVIDNKDKTLVVQYEVKLQNGLDCGGAYLKLLQ-DNAALHAEEFSNASPYIIMFG  169

Query  551  PDKCGATNKVHFIFKHKNPKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKPDNEVSILIDG  730
            PDKCGATNKVHFIF+HKNPK+GEY E HLK PP     K T +YT ++KPD    I IDG
Sbjct  170  PDKCGATNKVHFIFRHKNPKTGEYEEKHLKNPPMARIVKTTSLYTLIVKPDQTFEIKIDG  229



>gb|KEF58120.1| calnexin [Exophiala aquamarina CBS 119918]
Length=574

 Score =   169 bits (429),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 88/162 (54%), Positives = 106/162 (65%), Gaps = 9/162 (6%)
 Frame = +2

Query  245  AFEGRWIVSEKEDYKGVWKHSKSEGHEDHGLLVSEPARKYAIVKELDEVVNLKDGTVVLQ  424
            A+ G W V E     G+          D GL+V   A  +AI  +  + VN K  T+V+Q
Sbjct  80   AYVGEWSVEEPTVLPGIVG--------DKGLVVKNAAAHHAISAKFPKAVNNKGKTLVVQ  131

Query  425  YEVRLQNGLECGGAYIKYLRPQDAGWVAKEFDNESPYSIMFGPDKCGATNKVHFIFKHKN  604
            YEV+LQNGLECGGAY+K LR  +    A+EF N SPY IMFGPDKCGATNKVHFIF+HKN
Sbjct  132  YEVKLQNGLECGGAYLKLLR-DNKALHAEEFSNSSPYVIMFGPDKCGATNKVHFIFQHKN  190

Query  605  PKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKPDNEVSILIDG  730
            PK+GEY E HLK PP    +KLT +YT ++KPDN   ILID 
Sbjct  191  PKTGEYEEKHLKSPPQAKINKLTTLYTLIVKPDNTFEILIDN  232



>ref|XP_007750022.1| calnexin [Cladophialophora psammophila CBS 110553]
 gb|EXJ65732.1| calnexin [Cladophialophora psammophila CBS 110553]
Length=570

 Score =   169 bits (428),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 86/161 (53%), Positives = 107/161 (66%), Gaps = 9/161 (6%)
 Frame = +2

Query  245  AFEGRWIVSEKEDYKGVWKHSKSEGHEDHGLLVSEPARKYAIVKELDEVVNLKDGTVVLQ  424
            A+ G W V E     G+          D GL+V   A  +AI  +   V+N K  T+V+Q
Sbjct  77   AYVGEWAVEEPTVLPGIVG--------DKGLVVKNAAAHHAISAKFPSVINNKGKTLVIQ  128

Query  425  YEVRLQNGLECGGAYIKYLRPQDAGWVAKEFDNESPYSIMFGPDKCGATNKVHFIFKHKN  604
            YEV+LQNGLECGGAY+K LR ++    A+EF N SPY IMFGPDKCGATNKVHFIF+HKN
Sbjct  129  YEVKLQNGLECGGAYMKLLR-ENKELHAEEFSNASPYVIMFGPDKCGATNKVHFIFQHKN  187

Query  605  PKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKPDNEVSILID  727
            PK+GEY E HLK PP   + K+T +YT ++KPDN   +LID
Sbjct  188  PKTGEYEEKHLKSPPQAKTGKMTTLYTLIVKPDNTFEMLID  228



>gb|KIW77661.1| hypothetical protein Z517_07493 [Fonsecaea pedrosoi CBS 271.37]
Length=571

 Score =   169 bits (428),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 87/162 (54%), Positives = 107/162 (66%), Gaps = 9/162 (6%)
 Frame = +2

Query  245  AFEGRWIVSEKEDYKGVWKHSKSEGHEDHGLLVSEPARKYAIVKELDEVVNLKDGTVVLQ  424
            A+ G W V E     G+          D GL+V   A  +AI  +   V+N K  T+V+Q
Sbjct  77   AYVGEWAVEEPTVLPGIIG--------DKGLVVKNAAAHHAISAKFPSVINNKGKTLVVQ  128

Query  425  YEVRLQNGLECGGAYIKYLRPQDAGWVAKEFDNESPYSIMFGPDKCGATNKVHFIFKHKN  604
            YEV+LQNGLECGGAY+K LR ++    A+EF N SPY IMFGPDKCGATNKVHFIF+HKN
Sbjct  129  YEVKLQNGLECGGAYMKLLR-ENKELHAEEFSNASPYVIMFGPDKCGATNKVHFIFQHKN  187

Query  605  PKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKPDNEVSILIDG  730
            PK+GEY E HLK PP   + KLT +YT ++KPDN   +LID 
Sbjct  188  PKTGEYEEKHLKSPPQAKTGKLTTLYTLIVKPDNTFEMLIDN  229



>gb|KIW35677.1| hypothetical protein PV07_02362 [Cladophialophora immunda]
Length=571

 Score =   169 bits (428),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 86/162 (53%), Positives = 107/162 (66%), Gaps = 9/162 (6%)
 Frame = +2

Query  245  AFEGRWIVSEKEDYKGVWKHSKSEGHEDHGLLVSEPARKYAIVKELDEVVNLKDGTVVLQ  424
            A+ G W V E     G+          D GL+V   A  +AI  +   V+N K  T+V+Q
Sbjct  77   AYVGEWAVEEPTVLPGIVG--------DKGLVVKNAAAHHAISAKFPSVINNKGKTLVVQ  128

Query  425  YEVRLQNGLECGGAYIKYLRPQDAGWVAKEFDNESPYSIMFGPDKCGATNKVHFIFKHKN  604
            YEV+LQNGLECGGAY+K LR ++    A+EF N SPY IMFGPDKCGATNKVHFIF+HKN
Sbjct  129  YEVKLQNGLECGGAYMKLLR-ENKELHAEEFSNASPYVIMFGPDKCGATNKVHFIFQHKN  187

Query  605  PKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKPDNEVSILIDG  730
            PK+GEY E HLK PP   + K+T +YT ++KPDN   +LID 
Sbjct  188  PKTGEYEEKHLKSPPQAKTGKMTTLYTLIVKPDNTFEMLIDN  229



>gb|KIV88448.1| hypothetical protein PV10_08131 [Exophiala mesophila]
Length=570

 Score =   168 bits (426),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 86/161 (53%), Positives = 107/161 (66%), Gaps = 9/161 (6%)
 Frame = +2

Query  245  AFEGRWIVSEKEDYKGVWKHSKSEGHEDHGLLVSEPARKYAIVKELDEVVNLKDGTVVLQ  424
            A+ G W V E +   G+          D GL++   A  +AI  +  + V+ K  T+V+Q
Sbjct  77   AYVGEWAVEEPKVLPGIIG--------DKGLVLKNAAAHHAISAKFPKAVDNKGKTLVVQ  128

Query  425  YEVRLQNGLECGGAYIKYLRPQDAGWVAKEFDNESPYSIMFGPDKCGATNKVHFIFKHKN  604
            YEV+LQNGLECGGAY+K LR  +    A+EF N SPY IMFGPDKCGATNKVHFIF+HKN
Sbjct  129  YEVKLQNGLECGGAYLKLLR-DNKALHAEEFSNSSPYVIMFGPDKCGATNKVHFIFQHKN  187

Query  605  PKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKPDNEVSILID  727
            PK+GEY E HLK PP   + KLT +YT ++KPDN   ILID
Sbjct  188  PKTGEYEEKHLKSPPQAKTSKLTTLYTLIVKPDNTFEILID  228



>gb|KIW72703.1| hypothetical protein PV04_00879 [Capronia semiimmersa]
Length=571

 Score =   168 bits (426),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 88/162 (54%), Positives = 107/162 (66%), Gaps = 9/162 (6%)
 Frame = +2

Query  245  AFEGRWIVSEKEDYKGVWKHSKSEGHEDHGLLVSEPARKYAIVKELDEVVNLKDGTVVLQ  424
            A+ G W V E     G+          D GL+V   A  +AI  +   VVN K  T+V+Q
Sbjct  77   AYVGEWSVEEPTVLPGIVG--------DKGLVVKNAAAHHAISAKFPAVVNNKGKTLVVQ  128

Query  425  YEVRLQNGLECGGAYIKYLRPQDAGWVAKEFDNESPYSIMFGPDKCGATNKVHFIFKHKN  604
            YEV+LQNGLECGGAY+K LR ++    A+EF N SPY IMFGPDKCGATNKVHFIF+HKN
Sbjct  129  YEVKLQNGLECGGAYMKLLR-ENKELHAEEFSNASPYVIMFGPDKCGATNKVHFIFQHKN  187

Query  605  PKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKPDNEVSILIDG  730
            PK+GEY E HLK PP   + KLT +YT ++KPDN   +LID 
Sbjct  188  PKTGEYEEKHLKSPPQARTGKLTTLYTLIVKPDNTFEMLIDN  229



>gb|KIW90174.1| hypothetical protein Z519_08817 [Cladophialophora bantiana CBS 
173.52]
Length=570

 Score =   168 bits (425),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 86/161 (53%), Positives = 107/161 (66%), Gaps = 9/161 (6%)
 Frame = +2

Query  245  AFEGRWIVSEKEDYKGVWKHSKSEGHEDHGLLVSEPARKYAIVKELDEVVNLKDGTVVLQ  424
            A+ G W V E     G+          D GL+V   A  +AI  +   V+N K  T+V+Q
Sbjct  77   AYVGEWAVEEPIVLPGIVG--------DKGLVVKNAAAHHAISAKFPSVINNKGKTLVIQ  128

Query  425  YEVRLQNGLECGGAYIKYLRPQDAGWVAKEFDNESPYSIMFGPDKCGATNKVHFIFKHKN  604
            YEV+LQNGLECGGAY+K LR ++    A+EF N SPY IMFGPDKCGATNKVHFIF+HKN
Sbjct  129  YEVKLQNGLECGGAYMKLLR-ENKELHAEEFSNASPYVIMFGPDKCGATNKVHFIFQHKN  187

Query  605  PKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKPDNEVSILID  727
            PK+GEY E HLK PP   + K+T +YT ++KPDN   +LID
Sbjct  188  PKTGEYEEKHLKSPPQAKTGKMTTLYTLIVKPDNTFEMLID  228



>ref|XP_001794804.1| hypothetical protein SNOG_04385 [Phaeosphaeria nodorum SN15]
 gb|EAT88145.2| hypothetical protein SNOG_04385 [Phaeosphaeria nodorum SN15]
Length=500

 Score =   167 bits (423),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 92/175 (53%), Positives = 116/175 (66%), Gaps = 10/175 (6%)
 Frame = +2

Query  206  ASSDVKLYESFEEAFEGRWIVSEKEDYKGVWKHSKSEGHEDHGLLVSEPARKYAIVKELD  385
            A  DVK  +  E A+ G W V E    KG+      EG  D GL++ + A  +AI  +  
Sbjct  65   AKKDVKADDE-EWAYVGTWSVEEPSVLKGM------EG--DKGLVIKDKAAHHAISAKFP  115

Query  386  EVVNLKDGTVVLQYEVRLQNGLECGGAYIKYLRPQDAGWVAKEFDNESPYSIMFGPDKCG  565
            + ++ KD T+V+QYEV+LQ+GLECGGAY+K L+  +A   A+EF N SPY IMFGPDKCG
Sbjct  116  KAIDNKDNTLVVQYEVKLQDGLECGGAYMKLLQ-DNAALHAEEFSNASPYIIMFGPDKCG  174

Query  566  ATNKVHFIFKHKNPKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKPDNEVSILIDG  730
            ATNKVHFIF+HKNPK+GEY E HLK PP     K T +YT ++KPDN   I IDG
Sbjct  175  ATNKVHFIFRHKNPKTGEYEEKHLKNPPMARIVKTTSLYTLIVKPDNSFEIKIDG  229



>gb|KIX97224.1| hypothetical protein Z520_07339 [Fonsecaea multimorphosa CBS 
102226]
Length=571

 Score =   167 bits (424),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 86/162 (53%), Positives = 107/162 (66%), Gaps = 9/162 (6%)
 Frame = +2

Query  245  AFEGRWIVSEKEDYKGVWKHSKSEGHEDHGLLVSEPARKYAIVKELDEVVNLKDGTVVLQ  424
            A+ G W V E     G+          D GL+V   A  +AI  +   V+N K  T+V+Q
Sbjct  77   AYVGEWAVEEPTVLPGIVG--------DKGLVVKNAAAHHAISAKFPSVINNKGKTLVVQ  128

Query  425  YEVRLQNGLECGGAYIKYLRPQDAGWVAKEFDNESPYSIMFGPDKCGATNKVHFIFKHKN  604
            YEV+LQNGLECGGAY+K LR ++    A+EF N SPY IMFGPDKCGATNKVHFIF+HKN
Sbjct  129  YEVKLQNGLECGGAYMKLLR-ENKELHAEEFSNASPYVIMFGPDKCGATNKVHFIFQHKN  187

Query  605  PKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKPDNEVSILIDG  730
            PK+GEY E HLK PP   + K+T +YT ++KPDN   +LID 
Sbjct  188  PKTGEYEEKHLKSPPQAKTGKVTTLYTLIVKPDNTFEMLIDN  229



>gb|KIV80781.1| hypothetical protein PV11_08258 [Exophiala sideris]
Length=572

 Score =   167 bits (424),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 85/162 (52%), Positives = 107/162 (66%), Gaps = 9/162 (6%)
 Frame = +2

Query  245  AFEGRWIVSEKEDYKGVWKHSKSEGHEDHGLLVSEPARKYAIVKELDEVVNLKDGTVVLQ  424
            A+ G W V E     G+          D GL+V   A  +AI  +    ++  D T+V+Q
Sbjct  75   AYVGEWSVEEPTVLPGIVG--------DKGLVVKNAAAHHAISAKFPAPIDNTDKTLVVQ  126

Query  425  YEVRLQNGLECGGAYIKYLRPQDAGWVAKEFDNESPYSIMFGPDKCGATNKVHFIFKHKN  604
            YEV+LQNGLECGGAY+K L+ ++    A+EF N SPY IMFGPDKCG+TNKVHFIFKHKN
Sbjct  127  YEVKLQNGLECGGAYMKLLQ-ENKELHAEEFSNASPYVIMFGPDKCGSTNKVHFIFKHKN  185

Query  605  PKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKPDNEVSILIDG  730
            PK+GEY E HLK PP   +DKLTH+YT ++KPD    +LID 
Sbjct  186  PKTGEYEEKHLKTPPQAKNDKLTHLYTLIVKPDQTFEMLIDN  227



>gb|EKG22397.1| Calreticulin/calnexin [Macrophomina phaseolina MS6]
Length=563

 Score =   166 bits (420),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 87/164 (53%), Positives = 110/164 (67%), Gaps = 9/164 (5%)
 Frame = +2

Query  239  EEAFEGRWIVSEKEDYKGVWKHSKSEGHEDHGLLVSEPARKYAIVKELDEVVNLKDGTVV  418
            E A+ G W V E   +KG+      EG  D GL++ + A  +AI  +  + V+  D T+V
Sbjct  73   EWAYVGTWSVEEPSVFKGI------EG--DKGLVIKDKAAHHAISAKFPQAVDNTDNTLV  124

Query  419  LQYEVRLQNGLECGGAYIKYLRPQDAGWVAKEFDNESPYSIMFGPDKCGATNKVHFIFKH  598
            +QYEV+LQ+GLECGGAY+K L+ ++A     EF N SPY IMFGPDKCGATNKVHFIFKH
Sbjct  125  VQYEVKLQDGLECGGAYMKLLK-EEAALHQDEFSNASPYVIMFGPDKCGATNKVHFIFKH  183

Query  599  KNPKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKPDNEVSILIDG  730
            KNPK+GEY E HLK PPS    K T +YT ++KPD    I I+G
Sbjct  184  KNPKTGEYEEKHLKNPPSARITKTTALYTLIVKPDQTFEIKING  227



>ref|XP_009155238.1| calnexin [Exophiala dermatitidis NIH/UT8656]
 gb|EHY54777.1| calnexin [Exophiala dermatitidis NIH/UT8656]
Length=570

 Score =   166 bits (419),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 85/162 (52%), Positives = 107/162 (66%), Gaps = 9/162 (6%)
 Frame = +2

Query  245  AFEGRWIVSEKEDYKGVWKHSKSEGHEDHGLLVSEPARKYAIVKELDEVVNLKDGTVVLQ  424
            A+ G W V E   + G+          D  L+V   A  +AI  +  EV++ K  T+V+Q
Sbjct  77   AYVGEWSVEEPTVFPGI--------AGDKALVVKNAAAHHAISAKFPEVIDNKGKTLVVQ  128

Query  425  YEVRLQNGLECGGAYIKYLRPQDAGWVAKEFDNESPYSIMFGPDKCGATNKVHFIFKHKN  604
            YEV+LQNGLECGGAY+K LR ++    A+EF N SPY IMFGPDKCG+TNKVHFIF+HKN
Sbjct  129  YEVKLQNGLECGGAYMKLLR-ENKELHAEEFSNASPYVIMFGPDKCGSTNKVHFIFQHKN  187

Query  605  PKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKPDNEVSILIDG  730
            PK+GEY E HLK PP     KLT +YT ++KPDN   +LID 
Sbjct  188  PKTGEYEEKHLKSPPQAKISKLTTLYTLIVKPDNTFELLIDN  229



>ref|XP_007805590.1| Calnexin [Endocarpon pusillum Z07020]
 gb|ERF68760.1| Calnexin [Endocarpon pusillum Z07020]
Length=572

 Score =   166 bits (419),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 88/183 (48%), Positives = 115/183 (63%), Gaps = 15/183 (8%)
 Frame = +2

Query  224  LYESFEEAFEGRWIVS--EKEDYKGV--WKHSKSEGHE----------DHGLLVSEPARK  361
              E F + ++ RW  S  +KED K    W +      E          D GL+V  PA  
Sbjct  49   FLEQFTDDWDSRWTPSHAKKEDSKTAEDWAYVGEWAVEEPSVLPGMIGDKGLVVKNPAAH  108

Query  362  YAIVKELDEVVNLKDGTVVLQYEVRLQNGLECGGAYIKYLRPQDAGWVAKEFDNESPYSI  541
            +AI  +  + ++ K  T+V+QYEV+LQNGLECGGAY+K L+  +    A+EF N SPY I
Sbjct  109  HAISAKFPKTIDNKGKTLVVQYEVKLQNGLECGGAYMKLLK-DNKALHAEEFSNASPYVI  167

Query  542  MFGPDKCGATNKVHFIFKHKNPKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKPDNEVSIL  721
            MFGPDKCGATNKVHFIFKHKNPK+GEY E HLK PP   + K++ +YT ++KPDN   +L
Sbjct  168  MFGPDKCGATNKVHFIFKHKNPKTGEYEEKHLKSPPVAKTAKVSTLYTLIVKPDNTFEML  227

Query  722  IDG  730
            +D 
Sbjct  228  VDN  230



>gb|KIX07491.1| hypothetical protein Z518_02144 [Rhinocladiella mackenziei CBS 
650.93]
Length=570

 Score =   165 bits (418),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 85/162 (52%), Positives = 105/162 (65%), Gaps = 9/162 (6%)
 Frame = +2

Query  245  AFEGRWIVSEKEDYKGVWKHSKSEGHEDHGLLVSEPARKYAIVKELDEVVNLKDGTVVLQ  424
            A+ G W V E     G+          D  L+V   A  +AI  +   V+N K  T+V+Q
Sbjct  77   AYVGEWAVEEPTVLPGI--------AGDKSLVVKNAAAHHAISAKFPSVINNKGKTLVIQ  128

Query  425  YEVRLQNGLECGGAYIKYLRPQDAGWVAKEFDNESPYSIMFGPDKCGATNKVHFIFKHKN  604
            YEV+LQNGLECGGAY+K LR ++    A+EF N SPY IMFGPDKCGATNKVHFIF+HKN
Sbjct  129  YEVKLQNGLECGGAYMKLLR-ENKALHAEEFSNASPYVIMFGPDKCGATNKVHFIFQHKN  187

Query  605  PKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKPDNEVSILIDG  730
            PK+GEY E HLK  P   + KLT +YT ++KPDN   +LID 
Sbjct  188  PKTGEYEEKHLKSAPQAKTGKLTTLYTLIVKPDNTFEMLIDN  229



>emb|CCF46037.1| calreticulin [Colletotrichum higginsianum]
Length=249

 Score =   159 bits (401),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 84/164 (51%), Positives = 106/164 (65%), Gaps = 9/164 (5%)
 Frame = +2

Query  239  EEAFEGRWIVSEKEDYKGVWKHSKSEGHEDHGLLVSEPARKYAIVKELDEVVNLKDGTVV  418
            E A+ G W V E   YKGV      EG  D GL+V  PA  +AI  +  + ++ K  T+V
Sbjct  84   EWAYVGEWAVEEPTVYKGV------EG--DKGLVVKNPAAHHAISAKFPKKIDNKGKTLV  135

Query  419  LQYEVRLQNGLECGGAYIKYLRPQDAGWVAKEFDNESPYSIMFGPDKCGATNKVHFIFKH  598
            +QYEV+LQNGLECGGAY+K LR ++     +EF N +PY IMFGPDKCG TNKVHFIF H
Sbjct  136  VQYEVKLQNGLECGGAYLKLLR-ENKALHQEEFSNATPYVIMFGPDKCGHTNKVHFIFNH  194

Query  599  KNPKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKPDNEVSILIDG  730
            KNPK+GEY E HL  PP+    K T +YT ++ P+N   I  +G
Sbjct  195  KNPKTGEYEEKHLTAPPTARIVKTTELYTLIVHPNNTFIIQQNG  238



>ref|XP_007736137.1| calnexin [Capronia epimyces CBS 606.96]
 gb|EXJ79563.1| calnexin [Capronia epimyces CBS 606.96]
Length=570

 Score =   165 bits (417),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 85/162 (52%), Positives = 105/162 (65%), Gaps = 9/162 (6%)
 Frame = +2

Query  245  AFEGRWIVSEKEDYKGVWKHSKSEGHEDHGLLVSEPARKYAIVKELDEVVNLKDGTVVLQ  424
            A+ G W V E   +  +          D  L+V   A  +AI  +   V+N K  T+V+Q
Sbjct  77   AYVGEWSVEEPSVFPAIVG--------DKALVVKNAAAHHAISAKFPAVINNKGKTLVVQ  128

Query  425  YEVRLQNGLECGGAYIKYLRPQDAGWVAKEFDNESPYSIMFGPDKCGATNKVHFIFKHKN  604
            YEV+LQNGLECGGAY+K LR ++    A+EF N SPY IMFGPDKCGATNKVHFIF+HKN
Sbjct  129  YEVKLQNGLECGGAYMKLLR-ENKKLHAEEFSNASPYVIMFGPDKCGATNKVHFIFQHKN  187

Query  605  PKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKPDNEVSILIDG  730
            PK+GEY E HLK PP     KLT +YT ++KPDN   +LID 
Sbjct  188  PKTGEYEEKHLKSPPQAKITKLTTLYTLIVKPDNTFELLIDN  229



>ref|XP_003839005.1| similar to calnexin [Leptosphaeria maculans JN3]
 emb|CBX95526.1| similar to calnexin [Leptosphaeria maculans JN3]
Length=567

 Score =   165 bits (417),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 86/159 (54%), Positives = 107/159 (67%), Gaps = 9/159 (6%)
 Frame = +2

Query  254  GRWIVSEKEDYKGVWKHSKSEGHEDHGLLVSEPARKYAIVKELDEVVNLKDGTVVLQYEV  433
            G W V E    KG+      EG  D GL++ + A  +AI  +  +V+N KD T+V+QYEV
Sbjct  80   GNWAVEEPSVLKGM------EG--DKGLVLKDKAAHHAISAKFPKVINNKDKTLVVQYEV  131

Query  434  RLQNGLECGGAYIKYLRPQDAGWVAKEFDNESPYSIMFGPDKCGATNKVHFIFKHKNPKS  613
            +LQNGLECGGAY+K L+  +    A+EF N SPY IMFGPDKCGATNKVHFIF+HKNPK+
Sbjct  132  KLQNGLECGGAYMKLLQ-DNKALHAEEFSNSSPYVIMFGPDKCGATNKVHFIFRHKNPKT  190

Query  614  GEYVEHHLKYPPSVPSDKLTHVYTAVLKPDNEVSILIDG  730
            GEY E HLK PP     K T +YT ++KPD    + IDG
Sbjct  191  GEYEEKHLKNPPMARVVKTTSLYTLIVKPDQSFEMKIDG  229



>dbj|GAE00076.1| calnexin precursor [Byssochlamys spectabilis No. 5]
Length=562

 Score =   165 bits (417),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 87/162 (54%), Positives = 109/162 (67%), Gaps = 9/162 (6%)
 Frame = +2

Query  245  AFEGRWIVSEKEDYKGVWKHSKSEGHEDHGLLVSEPARKYAIVKELDEVVNLKDGTVVLQ  424
            A+ G W V E    KG+      EG  D GL+V   A  +AI  +  + ++ KD T+V+Q
Sbjct  80   AYVGEWSVEEPTVLKGI------EG--DKGLVVKNAAAHHAISAKFPKKIDNKDKTLVVQ  131

Query  425  YEVRLQNGLECGGAYIKYLRPQDAGWVAKEFDNESPYSIMFGPDKCGATNKVHFIFKHKN  604
            YEV+LQN L CGGAY+K L+ ++     +EF N SPY IMFGPDKCGATNKVHFIFKHKN
Sbjct  132  YEVKLQNSLVCGGAYLKLLQ-ENKKLHLEEFSNASPYVIMFGPDKCGATNKVHFIFKHKN  190

Query  605  PKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKPDNEVSILIDG  730
            PK+GEY E HLK PP+  + KLT +YT ++KPD    ILIDG
Sbjct  191  PKTGEYEEKHLKAPPAARTSKLTTLYTLIVKPDQSFQILIDG  232



>ref|XP_002851011.1| calnexin [Arthroderma otae CBS 113480]
 gb|EEQ28227.1| calnexin [Arthroderma otae CBS 113480]
Length=562

 Score =   164 bits (416),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 86/164 (52%), Positives = 110/164 (67%), Gaps = 9/164 (5%)
 Frame = +2

Query  239  EEAFEGRWIVSEKEDYKGVWKHSKSEGHEDHGLLVSEPARKYAIVKELDEVVNLKDGTVV  418
            E A+ G W V E   +KG+      EG  D GL+V  PA  +AI  +  + ++ K  T+V
Sbjct  79   EWAYVGEWAVEEPTVFKGI------EG--DKGLVVKNPAAHHAISAKFPKKIDNKGKTLV  130

Query  419  LQYEVRLQNGLECGGAYIKYLRPQDAGWVAKEFDNESPYSIMFGPDKCGATNKVHFIFKH  598
            +QYEV+LQN L CGGAY+K L+ ++    ++EF N SPY IMFGPD+CGATNKVHFIFKH
Sbjct  131  VQYEVKLQNSLTCGGAYMKLLQ-ENKKLHSEEFSNASPYVIMFGPDRCGATNKVHFIFKH  189

Query  599  KNPKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKPDNEVSILIDG  730
            KNPK+GEY E HLK PP+V   KLT +YT ++ PD    I IDG
Sbjct  190  KNPKTGEYEEKHLKAPPAVKISKLTSLYTLIVNPDQSFQIRIDG  233



>ref|XP_007689046.1| hypothetical protein COCMIDRAFT_98137 [Bipolaris oryzae ATCC 
44560]
 gb|EUC44436.1| hypothetical protein COCMIDRAFT_98137 [Bipolaris oryzae ATCC 
44560]
Length=566

 Score =   164 bits (416),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 86/164 (52%), Positives = 110/164 (67%), Gaps = 9/164 (5%)
 Frame = +2

Query  239  EEAFEGRWIVSEKEDYKGVWKHSKSEGHEDHGLLVSEPARKYAIVKELDEVVNLKDGTVV  418
            E A+ G W V E    KG+      EG  D GL++ + A  +AI  +  + ++ KD T+V
Sbjct  74   EWAYVGTWAVEEPSVLKGI------EG--DKGLVIKDQAAHHAISAKFPKAIDNKDNTLV  125

Query  419  LQYEVRLQNGLECGGAYIKYLRPQDAGWVAKEFDNESPYSIMFGPDKCGATNKVHFIFKH  598
            +QYEV+LQNGL+CGGAY+K L+  +A   A+EF N SPY IMFGPDKCGATNKVHFIF+H
Sbjct  126  VQYEVKLQNGLDCGGAYLKLLQ-DNAALHAEEFSNASPYIIMFGPDKCGATNKVHFIFRH  184

Query  599  KNPKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKPDNEVSILIDG  730
            KNPK+GEY E HLK PP     K + +YT ++KPD    I IDG
Sbjct  185  KNPKTGEYEEKHLKNPPMARIVKTSSLYTLIVKPDQTFEIKIDG  228



>gb|EMD94330.1| hypothetical protein COCHEDRAFT_1130883 [Bipolaris maydis C5]
 gb|ENI07372.1| hypothetical protein COCC4DRAFT_132061 [Bipolaris maydis ATCC 
48331]
Length=566

 Score =   164 bits (416),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 85/162 (52%), Positives = 109/162 (67%), Gaps = 9/162 (6%)
 Frame = +2

Query  245  AFEGRWIVSEKEDYKGVWKHSKSEGHEDHGLLVSEPARKYAIVKELDEVVNLKDGTVVLQ  424
            A+ G W V E    KG+      EG  D GL++ + A  +AI  +  + ++ KD T+V+Q
Sbjct  76   AYVGTWAVEEPSVLKGI------EG--DKGLVIKDQAAHHAISAKFPKAIDNKDNTLVVQ  127

Query  425  YEVRLQNGLECGGAYIKYLRPQDAGWVAKEFDNESPYSIMFGPDKCGATNKVHFIFKHKN  604
            YEV+LQNGL+CGGAY+K L+  +A   A+EF N SPY IMFGPDKCGATNKVHFIF+HKN
Sbjct  128  YEVKLQNGLDCGGAYLKLLQ-DNAALHAEEFSNASPYIIMFGPDKCGATNKVHFIFRHKN  186

Query  605  PKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKPDNEVSILIDG  730
            PK+GEY E HLK PP     K + +YT ++KPD    I IDG
Sbjct  187  PKTGEYEEKHLKNPPMARIVKTSTLYTLIVKPDQTFEIKIDG  228



>ref|XP_003177596.1| calnexin [Microsporum gypseum CBS 118893]
 gb|EFQ98644.1| calnexin [Microsporum gypseum CBS 118893]
Length=565

 Score =   164 bits (416),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 86/164 (52%), Positives = 110/164 (67%), Gaps = 9/164 (5%)
 Frame = +2

Query  239  EEAFEGRWIVSEKEDYKGVWKHSKSEGHEDHGLLVSEPARKYAIVKELDEVVNLKDGTVV  418
            E A+ G W V E   +KG+      EG  D GL+V  PA  +AI  +  + ++ K  T+V
Sbjct  80   EWAYVGEWSVEEPTVFKGI------EG--DKGLVVKNPAAHHAISAKFPKKIDNKGKTLV  131

Query  419  LQYEVRLQNGLECGGAYIKYLRPQDAGWVAKEFDNESPYSIMFGPDKCGATNKVHFIFKH  598
            +QYEV+LQN L CGGAY+K L+ ++    ++EF N SPY IMFGPD+CGATNKVHFIFKH
Sbjct  132  VQYEVKLQNSLTCGGAYMKLLQ-ENKKLHSEEFSNASPYVIMFGPDRCGATNKVHFIFKH  190

Query  599  KNPKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKPDNEVSILIDG  730
            KNPK+GEY E HLK PP+V   KLT +YT ++ PD    I IDG
Sbjct  191  KNPKTGEYEEKHLKAPPAVKVTKLTSLYTLIVNPDQTFQIRIDG  234



>ref|XP_007582295.1| putative calnexin protein [Neofusicoccum parvum UCRNP2]
 gb|EOD50245.1| putative calnexin protein [Neofusicoccum parvum UCRNP2]
Length=560

 Score =   164 bits (416),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 91/181 (50%), Positives = 119/181 (66%), Gaps = 13/181 (7%)
 Frame = +2

Query  224  LYESFEEAFEGRWIVS--EKED------YKGVW---KHSKSEGHE-DHGLLVSEPARKYA  367
             +E F + +E RW VS  +KE+      Y G W   + S  +G E D GL++ + A  +A
Sbjct  45   FFEQFTDDWEDRWKVSHAKKENTEEEWAYVGTWSVEEPSVFKGIEGDKGLVIKDKAAHHA  104

Query  368  IVKELDEVVNLKDGTVVLQYEVRLQNGLECGGAYIKYLRPQDAGWVAKEFDNESPYSIMF  547
            I  +  + V+  D T+V+QYEV+LQ+GLECGGAY+K L+  +    A+EF N SPY IMF
Sbjct  105  ISAKFPKAVDNTDNTLVVQYEVKLQDGLECGGAYMKLLQ-DNKALHAEEFSNASPYVIMF  163

Query  548  GPDKCGATNKVHFIFKHKNPKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKPDNEVSILID  727
            GPDKCGATNKVHFIFKHKNPK+GEY E HLK PPS    K + +YT ++KPD    I I+
Sbjct  164  GPDKCGATNKVHFIFKHKNPKTGEYEEKHLKNPPSARISKTSALYTLIVKPDQTFEIKIN  223

Query  728  G  730
            G
Sbjct  224  G  224



>gb|KDB27473.1| hypothetical protein H109_00736 [Trichophyton interdigitale MR816]
Length=563

 Score =   164 bits (416),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 86/164 (52%), Positives = 110/164 (67%), Gaps = 9/164 (5%)
 Frame = +2

Query  239  EEAFEGRWIVSEKEDYKGVWKHSKSEGHEDHGLLVSEPARKYAIVKELDEVVNLKDGTVV  418
            E A+ G W V E   +KG+      EG  D GL+V  PA  +AI  +  + ++ K  T+V
Sbjct  79   EWAYVGEWSVEEPTVFKGI------EG--DKGLVVKNPAAHHAISAKFPKKIDNKGKTLV  130

Query  419  LQYEVRLQNGLECGGAYIKYLRPQDAGWVAKEFDNESPYSIMFGPDKCGATNKVHFIFKH  598
            +QYEV+LQN L CGGAY+K L+ ++    ++EF N SPY IMFGPD+CGATNKVHFIFKH
Sbjct  131  VQYEVKLQNSLSCGGAYMKLLQ-ENKKLHSEEFSNASPYVIMFGPDRCGATNKVHFIFKH  189

Query  599  KNPKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKPDNEVSILIDG  730
            KNPK+GEY E HLK PP+V   KLT +YT ++ PD    I IDG
Sbjct  190  KNPKTGEYEEKHLKAPPAVKVTKLTSLYTLIVNPDQTFQIRIDG  233



>ref|XP_010757501.1| hypothetical protein PADG_01565 [Paracoccidioides brasiliensis 
Pb18]
 gb|EEH45415.1| hypothetical protein PADG_01565 [Paracoccidioides brasiliensis 
Pb18]
Length=568

 Score =   164 bits (416),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 91/204 (45%), Positives = 123/204 (60%), Gaps = 17/204 (8%)
 Frame = +2

Query  161  SVLLLVIGCFFSQLSASSDVKLYESFEEAFEGRWIVS--EKED--------YKGVW----  298
            S+  ++   FF+  +  +     E F + +E RW  S  +K+D        Y G W    
Sbjct  33   SISSVIEKPFFTPTTLKA--PFLEQFTDDWETRWTPSHAKKQDSSSEEDWAYVGTWAVEE  90

Query  299  KHSKSEGHEDHGLLVSEPARKYAIVKELDEVVNLKDGTVVLQYEVRLQNGLECGGAYIKY  478
             H  +    D GL++   A  +AI  +  + ++ KD T+V+QYEV+LQNGL CGGAY+K 
Sbjct  91   PHVFNGMKGDKGLVIKNAAAHHAISAKFPKKIDNKDNTLVVQYEVKLQNGLNCGGAYMKL  150

Query  479  LRPQDAGWVAKEFDNESPYSIMFGPDKCGATNKVHFIFKHKNPKSGEYVEHHLKYPPSVP  658
            L+  +    A+EF N SPY IMFGPDKCG TNKVHFIF+HKNPK+GEY E HLK PP+  
Sbjct  151  LQ-DNKKLHAEEFSNASPYVIMFGPDKCGVTNKVHFIFRHKNPKTGEYEEKHLKNPPAAR  209

Query  659  SDKLTHVYTAVLKPDNEVSILIDG  730
              KL+ +YT ++KPD    ILIDG
Sbjct  210  VSKLSTLYTLIVKPDQSFQILIDG  233



>gb|EZF33950.1| hypothetical protein H101_02494 [Trichophyton interdigitale H6]
Length=563

 Score =   164 bits (416),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 86/164 (52%), Positives = 110/164 (67%), Gaps = 9/164 (5%)
 Frame = +2

Query  239  EEAFEGRWIVSEKEDYKGVWKHSKSEGHEDHGLLVSEPARKYAIVKELDEVVNLKDGTVV  418
            E A+ G W V E   +KG+      EG  D GL+V  PA  +AI  +  + ++ K  T+V
Sbjct  79   EWAYVGEWSVEEPTVFKGI------EG--DKGLVVKNPAAHHAISAKFPKKIDNKGKTLV  130

Query  419  LQYEVRLQNGLECGGAYIKYLRPQDAGWVAKEFDNESPYSIMFGPDKCGATNKVHFIFKH  598
            +QYEV+LQN L CGGAY+K L+ ++    ++EF N SPY IMFGPD+CGATNKVHFIFKH
Sbjct  131  VQYEVKLQNSLSCGGAYMKLLQ-ENKKLHSEEFSNASPYVIMFGPDRCGATNKVHFIFKH  189

Query  599  KNPKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKPDNEVSILIDG  730
            KNPK+GEY E HLK PP+V   KLT +YT ++ PD    I IDG
Sbjct  190  KNPKTGEYEEKHLKAPPAVKVTKLTSLYTLIVNPDQTFQIRIDG  233



>ref|XP_007709681.1| hypothetical protein COCCADRAFT_24118 [Bipolaris zeicola 26-R-13]
 gb|EUC35957.1| hypothetical protein COCCADRAFT_24118 [Bipolaris zeicola 26-R-13]
 gb|EUN23242.1| hypothetical protein COCVIDRAFT_109339 [Bipolaris victoriae FI3]
Length=566

 Score =   164 bits (415),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 85/162 (52%), Positives = 109/162 (67%), Gaps = 9/162 (6%)
 Frame = +2

Query  245  AFEGRWIVSEKEDYKGVWKHSKSEGHEDHGLLVSEPARKYAIVKELDEVVNLKDGTVVLQ  424
            A+ G W V E    KG+      EG  D GL++ + A  +AI  +  + ++ KD T+V+Q
Sbjct  76   AYVGTWAVEEPSVLKGI------EG--DKGLVIKDQAAHHAISAKFPKAIDNKDNTLVVQ  127

Query  425  YEVRLQNGLECGGAYIKYLRPQDAGWVAKEFDNESPYSIMFGPDKCGATNKVHFIFKHKN  604
            YEV+LQNGL+CGGAY+K L+  +A   A+EF N SPY IMFGPDKCGATNKVHFIF+HKN
Sbjct  128  YEVKLQNGLDCGGAYLKLLQ-DNAALHAEEFSNASPYIIMFGPDKCGATNKVHFIFRHKN  186

Query  605  PKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKPDNEVSILIDG  730
            PK+GEY E HLK PP     K + +YT ++KPD    I IDG
Sbjct  187  PKTGEYEEKHLKNPPMARIVKTSTLYTLIVKPDQTFEIKIDG  228



>gb|EEH20809.1| hypothetical protein PABG_03040 [Paracoccidioides brasiliensis 
Pb03]
Length=568

 Score =   164 bits (415),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 90/195 (46%), Positives = 119/195 (61%), Gaps = 17/195 (9%)
 Frame = +2

Query  188  FFSQLSASSDVKLYESFEEAFEGRWIVS--EKED--------YKGVW----KHSKSEGHE  325
            FF+  +  +     E F + +E RW  S  +K+D        Y G W     H  +    
Sbjct  42   FFTPTTLKA--PFLEQFTDDWETRWTPSHAKKQDSSSEEDWAYVGTWAVEEPHVFNGMKG  99

Query  326  DHGLLVSEPARKYAIVKELDEVVNLKDGTVVLQYEVRLQNGLECGGAYIKYLRPQDAGWV  505
            D GL++   A  +AI  +  + ++ KD T+V+QYEV+LQNGL CGGAY+K L+  +    
Sbjct  100  DKGLVIKNAAAHHAISAKFPKKIDNKDNTLVVQYEVKLQNGLNCGGAYMKLLQ-DNKKLH  158

Query  506  AKEFDNESPYSIMFGPDKCGATNKVHFIFKHKNPKSGEYVEHHLKYPPSVPSDKLTHVYT  685
            A+EF N SPY IMFGPDKCG TNKVHFIF+HKNPK+GEY E HLK PP+    KL+ +YT
Sbjct  159  AEEFSNASPYVIMFGPDKCGVTNKVHFIFRHKNPKTGEYEEKHLKNPPAARVSKLSTLYT  218

Query  686  AVLKPDNEVSILIDG  730
             ++KPD    ILIDG
Sbjct  219  LIVKPDQSFQILIDG  233



>ref|XP_007701102.1| hypothetical protein COCSADRAFT_38208 [Bipolaris sorokiniana 
ND90Pr]
 gb|EMD63354.1| hypothetical protein COCSADRAFT_38208 [Bipolaris sorokiniana 
ND90Pr]
Length=566

 Score =   164 bits (415),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 85/162 (52%), Positives = 109/162 (67%), Gaps = 9/162 (6%)
 Frame = +2

Query  245  AFEGRWIVSEKEDYKGVWKHSKSEGHEDHGLLVSEPARKYAIVKELDEVVNLKDGTVVLQ  424
            A+ G W V E    KG+      EG  D GL++ + A  +AI  +  + ++ KD T+V+Q
Sbjct  76   AYVGTWAVEEPSVLKGI------EG--DKGLVIKDQAAHHAISAKFPKAIDNKDNTLVVQ  127

Query  425  YEVRLQNGLECGGAYIKYLRPQDAGWVAKEFDNESPYSIMFGPDKCGATNKVHFIFKHKN  604
            YEV+LQNGL+CGGAY+K L+  +A   A+EF N SPY IMFGPDKCGATNKVHFIF+HKN
Sbjct  128  YEVKLQNGLDCGGAYLKLLQ-DNAALHAEEFSNASPYIIMFGPDKCGATNKVHFIFRHKN  186

Query  605  PKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKPDNEVSILIDG  730
            PK+GEY E HLK PP     K + +YT ++KPD    I IDG
Sbjct  187  PKTGEYEEKHLKNPPMARIVKTSTLYTLIVKPDQTFEIKIDG  228



>ref|XP_003013696.1| hypothetical protein ARB_00147 [Arthroderma benhamiae CBS 112371]
 gb|EFE33056.1| hypothetical protein ARB_00147 [Arthroderma benhamiae CBS 112371]
Length=563

 Score =   164 bits (415),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 85/164 (52%), Positives = 110/164 (67%), Gaps = 9/164 (5%)
 Frame = +2

Query  239  EEAFEGRWIVSEKEDYKGVWKHSKSEGHEDHGLLVSEPARKYAIVKELDEVVNLKDGTVV  418
            E A+ G W V E   +KG+      EG  D GL+V  PA  +AI  +  + ++ K  T+V
Sbjct  79   EWAYVGEWSVEEPTVFKGI------EG--DKGLVVKNPAAHHAISAKFPKKIDNKGKTLV  130

Query  419  LQYEVRLQNGLECGGAYIKYLRPQDAGWVAKEFDNESPYSIMFGPDKCGATNKVHFIFKH  598
            +QYEV+LQN L CGGAY+K L+ ++    ++EF N SPY IMFGPD+CGATNKVHFIFKH
Sbjct  131  VQYEVKLQNSLSCGGAYMKLLQ-ENKKLHSEEFSNASPYVIMFGPDRCGATNKVHFIFKH  189

Query  599  KNPKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKPDNEVSILIDG  730
            KNPK+GEY E HLK PP++   KLT +YT ++ PD    I IDG
Sbjct  190  KNPKTGEYEEKHLKAPPAIKVTKLTSLYTLIVNPDQTFQIRIDG  233



>ref|XP_003024212.1| hypothetical protein TRV_01645 [Trichophyton verrucosum HKI 0517]
 gb|EFE43601.1| hypothetical protein TRV_01645 [Trichophyton verrucosum HKI 0517]
Length=649

 Score =   164 bits (416),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 86/164 (52%), Positives = 109/164 (66%), Gaps = 9/164 (5%)
 Frame = +2

Query  239  EEAFEGRWIVSEKEDYKGVWKHSKSEGHEDHGLLVSEPARKYAIVKELDEVVNLKDGTVV  418
            E A+ G W V E   +KG+      EG  D GL+V  PA  +AI  +  + ++ K  T+V
Sbjct  79   EWAYVGEWSVEEPTVFKGI------EG--DKGLVVKNPAAHHAISAKFPKKIDNKGKTLV  130

Query  419  LQYEVRLQNGLECGGAYIKYLRPQDAGWVAKEFDNESPYSIMFGPDKCGATNKVHFIFKH  598
            +QYEV+LQN L CGGAY+K L+ ++    + EF N SPY IMFGPD+CGATNKVHFIFKH
Sbjct  131  VQYEVKLQNSLSCGGAYMKLLQ-ENKKLHSDEFSNASPYVIMFGPDRCGATNKVHFIFKH  189

Query  599  KNPKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKPDNEVSILIDG  730
            KNPK+GEY E HLK PP+V   KLT +YT ++ PD    I IDG
Sbjct  190  KNPKTGEYEEKHLKAPPAVKVTKLTSLYTLIVNPDQTFQIRIDG  233



>ref|XP_001816793.1| calnexin protein [Aspergillus oryzae RIB40]
 dbj|BAE54791.1| unnamed protein product [Aspergillus oryzae RIB40]
Length=562

 Score =   164 bits (414),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 81/162 (50%), Positives = 109/162 (67%), Gaps = 9/162 (6%)
 Frame = +2

Query  245  AFEGRWIVSEKEDYKGVWKHSKSEGHEDHGLLVSEPARKYAIVKELDEVVNLKDGTVVLQ  424
            A+ G W V E   +KG+          D GL+V  PA  +AI  +  + ++ K  T+V+Q
Sbjct  79   AYVGEWSVEEPTVFKGI--------DGDKGLVVKNPAAHHAISAKFPKKIDNKGKTLVVQ  130

Query  425  YEVRLQNGLECGGAYIKYLRPQDAGWVAKEFDNESPYSIMFGPDKCGATNKVHFIFKHKN  604
            YEV+ QN L CGGAY+K L+ ++    A+EF N +PY IMFGPDKCGATNKVHFIF+HKN
Sbjct  131  YEVKPQNSLVCGGAYLKLLQ-ENKKLHAEEFSNATPYVIMFGPDKCGATNKVHFIFRHKN  189

Query  605  PKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKPDNEVSILIDG  730
            PK+GEY E HLK PP+  ++K+T +YT +++PD    ILIDG
Sbjct  190  PKTGEYEEKHLKAPPAARTNKVTSLYTLIVRPDQSFQILIDG  231



>ref|XP_003324724.1| calnexin [Puccinia graminis f. sp. tritici CRL 75-36-700-3]
 gb|EFP80305.1| calnexin [Puccinia graminis f. sp. tritici CRL 75-36-700-3]
Length=556

 Score =   163 bits (413),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 87/194 (45%), Positives = 119/194 (61%), Gaps = 18/194 (9%)
 Frame = +2

Query  176  VIGCFFSQLSA--------SSDVKLYESFEEAFE--GRWIVSEKEDYKGVWKHSKSEGHE  325
            V+G F  Q ++        S   K   +  E F   G+W V +     G+      EG  
Sbjct  37   VVGHFVEQFTSDWSTRWNPSEATKQTSTGGETFSYVGKWEVEDPTVLPGI------EG--  88

Query  326  DHGLLVSEPARKYAIVKELDEVVNLKDGTVVLQYEVRLQNGLECGGAYIKYLRPQDAGWV  505
            DHGL+V  PA  +AI     ++++  D T+VLQYEV+LQNGLECGGAY+K L+    G  
Sbjct  89   DHGLVVKSPAAHHAISAPFSKILDNTDKTLVLQYEVKLQNGLECGGAYLKLLKESPTGIQ  148

Query  506  AKEFDNESPYSIMFGPDKCGATNKVHFIFKHKNPKSGEYVEHHLKYPPSVPSDKLTHVYT  685
            A+EF +++ YSIMFGPD+CGATNKVHFIF+HKNPK+GEY E H    P++ + K T +YT
Sbjct  149  AQEFSDKTEYSIMFGPDRCGATNKVHFIFRHKNPKTGEYEEKHFNNAPAIKNVKTTSLYT  208

Query  686  AVLKPDNEVSILID  727
             +++PD   +I ID
Sbjct  209  LIVRPDQTFAIKID  222



>ref|XP_002383280.1| calnexin [Aspergillus flavus NRRL3357]
 gb|EED47100.1| calnexin [Aspergillus flavus NRRL3357]
 gb|EIT72779.1| calnexin [Aspergillus oryzae 3.042]
Length=562

 Score =   163 bits (413),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 81/162 (50%), Positives = 109/162 (67%), Gaps = 9/162 (6%)
 Frame = +2

Query  245  AFEGRWIVSEKEDYKGVWKHSKSEGHEDHGLLVSEPARKYAIVKELDEVVNLKDGTVVLQ  424
            A+ G W V E   +KG+          D GL+V  PA  +AI  +  + ++ K  T+V+Q
Sbjct  79   AYVGEWSVEEPTVFKGI--------DGDKGLVVKNPAAHHAISAKFPKKIDNKGKTLVVQ  130

Query  425  YEVRLQNGLECGGAYIKYLRPQDAGWVAKEFDNESPYSIMFGPDKCGATNKVHFIFKHKN  604
            YEV+ QN L CGGAY+K L+ ++    A+EF N +PY IMFGPDKCGATNKVHFIF+HKN
Sbjct  131  YEVKPQNSLVCGGAYLKLLQ-ENKKLHAEEFSNATPYVIMFGPDKCGATNKVHFIFRHKN  189

Query  605  PKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKPDNEVSILIDG  730
            PK+GEY E HLK PP+  ++K+T +YT +++PD    ILIDG
Sbjct  190  PKTGEYEEKHLKAPPAARTNKVTSLYTLIVRPDQSFQILIDG  231



>gb|EGE03014.1| calnexin [Trichophyton equinum CBS 127.97]
Length=563

 Score =   163 bits (413),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 84/164 (51%), Positives = 108/164 (66%), Gaps = 9/164 (5%)
 Frame = +2

Query  239  EEAFEGRWIVSEKEDYKGVWKHSKSEGHEDHGLLVSEPARKYAIVKELDEVVNLKDGTVV  418
            E A+ G W V E   +KG+          D GL+V  PA  +AI  +  + ++ K  T+V
Sbjct  79   EWAYVGEWSVEEPTVFKGI--------KGDKGLVVKNPAAHHAISAKFPKKIDNKGKTLV  130

Query  419  LQYEVRLQNGLECGGAYIKYLRPQDAGWVAKEFDNESPYSIMFGPDKCGATNKVHFIFKH  598
            +QYEV+LQN L CGGAY+K L+ ++    ++EF N SPY IMFGPD+CGATNKVHFIFKH
Sbjct  131  VQYEVKLQNSLSCGGAYMKLLQ-ENKKLHSEEFSNASPYVIMFGPDRCGATNKVHFIFKH  189

Query  599  KNPKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKPDNEVSILIDG  730
            KNPK+GEY E HLK PP+V   KLT +YT ++ PD    I IDG
Sbjct  190  KNPKTGEYEEKHLKAPPAVKVTKLTSLYTLIVNPDQTFQIRIDG  233



>gb|EGE00302.1| calnexin [Trichophyton tonsurans CBS 112818]
Length=563

 Score =   163 bits (413),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 84/164 (51%), Positives = 108/164 (66%), Gaps = 9/164 (5%)
 Frame = +2

Query  239  EEAFEGRWIVSEKEDYKGVWKHSKSEGHEDHGLLVSEPARKYAIVKELDEVVNLKDGTVV  418
            E A+ G W V E   +KG+          D GL+V  PA  +AI  +  + ++ K  T+V
Sbjct  79   EWAYVGEWSVEEPTVFKGI--------KGDKGLVVKNPAAHHAISAKFPKKIDNKGKTLV  130

Query  419  LQYEVRLQNGLECGGAYIKYLRPQDAGWVAKEFDNESPYSIMFGPDKCGATNKVHFIFKH  598
            +QYEV+LQN L CGGAY+K L+ ++    ++EF N SPY IMFGPD+CGATNKVHFIFKH
Sbjct  131  VQYEVKLQNSLSCGGAYMKLLQ-ENKKLHSEEFSNASPYVIMFGPDRCGATNKVHFIFKH  189

Query  599  KNPKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKPDNEVSILIDG  730
            KNPK+GEY E HLK PP+V   KLT +YT ++ PD    I IDG
Sbjct  190  KNPKTGEYEEKHLKAPPAVKVTKLTSLYTLIVNPDQTFQIRIDG  233



>gb|EMF10900.1| calreticulin precursor [Sphaerulina musiva SO2202]
Length=561

 Score =   163 bits (413),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 83/169 (49%), Positives = 112/169 (66%), Gaps = 11/169 (7%)
 Frame = +2

Query  230  ESFEEAFE--GRWIVSEKEDYKGVWKHSKSEGHEDHGLLVSEPARKYAIVKELDEVVNLK  403
            E+ EE ++  G W V E   +KG+          D GL++ + A  +AI  + D  ++ K
Sbjct  67   ENTEEEWQYVGNWEVEEPTVFKGL--------QGDKGLVLKDKAAHHAISAKFDAPIDNK  118

Query  404  DGTVVLQYEVRLQNGLECGGAYIKYLRPQDAGWVAKEFDNESPYSIMFGPDKCGATNKVH  583
            D T+V+QYEV+LQN LECGGAY+K LR ++A     EF N SPY IMFGPDKCGATNKVH
Sbjct  119  DKTLVVQYEVKLQNHLECGGAYLKLLR-ENAALSQDEFSNASPYVIMFGPDKCGATNKVH  177

Query  584  FIFKHKNPKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKPDNEVSILIDG  730
            FIF+HKNPK+GEY E H+   P    +KLT++YT +++PD    +LI+G
Sbjct  178  FIFQHKNPKTGEYEEKHMNAAPPAKINKLTNLYTLIVRPDQSFEVLING  226



>ref|XP_001212344.1| calnexin precursor [Aspergillus terreus NIH2624]
 gb|EAU36440.1| calnexin precursor [Aspergillus terreus NIH2624]
Length=564

 Score =   163 bits (412),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 84/162 (52%), Positives = 109/162 (67%), Gaps = 9/162 (6%)
 Frame = +2

Query  245  AFEGRWIVSEKEDYKGVWKHSKSEGHEDHGLLVSEPARKYAIVKELDEVVNLKDGTVVLQ  424
            A+ G W V E    KG+      EG  D GL+V  PA  +AI  +  + ++ K  T+V+Q
Sbjct  80   AYVGEWAVEEPTVLKGM------EG--DKGLVVKNPAAHHAISAKFPKKIDNKGKTLVVQ  131

Query  425  YEVRLQNGLECGGAYIKYLRPQDAGWVAKEFDNESPYSIMFGPDKCGATNKVHFIFKHKN  604
            YEV+ QN L CGGAY+K L+  +    A+EF N SPY IMFGPDKCGATNKVHFIF+HKN
Sbjct  132  YEVKPQNSLVCGGAYMKLLQ-DNKKLHAEEFSNASPYVIMFGPDKCGATNKVHFIFRHKN  190

Query  605  PKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKPDNEVSILIDG  730
            PK+GEY E HLK PP+  ++K+T +YT +++PD    ILIDG
Sbjct  191  PKTGEYEEKHLKAPPAARTNKVTSLYTLIVRPDQSFQILIDG  232



>gb|EYE92779.1| calnexin precursor [Aspergillus ruber CBS 135680]
Length=557

 Score =   162 bits (411),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 90/186 (48%), Positives = 119/186 (64%), Gaps = 15/186 (8%)
 Frame = +2

Query  215  DVKLYESFEEAFEGRWIVS--EKED--------YKGVW---KHSKSEGHE-DHGLLVSEP  352
            +    E F E +E RWI S  +KED        Y G W   + S  +G E D GL+V +P
Sbjct  47   EAPFLEQFTEGWESRWIPSHAKKEDSKSEDDWAYVGNWAVEEPSVFKGIEGDKGLVVKDP  106

Query  353  ARKYAIVKELDEVVNLKDGTVVLQYEVRLQNGLECGGAYIKYLRPQDAGWVAKEFDNESP  532
            A  + I  +  + ++ K   +V+QYEV+ QN L CGGAY+K L+ ++    A+EF N SP
Sbjct  107  AAHHGISAKFPKKIDNKGKMLVVQYEVKPQNSLVCGGAYLKLLQ-ENKKLHAEEFSNASP  165

Query  533  YSIMFGPDKCGATNKVHFIFKHKNPKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKPDNEV  712
            Y IMFGPDKCGATNKVHFIF+HKNPK+GEY E HLK PP+  + K+T +YT +++PD   
Sbjct  166  YVIMFGPDKCGATNKVHFIFRHKNPKTGEYEEKHLKAPPAARTSKVTSLYTLIVRPDQSF  225

Query  713  SILIDG  730
             ILIDG
Sbjct  226  QILIDG  231



>ref|XP_003231908.1| calnexin [Trichophyton rubrum CBS 118892]
 gb|EGD91306.1| hypothetical protein TERG_07527 [Trichophyton rubrum CBS 118892]
 gb|EZF26804.1| hypothetical protein H100_01109 [Trichophyton rubrum MR850]
 gb|EZF45798.1| hypothetical protein H102_01100 [Trichophyton rubrum CBS 100081]
 gb|EZF56485.1| hypothetical protein H103_01107 [Trichophyton rubrum CBS 288.86]
 gb|EZF67129.1| hypothetical protein H104_01093 [Trichophyton rubrum CBS 289.86]
 gb|EZF77831.1| hypothetical protein H105_01113 [Trichophyton soudanense CBS 
452.61]
 gb|EZF88416.1| hypothetical protein H110_01110 [Trichophyton rubrum MR1448]
 gb|EZF99228.1| hypothetical protein H113_01111 [Trichophyton rubrum MR1459]
 gb|EZG10419.1| hypothetical protein H106_00908 [Trichophyton rubrum CBS 735.88]
 gb|EZG20847.1| hypothetical protein H107_01159 [Trichophyton rubrum CBS 202.88]
 gb|KDB37708.1| hypothetical protein H112_01110 [Trichophyton rubrum D6]
Length=563

 Score =   162 bits (411),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 85/164 (52%), Positives = 110/164 (67%), Gaps = 9/164 (5%)
 Frame = +2

Query  239  EEAFEGRWIVSEKEDYKGVWKHSKSEGHEDHGLLVSEPARKYAIVKELDEVVNLKDGTVV  418
            E A+ G W V E   +KG+      EG  D GL+V  PA  +AI  +  + ++ K  T+V
Sbjct  79   EWAYVGEWSVEEPTVFKGI------EG--DKGLVVKNPAAHHAISAKFPKKIDNKGKTLV  130

Query  419  LQYEVRLQNGLECGGAYIKYLRPQDAGWVAKEFDNESPYSIMFGPDKCGATNKVHFIFKH  598
            +QYEV+LQN L CGGAY+K L+ ++    ++EF N SPY IMFGPD+CGATNKVHFIFKH
Sbjct  131  VQYEVKLQNSLSCGGAYMKLLQ-ENKKLHSEEFSNASPYVIMFGPDRCGATNKVHFIFKH  189

Query  599  KNPKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKPDNEVSILIDG  730
            KNPK+GEY E HLK PP+V   KL+ +YT ++ PD    I IDG
Sbjct  190  KNPKTGEYEEKHLKAPPAVKVTKLSTLYTLIVNPDQTFQIRIDG  233



>ref|XP_007724797.1| calnexin [Capronia coronata CBS 617.96]
 gb|EXJ85359.1| calnexin [Capronia coronata CBS 617.96]
Length=570

 Score =   162 bits (410),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 84/162 (52%), Positives = 104/162 (64%), Gaps = 9/162 (6%)
 Frame = +2

Query  245  AFEGRWIVSEKEDYKGVWKHSKSEGHEDHGLLVSEPARKYAIVKELDEVVNLKDGTVVLQ  424
            A+ G W V E     G+          D  L+V   A  +AI  +   V++ K  T+V+Q
Sbjct  77   AYVGEWSVEEPTVLPGIIG--------DKALVVKNAAAHHAISAKFPSVIDNKGKTLVVQ  128

Query  425  YEVRLQNGLECGGAYIKYLRPQDAGWVAKEFDNESPYSIMFGPDKCGATNKVHFIFKHKN  604
            YEV+LQNGLECGGAY+K LR ++    A+EF N SPY IMFGPDKCGATNKVHFIF+HKN
Sbjct  129  YEVKLQNGLECGGAYMKLLR-ENKELHAEEFSNASPYVIMFGPDKCGATNKVHFIFQHKN  187

Query  605  PKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKPDNEVSILIDG  730
            PK+GEY E HLK PP     KLT +YT ++ PDN   +LID 
Sbjct  188  PKTGEYEEKHLKTPPQAKISKLTTLYTLIVNPDNTFELLIDN  229



>emb|CCX15881.1| Similar to Calnexin homolog; acc. no. Q6Q487 [Pyronema omphalodes 
CBS 100304]
Length=578

 Score =   162 bits (410),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 83/164 (51%), Positives = 111/164 (68%), Gaps = 9/164 (5%)
 Frame = +2

Query  239  EEAFEGRWIVSEKEDYKGVWKHSKSEGHEDHGLLVSEPARKYAIVKELDEVVNLKDGTVV  418
            E+A+ G+W V E    KG+      EG  D GL+    A  +AI  + D+ ++    T+V
Sbjct  93   EQAYLGKWSVEEPTVLKGI------EG--DKGLVAKNVAAFHAISAKFDKPIDNTGKTLV  144

Query  419  LQYEVRLQNGLECGGAYIKYLRPQDAGWVAKEFDNESPYSIMFGPDKCGATNKVHFIFKH  598
            LQYEV+LQ+GLECGGAY+K L+ ++A   A+EF N+SPY IMFGPD+CG+TNKVHFIFKH
Sbjct  145  LQYEVKLQDGLECGGAYMKLLK-ENADLHAEEFSNDSPYVIMFGPDRCGSTNKVHFIFKH  203

Query  599  KNPKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKPDNEVSILIDG  730
            KNPK+GEY E HLK PP +   K + +YT ++ PD    + IDG
Sbjct  204  KNPKTGEYEEKHLKTPPMIKVTKQSALYTLIINPDQTYEMRIDG  247



>ref|XP_001938332.1| calreticulin precursor [Pyrenophora tritici-repentis Pt-1C-BFP]
 gb|EDU50919.1| calreticulin precursor [Pyrenophora tritici-repentis Pt-1C-BFP]
Length=564

 Score =   162 bits (409),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 89/175 (51%), Positives = 113/175 (65%), Gaps = 10/175 (6%)
 Frame = +2

Query  206  ASSDVKLYESFEEAFEGRWIVSEKEDYKGVWKHSKSEGHEDHGLLVSEPARKYAIVKELD  385
            A  DVK  +  E A+ G W V E    KG+      EG  D GL++ + A  +AI  +  
Sbjct  65   AKKDVK-SDDEEWAYVGTWAVEEPTVLKGM------EG--DKGLVIKDKAAHHAISAKFP  115

Query  386  EVVNLKDGTVVLQYEVRLQNGLECGGAYIKYLRPQDAGWVAKEFDNESPYSIMFGPDKCG  565
            + +N KD T+V+QYEV+LQ+GLECGGAY+K L+  +    A+EF N SPY IMFGPDKCG
Sbjct  116  KAINNKDNTLVVQYEVKLQDGLECGGAYMKLLQ-DNKALHAEEFSNASPYIIMFGPDKCG  174

Query  566  ATNKVHFIFKHKNPKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKPDNEVSILIDG  730
            ATNKVHFIF+HKNPK+GEY E HL  PP     K + +YT ++KPD    I IDG
Sbjct  175  ATNKVHFIFRHKNPKTGEYEEKHLNAPPMARIVKTSTLYTLIVKPDQNFEIKIDG  229



>ref|XP_007413029.1| hypothetical protein MELLADRAFT_72534 [Melampsora larici-populina 
98AG31]
 gb|EGG03582.1| hypothetical protein MELLADRAFT_72534 [Melampsora larici-populina 
98AG31]
Length=560

 Score =   162 bits (409),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 95/219 (43%), Positives = 128/219 (58%), Gaps = 16/219 (7%)
 Frame = +2

Query  89   CSIFQLFRVRFSAMEEKKRKIWTQSVLLLVIGCFFSQLSA----SSDVKLYESFEEAFE-  253
            CSI +   V  + +E  K K    S+    I  F S  S+    S   K   +  E F  
Sbjct  15   CSIARAEEVSSTVLE--KPKFAPTSIKAHFIEQFTSDWSSRWSPSEATKETSTGGETFSY  72

Query  254  -GRWIVSEKEDYKGVWKHSKSEGHEDHGLLVSEPARKYAIVKELDEVVNLKDGTVVLQYE  430
             G+W V E   Y  +      EG  D GL+V  PA  +AI     + ++  D T+V+QYE
Sbjct  73   VGKWEVEEATVYPAI------EG--DEGLVVKSPAAHHAISVPFTKSLDNTDKTLVVQYE  124

Query  431  VRLQNGLECGGAYIKYLRPQDAGWVAKEFDNESPYSIMFGPDKCGATNKVHFIFKHKNPK  610
            V+LQ GLECGGAYIK L+    G  A+EF +++ Y+IMFGPD+CG+TNKVHFIF+HKNPK
Sbjct  125  VKLQKGLECGGAYIKLLKESPTGIQAQEFSDKTEYTIMFGPDRCGSTNKVHFIFRHKNPK  184

Query  611  SGEYVEHHLKYPPSVPSDKLTHVYTAVLKPDNEVSILID  727
            +GEY E HLK PP + + K T +YT +++PD   SI I+
Sbjct  185  TGEYEEKHLKSPPMIKNVKTTALYTLIVRPDQTFSIKIN  223



>ref|XP_002791126.1| calnexin [Paracoccidioides sp. 'lutzii' Pb01]
 gb|ABB80132.1| calnexin [Paracoccidioides brasiliensis]
 gb|EEH36619.1| calnexin [Paracoccidioides sp. 'lutzii' Pb01]
Length=567

 Score =   161 bits (408),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 87/183 (48%), Positives = 113/183 (62%), Gaps = 15/183 (8%)
 Frame = +2

Query  224  LYESFEEAFEGRWIVS--EKED--------YKGVW----KHSKSEGHEDHGLLVSEPARK  361
              E F + +E RW  S  +K+D        Y G W     H  +    D GL++   A  
Sbjct  52   FLEQFTDDWETRWTPSHAKKQDSSSEEDWAYVGTWAVEEPHVFNGMKGDKGLVIKNAAAH  111

Query  362  YAIVKELDEVVNLKDGTVVLQYEVRLQNGLECGGAYIKYLRPQDAGWVAKEFDNESPYSI  541
            +AI  +  + ++ K  T+V+QYEV+LQNGL CGGAY+K L+  +    A+EF N SPY I
Sbjct  112  HAISAKFPKKIDNKGNTLVVQYEVKLQNGLNCGGAYMKLLQ-DNKKLHAEEFSNASPYVI  170

Query  542  MFGPDKCGATNKVHFIFKHKNPKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKPDNEVSIL  721
            MFGPDKCG TNKVHFIF+HKNPK+GEY E HLK PP+    KL+ +YT ++KPD    IL
Sbjct  171  MFGPDKCGVTNKVHFIFRHKNPKTGEYEEKHLKNPPAARVSKLSTLYTLIVKPDQSFQIL  230

Query  722  IDG  730
            IDG
Sbjct  231  IDG  233



>ref|XP_003295857.1| hypothetical protein PTT_03528 [Pyrenophora teres f. teres 0-1]
 gb|EFQ96046.1| hypothetical protein PTT_03528 [Pyrenophora teres f. teres 0-1]
Length=564

 Score =   161 bits (408),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 89/175 (51%), Positives = 113/175 (65%), Gaps = 10/175 (6%)
 Frame = +2

Query  206  ASSDVKLYESFEEAFEGRWIVSEKEDYKGVWKHSKSEGHEDHGLLVSEPARKYAIVKELD  385
            A  DVK  +  E A+ G W V E    KG+      EG  D GL++ + A  +AI  +  
Sbjct  65   AKKDVK-SDDEEWAYIGTWAVEEPTVLKGM------EG--DKGLVIKDKAAHHAISAKFP  115

Query  386  EVVNLKDGTVVLQYEVRLQNGLECGGAYIKYLRPQDAGWVAKEFDNESPYSIMFGPDKCG  565
            + +N KD T+V+QYEV+LQ+GLECGGAY+K L+  +    A+EF N SPY IMFGPDKCG
Sbjct  116  KAINNKDNTLVVQYEVKLQDGLECGGAYMKLLQ-DNKALHAEEFSNASPYIIMFGPDKCG  174

Query  566  ATNKVHFIFKHKNPKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKPDNEVSILIDG  730
            ATNKVHFIF+HKNPK+GEY E HL  PP     K + +YT ++KPD    I IDG
Sbjct  175  ATNKVHFIFRHKNPKTGEYEEKHLNSPPMARIVKTSTLYTLIVKPDQNFEIKIDG  229



>ref|XP_002627579.1| calnexin [Blastomyces dermatitidis SLH14081]
 gb|EEQ75219.1| calnexin [Blastomyces dermatitidis SLH14081]
Length=560

 Score =   160 bits (406),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 89/185 (48%), Positives = 113/185 (61%), Gaps = 19/185 (10%)
 Frame = +2

Query  224  LYESFEEAFEGRWIVS--EKED--------YKGVWKHSKSEGH------EDHGLLVSEPA  355
              E F + +E RW  S  +KED        Y G W  +  E H       D GL+V  PA
Sbjct  52   FLEQFTDGWETRWTPSHAKKEDSKSEEDWAYVGTW--AVEEPHVFNGMVGDKGLVVKNPA  109

Query  356  RKYAIVKELDEVVNLKDGTVVLQYEVRLQNGLECGGAYIKYLRPQDAGWVAKEFDNESPY  535
              +AI  +  + ++ K  T+V+QYEV+LQN L CGGAY+K L+  +    A+EF N SPY
Sbjct  110  AHHAISAKFPKKIDNKGKTLVVQYEVKLQNSLNCGGAYMKLLQ-DNKKLHAEEFSNTSPY  168

Query  536  SIMFGPDKCGATNKVHFIFKHKNPKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKPDNEVS  715
             IMFGPDKCG TNKVHFIFKHKNPK+GEY E H+K PP+V   KL+ +YT ++ PD    
Sbjct  169  VIMFGPDKCGVTNKVHFIFKHKNPKTGEYEEKHMKLPPAVRVSKLSTLYTLIVNPDQSFQ  228

Query  716  ILIDG  730
            I IDG
Sbjct  229  IRIDG  233



>gb|KFH43003.1| Calnexin-like protein [Acremonium chrysogenum ATCC 11550]
Length=564

 Score =   160 bits (406),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 86/167 (51%), Positives = 108/167 (65%), Gaps = 9/167 (5%)
 Frame = +2

Query  230  ESFEEAFEGRWIVSEKEDYKGVWKHSKSEGHEDHGLLVSEPARKYAIVKELDEVVNLKDG  409
            E  E A+ G W V E   YKG+      EG  D GL+V  PA  +AI  +  + ++ KD 
Sbjct  74   EEEEWAYVGEWSVEEPVKYKGI------EG--DKGLVVKNPAAHHAISAKFPKKIDNKDK  125

Query  410  TVVLQYEVRLQNGLECGGAYIKYLRPQDAGWVAKEFDNESPYSIMFGPDKCGATNKVHFI  589
            T+V+QYEV+LQNGLECGGAY+K LR  +      EF N +PY IMFGPDKCG TNKVHFI
Sbjct  126  TLVVQYEVKLQNGLECGGAYMKLLR-DNKALHQDEFANTTPYVIMFGPDKCGHTNKVHFI  184

Query  590  FKHKNPKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKPDNEVSILIDG  730
            F HKNPK+GEY E HLK PP+    K T +YT ++ P+N  +I  +G
Sbjct  185  FNHKNPKTGEYEEKHLKSPPTAKIVKTTELYTLIVHPNNTYAIRQNG  231



>gb|EEQ88189.1| calnexin [Blastomyces dermatitidis ER-3]
 gb|EGE86508.1| calnexin [Blastomyces dermatitidis ATCC 18188]
 gb|EQL28292.1| calnexin [Blastomyces dermatitidis ATCC 26199]
Length=560

 Score =   160 bits (405),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 89/185 (48%), Positives = 113/185 (61%), Gaps = 19/185 (10%)
 Frame = +2

Query  224  LYESFEEAFEGRWIVS--EKED--------YKGVWKHSKSEGH------EDHGLLVSEPA  355
              E F + +E RW  S  +KED        Y G W  +  E H       D GL+V  PA
Sbjct  52   FLEQFTDGWETRWTPSHAKKEDSKSEEDWAYVGTW--AVEEPHVFNGMVGDKGLVVKNPA  109

Query  356  RKYAIVKELDEVVNLKDGTVVLQYEVRLQNGLECGGAYIKYLRPQDAGWVAKEFDNESPY  535
              +AI  +  + ++ K  T+V+QYEV+LQN L CGGAY+K L+  +    A+EF N SPY
Sbjct  110  AHHAISAKFPKKIDNKGKTLVVQYEVKLQNSLNCGGAYMKLLQ-DNKKLHAEEFSNTSPY  168

Query  536  SIMFGPDKCGATNKVHFIFKHKNPKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKPDNEVS  715
             IMFGPDKCG TNKVHFIFKHKNPK+GEY E H+K PP+V   KL+ +YT ++ PD    
Sbjct  169  VIMFGPDKCGVTNKVHFIFKHKNPKTGEYEEKHMKLPPAVRVSKLSTLYTLIVNPDQSFQ  228

Query  716  ILIDG  730
            I IDG
Sbjct  229  IRIDG  233



>emb|CCJ28173.1| unnamed protein product [Pneumocystis jirovecii]
Length=568

 Score =   160 bits (404),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 80/180 (44%), Positives = 114/180 (63%), Gaps = 9/180 (5%)
 Frame = +2

Query  194  SQLSASSDVKLYESFEEAF-EGRWIVSEKEDYKGVWKHSKSEGHEDHGLLVSEPARKYAI  370
            ++ + SS ++L +     F +G W V E   YKG+        + D GL++ + A  +AI
Sbjct  62   TRWTVSSALRLTDGNNTVFYDGEWKVEEPTVYKGI--------NGDMGLVLKKQAAHHAI  113

Query  371  VKELDEVVNLKDGTVVLQYEVRLQNGLECGGAYIKYLRPQDAGWVAKEFDNESPYSIMFG  550
              +  E +N K   +V+QYEV+LQN LECGGAY+K +         K+F N++PY+IMFG
Sbjct  114  SAKFSEPLNNKGKVLVVQYEVKLQNDLECGGAYLKLITESQEDIRFKDFSNQTPYTIMFG  173

Query  551  PDKCGATNKVHFIFKHKNPKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKPDNEVSILIDG  730
            PDKCGATNKVHFIF+HKNPK+G+Y E HLK PP++   K T +YT +++PD    I I+ 
Sbjct  174  PDKCGATNKVHFIFRHKNPKTGKYEEKHLKSPPTIEETKFTTLYTLIVRPDQSFEIRINN  233



>ref|XP_002840340.1| hypothetical protein [Tuber melanosporum Mel28]
 emb|CAZ84531.1| unnamed protein product [Tuber melanosporum]
Length=503

 Score =   159 bits (402),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 92/195 (47%), Positives = 119/195 (61%), Gaps = 18/195 (9%)
 Frame = +2

Query  191  FSQLSASSDVKLYESFEEAFEGRWIVS-----------EKEDYKGVWKHSKS---EGHE-  325
            FS L+  +    YE F   ++ RW VS           E+  Y G W   +    +G E 
Sbjct  54   FSPLAIQA--PFYEQFTPGWDSRWKVSHAKKENDKTGDEEWTYVGQWAVEEPTVLKGIEG  111

Query  326  DHGLLVSEPARKYAIVKELDEVVNLKDGTVVLQYEVRLQNGLECGGAYIKYLRPQDAGWV  505
            D+GL+V   A  +AI  + D+ ++ K  T+V+QYEV+LQ GLECGGAY+K L+ ++A   
Sbjct  112  DNGLVVKNVAAHHAISAKFDKPIDNKGKTLVVQYEVKLQGGLECGGAYLKLLK-ENADLH  170

Query  506  AKEFDNESPYSIMFGPDKCGATNKVHFIFKHKNPKSGEYVEHHLKYPPSVPSDKLTHVYT  685
            A+EF N SPY IMFGPDKCGATNKVHFIFKHKNPK+GEY E HL  PP     K T +YT
Sbjct  171  AEEFSNASPYVIMFGPDKCGATNKVHFIFKHKNPKTGEYEEKHLMSPPMARISKQTTLYT  230

Query  686  AVLKPDNEVSILIDG  730
             ++ PD    I +DG
Sbjct  231  LIVNPDQTYVIKMDG  245



>gb|ACI30657.1| calreticulin [Beauveria bassiana]
Length=557

 Score =   159 bits (402),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 87/178 (49%), Positives = 114/178 (64%), Gaps = 11/178 (6%)
 Frame = +2

Query  203  SASSDVKLYESFEE--AFEGRWIVSEKEDYKGVWKHSKSEGHEDHGLLVSEPARKYAIVK  376
            +A  D+K  +  EE  A+ G+W V E   YKG      +EG  D+GL+V  PA  +AI  
Sbjct  61   TAKKDMKGADKEEEEWAYVGQWAVEEPTVYKG------TEG--DNGLVVKNPAAHHAISA  112

Query  377  ELDEVVNLKDGTVVLQYEVRLQNGLECGGAYIKYLRPQDAGWVAKEFDNESPYSIMFGPD  556
            +  + ++ K  T+V+QYEV+LQNGLECGGAY+K LR  +      EF N +PY IMFGPD
Sbjct  113  KFPKKIDNKGKTLVVQYEVKLQNGLECGGAYMKLLR-DNKALHQDEFSNATPYVIMFGPD  171

Query  557  KCGATNKVHFIFKHKNPKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKPDNEVSILIDG  730
            KCG TNKVHFIF HKNPK+GEY E HL  PP+    K T +YT ++ P+N  +I  +G
Sbjct  172  KCGHTNKVHFIFNHKNPKTGEYEEKHLTSPPTAKIVKTTELYTLIVNPNNTYAIRQNG  229



>ref|XP_008603048.1| calreticulin family protein [Beauveria bassiana ARSEF 2860]
 gb|EJP61334.1| calreticulin family protein [Beauveria bassiana ARSEF 2860]
Length=557

 Score =   159 bits (402),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 87/178 (49%), Positives = 114/178 (64%), Gaps = 11/178 (6%)
 Frame = +2

Query  203  SASSDVKLYESFEE--AFEGRWIVSEKEDYKGVWKHSKSEGHEDHGLLVSEPARKYAIVK  376
            +A  D+K  +  EE  A+ G+W V E   YKG      +EG  D+GL+V  PA  +AI  
Sbjct  61   TAKKDMKGADKEEEEWAYVGQWAVEEPTVYKG------TEG--DNGLVVKNPAAHHAISA  112

Query  377  ELDEVVNLKDGTVVLQYEVRLQNGLECGGAYIKYLRPQDAGWVAKEFDNESPYSIMFGPD  556
            +  + ++ K  T+V+QYEV+LQNGLECGGAY+K LR  +      EF N +PY IMFGPD
Sbjct  113  KFPKKIDNKGKTLVVQYEVKLQNGLECGGAYMKLLR-DNKALHQDEFSNATPYVIMFGPD  171

Query  557  KCGATNKVHFIFKHKNPKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKPDNEVSILIDG  730
            KCG TNKVHFIF HKNPK+GEY E HL  PP+    K T +YT ++ P+N  +I  +G
Sbjct  172  KCGHTNKVHFIFNHKNPKTGEYEEKHLTSPPTAKIVKTTELYTLIVNPNNTYAIRQNG  229



>gb|KGQ11752.1| Calnexin [Beauveria bassiana D1-5]
Length=557

 Score =   159 bits (402),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 87/178 (49%), Positives = 114/178 (64%), Gaps = 11/178 (6%)
 Frame = +2

Query  203  SASSDVKLYESFEE--AFEGRWIVSEKEDYKGVWKHSKSEGHEDHGLLVSEPARKYAIVK  376
            +A  D+K  +  EE  A+ G+W V E   YKG      +EG  D+GL+V  PA  +AI  
Sbjct  61   TAKKDMKGADKEEEEWAYVGQWAVEEPTVYKG------TEG--DNGLVVKNPAAHHAISA  112

Query  377  ELDEVVNLKDGTVVLQYEVRLQNGLECGGAYIKYLRPQDAGWVAKEFDNESPYSIMFGPD  556
            +  + ++ K  T+V+QYEV+LQNGLECGGAY+K LR  +      EF N +PY IMFGPD
Sbjct  113  KFPKKIDNKGKTLVVQYEVKLQNGLECGGAYMKLLR-DNKALHQDEFSNATPYVIMFGPD  171

Query  557  KCGATNKVHFIFKHKNPKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKPDNEVSILIDG  730
            KCG TNKVHFIF HKNPK+GEY E HL  PP+    K T +YT ++ P+N  +I  +G
Sbjct  172  KCGHTNKVHFIFNHKNPKTGEYEEKHLTSPPTAKIVKTTELYTLIVNPNNTYAIRQNG  229



>tpe|CBF75819.1| TPA: calnexin, putative (Eurofung) [Aspergillus nidulans FGSC 
A4]
Length=561

 Score =   159 bits (401),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 80/162 (49%), Positives = 106/162 (65%), Gaps = 9/162 (6%)
 Frame = +2

Query  245  AFEGRWIVSEKEDYKGVWKHSKSEGHEDHGLLVSEPARKYAIVKELDEVVNLKDGTVVLQ  424
            A+ G W V E   YKG+          D GL+V   A  +AI  +  + ++ K  T+V+Q
Sbjct  78   AYVGEWSVEEPTVYKGI--------DGDKGLVVKNVAAHHAISAKFPKKIDNKGKTLVVQ  129

Query  425  YEVRLQNGLECGGAYIKYLRPQDAGWVAKEFDNESPYSIMFGPDKCGATNKVHFIFKHKN  604
            YEV+ QN L CGGAY+K L+  +   +A +F N +PY IMFGPDKCGATNKVHFIF+HKN
Sbjct  130  YEVKPQNSLVCGGAYMKLLQ-DNKKALADDFSNTTPYVIMFGPDKCGATNKVHFIFRHKN  188

Query  605  PKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKPDNEVSILIDG  730
            PK+GEY E HLK PP+  + KL+ +YT +++PD    ILIDG
Sbjct  189  PKTGEYEEKHLKAPPAARTSKLSSLYTLIVRPDQSFQILIDG  230



>ref|XP_661196.1| hypothetical protein AN3592.2 [Aspergillus nidulans FGSC A4]
 gb|EAA59800.1| hypothetical protein AN3592.2 [Aspergillus nidulans FGSC A4]
Length=565

 Score =   159 bits (401),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 80/162 (49%), Positives = 106/162 (65%), Gaps = 9/162 (6%)
 Frame = +2

Query  245  AFEGRWIVSEKEDYKGVWKHSKSEGHEDHGLLVSEPARKYAIVKELDEVVNLKDGTVVLQ  424
            A+ G W V E   YKG+          D GL+V   A  +AI  +  + ++ K  T+V+Q
Sbjct  82   AYVGEWSVEEPTVYKGI--------DGDKGLVVKNVAAHHAISAKFPKKIDNKGKTLVVQ  133

Query  425  YEVRLQNGLECGGAYIKYLRPQDAGWVAKEFDNESPYSIMFGPDKCGATNKVHFIFKHKN  604
            YEV+ QN L CGGAY+K L+  +   +A +F N +PY IMFGPDKCGATNKVHFIF+HKN
Sbjct  134  YEVKPQNSLVCGGAYMKLLQ-DNKKALADDFSNTTPYVIMFGPDKCGATNKVHFIFRHKN  192

Query  605  PKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKPDNEVSILIDG  730
            PK+GEY E HLK PP+  + KL+ +YT +++PD    ILIDG
Sbjct  193  PKTGEYEEKHLKAPPAARTSKLSSLYTLIVRPDQSFQILIDG  234



>gb|EWG37268.1| calnexin [Fusarium verticillioides 7600]
Length=561

 Score =   159 bits (401),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 82/156 (53%), Positives = 103/156 (66%), Gaps = 9/156 (6%)
 Frame = +2

Query  239  EEAFEGRWIVSEKEDYKGVWKHSKSEGHEDHGLLVSEPARKYAIVKELDEVVNLKDGTVV  418
            E A+ G W V E   YKG+      EG  D GL+V  PA  +AI  +  + ++ KD T+V
Sbjct  74   EWAYVGEWAVEEPVQYKGI------EG--DKGLVVKNPAAHHAISAKFPKKIDNKDNTLV  125

Query  419  LQYEVRLQNGLECGGAYIKYLRPQDAGWVAKEFDNESPYSIMFGPDKCGATNKVHFIFKH  598
            +QYEV+LQNGLECGGAY+K LR  +     +EF N +PY IMFGPDKCG TNKVHFIF H
Sbjct  126  VQYEVKLQNGLECGGAYMKLLR-DNKALHQEEFANTTPYVIMFGPDKCGHTNKVHFIFNH  184

Query  599  KNPKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKPDN  706
            KNPK+GEY E HL  PP+    K T +YT ++ P+N
Sbjct  185  KNPKTGEYEEKHLDSPPTAKITKTTELYTLIVHPNN  220



>emb|CCT62441.1| probable calcium-binding protein precursor cnx1 [Fusarium fujikuroi 
IMI 58289]
Length=561

 Score =   159 bits (401),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 82/156 (53%), Positives = 103/156 (66%), Gaps = 9/156 (6%)
 Frame = +2

Query  239  EEAFEGRWIVSEKEDYKGVWKHSKSEGHEDHGLLVSEPARKYAIVKELDEVVNLKDGTVV  418
            E A+ G W V E   YKG+      EG  D GL+V  PA  +AI  +  + ++ KD T+V
Sbjct  74   EWAYVGEWAVEEPVQYKGI------EG--DKGLVVKNPAAHHAISAKFPKKIDNKDNTLV  125

Query  419  LQYEVRLQNGLECGGAYIKYLRPQDAGWVAKEFDNESPYSIMFGPDKCGATNKVHFIFKH  598
            +QYEV+LQNGLECGGAY+K LR  +     +EF N +PY IMFGPDKCG TNKVHFIF H
Sbjct  126  VQYEVKLQNGLECGGAYMKLLR-DNKALHQEEFANTTPYVIMFGPDKCGHTNKVHFIFNH  184

Query  599  KNPKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKPDN  706
            KNPK+GEY E HL  PP+    K T +YT ++ P+N
Sbjct  185  KNPKTGEYEEKHLDSPPTAKITKTTELYTLIVHPNN  220



>gb|ESA03120.1| hypothetical protein GLOINDRAFT_336953 [Rhizophagus irregularis 
DAOM 181602]
 gb|EXX56726.1| Cne1p [Rhizophagus irregularis DAOM 197198w]
Length=568

 Score =   158 bits (400),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 77/162 (48%), Positives = 107/162 (66%), Gaps = 8/162 (5%)
 Frame = +2

Query  245  AFEGRWIVSEKEDYKGVWKHSKSEGHEDHGLLVSEPARKYAIVKELDEVVNLKDGTVVLQ  424
            ++ G+W V E   + G+          D GL+V   A  +AI   L+  ++  + T+V+Q
Sbjct  73   SYVGKWKVEEPTVFPGILG--------DKGLIVDSKAAHHAISASLNNSLDNTNNTLVVQ  124

Query  425  YEVRLQNGLECGGAYIKYLRPQDAGWVAKEFDNESPYSIMFGPDKCGATNKVHFIFKHKN  604
            YEV+LQNGLECGGAY+K L   + G  A+EF +++PY+IMFGPDKCGATNKVHFIF+HKN
Sbjct  125  YEVKLQNGLECGGAYMKLLTESEKGIHAEEFSDKTPYTIMFGPDKCGATNKVHFIFRHKN  184

Query  605  PKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKPDNEVSILIDG  730
            PK+GEY E H+   PS    KL+ +YT +++PDN   I I+ 
Sbjct  185  PKTGEYEEKHMNSAPSAKISKLSTLYTLIVRPDNSFEIRINN  226



>gb|EGU80626.1| hypothetical protein FOXB_08849 [Fusarium oxysporum Fo5176]
 gb|EWY93689.1| calnexin [Fusarium oxysporum FOSC 3-a]
 gb|EWZ51007.1| calnexin [Fusarium oxysporum Fo47]
 gb|EWZ91525.1| calnexin [Fusarium oxysporum f. sp. lycopersici MN25]
 gb|EXK88380.1| calnexin [Fusarium oxysporum f. sp. raphani 54005]
 gb|EXL49887.1| calnexin [Fusarium oxysporum f. sp. radicis-lycopersici 26381]
 gb|EXL77281.1| calnexin [Fusarium oxysporum f. sp. conglutinans race 2 54008]
 gb|EXM27593.1| calnexin [Fusarium oxysporum f. sp. vasinfectum 25433]
Length=561

 Score =   158 bits (400),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 82/156 (53%), Positives = 103/156 (66%), Gaps = 9/156 (6%)
 Frame = +2

Query  239  EEAFEGRWIVSEKEDYKGVWKHSKSEGHEDHGLLVSEPARKYAIVKELDEVVNLKDGTVV  418
            E A+ G W V E   YKG+      EG  D GL+V  PA  +AI  +  + ++ KD T+V
Sbjct  74   EWAYVGEWAVEEPVQYKGI------EG--DKGLVVKNPAAHHAISAKFPKKIDNKDNTLV  125

Query  419  LQYEVRLQNGLECGGAYIKYLRPQDAGWVAKEFDNESPYSIMFGPDKCGATNKVHFIFKH  598
            +QYEV+LQNGLECGGAY+K LR  +     +EF N +PY IMFGPDKCG TNKVHFIF H
Sbjct  126  VQYEVKLQNGLECGGAYMKLLR-DNKALHQEEFANTTPYVIMFGPDKCGHTNKVHFIFNH  184

Query  599  KNPKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKPDN  706
            KNPK+GEY E HL  PP+    K T +YT ++ P+N
Sbjct  185  KNPKTGEYEEKHLDSPPTAKITKTTELYTLIVHPNN  220



>gb|EXK48260.1| calnexin [Fusarium oxysporum f. sp. melonis 26406]
Length=561

 Score =   158 bits (400),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 82/156 (53%), Positives = 103/156 (66%), Gaps = 9/156 (6%)
 Frame = +2

Query  239  EEAFEGRWIVSEKEDYKGVWKHSKSEGHEDHGLLVSEPARKYAIVKELDEVVNLKDGTVV  418
            E A+ G W V E   YKG+      EG  D GL+V  PA  +AI  +  + ++ KD T+V
Sbjct  74   EWAYVGEWAVEEPVQYKGI------EG--DKGLVVKNPAAHHAISAKFPKKIDNKDNTLV  125

Query  419  LQYEVRLQNGLECGGAYIKYLRPQDAGWVAKEFDNESPYSIMFGPDKCGATNKVHFIFKH  598
            +QYEV+LQNGLECGGAY+K LR  +     +EF N +PY IMFGPDKCG TNKVHFIF H
Sbjct  126  VQYEVKLQNGLECGGAYMKLLR-DNKALHQEEFANTTPYVIMFGPDKCGHTNKVHFIFNH  184

Query  599  KNPKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKPDN  706
            KNPK+GEY E HL  PP+    K T +YT ++ P+N
Sbjct  185  KNPKTGEYEEKHLDSPPTAKITKTTELYTLIVHPNN  220



>gb|EMT61884.1| Calnexin like protein [Fusarium oxysporum f. sp. cubense race 
4]
 gb|EXM11385.1| calnexin [Fusarium oxysporum f. sp. cubense tropical race 4 54006]
Length=561

 Score =   158 bits (400),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 82/156 (53%), Positives = 103/156 (66%), Gaps = 9/156 (6%)
 Frame = +2

Query  239  EEAFEGRWIVSEKEDYKGVWKHSKSEGHEDHGLLVSEPARKYAIVKELDEVVNLKDGTVV  418
            E A+ G W V E   YKG+      EG  D GL+V  PA  +AI  +  + ++ KD T+V
Sbjct  74   EWAYVGEWAVEEPVQYKGI------EG--DKGLVVKNPAAHHAISAKFPKKIDNKDNTLV  125

Query  419  LQYEVRLQNGLECGGAYIKYLRPQDAGWVAKEFDNESPYSIMFGPDKCGATNKVHFIFKH  598
            +QYEV+LQNGLECGGAY+K LR  +     +EF N +PY IMFGPDKCG TNKVHFIF H
Sbjct  126  VQYEVKLQNGLECGGAYMKLLR-DNKALHQEEFANTTPYVIMFGPDKCGHTNKVHFIFNH  184

Query  599  KNPKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKPDN  706
            KNPK+GEY E HL  PP+    K T +YT ++ P+N
Sbjct  185  KNPKTGEYEEKHLDSPPTAKITKTTELYTLIVHPNN  220



>gb|ENH61055.1| Calnexin like protein [Fusarium oxysporum f. sp. cubense race 
1]
 gb|EXA52781.1| calnexin [Fusarium oxysporum f. sp. pisi HDV247]
Length=561

 Score =   158 bits (399),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 82/156 (53%), Positives = 103/156 (66%), Gaps = 9/156 (6%)
 Frame = +2

Query  239  EEAFEGRWIVSEKEDYKGVWKHSKSEGHEDHGLLVSEPARKYAIVKELDEVVNLKDGTVV  418
            E A+ G W V E   YKG+      EG  D GL+V  PA  +AI  +  + ++ KD T+V
Sbjct  74   EWAYVGEWAVEEPVQYKGI------EG--DKGLVVKNPAAHHAISAKFPKKIDNKDNTLV  125

Query  419  LQYEVRLQNGLECGGAYIKYLRPQDAGWVAKEFDNESPYSIMFGPDKCGATNKVHFIFKH  598
            +QYEV+LQNGLECGGAY+K LR  +     +EF N +PY IMFGPDKCG TNKVHFIF H
Sbjct  126  VQYEVKLQNGLECGGAYMKLLR-DNKALHQEEFANTTPYVIMFGPDKCGHTNKVHFIFNH  184

Query  599  KNPKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKPDN  706
            KNPK+GEY E HL  PP+    K T +YT ++ P+N
Sbjct  185  KNPKTGEYEEKHLDSPPTAKITKTTELYTLIVHPNN  220



>ref|XP_001389264.1| calnexin protein [Aspergillus niger CBS 513.88]
 emb|CAC82717.1| calnexin [Aspergillus niger]
 emb|CAK43931.1| unnamed protein product [Aspergillus niger]
 gb|EHA26696.1| hypothetical protein ASPNIDRAFT_205810 [Aspergillus niger ATCC 
1015]
Length=562

 Score =   158 bits (399),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 87/163 (53%), Positives = 106/163 (65%), Gaps = 11/163 (7%)
 Frame = +2

Query  245  AFEGRWIVSEKEDYKGVWKHSKSEGHEDHGLLVSEPARKYAIVKELDEVVNLKDGTVVLQ  424
            A+ G W V E    KG+      EG  D GL+V   A  +AI  +  + ++ KD T+V+Q
Sbjct  79   AYVGEWSVEEPTVLKGM------EG--DKGLVVKNVAAHHAISAKFPKKIDNKDKTLVVQ  130

Query  425  YEVRLQNGLECGGAYIKYLRPQDAGWV-AKEFDNESPYSIMFGPDKCGATNKVHFIFKHK  601
            YEV+ QN L CGGAY+K L  QD   +   EF N SPY IMFGPDKCGATNKVHFIF+HK
Sbjct  131  YEVKPQNSLVCGGAYLKLL--QDNKQLHLDEFSNASPYVIMFGPDKCGATNKVHFIFRHK  188

Query  602  NPKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKPDNEVSILIDG  730
            NPK+GEY E HLK PP+  + K+T VYT V+ PD    ILIDG
Sbjct  189  NPKTGEYEEKHLKAPPAARTSKVTSVYTLVVNPDQTFQILIDG  231



>dbj|GAA81928.1| calnexin precursor [Aspergillus kawachii IFO 4308]
Length=562

 Score =   158 bits (399),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 85/162 (52%), Positives = 105/162 (65%), Gaps = 9/162 (6%)
 Frame = +2

Query  245  AFEGRWIVSEKEDYKGVWKHSKSEGHEDHGLLVSEPARKYAIVKELDEVVNLKDGTVVLQ  424
            A+ G W V E    KG+      EG  D GL+V   A  +AI  +  + ++ KD T+V+Q
Sbjct  79   AYVGEWSVEEPTVLKGM------EG--DKGLVVKNVAAHHAISAKFPKKIDNKDKTLVVQ  130

Query  425  YEVRLQNGLECGGAYIKYLRPQDAGWVAKEFDNESPYSIMFGPDKCGATNKVHFIFKHKN  604
            YEV+ QN L CGGAY+K L+  +      EF N SPY IMFGPDKCGATNKVHFIF+HKN
Sbjct  131  YEVKPQNSLVCGGAYLKLLQ-DNKKLHLDEFSNASPYVIMFGPDKCGATNKVHFIFRHKN  189

Query  605  PKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKPDNEVSILIDG  730
            PK+GEY E HLK PP+  + K+T VYT V+ PD    ILIDG
Sbjct  190  PKTGEYEEKHLKAPPAARTSKVTSVYTLVVNPDQTFQILIDG  231



>ref|XP_003853151.1| calnexin protein [Zymoseptoria tritici IPO323]
 gb|EGP88127.1| calnexin protein [Zymoseptoria tritici IPO323]
Length=566

 Score =   158 bits (399),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 82/161 (51%), Positives = 108/161 (67%), Gaps = 9/161 (6%)
 Frame = +2

Query  248  FEGRWIVSEKEDYKGVWKHSKSEGHEDHGLLVSEPARKYAIVKELDEVVNLKDGTVVLQY  427
            F G W V E    KG+      EG  D GL++ + A  +AI  + D  ++ K  T+V+QY
Sbjct  77   FVGNWEVEEPTVLKGM------EG--DKGLVLKDKAAHHAISAKFDAPIDNKGKTLVVQY  128

Query  428  EVRLQNGLECGGAYIKYLRPQDAGWVAKEFDNESPYSIMFGPDKCGATNKVHFIFKHKNP  607
            EV+LQN LECGGAY+K L+ Q+A     EF N SPY IMFGPDKCG+TNKVHFIF+HKNP
Sbjct  129  EVKLQNFLECGGAYMKLLQ-QNAALGTDEFSNASPYIIMFGPDKCGSTNKVHFIFRHKNP  187

Query  608  KSGEYVEHHLKYPPSVPSDKLTHVYTAVLKPDNEVSILIDG  730
            K+GEY E H+   PS   +KLT++YT +++PD    +LI+G
Sbjct  188  KTGEYEEKHMDGAPSAVINKLTNLYTLIVRPDQSFEVLING  228



>gb|KEQ69874.1| calnexin-like protein [Aureobasidium pullulans var. namibiae 
CBS 147.97]
Length=582

 Score =   158 bits (399),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 82/181 (45%), Positives = 110/181 (61%), Gaps = 13/181 (7%)
 Frame = +2

Query  224  LYESFEEAFEGRWIVSEKED--------YKGVWKHSKSE----GHEDHGLLVSEPARKYA  367
              E F + +E RW  SE +         Y G WK  +       H D GL++ + A  +A
Sbjct  61   FLEQFTDDWESRWQKSEAKKEGTEEEWAYVGTWKVEEPSVLRGMHGDKGLVLKDKAAHHA  120

Query  368  IVKELDEVVNLKDGTVVLQYEVRLQNGLECGGAYIKYLRPQDAGWVAKEFDNESPYSIMF  547
            I  +  + ++  D T+V+QYE + Q GLECGGAY+K L+  ++   A+EF N SPY IMF
Sbjct  121  ISAKFPKAIDNTDKTLVVQYEAKFQAGLECGGAYMKLLQ-DNSALHAEEFSNASPYIIMF  179

Query  548  GPDKCGATNKVHFIFKHKNPKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKPDNEVSILID  727
            GPDKCG+TNKVHFIF+HKNPK+GEY E HLK PP     K T +YT +++PD    + ID
Sbjct  180  GPDKCGSTNKVHFIFRHKNPKTGEYEEKHLKNPPMARISKQTSLYTLIVRPDQTFELKID  239

Query  728  G  730
            G
Sbjct  240  G  240



>ref|XP_007827647.1| Calnexin [Pestalotiopsis fici W106-1]
 gb|ETS87047.1| Calnexin [Pestalotiopsis fici W106-1]
Length=561

 Score =   157 bits (398),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 82/156 (53%), Positives = 103/156 (66%), Gaps = 9/156 (6%)
 Frame = +2

Query  239  EEAFEGRWIVSEKEDYKGVWKHSKSEGHEDHGLLVSEPARKYAIVKELDEVVNLKDGTVV  418
            E A+ G W V E   YKG+      EG  D GL+V  PA  +AI  + D+ ++ KD  +V
Sbjct  73   EWAYVGEWSVEEPTVYKGM------EG--DKGLVVKNPAAHHAISAKFDKAIDPKDKPLV  124

Query  419  LQYEVRLQNGLECGGAYIKYLRPQDAGWVAKEFDNESPYSIMFGPDKCGATNKVHFIFKH  598
            +QYEV+LQNGLECGGAY+K LR ++      EF N +PY IMFGPDKCG TNKVHFIF H
Sbjct  125  VQYEVKLQNGLECGGAYLKLLR-ENKALHQDEFANTTPYVIMFGPDKCGHTNKVHFIFNH  183

Query  599  KNPKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKPDN  706
            KNPK+GEY E HL  PP+    K T +YT ++ P+N
Sbjct  184  KNPKTGEYEEKHLTSPPTARVVKTTELYTLIVHPNN  219



>gb|ENH88310.1| calnexin precursor [Colletotrichum orbiculare MAFF 240422]
Length=571

 Score =   157 bits (398),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 84/164 (51%), Positives = 108/164 (66%), Gaps = 9/164 (5%)
 Frame = +2

Query  239  EEAFEGRWIVSEKEDYKGVWKHSKSEGHEDHGLLVSEPARKYAIVKELDEVVNLKDGTVV  418
            E A+ G W V E + YKG+      EG  D GL+V  PA  +AI  +  + ++ K  T+V
Sbjct  84   EWAYVGEWAVEEPKIYKGM------EG--DKGLVVKNPAAHHAISAKFPKKIDNKGKTLV  135

Query  419  LQYEVRLQNGLECGGAYIKYLRPQDAGWVAKEFDNESPYSIMFGPDKCGATNKVHFIFKH  598
            +QYEV+LQNGLECGGAY+K LR ++    ++EF N +PY IMFGPDKCG TNKVHFIF H
Sbjct  136  VQYEVKLQNGLECGGAYLKLLR-ENKALHSEEFSNATPYVIMFGPDKCGHTNKVHFIFNH  194

Query  599  KNPKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKPDNEVSILIDG  730
            KNPKSGEY E HL  PP+    K T +YT ++ P+N   I  +G
Sbjct  195  KNPKSGEYEEKHLTSPPTARIVKTTELYTLIVHPNNTYIIQQNG  238



>ref|XP_002151134.1| calnexin [Talaromyces marneffei ATCC 18224]
 gb|EEA20134.1| calnexin [Talaromyces marneffei ATCC 18224]
 gb|KFX48396.1| Calnexin like [Talaromyces marneffei PM1]
Length=563

 Score =   157 bits (398),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 82/162 (51%), Positives = 108/162 (67%), Gaps = 9/162 (6%)
 Frame = +2

Query  245  AFEGRWIVSEKEDYKGVWKHSKSEGHEDHGLLVSEPARKYAIVKELDEVVNLKDGTVVLQ  424
            A+ G W V E   +KG+      EG  D GL++  PA  +AI  +  + ++ K  T+V+Q
Sbjct  81   AYVGEWSVEEPTVFKGI------EG--DKGLVLKNPAAHHAISAKFPKKIDNKGKTLVVQ  132

Query  425  YEVRLQNGLECGGAYIKYLRPQDAGWVAKEFDNESPYSIMFGPDKCGATNKVHFIFKHKN  604
            YEV+ QN L CGGAY+K L+ ++    A+EF N SPY IMFGPDKCGATNKVHFIFKHKN
Sbjct  133  YEVKPQNSLICGGAYLKLLQ-ENKKLHAEEFSNASPYVIMFGPDKCGATNKVHFIFKHKN  191

Query  605  PKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKPDNEVSILIDG  730
            PK+G+Y E H+  PP   ++K T VYT ++KPD    ILI+G
Sbjct  192  PKTGKYEEKHMTNPPVPHTEKTTSVYTLIVKPDQTFEILING  233



>ref|XP_002341910.1| calnexin [Talaromyces stipitatus ATCC 10500]
 gb|EED24523.1| calnexin [Talaromyces stipitatus ATCC 10500]
Length=563

 Score =   157 bits (397),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 82/162 (51%), Positives = 106/162 (65%), Gaps = 9/162 (6%)
 Frame = +2

Query  245  AFEGRWIVSEKEDYKGVWKHSKSEGHEDHGLLVSEPARKYAIVKELDEVVNLKDGTVVLQ  424
            A+ G W V E   +KG+      EG  D GL++  PA  +AI  +  + ++ K  T+V+Q
Sbjct  81   AYVGEWSVEEPTVFKGI------EG--DKGLVLKNPAAHHAISAKFPKKIDNKGKTLVVQ  132

Query  425  YEVRLQNGLECGGAYIKYLRPQDAGWVAKEFDNESPYSIMFGPDKCGATNKVHFIFKHKN  604
            YEV+ QN L CGGAY+K L+ ++      EF N SPY IMFGPDKCG+TNKVHFIFKHKN
Sbjct  133  YEVKPQNSLVCGGAYLKLLQ-ENKKLHLDEFSNASPYVIMFGPDKCGSTNKVHFIFKHKN  191

Query  605  PKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKPDNEVSILIDG  730
            PK+GEY E H+  PP   +DK T VYT ++KPD    ILI+G
Sbjct  192  PKTGEYEEKHMTNPPVPRTDKTTSVYTLIVKPDQSFEILING  233



>gb|EQB45337.1| hypothetical protein CGLO_15805 [Colletotrichum gloeosporioides 
Cg-14]
Length=545

 Score =   157 bits (397),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 83/164 (51%), Positives = 108/164 (66%), Gaps = 9/164 (5%)
 Frame = +2

Query  239  EEAFEGRWIVSEKEDYKGVWKHSKSEGHEDHGLLVSEPARKYAIVKELDEVVNLKDGTVV  418
            E A+ G W V E + YKG+      EG  D GL+V  PA  +AI  +  + ++ K  T+V
Sbjct  82   EWAYVGEWAVEEPKVYKGM------EG--DKGLVVKNPAAHHAISAKFPKKIDNKGKTLV  133

Query  419  LQYEVRLQNGLECGGAYIKYLRPQDAGWVAKEFDNESPYSIMFGPDKCGATNKVHFIFKH  598
            +QYEV+LQNGLECGGAY+K LR ++    ++EF N +PY IMFGPDKCG TNKVHFIF H
Sbjct  134  VQYEVKLQNGLECGGAYLKLLR-ENKALHSEEFSNATPYVIMFGPDKCGHTNKVHFIFNH  192

Query  599  KNPKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKPDNEVSILIDG  730
            KNPK+GEY E HL  PP+    K T +YT ++ P+N   I  +G
Sbjct  193  KNPKTGEYEEKHLNSPPTARIVKTTELYTLIVHPNNTYIIQQNG  236



>gb|KFH63342.1| calnexin [Mortierella verticillata NRRL 6337]
Length=580

 Score =   157 bits (397),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 83/183 (45%), Positives = 107/183 (58%), Gaps = 14/183 (8%)
 Frame = +2

Query  224  LYESFEEAFEGRWIVSEKE----------DYKGVWKHSKSEGHE----DHGLLVSEPARK  361
              E F + +  RW  SE             Y G WK  +   +     D GL+   PA  
Sbjct  62   FLEQFSQNWSDRWTASEATKETSAEGEVFSYVGQWKVEEPTVYPGLKGDLGLVAKSPAAH  121

Query  362  YAIVKELDEVVNLKDGTVVLQYEVRLQNGLECGGAYIKYLRPQDAGWVAKEFDNESPYSI  541
            +AI   L +VV+ KD T+V+QYEV+ Q GLECGGAY+K L     G   KEF N++PY+I
Sbjct  122  HAISASLPQVVDNKDKTLVVQYEVKAQQGLECGGAYMKLLTDSPEGIKFKEFSNDTPYTI  181

Query  542  MFGPDKCGATNKVHFIFKHKNPKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKPDNEVSIL  721
            MFGPDKCG TNKVHFIF+HKNP +G Y E HL+  P    + LT++YT ++KPD    I 
Sbjct  182  MFGPDKCGGTNKVHFIFRHKNPITGVYEEKHLQSAPMAKVNSLTNLYTLIVKPDQSFEIK  241

Query  722  IDG  730
            I+G
Sbjct  242  ING  244



>ref|XP_005824254.1| hypothetical protein GUITHDRAFT_165512 [Guillardia theta CCMP2712]
 gb|EKX37274.1| hypothetical protein GUITHDRAFT_165512 [Guillardia theta CCMP2712]
Length=541

 Score =   157 bits (396),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 75/171 (44%), Positives = 113/171 (66%), Gaps = 4/171 (2%)
 Frame = +2

Query  224  LYESFEEAFEGRWIVSEKEDYKGVWKHSK--SEGHEDHGLLVSEPARKYAIVKELDEVVN  397
             +E F E ++ +W+ +   +Y G W+  K  SE  ED+GL +    +K+A+    ++ + 
Sbjct  38   FFEPFSEGWQSKWVNTTSSEYTGEWEWVKNYSEVTEDYGLRMGSAGQKHALSSAFEKPIE  97

Query  398  LKDGTVVLQYEVRLQNGLECGGAYIKYLRPQDAGWVAKEFDNESPYSIMFGPDKCGATNK  577
            +KD T V+QYEV+  NGL C GAYIK L+ +DA    +EFDN   Y+IMFGPD+CG+T+K
Sbjct  98   VKDSTFVVQYEVKAMNGLACDGAYIKLLQ-KDAAKKLQEFDNNLRYTIMFGPDRCGSTDK  156

Query  578  VHFIFKHKNPKSGEYVEHHLK-YPPSVPSDKLTHVYTAVLKPDNEVSILID  727
            VHFI +H+NP + ++ E H K  P S  +DK+TH+YT +++PDN   IL+D
Sbjct  157  VHFILQHQNPVTKQWEEKHAKGTPASSAADKMTHLYTLIIRPDNSFEILVD  207



>ref|XP_007281341.1| calnexin precursor [Colletotrichum gloeosporioides Nara gc5]
 gb|ELA29565.1| calnexin precursor [Colletotrichum gloeosporioides Nara gc5]
Length=569

 Score =   157 bits (396),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 83/164 (51%), Positives = 108/164 (66%), Gaps = 9/164 (5%)
 Frame = +2

Query  239  EEAFEGRWIVSEKEDYKGVWKHSKSEGHEDHGLLVSEPARKYAIVKELDEVVNLKDGTVV  418
            E A+ G W V E + YKG+      EG  D GL+V  PA  +AI  +  + ++ K  T+V
Sbjct  82   EWAYVGEWAVEEPKVYKGM------EG--DKGLVVKNPAAHHAISAKFPKKIDNKGKTLV  133

Query  419  LQYEVRLQNGLECGGAYIKYLRPQDAGWVAKEFDNESPYSIMFGPDKCGATNKVHFIFKH  598
            +QYEV+LQNGLECGGAY+K LR ++    ++EF N +PY IMFGPDKCG TNKVHFIF H
Sbjct  134  VQYEVKLQNGLECGGAYLKLLR-ENKALHSEEFSNATPYVIMFGPDKCGHTNKVHFIFNH  192

Query  599  KNPKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKPDNEVSILIDG  730
            KNPK+GEY E HL  PP+    K T +YT ++ P+N   I  +G
Sbjct  193  KNPKTGEYEEKHLNSPPTARIVKTTELYTLIVHPNNTYIIQQNG  236



>gb|KEQ88681.1| calnexin-like protein [Aureobasidium pullulans EXF-150]
Length=582

 Score =   156 bits (395),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 83/181 (46%), Positives = 112/181 (62%), Gaps = 13/181 (7%)
 Frame = +2

Query  224  LYESFEEAFEGRWIVSEKED--------YKGVWK---HSKSEGHE-DHGLLVSEPARKYA  367
              E F + +E RW  SE +         Y G WK    S   G + D GL++ + A  +A
Sbjct  61   FLEQFTDDWESRWQKSEAKKEGTEEEWAYVGTWKVEEPSVLRGIDGDKGLVLKDKAAHHA  120

Query  368  IVKELDEVVNLKDGTVVLQYEVRLQNGLECGGAYIKYLRPQDAGWVAKEFDNESPYSIMF  547
            I  +  + ++ KD T+V+QYE + Q GLECGGAY+K L+  ++   A+EF N SPY IMF
Sbjct  121  ISAKFPKAIDNKDKTLVVQYEAKFQAGLECGGAYMKLLQ-DNSALHAEEFSNASPYIIMF  179

Query  548  GPDKCGATNKVHFIFKHKNPKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKPDNEVSILID  727
            GPDKCG+TNKVHFIF+HKNPK+GEY E HLK PP     K T +YT +++PD    + +D
Sbjct  180  GPDKCGSTNKVHFIFRHKNPKTGEYEEKHLKNPPMARISKQTSLYTLIVRPDQSFELKVD  239

Query  728  G  730
            G
Sbjct  240  G  240



>ref|XP_011316164.1| hypothetical protein FGSG_00491 [Fusarium graminearum PH-1]
 gb|ESU05679.1| hypothetical protein FGSG_00491 [Fusarium graminearum PH-1]
 gb|EYB28043.1| hypothetical protein FG05_00491 [Fusarium graminearum]
 emb|CEF72430.1| unnamed protein product [Fusarium graminearum]
Length=562

 Score =   156 bits (395),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 82/160 (51%), Positives = 105/160 (66%), Gaps = 9/160 (6%)
 Frame = +2

Query  239  EEAFEGRWIVSEKEDYKGVWKHSKSEGHEDHGLLVSEPARKYAIVKELDEVVNLKDGTVV  418
            E A+ G W V E   YKG+      +G  D GL+V  PA  +AI  +  + ++ K  T+V
Sbjct  74   EWAYVGEWAVEEPVKYKGI------DG--DKGLVVKNPAAHHAISAKFPKKIDNKGKTLV  125

Query  419  LQYEVRLQNGLECGGAYIKYLRPQDAGWVAKEFDNESPYSIMFGPDKCGATNKVHFIFKH  598
            +QYEV+LQNGLECGGAY+K LR  +     +EF N +PY IMFGPDKCG TNKVHFIF H
Sbjct  126  VQYEVKLQNGLECGGAYMKLLR-DNKALHQEEFANTTPYVIMFGPDKCGHTNKVHFIFNH  184

Query  599  KNPKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKPDNEVSI  718
            KNPK+GEY E HL+ PPS    K T +YT ++ P+N  +I
Sbjct  185  KNPKTGEYEEKHLESPPSAKITKTTELYTLIVHPNNTYAI  224



>ref|XP_009252752.1| hypothetical protein FPSE_01357 [Fusarium pseudograminearum CS3096]
 gb|EKJ78469.1| hypothetical protein FPSE_01357 [Fusarium pseudograminearum CS3096]
Length=562

 Score =   156 bits (394),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 82/160 (51%), Positives = 105/160 (66%), Gaps = 9/160 (6%)
 Frame = +2

Query  239  EEAFEGRWIVSEKEDYKGVWKHSKSEGHEDHGLLVSEPARKYAIVKELDEVVNLKDGTVV  418
            E A+ G W V E   YKG+      +G  D GL+V  PA  +AI  +  + ++ K  T+V
Sbjct  74   EWAYVGEWAVEEPVKYKGI------DG--DKGLVVKNPAAHHAISAKFPKKIDNKGKTLV  125

Query  419  LQYEVRLQNGLECGGAYIKYLRPQDAGWVAKEFDNESPYSIMFGPDKCGATNKVHFIFKH  598
            +QYEV+LQNGLECGGAY+K LR  +     +EF N +PY IMFGPDKCG TNKVHFIF H
Sbjct  126  VQYEVKLQNGLECGGAYMKLLR-DNKALHQEEFANTTPYVIMFGPDKCGHTNKVHFIFNH  184

Query  599  KNPKSGEYVEHHLKYPPSVPSDKLTHVYTAVLKPDNEVSI  718
            KNPK+GEY E HL+ PPS    K T +YT ++ P+N  +I
Sbjct  185  KNPKTGEYEEKHLESPPSAKITKTTELYTLIVHPNNTYAI  224



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1313813971470