BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF045N12

Length=278
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

sp|P07145.1|CATA_IPOBA  RecName: Full=Catalase                          135   2e-35   Ipomoea batatas [batate]
gb|ADB03784.1|  catalase                                                135   3e-35   Ipomoea batatas [batate]
gb|AAC39465.1|  catalase 3                                              113   7e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006382987.1|  hypothetical protein POPTR_0005s10340g             117   4e-29   
ref|XP_006382990.1|  hypothetical protein POPTR_0005s10340g             117   4e-29   
ref|XP_006340832.1|  PREDICTED: catalase isozyme 2                      117   4e-29   Solanum tuberosum [potatoes]
ref|XP_002306427.1|  hypothetical protein POPTR_0005s10340g             117   4e-29   Populus trichocarpa [western balsam poplar]
ref|XP_011022153.1|  PREDICTED: catalase-2-like isoform X2              117   5e-29   Populus euphratica
ref|NP_001291326.1|  catalase isozyme 1                                 117   6e-29   Sesamum indicum [beniseed]
gb|AGC65520.1|  catalase                                                117   6e-29   Eriobotrya japonica [loquat]
gb|AGE15298.2|  catalase 1                                              117   7e-29   Eriobotrya japonica [loquat]
ref|XP_004158284.1|  PREDICTED: catalase isozyme 3-like                 117   7e-29   
gb|ADM96039.1|  catalase                                                117   7e-29   Cucumis sativus [cucumbers]
ref|XP_006382986.1|  hypothetical protein POPTR_0005s10340g             117   7e-29   
ref|XP_008237987.1|  PREDICTED: catalase isozyme 1                      117   7e-29   Prunus mume [ume]
gb|AHF27433.1|  catalase                                                117   8e-29   Cucurbita maxima [Boston marrow]
gb|AIX10947.1|  putative catalase                                       117   8e-29   Gardenia jasminoides
sp|P48351.1|CATA2_CUCPE  RecName: Full=Catalase isozyme 2               117   8e-29   Cucurbita pepo
emb|CBI29557.3|  unnamed protein product                                112   8e-29   Vitis vinifera
ref|XP_010063132.1|  PREDICTED: LOW QUALITY PROTEIN: catalase iso...    117   1e-28   
ref|XP_008464839.1|  PREDICTED: catalase isozyme 3                      117   1e-28   Cucumis melo [Oriental melon]
sp|P32290.1|CATA_VIGRR  RecName: Full=Catalase                          117   1e-28   Vigna radiata var. radiata [golden gram]
gb|AHF27430.1|  catalase                                                117   1e-28   Cucurbita moschata [ayote]
gb|ADZ45555.1|  catalase                                                116   1e-28   Vigna radiata [mung bean]
gb|ADZ45556.1|  catalase                                                116   1e-28   Vigna radiata [mung bean]
gb|KCW70315.1|  hypothetical protein EUGRSUZ_F03557                     116   1e-28   Eucalyptus grandis [rose gum]
emb|CAD42908.1|  catalase                                               116   1e-28   Prunus persica
gb|ACL27272.1|  catalase                                                116   1e-28   Nicotiana benthamiana
ref|XP_007209948.1|  hypothetical protein PRUPE_ppa004776mg             116   2e-28   Prunus persica
gb|EYU36566.1|  hypothetical protein MIMGU_mgv1a005245mg                116   2e-28   Erythranthe guttata [common monkey flower]
ref|XP_004500877.1|  PREDICTED: catalase-4-like isoform X2              116   2e-28   Cicer arietinum [garbanzo]
ref|XP_009794245.1|  PREDICTED: catalase isozyme 1                      116   2e-28   Nicotiana sylvestris
emb|CCP37650.1|  catalase-1                                             115   2e-28   Nicotiana tabacum [American tobacco]
gb|EYU30275.1|  hypothetical protein MIMGU_mgv1a005250mg                115   2e-28   Erythranthe guttata [common monkey flower]
gb|AAB71764.1|  catalase 1                                              115   2e-28   Nicotiana tabacum [American tobacco]
gb|ACJ71245.1|  catalase 2                                              115   2e-28   Vigna unguiculata
ref|XP_010242895.1|  PREDICTED: catalase isozyme 1-like isoform X2      115   2e-28   Nelumbo nucifera [Indian lotus]
gb|ACJ71244.1|  catalase 2                                              115   3e-28   Vigna unguiculata
ref|XP_010242894.1|  PREDICTED: catalase isozyme 1-like isoform X1      115   3e-28   Nelumbo nucifera [Indian lotus]
ref|XP_011034872.1|  PREDICTED: catalase isozyme 1-like                 115   3e-28   Populus euphratica
ref|XP_008452957.1|  PREDICTED: catalase isozyme 1-like                 115   3e-28   Cucumis melo [Oriental melon]
dbj|BAC79443.1|  catalase                                               115   3e-28   Acacia ampliceps
ref|XP_002301920.1|  catalase family protein                            115   3e-28   Populus trichocarpa [western balsam poplar]
gb|EPS69543.1|  catalase                                                115   3e-28   Genlisea aurea
emb|CAI43948.1|  catalase                                               115   3e-28   Populus deltoides
gb|KJB17474.1|  hypothetical protein B456_003G002800                    115   3e-28   Gossypium raimondii
gb|KJB17473.1|  hypothetical protein B456_003G002800                    115   4e-28   Gossypium raimondii
gb|KHG12976.1|  Catalase isozyme 2                                      115   4e-28   Gossypium arboreum [tree cotton]
ref|XP_010094556.1|  Catalase isozyme 1                                 115   4e-28   Morus notabilis
sp|P30567.1|CATA2_GOSHI  RecName: Full=Catalase isozyme 2               115   4e-28   Gossypium hirsutum [American cotton]
sp|P48352.1|CATA3_CUCPE  RecName: Full=Catalase isozyme 3               115   4e-28   Cucurbita pepo
ref|XP_007018034.1|  Catalase 2                                         115   5e-28   
sp|O24339.1|CATA_SOLAP  RecName: Full=Catalase                          115   5e-28   Soldanella alpina
gb|ACB11496.1|  catalase                                                115   6e-28   Pinus sylvestris [Scotch pine]
gb|AJE26131.1|  catalase                                                114   6e-28   Salix matsudana [tortured willow]
ref|XP_010663966.1|  PREDICTED: catalase isozyme 1                      114   6e-28   Vitis vinifera
ref|XP_002521709.1|  catalase, putative                                 114   6e-28   Ricinus communis
gb|ADC95629.1|  catalase                                                114   7e-28   Bruguiera gymnorhiza [Burma mangrove]
ref|NP_001237571.1|  catalase-4                                         114   7e-28   Glycine max [soybeans]
ref|XP_011074092.1|  PREDICTED: catalase isozyme 3 isoform X3           114   7e-28   Sesamum indicum [beniseed]
ref|XP_010523643.1|  PREDICTED: catalase-2-like                         114   8e-28   Tarenaya hassleriana [spider flower]
ref|XP_011074091.1|  PREDICTED: catalase isozyme 3 isoform X2           114   8e-28   
ref|NP_001237556.1|  catalase-1/2                                       114   8e-28   Glycine max [soybeans]
ref|XP_009149539.1|  PREDICTED: catalase-3                              115   8e-28   Brassica rapa
gb|AHF21552.1|  catalase                                                114   8e-28   Hylocereus undatus [dragon fruit]
gb|AII23739.1|  catalase                                                114   8e-28   Zostera marina
sp|P25890.1|CATA_PEA  RecName: Full=Catalase                            114   9e-28   Pisum sativum [garden pea]
gb|AIA61608.1|  catalase                                                114   9e-28   Gynostemma pentaphyllum [jiaogulan]
gb|AFU48609.1|  catalase 1                                              114   9e-28   Nicotiana benthamiana
dbj|BAH37035.1|  catalase 1                                             114   9e-28   Pisum sativum [garden pea]
ref|XP_004300681.1|  PREDICTED: catalase isozyme 1                      114   9e-28   Fragaria vesca subsp. vesca
gb|AFD29285.1|  catalase                                                114   9e-28   Vicia faba [broad bean]
ref|NP_001289779.1|  catalase isozyme 1                                 114   1e-27   Nelumbo nucifera [Indian lotus]
gb|AET97564.1|  catalase                                                114   1e-27   Ziziphus jujuba [Chinese jujube]
ref|NP_001235974.1|  catalase-3                                         114   1e-27   Glycine max [soybeans]
gb|AAC84138.1|  catalase                                                110   1e-27   Cichorium intybus [radicchio]
gb|AIZ77475.1|  catalase                                                114   1e-27   Triticum aestivum [Canadian hard winter wheat]
emb|CDX72514.1|  BnaC07g45360D                                          114   1e-27   
sp|Q43206.1|CATA1_WHEAT  RecName: Full=Catalase-1                       114   1e-27   Triticum aestivum [Canadian hard winter wheat]
ref|NP_001240021.1|  catalase                                           114   1e-27   Glycine max [soybeans]
ref|NP_001031791.1|  catalase 2                                         113   1e-27   Arabidopsis thaliana [mouse-ear cress]
emb|CDX69111.1|  BnaC01g03420D                                          113   1e-27   
dbj|BAH19523.1|  AT4G35090                                              113   1e-27   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001234186.1|  catalase isozyme 2                                 114   1e-27   
gb|ACA50528.1|  putative catalase 2                                     114   1e-27   Brassica napus [oilseed rape]
gb|AAK96854.1|  catalase                                                114   1e-27   Arabidopsis thaliana [mouse-ear cress]
emb|CAA64220.1|  catalase                                               114   1e-27   Arabidopsis thaliana [mouse-ear cress]
gb|AFU90823.1|  catalase                                                113   1e-27   Populus x beijingensis
emb|CDP07287.1|  unnamed protein product                                113   1e-27   Coffea canephora [robusta coffee]
tpg|DAA43177.1|  TPA: catalase2                                         113   2e-27   
ref|NP_195235.1|  catalase 2                                            113   2e-27   Arabidopsis thaliana [mouse-ear cress]
gb|KJB14250.1|  hypothetical protein B456_002G115900                    113   2e-27   Gossypium raimondii
gb|KHG25152.1|  Catalase isozyme 1                                      113   2e-27   Gossypium arboreum [tree cotton]
ref|XP_006412154.1|  hypothetical protein EUTSA_v10024932mg             114   2e-27   Eutrema salsugineum [saltwater cress]
gb|ACJ11733.1|  catalase                                                113   2e-27   Gossypium hirsutum [American cotton]
gb|ACL81498.1|  catalase                                                113   2e-27   Ginkgo biloba [ginkgo]
ref|XP_002867092.1|  hypothetical protein ARALYDRAFT_491144             113   2e-27   
gb|KHG21219.1|  Catalase isozyme 1                                      113   2e-27   Gossypium arboreum [tree cotton]
gb|AAD17933.1|  catalase                                                113   2e-27   Brassica juncea [brown mustard]
ref|XP_006283612.1|  hypothetical protein CARUB_v10004668mg             113   2e-27   Capsella rubella
ref|XP_009106100.1|  PREDICTED: catalase-2                              113   2e-27   Brassica rapa
gb|ACV92695.1|  catalase                                                113   2e-27   Brassica oleracea
ref|XP_006412153.1|  hypothetical protein EUTSA_v10024932mg             113   2e-27   Eutrema salsugineum [saltwater cress]
gb|KFK30147.1|  catalase                                                113   2e-27   Arabis alpina [alpine rockcress]
ref|XP_010437527.1|  PREDICTED: catalase-2                              113   2e-27   Camelina sativa [gold-of-pleasure]
gb|AAF71742.1|AF248491_1  catalase                                      113   2e-27   Raphanus sativus
dbj|BAJ33995.1|  unnamed protein product                                113   2e-27   Eutrema halophilum
ref|XP_009138342.1|  PREDICTED: catalase-2                              113   2e-27   Brassica rapa
emb|CDY40645.1|  BnaA03g53180D                                          113   2e-27   Brassica napus [oilseed rape]
ref|XP_010432341.1|  PREDICTED: catalase-2-like                         113   2e-27   Camelina sativa [gold-of-pleasure]
gb|KEH36313.1|  catalase heme-binding enzyme                            113   2e-27   Medicago truncatula
gb|AAD17935.1|  catalase                                                113   2e-27   Brassica juncea [brown mustard]
gb|AFN81243.1|  catalase 1                                              113   2e-27   Brassica rapa subsp. pekinensis [bai cai]
ref|XP_010446982.1|  PREDICTED: catalase-2-like                         113   2e-27   Camelina sativa [gold-of-pleasure]
ref|XP_009400996.1|  PREDICTED: catalase isozyme 2                      113   2e-27   Musa acuminata subsp. malaccensis [pisang utan]
sp|Q01297.2|CATA1_RICCO  RecName: Full=Catalase isozyme 1               113   2e-27   Ricinus communis
gb|AFU90822.1|  catalase                                                113   2e-27   Populus tomentosa [Chinese white poplar]
gb|KJB57963.1|  hypothetical protein B456_009G187600                    113   2e-27   Gossypium raimondii
ref|XP_007160597.1|  hypothetical protein PHAVU_001G001000g             113   2e-27   Phaseolus vulgaris [French bean]
gb|ABM47415.1|  catalase                                                113   2e-27   Prunus avium [gean]
ref|XP_002306976.2|  catalase family protein                            113   2e-27   
tpg|DAA43178.1|  TPA: catalase2                                         113   3e-27   
ref|XP_011041225.1|  PREDICTED: catalase isozyme 1                      113   3e-27   Populus euphratica
gb|ABK24453.1|  unknown                                                 113   3e-27   Picea sitchensis
ref|XP_010530333.1|  PREDICTED: catalase-2                              113   3e-27   Tarenaya hassleriana [spider flower]
gb|KEH36312.1|  catalase heme-binding enzyme                            113   3e-27   Medicago truncatula
ref|XP_009597278.1|  PREDICTED: catalase isozyme 1                      113   3e-27   Nicotiana tomentosiformis
gb|ACL35349.1|  catalase                                                112   3e-27   Picea glauca
ref|XP_006416379.1|  hypothetical protein EUTSA_v10007795mg             112   3e-27   
ref|XP_010536468.1|  PREDICTED: catalase-3-like                         112   3e-27   Tarenaya hassleriana [spider flower]
gb|ABF93811.1|  Catalase-1, putative, expressed                         112   3e-27   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010534184.1|  PREDICTED: catalase isozyme 3-like                 112   3e-27   Tarenaya hassleriana [spider flower]
ref|XP_006306495.1|  hypothetical protein CARUB_v10012481mg             112   3e-27   Capsella rubella
ref|XP_009624788.1|  PREDICTED: catalase isozyme 3                      112   3e-27   Nicotiana tomentosiformis
ref|XP_009773579.1|  PREDICTED: catalase isozyme 3-like                 112   4e-27   Nicotiana sylvestris
ref|XP_009794469.1|  PREDICTED: catalase isozyme 3                      112   4e-27   Nicotiana sylvestris
ref|XP_009600533.1|  PREDICTED: catalase isozyme 3-like                 112   4e-27   Nicotiana tomentosiformis
ref|XP_008365915.1|  PREDICTED: catalase isozyme 1                      112   4e-27   
gb|AAZ29552.1|  catalase-C                                              112   4e-27   Oryza sativa Indica Group [Indian rice]
ref|XP_008373403.1|  PREDICTED: catalase isozyme 1                      112   4e-27   
gb|AAD50974.1|AF170272_1  catalase CAT1                                 112   4e-27   Manihot esculenta [manioc]
ref|XP_008348924.1|  PREDICTED: catalase isozyme 1                      112   4e-27   
ref|XP_006828714.1|  hypothetical protein AMTR_s00001p00022550          112   4e-27   Amborella trichopoda
gb|AAR84577.1|  catalase 1b                                             112   4e-27   Lotus japonicus
emb|CAG23920.1|  catalase                                               112   4e-27   Festuca arundinacea [tall fescue]
emb|CDY29519.1|  BnaA06g14510D                                          112   4e-27   Brassica napus [oilseed rape]
gb|ABV55108.1|  catalase 2                                              112   4e-27   Musa acuminata AAA Group [Cavendish banana]
dbj|BAJ90861.1|  predicted protein                                      112   4e-27   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009398521.1|  PREDICTED: catalase isozyme A                      112   4e-27   Musa acuminata subsp. malaccensis [pisang utan]
gb|KFK44175.1|  hypothetical protein AALP_AA1G224300                    112   4e-27   Arabis alpina [alpine rockcress]
ref|XP_007046520.1|  Catalase 2                                         112   5e-27   Theobroma cacao [chocolate]
gb|AAR84578.1|  catalase 1a                                             112   5e-27   Lotus japonicus
sp|P49317.1|CATA3_NICPL  RecName: Full=Catalase isozyme 3               112   5e-27   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|NP_973873.1|  catalase 3                                            111   5e-27   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006649332.1|  PREDICTED: catalase-1-like                         112   5e-27   Oryza brachyantha
ref|XP_006828715.1|  hypothetical protein AMTR_s00001p00024160          112   5e-27   Amborella trichopoda
ref|XP_008452956.1|  PREDICTED: catalase isozyme 1                      112   5e-27   Cucumis melo [Oriental melon]
dbj|BAA34205.1|  catalase                                               112   5e-27   Oryza sativa Japonica Group [Japonica rice]
gb|AAD17936.1|  catalase                                                112   5e-27   Brassica juncea [brown mustard]
gb|KDP43757.1|  hypothetical protein JCGZ_22384                         112   5e-27   Jatropha curcas
ref|NP_001048861.1|  Os03g0131200                                       112   5e-27   
gb|KGN55499.1|  hypothetical protein Csa_4G658590                       112   5e-27   Cucumis sativus [cucumbers]
gb|AAD30291.2|AF139538_1  catalase 2                                    112   5e-27   Raphanus sativus
gb|AAD30292.1|AF139539_1  catalase 3                                    112   6e-27   Raphanus sativus
ref|XP_006306503.1|  hypothetical protein CARUB_v10012491mg             108   6e-27   
gb|AAF61734.1|AF243519_1  catalase 4                                    112   6e-27   Helianthus annuus
ref|XP_009110221.1|  PREDICTED: catalase-3                              112   6e-27   Brassica rapa
ref|XP_003631925.1|  PREDICTED: catalase isozyme 1-like                 112   6e-27   Vitis vinifera
ref|NP_001268098.1|  catalase                                           112   6e-27   Vitis vinifera
emb|CDY33636.1|  BnaC08g19360D                                          112   6e-27   Brassica napus [oilseed rape]
emb|CDY31878.1|  BnaC07g15280D                                          112   6e-27   Brassica napus [oilseed rape]
ref|XP_009103334.1|  PREDICTED: catalase-3-like                         112   6e-27   Brassica rapa
ref|NP_564120.1|  catalase 3                                            112   6e-27   Arabidopsis thaliana [mouse-ear cress]
dbj|BAH56915.1|  AT1G20620                                              112   6e-27   Arabidopsis thaliana [mouse-ear cress]
gb|AAO17721.1|  catalase                                                112   6e-27   Hypericum perforatum
gb|AAM65021.1|  unknown                                                 112   6e-27   Arabidopsis thaliana [mouse-ear cress]
gb|AAC19397.1|  leaf catalase                                           112   7e-27   Mesembryanthemum crystallinum
gb|AGV54297.1|  peroxisomal catalase                                    112   7e-27   Phaseolus vulgaris [French bean]
ref|NP_001031073.1|  catalase 3                                         112   7e-27   Arabidopsis thaliana [mouse-ear cress]
emb|CDY01364.1|  BnaA07g11370D                                          112   7e-27   
ref|XP_009413057.1|  PREDICTED: catalase isozyme 2-like                 112   7e-27   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAC49807.1|  catalase 3                                              112   7e-27   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007136018.1|  hypothetical protein PHAVU_009G011100g             112   7e-27   Phaseolus vulgaris [French bean]
gb|AAB70006.1|  catalase                                                111   8e-27   Chlamydomonas reinhardtii
ref|XP_001696763.1|  catalase/peroxidase                                111   9e-27   Chlamydomonas reinhardtii
ref|XP_008789355.1|  PREDICTED: catalase isozyme 1-like                 111   9e-27   Phoenix dactylifera
emb|CDP01803.1|  unnamed protein product                                111   9e-27   Coffea canephora [robusta coffee]
ref|XP_006435363.1|  hypothetical protein CICLE_v10000951mg             111   1e-26   Citrus clementina [clementine]
gb|AAX88799.1|  catalase                                                111   1e-26   Euphorbia characias
ref|XP_006473794.1|  PREDICTED: catalase isozyme 1-like isoform X4      111   1e-26   Citrus sinensis [apfelsine]
sp|P48350.1|CATA1_CUCPE  RecName: Full=Catalase isozyme 1               111   1e-26   Cucurbita pepo
emb|CDP07288.1|  unnamed protein product                                111   1e-26   Coffea canephora [robusta coffee]
gb|AHB72694.1|  catalase                                                111   1e-26   Beta vulgaris subsp. maritima [sea beet]
ref|XP_010692546.1|  PREDICTED: catalase                                111   1e-26   Beta vulgaris subsp. vulgaris [field beet]
emb|CAA73663.1|  catalase                                               111   1e-26   Chlamydomonas reinhardtii
ref|XP_001784759.1|  predicted protein                                  110   1e-26   
gb|ADU56189.1|  catalase 1                                              106   2e-26   Jatropha curcas
ref|XP_009108682.1|  PREDICTED: catalase-2-like isoform X1              111   2e-26   Brassica rapa
ref|XP_009108684.1|  PREDICTED: catalase-2-like isoform X3              110   2e-26   
ref|XP_008348922.1|  PREDICTED: catalase isozyme 1-like                 110   2e-26   
ref|XP_009108683.1|  PREDICTED: catalase-2-like isoform X2              110   2e-26   
ref|XP_001752315.1|  predicted protein                                  110   2e-26   
ref|XP_003558892.1|  PREDICTED: catalase-1                              110   2e-26   Brachypodium distachyon [annual false brome]
gb|KCW68093.1|  hypothetical protein EUGRSUZ_F01775                     109   2e-26   Eucalyptus grandis [rose gum]
ref|XP_008382478.1|  PREDICTED: catalase isozyme 1-like                 110   2e-26   
ref|XP_006382992.1|  hypothetical protein POPTR_0005s10340g             110   2e-26   
ref|XP_010536470.1|  PREDICTED: catalase-2-like                         110   2e-26   Tarenaya hassleriana [spider flower]
ref|XP_010061172.1|  PREDICTED: catalase isozyme 3-like                 110   3e-26   Eucalyptus grandis [rose gum]
ref|XP_009392261.1|  PREDICTED: catalase isozyme A-like isoform X2      110   3e-26   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004145541.1|  PREDICTED: catalase isozyme 1-like                 112   3e-26   
ref|XP_004238430.1|  PREDICTED: catalase isozyme 3                      110   3e-26   Solanum lycopersicum
gb|AIS20825.1|  CAT                                                     110   3e-26   Pyrus x bretschneideri [bai li]
ref|XP_010918244.1|  PREDICTED: catalase isozyme 1                      110   3e-26   Elaeis guineensis
gb|ADU56199.1|  catalase                                                110   3e-26   Hevea brasiliensis [jebe]
emb|CAA45564.1|  catalase                                               110   4e-26   Arabidopsis thaliana [mouse-ear cress]
prf||1906388A  catalase                                                 110   4e-26
dbj|BAA34714.1|  catalase                                               110   4e-26   Oryza sativa [red rice]
ref|XP_010061174.1|  PREDICTED: catalase isozyme 3-like isoform X2      109   4e-26   Eucalyptus grandis [rose gum]
ref|XP_009392260.1|  PREDICTED: catalase isozyme A-like isoform X1      110   4e-26   Musa acuminata subsp. malaccensis [pisang utan]
gb|KCW68095.1|  hypothetical protein EUGRSUZ_F01777                     110   4e-26   Eucalyptus grandis [rose gum]
ref|XP_011022152.1|  PREDICTED: catalase-2-like isoform X1              110   4e-26   Populus euphratica
gb|AAG61140.2|AF332973_1  catalase 2                                    109   4e-26   Zantedeschia aethiopica [arum-lily]
gb|ACH63223.1|  catalase                                                109   4e-26   Rheum australe [Himalayan rhubarb]
sp|P45739.1|CATA_HELAN  RecName: Full=Catalase                          109   4e-26   Helianthus annuus
prf||2104177A  catalase                                                 109   4e-26
gb|AHA50082.1|  catalase                                                109   5e-26   Eleutherococcus senticosus
gb|AAF61733.1|AF243518_1  catalase 3                                    109   5e-26   Helianthus annuus
ref|XP_010061173.1|  PREDICTED: catalase isozyme 2-like isoform X1      109   5e-26   
gb|ABK24543.1|  unknown                                                 109   5e-26   Picea sitchensis
ref|XP_010061175.1|  PREDICTED: catalase-like                           109   5e-26   Eucalyptus grandis [rose gum]
emb|CAE82295.1|  catalase                                               109   6e-26   Homogyne alpina
gb|KGN55500.1|  hypothetical protein Csa_4G658600                       108   6e-26   Cucumis sativus [cucumbers]
ref|XP_006342134.1|  PREDICTED: catalase isozyme 3-like                 109   6e-26   Solanum tuberosum [potatoes]
ref|XP_010498496.1|  PREDICTED: catalase-3                              109   7e-26   Camelina sativa [gold-of-pleasure]
gb|AAF61732.1|AF243517_1  catalase 2                                    109   7e-26   Helianthus annuus
ref|XP_008802866.1|  PREDICTED: catalase isozyme 1                      108   8e-26   Phoenix dactylifera
sp|P17598.2|CATA1_GOSHI  RecName: Full=Catalase isozyme 1               108   8e-26   Gossypium hirsutum [American cotton]
ref|XP_007210576.1|  hypothetical protein PRUPE_ppa004763mg             108   8e-26   Prunus persica
ref|XP_008237989.1|  PREDICTED: catalase isozyme 1-like                 108   8e-26   Prunus mume [ume]
ref|XP_002963086.1|  hypothetical protein SELMODRAFT_438313             108   8e-26   
emb|CAD42909.1|  catalase                                               108   9e-26   Prunus persica
ref|XP_002980247.1|  hypothetical protein SELMODRAFT_178171             108   9e-26   Selaginella moellendorffii
ref|XP_010934843.1|  PREDICTED: catalase isozyme 2                      108   9e-26   
gb|AAF19965.1|AF207906_1  catalase 1                                    108   9e-26   Zantedeschia aethiopica [arum-lily]
ref|XP_002950455.1|  catalase                                           108   1e-25   Volvox carteri f. nagariensis
ref|XP_004500876.1|  PREDICTED: catalase-4-like isoform X1              108   1e-25   
gb|KFK44176.1|  hypothetical protein AALP_AA1G224400                    108   1e-25   Arabis alpina [alpine rockcress]
ref|XP_008791900.1|  PREDICTED: catalase isozyme 2                      108   1e-25   Phoenix dactylifera
gb|ADQ28492.1|  catalase                                                108   1e-25   Aeluropus littoralis
ref|XP_008812256.1|  PREDICTED: catalase isozyme B                      108   1e-25   Phoenix dactylifera
ref|XP_001779509.1|  predicted protein                                  108   1e-25   
gb|ABY21704.1|  catalase-1 precursor                                    108   1e-25   Panax ginseng [Asiatic ginseng]
ref|XP_006416378.1|  hypothetical protein EUTSA_v10007472mg             108   2e-25   Eutrema salsugineum [saltwater cress]
emb|CDY31490.1|  BnaC05g15990D                                          108   2e-25   Brassica napus [oilseed rape]
emb|CDY29518.1|  BnaA06g14520D                                          108   2e-25   Brassica napus [oilseed rape]
ref|XP_009149540.1|  PREDICTED: catalase-1                              107   2e-25   Brassica rapa
gb|ABK24449.1|  unknown                                                 107   2e-25   Picea sitchensis
ref|XP_010941422.1|  PREDICTED: catalase isozyme B                      107   2e-25   Elaeis guineensis
gb|AAB62892.1|  catalase-1                                              107   2e-25   Nicotiana glutinosa
ref|XP_010907090.1|  PREDICTED: catalase isozyme 1-like                 107   3e-25   Elaeis guineensis
sp|P18123.2|CATA3_MAIZE  RecName: Full=Catalase isozyme 3               107   3e-25   Zea mays [maize]
gb|AAK67359.2|AF390210_1  catalase                                      107   3e-25   Suaeda salsa
gb|AFR53082.1|  CAT                                                     107   3e-25   Anthurium andraeanum [flamingo-lily]
ref|XP_009362858.1|  PREDICTED: catalase-4-like                         102   4e-25   
gb|AAB86582.2|  catalase                                                107   4e-25   Raphanus sativus
gb|AAC17731.1|  catalase 1                                              107   4e-25   Arabidopsis thaliana [mouse-ear cress]
gb|AAB07026.1|  catalase 1                                              107   4e-25   Arabidopsis thaliana [mouse-ear cress]
ref|NP_564121.1|  catalase 1                                            107   4e-25   Arabidopsis thaliana [mouse-ear cress]
gb|AIP93616.1|  CAT1                                                    107   5e-25   Bassia scoparia [burning bush]
gb|ACJ22771.1|  catalase 1                                              106   5e-25   Jatropha curcas
gb|AIU99480.1|  catalase                                                106   6e-25   Saccharum spontaneum [fodder cane]
gb|AIU99481.1|  catalase                                                106   6e-25   Saccharum spontaneum [fodder cane]
ref|XP_003573241.1|  PREDICTED: catalase isozyme 2                      106   6e-25   Brachypodium distachyon [annual false brome]
gb|AIU99479.1|  catalase                                                106   7e-25   Saccharum arundinaceum
ref|NP_001058635.1|  Os06g0727200                                       106   7e-25   
ref|XP_006646781.1|  PREDICTED: LOW QUALITY PROTEIN: catalase iso...    106   7e-25   Oryza brachyantha
ref|NP_001241808.1|  catalase isozyme B                                 106   7e-25   Zea mays [maize]
sp|P18122.1|CATA1_MAIZE  RecName: Full=Catalase isozyme 1               106   7e-25   Zea mays [maize]
gb|AIU99487.1|  catalase                                                106   7e-25   Saccharum hybrid cultivar ROC22
dbj|BAA34204.1|  catalase                                               106   7e-25   
sp|A2YH64.2|CATA2_ORYSI  RecName: Full=Catalase isozyme B; Short=...    106   7e-25   
ref|XP_002437631.1|  hypothetical protein SORBIDRAFT_10g030840          106   7e-25   
emb|CAA42720.1|  catalase-1                                             106   7e-25   
emb|CDX76313.1|  BnaA08g10870D                                          106   7e-25   
gb|AIU99488.1|  catalase                                                106   7e-25   
emb|CDY17510.1|  BnaC03g65530D                                          106   7e-25   
gb|AAY59707.1|  catalase                                                106   7e-25   
gb|AHZ13843.1|  catalase                                                106   7e-25   
ref|XP_006656514.1|  PREDICTED: catalase isozyme B-like                 106   7e-25   
gb|AFW66787.1|  catalase3                                               106   7e-25   
gb|AAA33441.1|  catalase isozyme 3 (EC 1.11.1.6)                        106   8e-25   
ref|NP_001105415.1|  catalase isozyme 1                                 106   8e-25   
emb|CAA43814.1|  catalase                                               106   8e-25   
pir||CSRZ  catalase (EC 1.11.1.6) catA - rice                           106   8e-25
ref|NP_001045673.1|  Os02g0115700                                       106   9e-25   
gb|ABN71233.2|  catalase                                                106   9e-25   
ref|XP_005645077.1|  catalase                                           106   9e-25   
ref|NP_001105416.1|  catalase isozyme 3                                 106   9e-25   
gb|AGT16310.1|  catalase                                                105   1e-24   
ref|XP_002961779.1|  hypothetical protein SELMODRAFT_140901             105   1e-24   
gb|AFW66788.1|  catalase3                                               105   1e-24   
emb|CDY52649.1|  BnaAnng11640D                                          105   1e-24   
gb|AAM97542.1|  catalase 3                                              105   1e-24   
ref|XP_004985840.1|  PREDICTED: catalase-1-like                         105   2e-24   
gb|AIM43584.1|  catalase                                                105   2e-24   
emb|CDY01363.1|  BnaA07g11360D                                          105   2e-24   
gb|AIU99486.1|  catalase                                                105   2e-24   
sp|P49316.1|CATA2_NICPL  RecName: Full=Catalase isozyme 2               105   2e-24   
ref|XP_009103333.1|  PREDICTED: catalase-1                              105   2e-24   
emb|CDY31877.1|  BnaC07g15270D                                          105   2e-24   
gb|AAC19398.1|  root catalase                                           105   2e-24   
sp|P12365.3|CATA2_MAIZE  RecName: Full=Catalase isozyme 2               105   2e-24   
gb|ADU56198.1|  catalase                                                105   2e-24   
prf||1803522A  catalase                                                 105   2e-24
ref|XP_008778560.1|  PREDICTED: catalase isozyme 2-like                 105   2e-24   
ref|XP_010692544.1|  PREDICTED: catalase-like                           105   2e-24   
emb|CAH61266.1|  catalase                                               105   3e-24   
ref|XP_004952158.1|  PREDICTED: catalase isozyme 3-like isoform X2      105   3e-24   
ref|XP_004952157.1|  PREDICTED: catalase isozyme 3-like isoform X1      105   3e-24   
dbj|BAJ92414.1|  predicted protein                                      105   3e-24   
gb|ADY02963.1|  catalase                                                105   3e-24   
ref|XP_002510677.1|  catalase, putative                                 106   3e-24   
ref|XP_004966515.1|  PREDICTED: catalase isozyme 1-like                 105   3e-24   
sp|P55312.1|CATA2_SOLTU  RecName: Full=Catalase isozyme 2               104   3e-24   
ref|NP_001274863.1|  catalase isozyme 1                                 104   3e-24   
gb|ABC01913.1|  catalase isozyme 1-like protein                         104   4e-24   
ref|NP_001234827.1|  catalase isozyme 1                                 104   4e-24   
sp|P55311.1|CATA_SOLME  RecName: Full=Catalase                          104   4e-24   
ref|XP_003563243.1|  PREDICTED: catalase isozyme 1                      104   4e-24   
sp|P49284.1|CATA1_SOLTU  RecName: Full=Catalase isozyme 1               104   4e-24   
ref|XP_011074090.1|  PREDICTED: catalase isoform X1                     104   4e-24   
ref|NP_001105310.1|  catalase isozyme 2                                 104   4e-24   
gb|AFW66785.1|  catalase3 isoform 1                                     105   5e-24   
gb|ABB72796.1|  catalase isozyme 1-like protein                         104   5e-24   
sp|P55313.1|CATA2_WHEAT  RecName: Full=Catalase                         104   5e-24   
dbj|BAJ88747.1|  predicted protein                                      104   5e-24   
sp|P55308.1|CATA2_HORVU  RecName: Full=Catalase isozyme 2               104   5e-24   
pir||S40265  catalase (EC 1.11.1.6) - eggplant                          104   5e-24
emb|CDY31488.1|  BnaC05g15970D                                          104   5e-24   
ref|XP_006473791.1|  PREDICTED: catalase isozyme 1-like isoform X1      104   6e-24   
gb|ABB51561.1|  truncated catalase 2                                    103   7e-24   
sp|P55307.1|CATA1_HORVU  RecName: Full=Catalase isozyme 1               103   7e-24   
dbj|BAA05494.1|  catalase                                               103   8e-24   
sp|P49318.1|CATA2_RICCO  RecName: Full=Catalase isozyme 2               103   8e-24   
gb|AIU99485.1|  catalase                                                103   8e-24   
sp|Q9M5L6.1|CATA_CAPAN  RecName: Full=Catalase; AltName: Full=CaCat1    103   1e-23   
sp|Q9AXH0.1|CATA_AVIMR  RecName: Full=Catalase                          103   1e-23   
dbj|BAF91369.1|  catalase                                               103   1e-23   
sp|P49315.1|CATA1_NICPL  RecName: Full=Catalase isozyme 1               103   1e-23   
ref|XP_011396830.1|  Catalase isozyme 2                                 103   1e-23   
ref|XP_006435362.1|  hypothetical protein CICLE_v10000948mg             102   1e-23   
gb|ACJ76836.3|  catalase                                                103   1e-23   
gb|AAF79625.1|AC027665_26  F5M15.5                                      104   1e-23   
gb|AIU99482.1|  catalase                                                102   1e-23   
gb|AAR97905.1|  catalase                                                102   2e-23   
gb|AAM97541.1|  catalase 2                                              102   2e-23   
gb|EMS61345.1|  Catalase isozyme 1                                      103   2e-23   
gb|AIU99483.1|  catalase                                                102   2e-23   
emb|CAA85470.1|  catalase                                               102   2e-23   
ref|XP_006435361.1|  hypothetical protein CICLE_v10000948mg             102   2e-23   
gb|AAG43363.1|AF151368_1  catalase                                      102   2e-23   
sp|P49319.2|CATA1_TOBAC  RecName: Full=Catalase isozyme 1; AltNam...    102   3e-23   
gb|ABK41476.1|  catalase                                                102   3e-23   
ref|XP_009792372.1|  PREDICTED: catalase isozyme 1                      102   4e-23   
ref|XP_009590727.1|  PREDICTED: catalase isozyme 1                      102   4e-23   
gb|AGI65617.1|  catalase                                                101   5e-23   
ref|XP_005708279.1|  catalase                                           101   6e-23   
gb|AIU99484.1|  catalase                                                101   7e-23   
gb|ADN94253.1|  catalase                                                101   7e-23   
ref|XP_010459749.1|  PREDICTED: catalase-1-like                         100   8e-23   
ref|XP_010498497.1|  PREDICTED: catalase-1-like                         100   9e-23   
ref|XP_010477308.1|  PREDICTED: catalase-1                              100   9e-23   
ref|XP_002890395.1|  F5M15.5                                            102   1e-22   
gb|AAP80622.1|AF475100_1  catalase isozyme                            97.8    2e-22   
gb|AEB22071.1|  catalase 2                                            95.1    3e-22   
gb|EMS51034.1|  Catalase isozyme 2                                    99.4    4e-22   
gb|AAC48918.1|  salicylic acid binding catalase                       98.6    6e-22   
gb|EAZ21490.1|  hypothetical protein OsJ_05114                        98.6    7e-22   
ref|XP_005847557.1|  hypothetical protein CHLNCDRAFT_57817            98.2    7e-22   
gb|AJF34884.1|  catalase                                              97.4    2e-21   
gb|AGT16188.1|  catalase                                              97.1    2e-21   
gb|AGT16054.1|  catalase                                              97.1    2e-21   
gb|AGT15888.1|  catalase                                              97.1    2e-21   
gb|EMT06167.1|  Catalase isozyme 2                                    97.8    3e-21   
gb|AGT16203.1|  catalase                                              96.7    3e-21   
gb|ABB88582.1|  catalase                                              96.7    3e-21   
gb|AEQ30070.1|  catalase                                              95.1    1e-20   
gb|EMT05040.1|  Catalase-1                                            94.4    2e-20   
gb|KDD77132.1|  catalase                                              94.4    3e-20   
ref|XP_004144240.1|  PREDICTED: catalase isozyme 3-like               93.6    4e-20   
ref|XP_005536240.1|  catalase                                         90.1    8e-19   
sp|P55310.1|CATA_SECCE  RecName: Full=Catalase                        89.7    1e-18   
dbj|BAQ21275.1|  catalase                                             86.3    1e-17   
gb|AAR14052.2|  catalase                                              85.9    2e-17   
ref|XP_006473789.1|  PREDICTED: catalase-like isoform X1              85.1    4e-17   
gb|KDO85095.1|  hypothetical protein CISIN_1g044386mg                 85.1    6e-17   
ref|WP_010296013.1|  catalase                                         75.1    2e-15   
ref|XP_005644653.1|  catalase-domain-containing protein               80.9    2e-15   
ref|XP_005647994.1|  catalase-domain-containing protein               80.1    3e-15   
ref|XP_005712277.1|  unnamed protein product                          79.3    5e-15   
gb|AIM05077.1|  catalase                                              75.1    1e-14   
ref|WP_006679508.1|  catalase                                         77.4    2e-14   
ref|XP_005642928.1|  catalase                                         76.6    5e-14   
dbj|GAK05364.1|  catalase                                             72.4    7e-14   
ref|WP_026798903.1|  catalase                                         76.3    7e-14   
ref|WP_016090862.1|  catalase                                         72.8    9e-14   
dbj|GAE06714.1|  catalase                                             73.6    1e-13   
ref|WP_028402967.1|  catalase                                         75.5    1e-13   
ref|WP_017674668.1|  catalase                                         75.1    2e-13   
ref|WP_035435964.1|  catalase                                         74.7    2e-13   
dbj|GAK43869.1|  catalase                                             74.7    2e-13   
ref|WP_001069181.1|  MULTISPECIES: catalase                           74.7    3e-13   
ref|WP_025967010.1|  catalase                                         74.3    3e-13   
ref|WP_030023914.1|  catalase                                         74.3    3e-13   
ref|WP_002134937.1|  catalase                                         74.3    3e-13   
ref|WP_002149880.1|  catalase                                         74.3    3e-13   
ref|WP_002201400.1|  catalase                                         74.3    3e-13   
ref|WP_001069185.1|  catalase                                         74.3    3e-13   
ref|WP_023521416.1|  catalase                                         74.3    3e-13   
ref|WP_016109536.1|  catalase                                         74.3    3e-13   
ref|WP_001069184.1|  MULTISPECIES: catalase                           74.3    3e-13   
ref|WP_001069183.1|  catalase                                         74.3    3e-13   
ref|WP_001069180.1|  MULTISPECIES: catalase                           74.3    3e-13   
ref|WP_001069168.1|  catalase                                         74.3    3e-13   
ref|WP_038413367.1|  catalase                                         74.3    3e-13   
ref|WP_016122096.1|  catalase                                         74.3    3e-13   
ref|WP_016093086.1|  catalase                                         74.3    3e-13   
ref|WP_001069151.1|  catalase                                         74.3    3e-13   
ref|WP_017152869.1|  catalase                                         74.3    3e-13   
ref|WP_001069189.1|  catalase                                         74.3    3e-13   
ref|WP_002011249.1|  catalase                                         74.3    3e-13   
ref|WP_033673856.1|  catalase                                         74.3    3e-13   
ref|WP_043936623.1|  MULTISPECIES: catalase                           74.3    3e-13   
ref|WP_016101561.1|  catalase                                         74.3    3e-13   
ref|WP_001069192.1|  catalase                                         74.3    3e-13   
ref|WP_001069161.1|  catalase                                         74.3    3e-13   
ref|WP_001069175.1|  catalase                                         74.3    3e-13   
ref|WP_001069178.1|  catalase                                         74.3    3e-13   
ref|WP_002140813.1|  MULTISPECIES: catalase                           74.3    3e-13   
ref|WP_044437756.1|  catalase                                         74.3    3e-13   
ref|WP_001069186.1|  catalase                                         74.3    3e-13   
ref|WP_002188737.1|  catalase                                         74.3    3e-13   
ref|WP_044792704.1|  catalase                                         74.3    3e-13   
ref|WP_001069177.1|  MULTISPECIES: catalase                           74.3    3e-13   
ref|WP_017673056.1|  catalase                                         74.3    3e-13   
ref|WP_016113754.1|  catalase                                         74.3    3e-13   
ref|WP_016119811.1|  catalase                                         74.3    3e-13   
ref|WP_002202803.1|  catalase                                         74.3    3e-13   
ref|WP_001069163.1|  catalase                                         74.3    3e-13   
ref|WP_001069162.1|  catalase                                         74.3    3e-13   
ref|WP_001069173.1|  catalase                                         74.3    3e-13   
ref|WP_002158904.1|  catalase                                         74.3    3e-13   
ref|WP_001069164.1|  catalase                                         74.3    3e-13   
ref|WP_001069176.1|  MULTISPECIES: catalase                           74.3    3e-13   
ref|WP_002064215.1|  catalase                                         74.3    3e-13   
ref|WP_001069179.1|  MULTISPECIES: catalase                           74.3    3e-13   
ref|WP_001069172.1|  catalase                                         74.3    3e-13   
ref|WP_001069193.1|  catalase                                         74.3    3e-13   
ref|WP_001069182.1|  MULTISPECIES: catalase                           74.3    3e-13   
ref|WP_044306649.1|  catalase                                         74.3    3e-13   
ref|WP_001069155.1|  catalase                                         74.3    3e-13   
ref|WP_016104158.1|  catalase                                         74.3    3e-13   
ref|WP_001069152.1|  catalase                                         74.3    3e-13   
ref|WP_001069165.1|  catalase                                         74.3    3e-13   
ref|WP_002030287.1|  MULTISPECIES: catalase                           74.3    3e-13   
ref|WP_001069153.1|  catalase                                         74.3    3e-13   
ref|WP_029437825.1|  catalase                                         74.3    3e-13   
ref|WP_001069157.1|  MULTISPECIES: catalase                           74.3    3e-13   
ref|WP_001069190.1|  catalase                                         74.3    3e-13   
ref|WP_002087018.1|  catalase                                         74.3    3e-13   
ref|WP_001069159.1|  catalase                                         74.3    3e-13   
ref|WP_001069154.1|  MULTISPECIES: catalase                           74.3    3e-13   
ref|WP_001069156.1|  catalase                                         74.3    3e-13   
ref|WP_001069166.1|  MULTISPECIES: catalase                           74.3    3e-13   
ref|WP_001069158.1|  MULTISPECIES: catalase                           74.3    3e-13   
ref|WP_018763991.1|  catalase                                         73.9    4e-13   
ref|WP_002168907.1|  catalase                                         73.9    4e-13   
ref|WP_000184218.1|  catalase                                         73.9    4e-13   
ref|WP_033798420.1|  catalase                                         73.9    4e-13   
ref|WP_002194469.1|  catalase                                         73.9    4e-13   
ref|WP_016082491.1|  MULTISPECIES: catalase                           73.9    4e-13   
ref|WP_001069171.1|  catalase                                         73.9    4e-13   
ref|WP_001069174.1|  catalase                                         73.9    4e-13   
ref|WP_002186432.1|  MULTISPECIES: catalase                           73.9    4e-13   
ref|WP_002170801.1|  MULTISPECIES: catalase                           73.9    4e-13   
ref|WP_001069167.1|  catalase                                         73.9    4e-13   
ref|WP_001069170.1|  catalase                                         73.9    4e-13   
ref|WP_006093931.1|  MULTISPECIES: catalase                           73.9    4e-13   
ref|WP_003195883.1|  catalase                                         73.9    4e-13   
ref|WP_002125906.1|  MULTISPECIES: catalase                           73.9    4e-13   
ref|WP_001069191.1|  catalase                                         73.9    4e-13   
ref|WP_001069169.1|  MULTISPECIES: catalase                           73.9    4e-13   
ref|WP_001069160.1|  catalase                                         73.9    4e-13   
ref|WP_044741157.1|  catalase                                         73.9    4e-13   
ref|WP_037688679.1|  catalase                                         73.9    4e-13   
gb|AAS40190.1|  catalase                                              73.9    4e-13   
ref|WP_001069188.1|  catalase                                         73.9    4e-13   
ref|WP_000184219.1|  catalase                                         73.9    4e-13   
gb|AHJ65563.1|  Catalase                                              74.3    4e-13   
ref|WP_028608353.1|  catalase                                         73.9    4e-13   



>sp|P07145.1|CATA_IPOBA RecName: Full=Catalase [Ipomoea batatas]
 emb|CAA29063.1| unnamed protein product [Ipomoea batatas]
Length=492

 Score =   135 bits (340),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 63/66 (95%), Positives = 63/66 (95%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDPSKYRPSSSFNTPFCTTN GAPVWNNTCALTVGSRGPILLEDYHLVEKI NFTRERIP
Sbjct  1    MDPSKYRPSSSFNTPFCTTNSGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>gb|ADB03784.1| catalase [Ipomoea batatas]
Length=492

 Score =   135 bits (339),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 62/66 (94%), Positives = 63/66 (95%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDPSKYRPSSSFNTPFCTTN GAPVWNNTCALTVGSRGPILLEDYHL+EKI NFTRERIP
Sbjct  1    MDPSKYRPSSSFNTPFCTTNSGAPVWNNTCALTVGSRGPILLEDYHLIEKIQNFTRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>gb|AAC39465.1| catalase 3 [Arabidopsis thaliana]
Length=115

 Score =   113 bits (283),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 50/66 (76%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP KYRPSS++N PF TTNGGAPV NN  +LT+G RGP+LLEDYHL+EK+ NFTRERIP
Sbjct  1    MDPYKYRPSSAYNAPFYTTNGGAPVSNNISSLTIGERGPVLLEDYHLIEKVANFTRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>ref|XP_006382987.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 ref|XP_006382988.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 ref|XP_006382989.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60784.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60785.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60786.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
Length=434

 Score =   117 bits (294),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 54/66 (82%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP KYRPSSS+N+PF TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSSYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>ref|XP_006382990.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 ref|XP_006382991.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60787.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60788.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
Length=455

 Score =   117 bits (294),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 54/66 (82%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP KYRPSSS+N+PF TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSSYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>ref|XP_006340832.1| PREDICTED: catalase isozyme 2 [Solanum tuberosum]
Length=492

 Score =   117 bits (294),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 52/66 (79%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP KYRPSS+FN+PFCTTN GAPVWNN  +LTVG+RGP+LLEDYHLVEK+ NF RERI 
Sbjct  1    MDPYKYRPSSAFNSPFCTTNSGAPVWNNNSSLTVGARGPVLLEDYHLVEKLANFDRERIA  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>ref|XP_002306427.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 ref|XP_006382993.1| catalase family protein [Populus trichocarpa]
 emb|CAI43950.1| catalase [Populus deltoides]
 gb|EEE93423.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60790.1| catalase family protein [Populus trichocarpa]
Length=492

 Score =   117 bits (294),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 54/66 (82%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP KYRPSSS+N+PF TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSSYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>ref|XP_011022153.1| PREDICTED: catalase-2-like isoform X2 [Populus euphratica]
Length=492

 Score =   117 bits (294),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 54/66 (82%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP KYRPSSS+N+PF TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSSYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>ref|NP_001291326.1| catalase isozyme 1 [Sesamum indicum]
 gb|AFJ42575.1| catalase [Sesamum indicum]
Length=492

 Score =   117 bits (294),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 54/66 (82%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP KYRPSS+FN+PF TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAFNSPFMTTNSGAPVWNNNNSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>gb|AGC65520.1| catalase [Eriobotrya japonica]
 gb|AGC65522.1| catalase [Eriobotrya japonica]
 gb|AGC65523.1| catalase [Eriobotrya japonica]
 gb|AGC65524.1| catalase [Eriobotrya japonica]
 gb|AGE15297.2| catalase 2 [Eriobotrya japonica]
Length=492

 Score =   117 bits (293),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 52/66 (79%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP KYRPSS+FN+PF TTN GAPVWNN  +LTVGSRGP+LLEDYHL+EK+ NF RERIP
Sbjct  1    MDPYKYRPSSAFNSPFWTTNAGAPVWNNNSSLTVGSRGPVLLEDYHLIEKLANFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>gb|AGE15298.2| catalase 1 [Eriobotrya japonica]
Length=492

 Score =   117 bits (293),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 52/66 (79%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP KYRPSS+FN+PF TTN GAPVWNN  +LTVGSRGP+LLEDYHL+EK+ NF RERIP
Sbjct  1    MDPYKYRPSSAFNSPFWTTNAGAPVWNNNSSLTVGSRGPVLLEDYHLIEKLANFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>ref|XP_004158284.1| PREDICTED: catalase isozyme 3-like [Cucumis sativus]
 gb|KGN47533.1| Catalase isozyme 3 [Cucumis sativus]
Length=492

 Score =   117 bits (293),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 52/66 (79%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP KYRPSS++NTPFCTTN GAPVWNNT  ++VG RGPILLEDY L+EKI  FTRERIP
Sbjct  1    MDPYKYRPSSAYNTPFCTTNSGAPVWNNTAVMSVGERGPILLEDYQLIEKIATFTRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>gb|ADM96039.1| catalase [Cucumis sativus]
Length=492

 Score =   117 bits (293),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 52/66 (79%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP KYRPSS++NTPFCTTN GAPVWNNT  ++VG RGPILLEDY L+EKI  FTRERIP
Sbjct  1    MDPYKYRPSSAYNTPFCTTNSGAPVWNNTAVMSVGERGPILLEDYQLIEKIATFTRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>ref|XP_006382986.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60783.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
Length=519

 Score =   117 bits (294),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 54/66 (82%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP KYRPSSS+N+PF TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSSYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>ref|XP_008237987.1| PREDICTED: catalase isozyme 1 [Prunus mume]
Length=492

 Score =   117 bits (293),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 54/66 (82%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP KYRPSS+F++PF TTN GAPVWNN  +LTVGSRGPILLEDYHLVEKI NF RERIP
Sbjct  1    MDPYKYRPSSAFDSPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKIANFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>gb|AHF27433.1| catalase [Cucurbita maxima]
Length=492

 Score =   117 bits (293),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 52/66 (79%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP KYRPSS++NTPFCTTN GAPVWNNT  ++VG RGPILLEDY L+EKI  FTRERIP
Sbjct  1    MDPYKYRPSSAYNTPFCTTNSGAPVWNNTAVMSVGERGPILLEDYQLIEKIATFTRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>gb|AIX10947.1| putative catalase [Gardenia jasminoides]
Length=492

 Score =   117 bits (293),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 53/66 (80%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP K+RPSS+FNTPF TTN G PVWNN  ALTVG+RGPILLEDYHLVEK+ N+TRERIP
Sbjct  1    MDPYKFRPSSAFNTPFWTTNAGGPVWNNDSALTVGTRGPILLEDYHLVEKLANWTRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>sp|P48351.1|CATA2_CUCPE RecName: Full=Catalase isozyme 2 [Cucurbita pepo]
 dbj|BAA09507.1| catalase [Cucurbita pepo]
Length=492

 Score =   117 bits (293),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP KYRPSS++NTPFCTTN GAP+WNNT  ++VG RGPILLEDY L+EKI  FTRERIP
Sbjct  1    MDPYKYRPSSAYNTPFCTTNSGAPIWNNTAVMSVGERGPILLEDYQLIEKIATFTRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>emb|CBI29557.3| unnamed protein product [Vitis vinifera]
 emb|CBI37654.3| unnamed protein product [Vitis vinifera]
Length=160

 Score =   112 bits (280),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 50/66 (76%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP KYRPSS++N+P+ TTN GAPV+NN  +LTVGSRGP+LLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAYNSPYFTTNAGAPVYNNDSSLTVGSRGPVLLEDYHLVEKLANFQRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>ref|XP_010063132.1| PREDICTED: LOW QUALITY PROTEIN: catalase isozyme 1-like [Eucalyptus 
grandis]
Length=490

 Score =   117 bits (292),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 54/66 (82%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP KYRPSS+FNT F TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPHKYRPSSAFNTSFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>ref|XP_008464839.1| PREDICTED: catalase isozyme 3 [Cucumis melo]
 gb|ADN33988.1| catalase [Cucumis melo subsp. melo]
Length=492

 Score =   117 bits (292),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP KYRPSS++NTPFCTTN GAP+WNNT  ++VG RGPILLEDY L+EKI  FTRERIP
Sbjct  1    MDPYKYRPSSAYNTPFCTTNSGAPIWNNTAVMSVGERGPILLEDYQLIEKIATFTRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>sp|P32290.1|CATA_VIGRR RecName: Full=Catalase [Vigna radiata var. radiata]
 dbj|BAA02755.1| catalase [Vigna radiata var. radiata]
Length=492

 Score =   117 bits (292),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 53/66 (80%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP KYRPSS+FN+PF TTN GAPVWNN  +LTVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAFNSPFWTTNSGAPVWNNNNSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>gb|AHF27430.1| catalase [Cucurbita moschata]
Length=492

 Score =   117 bits (292),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP KYRPSS++NTPFCTTN GAPVWNNT  +++G RGPILLEDY L+EKI  FTRERIP
Sbjct  1    MDPYKYRPSSAYNTPFCTTNSGAPVWNNTAVMSIGERGPILLEDYQLIEKIATFTRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>gb|ADZ45555.1| catalase [Vigna radiata]
Length=492

 Score =   116 bits (291),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 53/66 (80%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP KYRPSS+FN+PF TTN GAPVWNN  +LTVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAFNSPFWTTNSGAPVWNNNNSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>gb|ADZ45556.1| catalase [Vigna radiata]
Length=492

 Score =   116 bits (291),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 53/66 (80%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP KYRPSS+FN+PF TTN GAPVWNN  +LTVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAFNSPFWTTNSGAPVWNNNNSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>gb|KCW70315.1| hypothetical protein EUGRSUZ_F03557 [Eucalyptus grandis]
Length=479

 Score =   116 bits (291),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 54/66 (82%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP KYRPSS+FNT F TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPHKYRPSSAFNTSFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>emb|CAD42908.1| catalase [Prunus persica]
Length=492

 Score =   116 bits (291),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 53/66 (80%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP KYRPSS+F++PF TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAFDSPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>gb|ACL27272.1| catalase [Nicotiana benthamiana]
Length=492

 Score =   116 bits (291),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 52/66 (79%), Positives = 59/66 (89%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP KYRPSS+FN+PFCTTN GAPV+NN  +LTVG+RGPILLEDYHLVEK+ NF RER+P
Sbjct  1    MDPYKYRPSSAFNSPFCTTNSGAPVFNNNSSLTVGARGPILLEDYHLVEKLANFDRERVP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>ref|XP_007209948.1| hypothetical protein PRUPE_ppa004776mg [Prunus persica]
 gb|EMJ11147.1| hypothetical protein PRUPE_ppa004776mg [Prunus persica]
Length=492

 Score =   116 bits (290),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 53/66 (80%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP KYRPSS+F++PF TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAFDSPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>gb|EYU36566.1| hypothetical protein MIMGU_mgv1a005245mg [Erythranthe guttata]
Length=492

 Score =   116 bits (290),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 53/66 (80%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP KYRPSS+FN+PF TTN GAPVWNN  +LTVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAFNSPFMTTNSGAPVWNNNNSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>ref|XP_004500877.1| PREDICTED: catalase-4-like isoform X2 [Cicer arietinum]
Length=492

 Score =   116 bits (290),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 53/66 (80%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP K+RPSS+FN+PF TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>ref|XP_009794245.1| PREDICTED: catalase isozyme 1 [Nicotiana sylvestris]
Length=492

 Score =   116 bits (290),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 59/66 (89%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP KYRPSS+FN+PFCTTN GAPV+NN  +LTVG+RGP+LLEDYHLVEK+ NF RER+P
Sbjct  1    MDPYKYRPSSAFNSPFCTTNSGAPVFNNNSSLTVGARGPVLLEDYHLVEKLANFDRERVP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>emb|CCP37650.1| catalase-1 [Nicotiana tabacum]
Length=492

 Score =   115 bits (289),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 59/66 (89%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP KYRPSS+FN+PFCTTN GAPV+NN  +LTVG+RGP+LLEDYHLVEK+ NF RER+P
Sbjct  1    MDPYKYRPSSAFNSPFCTTNSGAPVFNNNSSLTVGARGPVLLEDYHLVEKLANFDRERVP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>gb|EYU30275.1| hypothetical protein MIMGU_mgv1a005250mg [Erythranthe guttata]
Length=492

 Score =   115 bits (289),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 53/66 (80%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP KYRPSS+FN+PF TTN GAPVWNN  +LTVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAFNSPFMTTNSGAPVWNNNNSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>gb|AAB71764.1| catalase 1 [Nicotiana tabacum]
Length=492

 Score =   115 bits (289),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 59/66 (89%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP KYRPSS+FN+PFCTTN GAPV+NN  +LTVG+RGP+LLEDYHLVEK+ NF RER+P
Sbjct  1    MDPYKYRPSSAFNSPFCTTNSGAPVFNNNSSLTVGARGPVLLEDYHLVEKLANFDRERVP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>gb|ACJ71245.1| catalase 2, partial [Vigna unguiculata]
Length=394

 Score =   115 bits (287),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 52/66 (79%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP K+RPSS+FN+PF TTN GAPVWNN  +LTVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>ref|XP_010242895.1| PREDICTED: catalase isozyme 1-like isoform X2 [Nelumbo nucifera]
Length=433

 Score =   115 bits (288),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 52/66 (79%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP KYRPSS+FN+PF +TN GAPVWNN  +LTVG+RGPI+LEDYHLVEKI NF RERIP
Sbjct  1    MDPYKYRPSSAFNSPFWSTNSGAPVWNNNSSLTVGTRGPIMLEDYHLVEKIANFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>gb|ACJ71244.1| catalase 2, partial [Vigna unguiculata]
Length=394

 Score =   115 bits (287),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 52/66 (79%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP K+RPSS+FN+PF TTN GAPVWNN  +LTVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>ref|XP_010242894.1| PREDICTED: catalase isozyme 1-like isoform X1 [Nelumbo nucifera]
Length=492

 Score =   115 bits (289),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 52/66 (79%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP KYRPSS+FN+PF +TN GAPVWNN  +LTVG+RGPI+LEDYHLVEKI NF RERIP
Sbjct  1    MDPYKYRPSSAFNSPFWSTNSGAPVWNNNSSLTVGTRGPIMLEDYHLVEKIANFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>ref|XP_011034872.1| PREDICTED: catalase isozyme 1-like [Populus euphratica]
Length=492

 Score =   115 bits (289),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 53/66 (80%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP KYRPSS+F+TP+ TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAFSTPYWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>ref|XP_008452957.1| PREDICTED: catalase isozyme 1-like [Cucumis melo]
Length=492

 Score =   115 bits (289),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 53/66 (80%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP K RPSS++NTPF TTN GAPVWNN  ALT+GSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKQRPSSAYNTPFWTTNSGAPVWNNNSALTIGSRGPILLEDYHLVEKLANFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>dbj|BAC79443.1| catalase [Acacia ampliceps]
Length=492

 Score =   115 bits (289),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 54/66 (82%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP KYRPSS+FNTPF TTN G PV+NN  ALT+GSRGPILLEDYHLVEKI NFTRER P
Sbjct  1    MDPYKYRPSSTFNTPFWTTNSGTPVYNNDSALTIGSRGPILLEDYHLVEKIANFTRERTP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>ref|XP_002301920.1| catalase family protein [Populus trichocarpa]
 gb|ABK96479.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|EEE81193.1| catalase family protein [Populus trichocarpa]
Length=492

 Score =   115 bits (289),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 53/66 (80%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP KYRPSS+F TP+ TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAFGTPYWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>gb|EPS69543.1| catalase [Genlisea aurea]
Length=492

 Score =   115 bits (288),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 52/66 (79%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP KYRPSS++N+PF TTN GAPVWNN  +LTVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAYNSPFWTTNSGAPVWNNNHSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>emb|CAI43948.1| catalase [Populus deltoides]
 gb|ABK96317.1| unknown [Populus trichocarpa x Populus deltoides]
Length=492

 Score =   115 bits (288),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 53/66 (80%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP KYRPSS+F TP+ TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAFGTPYWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>gb|KJB17474.1| hypothetical protein B456_003G002800 [Gossypium raimondii]
Length=451

 Score =   115 bits (287),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 52/66 (79%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP K+RPSSSF++PF TTN GAPVWNN  +LTVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKFRPSSSFDSPFWTTNSGAPVWNNNSSLTVGARGPILLEDYHLVEKLANFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>gb|KJB17473.1| hypothetical protein B456_003G002800 [Gossypium raimondii]
Length=492

 Score =   115 bits (288),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 52/66 (79%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP K+RPSSSF++PF TTN GAPVWNN  +LTVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKFRPSSSFDSPFWTTNSGAPVWNNNSSLTVGARGPILLEDYHLVEKLANFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>gb|KHG12976.1| Catalase isozyme 2 [Gossypium arboreum]
Length=492

 Score =   115 bits (288),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 52/66 (79%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP K+RPSSSF++PF TTN GAPVWNN  +LTVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKFRPSSSFDSPFWTTNSGAPVWNNNSSLTVGARGPILLEDYHLVEKLANFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>ref|XP_010094556.1| Catalase isozyme 1 [Morus notabilis]
 gb|EXB56310.1| Catalase isozyme 1 [Morus notabilis]
Length=492

 Score =   115 bits (288),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 52/66 (79%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP KYRPSS++N+PF TTN GAPVWNN  +LTVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAYNSPFFTTNSGAPVWNNNSSLTVGQRGPILLEDYHLVEKLANFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>sp|P30567.1|CATA2_GOSHI RecName: Full=Catalase isozyme 2 [Gossypium hirsutum]
 emb|CAA39998.1| subunit 2 of cotton catalase [Gossypium hirsutum]
Length=492

 Score =   115 bits (288),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 52/66 (79%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP K+RPSSSF++PF TTN GAPVWNN  +LTVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKFRPSSSFDSPFWTTNSGAPVWNNNSSLTVGARGPILLEDYHLVEKLANFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>sp|P48352.1|CATA3_CUCPE RecName: Full=Catalase isozyme 3 [Cucurbita pepo]
 dbj|BAA09508.1| catalase [Cucurbita pepo]
Length=492

 Score =   115 bits (287),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 50/65 (77%), Positives = 56/65 (86%), Gaps = 0/65 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP KYRPSS++NTPFCTTN GAP+WNNT  ++VG RGPILLEDY L+EKI  FTRERIP
Sbjct  1    MDPYKYRPSSAYNTPFCTTNSGAPIWNNTAVMSVGERGPILLEDYQLIEKIATFTRERIP  60

Query  261  XRVVH  275
             RVVH
Sbjct  61   ERVVH  65



>ref|XP_007018034.1| Catalase 2 [Theobroma cacao]
 gb|EOY15259.1| Catalase 2 [Theobroma cacao]
Length=492

 Score =   115 bits (287),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 53/66 (80%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP KYRPSS+FN+PF TTN GAPVWNN  +LTVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAFNSPFWTTNSGAPVWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>sp|O24339.1|CATA_SOLAP RecName: Full=Catalase [Soldanella alpina]
 emb|CAB16749.1| catalase [Soldanella alpina]
Length=492

 Score =   115 bits (287),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 53/66 (80%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP KYR SS+FNTPF TTN GAPVWNN  +LTVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRSSSAFNTPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>gb|ACB11496.1| catalase [Pinus sylvestris]
Length=492

 Score =   115 bits (287),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP KYRPSS++N+PF TTN GAPVWNN  +LT+GSRGPILLEDYHLVEKI  F RER+P
Sbjct  1    MDPYKYRPSSAYNSPFWTTNAGAPVWNNNSSLTIGSRGPILLEDYHLVEKIAQFDRERVP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>gb|AJE26131.1| catalase [Salix matsudana]
Length=492

 Score =   114 bits (286),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 53/66 (80%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP K+RPSS+F+TP+ TTN GAPVWNN  +LTVGSRGPILLEDYHLVEKI NF RERIP
Sbjct  1    MDPYKHRPSSAFSTPYWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKIANFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>ref|XP_010663966.1| PREDICTED: catalase isozyme 1 [Vitis vinifera]
 emb|CBI40714.3| unnamed protein product [Vitis vinifera]
Length=492

 Score =   114 bits (286),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 52/66 (79%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP KYRPSS++N+PF TTN GAPVWNN  +LTVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAYNSPFWTTNSGAPVWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>ref|XP_002521709.1| catalase, putative [Ricinus communis]
 gb|EEF40696.1| catalase, putative [Ricinus communis]
Length=492

 Score =   114 bits (286),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 52/66 (79%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP K+RPSS++N+PF TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKFRPSSAYNSPFFTTNSGAPVWNNNNSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>gb|ADC95629.1| catalase [Bruguiera gymnorhiza]
Length=492

 Score =   114 bits (286),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 52/66 (79%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP KYRPSS++N+PF T N GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAYNSPFWTANSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>ref|NP_001237571.1| catalase-4 [Glycine max]
 sp|O48561.1|CATA4_SOYBN RecName: Full=Catalase-4 [Glycine max]
 gb|AAB88172.1| catalase [Glycine max]
 gb|KHN33801.1| Catalase-4 [Glycine soja]
Length=492

 Score =   114 bits (286),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP K+RPSS+FN+PF TTN GAP+WNN  +LTVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPIWNNNSSLTVGARGPILLEDYHLVEKLANFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>ref|XP_011074092.1| PREDICTED: catalase isozyme 3 isoform X3 [Sesamum indicum]
Length=492

 Score =   114 bits (286),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 52/66 (79%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP KYRPS +FN+PF TTN GAPVWNN  +LTVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSRAFNSPFMTTNSGAPVWNNNDSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>ref|XP_010523643.1| PREDICTED: catalase-2-like [Tarenaya hassleriana]
Length=492

 Score =   114 bits (286),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 52/66 (79%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP KYRPSSS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>ref|XP_011074091.1| PREDICTED: catalase isozyme 3 isoform X2 [Sesamum indicum]
Length=492

 Score =   114 bits (286),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 52/66 (79%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP KYRPS +FN+PF TTN GAPVWNN  +LTVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSRAFNSPFMTTNSGAPVWNNNDSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>ref|NP_001237556.1| catalase-1/2 [Glycine max]
 sp|P29756.1|CATA1_SOYBN RecName: Full=Catalase-1/2 [Glycine max]
 emb|CAA78056.1| catalase [Glycine max]
 gb|AAB88169.1| catalase [Glycine max]
 gb|AAB88170.1| catalase [Glycine max]
 gb|KHN48523.1| Catalase-1/2 [Glycine soja]
Length=492

 Score =   114 bits (286),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 52/66 (79%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP K RPSS+FN+PF TTN GAP+WNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKNRPSSAFNSPFWTTNSGAPIWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>ref|XP_009149539.1| PREDICTED: catalase-3 [Brassica rapa]
Length=543

 Score =   115 bits (287),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 51/69 (74%), Positives = 60/69 (87%), Gaps = 0/69 (0%)
 Frame = +3

Query  72   LISMDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRE  251
             I+MDP KYRPSS++N+PF TTNGGAPV NN  +LT+G RGP+LLEDYHL+EK+ NFTRE
Sbjct  49   FITMDPYKYRPSSAYNSPFYTTNGGAPVSNNISSLTIGERGPVLLEDYHLIEKVANFTRE  108

Query  252  RIPXRVVHA  278
            RIP RVVHA
Sbjct  109  RIPERVVHA  117



>gb|AHF21552.1| catalase [Hylocereus undatus]
Length=492

 Score =   114 bits (285),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP K+RPSSSFNT F TTN GAPVWNNT A+T+G RGP+LLEDYHL+EKI NF RERIP
Sbjct  1    MDPYKHRPSSSFNTTFWTTNSGAPVWNNTSAMTIGQRGPVLLEDYHLIEKITNFHRERIP  60

Query  261  XRVVHA  278
             R+VHA
Sbjct  61   ERIVHA  66



>gb|AII23739.1| catalase [Zostera marina]
Length=477

 Score =   114 bits (285),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP+K+RPSS FN+P+ TTN GAPVWNN  +LTVGSRGPILLEDYHL+EKI  F RERIP
Sbjct  1    MDPTKFRPSSDFNSPYWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLIEKIAQFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>sp|P25890.1|CATA_PEA RecName: Full=Catalase [Pisum sativum]
 emb|CAA42736.1| catalase [Pisum sativum]
Length=494

 Score =   114 bits (285),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 52/66 (79%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP K+RPSS+FN+PF TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+  F RERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLAQFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>gb|AIA61608.1| catalase [Gynostemma pentaphyllum]
Length=492

 Score =   114 bits (285),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 53/66 (80%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP K RPSS+FN+PF TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKNRPSSAFNSPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>gb|AFU48609.1| catalase 1, partial [Nicotiana benthamiana]
Length=491

 Score =   114 bits (285),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 51/65 (78%), Positives = 58/65 (89%), Gaps = 0/65 (0%)
 Frame = +3

Query  84   DPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIPX  263
            DP KYRPSS+FN+PFCTTN GAPV+NN  +LTVG+RGPILLEDYHLVEK+ NF RER+P 
Sbjct  1    DPYKYRPSSAFNSPFCTTNSGAPVFNNNSSLTVGARGPILLEDYHLVEKLANFDRERVPE  60

Query  264  RVVHA  278
            RVVHA
Sbjct  61   RVVHA  65



>dbj|BAH37035.1| catalase 1 [Pisum sativum]
Length=494

 Score =   114 bits (285),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 52/66 (79%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP K+RPSS+FN+PF TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+  F RERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLAQFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>ref|XP_004300681.1| PREDICTED: catalase isozyme 1 [Fragaria vesca subsp. vesca]
Length=492

 Score =   114 bits (285),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 50/66 (76%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP KYRPSS++++PF TTN GAPVWNN  +LT+G+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAYDSPFWTTNSGAPVWNNNSSLTIGARGPILLEDYHLVEKLANFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>gb|AFD29285.1| catalase [Vicia faba]
Length=494

 Score =   114 bits (285),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 52/66 (79%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP K+RPSS+FN+PF TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+  F RERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLAQFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>ref|NP_001289779.1| catalase isozyme 1 [Nelumbo nucifera]
 gb|ADY11209.1| catalase [Nelumbo nucifera]
Length=492

 Score =   114 bits (285),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP KYRPS++F++PF TTN GAPVWNN  +LTVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSTAFDSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>gb|AET97564.1| catalase [Ziziphus jujuba]
Length=492

 Score =   114 bits (285),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP KYRPSS+FN+P+ TTN GAP+WNN  +LTVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAFNSPYWTTNSGAPIWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>ref|NP_001235974.1| catalase-3 [Glycine max]
 sp|O48560.1|CATA3_SOYBN RecName: Full=Catalase-3 [Glycine max]
 gb|AAB88171.1| catalase [Glycine max]
 gb|KHN12602.1| Catalase-3 [Glycine soja]
Length=492

 Score =   114 bits (284),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 52/66 (79%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP K RPSS+FN+PF TTN GAP+WNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKNRPSSAFNSPFWTTNSGAPIWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>gb|AAC84138.1| catalase [Cichorium intybus]
Length=182

 Score =   110 bits (274),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 49/66 (74%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP K RPSS++N+PF TTN G PV+NNT +LTVG+RGPILLEDYHL+EK+ NFTRERIP
Sbjct  1    MDPYKQRPSSAYNSPFWTTNAGLPVYNNTASLTVGNRGPILLEDYHLIEKLANFTRERIP  60

Query  261  XRVVHA  278
             R+VHA
Sbjct  61   ERIVHA  66



>gb|AIZ77475.1| catalase, partial [Triticum aestivum]
Length=490

 Score =   114 bits (284),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/66 (80%), Positives = 56/66 (85%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP KYRPSSSFN P  +TN GAPVWNN  +LTVGSRGPILLEDYHLVEKI +F RERIP
Sbjct  1    MDPYKYRPSSSFNAPMWSTNSGAPVWNNDNSLTVGSRGPILLEDYHLVEKIADFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>emb|CDX72514.1| BnaC07g45360D [Brassica napus]
Length=480

 Score =   114 bits (284),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>sp|Q43206.1|CATA1_WHEAT RecName: Full=Catalase-1 [Triticum aestivum]
 dbj|BAA13068.1| catalase [Triticum aestivum]
 gb|ADF83496.1| catalase [Triticum aestivum]
Length=492

 Score =   114 bits (284),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/66 (80%), Positives = 56/66 (85%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP KYRPSSSFN P  +TN GAPVWNN  +LTVGSRGPILLEDYHLVEKI +F RERIP
Sbjct  1    MDPYKYRPSSSFNAPMWSTNSGAPVWNNDNSLTVGSRGPILLEDYHLVEKIADFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>ref|NP_001240021.1| catalase [Glycine max]
 dbj|BAG09375.1| peroxisomal catalase [Glycine max]
 gb|KHN20113.1| Catalase-4 [Glycine soja]
Length=492

 Score =   114 bits (284),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 52/66 (79%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP K RPSS+FN+PF TTN GAPVWNN  +LTVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKLRPSSAFNSPFWTTNSGAPVWNNNSSLTVGARGPILLEDYHLVEKLANFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>ref|NP_001031791.1| catalase 2 [Arabidopsis thaliana]
 gb|AEE86463.1| catalase 2 [Arabidopsis thaliana]
Length=474

 Score =   113 bits (283),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>emb|CDX69111.1| BnaC01g03420D [Brassica napus]
Length=480

 Score =   113 bits (283),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>dbj|BAH19523.1| AT4G35090 [Arabidopsis thaliana]
Length=474

 Score =   113 bits (283),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>ref|NP_001234186.1| catalase isozyme 2 [Solanum lycopersicum]
 sp|Q9XHH3.1|CATA2_SOLLC RecName: Full=Catalase isozyme 2 [Solanum lycopersicum]
 gb|AAD41256.1| catalase 2 [Solanum lycopersicum]
Length=492

 Score =   114 bits (284),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP KYRPSS+FN+PFCTTN GAPV+NN  +LTVG+RGP+LLEDYHLVEK+ NF RERI 
Sbjct  1    MDPYKYRPSSAFNSPFCTTNSGAPVFNNNSSLTVGARGPVLLEDYHLVEKLANFDRERIA  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>gb|ACA50528.1| putative catalase 2 [Brassica napus]
Length=492

 Score =   114 bits (284),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>gb|AAK96854.1| catalase [Arabidopsis thaliana]
Length=492

 Score =   114 bits (284),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>emb|CAA64220.1| catalase [Arabidopsis thaliana]
Length=492

 Score =   114 bits (284),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>gb|AFU90823.1| catalase, partial [Populus x beijingensis]
Length=446

 Score =   113 bits (283),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 52/65 (80%), Positives = 56/65 (86%), Gaps = 0/65 (0%)
 Frame = +3

Query  84   DPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIPX  263
            DP KYRPSS+F TP+ TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP 
Sbjct  1    DPYKYRPSSAFGTPYWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIPE  60

Query  264  RVVHA  278
            RVVHA
Sbjct  61   RVVHA  65



>emb|CDP07287.1| unnamed protein product [Coffea canephora]
Length=492

 Score =   113 bits (283),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP KYRPSS+FN+PF TTN GA VWNN  +LTVG+RGP+LLEDYHLVEK+ NF RERIP
Sbjct  1    MDPCKYRPSSAFNSPFWTTNSGASVWNNNSSLTVGTRGPVLLEDYHLVEKLANFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>tpg|DAA43177.1| TPA: catalase2 [Zea mays]
Length=493

 Score =   113 bits (283),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP K+RPSS+FN P+ TTN GAPVWNN  +LTVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKHRPSSAFNAPYWTTNSGAPVWNNDSSLTVGARGPILLEDYHLVEKLANFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>ref|NP_195235.1| catalase 2 [Arabidopsis thaliana]
 sp|P25819.3|CATA2_ARATH RecName: Full=Catalase-2 [Arabidopsis thaliana]
 emb|CAA17773.1| catalase [Arabidopsis thaliana]
 emb|CAB80226.1| catalase [Arabidopsis thaliana]
 gb|AAL66998.1| putative catalase [Arabidopsis thaliana]
 gb|AAM44902.1| putative catalase [Arabidopsis thaliana]
 gb|AEE86462.1| catalase 2 [Arabidopsis thaliana]
Length=492

 Score =   113 bits (283),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>gb|KJB14250.1| hypothetical protein B456_002G115900 [Gossypium raimondii]
Length=492

 Score =   113 bits (283),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/66 (79%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP K+RPSS+FN+PF TTN GAPVWNN  +LTVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>gb|KHG25152.1| Catalase isozyme 1 [Gossypium arboreum]
Length=492

 Score =   113 bits (283),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/66 (79%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP K+RPSS+FN+PF TTN GAPVWNN  +LTVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>ref|XP_006412154.1| hypothetical protein EUTSA_v10024932mg [Eutrema salsugineum]
 gb|ESQ53607.1| hypothetical protein EUTSA_v10024932mg [Eutrema salsugineum]
Length=518

 Score =   114 bits (284),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>gb|ACJ11733.1| catalase [Gossypium hirsutum]
Length=492

 Score =   113 bits (283),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/66 (79%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP K+RPSS+FN+PF TTN GAPVWNN  +LTVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>gb|ACL81498.1| catalase [Ginkgo biloba]
Length=492

 Score =   113 bits (283),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 49/66 (74%), Positives = 60/66 (91%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP K+RPSS++N+P+CTTN GAPVWNNT +LT+G+RGP+LLEDYHL+EK+  FTRERIP
Sbjct  1    MDPYKHRPSSAYNSPYCTTNQGAPVWNNTSSLTLGNRGPVLLEDYHLIEKLSVFTRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>ref|XP_002867092.1| hypothetical protein ARALYDRAFT_491144 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43351.1| hypothetical protein ARALYDRAFT_491144 [Arabidopsis lyrata subsp. 
lyrata]
Length=492

 Score =   113 bits (283),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>gb|KHG21219.1| Catalase isozyme 1 [Gossypium arboreum]
Length=432

 Score =   113 bits (282),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP K+RPSS+FN+PF TTN GAP+WNN  +LTVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPIWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>gb|AAD17933.1| catalase [Brassica juncea]
Length=496

 Score =   113 bits (283),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>ref|XP_006283612.1| hypothetical protein CARUB_v10004668mg [Capsella rubella]
 gb|EOA16510.1| hypothetical protein CARUB_v10004668mg [Capsella rubella]
Length=492

 Score =   113 bits (283),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>ref|XP_009106100.1| PREDICTED: catalase-2 [Brassica rapa]
Length=492

 Score =   113 bits (283),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>gb|ACV92695.1| catalase [Brassica oleracea]
Length=492

 Score =   113 bits (283),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>ref|XP_006412153.1| hypothetical protein EUTSA_v10024932mg [Eutrema salsugineum]
 gb|ESQ53606.1| hypothetical protein EUTSA_v10024932mg [Eutrema salsugineum]
Length=492

 Score =   113 bits (283),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>gb|KFK30147.1| catalase [Arabis alpina]
Length=492

 Score =   113 bits (283),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>ref|XP_010437527.1| PREDICTED: catalase-2 [Camelina sativa]
Length=492

 Score =   113 bits (283),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>gb|AAF71742.1|AF248491_1 catalase [Raphanus sativus]
Length=492

 Score =   113 bits (283),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>dbj|BAJ33995.1| unnamed protein product [Thellungiella halophila]
Length=492

 Score =   113 bits (283),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>ref|XP_009138342.1| PREDICTED: catalase-2 [Brassica rapa]
 gb|AAD17934.1| catalase [Brassica juncea]
Length=492

 Score =   113 bits (283),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>emb|CDY40645.1| BnaA03g53180D [Brassica napus]
Length=485

 Score =   113 bits (283),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>ref|XP_010432341.1| PREDICTED: catalase-2-like [Camelina sativa]
Length=492

 Score =   113 bits (283),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>gb|KEH36313.1| catalase heme-binding enzyme [Medicago truncatula]
Length=430

 Score =   113 bits (282),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP K+RPSS++N+PF TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+  F RERIP
Sbjct  1    MDPYKHRPSSAYNSPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLAQFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>gb|AAD17935.1| catalase [Brassica juncea]
Length=492

 Score =   113 bits (283),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>gb|AFN81243.1| catalase 1 [Brassica rapa subsp. pekinensis]
Length=492

 Score =   113 bits (283),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>ref|XP_010446982.1| PREDICTED: catalase-2-like [Camelina sativa]
Length=492

 Score =   113 bits (283),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>ref|XP_009400996.1| PREDICTED: catalase isozyme 2 [Musa acuminata subsp. malaccensis]
Length=492

 Score =   113 bits (283),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP K+RPSS++N+PF TTN GAPVWNN  ++TVGSRGPILLEDYHLVEKI  F RERIP
Sbjct  1    MDPYKFRPSSNYNSPFWTTNSGAPVWNNNASITVGSRGPILLEDYHLVEKIAQFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>sp|Q01297.2|CATA1_RICCO RecName: Full=Catalase isozyme 1 [Ricinus communis]
 gb|AAB31537.1| catalase 1 [Ricinus communis=castor beans, hypocotyls, Peptide, 
492 aa]
 dbj|BAA04697.1| catalase CAT1 [Ricinus communis]
Length=492

 Score =   113 bits (282),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/66 (79%), Positives = 56/66 (85%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP + RPSS FNTPF TTN GAPVWNN  +LTVGSRGPILLEDYHL+EK+ NF RERIP
Sbjct  1    MDPYRNRPSSGFNTPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLIEKLANFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>gb|AFU90822.1| catalase, partial [Populus tomentosa]
Length=487

 Score =   113 bits (282),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/65 (80%), Positives = 56/65 (86%), Gaps = 0/65 (0%)
 Frame = +3

Query  84   DPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIPX  263
            DP KYRPSS+F TP+ TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP 
Sbjct  1    DPYKYRPSSAFGTPYWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIPE  60

Query  264  RVVHA  278
            RVVHA
Sbjct  61   RVVHA  65



>gb|KJB57963.1| hypothetical protein B456_009G187600 [Gossypium raimondii]
Length=492

 Score =   113 bits (282),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP K+RPSS+FN+PF TTN GAP+WNN  +LTVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPIWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>ref|XP_007160597.1| hypothetical protein PHAVU_001G001000g [Phaseolus vulgaris]
 gb|ESW32591.1| hypothetical protein PHAVU_001G001000g [Phaseolus vulgaris]
Length=492

 Score =   113 bits (282),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP K RPS++FN+PF TTN GAP+WNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKNRPSTAFNSPFWTTNSGAPIWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>gb|ABM47415.1| catalase [Prunus avium]
Length=492

 Score =   113 bits (282),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP K+RPSS+F+TPF TTN GAPVWNN  +LTVGSRGP+LLEDYHLVEK+  F RERIP
Sbjct  1    MDPYKHRPSSAFDTPFWTTNSGAPVWNNDSSLTVGSRGPVLLEDYHLVEKLATFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>ref|XP_002306976.2| catalase family protein [Populus trichocarpa]
 gb|EEE93972.2| catalase family protein [Populus trichocarpa]
Length=492

 Score =   113 bits (282),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/66 (79%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP K+RPSS+FN+P+ TTN GA VWNN  +LTVGSRGPILLEDYHLVEKI NF RERIP
Sbjct  1    MDPYKHRPSSAFNSPYWTTNSGASVWNNNSSLTVGSRGPILLEDYHLVEKIANFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>tpg|DAA43178.1| TPA: catalase2 [Zea mays]
Length=531

 Score =   113 bits (283),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP K+RPSS+FN P+ TTN GAPVWNN  +LTVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKHRPSSAFNAPYWTTNSGAPVWNNDSSLTVGARGPILLEDYHLVEKLANFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>ref|XP_011041225.1| PREDICTED: catalase isozyme 1 [Populus euphratica]
Length=492

 Score =   113 bits (282),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 52/66 (79%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP K+RPSS+FN+P+ TTN GA VWNN  +LTVGSRGPILLEDYHLVEKI NF RERIP
Sbjct  1    MDPYKHRPSSAFNSPYWTTNSGASVWNNNSSLTVGSRGPILLEDYHLVEKIANFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>gb|ABK24453.1| unknown [Picea sitchensis]
Length=492

 Score =   113 bits (282),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 50/66 (76%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP K+RPSS++N+PF TTN GAPVWNN  +LT+GSRGPILLEDYHLVEKI  F RER+P
Sbjct  1    MDPYKHRPSSAYNSPFWTTNSGAPVWNNNSSLTIGSRGPILLEDYHLVEKIAQFDRERVP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>ref|XP_010530333.1| PREDICTED: catalase-2 [Tarenaya hassleriana]
Length=492

 Score =   113 bits (282),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 52/66 (79%), Positives = 56/66 (85%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP KYRPSSS N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSSHNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>gb|KEH36312.1| catalase heme-binding enzyme [Medicago truncatula]
Length=492

 Score =   113 bits (282),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP K+RPSS++N+PF TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+  F RERIP
Sbjct  1    MDPYKHRPSSAYNSPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLAQFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>ref|XP_009597278.1| PREDICTED: catalase isozyme 1 [Nicotiana tomentosiformis]
 emb|CCP37651.1| catalase-1 [Nicotiana tabacum]
Length=492

 Score =   113 bits (282),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 50/66 (76%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP KYRPSS+FN+ FCTTN GAPV+NN  +LTVG+RGP+LLEDYHLVEK+ NF RER+P
Sbjct  1    MDPYKYRPSSAFNSTFCTTNSGAPVFNNNSSLTVGARGPVLLEDYHLVEKLANFDRERVP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>gb|ACL35349.1| catalase [Picea glauca]
Length=492

 Score =   112 bits (281),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 50/66 (76%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP K+RPSS++N+PF TTN GAPVWNN  +LT+GSRGPILLEDYHLVEKI  F RER+P
Sbjct  1    MDPYKHRPSSAYNSPFWTTNSGAPVWNNNSSLTIGSRGPILLEDYHLVEKIAQFDRERVP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>ref|XP_006416379.1| hypothetical protein EUTSA_v10007795mg [Eutrema salsugineum]
 gb|ESQ34732.1| hypothetical protein EUTSA_v10007795mg [Eutrema salsugineum]
Length=405

 Score =   112 bits (280),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 50/66 (76%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP KYRPSS++N PF TTNGGAPV NN  +LT+G RGP+LLEDYHL+EK+ NFTRERIP
Sbjct  1    MDPYKYRPSSAYNAPFYTTNGGAPVSNNISSLTIGERGPVLLEDYHLIEKVANFTRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>ref|XP_010536468.1| PREDICTED: catalase-3-like [Tarenaya hassleriana]
Length=492

 Score =   112 bits (281),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 59/66 (89%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP K+RPSSS +TP+ TTNGGAPV+NN  +LTVG+RGPILLEDYHL+EK+ NFTRERIP
Sbjct  1    MDPYKFRPSSSHDTPYYTTNGGAPVYNNISSLTVGTRGPILLEDYHLIEKVANFTRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>gb|ABF93811.1| Catalase-1, putative, expressed [Oryza sativa Japonica Group]
Length=382

 Score =   112 bits (279),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 52/66 (79%), Positives = 56/66 (85%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP K+RPSSSFN P  +TN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKHRPSSSFNGPLWSTNSGAPVWNNNNSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>ref|XP_010534184.1| PREDICTED: catalase isozyme 3-like [Tarenaya hassleriana]
Length=492

 Score =   112 bits (281),  Expect = 3e-27, Method: Composition-based stats.
 Identities = 50/66 (76%), Positives = 59/66 (89%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP K+RPSSS ++P+ TTNGGAPV+NN  +LTVG+RGPILLEDYHL+EK+ NFTRERIP
Sbjct  1    MDPYKFRPSSSHDSPYYTTNGGAPVYNNISSLTVGTRGPILLEDYHLIEKVANFTRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>ref|XP_006306495.1| hypothetical protein CARUB_v10012481mg [Capsella rubella]
 gb|EOA39393.1| hypothetical protein CARUB_v10012481mg [Capsella rubella]
Length=492

 Score =   112 bits (281),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP KYRPSS++N PF TTNGGAPV NN  +LTVG RGP+LLEDYHL+EK+ NFTRERIP
Sbjct  1    MDPYKYRPSSAYNAPFYTTNGGAPVSNNISSLTVGERGPVLLEDYHLIEKVANFTRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>ref|XP_009624788.1| PREDICTED: catalase isozyme 3 [Nicotiana tomentosiformis]
Length=492

 Score =   112 bits (281),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP KYRPSS+ N+PF TTN GAPVWNN  ++TVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSANNSPFMTTNSGAPVWNNNSSMTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>ref|XP_009773579.1| PREDICTED: catalase isozyme 3-like [Nicotiana sylvestris]
Length=492

 Score =   112 bits (281),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP K RPSS+FN+PF TTN GAPVWNN  +LTVG+RGP+LLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKNRPSSAFNSPFMTTNSGAPVWNNNSSLTVGTRGPVLLEDYHLVEKLANFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>ref|XP_009794469.1| PREDICTED: catalase isozyme 3 [Nicotiana sylvestris]
 emb|CCP37652.1| catalase-3 [Nicotiana tabacum]
Length=492

 Score =   112 bits (281),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP KYRPSS+ N+PF TTN GAPVWNN  ++TVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSANNSPFMTTNSGAPVWNNNSSMTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>ref|XP_009600533.1| PREDICTED: catalase isozyme 3-like [Nicotiana tomentosiformis]
Length=492

 Score =   112 bits (281),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP K RPSS+FN+PF TTN GAPVWNN  +LTVG+RGP+LLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKNRPSSAFNSPFMTTNSGAPVWNNNSSLTVGTRGPVLLEDYHLVEKLANFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>ref|XP_008365915.1| PREDICTED: catalase isozyme 1 [Malus domestica]
Length=492

 Score =   112 bits (281),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP ++RPSS+FN+PF TTN GAPVWNN  +LTVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYRHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>gb|AAZ29552.1| catalase-C [Oryza sativa Indica Group]
Length=500

 Score =   112 bits (281),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 52/66 (79%), Positives = 56/66 (85%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP K+RPSSSFN P  +TN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKHRPSSSFNGPLWSTNSGAPVWNNNNSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>ref|XP_008373403.1| PREDICTED: catalase isozyme 1 [Malus domestica]
Length=492

 Score =   112 bits (281),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP ++RPSS+FN+PF TTN GAPVWNN  +LTVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYRHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>gb|AAD50974.1|AF170272_1 catalase CAT1 [Manihot esculenta]
Length=492

 Score =   112 bits (281),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 50/66 (76%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP K+RPSSS NTPF TT+ GAPVWNN  ++TVG+RGPILLEDYH++EK+ NFTRERIP
Sbjct  1    MDPCKFRPSSSNNTPFWTTDAGAPVWNNNSSMTVGTRGPILLEDYHMIEKLANFTRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>ref|XP_008348924.1| PREDICTED: catalase isozyme 1 [Malus domestica]
Length=492

 Score =   112 bits (281),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP ++RPSS+FN+PF TTN GAPVWNN  +LTVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYRHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>ref|XP_006828714.1| hypothetical protein AMTR_s00001p00022550 [Amborella trichopoda]
 gb|ERM96130.1| hypothetical protein AMTR_s00001p00022550 [Amborella trichopoda]
Length=492

 Score =   112 bits (280),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 49/66 (74%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP KYRPSS++N+PF TTN GAPVWN+  +LTVGSRGPILLEDYHL+EK+ +FTRER P
Sbjct  1    MDPYKYRPSSAYNSPFMTTNAGAPVWNDDSSLTVGSRGPILLEDYHLIEKLAHFTRERTP  60

Query  261  XRVVHA  278
             R+VHA
Sbjct  61   ERIVHA  66



>gb|AAR84577.1| catalase 1b [Lotus japonicus]
 gb|AAR84579.1| catalase 1b [Lotus japonicus]
Length=449

 Score =   112 bits (279),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP K+RPSS+FN+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNNSMTVGVRGPILLEDYHLVEKLANFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>emb|CAG23920.1| catalase [Festuca arundinacea]
Length=492

 Score =   112 bits (280),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 53/66 (80%), Positives = 56/66 (85%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP KYRPSSSFN P  +TN GAPVWNN  +LTVGSRGPILLEDYHLVEKI +F RERIP
Sbjct  1    MDPYKYRPSSSFNGPQWSTNSGAPVWNNDNSLTVGSRGPILLEDYHLVEKIADFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>emb|CDY29519.1| BnaA06g14510D [Brassica napus]
Length=492

 Score =   112 bits (280),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 50/66 (76%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP KYRPSS++N+PF TTNGGAPV NN  +LT+G RGP+LLEDYHL+EK+ NFTRERIP
Sbjct  1    MDPYKYRPSSAYNSPFYTTNGGAPVSNNISSLTIGERGPVLLEDYHLIEKVANFTRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>gb|ABV55108.1| catalase 2 [Musa acuminata AAA Group]
Length=492

 Score =   112 bits (280),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 53/66 (80%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP K+RPSSSF+T F TTN GAPVWN+  ALTVGSRGPILLEDYHLVEKI +F RERIP
Sbjct  1    MDPYKFRPSSSFDTNFTTTNAGAPVWNDDQALTVGSRGPILLEDYHLVEKIAHFARERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>dbj|BAJ90861.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ86892.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=492

 Score =   112 bits (280),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 52/66 (79%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP K+RPSSSFN+P  +TN GAPVWNN  +LTVGSRGPILLEDYHLVEKI +F RERIP
Sbjct  1    MDPYKHRPSSSFNSPMWSTNSGAPVWNNDNSLTVGSRGPILLEDYHLVEKIADFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>ref|XP_009398521.1| PREDICTED: catalase isozyme A [Musa acuminata subsp. malaccensis]
Length=492

 Score =   112 bits (280),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 53/66 (80%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP K+RPSSSF+T F TTN GAPVWN+  ALTVGSRGPILLEDYHLVEKI +F RERIP
Sbjct  1    MDPYKFRPSSSFDTNFTTTNAGAPVWNDDQALTVGSRGPILLEDYHLVEKIAHFARERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>gb|KFK44175.1| hypothetical protein AALP_AA1G224300 [Arabis alpina]
Length=492

 Score =   112 bits (280),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 50/66 (76%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP KYRPSS++N+PF TTNGGAPV NN  +LT+G RGP+LLEDYHL+EK+ NFTRERIP
Sbjct  1    MDPYKYRPSSAYNSPFYTTNGGAPVSNNISSLTIGERGPVLLEDYHLIEKVANFTRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>ref|XP_007046520.1| Catalase 2 [Theobroma cacao]
 gb|EOX90677.1| Catalase 2 [Theobroma cacao]
Length=492

 Score =   112 bits (280),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP KYRPSS+FN+PF TTN GAPV+NN  +L+VG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAFNSPFWTTNSGAPVYNNNSSLSVGARGPILLEDYHLVEKLANFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>gb|AAR84578.1| catalase 1a [Lotus japonicus]
Length=492

 Score =   112 bits (280),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP K+RPSS+FN+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNNSMTVGVRGPILLEDYHLVEKLANFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>sp|P49317.1|CATA3_NICPL RecName: Full=Catalase isozyme 3 [Nicotiana plumbaginifolia]
 emb|CAA85426.1| catalase [Nicotiana plumbaginifolia]
Length=492

 Score =   112 bits (280),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP KYRPSS+ N+PF TTN GAPVWNN  ++TVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSANNSPFWTTNSGAPVWNNNSSMTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>ref|NP_973873.1| catalase 3 [Arabidopsis thaliana]
 gb|AEE29994.1| catalase 3 [Arabidopsis thaliana]
Length=427

 Score =   111 bits (278),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 50/66 (76%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP KYRPSS++N PF TTNGGAPV NN  +LT+G RGP+LLEDYHL+EK+ NFTRERIP
Sbjct  1    MDPYKYRPSSAYNAPFYTTNGGAPVSNNISSLTIGERGPVLLEDYHLIEKVANFTRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>ref|XP_006649332.1| PREDICTED: catalase-1-like [Oryza brachyantha]
Length=492

 Score =   112 bits (280),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 52/66 (79%), Positives = 56/66 (85%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP K+RPSSSFN P  +TN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKHRPSSSFNGPLWSTNSGAPVWNNNNSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>ref|XP_006828715.1| hypothetical protein AMTR_s00001p00024160 [Amborella trichopoda]
 gb|ERM96131.1| hypothetical protein AMTR_s00001p00024160 [Amborella trichopoda]
Length=492

 Score =   112 bits (280),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 52/66 (79%), Positives = 56/66 (85%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP K+RPSS+ N PF TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKFRPSSAHNCPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>ref|XP_008452956.1| PREDICTED: catalase isozyme 1 [Cucumis melo]
Length=492

 Score =   112 bits (280),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 56/66 (85%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP ++RPSS +NTPF TTN GAPVWNN  +LTVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYRHRPSSGYNTPFWTTNSGAPVWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>dbj|BAA34205.1| catalase [Oryza sativa Japonica Group]
 gb|AAQ19030.1| catalase [Oryza sativa]
Length=492

 Score =   112 bits (280),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 52/66 (79%), Positives = 56/66 (85%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP K+RPSSSFN P  +TN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKHRPSSSFNGPLWSTNSGAPVWNNNNSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>gb|AAD17936.1| catalase [Brassica juncea]
Length=492

 Score =   112 bits (280),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNFGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>gb|KDP43757.1| hypothetical protein JCGZ_22384 [Jatropha curcas]
Length=492

 Score =   112 bits (280),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 52/66 (79%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP K+RPSS+ N+PF TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKFRPSSANNSPFFTTNSGAPVWNNNNSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>ref|NP_001048861.1| Os03g0131200 [Oryza sativa Japonica Group]
 gb|ABF93810.1| Catalase-1, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF10775.1| Os03g0131200 [Oryza sativa Japonica Group]
 dbj|BAG88238.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG89941.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC74449.1| hypothetical protein OsI_09857 [Oryza sativa Indica Group]
 gb|EEE58275.1| hypothetical protein OsJ_09293 [Oryza sativa Japonica Group]
Length=492

 Score =   112 bits (280),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 52/66 (79%), Positives = 56/66 (85%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP K+RPSSSFN P  +TN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKHRPSSSFNGPLWSTNSGAPVWNNNNSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>gb|KGN55499.1| hypothetical protein Csa_4G658590 [Cucumis sativus]
Length=492

 Score =   112 bits (280),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 56/66 (85%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP ++RPSS +NTPF TTN GAPVWNN  +LTVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYRHRPSSGYNTPFWTTNSGAPVWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>gb|AAD30291.2|AF139538_1 catalase 2 [Raphanus sativus]
Length=492

 Score =   112 bits (280),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 50/66 (76%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP KYRPSS++N PF TTNGGAPV NN  +LT+G RGP+LLEDYHL+EK+ NFTRERIP
Sbjct  1    MDPYKYRPSSAYNAPFYTTNGGAPVSNNISSLTIGERGPVLLEDYHLIEKVANFTRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>gb|AAD30292.1|AF139539_1 catalase 3 [Raphanus sativus]
Length=492

 Score =   112 bits (279),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 50/66 (76%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP KYRPSS++N PF TTNGGAPV NN  +LT+G RGP+LLEDYHL+EK+ NFTRERIP
Sbjct  1    MDPYKYRPSSAYNAPFYTTNGGAPVSNNISSLTIGERGPVLLEDYHLIEKVANFTRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>ref|XP_006306503.1| hypothetical protein CARUB_v10012491mg [Capsella rubella]
 gb|EOA39401.1| hypothetical protein CARUB_v10012491mg [Capsella rubella]
Length=201

 Score =   108 bits (270),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 49/66 (74%), Positives = 56/66 (85%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP + RPSS+ ++PF TTN GAPVWNN  +LTVG+RGPILLEDYHL+EKI NF RERIP
Sbjct  1    MDPYRVRPSSAHDSPFFTTNSGAPVWNNNSSLTVGTRGPILLEDYHLLEKIANFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>gb|AAF61734.1|AF243519_1 catalase 4 [Helianthus annuus]
Length=492

 Score =   112 bits (279),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 50/66 (76%), Positives = 59/66 (89%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP K RPSS+++TPF TTN GAPV+NNT +LTVG+RGPILLEDYHL+EK+ NFTRERIP
Sbjct  1    MDPYKQRPSSAYDTPFWTTNAGAPVYNNTASLTVGNRGPILLEDYHLIEKLANFTRERIP  60

Query  261  XRVVHA  278
             R+VHA
Sbjct  61   ERIVHA  66



>ref|XP_009110221.1| PREDICTED: catalase-3 [Brassica rapa]
 gb|AFN81244.1| catalase 2 [Brassica rapa subsp. pekinensis]
 emb|CDX96630.1| BnaA08g21730D [Brassica napus]
Length=492

 Score =   112 bits (279),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 50/66 (76%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP KYRPSS++N PF TTNGGAPV NN  +LT+G RGP+LLEDYHL+EK+ NFTRERIP
Sbjct  1    MDPYKYRPSSAYNAPFYTTNGGAPVSNNISSLTIGERGPVLLEDYHLIEKVANFTRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>ref|XP_003631925.1| PREDICTED: catalase isozyme 1-like [Vitis vinifera]
Length=492

 Score =   112 bits (279),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 50/66 (76%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP KYRPSS++N+P+ TTN GAPV+NN  +LTVGSRGP+LLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAYNSPYFTTNAGAPVYNNDSSLTVGSRGPVLLEDYHLVEKLANFQRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>ref|NP_001268098.1| catalase [Vitis vinifera]
 gb|AAL83720.1|AF236127_1 catalase [Vitis vinifera]
Length=492

 Score =   112 bits (279),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 50/66 (76%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP KYRPSS++N+P+ TTN GAPV+NN  +LTVGSRGP+LLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAYNSPYFTTNAGAPVYNNDSSLTVGSRGPVLLEDYHLVEKLANFQRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>emb|CDY33636.1| BnaC08g19360D [Brassica napus]
Length=492

 Score =   112 bits (279),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 50/66 (76%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP KYRPSS++N PF TTNGGAPV NN  +LT+G RGP+LLEDYHL+EK+ NFTRERIP
Sbjct  1    MDPYKYRPSSAYNAPFYTTNGGAPVSNNISSLTIGERGPVLLEDYHLIEKVANFTRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>emb|CDY31878.1| BnaC07g15280D [Brassica napus]
Length=492

 Score =   112 bits (279),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 50/66 (76%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP KYRPSS++N PF TTNGGAPV NN  +LT+G RGP+LLEDYHL+EK+ NFTRERIP
Sbjct  1    MDPYKYRPSSAYNAPFYTTNGGAPVSNNISSLTIGERGPVLLEDYHLIEKVANFTRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>ref|XP_009103334.1| PREDICTED: catalase-3-like [Brassica rapa]
 gb|AAB53101.2| catalase [Brassica napus]
 gb|AET08935.1| catalase [Brassica napus]
Length=492

 Score =   112 bits (279),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 50/66 (76%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP KYRPSS++N PF TTNGGAPV NN  +LT+G RGP+LLEDYHL+EK+ NFTRERIP
Sbjct  1    MDPYKYRPSSAYNAPFYTTNGGAPVSNNISSLTIGERGPVLLEDYHLIEKVANFTRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>ref|NP_564120.1| catalase 3 [Arabidopsis thaliana]
 sp|Q42547.3|CATA3_ARATH RecName: Full=Catalase-3 [Arabidopsis thaliana]
 gb|AAL08303.1| At1g20620/F5M15_4 [Arabidopsis thaliana]
 gb|AAL24212.1| At1g20620/F5M15_4 [Arabidopsis thaliana]
 gb|AEE29995.1| catalase 3 [Arabidopsis thaliana]
Length=492

 Score =   112 bits (279),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 50/66 (76%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP KYRPSS++N PF TTNGGAPV NN  +LT+G RGP+LLEDYHL+EK+ NFTRERIP
Sbjct  1    MDPYKYRPSSAYNAPFYTTNGGAPVSNNISSLTIGERGPVLLEDYHLIEKVANFTRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>dbj|BAH56915.1| AT1G20620 [Arabidopsis thaliana]
Length=493

 Score =   112 bits (279),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 50/66 (76%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP KYRPSS++N PF TTNGGAPV NN  +LT+G RGP+LLEDYHL+EK+ NFTRERIP
Sbjct  1    MDPYKYRPSSAYNAPFYTTNGGAPVSNNISSLTIGERGPVLLEDYHLIEKVANFTRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>gb|AAO17721.1| catalase [Hypericum perforatum]
Length=492

 Score =   112 bits (279),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 52/66 (79%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP KYRPSS+FN+PF TTN GAPV++N  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAFNSPFWTTNSGAPVYSNDHSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>gb|AAM65021.1| unknown [Arabidopsis thaliana]
Length=492

 Score =   112 bits (279),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 50/66 (76%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP KYRPSS++N PF TTNGGAPV NN  +LT+G RGP+LLEDYHL+EK+ NFTRERIP
Sbjct  1    MDPYKYRPSSAYNAPFYTTNGGAPVSNNISSLTIGERGPVLLEDYHLIEKVANFTRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>gb|AAC19397.1| leaf catalase [Mesembryanthemum crystallinum]
Length=492

 Score =   112 bits (279),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP KYRPSS+FN+P+ TTN GAPV+NN  +LTVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAFNSPYFTTNSGAPVYNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>gb|AGV54297.1| peroxisomal catalase [Phaseolus vulgaris]
Length=492

 Score =   112 bits (279),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP K+RPSS+FN+PF TTN GAPV+NN  +LTVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVYNNNSSLTVGARGPILLEDYHLVEKLANFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>ref|NP_001031073.1| catalase 3 [Arabidopsis thaliana]
 dbj|BAH19685.1| AT1G20620 [Arabidopsis thaliana]
 gb|AEE29997.1| catalase 3 [Arabidopsis thaliana]
Length=485

 Score =   112 bits (279),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 50/66 (76%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP KYRPSS++N PF TTNGGAPV NN  +LT+G RGP+LLEDYHL+EK+ NFTRERIP
Sbjct  1    MDPYKYRPSSAYNAPFYTTNGGAPVSNNISSLTIGERGPVLLEDYHLIEKVANFTRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>emb|CDY01364.1| BnaA07g11370D [Brassica napus]
Length=556

 Score =   112 bits (281),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 50/69 (72%), Positives = 58/69 (84%), Gaps = 0/69 (0%)
 Frame = +3

Query  72   LISMDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRE  251
              +MDP KYRPSS++N PF TTNGGAPV NN  +LT+G RGP+LLEDYHL+EK+ NFTRE
Sbjct  62   FTTMDPYKYRPSSAYNAPFYTTNGGAPVSNNISSLTIGERGPVLLEDYHLIEKVANFTRE  121

Query  252  RIPXRVVHA  278
            RIP RVVHA
Sbjct  122  RIPERVVHA  130



>ref|XP_009413057.1| PREDICTED: catalase isozyme 2-like [Musa acuminata subsp. malaccensis]
Length=492

 Score =   112 bits (279),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 56/66 (85%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP KYRPSS++N+PF TTN GAPVWNN  +LTVG RGPILLEDYHLVEK+  F RERIP
Sbjct  1    MDPYKYRPSSNYNSPFWTTNSGAPVWNNNSSLTVGIRGPILLEDYHLVEKLAQFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>gb|AAC49807.1| catalase 3 [Arabidopsis thaliana]
 gb|AAC17732.1| catalase 3 [Arabidopsis thaliana]
Length=492

 Score =   112 bits (279),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 50/66 (76%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP KYRPSS++N PF TTNGGAPV NN  +LT+G RGP+LLEDYHL+EK+ NFTRERIP
Sbjct  1    MDPYKYRPSSAYNAPFYTTNGGAPVSNNISSLTIGERGPVLLEDYHLIEKVANFTRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>ref|XP_007136018.1| hypothetical protein PHAVU_009G011100g [Phaseolus vulgaris]
 gb|ESW08012.1| hypothetical protein PHAVU_009G011100g [Phaseolus vulgaris]
Length=492

 Score =   112 bits (279),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP K+RPSS+FN+PF TTN GAPV+NN  +LTVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVYNNNSSLTVGARGPILLEDYHLVEKLANFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>gb|AAB70006.1| catalase [Chlamydomonas reinhardtii]
Length=493

 Score =   111 bits (278),  Expect = 8e-27, Method: Composition-based stats.
 Identities = 49/66 (74%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP+K RPSS++NTP+ TTN GAPVWNN  ++TVG+RGPILLEDYHLVEK+  F RERIP
Sbjct  1    MDPAKIRPSSAYNTPYWTTNSGAPVWNNNNSMTVGTRGPILLEDYHLVEKLAQFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>ref|XP_001696763.1| catalase/peroxidase [Chlamydomonas reinhardtii]
 gb|EDP00871.1| catalase/peroxidase [Chlamydomonas reinhardtii]
Length=493

 Score =   111 bits (278),  Expect = 9e-27, Method: Composition-based stats.
 Identities = 49/66 (74%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP+K RPSS++NTP+ TTN GAPVWNN  ++TVG+RGPILLEDYHLVEK+  F RERIP
Sbjct  1    MDPAKIRPSSAYNTPYWTTNSGAPVWNNNNSMTVGTRGPILLEDYHLVEKLAQFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>ref|XP_008789355.1| PREDICTED: catalase isozyme 1-like [Phoenix dactylifera]
Length=492

 Score =   111 bits (278),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 49/66 (74%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP KYRPSS++N+PF TTN GAPVWNN  +LTVG+RGPILLEDYH++EK+  F RERIP
Sbjct  1    MDPYKYRPSSAYNSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHVIEKLAQFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>emb|CDP01803.1| unnamed protein product [Coffea canephora]
Length=492

 Score =   111 bits (278),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 50/66 (76%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP K+RPSS++N+ F TTN GAPVWNN  +LTVGSRGP+LLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKFRPSSAYNSTFFTTNSGAPVWNNNSSLTVGSRGPVLLEDYHLVEKLANFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>ref|XP_006435363.1| hypothetical protein CICLE_v10000951mg [Citrus clementina]
 gb|ESR48603.1| hypothetical protein CICLE_v10000951mg [Citrus clementina]
 gb|KDO85096.1| hypothetical protein CISIN_1g042356mg [Citrus sinensis]
Length=492

 Score =   111 bits (278),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 50/66 (76%), Positives = 56/66 (85%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP K+RP+SSFN PF TTN GAPVWNN  ++T+G RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKFRPASSFNAPFFTTNSGAPVWNNNSSMTIGPRGPILLEDYHLVEKLANFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>gb|AAX88799.1| catalase [Euphorbia characias]
Length=493

 Score =   111 bits (278),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP K+RPSS++N+ F TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKFRPSSAYNSGFFTTNSGAPVWNNNNSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>ref|XP_006473794.1| PREDICTED: catalase isozyme 1-like isoform X4 [Citrus sinensis]
Length=492

 Score =   111 bits (278),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 50/66 (76%), Positives = 56/66 (85%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP K+RP+SSFN PF TTN GAPVWNN  ++T+G RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKFRPASSFNAPFFTTNSGAPVWNNNSSMTIGPRGPILLEDYHLVEKLANFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>sp|P48350.1|CATA1_CUCPE RecName: Full=Catalase isozyme 1 [Cucurbita pepo]
 dbj|BAA09506.1| catalase [Cucurbita pepo]
Length=492

 Score =   111 bits (278),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 50/66 (76%), Positives = 56/66 (85%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP ++RPSS+FN PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYRHRPSSAFNAPFWTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>emb|CDP07288.1| unnamed protein product [Coffea canephora]
Length=492

 Score =   111 bits (278),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 49/66 (74%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP K+RPSS+FN+PF TT+ GAPVW+N  +LTVG+RGP+LLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTSSGAPVWDNNSSLTVGTRGPVLLEDYHLVEKLANFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>gb|AHB72694.1| catalase [Beta vulgaris subsp. maritima]
Length=492

 Score =   111 bits (278),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 50/66 (76%), Positives = 55/66 (83%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP K+RPSS+ N P+CTTN GAPVWNN  +LTV  RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKFRPSSANNAPYCTTNSGAPVWNNNSSLTVSHRGPILLEDYHLVEKLANFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>ref|XP_010692546.1| PREDICTED: catalase [Beta vulgaris subsp. vulgaris]
Length=492

 Score =   111 bits (278),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 50/66 (76%), Positives = 55/66 (83%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP K+RPSS+ N P+CTTN GAPVWNN  +LTV  RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKFRPSSANNAPYCTTNSGAPVWNNNSSLTVSHRGPILLEDYHLVEKLANFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>emb|CAA73663.1| catalase [Chlamydomonas reinhardtii]
Length=492

 Score =   111 bits (277),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 49/66 (74%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP+K RPSS++NTP+ TTN GAPVWNN  ++TVG+RGPILLEDYHLVEK+  F RERIP
Sbjct  1    MDPAKIRPSSAYNTPYWTTNSGAPVWNNNNSMTVGTRGPILLEDYHLVEKLAQFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>ref|XP_001784759.1| predicted protein [Physcomitrella patens]
 gb|EDQ50419.1| predicted protein [Physcomitrella patens]
Length=492

 Score =   110 bits (276),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 50/66 (76%), Positives = 55/66 (83%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP KYRPSS +NTPF TTN G+PVWNN  +LTVG RGP+LLEDYHLVEK+  F RERIP
Sbjct  1    MDPYKYRPSSQYNTPFWTTNQGSPVWNNNNSLTVGPRGPVLLEDYHLVEKLAQFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>gb|ADU56189.1| catalase 1 [Jatropha curcas]
Length=152

 Score =   106 bits (264),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 48/66 (73%), Positives = 55/66 (83%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP K+ PSS+ NTPF TTN GAPVWNN  ++TVG RGPILLEDYH++EK+ NF RERIP
Sbjct  1    MDPYKHCPSSAHNTPFWTTNAGAPVWNNNSSMTVGQRGPILLEDYHMLEKLANFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>ref|XP_009108682.1| PREDICTED: catalase-2-like isoform X1 [Brassica rapa]
Length=514

 Score =   111 bits (277),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 50/66 (76%), Positives = 55/66 (83%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP KYRP+SS+N+PF T N GAPVWNN   +TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTANSGAPVWNNNSPMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>ref|XP_009108684.1| PREDICTED: catalase-2-like isoform X3 [Brassica rapa]
Length=474

 Score =   110 bits (275),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 50/66 (76%), Positives = 55/66 (83%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP KYRP+SS+N+PF T N GAPVWNN   +TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTANSGAPVWNNNSPMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>ref|XP_008348922.1| PREDICTED: catalase isozyme 1-like [Malus domestica]
Length=445

 Score =   110 bits (275),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 56/66 (85%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP KYRPSS+FN+PF TTN GAPV NN  +LTVG RGP+LLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAFNSPFWTTNAGAPVSNNNSSLTVGPRGPVLLEDYHLVEKLANFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>ref|XP_009108683.1| PREDICTED: catalase-2-like isoform X2 [Brassica rapa]
Length=496

 Score =   110 bits (276),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 50/66 (76%), Positives = 55/66 (83%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP KYRP+SS+N+PF T N GAPVWNN   +TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTANSGAPVWNNNSPMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>ref|XP_001752315.1| predicted protein [Physcomitrella patens]
 gb|EDQ83048.1| predicted protein [Physcomitrella patens]
Length=492

 Score =   110 bits (276),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 50/66 (76%), Positives = 55/66 (83%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP KYRPSS ++TPF TTN GAPVWNN  +LTVG RGP+LLEDYHLVEK+  F RERIP
Sbjct  1    MDPYKYRPSSQYDTPFWTTNQGAPVWNNNNSLTVGPRGPVLLEDYHLVEKLAQFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>ref|XP_003558892.1| PREDICTED: catalase-1 [Brachypodium distachyon]
Length=492

 Score =   110 bits (276),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 52/66 (79%), Positives = 55/66 (83%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP K+RPSSSFN P  +TN GAPVWNN  +LTVG RGPILLEDYHLVEKI NF RERIP
Sbjct  1    MDPYKHRPSSSFNGPMWSTNSGAPVWNNDNSLTVGPRGPILLEDYHLVEKIANFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>gb|KCW68093.1| hypothetical protein EUGRSUZ_F01775 [Eucalyptus grandis]
Length=399

 Score =   109 bits (273),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 49/66 (74%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP KYRPSS++++ F TTN GAPVWNN  +LTVG+RGPILLEDYHL+EK+ NF RERIP
Sbjct  1    MDPYKYRPSSAYDSSFWTTNYGAPVWNNDSSLTVGTRGPILLEDYHLLEKLANFERERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>ref|XP_008382478.1| PREDICTED: catalase isozyme 1-like [Malus domestica]
Length=453

 Score =   110 bits (274),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 56/66 (85%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP KYRPSS+FN+PF TTN GAPV NN  +LTVG RGP+LLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAFNSPFWTTNAGAPVSNNNSSLTVGPRGPVLLEDYHLVEKLANFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>ref|XP_006382992.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60789.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
Length=490

 Score =   110 bits (275),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = +3

Query  93   KYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIPXRVV  272
            +YRPSSS+N+PF TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP RVV
Sbjct  3    QYRPSSSYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIPERVV  62

Query  273  HA  278
            HA
Sbjct  63   HA  64



>ref|XP_010536470.1| PREDICTED: catalase-2-like [Tarenaya hassleriana]
Length=492

 Score =   110 bits (275),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 50/66 (76%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP KYRPSS+ ++PF TTN GAPVWNN  +LTVG+RGPILLEDYHL+EK+ NF RERIP
Sbjct  1    MDPYKYRPSSAHSSPFFTTNSGAPVWNNNSSLTVGTRGPILLEDYHLLEKLANFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>ref|XP_010061172.1| PREDICTED: catalase isozyme 3-like [Eucalyptus grandis]
 gb|KCW68094.1| hypothetical protein EUGRSUZ_F01776 [Eucalyptus grandis]
Length=492

 Score =   110 bits (275),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 49/66 (74%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP KYRPSS++++ F TTN GAPVWNN  +LTVG+RGPILLEDYHL+EK+ NF RERIP
Sbjct  1    MDPYKYRPSSAYDSSFWTTNYGAPVWNNDSSLTVGTRGPILLEDYHLIEKLANFERERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>ref|XP_009392261.1| PREDICTED: catalase isozyme A-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=492

 Score =   110 bits (274),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 50/66 (76%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP K+RPSSSF+T F TTN GAPVWN+  ALT+GSRGPILLEDYHL+EK+ +F RERIP
Sbjct  1    MDPYKFRPSSSFDTNFTTTNAGAPVWNDDQALTMGSRGPILLEDYHLIEKVAHFARERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>ref|XP_004145541.1| PREDICTED: catalase isozyme 1-like [Cucumis sativus]
 ref|XP_004157075.1| PREDICTED: catalase isozyme 1-like [Cucumis sativus]
Length=973

 Score =   112 bits (280),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 56/66 (85%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP ++RPSS +NTPF TTN GAPVWNN  +LTVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYRHRPSSGYNTPFWTTNSGAPVWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66


 Score =   107 bits (267),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 49/60 (82%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = +3

Query  99   RPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIPXRVVHA  278
            RPSS+F+TPF TTN GAPVWNN  ALT+GSRGPILLEDYHLVEK+ NF RERIP RVVHA
Sbjct  488  RPSSAFDTPFWTTNSGAPVWNNNSALTIGSRGPILLEDYHLVEKLANFDRERIPERVVHA  547



>ref|XP_004238430.1| PREDICTED: catalase isozyme 3 [Solanum lycopersicum]
Length=492

 Score =   110 bits (274),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP KYRPSS+ N+PF TTN GAPV+NN  +LTVG+RGPILLEDYHL+EKI NF RERIP
Sbjct  1    MDPYKYRPSSAANSPFMTTNSGAPVYNNNSSLTVGTRGPILLEDYHLLEKIANFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>gb|AIS20825.1| CAT [Pyrus x bretschneideri]
Length=492

 Score =   110 bits (274),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 52/66 (79%), Positives = 56/66 (85%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP KYRPSS+FN+PF TTN GAPV NN  +LTVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAFNSPFWTTNSGAPVSNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>ref|XP_010918244.1| PREDICTED: catalase isozyme 1 [Elaeis guineensis]
Length=492

 Score =   110 bits (274),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 49/66 (74%), Positives = 56/66 (85%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP KYRPSS++N+PF TTN GAPVWNN  +LTVG RGPILLEDYH++EK+  F RERIP
Sbjct  1    MDPYKYRPSSAYNSPFWTTNSGAPVWNNNSSLTVGIRGPILLEDYHVIEKLAQFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>gb|ADU56199.1| catalase [Hevea brasiliensis]
Length=492

 Score =   110 bits (274),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 56/66 (85%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP K+RPSS+ N+ F TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKFRPSSAHNSSFFTTNSGAPVWNNNNSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>emb|CAA45564.1| catalase [Arabidopsis thaliana]
Length=492

 Score =   110 bits (274),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 50/66 (76%), Positives = 56/66 (85%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RG ILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGLILLEDYHLVEKLANFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>prf||1906388A catalase
Length=492

 Score =   110 bits (274),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 50/66 (76%), Positives = 56/66 (85%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RG ILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGLILLEDYHLVEKLANFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>dbj|BAA34714.1| catalase [Oryza sativa]
Length=492

 Score =   110 bits (274),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 52/66 (79%), Positives = 55/66 (83%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP K RPSSSFN P  +TN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKGRPSSSFNGPLWSTNSGAPVWNNNNSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>ref|XP_010061174.1| PREDICTED: catalase isozyme 3-like isoform X2 [Eucalyptus grandis]
 gb|KCW68092.1| hypothetical protein EUGRSUZ_F01775 [Eucalyptus grandis]
Length=492

 Score =   109 bits (273),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 49/66 (74%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP KYRPSS++++ F TTN GAPVWNN  +LTVG+RGPILLEDYHL+EK+ NF RERIP
Sbjct  1    MDPYKYRPSSAYDSSFWTTNYGAPVWNNDSSLTVGTRGPILLEDYHLLEKLANFERERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>ref|XP_009392260.1| PREDICTED: catalase isozyme A-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=511

 Score =   110 bits (274),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 50/66 (76%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP K+RPSSSF+T F TTN GAPVWN+  ALT+GSRGPILLEDYHL+EK+ +F RERIP
Sbjct  1    MDPYKFRPSSSFDTNFTTTNAGAPVWNDDQALTMGSRGPILLEDYHLIEKVAHFARERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>gb|KCW68095.1| hypothetical protein EUGRSUZ_F01777 [Eucalyptus grandis]
Length=584

 Score =   110 bits (276),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 50/70 (71%), Positives = 58/70 (83%), Gaps = 0/70 (0%)
 Frame = +3

Query  69   PLISMDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTR  248
            P  +MDP KYRPSS+ ++ F TTN GAPVWNN  +LTVG+RGP+LLEDYHL+EKI NF R
Sbjct  89   PPTAMDPYKYRPSSAHDSSFWTTNSGAPVWNNNASLTVGTRGPVLLEDYHLLEKIANFDR  148

Query  249  ERIPXRVVHA  278
            ERIP RVVHA
Sbjct  149  ERIPERVVHA  158



>ref|XP_011022152.1| PREDICTED: catalase-2-like isoform X1 [Populus euphratica]
Length=511

 Score =   110 bits (274),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = +3

Query  93   KYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIPXRVV  272
            +YRPSSS+N+PF TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP RVV
Sbjct  24   QYRPSSSYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIPERVV  83

Query  273  HA  278
            HA
Sbjct  84   HA  85



>gb|AAG61140.2|AF332973_1 catalase 2 [Zantedeschia aethiopica]
Length=492

 Score =   109 bits (273),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 49/66 (74%), Positives = 55/66 (83%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP KYRPSSS++  F TTN G PVWN+  ALTVGSRGPILLEDYHL+EK+ +F RERIP
Sbjct  1    MDPCKYRPSSSYDASFTTTNAGGPVWNDDVALTVGSRGPILLEDYHLIEKVAHFARERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>gb|ACH63223.1| catalase [Rheum australe]
Length=492

 Score =   109 bits (273),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 50/66 (76%), Positives = 56/66 (85%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP K+RPSS+ ++P+ TTN GAPVWNN  +LTVG RGPILLEDYHLVEKI NF RERIP
Sbjct  1    MDPYKFRPSSAHDSPYWTTNSGAPVWNNNSSLTVGPRGPILLEDYHLVEKIVNFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>sp|P45739.1|CATA_HELAN RecName: Full=Catalase [Helianthus annuus]
 gb|AAA69866.1| catalase [Helianthus annuus]
Length=492

 Score =   109 bits (273),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 56/66 (85%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP KYR SS++N PF TTN GAPV+NN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRSSSAYNAPFWTTNSGAPVYNNNNSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>prf||2104177A catalase
Length=492

 Score =   109 bits (273),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 56/66 (85%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP KYR SS++N PF TTN GAPV+NN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRSSSAYNAPFWTTNSGAPVYNNNNSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>gb|AHA50082.1| catalase [Eleutherococcus senticosus]
Length=492

 Score =   109 bits (273),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 50/66 (76%), Positives = 55/66 (83%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP KYRPSS+FN+P+ TTN GAP WNN  +LTVG+RGPILLEDY LVE I NF RERIP
Sbjct  1    MDPYKYRPSSAFNSPYWTTNSGAPAWNNNSSLTVGTRGPILLEDYQLVEIIANFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>gb|AAF61733.1|AF243518_1 catalase 3 [Helianthus annuus]
Length=492

 Score =   109 bits (273),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 49/66 (74%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP K RPSS++N PF TTN G PV+NNT +LTVG+RGPILLEDYHL+EK+ NFTRERIP
Sbjct  1    MDPYKQRPSSAYNAPFWTTNAGLPVYNNTASLTVGNRGPILLEDYHLIEKLANFTRERIP  60

Query  261  XRVVHA  278
             R+VHA
Sbjct  61   ERIVHA  66



>ref|XP_010061173.1| PREDICTED: catalase isozyme 2-like isoform X1 [Eucalyptus grandis]
Length=496

 Score =   109 bits (273),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 49/66 (74%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP KYRPSS++++ F TTN GAPVWNN  +LTVG+RGPILLEDYHL+EK+ NF RERIP
Sbjct  1    MDPYKYRPSSAYDSSFWTTNYGAPVWNNDSSLTVGTRGPILLEDYHLLEKLANFERERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>gb|ABK24543.1| unknown [Picea sitchensis]
Length=492

 Score =   109 bits (273),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 48/66 (73%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP K+RPSS++N+P+ TTN GAPVWNNT +LTVG+RGP+LLEDYHL+EK   F RERIP
Sbjct  1    MDPYKHRPSSAYNSPYLTTNQGAPVWNNTSSLTVGARGPVLLEDYHLIEKFAAFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>ref|XP_010061175.1| PREDICTED: catalase-like [Eucalyptus grandis]
Length=492

 Score =   109 bits (273),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 49/66 (74%), Positives = 56/66 (85%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP KYRPSS+ ++ F TTN GAPVWNN  +LTVG+RGP+LLEDYHL+EKI NF RERIP
Sbjct  1    MDPYKYRPSSAHDSSFWTTNSGAPVWNNNASLTVGTRGPVLLEDYHLLEKIANFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>emb|CAE82295.1| catalase [Homogyne alpina]
Length=492

 Score =   109 bits (272),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 48/66 (73%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP K RP+S++N+PF TTN G PV+NNT +LTVG+RGPILLEDYHL+EK+ NFTRERIP
Sbjct  1    MDPYKQRPASAYNSPFLTTNAGLPVYNNTASLTVGNRGPILLEDYHLIEKLANFTRERIP  60

Query  261  XRVVHA  278
             R+VHA
Sbjct  61   ERIVHA  66



>gb|KGN55500.1| hypothetical protein Csa_4G658600 [Cucumis sativus]
Length=405

 Score =   108 bits (270),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 50/63 (79%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = +3

Query  90   SKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIPXRV  269
            S  RPSS+F+TPF TTN GAPVWNN  ALT+GSRGPILLEDYHLVEK+ NF RERIP RV
Sbjct  3    SHQRPSSAFDTPFWTTNSGAPVWNNNSALTIGSRGPILLEDYHLVEKLANFDRERIPERV  62

Query  270  VHA  278
            VHA
Sbjct  63   VHA  65



>ref|XP_006342134.1| PREDICTED: catalase isozyme 3-like [Solanum tuberosum]
Length=492

 Score =   109 bits (272),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 50/66 (76%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP KYRPSS+ N+PF TTN GAPV+NN  +LTVG+RGPILLEDYHL+EK+ NF RERIP
Sbjct  1    MDPYKYRPSSAANSPFMTTNSGAPVYNNNSSLTVGTRGPILLEDYHLLEKLANFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>ref|XP_010498496.1| PREDICTED: catalase-3 [Camelina sativa]
 ref|XP_010459748.1| PREDICTED: catalase-3 [Camelina sativa]
 ref|XP_010477307.1| PREDICTED: catalase-3 [Camelina sativa]
Length=492

 Score =   109 bits (272),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 48/66 (73%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP KYRPSS++NT F T+NGGAP+ NN  +LT+G RGP+LLEDYHL+EK+ NFTRERIP
Sbjct  1    MDPYKYRPSSAYNTSFYTSNGGAPISNNISSLTIGERGPVLLEDYHLIEKVANFTRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>gb|AAF61732.1|AF243517_1 catalase 2 [Helianthus annuus]
Length=492

 Score =   109 bits (272),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 50/66 (76%), Positives = 56/66 (85%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP KYRPSS++N PF TTN GAPV+NN  +LTVG+RGPILLEDYH VEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAYNAPFWTTNYGAPVYNNDSSLTVGTRGPILLEDYHFVEKLANFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>ref|XP_008802866.1| PREDICTED: catalase isozyme 1 [Phoenix dactylifera]
Length=492

 Score =   108 bits (271),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 49/66 (74%), Positives = 56/66 (85%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP KYRPSS+ N+PF TTN GAPVWNN  +LTVG+RGPILLEDYH++EK+  F RERIP
Sbjct  1    MDPYKYRPSSANNSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHVIEKLAQFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>sp|P17598.2|CATA1_GOSHI RecName: Full=Catalase isozyme 1 [Gossypium hirsutum]
 emb|CAA36380.1| unnamed protein product [Gossypium hirsutum]
Length=492

 Score =   108 bits (271),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 50/66 (76%), Positives = 55/66 (83%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP K+RPSS+FN+PF TTN GAPVWNN  +LTVG RG  LLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGPRGQYLLEDYHLVEKLANFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>ref|XP_007210576.1| hypothetical protein PRUPE_ppa004763mg [Prunus persica]
 gb|EMJ11775.1| hypothetical protein PRUPE_ppa004763mg [Prunus persica]
Length=492

 Score =   108 bits (271),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 48/66 (73%), Positives = 56/66 (85%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP K+RPSS+F++P+ TTN GAPVWNN  +LTVG RGP+LLEDYHLVEK+  F RERIP
Sbjct  1    MDPYKHRPSSAFDSPYWTTNAGAPVWNNDSSLTVGPRGPVLLEDYHLVEKLATFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>ref|XP_008237989.1| PREDICTED: catalase isozyme 1-like [Prunus mume]
Length=492

 Score =   108 bits (271),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 48/66 (73%), Positives = 56/66 (85%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP K+RPSS+F++P+ TTN GAPVWNN  +LTVG RGP+LLEDYHLVEK+  F RERIP
Sbjct  1    MDPYKHRPSSAFDSPYWTTNAGAPVWNNDSSLTVGPRGPVLLEDYHLVEKLATFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>ref|XP_002963086.1| hypothetical protein SELMODRAFT_438313 [Selaginella moellendorffii]
 gb|EFJ36549.1| hypothetical protein SELMODRAFT_438313 [Selaginella moellendorffii]
Length=484

 Score =   108 bits (271),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 50/66 (76%), Positives = 55/66 (83%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP KYRPSS++N+   TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+  F RERIP
Sbjct  1    MDPYKYRPSSAYNSAHFTTNTGAPVWNNNASLTVGSRGPILLEDYHLVEKLAQFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>emb|CAD42909.1| catalase [Prunus persica]
Length=492

 Score =   108 bits (271),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 48/66 (73%), Positives = 56/66 (85%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP K+RPSS+F++P+ TTN GAPVWNN  +LTVG RGP+LLEDYHLVEK+  F RERIP
Sbjct  1    MDPYKHRPSSAFDSPYWTTNAGAPVWNNDSSLTVGPRGPVLLEDYHLVEKLATFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>ref|XP_002980247.1| hypothetical protein SELMODRAFT_178171 [Selaginella moellendorffii]
 gb|EFJ18507.1| hypothetical protein SELMODRAFT_178171 [Selaginella moellendorffii]
Length=492

 Score =   108 bits (271),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 50/66 (76%), Positives = 55/66 (83%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP KYRPSS++N+   TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+  F RERIP
Sbjct  1    MDPYKYRPSSAYNSAHFTTNTGAPVWNNNASLTVGSRGPILLEDYHLVEKLAQFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>ref|XP_010934843.1| PREDICTED: catalase isozyme 2 [Elaeis guineensis]
 gb|AFS65099.1| catalase 2 [Elaeis guineensis]
Length=492

 Score =   108 bits (271),  Expect = 9e-26, Method: Composition-based stats.
 Identities = 49/66 (74%), Positives = 56/66 (85%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP K+RPSS+F+T + TTN G PVWN+  ALTVGSRGPILLEDYHL+EKI +F RERIP
Sbjct  1    MDPYKFRPSSAFDTAYTTTNAGGPVWNDDQALTVGSRGPILLEDYHLIEKIAHFARERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>gb|AAF19965.1|AF207906_1 catalase 1 [Zantedeschia aethiopica]
Length=492

 Score =   108 bits (271),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 49/66 (74%), Positives = 56/66 (85%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP + RPSS+FN+PF TTN GAPVWNN  +LTVG+RGPILLEDYHL+EK+  F RERIP
Sbjct  1    MDPYRQRPSSAFNSPFWTTNSGAPVWNNNNSLTVGARGPILLEDYHLLEKLAQFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>ref|XP_002950455.1| catalase [Volvox carteri f. nagariensis]
 gb|EFJ48656.1| catalase [Volvox carteri f. nagariensis]
Length=498

 Score =   108 bits (271),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 48/66 (73%), Positives = 56/66 (85%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDPSK RPSS++N+P+ TTN GAPVWNN  ++TVG RGPILLEDYHL+EK+  F RERIP
Sbjct  1    MDPSKVRPSSAYNSPYWTTNSGAPVWNNNNSMTVGPRGPILLEDYHLIEKLAQFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>ref|XP_004500876.1| PREDICTED: catalase-4-like isoform X1 [Cicer arietinum]
Length=493

 Score =   108 bits (271),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = +3

Query  93   KYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIPXRVV  272
            ++RPSS+FN+PF TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP RVV
Sbjct  6    QHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIPERVV  65

Query  273  HA  278
            HA
Sbjct  66   HA  67



>gb|KFK44176.1| hypothetical protein AALP_AA1G224400 [Arabis alpina]
Length=492

 Score =   108 bits (271),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 49/66 (74%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP ++RPSS+ ++PF TTN GAPVWNN  +LTVG+RGPILLEDYHL+EKI NF RERIP
Sbjct  1    MDPYRFRPSSANDSPFFTTNSGAPVWNNNSSLTVGTRGPILLEDYHLLEKIANFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>ref|XP_008791900.1| PREDICTED: catalase isozyme 2 [Phoenix dactylifera]
Length=492

 Score =   108 bits (271),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 49/66 (74%), Positives = 56/66 (85%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP K+RPSSSF+T + TTN G PVWN+  ALTVG+RGPILLEDYHL+EKI +F RERIP
Sbjct  1    MDPYKFRPSSSFDTTYTTTNAGGPVWNDDQALTVGARGPILLEDYHLIEKIAHFARERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>gb|ADQ28492.1| catalase [Aeluropus littoralis]
Length=494

 Score =   108 bits (270),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 50/66 (76%), Positives = 54/66 (82%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP K+RPSSSF+T   TTN GAPVWNN  ALTVG RGPILLEDYHL+EK+  F RERIP
Sbjct  1    MDPCKFRPSSSFDTNVWTTNAGAPVWNNNSALTVGQRGPILLEDYHLIEKLAQFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



>ref|XP_008812256.1| PREDICTED: catalase isozyme B [Phoenix dactylifera]
Length=478

 Score =   108 bits (269),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 48/66 (73%), Positives = 54/66 (82%), Gaps = 0/66 (0%)
 Frame = +3

Query  81   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIXNFTRERIP  260
            MDP K+RPSS+ N PF TTN GAPVWNN  +LTVGSRGP+ LEDYHL+EK+  F RERIP
Sbjct  1    MDPYKHRPSSTHNAPFWTTNSGAPVWNNNSSLTVGSRGPVFLEDYHLIEKLAQFDRERIP  60

Query  261  XRVVHA  278
             RVVHA
Sbjct  61   ERVVHA  66



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 559814424900