BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF045M19

Length=800
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009590288.1|  PREDICTED: oligopeptide transporter 3              413   5e-136   Nicotiana tomentosiformis
ref|XP_011095913.1|  PREDICTED: oligopeptide transporter 3              413   6e-136   Sesamum indicum [beniseed]
gb|KEH32684.1|  oligopeptide transporter OPT family protein             405   2e-135   Medicago truncatula
gb|KDO78545.1|  hypothetical protein CISIN_1g004659mg                   400   2e-135   Citrus sinensis [apfelsine]
emb|CDP04526.1|  unnamed protein product                                410   1e-134   Coffea canephora [robusta coffee]
gb|KDO78543.1|  hypothetical protein CISIN_1g004659mg                   400   4e-134   Citrus sinensis [apfelsine]
ref|XP_006352325.1|  PREDICTED: oligopeptide transporter 3-like         409   4e-134   Solanum tuberosum [potatoes]
gb|KDO78544.1|  hypothetical protein CISIN_1g004659mg                   401   9e-134   Citrus sinensis [apfelsine]
ref|XP_004250295.1|  PREDICTED: oligopeptide transporter 3              407   1e-133   Solanum lycopersicum
gb|EYU27660.1|  hypothetical protein MIMGU_mgv1a001879mg                403   4e-132   Erythranthe guttata [common monkey flower]
gb|KEH32683.1|  oligopeptide transporter OPT family protein             402   9e-132   Medicago truncatula
ref|XP_011040169.1|  PREDICTED: oligopeptide transporter 3              402   1e-131   Populus euphratica
sp|O23482.3|OPT3_ARATH  RecName: Full=Oligopeptide transporter 3;...    401   2e-131   Arabidopsis thaliana [mouse-ear cress]
ref|NP_567493.5|  oligopeptide transporter                              401   2e-131   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002308764.1|  OLIGOPEPTIDE TRANSPORTER family protein            400   5e-131   Populus trichocarpa [western balsam poplar]
ref|XP_011002374.1|  PREDICTED: oligopeptide transporter 3-like         400   6e-131   Populus euphratica
gb|AAK96781.1|  Unknown protein                                         399   9e-131   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006414361.1|  hypothetical protein EUTSA_v10024512mg             399   1e-130   Eutrema salsugineum [saltwater cress]
ref|XP_002273768.2|  PREDICTED: oligopeptide transporter 3              399   1e-130   Vitis vinifera
emb|CBI18634.3|  unnamed protein product                                399   1e-130   Vitis vinifera
ref|XP_002868139.1|  hypothetical protein ARALYDRAFT_355122             399   2e-130   Arabidopsis lyrata subsp. lyrata
ref|XP_010087657.1|  Oligopeptide transporter 3                         397   4e-130   
ref|XP_010449801.1|  PREDICTED: oligopeptide transporter 3              398   4e-130   Camelina sativa [gold-of-pleasure]
ref|XP_010440168.1|  PREDICTED: oligopeptide transporter 3-like         397   5e-130   Camelina sativa [gold-of-pleasure]
ref|XP_004507597.1|  PREDICTED: oligopeptide transporter 3-like         397   5e-130   Cicer arietinum [garbanzo]
gb|KDO78542.1|  hypothetical protein CISIN_1g004659mg                   397   6e-130   Citrus sinensis [apfelsine]
ref|XP_006283198.1|  hypothetical protein CARUB_v10004230mg             397   7e-130   Capsella rubella
ref|XP_007154044.1|  hypothetical protein PHAVU_003G086500g             397   8e-130   Phaseolus vulgaris [French bean]
ref|XP_006467278.1|  PREDICTED: oligopeptide transporter 3-like         397   8e-130   Citrus sinensis [apfelsine]
ref|XP_006449924.1|  hypothetical protein CICLE_v10014396mg             397   1e-129   Citrus clementina [clementine]
ref|XP_010907563.1|  PREDICTED: oligopeptide transporter 3-like         396   2e-129   Elaeis guineensis
ref|XP_009773627.1|  PREDICTED: oligopeptide transporter 3              396   2e-129   Nicotiana sylvestris
ref|XP_009124517.1|  PREDICTED: oligopeptide transporter 3              395   2e-129   Brassica rapa
ref|XP_010436532.1|  PREDICTED: oligopeptide transporter 3              395   3e-129   Camelina sativa [gold-of-pleasure]
ref|XP_007026363.1|  Oligopeptide transporter isoform 2                 394   3e-129   
ref|XP_003529676.1|  PREDICTED: oligopeptide transporter 3-like         394   2e-128   Glycine max [soybeans]
gb|ADW09325.1|  oligopeptide transporter 3                              393   2e-128   Noccaea caerulescens
ref|XP_010270227.1|  PREDICTED: oligopeptide transporter 3              394   2e-128   Nelumbo nucifera [Indian lotus]
gb|KHG20373.1|  Oligopeptide transporter 3 -like protein                393   3e-128   Gossypium arboreum [tree cotton]
ref|XP_007026362.1|  Oligopeptide transporter isoform 1                 393   4e-128   
gb|KJB67417.1|  hypothetical protein B456_010G190300                    392   4e-128   Gossypium raimondii
ref|XP_010939248.1|  PREDICTED: oligopeptide transporter 3-like         392   5e-128   Elaeis guineensis
emb|CDY42539.1|  BnaC08g10640D                                          392   6e-128   Brassica napus [oilseed rape]
ref|XP_003549274.1|  PREDICTED: oligopeptide transporter 3-like         392   8e-128   Glycine max [soybeans]
ref|XP_008785648.1|  PREDICTED: oligopeptide transporter 3-like         391   1e-127   Phoenix dactylifera
ref|XP_008224626.1|  PREDICTED: oligopeptide transporter 3              391   1e-127   Prunus mume [ume]
gb|KDP35505.1|  hypothetical protein JCGZ_08943                         391   2e-127   Jatropha curcas
ref|XP_008780991.1|  PREDICTED: oligopeptide transporter 3-like         391   2e-127   Phoenix dactylifera
ref|XP_010039442.1|  PREDICTED: oligopeptide transporter 3-like         390   3e-127   Eucalyptus grandis [rose gum]
ref|XP_009380132.1|  PREDICTED: oligopeptide transporter 3-like         389   6e-127   Musa acuminata subsp. malaccensis [pisang utan]
gb|KFK26550.1|  hypothetical protein AALP_AA8G263100                    389   8e-127   Arabis alpina [alpine rockcress]
ref|XP_008464311.1|  PREDICTED: oligopeptide transporter 3              389   1e-126   Cucumis melo [Oriental melon]
ref|XP_004139520.1|  PREDICTED: oligopeptide transporter 3-like         387   9e-126   Cucumis sativus [cucumbers]
ref|XP_010686627.1|  PREDICTED: oligopeptide transporter 3              384   6e-125   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010057794.1|  PREDICTED: oligopeptide transporter 3-like         384   6e-125   Eucalyptus grandis [rose gum]
ref|XP_008345787.1|  PREDICTED: oligopeptide transporter 3-like         385   7e-125   Malus domestica [apple tree]
gb|ABF70152.1|  oligopeptide transporter OPT family protein             384   8e-125   Musa acuminata [banana]
ref|XP_009397220.1|  PREDICTED: oligopeptide transporter 3-like         382   4e-124   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009374520.1|  PREDICTED: oligopeptide transporter 3              382   5e-124   Pyrus x bretschneideri [bai li]
ref|XP_010542186.1|  PREDICTED: oligopeptide transporter 3              380   2e-123   Tarenaya hassleriana [spider flower]
ref|XP_004295330.1|  PREDICTED: oligopeptide transporter 3              379   8e-123   Fragaria vesca subsp. vesca
ref|XP_009404107.1|  PREDICTED: oligopeptide transporter 3-like         376   1e-121   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007211357.1|  hypothetical protein PRUPE_ppa001984mg             375   3e-121   
ref|XP_009374859.1|  PREDICTED: oligopeptide transporter 3-like         375   4e-121   Pyrus x bretschneideri [bai li]
ref|XP_008349335.1|  PREDICTED: oligopeptide transporter 3-like         373   2e-120   
gb|KCW45990.1|  hypothetical protein EUGRSUZ_L00158                     370   4e-119   Eucalyptus grandis [rose gum]
ref|XP_010039444.1|  PREDICTED: oligopeptide transporter 3-like i...    370   5e-119   Eucalyptus grandis [rose gum]
ref|XP_006856263.1|  hypothetical protein AMTR_s00047p00062520          367   3e-118   Amborella trichopoda
ref|XP_002463867.1|  hypothetical protein SORBIDRAFT_01g007880          366   8e-118   Sorghum bicolor [broomcorn]
gb|ACL82964.1|  glutathione transporter                                 365   2e-117   Zea mays [maize]
ref|XP_004981750.1|  PREDICTED: LOW QUALITY PROTEIN: oligopeptide...    365   3e-117   
ref|XP_003559475.2|  PREDICTED: LOW QUALITY PROTEIN: oligopeptide...    355   2e-116   
ref|XP_008665425.1|  PREDICTED: oligopeptide transporter 3              361   8e-116   
gb|ABB55328.1|  small oligopeptide transporter, OPT family              361   1e-115   Asparagus officinalis
gb|AAQ91200.1|  putative glutathione transporter                        355   1e-113   Zea mays [maize]
dbj|BAK07444.1|  predicted protein                                      353   1e-112   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006651827.1|  PREDICTED: oligopeptide transporter 3-like         351   6e-112   
gb|AAO32313.1|  putative oligopeptide transporter protein               350   8e-112   Oryza sativa Japonica Group [Japonica rice]
gb|KHN42268.1|  Oligopeptide transporter 3                              348   1e-111   Glycine soja [wild soybean]
gb|ADW66457.1|  oligopeptide transporter                                350   1e-111   Phytolacca americana [common pokeberry]
ref|NP_001051290.1|  Os03g0751100                                       350   2e-111   
gb|EMT33592.1|  Oligopeptide transporter 3                              349   4e-111   
ref|XP_010039443.1|  PREDICTED: oligopeptide transporter 3-like         332   6e-105   Eucalyptus grandis [rose gum]
emb|CAB10414.1|  isp4 like protein                                      329   4e-104   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002522882.1|  Oligopeptide transporter, putative                 326   2e-102   
gb|KHN03544.1|  Oligopeptide transporter 3                              305   2e-94    Glycine soja [wild soybean]
emb|CDP04527.1|  unnamed protein product                                295   3e-91    Coffea canephora [robusta coffee]
gb|AEJ88342.1|  putative oligopeptide transporter                       286   3e-89    Tamarix hispida
emb|CAD91127.1|  glutathione transporter GT1                            290   3e-89    Brassica juncea [brown mustard]
ref|XP_006376658.1|  hypothetical protein POPTR_0012s02660g             280   9e-89    
gb|EYU33488.1|  hypothetical protein MIMGU_mgv1a0023121mg               285   1e-88    Erythranthe guttata [common monkey flower]
ref|XP_008361590.1|  PREDICTED: oligopeptide transporter 2-like         286   1e-88    
ref|XP_002323123.2|  OLIGOPEPTIDE TRANSPORTER family protein            288   1e-88    
gb|EMS48793.1|  Oligopeptide transporter 3                              285   2e-88    Triticum urartu
ref|XP_010676880.1|  PREDICTED: oligopeptide transporter 7-like         290   2e-88    Beta vulgaris subsp. vulgaris [field beet]
gb|KJB32170.1|  hypothetical protein B456_005G227300                    289   4e-88    Gossypium raimondii
dbj|BAJ97716.1|  predicted protein                                      283   6e-88    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KJB32172.1|  hypothetical protein B456_005G227300                    281   6e-88    Gossypium raimondii
ref|XP_010090590.1|  Oligopeptide transporter 7                         287   8e-88    
ref|XP_010267481.1|  PREDICTED: oligopeptide transporter 7-like         287   1e-87    Nelumbo nucifera [Indian lotus]
ref|XP_006851884.1|  hypothetical protein AMTR_s00041p00121000          287   1e-87    
ref|XP_004136415.1|  PREDICTED: oligopeptide transporter 2-like         286   3e-87    Cucumis sativus [cucumbers]
ref|XP_002981747.1|  hypothetical protein SELMODRAFT_179057             286   5e-87    Selaginella moellendorffii
ref|XP_011070370.1|  PREDICTED: oligopeptide transporter 7              286   6e-87    Sesamum indicum [beniseed]
ref|XP_002967597.1|  hypothetical protein SELMODRAFT_88962              286   7e-87    Selaginella moellendorffii
gb|KJB24153.1|  hypothetical protein B456_004G130200                    286   7e-87    Gossypium raimondii
ref|XP_006376659.1|  hypothetical protein POPTR_0012s02660g             280   8e-87    
gb|EMT01286.1|  Oligopeptide transporter 4                              285   9e-87    
ref|XP_002963418.1|  hypothetical protein SELMODRAFT_166204             285   9e-87    Selaginella moellendorffii
ref|XP_010676881.1|  PREDICTED: oligopeptide transporter 7              285   1e-86    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010538850.1|  PREDICTED: oligopeptide transporter 7              285   1e-86    Tarenaya hassleriana [spider flower]
ref|XP_006343795.1|  PREDICTED: oligopeptide transporter 7-like         285   2e-86    Solanum tuberosum [potatoes]
gb|KHG17687.1|  Oligopeptide transporter 7                              285   2e-86    Gossypium arboreum [tree cotton]
ref|XP_008466130.1|  PREDICTED: oligopeptide transporter 2              284   2e-86    Cucumis melo [Oriental melon]
gb|KHG17686.1|  Oligopeptide transporter 7                              285   2e-86    Gossypium arboreum [tree cotton]
gb|EPS60835.1|  hypothetical protein M569_13965                         284   2e-86    Genlisea aurea
ref|XP_009358688.1|  PREDICTED: LOW QUALITY PROTEIN: oligopeptide...    284   2e-86    
ref|XP_010553673.1|  PREDICTED: oligopeptide transporter 2              283   3e-86    Tarenaya hassleriana [spider flower]
ref|XP_008338986.1|  PREDICTED: oligopeptide transporter 2-like         283   3e-86    
gb|EMS68344.1|  Oligopeptide transporter 4                              283   3e-86    Triticum urartu
ref|XP_009359568.1|  PREDICTED: LOW QUALITY PROTEIN: oligopeptide...    284   3e-86    Pyrus x bretschneideri [bai li]
gb|KDP25233.1|  hypothetical protein JCGZ_20389                         284   4e-86    Jatropha curcas
gb|EMS65129.1|  Oligopeptide transporter 7                              285   4e-86    Triticum urartu
ref|XP_002971556.1|  hypothetical protein SELMODRAFT_172313             283   6e-86    Selaginella moellendorffii
ref|XP_009765351.1|  PREDICTED: oligopeptide transporter 7-like         283   6e-86    Nicotiana sylvestris
emb|CDP12213.1|  unnamed protein product                                283   7e-86    Coffea canephora [robusta coffee]
ref|XP_008239235.1|  PREDICTED: oligopeptide transporter 7-like         283   8e-86    Prunus mume [ume]
ref|XP_009366376.1|  PREDICTED: oligopeptide transporter 2-like         282   8e-86    Pyrus x bretschneideri [bai li]
ref|XP_007220230.1|  hypothetical protein PRUPE_ppa002014mg             282   9e-86    Prunus persica
ref|XP_002272972.2|  PREDICTED: oligopeptide transporter 7              283   9e-86    Vitis vinifera
ref|XP_008234693.1|  PREDICTED: oligopeptide transporter 6-like         282   1e-85    Prunus mume [ume]
ref|XP_007039426.1|  Oligopeptide transporter 7 isoform 1               283   1e-85    
ref|XP_002437735.1|  hypothetical protein SORBIDRAFT_10g001530          283   1e-85    Sorghum bicolor [broomcorn]
ref|XP_004245468.1|  PREDICTED: oligopeptide transporter 7-like         282   1e-85    Solanum lycopersicum
ref|XP_002303684.2|  hypothetical protein POPTR_0003s14540g             283   1e-85    
ref|XP_008390299.1|  PREDICTED: oligopeptide transporter 7 isofor...    281   2e-85    Malus domestica [apple tree]
ref|XP_004143945.1|  PREDICTED: oligopeptide transporter 7-like         281   3e-85    Cucumis sativus [cucumbers]
ref|XP_002313213.2|  hypothetical protein POPTR_0009s08290g             281   3e-85    Populus trichocarpa [western balsam poplar]
ref|XP_006397011.1|  hypothetical protein EUTSA_v10028453mg             281   5e-85    Eutrema salsugineum [saltwater cress]
ref|XP_004309550.1|  PREDICTED: oligopeptide transporter 7              281   5e-85    Fragaria vesca subsp. vesca
ref|XP_010267482.1|  PREDICTED: oligopeptide transporter 7-like         281   5e-85    Nelumbo nucifera [Indian lotus]
ref|XP_011022429.1|  PREDICTED: oligopeptide transporter 7-like         281   5e-85    Populus euphratica
ref|XP_010246854.1|  PREDICTED: oligopeptide transporter 7-like         281   6e-85    Nelumbo nucifera [Indian lotus]
ref|XP_009801973.1|  PREDICTED: oligopeptide transporter 6-like         280   6e-85    Nicotiana sylvestris
ref|XP_009608843.1|  PREDICTED: oligopeptide transporter 7-like         280   6e-85    Nicotiana tomentosiformis
ref|XP_008437437.1|  PREDICTED: LOW QUALITY PROTEIN: oligopeptide...    280   6e-85    Cucumis melo [Oriental melon]
ref|XP_004163578.1|  PREDICTED: oligopeptide transporter 7-like         282   6e-85    
ref|XP_007210345.1|  hypothetical protein PRUPE_ppa001827mg             280   7e-85    Prunus persica
gb|KJB40152.1|  hypothetical protein B456_007G049100                    277   7e-85    Gossypium raimondii
ref|XP_008239237.1|  PREDICTED: oligopeptide transporter 7              280   8e-85    Prunus mume [ume]
ref|XP_008394097.1|  PREDICTED: oligopeptide transporter 7-like         280   1e-84    
ref|XP_003581597.1|  PREDICTED: oligopeptide transporter 4-like         279   1e-84    Brachypodium distachyon [annual false brome]
emb|CDX86844.1|  BnaA09g22340D                                          280   1e-84    
gb|KHG27803.1|  Oligopeptide transporter 7 -like protein                280   1e-84    Gossypium arboreum [tree cotton]
ref|XP_009108224.1|  PREDICTED: oligopeptide transporter 7              280   1e-84    Brassica rapa
gb|KJB32169.1|  hypothetical protein B456_005G227300                    280   1e-84    Gossypium raimondii
dbj|BAJ87692.1|  predicted protein                                      279   2e-84    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KHG09371.1|  Oligopeptide transporter 4 -like protein                279   2e-84    Gossypium arboreum [tree cotton]
ref|XP_010455470.1|  PREDICTED: oligopeptide transporter 7-like         280   2e-84    Camelina sativa [gold-of-pleasure]
ref|XP_006289826.1|  hypothetical protein CARUB_v10003431mg             280   2e-84    Capsella rubella
ref|XP_002263530.1|  PREDICTED: oligopeptide transporter 4              279   2e-84    Vitis vinifera
ref|XP_011003045.1|  PREDICTED: oligopeptide transporter 4              279   2e-84    Populus euphratica
gb|EEC79904.1|  hypothetical protein OsI_21444                          279   2e-84    Oryza sativa Indica Group [Indian rice]
gb|KDO76688.1|  hypothetical protein CISIN_1g010747mg                   270   2e-84    Citrus sinensis [apfelsine]
ref|XP_002283691.1|  PREDICTED: oligopeptide transporter 2              278   2e-84    Vitis vinifera
ref|XP_010252553.1|  PREDICTED: oligopeptide transporter 7-like         278   2e-84    Nelumbo nucifera [Indian lotus]
ref|XP_011016978.1|  PREDICTED: oligopeptide transporter 2              278   2e-84    Populus euphratica
ref|NP_001056665.1|  Os06g0127700                                       279   3e-84    
ref|XP_011087976.1|  PREDICTED: oligopeptide transporter 4              278   3e-84    Sesamum indicum [beniseed]
emb|CDY19030.1|  BnaC01g20380D                                          278   3e-84    Brassica napus [oilseed rape]
ref|XP_006851891.1|  hypothetical protein AMTR_s00041p00133990          280   3e-84    
ref|XP_010537060.1|  PREDICTED: oligopeptide transporter 6-like         278   3e-84    Tarenaya hassleriana [spider flower]
gb|KDO76687.1|  hypothetical protein CISIN_1g010747mg                   270   3e-84    Citrus sinensis [apfelsine]
ref|XP_004309115.1|  PREDICTED: oligopeptide transporter 6-like         278   4e-84    Fragaria vesca subsp. vesca
emb|CDY14374.1|  BnaA10g06810D                                          277   4e-84    Brassica napus [oilseed rape]
ref|XP_006376657.1|  hypothetical protein POPTR_0012s02650g             278   4e-84    
emb|CAN79818.1|  hypothetical protein VITISV_040328                     277   4e-84    Vitis vinifera
ref|XP_009601745.1|  PREDICTED: oligopeptide transporter 7-like         278   5e-84    Nicotiana tomentosiformis
ref|XP_002317799.2|  hypothetical protein POPTR_0012s02660g             278   5e-84    Populus trichocarpa [western balsam poplar]
ref|XP_006655737.1|  PREDICTED: oligopeptide transporter 7-like         278   5e-84    
ref|XP_002301110.1|  oligopeptide transporter OPT family protein        277   5e-84    
ref|XP_010254620.1|  PREDICTED: oligopeptide transporter 4-like         278   5e-84    Nelumbo nucifera [Indian lotus]
ref|XP_011043664.1|  PREDICTED: oligopeptide transporter 9-like         277   6e-84    Populus euphratica
ref|XP_008241834.1|  PREDICTED: oligopeptide transporter 7-like         278   6e-84    Prunus mume [ume]
ref|XP_009128701.1|  PREDICTED: LOW QUALITY PROTEIN: oligopeptide...    278   7e-84    Brassica rapa
gb|KFK31865.1|  hypothetical protein AALP_AA6G168500                    278   7e-84    Arabis alpina [alpine rockcress]
ref|XP_010436760.1|  PREDICTED: oligopeptide transporter 7-like         278   8e-84    Camelina sativa [gold-of-pleasure]
ref|XP_010422002.1|  PREDICTED: oligopeptide transporter 7              278   9e-84    Camelina sativa [gold-of-pleasure]
gb|EPS60258.1|  hypothetical protein M569_14546                         276   1e-83    Genlisea aurea
ref|NP_192815.1|  oligopeptide transporter 7                            277   1e-83    Arabidopsis thaliana [mouse-ear cress]
gb|KDP41518.1|  hypothetical protein JCGZ_15925                         276   1e-83    Jatropha curcas
ref|XP_004964383.1|  PREDICTED: oligopeptide transporter 7-like i...    278   1e-83    Setaria italica
ref|XP_007204095.1|  hypothetical protein PRUPE_ppa002122mg             276   1e-83    
ref|XP_008349603.1|  PREDICTED: oligopeptide transporter 5-like         268   1e-83    
ref|XP_010048814.1|  PREDICTED: oligopeptide transporter 6              276   1e-83    Eucalyptus grandis [rose gum]
ref|XP_010691453.1|  PREDICTED: oligopeptide transporter 4              276   1e-83    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009379386.1|  PREDICTED: oligopeptide transporter 7-like         276   1e-83    Pyrus x bretschneideri [bai li]
emb|CBI19303.3|  unnamed protein product                                279   1e-83    Vitis vinifera
gb|KCW53168.1|  hypothetical protein EUGRSUZ_J02449                     272   2e-83    Eucalyptus grandis [rose gum]
emb|CDY25261.1|  BnaA02g21950D                                          276   2e-83    Brassica napus [oilseed rape]
ref|XP_008803572.1|  PREDICTED: oligopeptide transporter 4-like i...    273   2e-83    Phoenix dactylifera
dbj|BAJ85948.1|  predicted protein                                      276   2e-83    Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDO97358.1|  unnamed protein product                                264   2e-83    Coffea canephora [robusta coffee]
ref|XP_008803573.1|  PREDICTED: oligopeptide transporter 4-like i...    273   2e-83    Phoenix dactylifera
ref|XP_009407958.1|  PREDICTED: oligopeptide transporter 7-like         276   2e-83    Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB32171.1|  hypothetical protein B456_005G227300                    280   2e-83    Gossypium raimondii
gb|KFK29294.1|  hypothetical protein AALP_AA7G114600                    276   2e-83    Arabis alpina [alpine rockcress]
gb|KDO76686.1|  hypothetical protein CISIN_1g010747mg                   270   3e-83    Citrus sinensis [apfelsine]
ref|XP_002267184.1|  PREDICTED: oligopeptide transporter 1-like         276   3e-83    Vitis vinifera
ref|XP_011078837.1|  PREDICTED: oligopeptide transporter 7-like i...    276   3e-83    Sesamum indicum [beniseed]
ref|XP_010053083.1|  PREDICTED: oligopeptide transporter 7              276   3e-83    Eucalyptus grandis [rose gum]
ref|XP_004147543.1|  PREDICTED: oligopeptide transporter 4-like         275   4e-83    Cucumis sativus [cucumbers]
ref|XP_009790410.1|  PREDICTED: oligopeptide transporter 4              275   4e-83    Nicotiana sylvestris
ref|XP_011078828.1|  PREDICTED: oligopeptide transporter 7-like i...    276   4e-83    Sesamum indicum [beniseed]
ref|XP_006380596.1|  hypothetical protein POPTR_0007s09650g             275   5e-83    Populus trichocarpa [western balsam poplar]
ref|XP_007039133.1|  Oligopeptide transporter 1 isoform 2               272   5e-83    
ref|XP_003555686.1|  PREDICTED: oligopeptide transporter 7              275   5e-83    Glycine max [soybeans]
ref|XP_010065750.1|  PREDICTED: oligopeptide transporter 4-like         275   5e-83    Eucalyptus grandis [rose gum]
gb|KJB40153.1|  hypothetical protein B456_007G049100                    275   5e-83    Gossypium raimondii
gb|KCW53167.1|  hypothetical protein EUGRSUZ_J02449                     271   7e-83    Eucalyptus grandis [rose gum]
ref|XP_010644607.1|  PREDICTED: oligopeptide transporter 1-like         275   7e-83    Vitis vinifera
ref|XP_002518892.1|  Oligopeptide transporter, putative                 275   7e-83    Ricinus communis
ref|XP_002447030.1|  hypothetical protein SORBIDRAFT_06g027230          274   9e-83    Sorghum bicolor [broomcorn]
ref|XP_007200086.1|  hypothetical protein PRUPE_ppa021086mg             274   1e-82    Prunus persica
ref|XP_009143920.1|  PREDICTED: oligopeptide transporter 6              274   1e-82    Brassica rapa
ref|XP_003601453.1|  Oligopeptide transporter                           274   1e-82    
emb|CBI39770.3|  unnamed protein product                                274   1e-82    Vitis vinifera
ref|XP_004502063.1|  PREDICTED: oligopeptide transporter 7-like         274   1e-82    Cicer arietinum [garbanzo]
ref|XP_002518328.1|  Oligopeptide transporter, putative                 274   1e-82    Ricinus communis
gb|AES71704.2|  oligopeptide transporter OPT family protein             274   1e-82    Medicago truncatula
ref|XP_004235114.1|  PREDICTED: oligopeptide transporter 6              274   1e-82    Solanum lycopersicum
ref|XP_010482752.1|  PREDICTED: oligopeptide transporter 9              274   1e-82    Camelina sativa [gold-of-pleasure]
ref|XP_010039447.1|  PREDICTED: oligopeptide transporter 3-like i...    273   1e-82    Eucalyptus grandis [rose gum]
ref|XP_011078507.1|  PREDICTED: oligopeptide transporter 4-like         274   1e-82    Sesamum indicum [beniseed]
ref|XP_002275134.2|  PREDICTED: oligopeptide transporter 6-like         274   1e-82    
ref|XP_006350626.1|  PREDICTED: oligopeptide transporter 7-like         274   2e-82    Solanum tuberosum [potatoes]
ref|XP_002283680.1|  PREDICTED: oligopeptide transporter 4              274   2e-82    Vitis vinifera
gb|EYU45286.1|  hypothetical protein MIMGU_mgv1a0020142mg               268   2e-82    Erythranthe guttata [common monkey flower]
dbj|BAD67732.1|  putative sexual differentiation process protein ...    274   2e-82    Oryza sativa Japonica Group [Japonica rice]
ref|XP_003564333.1|  PREDICTED: oligopeptide transporter 7-like         274   2e-82    Brachypodium distachyon [annual false brome]
gb|EMS45172.1|  Oligopeptide transporter 7                              276   2e-82    Triticum urartu
ref|XP_006364982.1|  PREDICTED: oligopeptide transporter 4-like         273   3e-82    Solanum tuberosum [potatoes]
ref|XP_010649021.1|  PREDICTED: oligopeptide transporter 7-like         273   3e-82    Vitis vinifera
ref|XP_006394156.1|  hypothetical protein EUTSA_v10003716mg             273   3e-82    Eutrema salsugineum [saltwater cress]
ref|XP_007039132.1|  Oligopeptide transporter 1 isoform 1               273   3e-82    
ref|XP_002874647.1|  ATOPT7                                             273   3e-82    
ref|XP_004238028.1|  PREDICTED: oligopeptide transporter 4-like         273   4e-82    Solanum lycopersicum
ref|XP_006474841.1|  PREDICTED: oligopeptide transporter 1-like         273   4e-82    
ref|XP_007046673.1|  Oligopeptide transporter 7 isoform 1               273   4e-82    
ref|XP_009368318.1|  PREDICTED: oligopeptide transporter 4              273   5e-82    Pyrus x bretschneideri [bai li]
gb|KDO59178.1|  hypothetical protein CISIN_1g0044241mg                  272   5e-82    Citrus sinensis [apfelsine]
emb|CDP01884.1|  unnamed protein product                                273   5e-82    Coffea canephora [robusta coffee]
ref|XP_010461766.1|  PREDICTED: oligopeptide transporter 4-like         272   5e-82    Camelina sativa [gold-of-pleasure]
ref|XP_006452634.1|  hypothetical protein CICLE_v10007552mg             273   6e-82    
ref|XP_003557106.2|  PREDICTED: oligopeptide transporter 7-like i...    272   6e-82    Brachypodium distachyon [annual false brome]
ref|XP_010484229.1|  PREDICTED: oligopeptide transporter 4              272   6e-82    Camelina sativa [gold-of-pleasure]
ref|XP_008349390.1|  PREDICTED: oligopeptide transporter 1-like         263   6e-82    
ref|XP_006474840.1|  PREDICTED: oligopeptide transporter 1-like         273   6e-82    Citrus sinensis [apfelsine]
ref|XP_010228050.1|  PREDICTED: oligopeptide transporter 7-like i...    272   7e-82    Brachypodium distachyon [annual false brome]
gb|KDO59669.1|  hypothetical protein CISIN_1g009296mg                   267   7e-82    Citrus sinensis [apfelsine]
ref|XP_008445079.1|  PREDICTED: oligopeptide transporter 6-like         272   7e-82    Cucumis melo [Oriental melon]
gb|EEE68909.1|  hypothetical protein OsJ_27765                          271   7e-82    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010444374.1|  PREDICTED: oligopeptide transporter 4-like         272   7e-82    Camelina sativa [gold-of-pleasure]
ref|XP_008806360.1|  PREDICTED: oligopeptide transporter 7-like         273   7e-82    
gb|AAM64614.1|  Isp4-like protein                                       272   7e-82    Arabidopsis thaliana [mouse-ear cress]
ref|XP_011043662.1|  PREDICTED: oligopeptide transporter 9-like         272   7e-82    Populus euphratica
ref|XP_006474839.1|  PREDICTED: oligopeptide transporter 1-like         273   7e-82    Citrus sinensis [apfelsine]
ref|NP_201246.1|  oligopeptide transporter 4                            272   7e-82    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004288878.1|  PREDICTED: oligopeptide transporter 2-like         272   9e-82    Fragaria vesca subsp. vesca
ref|XP_008454451.1|  PREDICTED: oligopeptide transporter 4              272   9e-82    Cucumis melo [Oriental melon]
emb|CDY31321.1|  BnaA02g34200D                                          271   9e-82    Brassica napus [oilseed rape]
ref|XP_009126974.1|  PREDICTED: oligopeptide transporter 1              272   9e-82    
emb|CDY46800.1|  BnaC02g43080D                                          271   1e-81    Brassica napus [oilseed rape]
emb|CDY06549.1|  BnaC02g12730D                                          272   1e-81    
ref|XP_009130453.1|  PREDICTED: oligopeptide transporter 4              271   1e-81    Brassica rapa
ref|XP_006280078.1|  hypothetical protein CARUB_v10025959mg             271   1e-81    Capsella rubella
ref|XP_010029951.1|  PREDICTED: oligopeptide transporter 4-like         271   1e-81    Eucalyptus grandis [rose gum]
gb|EMT07894.1|  Oligopeptide transporter 7                              272   1e-81    
ref|XP_002515831.1|  Oligopeptide transporter, putative                 271   1e-81    Ricinus communis
ref|NP_001056651.1|  Os06g0125500                                       272   1e-81    
ref|XP_002866614.1|  hypothetical protein ARALYDRAFT_496649             271   1e-81    
gb|KDP42149.1|  hypothetical protein JCGZ_03016                         271   1e-81    
ref|XP_009361323.1|  PREDICTED: oligopeptide transporter 6-like         271   1e-81    
ref|XP_004160803.1|  PREDICTED: oligopeptide transporter 6-like         271   1e-81    
ref|XP_009412736.1|  PREDICTED: oligopeptide transporter 7-like         271   2e-81    
ref|XP_006351838.1|  PREDICTED: oligopeptide transporter 4-like         271   2e-81    
ref|XP_009612437.1|  PREDICTED: oligopeptide transporter 4              271   2e-81    
ref|XP_004287803.1|  PREDICTED: oligopeptide transporter 7-like         271   2e-81    
ref|XP_008806363.1|  PREDICTED: oligopeptide transporter 7-like         271   2e-81    
ref|NP_001130398.1|  uncharacterized protein LOC100191494               271   2e-81    
ref|XP_008790539.1|  PREDICTED: oligopeptide transporter 7-like         271   2e-81    
ref|XP_009132469.1|  PREDICTED: oligopeptide transporter 9-like         271   2e-81    
ref|XP_008237085.1|  PREDICTED: oligopeptide transporter 4-like         271   2e-81    
ref|XP_010934487.1|  PREDICTED: oligopeptide transporter 7              271   2e-81    
gb|KDO59179.1|  hypothetical protein CISIN_1g004845mg                   270   2e-81    
emb|CBI19304.3|  unnamed protein product                                271   2e-81    
ref|NP_194389.1|  oligopeptide transporter 5                            271   2e-81    
ref|XP_007145948.1|  hypothetical protein PHAVU_006G000100g             271   3e-81    
ref|XP_009349149.1|  PREDICTED: oligopeptide transporter 1-like         271   3e-81    
ref|XP_008800083.1|  PREDICTED: oligopeptide transporter 4-like         271   3e-81    
ref|XP_002867483.1|  ATOPT6                                             270   3e-81    
ref|XP_008803571.1|  PREDICTED: oligopeptide transporter 4-like i...    271   3e-81    
ref|XP_006425445.1|  hypothetical protein CICLE_v10024968mg             271   3e-81    
ref|XP_010934151.1|  PREDICTED: oligopeptide transporter 7-like         271   3e-81    
gb|KFK29177.1|  hypothetical protein AALP_AA7G099400                    271   3e-81    
ref|NP_194503.1|  oligopeptide transporter                              270   3e-81    
ref|XP_006413036.1|  hypothetical protein EUTSA_v10024519mg             270   4e-81    
ref|XP_010040072.1|  PREDICTED: oligopeptide transporter 7-like         271   4e-81    
ref|NP_001062118.1|  Os08g0492000                                       270   4e-81    
ref|XP_008376782.1|  PREDICTED: oligopeptide transporter 6              270   4e-81    
ref|XP_009775420.1|  PREDICTED: oligopeptide transporter 2-like         270   4e-81    
ref|XP_004138881.1|  PREDICTED: oligopeptide transporter 6-like         270   5e-81    
ref|XP_006655730.1|  PREDICTED: oligopeptide transporter 7-like         270   5e-81    
gb|KJB39494.1|  hypothetical protein B456_007G016300                    270   5e-81    
ref|XP_002864417.1|  ATOPT1                                             270   5e-81    
ref|XP_010244695.1|  PREDICTED: oligopeptide transporter 4-like         270   6e-81    
ref|XP_009619170.1|  PREDICTED: oligopeptide transporter 2-like         270   6e-81    
ref|XP_010446080.1|  PREDICTED: oligopeptide transporter 9-like         270   6e-81    
ref|XP_010065749.1|  PREDICTED: oligopeptide transporter 4-like         270   6e-81    
ref|XP_009795933.1|  PREDICTED: oligopeptide transporter 7-like i...    270   7e-81    
ref|XP_003519862.1|  PREDICTED: oligopeptide transporter 7-like         270   7e-81    
ref|XP_006452635.1|  hypothetical protein CICLE_v10007550mg             270   7e-81    
ref|XP_010438561.1|  PREDICTED: oligopeptide transporter 6              269   7e-81    
gb|KCW63396.1|  hypothetical protein EUGRSUZ_G01042                     269   7e-81    
ref|XP_009391956.1|  PREDICTED: oligopeptide transporter 7-like         270   7e-81    
ref|XP_002864248.1|  predicted protein                                  269   8e-81    
ref|XP_010448085.1|  PREDICTED: oligopeptide transporter 6              269   9e-81    
ref|XP_006285678.1|  hypothetical protein CARUB_v10007142mg             269   9e-81    
ref|XP_008219410.1|  PREDICTED: oligopeptide transporter 1-like         269   1e-80    
ref|XP_006417516.1|  hypothetical protein EUTSA_v10009349mg             268   1e-80    
gb|KDP35526.1|  hypothetical protein JCGZ_08964                         269   1e-80    
ref|XP_004953568.1|  PREDICTED: oligopeptide transporter 4-like i...    269   1e-80    
ref|XP_009591882.1|  PREDICTED: oligopeptide transporter 7-like         269   1e-80    
ref|XP_006364985.1|  PREDICTED: oligopeptide transporter 2-like i...    268   2e-80    
ref|XP_010501399.1|  PREDICTED: oligopeptide transporter 2              268   2e-80    
ref|XP_004231372.1|  PREDICTED: oligopeptide transporter 4              268   2e-80    
ref|XP_006452637.1|  hypothetical protein CICLE_v10007550mg             268   2e-80    
ref|XP_007137663.1|  hypothetical protein PHAVU_009G145300g             268   2e-80    
ref|XP_011008821.1|  PREDICTED: oligopeptide transporter 7-like         268   2e-80    
gb|EPS62495.1|  hypothetical protein M569_12295                         268   2e-80    
ref|XP_006476310.1|  PREDICTED: oligopeptide transporter 7-like i...    268   3e-80    
ref|XP_009119900.1|  PREDICTED: oligopeptide transporter 9              268   3e-80    
ref|XP_004953567.1|  PREDICTED: oligopeptide transporter 4-like i...    269   3e-80    
ref|XP_002960906.1|  hypothetical protein SELMODRAFT_229868             268   3e-80    
ref|NP_200164.1|  oligopeptide transporter 8                            268   3e-80    
ref|XP_010933427.1|  PREDICTED: oligopeptide transporter 4-like         268   3e-80    
ref|XP_007042780.1|  Oligopeptide transporter 4                         271   3e-80    
ref|XP_010096485.1|  Oligopeptide transporter 1                         268   3e-80    
ref|XP_009615073.1|  PREDICTED: oligopeptide transporter 4-like         268   3e-80    
ref|XP_006401399.1|  hypothetical protein EUTSA_v10012759mg             268   3e-80    
ref|XP_010475851.1|  PREDICTED: oligopeptide transporter 2-like         268   3e-80    
gb|KGN53886.1|  hypothetical protein Csa_4G179700                       268   3e-80    
ref|XP_006364984.1|  PREDICTED: oligopeptide transporter 2-like i...    267   4e-80    
ref|XP_006660244.1|  PREDICTED: oligopeptide transporter 5-like         268   4e-80    
ref|XP_010458316.1|  PREDICTED: oligopeptide transporter 2-like         267   4e-80    
ref|XP_010096486.1|  Oligopeptide transporter 1                         268   4e-80    
ref|XP_007207290.1|  hypothetical protein PRUPE_ppa014997mg             268   5e-80    
ref|XP_006476309.1|  PREDICTED: oligopeptide transporter 7-like i...    268   5e-80    
ref|XP_010109222.1|  Oligopeptide transporter 6                         267   5e-80    
ref|XP_008378664.1|  PREDICTED: oligopeptide transporter 2-like         267   5e-80    
emb|CDY38751.1|  BnaC03g14980D                                          267   5e-80    
ref|XP_002436389.1|  hypothetical protein SORBIDRAFT_10g001670          268   6e-80    
gb|KCW76554.1|  hypothetical protein EUGRSUZ_D00943                     266   6e-80    
gb|KFK26970.1|  hypothetical protein AALP_AA8G317000                    267   6e-80    
ref|XP_006439250.1|  hypothetical protein CICLE_v10018971mg             267   6e-80    
ref|XP_006439249.1|  hypothetical protein CICLE_v10018971mg             267   6e-80    
ref|XP_006472993.1|  PREDICTED: oligopeptide transporter 2-like         267   7e-80    
ref|XP_002892535.1|  ATOPT2                                             266   7e-80    
ref|XP_010545870.1|  PREDICTED: oligopeptide transporter 1-like         267   8e-80    
ref|XP_006304646.1|  hypothetical protein CARUB_v10011782mg             266   8e-80    
ref|XP_010520694.1|  PREDICTED: oligopeptide transporter 4              267   8e-80    
ref|XP_008648099.1|  PREDICTED: uncharacterized protein LOC100383...    267   9e-80    
ref|XP_006401695.1|  hypothetical protein EUTSA_v10016096mg             266   9e-80    
ref|XP_010052485.1|  PREDICTED: oligopeptide transporter 1-like         266   9e-80    
ref|XP_004289821.1|  PREDICTED: oligopeptide transporter 4              266   1e-79    
ref|XP_002967106.1|  hypothetical protein SELMODRAFT_87413              266   1e-79    
ref|XP_011075935.1|  PREDICTED: oligopeptide transporter 6              266   1e-79    
ref|XP_008440830.1|  PREDICTED: oligopeptide transporter 7-like         266   1e-79    
ref|XP_009773684.1|  PREDICTED: oligopeptide transporter 7-like i...    266   1e-79    
ref|XP_010483061.1|  PREDICTED: oligopeptide transporter 1              266   1e-79    
ref|XP_008445076.1|  PREDICTED: oligopeptide transporter 6-like         266   2e-79    
ref|XP_006343361.1|  PREDICTED: oligopeptide transporter 7-like         266   2e-79    
gb|KGN48927.1|  hypothetical protein Csa_6G506530                       266   2e-79    
ref|NP_172464.1|  oligopeptide transporter 2                            266   2e-79    
gb|ABE65610.1|  oligopeptide transporter OPT family protein             266   2e-79    
emb|CDY35662.1|  BnaC09g29840D                                          266   2e-79    
ref|XP_006433764.1|  hypothetical protein CICLE_v10003491mg             266   2e-79    
ref|XP_010450442.1|  PREDICTED: oligopeptide transporter 1-like         266   2e-79    
ref|XP_006441174.1|  hypothetical protein CICLE_v10019012mg             266   2e-79    
ref|XP_006856596.1|  hypothetical protein AMTR_s00046p00213370          265   2e-79    
emb|CDY47076.1|  BnaA03g12220D                                          265   2e-79    
ref|XP_008366119.1|  PREDICTED: oligopeptide transporter 1-like         260   2e-79    
ref|XP_010443233.1|  PREDICTED: oligopeptide transporter 1-like         266   2e-79    
gb|KCW70462.1|  hypothetical protein EUGRSUZ_F03679                     265   2e-79    
ref|XP_010445886.1|  PREDICTED: oligopeptide transporter 8              265   3e-79    
emb|CDY28832.1|  BnaA02g10240D                                          265   3e-79    
ref|XP_009127158.1|  PREDICTED: oligopeptide transporter 8              265   3e-79    
ref|XP_002527347.1|  Oligopeptide transporter, putative                 265   3e-79    
ref|XP_004135024.1|  PREDICTED: oligopeptide transporter 7-like         267   3e-79    
ref|XP_004169608.1|  PREDICTED: oligopeptide transporter 7-like         266   3e-79    
ref|XP_006491962.1|  PREDICTED: oligopeptide transporter 9-like         265   3e-79    
ref|XP_010064976.1|  PREDICTED: oligopeptide transporter 1-like         265   4e-79    
ref|XP_011040150.1|  PREDICTED: oligopeptide transporter 1-like i...    265   4e-79    
ref|XP_010029956.1|  PREDICTED: oligopeptide transporter 4-like         265   4e-79    
ref|XP_007156168.1|  hypothetical protein PHAVU_003G263900g             265   4e-79    
ref|XP_010320236.1|  PREDICTED: oligopeptide transporter 2-like         265   4e-79    
emb|CCO06497.1|  oligopeptide transporter                               265   4e-79    
ref|XP_002283674.1|  PREDICTED: oligopeptide transporter 4-like         265   4e-79    
ref|XP_004953566.1|  PREDICTED: oligopeptide transporter 4-like         265   4e-79    
ref|XP_004252726.1|  PREDICTED: oligopeptide transporter 2-like         265   4e-79    
gb|KFK27168.1|  hypothetical protein AALP_AA8G344300                    265   4e-79    
ref|XP_003603705.1|  Oligopeptide transporter                           264   5e-79    
ref|XP_011040149.1|  PREDICTED: oligopeptide transporter 1-like i...    265   5e-79    
ref|XP_002323113.2|  hypothetical protein POPTR_0016s00650g             265   5e-79    
ref|XP_010442919.1|  PREDICTED: oligopeptide transporter 8-like         264   6e-79    
ref|XP_008663549.1|  PREDICTED: oligopeptide transporter 4-like         264   6e-79    
ref|XP_007142437.1|  hypothetical protein PHAVU_008G280400g             265   6e-79    
ref|XP_004976663.1|  PREDICTED: oligopeptide transporter 4-like         264   6e-79    
ref|XP_004160804.1|  PREDICTED: oligopeptide transporter 6-like         264   6e-79    
ref|XP_010536754.1|  PREDICTED: oligopeptide transporter 5-like         265   6e-79    
gb|KCW56912.1|  hypothetical protein EUGRSUZ_I02589                     265   7e-79    
ref|XP_010104574.1|  Oligopeptide transporter 4                         264   8e-79    
ref|XP_002306519.1|  hypothetical protein POPTR_0005s19410g             264   8e-79    
emb|CDP00949.1|  unnamed protein product                                264   8e-79    
ref|XP_009379497.1|  PREDICTED: oligopeptide transporter 1-like         264   8e-79    
ref|XP_002864247.1|  ATOPT9                                             264   9e-79    
ref|XP_009367290.1|  PREDICTED: oligopeptide transporter 1-like         264   9e-79    
ref|XP_006279740.1|  hypothetical protein CARUB_v10027572mg             264   9e-79    
ref|NP_200163.1|  oligopeptide transporter 9                            263   1e-78    
ref|XP_007136469.1|  hypothetical protein PHAVU_009G047800g             263   1e-78    
ref|XP_006281558.1|  hypothetical protein CARUB_v10027665mg             263   1e-78    
ref|XP_010244696.1|  PREDICTED: oligopeptide transporter 4-like         263   1e-78    
ref|XP_010433323.1|  PREDICTED: oligopeptide transporter 6-like         263   1e-78    
ref|XP_002529653.1|  Oligopeptide transporter, putative                 264   1e-78    
ref|XP_003527991.1|  PREDICTED: oligopeptide transporter 9-like         263   1e-78    
gb|EYU21027.1|  hypothetical protein MIMGU_mgv1a026700mg                263   2e-78    
ref|XP_006433763.1|  hypothetical protein CICLE_v10003230mg             263   2e-78    
ref|XP_011015796.1|  PREDICTED: oligopeptide transporter 4-like         263   2e-78    
ref|XP_004973781.1|  PREDICTED: oligopeptide transporter 1-like         263   2e-78    
ref|XP_006401694.1|  hypothetical protein EUTSA_v10015543mg             263   2e-78    
gb|KFK28135.1|  hypothetical protein AALP_AA8G476800                    266   2e-78    
ref|XP_003522744.1|  PREDICTED: LOW QUALITY PROTEIN: oligopeptide...    263   2e-78    
emb|CDX96230.1|  BnaC02g14210D                                          263   2e-78    
ref|XP_002298878.2|  hypothetical protein POPTR_0001s37840g             263   2e-78    
ref|NP_001152089.1|  oligopeptide transporter 4                         263   3e-78    
ref|XP_002452707.1|  hypothetical protein SORBIDRAFT_04g031080          263   3e-78    
ref|XP_010112260.1|  Oligopeptide transporter 4                         262   4e-78    
dbj|BAJ90957.1|  predicted protein                                      262   4e-78    
ref|XP_002445962.1|  hypothetical protein SORBIDRAFT_07g028740          262   5e-78    
ref|XP_003522539.1|  PREDICTED: oligopeptide transporter 9-like         262   5e-78    
ref|XP_008677393.1|  PREDICTED: oligopeptide transporter 4 isofor...    262   5e-78    
ref|XP_004964382.1|  PREDICTED: oligopeptide transporter 7-like i...    263   7e-78    
ref|XP_008339039.1|  PREDICTED: oligopeptide transporter 2-like         261   7e-78    
ref|XP_010520948.1|  PREDICTED: oligopeptide transporter 6              261   9e-78    
ref|XP_010317692.1|  PREDICTED: oligopeptide transporter 7-like         261   9e-78    
ref|XP_009616769.1|  PREDICTED: oligopeptide transporter 2-like         261   1e-77    
ref|XP_011038841.1|  PREDICTED: oligopeptide transporter 1 isofor...    261   1e-77    
ref|XP_007225210.1|  hypothetical protein PRUPE_ppa002011mg             261   1e-77    
ref|XP_009413226.1|  PREDICTED: oligopeptide transporter 4-like         261   1e-77    
ref|XP_006475109.1|  PREDICTED: oligopeptide transporter 1-like         260   1e-77    
ref|XP_006472404.1|  PREDICTED: oligopeptide transporter 4-like         261   1e-77    
ref|XP_008219191.1|  PREDICTED: oligopeptide transporter 2-like         260   1e-77    
ref|XP_006452632.1|  hypothetical protein CICLE_v10010604mg             260   2e-77    
ref|XP_002298879.1|  oligopeptide transporter OPT family protein        261   2e-77    
ref|XP_002522788.1|  Oligopeptide transporter, putative                 261   2e-77    
ref|XP_008222894.1|  PREDICTED: oligopeptide transporter 1-like         256   2e-77    
gb|EYU30413.1|  hypothetical protein MIMGU_mgv1a002159mg                259   2e-77    
gb|EYU19483.1|  hypothetical protein MIMGU_mgv1a023929mg                259   2e-77    
ref|XP_003628537.1|  Oligopeptide transporter                           260   3e-77    
ref|XP_006486776.1|  PREDICTED: oligopeptide transporter 4-like         260   3e-77    
ref|XP_004972025.1|  PREDICTED: oligopeptide transporter 4-like         260   3e-77    
ref|XP_011038843.1|  PREDICTED: oligopeptide transporter 1 isofor...    260   3e-77    
ref|XP_007156167.1|  hypothetical protein PHAVU_003G263800g             260   3e-77    
ref|XP_007224505.1|  hypothetical protein PRUPE_ppa022679mg             259   3e-77    
ref|XP_004138770.1|  PREDICTED: oligopeptide transporter 6-like         262   3e-77    
ref|XP_008663011.1|  PREDICTED: oligopeptide transporter 5-like         260   3e-77    
ref|XP_008219210.1|  PREDICTED: oligopeptide transporter 2-like         259   3e-77    
ref|XP_002452706.1|  hypothetical protein SORBIDRAFT_04g031070          260   3e-77    
ref|XP_010030910.1|  PREDICTED: oligopeptide transporter 4-like         259   3e-77    
ref|XP_009366375.1|  PREDICTED: oligopeptide transporter 2-like         259   3e-77    
emb|CDP19589.1|  unnamed protein product                                259   4e-77    
ref|XP_009132467.1|  PREDICTED: oligopeptide transporter 8-like         259   4e-77    
ref|NP_200404.1|  oligopeptide transporter 1                            259   4e-77    
ref|XP_006422647.1|  hypothetical protein CICLE_v10027887mg             258   4e-77    
ref|XP_010064977.1|  PREDICTED: oligopeptide transporter 1-like         259   4e-77    
gb|KCW56911.1|  hypothetical protein EUGRSUZ_I02587                     259   6e-77    
ref|XP_003572326.1|  PREDICTED: oligopeptide transporter 5-like         259   6e-77    
gb|KCW76552.1|  hypothetical protein EUGRSUZ_D00942                     258   6e-77    
ref|XP_011074283.1|  PREDICTED: oligopeptide transporter 4-like         259   6e-77    
gb|KDP46770.1|  hypothetical protein JCGZ_06558                         259   7e-77    
dbj|BAD10428.1|  putative sexual differentiation process protein ...    250   7e-77    
ref|XP_010030911.1|  PREDICTED: oligopeptide transporter 4-like         258   8e-77    
ref|XP_009773685.1|  PREDICTED: oligopeptide transporter 7-like i...    258   9e-77    
ref|XP_007026393.1|  Oligopeptide transporter 5                         259   9e-77    
emb|CDP19590.1|  unnamed protein product                                259   9e-77    
ref|XP_008646108.1|  PREDICTED: oligopeptide transporter 4-like         259   1e-76    
gb|KJB68518.1|  hypothetical protein B456_010G248000                    258   1e-76    
ref|XP_004502694.1|  PREDICTED: oligopeptide transporter 6-like         258   1e-76    
ref|XP_006422648.1|  hypothetical protein CICLE_v10027887mg             258   1e-76    
gb|KHG27446.1|  Oligopeptide transporter 4 -like protein                258   1e-76    



>ref|XP_009590288.1| PREDICTED: oligopeptide transporter 3 [Nicotiana tomentosiformis]
Length=751

 Score =   413 bits (1062),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 197/247 (80%), Positives = 219/247 (89%), Gaps = 3/247 (1%)
 Frame = +2

Query  68   LNPATAGEKTAP---SGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNT  238
            L P+ AG+          RCPVEEVALVVPETDDPTLPV+TFRAWFLG+TSC +LIFLNT
Sbjct  14   LPPSAAGKLNGEPPADHERCPVEEVALVVPETDDPTLPVMTFRAWFLGLTSCTLLIFLNT  73

Query  239  FFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIIT  418
            FFIYRTQPL+ISAILMQI+VLPIGKFMAATLP++ +  FGRW F+LNPGPFNIKEHVIIT
Sbjct  74   FFIYRTQPLTISAILMQIAVLPIGKFMAATLPKKNYTLFGRWGFSLNPGPFNIKEHVIIT  133

Query  419  VMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVD  598
            VMANCGVS GGGDAYSIGAIT+MKAYYKQ+L+FLC L+IVLTTQ++GYGWAG+LRRYLVD
Sbjct  134  VMANCGVSIGGGDAYSIGAITVMKAYYKQSLNFLCALLIVLTTQIVGYGWAGMLRRYLVD  193

Query  599  PVDMWWPSNLAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFS  778
            PVDMWWPSNLAQVSLFRALHE E K+ G+TRM+FFL+ M ASF YY  PGYLFPILTFFS
Sbjct  194  PVDMWWPSNLAQVSLFRALHEKEQKTRGLTRMQFFLVFMAASFAYYAFPGYLFPILTFFS  253

Query  779  WVCWVWP  799
            WVCW WP
Sbjct  254  WVCWAWP  260



>ref|XP_011095913.1| PREDICTED: oligopeptide transporter 3 [Sesamum indicum]
Length=740

 Score =   413 bits (1061),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 196/243 (81%), Positives = 218/243 (90%), Gaps = 2/243 (1%)
 Frame = +2

Query  71   NPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIY  250
             PA+ GE  A +  RC VEEVALVVPETDDPTLPV+TFRAW LG+ SCIILIFLNTFFIY
Sbjct  9    KPASNGE--AETEERCSVEEVALVVPETDDPTLPVMTFRAWVLGLASCIILIFLNTFFIY  66

Query  251  RTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMAN  430
            RTQPL+ISAILMQI VLPIGKFMAATLP +++  FGRWSF+LNPGPFNIKEHVIITVMAN
Sbjct  67   RTQPLTISAILMQIGVLPIGKFMAATLPTKQYTVFGRWSFSLNPGPFNIKEHVIITVMAN  126

Query  431  CGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDM  610
            CGVS GGGDAYSIGAIT+MKAYYKQ+++FLC L+IVLTTQ++GYGWAG+LR+YLVDPV+M
Sbjct  127  CGVSIGGGDAYSIGAITVMKAYYKQSVNFLCALLIVLTTQILGYGWAGMLRKYLVDPVEM  186

Query  611  WWPSNLAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCW  790
            WWPSNLAQVSLFRALHE E K+ GMTRM+FFL+ M ASF YY  PGYLFPILTFFSWVCW
Sbjct  187  WWPSNLAQVSLFRALHEKETKAQGMTRMKFFLIFMAASFAYYLFPGYLFPILTFFSWVCW  246

Query  791  VWP  799
             WP
Sbjct  247  AWP  249



>gb|KEH32684.1| oligopeptide transporter OPT family protein [Medicago truncatula]
Length=546

 Score =   405 bits (1042),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 193/251 (77%), Positives = 220/251 (88%), Gaps = 4/251 (2%)
 Frame = +2

Query  59   MSGLNPATAGEKTA---PSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIF  229
            M+ +NP    EK +   P   RCP+EEVALVVPETDDP+LPV+TFR+WFLGITSCIILIF
Sbjct  1    MAPMNPTPDTEKASNGVPPDDRCPIEEVALVVPETDDPSLPVMTFRSWFLGITSCIILIF  60

Query  230  LNTFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHV  409
            LNTFF +RTQPL+ISAILMQI+VLPIGKFMAATLP +++  FGRW FTLNPGPFN+KEHV
Sbjct  61   LNTFFTFRTQPLTISAILMQIAVLPIGKFMAATLPTKEYNFFGRWRFTLNPGPFNMKEHV  120

Query  410  IITVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRY  589
            IIT+ ANCGVS GGGDAYSIGAITIMKAYYKQ+LSFL  L IVLTTQ++GYGWAG+LRRY
Sbjct  121  IITIFANCGVSQGGGDAYSIGAITIMKAYYKQSLSFLLALFIVLTTQILGYGWAGILRRY  180

Query  590  LVDPVDMWWPSNLAQVSLFRALHETEVKSS-GMTRMRFFLLVMGASFVYYTLPGYLFPIL  766
            LVDPV+MWWPSNLAQVSLFRALHE E K+S G TRM+FFL+ MG SF+YY LPGYLF +L
Sbjct  181  LVDPVEMWWPSNLAQVSLFRALHEKENKASKGFTRMQFFLIAMGVSFLYYALPGYLFTVL  240

Query  767  TFFSWVCWVWP  799
            TFFSW+C+ WP
Sbjct  241  TFFSWICYAWP  251



>gb|KDO78545.1| hypothetical protein CISIN_1g004659mg [Citrus sinensis]
Length=388

 Score =   400 bits (1027),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 188/243 (77%), Positives = 215/243 (88%), Gaps = 4/243 (2%)
 Frame = +2

Query  71   NPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIY  250
            N    G+ T     RCP+EEVAL+VPETDDPT+PV+TFRAWFLG+TSC +LIFLNTFF +
Sbjct  10   NENPNGDSTEE---RCPIEEVALIVPETDDPTMPVMTFRAWFLGLTSCTLLIFLNTFFTF  66

Query  251  RTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMAN  430
            RTQPL+ISAILMQI+VLPIGKFMA  LP ++F   G W F+LNPGPFNIKEHVIIT+ AN
Sbjct  67   RTQPLTISAILMQIAVLPIGKFMARILPNKEFQVLG-WRFSLNPGPFNIKEHVIITIFAN  125

Query  431  CGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDM  610
            CGVS GGGDAYSIGAIT+MKAYYKQ+L+FLCGL+IVLTTQ++GYGWAG+LRRYLVDPV+M
Sbjct  126  CGVSFGGGDAYSIGAITVMKAYYKQSLNFLCGLLIVLTTQILGYGWAGMLRRYLVDPVEM  185

Query  611  WWPSNLAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCW  790
            WWPSNLAQVSLFRALHE E KS G+TRM+FFL+V+ ASF YY+LPGYLFPILTFFSWVCW
Sbjct  186  WWPSNLAQVSLFRALHEKESKSKGLTRMQFFLIVLAASFAYYSLPGYLFPILTFFSWVCW  245

Query  791  VWP  799
             WP
Sbjct  246  AWP  248



>emb|CDP04526.1| unnamed protein product [Coffea canephora]
Length=755

 Score =   410 bits (1054),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 195/242 (81%), Positives = 216/242 (89%), Gaps = 2/242 (1%)
 Frame = +2

Query  80   TAGEKTAPSG--GRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYR  253
              G+  AP+    RC VEEVALVVPETDDPTLPV+TFRAWFLG+TSC ILIFLNTFFIYR
Sbjct  23   NGGDAPAPTDHKDRCAVEEVALVVPETDDPTLPVMTFRAWFLGLTSCTILIFLNTFFIYR  82

Query  254  TQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANC  433
            TQPL+ISAILMQI+VLPIGKFMA+ LP + +  FGRWSF+LNPGPFNIKEHVIITVMANC
Sbjct  83   TQPLTISAILMQIAVLPIGKFMASALPTKTYTLFGRWSFSLNPGPFNIKEHVIITVMANC  142

Query  434  GVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMW  613
            GVS GGGDAYSIGAIT+M+AYYKQ LSFLC L+IVLTTQ++GYGWAG+LR+YLVDPV+MW
Sbjct  143  GVSIGGGDAYSIGAITVMRAYYKQTLSFLCALLIVLTTQILGYGWAGMLRKYLVDPVEMW  202

Query  614  WPSNLAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWV  793
            WPSNLAQVSLFRALHE E KS GMTRM+FFL+ + ASF YY LPGYLFPILTFFSWVCW 
Sbjct  203  WPSNLAQVSLFRALHEKESKSQGMTRMQFFLIFLAASFAYYALPGYLFPILTFFSWVCWA  262

Query  794  WP  799
            WP
Sbjct  263  WP  264



>gb|KDO78543.1| hypothetical protein CISIN_1g004659mg [Citrus sinensis]
Length=490

 Score =   400 bits (1028),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 188/243 (77%), Positives = 215/243 (88%), Gaps = 4/243 (2%)
 Frame = +2

Query  71   NPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIY  250
            N    G+ T     RCP+EEVAL+VPETDDPT+PV+TFRAWFLG+TSC +LIFLNTFF +
Sbjct  10   NENPNGDSTEE---RCPIEEVALIVPETDDPTMPVMTFRAWFLGLTSCTLLIFLNTFFTF  66

Query  251  RTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMAN  430
            RTQPL+ISAILMQI+VLPIGKFMA  LP ++F   G W F+LNPGPFNIKEHVIIT+ AN
Sbjct  67   RTQPLTISAILMQIAVLPIGKFMARILPNKEFQVLG-WRFSLNPGPFNIKEHVIITIFAN  125

Query  431  CGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDM  610
            CGVS GGGDAYSIGAIT+MKAYYKQ+L+FLCGL+IVLTTQ++GYGWAG+LRRYLVDPV+M
Sbjct  126  CGVSFGGGDAYSIGAITVMKAYYKQSLNFLCGLLIVLTTQILGYGWAGMLRRYLVDPVEM  185

Query  611  WWPSNLAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCW  790
            WWPSNLAQVSLFRALHE E KS G+TRM+FFL+V+ ASF YY+LPGYLFPILTFFSWVCW
Sbjct  186  WWPSNLAQVSLFRALHEKESKSKGLTRMQFFLIVLAASFAYYSLPGYLFPILTFFSWVCW  245

Query  791  VWP  799
             WP
Sbjct  246  AWP  248



>ref|XP_006352325.1| PREDICTED: oligopeptide transporter 3-like [Solanum tuberosum]
Length=752

 Score =   409 bits (1050),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 194/239 (81%), Positives = 217/239 (91%), Gaps = 1/239 (0%)
 Frame = +2

Query  86   GEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPL  265
            G+  +    RCPVEEVALVVPETDDPTLPV+TFRAWFLG++SC ILIFLNTFFIYRTQPL
Sbjct  23   GDTLSSDDDRCPVEEVALVVPETDDPTLPVMTFRAWFLGLSSCTILIFLNTFFIYRTQPL  82

Query  266  SISAILMQISVLPIGKFMAATLPERKFAPFGRW-SFTLNPGPFNIKEHVIITVMANCGVS  442
            +ISAILMQI+VLPIGKFMAATLP++ FA FGRW SF+LNPGPFNIKEHV+ITVMANCGVS
Sbjct  83   TISAILMQIAVLPIGKFMAATLPKKNFALFGRWGSFSLNPGPFNIKEHVVITVMANCGVS  142

Query  443  PGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPS  622
             GGGDAYSIGAIT+M+AYY Q++SFLC LIIVLTTQ++GYGWAG+LRRYLVDPVDMWWPS
Sbjct  143  IGGGDAYSIGAITVMRAYYNQSVSFLCSLIIVLTTQILGYGWAGMLRRYLVDPVDMWWPS  202

Query  623  NLAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  799
            NLAQVSLFRALHE E K+  +TRM+FFL+ M ASF YY LPGYLFPILTFFSWVCW +P
Sbjct  203  NLAQVSLFRALHEKEPKTRSLTRMKFFLVFMAASFAYYALPGYLFPILTFFSWVCWAYP  261



>gb|KDO78544.1| hypothetical protein CISIN_1g004659mg [Citrus sinensis]
Length=554

 Score =   401 bits (1031),  Expect = 9e-134, Method: Compositional matrix adjust.
 Identities = 188/243 (77%), Positives = 215/243 (88%), Gaps = 4/243 (2%)
 Frame = +2

Query  71   NPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIY  250
            N    G+ T     RCP+EEVAL+VPETDDPT+PV+TFRAWFLG+TSC +LIFLNTFF +
Sbjct  10   NENPNGDSTEE---RCPIEEVALIVPETDDPTMPVMTFRAWFLGLTSCTLLIFLNTFFTF  66

Query  251  RTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMAN  430
            RTQPL+ISAILMQI+VLPIGKFMA  LP ++F   G W F+LNPGPFNIKEHVIIT+ AN
Sbjct  67   RTQPLTISAILMQIAVLPIGKFMARILPNKEFQVLG-WRFSLNPGPFNIKEHVIITIFAN  125

Query  431  CGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDM  610
            CGVS GGGDAYSIGAIT+MKAYYKQ+L+FLCGL+IVLTTQ++GYGWAG+LRRYLVDPV+M
Sbjct  126  CGVSFGGGDAYSIGAITVMKAYYKQSLNFLCGLLIVLTTQILGYGWAGMLRRYLVDPVEM  185

Query  611  WWPSNLAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCW  790
            WWPSNLAQVSLFRALHE E KS G+TRM+FFL+V+ ASF YY+LPGYLFPILTFFSWVCW
Sbjct  186  WWPSNLAQVSLFRALHEKESKSKGLTRMQFFLIVLAASFAYYSLPGYLFPILTFFSWVCW  245

Query  791  VWP  799
             WP
Sbjct  246  AWP  248



>ref|XP_004250295.1| PREDICTED: oligopeptide transporter 3 [Solanum lycopersicum]
Length=755

 Score =   407 bits (1047),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 193/239 (81%), Positives = 218/239 (91%), Gaps = 1/239 (0%)
 Frame = +2

Query  86   GEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPL  265
            G+ ++ +  RC VEEVALVVPETDDP+LPV+TFRAWFLG++SC ILIFLNTFFIYRTQPL
Sbjct  26   GDASSTNDERCSVEEVALVVPETDDPSLPVMTFRAWFLGLSSCTILIFLNTFFIYRTQPL  85

Query  266  SISAILMQISVLPIGKFMAATLPERKFAPFGRW-SFTLNPGPFNIKEHVIITVMANCGVS  442
            +ISAILMQI+VLPIGKFMAATLP++ FA FGRW SF+LNPGPFNIKEHV+ITVMANCGVS
Sbjct  86   TISAILMQIAVLPIGKFMAATLPKKSFAIFGRWGSFSLNPGPFNIKEHVVITVMANCGVS  145

Query  443  PGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPS  622
             GGGDAYSIGAIT+M+AYY Q++SFLC LIIVLTTQ++GYGWAG+LRRYLVDPVDMWWPS
Sbjct  146  IGGGDAYSIGAITVMRAYYNQSVSFLCSLIIVLTTQILGYGWAGMLRRYLVDPVDMWWPS  205

Query  623  NLAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  799
            NLAQVSLFRALHE E K+ G TRM+FFL+ M ASF YY LPGYLFPILTFFSWVCW +P
Sbjct  206  NLAQVSLFRALHEKEPKTRGFTRMKFFLIFMAASFAYYALPGYLFPILTFFSWVCWAYP  264



>gb|EYU27660.1| hypothetical protein MIMGU_mgv1a001879mg [Erythranthe guttata]
Length=745

 Score =   403 bits (1035),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 188/229 (82%), Positives = 211/229 (92%), Gaps = 0/229 (0%)
 Frame = +2

Query  113  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  292
            RC VEEVALVVPETDDPTLPV+TFRAW LG+ SC ILIFLNTFFIYRTQPLSISAILMQI
Sbjct  26   RCSVEEVALVVPETDDPTLPVMTFRAWVLGLVSCTILIFLNTFFIYRTQPLSISAILMQI  85

Query  293  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            +VLP+G+FMAATLP +++A FGRW F+LNPGPFNIKEHVIITVMANCGVS GGGDAYSIG
Sbjct  86   AVLPVGRFMAATLPTKEYALFGRWRFSLNPGPFNIKEHVIITVMANCGVSVGGGDAYSIG  145

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFRA  652
            AIT+MKAYYKQ+L+FLC L+IVLTTQ++GYGWAG+LR+YLVDPV+MWWPSNLAQVSLFRA
Sbjct  146  AITVMKAYYKQSLNFLCALLIVLTTQILGYGWAGMLRKYLVDPVEMWWPSNLAQVSLFRA  205

Query  653  LHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  799
            LHE E K+ G+TRM+FFL+ M ASF+YY  PGYLF ILTFFSWVCW WP
Sbjct  206  LHEKETKAQGITRMKFFLICMTASFIYYLFPGYLFQILTFFSWVCWAWP  254



>gb|KEH32683.1| oligopeptide transporter OPT family protein [Medicago truncatula]
Length=741

 Score =   402 bits (1033),  Expect = 9e-132, Method: Compositional matrix adjust.
 Identities = 193/251 (77%), Positives = 220/251 (88%), Gaps = 4/251 (2%)
 Frame = +2

Query  59   MSGLNPATAGEKTA---PSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIF  229
            M+ +NP    EK +   P   RCP+EEVALVVPETDDP+LPV+TFR+WFLGITSCIILIF
Sbjct  1    MAPMNPTPDTEKASNGVPPDDRCPIEEVALVVPETDDPSLPVMTFRSWFLGITSCIILIF  60

Query  230  LNTFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHV  409
            LNTFF +RTQPL+ISAILMQI+VLPIGKFMAATLP +++  FGRW FTLNPGPFN+KEHV
Sbjct  61   LNTFFTFRTQPLTISAILMQIAVLPIGKFMAATLPTKEYNFFGRWRFTLNPGPFNMKEHV  120

Query  410  IITVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRY  589
            IIT+ ANCGVS GGGDAYSIGAITIMKAYYKQ+LSFL  L IVLTTQ++GYGWAG+LRRY
Sbjct  121  IITIFANCGVSQGGGDAYSIGAITIMKAYYKQSLSFLLALFIVLTTQILGYGWAGILRRY  180

Query  590  LVDPVDMWWPSNLAQVSLFRALHETEVKSS-GMTRMRFFLLVMGASFVYYTLPGYLFPIL  766
            LVDPV+MWWPSNLAQVSLFRALHE E K+S G TRM+FFL+ MG SF+YY LPGYLF +L
Sbjct  181  LVDPVEMWWPSNLAQVSLFRALHEKENKASKGFTRMQFFLIAMGVSFLYYALPGYLFTVL  240

Query  767  TFFSWVCWVWP  799
            TFFSW+C+ WP
Sbjct  241  TFFSWICYAWP  251



>ref|XP_011040169.1| PREDICTED: oligopeptide transporter 3 [Populus euphratica]
Length=743

 Score =   402 bits (1032),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 192/237 (81%), Positives = 212/237 (89%), Gaps = 1/237 (0%)
 Frame = +2

Query  89   EKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLS  268
            +  A    RCPVEEVALVVPETDDPTLPVLTFRAWFLG+TSC+ILIFLNTFF YRTQPL+
Sbjct  18   DSAAEHHERCPVEEVALVVPETDDPTLPVLTFRAWFLGLTSCVILIFLNTFFTYRTQPLT  77

Query  269  ISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPG  448
            ISAILMQI+VLPIGKFMA TLP + +   G WSF+LNPGPFN+KEHVIIT+ ANCGVS G
Sbjct  78   ISAILMQIAVLPIGKFMAKTLPTKDYRILG-WSFSLNPGPFNMKEHVIITIFANCGVSYG  136

Query  449  GGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNL  628
            GGDAYSIGAIT+MKAYY+Q+LSFLCGL+IVLTTQ++GYGWAG+LRRYLV PV+MWWPSNL
Sbjct  137  GGDAYSIGAITVMKAYYRQSLSFLCGLLIVLTTQILGYGWAGMLRRYLVYPVEMWWPSNL  196

Query  629  AQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  799
            AQVSLFRALHE E KS GMTRMRFFL+ M ASF YY +PGYLFPILTFFSWVCW WP
Sbjct  197  AQVSLFRALHEKEPKSKGMTRMRFFLIAMTASFFYYAVPGYLFPILTFFSWVCWAWP  253



>sp|O23482.3|OPT3_ARATH RecName: Full=Oligopeptide transporter 3; Short=AtOPT3 [Arabidopsis 
thaliana]
 gb|AAN72034.1| isp4 like protein [Arabidopsis thaliana]
Length=737

 Score =   401 bits (1030),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 192/248 (77%), Positives = 217/248 (88%), Gaps = 5/248 (2%)
 Frame = +2

Query  68   LNPATAGEKT----APSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLN  235
            ++   A +KT    +    RCPVEEVALVVPETDDP+LPV+TFRAWFLG+TSC++LIFLN
Sbjct  1    MDAEKATDKTNVHLSSDHERCPVEEVALVVPETDDPSLPVMTFRAWFLGLTSCVLLIFLN  60

Query  236  TFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVII  415
            TFF YRTQPL+ISAILMQI+VLPIGKFMA TLP       G WSF+LNPGPFNIKEHVII
Sbjct  61   TFFTYRTQPLTISAILMQIAVLPIGKFMARTLPTTSHNLLG-WSFSLNPGPFNIKEHVII  119

Query  416  TVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  595
            T+ ANCGV+ GGGDAYSIGAIT+MKAYYKQ+LSF+CGL IVLTTQ++GYGWAG+LRRYLV
Sbjct  120  TIFANCGVAYGGGDAYSIGAITVMKAYYKQSLSFICGLFIVLTTQILGYGWAGILRRYLV  179

Query  596  DPVDMWWPSNLAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFF  775
            DPVDMWWPSNLAQVSLFRALHE E KS G+TRM+FFL+ +GASF+YY LPGYLFPILTFF
Sbjct  180  DPVDMWWPSNLAQVSLFRALHEKENKSKGLTRMKFFLVALGASFIYYALPGYLFPILTFF  239

Query  776  SWVCWVWP  799
            SWVCW WP
Sbjct  240  SWVCWAWP  247



>ref|NP_567493.5| oligopeptide transporter [Arabidopsis thaliana]
 gb|AEE83738.1| oligopeptide transporter [Arabidopsis thaliana]
Length=737

 Score =   401 bits (1030),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 192/248 (77%), Positives = 217/248 (88%), Gaps = 5/248 (2%)
 Frame = +2

Query  68   LNPATAGEKT----APSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLN  235
            ++   A +KT    +    RCPVEEVALVVPETDDP+LPV+TFRAWFLG+TSC++LIFLN
Sbjct  1    MDAEKATDKTNVHLSSDHERCPVEEVALVVPETDDPSLPVMTFRAWFLGLTSCVLLIFLN  60

Query  236  TFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVII  415
            TFF YRTQPL+ISAILMQI+VLPIGKFMA TLP       G WSF+LNPGPFNIKEHVII
Sbjct  61   TFFTYRTQPLTISAILMQIAVLPIGKFMARTLPTTSHNLLG-WSFSLNPGPFNIKEHVII  119

Query  416  TVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  595
            T+ ANCGV+ GGGDAYSIGAIT+MKAYYKQ+LSF+CGL IVLTTQ++GYGWAG+LRRYLV
Sbjct  120  TIFANCGVAYGGGDAYSIGAITVMKAYYKQSLSFICGLFIVLTTQILGYGWAGILRRYLV  179

Query  596  DPVDMWWPSNLAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFF  775
            DPVDMWWPSNLAQVSLFRALHE E KS G+TRM+FFL+ +GASF+YY LPGYLFPILTFF
Sbjct  180  DPVDMWWPSNLAQVSLFRALHEKENKSKGLTRMKFFLVALGASFIYYALPGYLFPILTFF  239

Query  776  SWVCWVWP  799
            SWVCW WP
Sbjct  240  SWVCWAWP  247



>ref|XP_002308764.1| OLIGOPEPTIDE TRANSPORTER family protein [Populus trichocarpa]
 gb|EEE92287.1| OLIGOPEPTIDE TRANSPORTER family protein [Populus trichocarpa]
Length=744

 Score =   400 bits (1028),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 195/248 (79%), Positives = 218/248 (88%), Gaps = 4/248 (2%)
 Frame = +2

Query  56   EMSGLNPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLN  235
              +GL   ++ E+      RCPVEEVALVVPETDDPTLPVLTFRAWFLG+TSCIILIFLN
Sbjct  11   HTNGLGLDSSAEEQHE---RCPVEEVALVVPETDDPTLPVLTFRAWFLGLTSCIILIFLN  67

Query  236  TFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVII  415
            TFF YRTQPL+ISAILMQI+VLPIGKFMA TLP R +   G WSF+LNPGPFN+KEHVII
Sbjct  68   TFFTYRTQPLTISAILMQIAVLPIGKFMAKTLPTRDYRILG-WSFSLNPGPFNMKEHVII  126

Query  416  TVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  595
            T+ ANCGVS GGGDAYSIGAIT+MKAYYKQ LSFLCGL IVLTTQ++GYGWAG+LRRYLV
Sbjct  127  TIFANCGVSFGGGDAYSIGAITVMKAYYKQNLSFLCGLFIVLTTQILGYGWAGMLRRYLV  186

Query  596  DPVDMWWPSNLAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFF  775
             PV+MWWPSNLAQVSLFRALHE + KS G+TRM+FFL+ M ASF+YYT+PGYLFPI+TFF
Sbjct  187  YPVEMWWPSNLAQVSLFRALHEKDPKSKGLTRMQFFLIAMTASFLYYTVPGYLFPIMTFF  246

Query  776  SWVCWVWP  799
            SWVCWVWP
Sbjct  247  SWVCWVWP  254



>ref|XP_011002374.1| PREDICTED: oligopeptide transporter 3-like [Populus euphratica]
Length=744

 Score =   400 bits (1028),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 195/248 (79%), Positives = 218/248 (88%), Gaps = 4/248 (2%)
 Frame = +2

Query  56   EMSGLNPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLN  235
              +GL   ++ E+      RCPVEEVALVVPETDDPTLPVLTFRAWFLG+TSCIILIFLN
Sbjct  11   HTNGLGLDSSAEEQHE---RCPVEEVALVVPETDDPTLPVLTFRAWFLGLTSCIILIFLN  67

Query  236  TFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVII  415
            TFF YRTQPL+ISAILMQI+VLPIGKFMA TLP R +   G WSF+LNPGPFN+KEHVII
Sbjct  68   TFFTYRTQPLTISAILMQIAVLPIGKFMAKTLPPRDYRILG-WSFSLNPGPFNMKEHVII  126

Query  416  TVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  595
            T+ ANCGVS GGGDAYSIGAIT+MKAYYKQ LSFLCGL IVLTTQ++GYGWAG+LRRYLV
Sbjct  127  TIFANCGVSFGGGDAYSIGAITVMKAYYKQNLSFLCGLFIVLTTQILGYGWAGMLRRYLV  186

Query  596  DPVDMWWPSNLAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFF  775
             PV+MWWPSNLAQVSLFRALHE + KS G+TRM+FFL+ M ASF+YYT+PGYLFPI+TFF
Sbjct  187  YPVEMWWPSNLAQVSLFRALHEKDPKSKGLTRMQFFLIAMTASFLYYTVPGYLFPIMTFF  246

Query  776  SWVCWVWP  799
            SWVCWVWP
Sbjct  247  SWVCWVWP  254



>gb|AAK96781.1| Unknown protein [Arabidopsis thaliana]
Length=737

 Score =   399 bits (1026),  Expect = 9e-131, Method: Compositional matrix adjust.
 Identities = 191/248 (77%), Positives = 216/248 (87%), Gaps = 5/248 (2%)
 Frame = +2

Query  68   LNPATAGEKT----APSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLN  235
            ++   A +KT    +    RCPVEEVALVVPETDDP+LPV+TFR WFLG+TSC++LIFLN
Sbjct  1    MDAEKATDKTNVHLSSDHERCPVEEVALVVPETDDPSLPVMTFRTWFLGLTSCVLLIFLN  60

Query  236  TFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVII  415
            TFF YRTQPL+ISAILMQI+VLPIGKFMA TLP       G WSF+LNPGPFNIKEHVII
Sbjct  61   TFFTYRTQPLTISAILMQIAVLPIGKFMARTLPTTSHNLLG-WSFSLNPGPFNIKEHVII  119

Query  416  TVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  595
            T+ ANCGV+ GGGDAYSIGAIT+MKAYYKQ+LSF+CGL IVLTTQ++GYGWAG+LRRYLV
Sbjct  120  TIFANCGVAYGGGDAYSIGAITVMKAYYKQSLSFICGLFIVLTTQILGYGWAGILRRYLV  179

Query  596  DPVDMWWPSNLAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFF  775
            DPVDMWWPSNLAQVSLFRALHE E KS G+TRM+FFL+ +GASF+YY LPGYLFPILTFF
Sbjct  180  DPVDMWWPSNLAQVSLFRALHEKENKSKGLTRMKFFLVALGASFIYYALPGYLFPILTFF  239

Query  776  SWVCWVWP  799
            SWVCW WP
Sbjct  240  SWVCWAWP  247



>ref|XP_006414361.1| hypothetical protein EUTSA_v10024512mg [Eutrema salsugineum]
 gb|ESQ55814.1| hypothetical protein EUTSA_v10024512mg [Eutrema salsugineum]
Length=736

 Score =   399 bits (1025),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 191/247 (77%), Positives = 211/247 (85%), Gaps = 1/247 (0%)
 Frame = +2

Query  59   MSGLNPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNT  238
            M     A           RCPVEEVALVVPETDDPTLPV+TFRAWFLG+TSC++LIFLNT
Sbjct  1    MDAEKAANNDNNGHLDHERCPVEEVALVVPETDDPTLPVMTFRAWFLGLTSCVLLIFLNT  60

Query  239  FFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIIT  418
            FF YRTQPL+ISAILMQI+VLPIGKFMA TLP       G W F+LNPGPFNIKEHVIIT
Sbjct  61   FFTYRTQPLTISAILMQIAVLPIGKFMARTLPTTSHKLMG-WEFSLNPGPFNIKEHVIIT  119

Query  419  VMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVD  598
            + ANCGV+ GGGDAYSIGAIT+MKAYYKQ+LSF+CGL IVLTTQ++GYGWAG+LRRYLVD
Sbjct  120  IFANCGVAYGGGDAYSIGAITVMKAYYKQSLSFICGLFIVLTTQILGYGWAGILRRYLVD  179

Query  599  PVDMWWPSNLAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFS  778
            PVDMWWPSNLAQVSLFRALHE E KS G+TRM+FFL+ +GASF+YY LPGYLFPILTFFS
Sbjct  180  PVDMWWPSNLAQVSLFRALHEKEHKSKGLTRMQFFLVALGASFLYYALPGYLFPILTFFS  239

Query  779  WVCWVWP  799
            WVCW WP
Sbjct  240  WVCWAWP  246



>ref|XP_002273768.2| PREDICTED: oligopeptide transporter 3 [Vitis vinifera]
Length=748

 Score =   399 bits (1026),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 193/244 (79%), Positives = 217/244 (89%), Gaps = 3/244 (1%)
 Frame = +2

Query  74   PATAGEKT--APSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFI  247
            P T G++   AP G R PVEEVALVVPETDD TLPV+TFRAWFLGI SC +LIFLNTFF 
Sbjct  15   PTTNGKEATQAPEGERTPVEEVALVVPETDDQTLPVMTFRAWFLGIISCSLLIFLNTFFS  74

Query  248  YRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMA  427
            YRTQPL+ISAILMQI+VLP+GKFMA+TLP R+F  FG W F+LNPGPFN+KEHVIITV A
Sbjct  75   YRTQPLTISAILMQIAVLPVGKFMASTLPRREFKVFG-WGFSLNPGPFNMKEHVIITVFA  133

Query  428  NCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVD  607
            NCGVS GGGDAYSIGAIT+MKAYYKQ+L+FLCGL+IVLTTQ++GYGWAG+LR+YLV+P +
Sbjct  134  NCGVSYGGGDAYSIGAITVMKAYYKQSLNFLCGLLIVLTTQILGYGWAGMLRKYLVEPAE  193

Query  608  MWWPSNLAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVC  787
            MWWPSNLAQVSLFRALHE E KS G+TRM+FFLL + ASF YY LPGYLFPILTFFSWVC
Sbjct  194  MWWPSNLAQVSLFRALHEKESKSKGLTRMQFFLLFLMASFFYYALPGYLFPILTFFSWVC  253

Query  788  WVWP  799
            WVWP
Sbjct  254  WVWP  257



>emb|CBI18634.3| unnamed protein product [Vitis vinifera]
Length=752

 Score =   399 bits (1026),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 193/244 (79%), Positives = 217/244 (89%), Gaps = 3/244 (1%)
 Frame = +2

Query  74   PATAGEKT--APSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFI  247
            P T G++   AP G R PVEEVALVVPETDD TLPV+TFRAWFLGI SC +LIFLNTFF 
Sbjct  15   PTTNGKEATQAPEGERTPVEEVALVVPETDDQTLPVMTFRAWFLGIISCSLLIFLNTFFS  74

Query  248  YRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMA  427
            YRTQPL+ISAILMQI+VLP+GKFMA+TLP R+F  FG W F+LNPGPFN+KEHVIITV A
Sbjct  75   YRTQPLTISAILMQIAVLPVGKFMASTLPRREFKVFG-WGFSLNPGPFNMKEHVIITVFA  133

Query  428  NCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVD  607
            NCGVS GGGDAYSIGAIT+MKAYYKQ+L+FLCGL+IVLTTQ++GYGWAG+LR+YLV+P +
Sbjct  134  NCGVSYGGGDAYSIGAITVMKAYYKQSLNFLCGLLIVLTTQILGYGWAGMLRKYLVEPAE  193

Query  608  MWWPSNLAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVC  787
            MWWPSNLAQVSLFRALHE E KS G+TRM+FFLL + ASF YY LPGYLFPILTFFSWVC
Sbjct  194  MWWPSNLAQVSLFRALHEKESKSKGLTRMQFFLLFLMASFFYYALPGYLFPILTFFSWVC  253

Query  788  WVWP  799
            WVWP
Sbjct  254  WVWP  257



>ref|XP_002868139.1| hypothetical protein ARALYDRAFT_355122 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44398.1| hypothetical protein ARALYDRAFT_355122 [Arabidopsis lyrata subsp. 
lyrata]
Length=737

 Score =   399 bits (1024),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 188/229 (82%), Positives = 210/229 (92%), Gaps = 1/229 (0%)
 Frame = +2

Query  113  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  292
            RCPVEEVALVVPETDDP++PV+TFRAWFLG+TSC++LIFLNTFF YRTQPL+ISAILMQI
Sbjct  20   RCPVEEVALVVPETDDPSIPVMTFRAWFLGLTSCVLLIFLNTFFTYRTQPLTISAILMQI  79

Query  293  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            +VLPIGKFMA TLP       G W+F+LNPGPFNIKEHVIIT+ ANCGVS GGGDAYSIG
Sbjct  80   AVLPIGKFMARTLPTTSHNLLG-WNFSLNPGPFNIKEHVIITIFANCGVSYGGGDAYSIG  138

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFRA  652
            AIT+MKAYYKQ+LSF+CGL IVLTTQ++GYGWAG+LRRYLVDPVDMWWPSNLAQVSLFRA
Sbjct  139  AITVMKAYYKQSLSFICGLFIVLTTQILGYGWAGILRRYLVDPVDMWWPSNLAQVSLFRA  198

Query  653  LHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  799
            LHE E KS G+TRM+FFL+ +GASF+YY LPGYLFPILTFFSWVCW WP
Sbjct  199  LHEKENKSKGLTRMQFFLVALGASFLYYALPGYLFPILTFFSWVCWAWP  247



>ref|XP_010087657.1| Oligopeptide transporter 3 [Morus notabilis]
 gb|EXB29550.1| Oligopeptide transporter 3 [Morus notabilis]
Length=724

 Score =   397 bits (1021),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 188/248 (76%), Positives = 214/248 (86%), Gaps = 1/248 (0%)
 Frame = +2

Query  56   EMSGLNPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLN  235
            + +G    T       S  RC VEEVALVVPETDDP+LPVLTFRAW LG+ SC++LIFLN
Sbjct  4    KTNGQGTETEKPNVESSEERCSVEEVALVVPETDDPSLPVLTFRAWVLGLGSCVLLIFLN  63

Query  236  TFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVII  415
            TFF YRTQPL+ISAILMQISVLPIGKFMAATLP ++++  GR  F+LNPGPFN+KEHVII
Sbjct  64   TFFTYRTQPLTISAILMQISVLPIGKFMAATLPTKEYSLLGR-RFSLNPGPFNMKEHVII  122

Query  416  TVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  595
            T+ ANCGVS GGGDAYSIGAIT+MKAYYKQ+++FLC L+IVLTTQ++GYGWAG+LRRYLV
Sbjct  123  TIFANCGVSFGGGDAYSIGAITVMKAYYKQSVNFLCALLIVLTTQILGYGWAGMLRRYLV  182

Query  596  DPVDMWWPSNLAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFF  775
            DPV+MWWP+NLAQVSLFRALHE E K  GMTRM+FFL+ MGASF YY LPGYLFPILTFF
Sbjct  183  DPVEMWWPANLAQVSLFRALHEKEDKKKGMTRMKFFLIAMGASFAYYALPGYLFPILTFF  242

Query  776  SWVCWVWP  799
            SWVCW WP
Sbjct  243  SWVCWAWP  250



>ref|XP_010449801.1| PREDICTED: oligopeptide transporter 3 [Camelina sativa]
Length=737

 Score =   398 bits (1022),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 189/229 (83%), Positives = 208/229 (91%), Gaps = 1/229 (0%)
 Frame = +2

Query  113  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  292
            RCPVEEVALVVPETDDP++PV+TFRAWFLG+TSC++LIFLNTFF YRTQPL+ISAILMQI
Sbjct  20   RCPVEEVALVVPETDDPSIPVMTFRAWFLGLTSCVLLIFLNTFFTYRTQPLTISAILMQI  79

Query  293  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            +VLPIGKFMA TLP       G W F+LNPGPFNIKEHVIIT+ ANCGVS GGGDAYSIG
Sbjct  80   AVLPIGKFMARTLPTTSRNLLG-WKFSLNPGPFNIKEHVIITIFANCGVSYGGGDAYSIG  138

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFRA  652
            AIT+MKAYYKQ+LSF+CGL IVLTTQ+IGYGWAG+LRRYLVDPVDMWWPSNLAQVSLFRA
Sbjct  139  AITVMKAYYKQSLSFICGLFIVLTTQIIGYGWAGILRRYLVDPVDMWWPSNLAQVSLFRA  198

Query  653  LHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  799
            LHE E KS G TRM+FFL+ +GASF+YY LPGYLFPILTFFSWVCW WP
Sbjct  199  LHEKEEKSKGFTRMQFFLVALGASFLYYALPGYLFPILTFFSWVCWAWP  247



>ref|XP_010440168.1| PREDICTED: oligopeptide transporter 3-like [Camelina sativa]
Length=737

 Score =   397 bits (1021),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 189/229 (83%), Positives = 208/229 (91%), Gaps = 1/229 (0%)
 Frame = +2

Query  113  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  292
            RCPVEEVALVVPETDDP++PV+TFRAWFLG+TSC++LIFLNTFF YRTQPL+ISAILMQI
Sbjct  20   RCPVEEVALVVPETDDPSIPVMTFRAWFLGLTSCVLLIFLNTFFTYRTQPLTISAILMQI  79

Query  293  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            +VLPIGKFMA TLP       G W FTLNPGPFNIKEHVIIT+ ANCGVS GGGDAYSIG
Sbjct  80   AVLPIGKFMARTLPTTSRNLLG-WKFTLNPGPFNIKEHVIITIFANCGVSYGGGDAYSIG  138

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFRA  652
            AIT+MKAYYKQ+L+F+CGL IVLTTQ+IGYGWAG+LRRYLVDPVDMWWPSNLAQVSLFRA
Sbjct  139  AITVMKAYYKQSLTFICGLFIVLTTQIIGYGWAGILRRYLVDPVDMWWPSNLAQVSLFRA  198

Query  653  LHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  799
            LHE E KS G TRM+FFL+ +GASF+YY LPGYLFPILTFFSWVCW WP
Sbjct  199  LHEKEEKSKGFTRMQFFLVALGASFLYYALPGYLFPILTFFSWVCWAWP  247



>ref|XP_004507597.1| PREDICTED: oligopeptide transporter 3-like [Cicer arietinum]
Length=739

 Score =   397 bits (1021),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 190/250 (76%), Positives = 217/250 (87%), Gaps = 4/250 (2%)
 Frame = +2

Query  59   MSGLNPATAGEKTA---PSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIF  229
            M+  N  T  EK A   P   RCP+EEVALVVPETDDPTLPV+TFR+WFLGI SCI+LIF
Sbjct  1    MAPKNQTTDTEKAANGAPPDDRCPIEEVALVVPETDDPTLPVMTFRSWFLGIASCILLIF  60

Query  230  LNTFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHV  409
            LNTFF +RTQPL+ISAILMQI+VLPIG+FMA+TLP ++++  G W F+LNPGPFN+KEHV
Sbjct  61   LNTFFTFRTQPLAISAILMQIAVLPIGRFMASTLPTKEYSVLG-WRFSLNPGPFNMKEHV  119

Query  410  IITVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRY  589
            IIT+ ANCGVS GGGDAYSIGAITIMKAYYKQ++SFLC L IVLTTQ++GYGWAG+LRRY
Sbjct  120  IITIFANCGVSYGGGDAYSIGAITIMKAYYKQSISFLCALFIVLTTQILGYGWAGILRRY  179

Query  590  LVDPVDMWWPSNLAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILT  769
            LVDPV+MWWPSNLAQVSLFRALHE E KS G TRM+FFL+ MG SF+YY LPGYL  ILT
Sbjct  180  LVDPVEMWWPSNLAQVSLFRALHEKENKSKGFTRMQFFLIAMGLSFLYYALPGYLLTILT  239

Query  770  FFSWVCWVWP  799
            FFSW+CWVWP
Sbjct  240  FFSWICWVWP  249



>gb|KDO78542.1| hypothetical protein CISIN_1g004659mg [Citrus sinensis]
Length=739

 Score =   397 bits (1021),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 188/243 (77%), Positives = 215/243 (88%), Gaps = 4/243 (2%)
 Frame = +2

Query  71   NPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIY  250
            N    G+ T     RCP+EEVAL+VPETDDPT+PV+TFRAWFLG+TSC +LIFLNTFF +
Sbjct  10   NENPNGDSTEE---RCPIEEVALIVPETDDPTMPVMTFRAWFLGLTSCTLLIFLNTFFTF  66

Query  251  RTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMAN  430
            RTQPL+ISAILMQI+VLPIGKFMA  LP ++F   G W F+LNPGPFNIKEHVIIT+ AN
Sbjct  67   RTQPLTISAILMQIAVLPIGKFMARILPNKEFQVLG-WRFSLNPGPFNIKEHVIITIFAN  125

Query  431  CGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDM  610
            CGVS GGGDAYSIGAIT+MKAYYKQ+L+FLCGL+IVLTTQ++GYGWAG+LRRYLVDPV+M
Sbjct  126  CGVSFGGGDAYSIGAITVMKAYYKQSLNFLCGLLIVLTTQILGYGWAGMLRRYLVDPVEM  185

Query  611  WWPSNLAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCW  790
            WWPSNLAQVSLFRALHE E KS G+TRM+FFL+V+ ASF YY+LPGYLFPILTFFSWVCW
Sbjct  186  WWPSNLAQVSLFRALHEKESKSKGLTRMQFFLIVLAASFAYYSLPGYLFPILTFFSWVCW  245

Query  791  VWP  799
             WP
Sbjct  246  AWP  248



>ref|XP_006283198.1| hypothetical protein CARUB_v10004230mg [Capsella rubella]
 gb|EOA16096.1| hypothetical protein CARUB_v10004230mg [Capsella rubella]
Length=737

 Score =   397 bits (1020),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 190/248 (77%), Positives = 215/248 (87%), Gaps = 5/248 (2%)
 Frame = +2

Query  68   LNPATAGEKT----APSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLN  235
            ++   AG+K     +    RCPVEEVALVVPETDDP++PV+TFRAWFLG+TSC++LIFLN
Sbjct  1    MDAEKAGDKNNAHLSSDHERCPVEEVALVVPETDDPSIPVMTFRAWFLGLTSCVLLIFLN  60

Query  236  TFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVII  415
            TFF YRTQPL+ISAILMQI+VLPIGKFMA TLP       G W+F+LNPGPFNIKEHVII
Sbjct  61   TFFTYRTQPLTISAILMQIAVLPIGKFMARTLPTTSHNLLG-WNFSLNPGPFNIKEHVII  119

Query  416  TVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  595
            T+ ANCGVS GGGDAYSIGAIT+MKAYYKQ+LSF+CGL IVLTTQ++GYGWAG+LRRYLV
Sbjct  120  TIFANCGVSYGGGDAYSIGAITVMKAYYKQSLSFICGLFIVLTTQILGYGWAGILRRYLV  179

Query  596  DPVDMWWPSNLAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFF  775
            DPVDMWWPSNLAQVSLFRALHE E KS G TRM+FFL+ + ASF+YY LPGYLFPILTFF
Sbjct  180  DPVDMWWPSNLAQVSLFRALHEREEKSKGFTRMQFFLVALAASFLYYALPGYLFPILTFF  239

Query  776  SWVCWVWP  799
            SWVCW WP
Sbjct  240  SWVCWAWP  247



>ref|XP_007154044.1| hypothetical protein PHAVU_003G086500g [Phaseolus vulgaris]
 gb|ESW26038.1| hypothetical protein PHAVU_003G086500g [Phaseolus vulgaris]
Length=741

 Score =   397 bits (1020),  Expect = 8e-130, Method: Compositional matrix adjust.
 Identities = 188/251 (75%), Positives = 217/251 (86%), Gaps = 5/251 (2%)
 Frame = +2

Query  59   MSGLNPATAGEKTAPSG----GRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILI  226
            M+     T   + A +G     RCPVEEVALVVPETDDP+LPV+TFRAWFLG+ SC++LI
Sbjct  1    MAAAKTTTKDSEKAENGESPPDRCPVEEVALVVPETDDPSLPVMTFRAWFLGLASCVVLI  60

Query  227  FLNTFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEH  406
            FLNTFF +RTQPL+ISAILMQI+VLPIG+FMAATLP ++++  G W FTLNPGPFN+KEH
Sbjct  61   FLNTFFTFRTQPLTISAILMQIAVLPIGRFMAATLPTKEYSFLG-WRFTLNPGPFNMKEH  119

Query  407  VIITVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRR  586
            VIIT+ ANCGVS GGGDAYSIGAIT+MKAYYKQ+LSFLC L IVLTTQ++GYGWAG+LRR
Sbjct  120  VIITIFANCGVSFGGGDAYSIGAITVMKAYYKQSLSFLCALFIVLTTQMLGYGWAGILRR  179

Query  587  YLVDPVDMWWPSNLAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPIL  766
            YLVDPV+MWWP+NLAQVSLFRALHE E KS G TRM+FFL+ MGASF+YY LPGYLF +L
Sbjct  180  YLVDPVEMWWPANLAQVSLFRALHEKEQKSKGFTRMQFFLIAMGASFLYYALPGYLFTVL  239

Query  767  TFFSWVCWVWP  799
            TFFSWVCW WP
Sbjct  240  TFFSWVCWAWP  250



>ref|XP_006467278.1| PREDICTED: oligopeptide transporter 3-like [Citrus sinensis]
Length=739

 Score =   397 bits (1020),  Expect = 8e-130, Method: Compositional matrix adjust.
 Identities = 188/243 (77%), Positives = 214/243 (88%), Gaps = 4/243 (2%)
 Frame = +2

Query  71   NPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIY  250
            N    G+ T     RCP+EEVAL+VPETDDPT+PV+TFRAWFLG+TSC +LIFLNTFF +
Sbjct  10   NENPNGDSTEE---RCPIEEVALIVPETDDPTMPVMTFRAWFLGLTSCTLLIFLNTFFTF  66

Query  251  RTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMAN  430
            RTQPL+ISAILMQI+VLPIGKFMA  LP ++F   G W F+LNPGPFNIKEHVIIT+ AN
Sbjct  67   RTQPLTISAILMQIAVLPIGKFMARILPNKEFQVLG-WRFSLNPGPFNIKEHVIITIFAN  125

Query  431  CGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDM  610
            CGVS GGGDAYSIGAIT+MKAYYKQ+L+FLCGL+IVLTTQ++GYGWAG+LRRYLVDPV+M
Sbjct  126  CGVSFGGGDAYSIGAITVMKAYYKQSLNFLCGLLIVLTTQILGYGWAGMLRRYLVDPVEM  185

Query  611  WWPSNLAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCW  790
            WWPSNLAQVSLFRALHE E KS G+TRM+FFL+ + ASF YYTLPGYLFPILTFFSWVCW
Sbjct  186  WWPSNLAQVSLFRALHEKESKSKGLTRMQFFLITLAASFAYYTLPGYLFPILTFFSWVCW  245

Query  791  VWP  799
             WP
Sbjct  246  AWP  248



>ref|XP_006449924.1| hypothetical protein CICLE_v10014396mg [Citrus clementina]
 gb|ESR63164.1| hypothetical protein CICLE_v10014396mg [Citrus clementina]
Length=739

 Score =   397 bits (1019),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 185/229 (81%), Positives = 210/229 (92%), Gaps = 1/229 (0%)
 Frame = +2

Query  113  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  292
            RCP+EEVAL+VPETDDPT+PV+TFRAWFLG+TSC +LIFLNTFF +RTQPL+ISAILMQI
Sbjct  21   RCPIEEVALIVPETDDPTMPVMTFRAWFLGLTSCTLLIFLNTFFTFRTQPLTISAILMQI  80

Query  293  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            +VLPIGKFMA  LP ++F   G W F+LNPGPFNIKEHVIIT+ ANCGVS GGGDAYSIG
Sbjct  81   AVLPIGKFMARILPNKEFQVLG-WRFSLNPGPFNIKEHVIITIFANCGVSFGGGDAYSIG  139

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFRA  652
            AIT+MKAYYKQ+L+FLCGL+IVLTTQ++GYGWAG+LRRYLVDPV+MWWPSNLAQVSLFRA
Sbjct  140  AITVMKAYYKQSLNFLCGLLIVLTTQILGYGWAGMLRRYLVDPVEMWWPSNLAQVSLFRA  199

Query  653  LHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  799
            LHE E KS G+TRM+FFL+ + ASF YYTLPGYLFPILTFFSWVCW WP
Sbjct  200  LHEKESKSKGLTRMQFFLIALAASFAYYTLPGYLFPILTFFSWVCWAWP  248



>ref|XP_010907563.1| PREDICTED: oligopeptide transporter 3-like [Elaeis guineensis]
Length=735

 Score =   396 bits (1017),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 187/239 (78%), Positives = 212/239 (89%), Gaps = 0/239 (0%)
 Frame = +2

Query  83   AGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQP  262
            A  +  P   RCPVEEVALVVPETDDP+LPV+TFRAWFLG+ SCIILIFLNTFF YRTQP
Sbjct  7    ARPQAQPPEERCPVEEVALVVPETDDPSLPVMTFRAWFLGLASCIILIFLNTFFTYRTQP  66

Query  263  LSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVS  442
            L+ISAILMQI+ LP+G+FMA+ LP ++    G WSF LNPGPFNIKEHVIIT+ ANCGVS
Sbjct  67   LTISAILMQIAALPLGQFMASVLPNKEVRLPGNWSFNLNPGPFNIKEHVIITIFANCGVS  126

Query  443  PGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPS  622
             GGGDAYSIGAIT+MKAYYKQ+LSFLC LIIVLTTQ++GYGWAG+LRRYLV+PV+MWWPS
Sbjct  127  IGGGDAYSIGAITVMKAYYKQSLSFLCALIIVLTTQILGYGWAGMLRRYLVEPVEMWWPS  186

Query  623  NLAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  799
            NLAQVSLFRALHE + +S G+TRM+FFL+ + ASF YYTLPGYLFPILTFFSWVCWVWP
Sbjct  187  NLAQVSLFRALHEKDSRSKGLTRMQFFLVFLVASFAYYTLPGYLFPILTFFSWVCWVWP  245



>ref|XP_009773627.1| PREDICTED: oligopeptide transporter 3 [Nicotiana sylvestris]
Length=751

 Score =   396 bits (1018),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 193/229 (84%), Positives = 213/229 (93%), Gaps = 0/229 (0%)
 Frame = +2

Query  113  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  292
            RCPVEEVALVVPETDDPTLPV+TFRAWFLG+TSC +LIFLNTFFIYRTQPL+ISAILMQI
Sbjct  32   RCPVEEVALVVPETDDPTLPVMTFRAWFLGLTSCTLLIFLNTFFIYRTQPLTISAILMQI  91

Query  293  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            +VLPIGKFMAATLP++ +  FGRW F+LNPGPFNIKEHVIITVMANCGVS GGGDAYSIG
Sbjct  92   AVLPIGKFMAATLPKKSYTLFGRWGFSLNPGPFNIKEHVIITVMANCGVSIGGGDAYSIG  151

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFRA  652
            AIT+MKAYYKQ+L+FLC L++VLTTQL+GYGWAG+LRRYLVDPVDMWWPSNLAQVSLFRA
Sbjct  152  AITVMKAYYKQSLNFLCALLLVLTTQLVGYGWAGMLRRYLVDPVDMWWPSNLAQVSLFRA  211

Query  653  LHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  799
            LHE E K+ G+TRM+FFL+ M ASF YY  PGYLFPILTFFSWVCW WP
Sbjct  212  LHEKEQKTRGLTRMKFFLVFMAASFAYYAFPGYLFPILTFFSWVCWAWP  260



>ref|XP_009124517.1| PREDICTED: oligopeptide transporter 3 [Brassica rapa]
 emb|CDY22769.1| BnaA08g05990D [Brassica napus]
Length=735

 Score =   395 bits (1016),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 187/229 (82%), Positives = 209/229 (91%), Gaps = 1/229 (0%)
 Frame = +2

Query  113  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  292
            RCPVEEVALVVPETDDPTLPV+TFRAWFLG++SC++LIFLNTFF YRTQPL+ISAILMQI
Sbjct  18   RCPVEEVALVVPETDDPTLPVMTFRAWFLGLSSCVLLIFLNTFFTYRTQPLTISAILMQI  77

Query  293  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            +VLPIGKFMA TLP       G W ++LNPGPFNIKEHVIIT+ ANCGV+ GGGDAYSIG
Sbjct  78   AVLPIGKFMARTLPTTSHRLMG-WEWSLNPGPFNIKEHVIITIFANCGVAYGGGDAYSIG  136

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFRA  652
            AIT+MKAYYKQ+LSF+CGL IVLTTQ++GYGWAG+LRRYLVDPVDMWWPSNLAQVSLFRA
Sbjct  137  AITVMKAYYKQSLSFICGLFIVLTTQILGYGWAGILRRYLVDPVDMWWPSNLAQVSLFRA  196

Query  653  LHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  799
            LHE E KS G+TRM+FFL+ +GASF+YY LPGYLFPILTFFSWVCW WP
Sbjct  197  LHEKEHKSKGLTRMQFFLVALGASFLYYALPGYLFPILTFFSWVCWAWP  245



>ref|XP_010436532.1| PREDICTED: oligopeptide transporter 3 [Camelina sativa]
Length=726

 Score =   395 bits (1015),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 187/229 (82%), Positives = 208/229 (91%), Gaps = 1/229 (0%)
 Frame = +2

Query  113  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  292
            RCPVEEVALVVPETDDP++PV+TFRAWFLG++SC++LIFLNTFF YRTQPL+ISAILMQI
Sbjct  20   RCPVEEVALVVPETDDPSIPVMTFRAWFLGLSSCVLLIFLNTFFTYRTQPLTISAILMQI  79

Query  293  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            +VLPIGKFMA TLP       G W F+LNPGPFNIKEHVIIT+ ANCGV+ GGGDAYSIG
Sbjct  80   AVLPIGKFMARTLPTTSRNLLG-WKFSLNPGPFNIKEHVIITIFANCGVAYGGGDAYSIG  138

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFRA  652
            AIT+MKAYYKQ+LSF+CGL IVLTTQ+IGYGWAG+LRRYLVDPVDMWWPSNLAQVSLFRA
Sbjct  139  AITVMKAYYKQSLSFICGLFIVLTTQIIGYGWAGILRRYLVDPVDMWWPSNLAQVSLFRA  198

Query  653  LHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  799
            LHE E KS G TRM+FFL+ +GASF+YY LPGYLFPILTFFSWVCW WP
Sbjct  199  LHEKEEKSKGFTRMQFFLVALGASFLYYALPGYLFPILTFFSWVCWAWP  247



>ref|XP_007026363.1| Oligopeptide transporter isoform 2 [Theobroma cacao]
 gb|EOY28985.1| Oligopeptide transporter isoform 2 [Theobroma cacao]
Length=680

 Score =   394 bits (1011),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 185/235 (79%), Positives = 211/235 (90%), Gaps = 1/235 (0%)
 Frame = +2

Query  95   TAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSIS  274
             A    R PVEEVALVVPETDDPTLPV+TFRAWFLG+TSC++LIFLNTFF YRTQPL+IS
Sbjct  15   NAAEDDRSPVEEVALVVPETDDPTLPVMTFRAWFLGLTSCMLLIFLNTFFTYRTQPLTIS  74

Query  275  AILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGG  454
            AILMQISVLPIGKFMA TLP R+++  GR SF+LNPGPFN+KEHVIIT+ ANCGVS GGG
Sbjct  75   AILMQISVLPIGKFMARTLPTREYSLLGR-SFSLNPGPFNMKEHVIITIFANCGVSFGGG  133

Query  455  DAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQ  634
            DAYSIGAIT+MKAYYKQ+L+FLCGL+IVLTTQ++GYGWAG+LRRYLVDP +MWWPSNLAQ
Sbjct  134  DAYSIGAITVMKAYYKQSLNFLCGLLIVLTTQILGYGWAGMLRRYLVDPAEMWWPSNLAQ  193

Query  635  VSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  799
            VSLFRALHE +    G+TRM+FFL+ + ASF YY+ PGYLFP+LTFFSWVCWVWP
Sbjct  194  VSLFRALHEKDTNKKGLTRMKFFLVALVASFAYYSFPGYLFPVLTFFSWVCWVWP  248



>ref|XP_003529676.1| PREDICTED: oligopeptide transporter 3-like [Glycine max]
Length=742

 Score =   394 bits (1011),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 187/244 (77%), Positives = 214/244 (88%), Gaps = 4/244 (2%)
 Frame = +2

Query  77   ATAGEKTAPSGG---RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFI  247
            +T  EK A       RCPVEEVALVVPETDDP+LPV+TFRAWFLGI SC++LIFLNTFF 
Sbjct  9    STDAEKAANGESPPERCPVEEVALVVPETDDPSLPVMTFRAWFLGIASCVLLIFLNTFFT  68

Query  248  YRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMA  427
            +RTQPL+ISAILMQI+VLPIG+FMAATLP +++   G W FT NPGPFN+KEHVIIT+ A
Sbjct  69   FRTQPLTISAILMQIAVLPIGRFMAATLPTKEYGFLG-WRFTFNPGPFNMKEHVIITIFA  127

Query  428  NCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVD  607
            NCGVS GGGDAYSIGAIT+MKAYYKQ+LSFLC L IVLTTQ++GYGWAG+LRRYLVDPV+
Sbjct  128  NCGVSFGGGDAYSIGAITVMKAYYKQSLSFLCALFIVLTTQMLGYGWAGILRRYLVDPVE  187

Query  608  MWWPSNLAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVC  787
            MWWP+NLAQVSLFRALHE E KS G+TRM+FFL+ MGASF+YY LPGYLF +LTFFSW+C
Sbjct  188  MWWPANLAQVSLFRALHEKEPKSKGLTRMQFFLIAMGASFLYYALPGYLFMVLTFFSWIC  247

Query  788  WVWP  799
            W WP
Sbjct  248  WAWP  251



>gb|ADW09325.1| oligopeptide transporter 3 [Noccaea caerulescens]
Length=736

 Score =   393 bits (1010),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 186/229 (81%), Positives = 206/229 (90%), Gaps = 1/229 (0%)
 Frame = +2

Query  113  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  292
            RCPVEEVALVVPETDDPTLPV+TFRAWFLG+ SC++LIFLNTFF YRTQPL+ISAILMQI
Sbjct  19   RCPVEEVALVVPETDDPTLPVMTFRAWFLGLASCVLLIFLNTFFTYRTQPLTISAILMQI  78

Query  293  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            +VLPIGKFMA  LP       G+  F+LNPGPFNIKEHVIIT+ ANCGV+ GGGDAYSIG
Sbjct  79   AVLPIGKFMARILPTTSHKLMGK-EFSLNPGPFNIKEHVIITIFANCGVAYGGGDAYSIG  137

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFRA  652
            AIT+MKAYYKQ+L+F+CGL IVLTTQ++GYGWAG+LRRYLVDPVD WWPSNLAQVSLFRA
Sbjct  138  AITVMKAYYKQSLTFICGLFIVLTTQILGYGWAGILRRYLVDPVDTWWPSNLAQVSLFRA  197

Query  653  LHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  799
            LHE E KS G+TRMRFFLL +GASF+YY LPGYLFPILTFFSWVCW WP
Sbjct  198  LHEKEHKSKGLTRMRFFLLALGASFLYYALPGYLFPILTFFSWVCWAWP  246



>ref|XP_010270227.1| PREDICTED: oligopeptide transporter 3 [Nelumbo nucifera]
Length=746

 Score =   394 bits (1011),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 190/251 (76%), Positives = 215/251 (86%), Gaps = 4/251 (2%)
 Frame = +2

Query  56   EMSGLNPA---TAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILI  226
            E  G N     T      P   RCPVEEV LVVPETDDP+LPV+TFRAWFLGI SC +LI
Sbjct  6    ETKGQNKKFTTTQKLDDEPPEERCPVEEVRLVVPETDDPSLPVMTFRAWFLGIISCTLLI  65

Query  227  FLNTFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEH  406
            FLNTFFIYRTQPL+ISAILMQI+VLPIGKFMA+TLP ++    G  SF LNPGPFN+KEH
Sbjct  66   FLNTFFIYRTQPLTISAILMQIAVLPIGKFMASTLPNKEIKVLGM-SFNLNPGPFNMKEH  124

Query  407  VIITVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRR  586
            VIIT+ ANCGVS GGGDAYSIGAIT+MKAYYKQ+L+F+CGL+IVLTTQ++GYGWAG+LRR
Sbjct  125  VIITIFANCGVSYGGGDAYSIGAITVMKAYYKQSLNFVCGLLIVLTTQILGYGWAGMLRR  184

Query  587  YLVDPVDMWWPSNLAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPIL  766
            YLVDP +MWWPSNLAQVSLFRALHE + +S G+TRM+FFL+ M ASFVYYTLPGYLFP+L
Sbjct  185  YLVDPAEMWWPSNLAQVSLFRALHEKDSRSKGLTRMQFFLIFMVASFVYYTLPGYLFPVL  244

Query  767  TFFSWVCWVWP  799
            TFFSWVCWVWP
Sbjct  245  TFFSWVCWVWP  255



>gb|KHG20373.1| Oligopeptide transporter 3 -like protein [Gossypium arboreum]
Length=741

 Score =   393 bits (1009),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 188/238 (79%), Positives = 210/238 (88%), Gaps = 1/238 (0%)
 Frame = +2

Query  86   GEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPL  265
             E TA +    PVEEVALVVPETDDPTLPVLTFRAWFLG+ SC++LIFLNTFF YRTQPL
Sbjct  14   AEGTAENEDTSPVEEVALVVPETDDPTLPVLTFRAWFLGLVSCVLLIFLNTFFTYRTQPL  73

Query  266  SISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSP  445
            +ISAILMQISVLPIGKFMA TLP  +++  G W F+LNPGPFNIKEHVIIT+ ANCGVS 
Sbjct  74   TISAILMQISVLPIGKFMARTLPTTQYSLLG-WHFSLNPGPFNIKEHVIITIFANCGVSF  132

Query  446  GGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSN  625
            GGGDAYSIGAIT+MKAYYKQ+L+FLCG++IVLTTQ++GYGWAG+LRRYLVDP +MWWPSN
Sbjct  133  GGGDAYSIGAITVMKAYYKQSLNFLCGVLIVLTTQILGYGWAGMLRRYLVDPAEMWWPSN  192

Query  626  LAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  799
            LAQVSLFRALHE + K  G+TRM+FFL VM ASF YY LPGYLFPILTFFSWVCW WP
Sbjct  193  LAQVSLFRALHEKDSKKKGLTRMQFFLAVMVASFAYYALPGYLFPILTFFSWVCWAWP  250



>ref|XP_007026362.1| Oligopeptide transporter isoform 1 [Theobroma cacao]
 gb|EOY28984.1| Oligopeptide transporter isoform 1 [Theobroma cacao]
Length=739

 Score =   393 bits (1009),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 185/235 (79%), Positives = 211/235 (90%), Gaps = 1/235 (0%)
 Frame = +2

Query  95   TAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSIS  274
             A    R PVEEVALVVPETDDPTLPV+TFRAWFLG+TSC++LIFLNTFF YRTQPL+IS
Sbjct  15   NAAEDDRSPVEEVALVVPETDDPTLPVMTFRAWFLGLTSCMLLIFLNTFFTYRTQPLTIS  74

Query  275  AILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGG  454
            AILMQISVLPIGKFMA TLP R+++  GR SF+LNPGPFN+KEHVIIT+ ANCGVS GGG
Sbjct  75   AILMQISVLPIGKFMARTLPTREYSLLGR-SFSLNPGPFNMKEHVIITIFANCGVSFGGG  133

Query  455  DAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQ  634
            DAYSIGAIT+MKAYYKQ+L+FLCGL+IVLTTQ++GYGWAG+LRRYLVDP +MWWPSNLAQ
Sbjct  134  DAYSIGAITVMKAYYKQSLNFLCGLLIVLTTQILGYGWAGMLRRYLVDPAEMWWPSNLAQ  193

Query  635  VSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  799
            VSLFRALHE +    G+TRM+FFL+ + ASF YY+ PGYLFP+LTFFSWVCWVWP
Sbjct  194  VSLFRALHEKDTNKKGLTRMKFFLVALVASFAYYSFPGYLFPVLTFFSWVCWVWP  248



>gb|KJB67417.1| hypothetical protein B456_010G190300 [Gossypium raimondii]
Length=741

 Score =   392 bits (1008),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 190/243 (78%), Positives = 212/243 (87%), Gaps = 3/243 (1%)
 Frame = +2

Query  71   NPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIY  250
             P  AG  TA + G  PVEEVALVVPETDDPTLPVLTFRAWFLG+ SC++LIFLNTFF Y
Sbjct  11   KPNAAG--TAENEGMSPVEEVALVVPETDDPTLPVLTFRAWFLGLVSCVLLIFLNTFFTY  68

Query  251  RTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMAN  430
            RTQPL+ISAILMQISVLPIGKFMA TLP  +++  G W F+LNPGPFNIKEHVIIT+ AN
Sbjct  69   RTQPLTISAILMQISVLPIGKFMARTLPTTQYSLLG-WHFSLNPGPFNIKEHVIITIFAN  127

Query  431  CGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDM  610
            CGVS GGGDAYSIGAIT+MKAYYKQ+L+FLCG++IVLTTQ++GYGWAG+LRRYLVDP +M
Sbjct  128  CGVSFGGGDAYSIGAITVMKAYYKQSLNFLCGVLIVLTTQILGYGWAGMLRRYLVDPAEM  187

Query  611  WWPSNLAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCW  790
            WWPSNLAQVSLFRALHE +    G+TRM+FFL VM ASF YY LPGYLFPILTFFSWVCW
Sbjct  188  WWPSNLAQVSLFRALHEKDSTKKGLTRMQFFLAVMVASFAYYALPGYLFPILTFFSWVCW  247

Query  791  VWP  799
             WP
Sbjct  248  AWP  250



>ref|XP_010939248.1| PREDICTED: oligopeptide transporter 3-like [Elaeis guineensis]
Length=729

 Score =   392 bits (1007),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 183/238 (77%), Positives = 209/238 (88%), Gaps = 0/238 (0%)
 Frame = +2

Query  86   GEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPL  265
             EK      RCPVEEVALVVPETDD +LPV+TFRAWFLGITSC +LIFLNTFF YRTQPL
Sbjct  2    AEKQEVDQERCPVEEVALVVPETDDMSLPVMTFRAWFLGITSCTVLIFLNTFFTYRTQPL  61

Query  266  SISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSP  445
            +ISAILMQISVLP+G+FMA+ LP ++   FG+W F LNPGPFNIKEHVIITV ANCGVSP
Sbjct  62   TISAILMQISVLPLGRFMASALPNKEVKVFGQWGFNLNPGPFNIKEHVIITVFANCGVSP  121

Query  446  GGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSN  625
            GGGDAYSIGAIT+MKAYY+Q+LSFLCGLIIV+TTQL+GYGWAG++R++LVDPV+MWWPS 
Sbjct  122  GGGDAYSIGAITVMKAYYRQSLSFLCGLIIVMTTQLLGYGWAGMMRKFLVDPVEMWWPST  181

Query  626  LAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  799
            LAQVSLFRALHE +  S G +RM+FF++    SF+YY LPGYLFPILTFFSWVCWVWP
Sbjct  182  LAQVSLFRALHEKDSPSKGPSRMKFFMIFFVGSFLYYALPGYLFPILTFFSWVCWVWP  239



>emb|CDY42539.1| BnaC08g10640D [Brassica napus]
Length=735

 Score =   392 bits (1007),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 189/230 (82%), Positives = 208/230 (90%), Gaps = 3/230 (1%)
 Frame = +2

Query  113  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  292
            RCPVEEVALVVPETDDPTLPV+TFRAWFLG++SC++LIFLNTFF YRTQPL+ISAILMQI
Sbjct  18   RCPVEEVALVVPETDDPTLPVMTFRAWFLGLSSCVLLIFLNTFFTYRTQPLTISAILMQI  77

Query  293  SVLPIGKFMAATLPERKFAPFG-RWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSI  469
            +VLPIGKFMA TLP       G  WS  LNPGPFNIKEHVIIT+ ANCGV+ GGGDAYSI
Sbjct  78   AVLPIGKFMARTLPTTSHRLMGCEWS--LNPGPFNIKEHVIITIFANCGVAYGGGDAYSI  135

Query  470  GAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFR  649
            GAIT+MKAYYKQ+LSF+CGL IVLTTQ++GYGWAGVLRRYLVDPVDMWWPSNLAQVSLFR
Sbjct  136  GAITVMKAYYKQSLSFICGLFIVLTTQILGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFR  195

Query  650  ALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  799
            ALHE E KS G+TRM+FFL+ +GASF+YY LPGYLFPILTFFSWVCW WP
Sbjct  196  ALHEKEHKSKGLTRMQFFLVALGASFLYYALPGYLFPILTFFSWVCWAWP  245



>ref|XP_003549274.1| PREDICTED: oligopeptide transporter 3-like [Glycine max]
Length=741

 Score =   392 bits (1007),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 186/249 (75%), Positives = 216/249 (87%), Gaps = 2/249 (1%)
 Frame = +2

Query  53   VEMSGLNPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFL  232
            V+ S ++   A    +P   RCPVEEVALVVPETDDP+LPV+TFRAWFLGI SC++LIFL
Sbjct  4    VKSSSMDAEKAANGESPPE-RCPVEEVALVVPETDDPSLPVMTFRAWFLGIASCVLLIFL  62

Query  233  NTFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVI  412
            NTFF +RTQPL+ISAILMQI+VLPIG+FMAATLP +++   G   FT NPGPFN+KEHVI
Sbjct  63   NTFFTFRTQPLTISAILMQIAVLPIGRFMAATLPTKEYGFLGS-RFTFNPGPFNMKEHVI  121

Query  413  ITVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYL  592
            IT+ ANCGVS GGGDAYSIGAIT+MKAYYKQ+LSFLC L IVLTTQ++GYGWAG+LRRYL
Sbjct  122  ITIFANCGVSFGGGDAYSIGAITVMKAYYKQSLSFLCALFIVLTTQMMGYGWAGILRRYL  181

Query  593  VDPVDMWWPSNLAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTF  772
            VDPV+MWWP+NLAQVSLFRALHE E KS G+TRM+FFL+ MGASF+YY LPGYLF +LTF
Sbjct  182  VDPVEMWWPANLAQVSLFRALHEKEPKSKGLTRMQFFLIAMGASFLYYALPGYLFMVLTF  241

Query  773  FSWVCWVWP  799
            FSW+CW WP
Sbjct  242  FSWICWAWP  250



>ref|XP_008785648.1| PREDICTED: oligopeptide transporter 3-like [Phoenix dactylifera]
Length=730

 Score =   391 bits (1004),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 182/238 (76%), Positives = 207/238 (87%), Gaps = 0/238 (0%)
 Frame = +2

Query  86   GEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPL  265
             EK      RCPVEEVALVVPE DDP+LPV+TFRAWFLGITSC +LIFLNTFF YRTQPL
Sbjct  2    AEKQEVEQERCPVEEVALVVPENDDPSLPVMTFRAWFLGITSCTVLIFLNTFFTYRTQPL  61

Query  266  SISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSP  445
            +ISAILMQISVLP+G+ MA+ LP ++   FGRW F LNPGPFN+KEH IITV ANCGVSP
Sbjct  62   TISAILMQISVLPLGRLMASALPNKEVKVFGRWGFNLNPGPFNVKEHTIITVFANCGVSP  121

Query  446  GGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSN  625
            GGGDAYSIGAIT+MKAYY+Q+LSFLCGLIIV+TTQL+GYGWAG+LR++LVDP +MWWPS+
Sbjct  122  GGGDAYSIGAITVMKAYYRQSLSFLCGLIIVITTQLLGYGWAGMLRKFLVDPAEMWWPSS  181

Query  626  LAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  799
            LAQVSLFRALHE +  S G +RM+FFL+    SF+YY LPGYLFPILTFFSWVCWVWP
Sbjct  182  LAQVSLFRALHEKDSPSRGPSRMKFFLIFFVGSFLYYVLPGYLFPILTFFSWVCWVWP  239



>ref|XP_008224626.1| PREDICTED: oligopeptide transporter 3 [Prunus mume]
Length=739

 Score =   391 bits (1005),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 182/246 (74%), Positives = 216/246 (88%), Gaps = 1/246 (0%)
 Frame = +2

Query  62   SGLNPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTF  241
            + ++P  A   ++    RC +EEVALVVPETDDP++PV+TFRAWFLG+T+CIILIFLNTF
Sbjct  5    NHMDPEKAANGSSEDHERCAIEEVALVVPETDDPSMPVMTFRAWFLGLTTCIILIFLNTF  64

Query  242  FIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITV  421
            F +RTQPLSISAILMQI+ LPIGK MA+TLP+R+++  G W F+LNPGPFN+KEHVIIT+
Sbjct  65   FTFRTQPLSISAILMQIASLPIGKLMASTLPKREYSLLG-WRFSLNPGPFNMKEHVIITI  123

Query  422  MANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDP  601
             ANCG+S GGGDAYSIGAITIMKAYYKQ+LSFL  LIIVLT+Q++GYGWAG+LRR+LVDP
Sbjct  124  FANCGISYGGGDAYSIGAITIMKAYYKQSLSFLLALIIVLTSQILGYGWAGILRRFLVDP  183

Query  602  VDMWWPSNLAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSW  781
            V+MWWPSNLAQVSLFRALHE + K+ G+TRM+FFL+ M ASF YY LPGYLFPILTFFSW
Sbjct  184  VEMWWPSNLAQVSLFRALHEKDNKAKGLTRMQFFLIAMTASFAYYALPGYLFPILTFFSW  243

Query  782  VCWVWP  799
            VCW WP
Sbjct  244  VCWAWP  249



>gb|KDP35505.1| hypothetical protein JCGZ_08943 [Jatropha curcas]
Length=743

 Score =   391 bits (1004),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 188/245 (77%), Positives = 209/245 (85%), Gaps = 1/245 (0%)
 Frame = +2

Query  65   GLNPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFF  244
            G     A    +    RC +EEVALVVPETDDPTLPV+TFRAWFLG+ SC +LIFLNTFF
Sbjct  9    GTESEKAANGDSTEHERCSIEEVALVVPETDDPTLPVMTFRAWFLGLASCSLLIFLNTFF  68

Query  245  IYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVM  424
             YRTQPL+ISAILMQI VLPIGKFMA TLP +++  FG + FTLNPGPFNIKEHVIIT+ 
Sbjct  69   TYRTQPLTISAILMQIGVLPIGKFMARTLPSKEYKIFG-YGFTLNPGPFNIKEHVIITIF  127

Query  425  ANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPV  604
            ANCGVS GGGDAYSIGAIT+MKAYYKQ L+FL  LIIVLT+Q++GYGWAG+LRRYLVDPV
Sbjct  128  ANCGVSYGGGDAYSIGAITVMKAYYKQGLNFLLALIIVLTSQILGYGWAGMLRRYLVDPV  187

Query  605  DMWWPSNLAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWV  784
            +MWWPSNLAQVSLFRALHE E KS GMTRMRFFL+ + ASF+YY LPGYLFPILTFFSWV
Sbjct  188  EMWWPSNLAQVSLFRALHEKEPKSKGMTRMRFFLIALTASFLYYALPGYLFPILTFFSWV  247

Query  785  CWVWP  799
            CW WP
Sbjct  248  CWAWP  252



>ref|XP_008780991.1| PREDICTED: oligopeptide transporter 3-like [Phoenix dactylifera]
Length=735

 Score =   391 bits (1004),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 183/233 (79%), Positives = 207/233 (89%), Gaps = 0/233 (0%)
 Frame = +2

Query  101  PSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAI  280
            P   RCPVEEVALVVPETDDP+LPV+TFRAWFLG+ SC ILIFLNTFF YRTQPL ISAI
Sbjct  13   PPEERCPVEEVALVVPETDDPSLPVMTFRAWFLGLASCTILIFLNTFFTYRTQPLIISAI  72

Query  281  LMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDA  460
            LMQI+ LP+G+FMA+ LP ++    G WSF LNPGPFNIKEHVIIT+ ANCGVS GGGDA
Sbjct  73   LMQIAALPMGQFMASVLPNKEVRVLGNWSFNLNPGPFNIKEHVIITIFANCGVSIGGGDA  132

Query  461  YSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVS  640
            YSIGAIT+MKAYYKQ+LSFLC LIIVLTTQ++GYGWAG+LRRYLV+P++MWWPSNLAQVS
Sbjct  133  YSIGAITVMKAYYKQSLSFLCALIIVLTTQILGYGWAGMLRRYLVEPIEMWWPSNLAQVS  192

Query  641  LFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  799
            LFRALHE + +S G+TRM+FFL+ + ASF YY LPGYLFPILTFFSWVCWVWP
Sbjct  193  LFRALHEKDSRSKGLTRMQFFLVFLVASFAYYALPGYLFPILTFFSWVCWVWP  245



>ref|XP_010039442.1| PREDICTED: oligopeptide transporter 3-like [Eucalyptus grandis]
 gb|KCW45989.1| hypothetical protein EUGRSUZ_L00157 [Eucalyptus grandis]
Length=745

 Score =   390 bits (1003),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 184/229 (80%), Positives = 208/229 (91%), Gaps = 1/229 (0%)
 Frame = +2

Query  113  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  292
            RCPVEEVALVVPETDDP+LPV+TFR W LG+ SCIILIFLNTFF +RTQPL+ISAILMQI
Sbjct  27   RCPVEEVALVVPETDDPSLPVMTFRVWTLGLASCIILIFLNTFFTFRTQPLTISAILMQI  86

Query  293  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            +VLPIG+FMA TLP R++   G + F+LNPGPFN+KEHVIIT+ ANCGVS GGGDAYSIG
Sbjct  87   AVLPIGRFMAKTLPSREYKVLG-YGFSLNPGPFNMKEHVIITIFANCGVSIGGGDAYSIG  145

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFRA  652
            AIT+MKAYYKQ LSFLCGL+IVLTTQ++GYGWAG+LR+YLVDPV+MWWP+NLAQVSLFRA
Sbjct  146  AITVMKAYYKQNLSFLCGLVIVLTTQILGYGWAGLLRKYLVDPVEMWWPANLAQVSLFRA  205

Query  653  LHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  799
            LHE E K+ G TRM+FFL+ MGASFVYY LPGYLFPILTFFSWVCW WP
Sbjct  206  LHEREHKTRGFTRMQFFLMAMGASFVYYALPGYLFPILTFFSWVCWAWP  254



>ref|XP_009380132.1| PREDICTED: oligopeptide transporter 3-like [Musa acuminata subsp. 
malaccensis]
Length=740

 Score =   389 bits (1000),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 186/250 (74%), Positives = 210/250 (84%), Gaps = 3/250 (1%)
 Frame = +2

Query  59   MSGLNPATAGEKTAPSGG---RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIF  229
            M+       G  TA  G    RCPVEEVALVVPETDDP+LPV+TFRAWFLG+TSC +LIF
Sbjct  1    MASKGENKGGSSTAEEGEEVERCPVEEVALVVPETDDPSLPVMTFRAWFLGLTSCSLLIF  60

Query  230  LNTFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHV  409
            LNTFF YRTQPL+ISAILMQI+VLP G+FMA+ LP+R+   F  W F LNPGPFNIKEHV
Sbjct  61   LNTFFTYRTQPLTISAILMQIAVLPAGRFMASVLPDREVKVFRNWGFHLNPGPFNIKEHV  120

Query  410  IITVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRY  589
            IIT+ ANCGVS GGGDAYSIGAIT+MKAYYKQ+LSFLC LIIVLTTQ++GYGWAG++RRY
Sbjct  121  IITIFANCGVSIGGGDAYSIGAITVMKAYYKQSLSFLCALIIVLTTQILGYGWAGMMRRY  180

Query  590  LVDPVDMWWPSNLAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILT  769
            LVDP +MWWPSNLAQVSLFRALHE + +S G +RM+FFL+   ASF YYTLPGYL PILT
Sbjct  181  LVDPAEMWWPSNLAQVSLFRALHEKDSRSKGPSRMQFFLVFFVASFAYYTLPGYLLPILT  240

Query  770  FFSWVCWVWP  799
            FFSWVCW WP
Sbjct  241  FFSWVCWTWP  250



>gb|KFK26550.1| hypothetical protein AALP_AA8G263100 [Arabis alpina]
Length=734

 Score =   389 bits (999),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 190/242 (79%), Positives = 210/242 (87%), Gaps = 6/242 (2%)
 Frame = +2

Query  89   EKTAPSGG----RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRT  256
            EK A + G    RCPVEEVALVVPETDDPTLPV+TFRAW LG+TSC++LIFLNTFF YRT
Sbjct  4    EKAAATNGVDHERCPVEEVALVVPETDDPTLPVMTFRAWSLGLTSCVLLIFLNTFFTYRT  63

Query  257  QPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCG  436
            QPL+ISAILMQI+VLPIGKFMA TLP   +   GR  F+LNPGPFNIKEHVIIT+ ANCG
Sbjct  64   QPLTISAILMQIAVLPIGKFMARTLPTTSYHLLGR-EFSLNPGPFNIKEHVIITIFANCG  122

Query  437  VSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWW  616
            VS GGGDAYSIGAIT+MKAYYKQ+LSF+C L IVLTTQ++GYGWAG+LRRYLVDPV+MWW
Sbjct  123  VSFGGGDAYSIGAITVMKAYYKQSLSFICALFIVLTTQILGYGWAGILRRYLVDPVEMWW  182

Query  617  PSNLAQVSLFRALHETEVKSS-GMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWV  793
            PSNLAQVSLFRALHE E K S G TRM+FFL+  GASF+YY  PGYLFPILTFFSWVCW 
Sbjct  183  PSNLAQVSLFRALHEKENKQSKGFTRMQFFLVAFGASFLYYAFPGYLFPILTFFSWVCWA  242

Query  794  WP  799
            WP
Sbjct  243  WP  244



>ref|XP_008464311.1| PREDICTED: oligopeptide transporter 3 [Cucumis melo]
Length=745

 Score =   389 bits (999),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 182/238 (76%), Positives = 209/238 (88%), Gaps = 1/238 (0%)
 Frame = +2

Query  86   GEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPL  265
            G    PS  RCPVEEVALVVPETDDP+LPV+TFR+W LG+ SC +LIFLNTFF YR+QPL
Sbjct  19   GGGELPSEDRCPVEEVALVVPETDDPSLPVMTFRSWVLGLASCCLLIFLNTFFTYRSQPL  78

Query  266  SISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSP  445
            +ISAILMQI+VLPIG+FMA+TLP R F  F RW F+LNPGPFN+KEHVIIT+ ANCG+S 
Sbjct  79   AISAILMQIAVLPIGRFMASTLPNRDFH-FLRWKFSLNPGPFNMKEHVIITIFANCGISY  137

Query  446  GGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSN  625
            GGGDAYSIGAIT+MKAYYKQ+L+F   L+IVLTTQ++GYGWAG+LRRYLVDPV+MWWP+N
Sbjct  138  GGGDAYSIGAITVMKAYYKQSLNFFLALLIVLTTQVLGYGWAGMLRRYLVDPVEMWWPAN  197

Query  626  LAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  799
            LAQVSLFRALHE E KS GMTRM+FFL+ MGASF+YY  PGYL  IL+FFSWVCWVWP
Sbjct  198  LAQVSLFRALHEKEDKSKGMTRMKFFLIFMGASFIYYAFPGYLLQILSFFSWVCWVWP  255



>ref|XP_004139520.1| PREDICTED: oligopeptide transporter 3-like [Cucumis sativus]
 ref|XP_004162504.1| PREDICTED: oligopeptide transporter 3-like [Cucumis sativus]
 gb|KGN65011.1| hypothetical protein Csa_1G180750 [Cucumis sativus]
Length=745

 Score =   387 bits (993),  Expect = 9e-126, Method: Compositional matrix adjust.
 Identities = 182/238 (76%), Positives = 208/238 (87%), Gaps = 1/238 (0%)
 Frame = +2

Query  86   GEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPL  265
            G    PS  RC VEEVALVVPETDDPTLPV+TFR+W LG+ SC +LIFLNTFF YR+QPL
Sbjct  19   GGGELPSEDRCSVEEVALVVPETDDPTLPVMTFRSWVLGLASCCLLIFLNTFFTYRSQPL  78

Query  266  SISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSP  445
            +ISAILMQI+VLPIG+FMA+TLP R F  F RW F+LNPGPFN+KEHVIIT+ ANCG+S 
Sbjct  79   AISAILMQIAVLPIGRFMASTLPNRDFH-FLRWKFSLNPGPFNMKEHVIITIFANCGISY  137

Query  446  GGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSN  625
            GGGDAYSIGAIT+MKAYYKQ+L+F   L+IVLTTQ++GYGWAG+LRRYLVDPV+MWWP+N
Sbjct  138  GGGDAYSIGAITVMKAYYKQSLNFFLALLIVLTTQVLGYGWAGMLRRYLVDPVEMWWPAN  197

Query  626  LAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  799
            LAQVSLFRALHE E KS GMTRM+FFL+ MGASF+YY  PGYL  IL+FFSWVCWVWP
Sbjct  198  LAQVSLFRALHEKEDKSKGMTRMKFFLIFMGASFIYYAFPGYLLQILSFFSWVCWVWP  255



>ref|XP_010686627.1| PREDICTED: oligopeptide transporter 3 [Beta vulgaris subsp. vulgaris]
Length=741

 Score =   384 bits (987),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 179/229 (78%), Positives = 203/229 (89%), Gaps = 1/229 (0%)
 Frame = +2

Query  116  CPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQIS  295
            CPVEEVALVVPETDDPTLPVLTFRAWFLG+ SC++LIFLNTFFI+RTQPL+ISAILMQI+
Sbjct  23   CPVEEVALVVPETDDPTLPVLTFRAWFLGMVSCVLLIFLNTFFIFRTQPLTISAILMQIA  82

Query  296  VLPIGKFMAATLPERKFAPFG-RWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            VLP+GKFMA  +P R +  FG RW F+LNPGPFNIKEHVII+++ANCGVS GGGDAYS G
Sbjct  83   VLPMGKFMARVMPTRTYRLFGGRWEFSLNPGPFNIKEHVIISILANCGVSYGGGDAYSTG  142

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFRA  652
            AI +MKAYYKQ++ FLC + IVLTTQ++GYGWAG+LRRYLVDPV+MWWP+NLAQVS FRA
Sbjct  143  AIVVMKAYYKQSIGFLCAVFIVLTTQILGYGWAGMLRRYLVDPVEMWWPANLAQVSFFRA  202

Query  653  LHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  799
            LHE E K  G+TRMRFFL+   ASF YY LPGYLFPILTFFSWVCW WP
Sbjct  203  LHEKEHKQQGLTRMRFFLIFFAASFAYYALPGYLFPILTFFSWVCWAWP  251



>ref|XP_010057794.1| PREDICTED: oligopeptide transporter 3-like [Eucalyptus grandis]
 gb|KCW75109.1| hypothetical protein EUGRSUZ_E03859 [Eucalyptus grandis]
Length=744

 Score =   384 bits (987),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 184/245 (75%), Positives = 208/245 (85%), Gaps = 4/245 (2%)
 Frame = +2

Query  74   PATAGEKT---APSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFF  244
            P  A ++    APS  RC VEEVALVVPETDDPT+PV+TFR W LG+TSC+ILIFLNTFF
Sbjct  10   PGDAEKQNGAAAPSDERCSVEEVALVVPETDDPTIPVMTFRTWTLGLTSCVILIFLNTFF  69

Query  245  IYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVM  424
             YRTQPL ISAILMQI+VLPIG+FMA  LP  +++  GR  F LNPGPFNIKEHV+IT+ 
Sbjct  70   TYRTQPLVISAILMQIAVLPIGRFMARVLPTTEYSLLGR-RFRLNPGPFNIKEHVVITIF  128

Query  425  ANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPV  604
            ANCGVS GGGDAYSIGA+T+MK YYKQ LSFLC  +IVLTTQ++GYGWAG+LRRYLVDPV
Sbjct  129  ANCGVSTGGGDAYSIGAVTVMKTYYKQNLSFLCAFLIVLTTQILGYGWAGMLRRYLVDPV  188

Query  605  DMWWPSNLAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWV  784
            +MWWPSN+AQVSLFRALHE E KS G TRMRFFL+ MGASF+YY LPGYLF +LTFFSWV
Sbjct  189  EMWWPSNVAQVSLFRALHEKEHKSKGCTRMRFFLIAMGASFLYYALPGYLFMVLTFFSWV  248

Query  785  CWVWP  799
            CW WP
Sbjct  249  CWAWP  253



>ref|XP_008345787.1| PREDICTED: oligopeptide transporter 3-like [Malus domestica]
Length=753

 Score =   385 bits (988),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 181/228 (79%), Positives = 206/228 (90%), Gaps = 1/228 (0%)
 Frame = +2

Query  116  CPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQIS  295
            C +EEVALVVPETDDPT+PV+TFRAWFLGITSC ILIFLNTFF YRTQPL+ISAILMQI+
Sbjct  37   CKIEEVALVVPETDDPTMPVMTFRAWFLGITSCTILIFLNTFFTYRTQPLAISAILMQIT  96

Query  296  VLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIGA  475
             LPIGKFMA+ LP R+ +  G W F+LNPGPFNIKEHVIIT+ ANCG+S GGGDAYSIGA
Sbjct  97   TLPIGKFMASALPRREHSLLG-WRFSLNPGPFNIKEHVIITIFANCGISYGGGDAYSIGA  155

Query  476  ITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFRAL  655
            ITIMKAYYKQ+LSF+  L+IVLTTQ+IGYGWAG+LRRYLVDPV+MWWPSN+AQVSLFRAL
Sbjct  156  ITIMKAYYKQSLSFILSLVIVLTTQVIGYGWAGILRRYLVDPVEMWWPSNVAQVSLFRAL  215

Query  656  HETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  799
            HE + K+ G+TRM+FFL+ + ASF+YY LPGYLFPILTFFSWVCW WP
Sbjct  216  HEKDHKAKGLTRMQFFLIALTASFLYYALPGYLFPILTFFSWVCWAWP  263



>gb|ABF70152.1| oligopeptide transporter OPT family protein [Musa acuminata]
Length=748

 Score =   384 bits (987),  Expect = 8e-125, Method: Compositional matrix adjust.
 Identities = 179/227 (79%), Positives = 202/227 (89%), Gaps = 0/227 (0%)
 Frame = +2

Query  119  PVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISV  298
            PVEEVALVVPETDDP+LPV+TFRAWF+G+ SCIILIFLNTFF YRTQPL+ISAIL QI+ 
Sbjct  32   PVEEVALVVPETDDPSLPVMTFRAWFIGLASCIILIFLNTFFTYRTQPLTISAILAQITA  91

Query  299  LPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIGAI  478
            LP+G+FMA+ LP R+   F  W F LNPGPFNIKEHVIIT+ ANCGVS GGGDAYSIGAI
Sbjct  92   LPVGRFMASVLPNREIRVFRNWGFNLNPGPFNIKEHVIITIFANCGVSIGGGDAYSIGAI  151

Query  479  TIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFRALH  658
            T+MKAYYKQ+LSFLCGLIIVLTTQ++GYGWAG+LRRYLVDP +MWWPSNLAQVSLFRALH
Sbjct  152  TVMKAYYKQSLSFLCGLIIVLTTQILGYGWAGMLRRYLVDPAEMWWPSNLAQVSLFRALH  211

Query  659  ETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  799
            E + +S G+TRM+FF+L   ASF YYTLPGYL PILTFFSW+CW WP
Sbjct  212  EKDSRSKGLTRMQFFVLFFVASFAYYTLPGYLLPILTFFSWICWSWP  258



>ref|XP_009397220.1| PREDICTED: oligopeptide transporter 3-like [Musa acuminata subsp. 
malaccensis]
Length=748

 Score =   382 bits (982),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 178/227 (78%), Positives = 201/227 (89%), Gaps = 0/227 (0%)
 Frame = +2

Query  119  PVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISV  298
            PVEEVALVVPETDDP+LPV+TFRAWF+G+ SC ILIFLNTFF YRTQPL+ISAIL QI+ 
Sbjct  32   PVEEVALVVPETDDPSLPVMTFRAWFIGLASCTILIFLNTFFTYRTQPLTISAILAQITA  91

Query  299  LPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIGAI  478
            LP+G+FMA+ LP R+   F  W F LNPGPFNIKEHVIIT+ ANCGVS GGGDAYSIGAI
Sbjct  92   LPVGRFMASVLPNREIRVFRNWGFNLNPGPFNIKEHVIITIFANCGVSIGGGDAYSIGAI  151

Query  479  TIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFRALH  658
            T+MKAYYKQ+LSFLCGLIIVLTTQ++GYGWAG+LRRYLVDP +MWWPSNLAQVSLFRALH
Sbjct  152  TVMKAYYKQSLSFLCGLIIVLTTQILGYGWAGMLRRYLVDPAEMWWPSNLAQVSLFRALH  211

Query  659  ETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  799
            E + +S G+TRM+FF+L   ASF YYTLPGYL PILTFFSW+CW WP
Sbjct  212  EKDSRSKGLTRMQFFVLFFVASFAYYTLPGYLLPILTFFSWICWSWP  258



>ref|XP_009374520.1| PREDICTED: oligopeptide transporter 3 [Pyrus x bretschneideri]
Length=749

 Score =   382 bits (982),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 183/247 (74%), Positives = 210/247 (85%), Gaps = 2/247 (1%)
 Frame = +2

Query  62   SGLNPATAGEKTAPSGGR-CPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNT  238
            +G N A         G   C +EEVALVVPETDDPT+PV+TFRAWFLG+TSC ILIFLNT
Sbjct  14   NGTNGAGDHYPHQSDGHEPCKIEEVALVVPETDDPTMPVMTFRAWFLGLTSCTILIFLNT  73

Query  239  FFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIIT  418
            FF YRTQPL+ISAILMQI+ LPIGKFMA+ LP  + +  G W F+LNPGPFNIKEHVIIT
Sbjct  74   FFTYRTQPLAISAILMQITTLPIGKFMASALPRHEHSLLG-WGFSLNPGPFNIKEHVIIT  132

Query  419  VMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVD  598
            + ANCG+S GGGDAYSIGAITIMKAYYKQ+LSF+  L++VLTTQ+IGYGWAG+LRRYLVD
Sbjct  133  IFANCGISYGGGDAYSIGAITIMKAYYKQSLSFILSLVLVLTTQIIGYGWAGILRRYLVD  192

Query  599  PVDMWWPSNLAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFS  778
            PV+MWWPSNLAQVSLFRALHE + K+ G+TRM+FFL+ + ASF+YY LPGYLFPILTFFS
Sbjct  193  PVEMWWPSNLAQVSLFRALHEKDHKAKGLTRMQFFLIALTASFLYYALPGYLFPILTFFS  252

Query  779  WVCWVWP  799
            WVCW WP
Sbjct  253  WVCWAWP  259



>ref|XP_010542186.1| PREDICTED: oligopeptide transporter 3 [Tarenaya hassleriana]
Length=727

 Score =   380 bits (975),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 180/223 (81%), Positives = 202/223 (91%), Gaps = 1/223 (0%)
 Frame = +2

Query  131  VALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISVLPIG  310
            VALVVPETDDP+LPV+TFRAWFLG+TSC++LIFLNTFF YRTQPL+ISAILMQISVLPIG
Sbjct  21   VALVVPETDDPSLPVMTFRAWFLGLTSCVLLIFLNTFFTYRTQPLTISAILMQISVLPIG  80

Query  311  KFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIGAITIMK  490
            KFMA TLP   +  FGR  F+LNPGPFNIKEHVIIT+ ANCGVS GGGDAYSIGAIT+MK
Sbjct  81   KFMARTLPTTPYELFGR-KFSLNPGPFNIKEHVIITIFANCGVSFGGGDAYSIGAITVMK  139

Query  491  AYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFRALHETEV  670
            AYYKQ LSFLC + IVLTTQ++GYGWAG+LRRYLVDPVDMWWPSNLAQVSLFRALHE E 
Sbjct  140  AYYKQTLSFLCAIFIVLTTQILGYGWAGILRRYLVDPVDMWWPSNLAQVSLFRALHEKEN  199

Query  671  KSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  799
            K+ G++RM+FFL+ +  SF+YY LPGYLFP+LTFFSWVCWVWP
Sbjct  200  KTRGLSRMQFFLVALAGSFIYYALPGYLFPVLTFFSWVCWVWP  242



>ref|XP_004295330.1| PREDICTED: oligopeptide transporter 3 [Fragaria vesca subsp. 
vesca]
Length=736

 Score =   379 bits (973),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 180/228 (79%), Positives = 199/228 (87%), Gaps = 1/228 (0%)
 Frame = +2

Query  116  CPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQIS  295
            C +EEVALVVPETDDP+LPV+TFR WFLGITSC ILIFLNTFF YRTQPL ISAILMQI+
Sbjct  20   CEIEEVALVVPETDDPSLPVMTFRTWFLGITSCTILIFLNTFFSYRTQPLIISAILMQIA  79

Query  296  VLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIGA  475
            VLPIGKFMA TLP + F   G + F LNP PFN+KEHV+IT+ ANCGVS GGGDAYS GA
Sbjct  80   VLPIGKFMAKTLPNKDFNLMG-FKFNLNPAPFNMKEHVVITIFANCGVSAGGGDAYSTGA  138

Query  476  ITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFRAL  655
            IT+MKAYY Q+LSFLCGL IVLT+Q+IGYGWAG+LRRYLVDPV+MWWP+NLAQVSLFRAL
Sbjct  139  ITVMKAYYHQSLSFLCGLFIVLTSQMIGYGWAGLLRRYLVDPVEMWWPANLAQVSLFRAL  198

Query  656  HETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  799
            HE E K+ GMTRM+FFL+   ASF YY LPGYLFPILTFFSWVCW WP
Sbjct  199  HEKEHKAKGMTRMKFFLIAFAASFFYYFLPGYLFPILTFFSWVCWAWP  246



>ref|XP_009404107.1| PREDICTED: oligopeptide transporter 3-like [Musa acuminata subsp. 
malaccensis]
Length=738

 Score =   376 bits (965),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 175/229 (76%), Positives = 202/229 (88%), Gaps = 0/229 (0%)
 Frame = +2

Query  113  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  292
            RCPVEEV LVVPETDDP+LPV+TFRAWFLG+TSC +LIFLNTFF YRTQPL+ISAILMQI
Sbjct  20   RCPVEEVKLVVPETDDPSLPVMTFRAWFLGLTSCSLLIFLNTFFTYRTQPLTISAILMQI  79

Query  293  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            +VLPIG+ MA+ LP+R+      W F LNPGPFNIKEHVIIT+ A+CGVS GGGDAYSIG
Sbjct  80   AVLPIGRLMASVLPDREVNLLPGWGFNLNPGPFNIKEHVIITIFASCGVSYGGGDAYSIG  139

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFRA  652
            AIT+MKAYYKQ LSFLC L+IVL+TQ++GYGWAG++RRYLV+P +MWWPSNLAQVSLFRA
Sbjct  140  AITVMKAYYKQNLSFLCALLIVLSTQILGYGWAGMMRRYLVEPPEMWWPSNLAQVSLFRA  199

Query  653  LHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  799
            LHE + +S G++RMRFFL+   ASF YYTLPGYL PILTFFSW+CW WP
Sbjct  200  LHEKDSRSQGLSRMRFFLIFFVASFAYYTLPGYLLPILTFFSWMCWAWP  248



>ref|XP_007211357.1| hypothetical protein PRUPE_ppa001984mg [Prunus persica]
 gb|EMJ12556.1| hypothetical protein PRUPE_ppa001984mg [Prunus persica]
Length=733

 Score =   375 bits (962),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 178/243 (73%), Positives = 208/243 (86%), Gaps = 7/243 (3%)
 Frame = +2

Query  71   NPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIY  250
            +P  A   ++    RC +EEVALVVPETDDP++PV+TFRAWFLG+T+CIILIFLNTFF +
Sbjct  8    DPEKAANGSSEDHERCAIEEVALVVPETDDPSMPVMTFRAWFLGLTTCIILIFLNTFFTF  67

Query  251  RTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMAN  430
            RTQPLSISAILMQI+ LPIGK MA+TLP+R+++  G W F+LNPGPFN+KEHVIIT+ AN
Sbjct  68   RTQPLSISAILMQIAALPIGKLMASTLPKREYSLLG-WRFSLNPGPFNMKEHVIITIFAN  126

Query  431  CGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDM  610
            CG+S GGGDAYSIGAITIMKAYYKQ+LSFL  LIIVLT+Q++GYGWAG+LRR+LVDPV+M
Sbjct  127  CGISYGGGDAYSIGAITIMKAYYKQSLSFLLALIIVLTSQILGYGWAGILRRFLVDPVEM  186

Query  611  WWPSNLAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCW  790
            WWPSNLAQVSLFR +      S G TRM+FFL+ M ASF YY LPGYLFPILTFFSWVCW
Sbjct  187  WWPSNLAQVSLFRTI------SKGFTRMQFFLIAMAASFAYYALPGYLFPILTFFSWVCW  240

Query  791  VWP  799
             WP
Sbjct  241  AWP  243



>ref|XP_009374859.1| PREDICTED: oligopeptide transporter 3-like [Pyrus x bretschneideri]
Length=753

 Score =   375 bits (963),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 179/242 (74%), Positives = 207/242 (86%), Gaps = 7/242 (3%)
 Frame = +2

Query  74   PATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYR  253
            P + G K      RC +EEVALVVPETDDPT+PV+TFRA FLG+TSC +LIFLNTFF +R
Sbjct  29   PESDGHK------RCKIEEVALVVPETDDPTMPVMTFRALFLGLTSCTLLIFLNTFFSFR  82

Query  254  TQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANC  433
            TQPL+ISAILMQI  LPIGKFMA+ LP R+ +  G W F+LNPGPFNIKEHVI+T+ ANC
Sbjct  83   TQPLAISAILMQIITLPIGKFMASALPSRQHSLRG-WRFSLNPGPFNIKEHVIVTIFANC  141

Query  434  GVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMW  613
            G+S GGGDAYSIGAITIMKAYYKQ+LSF+  L+IVLTTQ+IGYGWAG+ RRYLVDPV+MW
Sbjct  142  GISYGGGDAYSIGAITIMKAYYKQSLSFILSLVIVLTTQIIGYGWAGIFRRYLVDPVEMW  201

Query  614  WPSNLAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWV  793
            WPSN+AQVSLFRALHE E K  G+T+++FFL+ M ASF+YY LPGYLFPILTFFSWVCW 
Sbjct  202  WPSNVAQVSLFRALHEKEHKEKGLTQLQFFLIAMTASFLYYALPGYLFPILTFFSWVCWA  261

Query  794  WP  799
            WP
Sbjct  262  WP  263



>ref|XP_008349335.1| PREDICTED: oligopeptide transporter 3-like [Malus domestica]
Length=756

 Score =   373 bits (958),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 177/229 (77%), Positives = 203/229 (89%), Gaps = 1/229 (0%)
 Frame = +2

Query  113  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  292
            RC +EEVALVVPETDDPTLPV+TFRAWFLG+TSC +LIFLNTFF +RTQPL+ISAILMQI
Sbjct  39   RCKIEEVALVVPETDDPTLPVMTFRAWFLGLTSCTLLIFLNTFFSFRTQPLAISAILMQI  98

Query  293  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
              LPIGKFMA+ LP R+ +  G W F+ N GPFNIKEHVIIT+ ANCG+S GGGDAYSIG
Sbjct  99   ITLPIGKFMASALPRREHSLRG-WRFSXNXGPFNIKEHVIITIFANCGISYGGGDAYSIG  157

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFRA  652
            AITIMKAYYKQ+LSF+  L+IVLTTQ+IGYGWAG+LRRYLVDPV+MWWPSN+AQVSLFRA
Sbjct  158  AITIMKAYYKQSLSFILSLVIVLTTQIIGYGWAGILRRYLVDPVEMWWPSNVAQVSLFRA  217

Query  653  LHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  799
            LHE + K+ G+TRM+FFL+ + ASF+YY LPGYLF ILTFFSWVCW WP
Sbjct  218  LHEKDHKTKGLTRMQFFLIALTASFLYYALPGYLFSILTFFSWVCWAWP  266



>gb|KCW45990.1| hypothetical protein EUGRSUZ_L00158 [Eucalyptus grandis]
Length=745

 Score =   370 bits (949),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 171/229 (75%), Positives = 200/229 (87%), Gaps = 1/229 (0%)
 Frame = +2

Query  113  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  292
            +C VEEVALVVPETDDP LPV+TFR W LG+TSC++LIFLNTFF++RTQPL+IS+ILMQI
Sbjct  28   KCAVEEVALVVPETDDPLLPVMTFRVWVLGLTSCVVLIFLNTFFMFRTQPLTISSILMQI  87

Query  293  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            ++LPIGKFMA TLP +++  FG +SFTLNPGPFN+KEHV+IT+ ANCGV+ GG DAYSIG
Sbjct  88   TMLPIGKFMARTLPAKRYQVFG-YSFTLNPGPFNVKEHVLITIFANCGVATGGVDAYSIG  146

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFRA  652
             IT+MK YYKQ LSFLC LIIVLTTQL GYGWAG+ R+YLVDP +MWWP+NLAQVSLFRA
Sbjct  147  PITVMKTYYKQNLSFLCALIIVLTTQLAGYGWAGMFRKYLVDPAEMWWPANLAQVSLFRA  206

Query  653  LHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  799
            LHE E K+ G+TRM+FFL  +  SF YY LPGYLFP+LTFFSWVCW WP
Sbjct  207  LHEKEHKTKGLTRMQFFLAALAVSFAYYLLPGYLFPVLTFFSWVCWAWP  255



>ref|XP_010039444.1| PREDICTED: oligopeptide transporter 3-like isoform X1 [Eucalyptus 
grandis]
 ref|XP_010039445.1| PREDICTED: oligopeptide transporter 3-like isoform X1 [Eucalyptus 
grandis]
 gb|KCW45991.1| hypothetical protein EUGRSUZ_L00159 [Eucalyptus grandis]
Length=765

 Score =   370 bits (950),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 182/263 (69%), Positives = 208/263 (79%), Gaps = 5/263 (2%)
 Frame = +2

Query  11   SQTVPAQ*LSEHIVVEMSGLNPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRA  190
              T   Q   E   VE   L    AGE       RC VEEVALVV ETDD +LPV+TFR 
Sbjct  17   DHTGGDQEQEERCAVEEVAL---IAGEDQEQEE-RCAVEEVALVVLETDDRSLPVMTFRV  72

Query  191  WFLGITSCIILIFLNTFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSF  370
            W LG+TSC++LIFLNTFF+YRTQPL+IS+ILMQI+VLPIGKFMA  LP +++  FG +SF
Sbjct  73   WVLGLTSCVVLIFLNTFFMYRTQPLTISSILMQITVLPIGKFMARALPAKRYRFFG-YSF  131

Query  371  TLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQ  550
            TLNPGPFNIKEHV+IT+ ANCGV+ GG DAYSIG IT+MK YYKQ LSFLC LIIVLTTQ
Sbjct  132  TLNPGPFNIKEHVLITIFANCGVATGGVDAYSIGPITVMKTYYKQNLSFLCALIIVLTTQ  191

Query  551  LIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFV  730
            L GYGWAG+ R+YLVDP +MWWP+NLAQVSLFRALHE E KS G+TRM+FFL+ +  SF 
Sbjct  192  LAGYGWAGMFRKYLVDPAEMWWPANLAQVSLFRALHEKEHKSKGLTRMQFFLIALAVSFA  251

Query  731  YYTLPGYLFPILTFFSWVCWVWP  799
            YY LPGYLFP+LTFFSWVCW WP
Sbjct  252  YYVLPGYLFPVLTFFSWVCWAWP  274



>ref|XP_006856263.1| hypothetical protein AMTR_s00047p00062520 [Amborella trichopoda]
 gb|ERN17730.1| hypothetical protein AMTR_s00047p00062520 [Amborella trichopoda]
Length=738

 Score =   367 bits (942),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 172/229 (75%), Positives = 204/229 (89%), Gaps = 1/229 (0%)
 Frame = +2

Query  113  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  292
            + P+EEVALVVP TDDP LPV+TFRAWFLGIT C+ L+F+NTFF YRTQPL+ISAIL QI
Sbjct  21   QSPIEEVALVVPVTDDPNLPVMTFRAWFLGITFCVFLMFVNTFFTYRTQPLTISAILAQI  80

Query  293  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            + LP+G+FMAATLP+++    G +SF+LNPGPFNIKEHVIIT+ ANCGV+ GGGDAYSIG
Sbjct  81   AALPMGRFMAATLPKKEMRVLG-YSFSLNPGPFNIKEHVIITIFANCGVAYGGGDAYSIG  139

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFRA  652
            AIT+MK YYKQ+LSFLCGL IVLTTQ++GYGWAG++RRYLV+P +MWWPSNLAQVSLFRA
Sbjct  140  AITVMKVYYKQSLSFLCGLFIVLTTQVLGYGWAGMMRRYLVEPANMWWPSNLAQVSLFRA  199

Query  653  LHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  799
            LHE + +S G++RM+FF++ M ASF YYTLPGYLF ILTFFSWVCWVWP
Sbjct  200  LHEKDSRSKGLSRMQFFMVFMIASFAYYTLPGYLFSILTFFSWVCWVWP  248



>ref|XP_002463867.1| hypothetical protein SORBIDRAFT_01g007880 [Sorghum bicolor]
 gb|EER90865.1| hypothetical protein SORBIDRAFT_01g007880 [Sorghum bicolor]
Length=747

 Score =   366 bits (940),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 183/254 (72%), Positives = 203/254 (80%), Gaps = 8/254 (3%)
 Frame = +2

Query  62   SGLNPATAGEKTA---PSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFL  232
            S  +P  A E+       G RC VEEVALVVPETDDP+LPV+TFRAW LG+ SC++LIFL
Sbjct  4    SRKSPVVAEERAGMEEGKGERCAVEEVALVVPETDDPSLPVMTFRAWTLGLGSCVVLIFL  63

Query  233  NTFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRW--SFTLNPGPFNIKEH  406
            NTFF YRTQPL+IS IL QI VLP G+FMAA LP R+    G    SF LNPGPFN+KEH
Sbjct  64   NTFFTYRTQPLTISGILAQILVLPAGRFMAAVLPNREVRLLGGRLGSFNLNPGPFNVKEH  123

Query  407  VIITVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRR  586
            VIIT+ ANCGVS GGGDAYSIGAIT+MKAYYKQ LSF C L+IVLTTQ++GYGWAG+LRR
Sbjct  124  VIITIFANCGVSYGGGDAYSIGAITVMKAYYKQTLSFACALLIVLTTQILGYGWAGMLRR  183

Query  587  YLVDPVDMWWPSNLAQVSLFRALHETEV---KSSGMTRMRFFLLVMGASFVYYTLPGYLF  757
            YLVDP +MWWPSNLAQVSLFRALHE E    KS G +RMRFFL+V  ASF YY LPGYL 
Sbjct  184  YLVDPAEMWWPSNLAQVSLFRALHEKEEEGGKSRGPSRMRFFLIVFFASFAYYALPGYLL  243

Query  758  PILTFFSWVCWVWP  799
            PILTFFSW CWVWP
Sbjct  244  PILTFFSWACWVWP  257



>gb|ACL82964.1| glutathione transporter [Zea mays]
Length=746

 Score =   365 bits (937),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 180/251 (72%), Positives = 202/251 (80%), Gaps = 8/251 (3%)
 Frame = +2

Query  71   NPATAGEKTAP---SGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTF  241
            +P  A E+       G RC VEEVALVVPETDDP+LPV+TFRAW LG+ SC++LIFLNTF
Sbjct  6    SPVAAEERAGTGEGKGERCAVEEVALVVPETDDPSLPVMTFRAWALGLGSCVVLIFLNTF  65

Query  242  FIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRW--SFTLNPGPFNIKEHVII  415
            F YRTQPL+IS IL QI VLP G+F+AA LP+R+    G    SF LNPGPFN+KEHVII
Sbjct  66   FTYRTQPLTISGILAQILVLPAGRFLAAVLPDREVRILGGRLGSFNLNPGPFNVKEHVII  125

Query  416  TVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  595
            T+ ANCGVS GGGDAYSIGAIT+MKAYYKQ LSF C L+IVLTTQ++GYGWAG+LRRYLV
Sbjct  126  TIFANCGVSYGGGDAYSIGAITVMKAYYKQTLSFACALLIVLTTQILGYGWAGLLRRYLV  185

Query  596  DPVDMWWPSNLAQVSLFRALHETEV---KSSGMTRMRFFLLVMGASFVYYTLPGYLFPIL  766
            DP +MWWPSNLAQVSLFRALHE E    KS G +RMRFFL+V  ASF YY LPGYL PIL
Sbjct  186  DPAEMWWPSNLAQVSLFRALHEKEEEGGKSRGPSRMRFFLIVFFASFAYYALPGYLLPIL  245

Query  767  TFFSWVCWVWP  799
            TFFSW CW WP
Sbjct  246  TFFSWACWAWP  256



>ref|XP_004981750.1| PREDICTED: LOW QUALITY PROTEIN: oligopeptide transporter 3-like 
[Setaria italica]
Length=750

 Score =   365 bits (937),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 178/233 (76%), Positives = 198/233 (85%), Gaps = 4/233 (2%)
 Frame = +2

Query  113  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  292
            RCPVEEVALVVPETDDP+LPV+TFRAW LG+ SC++LIFLNTFF YRTQPL+IS IL QI
Sbjct  28   RCPVEEVALVVPETDDPSLPVMTFRAWTLGLASCVVLIFLNTFFTYRTQPLTISGILAQI  87

Query  293  SVLPIGKFMAATLPERKFAPFGRW--SFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYS  466
             VLP G+FMAA LP+R+    G    SF LNPGPFN+KEHVIIT+ ANCGVS GGGDAYS
Sbjct  88   LVLPAGRFMAAVLPDREVRLLGGRLGSFNLNPGPFNVKEHVIITIFANCGVSYGGGDAYS  147

Query  467  IGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLF  646
            IGAIT+MKAYYKQ LSF+  L+IVLTTQ++GYGWAG+LRRYLVDP +MWWPSNLAQVSLF
Sbjct  148  IGAITVMKAYYKQTLSFVLALLIVLTTQILGYGWAGMLRRYLVDPAEMWWPSNLAQVSLF  207

Query  647  RALHETE--VKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  799
            RALHE E   KS G +RMRFFL+V  ASF YY LPGYL PILTFFSW CWVWP
Sbjct  208  RALHEKEDGEKSRGPSRMRFFLIVFFASFAYYALPGYLLPILTFFSWACWVWP  260



>ref|XP_003559475.2| PREDICTED: LOW QUALITY PROTEIN: oligopeptide transporter 3, partial 
[Brachypodium distachyon]
Length=494

 Score =   355 bits (911),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 182/257 (71%), Positives = 206/257 (80%), Gaps = 10/257 (4%)
 Frame = +2

Query  59   MSGLNPATAGE-----KTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIIL  223
            MS L    A E     K    G R PVEEVALVVPETDDP+ PV+TFRAW LG++SC++L
Sbjct  1    MSSLKSPVAAEEAMRGKQQGEGERYPVEEVALVVPETDDPSTPVMTFRAWTLGLSSCVVL  60

Query  224  IFLNTFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRW--SFTLNPGPFNI  397
            IFLNTFF YRTQPL+IS IL QI VLP+G+FMA+ LP+R+    G    SF LNPGPFN+
Sbjct  61   IFLNTFFTYRTQPLTISGILAQILVLPVGRFMASVLPDREVRLLGGRLGSFNLNPGPFNV  120

Query  398  KEHVIITVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGV  577
            KEHVIIT+ ANCGVS GGGDAYSIGAIT+MKAYYKQ+LSFLC L+IVL+TQ++GYGWAG+
Sbjct  121  KEHVIITIFANCGVSYGGGDAYSIGAITVMKAYYKQSLSFLCALLIVLSTQILGYGWAGM  180

Query  578  LRRYLVDPVDMWWPSNLAQVSLFRALHETEVK---SSGMTRMRFFLLVMGASFVYYTLPG  748
            LRRYLVDP +MWWPSNLAQVSLFRALHET+     S G TRMRFFL+   ASF YY LPG
Sbjct  181  LRRYLVDPAEMWWPSNLAQVSLFRALHETKEGGKPSKGPTRMRFFLIFFFASFAYYALPG  240

Query  749  YLFPILTFFSWVCWVWP  799
            YL PILTFFSW CWVWP
Sbjct  241  YLLPILTFFSWACWVWP  257



>ref|XP_008665425.1| PREDICTED: oligopeptide transporter 3 [Zea mays]
 tpg|DAA51401.1| TPA: glutathione transporter [Zea mays]
Length=748

 Score =   361 bits (927),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 175/234 (75%), Positives = 196/234 (84%), Gaps = 5/234 (2%)
 Frame = +2

Query  113  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  292
            RC VEEVALVVPETDDP++PV+TFRAW LG+ SC++LIFLNTFF YRTQPL+IS IL QI
Sbjct  25   RCAVEEVALVVPETDDPSMPVMTFRAWALGLGSCVVLIFLNTFFTYRTQPLTISGILAQI  84

Query  293  SVLPIGKFMAATLPERKFAPFGRW--SFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYS  466
             VLP G+F+AA LP+R+    G    SF LNPGPFN+KEHVIIT+ ANCGVS GGGDAYS
Sbjct  85   LVLPAGRFLAAVLPDREVRILGGRLGSFNLNPGPFNVKEHVIITIFANCGVSYGGGDAYS  144

Query  467  IGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLF  646
            IGAIT+MKAYYKQ LSF C L+IVLTTQ++GYGWAG+LRRYLVDP +MWWPSNLAQVSLF
Sbjct  145  IGAITVMKAYYKQTLSFACALLIVLTTQILGYGWAGLLRRYLVDPAEMWWPSNLAQVSLF  204

Query  647  RALHETEV---KSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  799
            RALHE E    KS G +RMRFFL+V  ASF YY LPGYL PILTFFSW CW WP
Sbjct  205  RALHEKEEEGGKSRGPSRMRFFLIVFFASFAYYALPGYLLPILTFFSWACWAWP  258



>gb|ABB55328.1| small oligopeptide transporter, OPT family [Asparagus officinalis]
Length=755

 Score =   361 bits (926),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 180/286 (63%), Positives = 204/286 (71%), Gaps = 49/286 (17%)
 Frame = +2

Query  89   EKTAP-SGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPL  265
            +K  P    RCP+EEVALVVPETDDP LPVLTFRAWFLG+TSC +LIFLNTFF YRTQPL
Sbjct  10   QKPVPVESDRCPIEEVALVVPETDDPNLPVLTFRAWFLGLTSCSVLIFLNTFFTYRTQPL  69

Query  266  SISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSP  445
            +ISAIL QI+VLPIG+FMA+ LP+++    G W F LNPGPF+IKEHVIIT+ ANCGVS 
Sbjct  70   TISAILTQIAVLPIGRFMASALPDKEVRVLGGWGFNLNPGPFSIKEHVIITIFANCGVST  129

Query  446  GGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQ-------------------------  550
            GGGDAYSIGAIT+MKAYYKQ L FLC LIIVLTTQ                         
Sbjct  130  GGGDAYSIGAITVMKAYYKQGLGFLCALIIVLTTQAVLSHYLLMGFKSSSSSSSSSHRKV  189

Query  551  -----------------------LIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFRALHE  661
                                   +IGYGWAGVLRR+LVDPV+MWWP+NLAQVSLFRALHE
Sbjct  190  TVGFIAELTVTSTFAAVRAPDFNVIGYGWAGVLRRFLVDPVEMWWPANLAQVSLFRALHE  249

Query  662  TEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  799
             +V S G +RM+FF++    SF+YY  PGYLFPILTFFSWVCW WP
Sbjct  250  KDVNSKGPSRMKFFMIFFIGSFLYYAFPGYLFPILTFFSWVCWAWP  295



>gb|AAQ91200.1| putative glutathione transporter [Zea mays]
Length=721

 Score =   355 bits (910),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 173/231 (75%), Positives = 194/231 (84%), Gaps = 5/231 (2%)
 Frame = +2

Query  122  VEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISVL  301
            VEEVALVVPETDDP++PV+TFRAW LG+ SC++LIFLNTFF YRTQPL+IS IL QI VL
Sbjct  1    VEEVALVVPETDDPSMPVMTFRAWALGLGSCVVLIFLNTFFTYRTQPLTISGILAQILVL  60

Query  302  PIGKFMAATLPERKFAPFGR--WSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIGA  475
            P G+F+AA LP+R+    G    SF LNPGPFN+KEHVIIT+ ANCGVS GGGDAYSIGA
Sbjct  61   PAGRFLAAVLPDREVRILGGRLGSFNLNPGPFNVKEHVIITIFANCGVSYGGGDAYSIGA  120

Query  476  ITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFRAL  655
            IT+MKAYYKQ LSF C L+IVLTTQ++GYGWAG+LRRYLVDP +MWWPSNLAQVSLFRAL
Sbjct  121  ITVMKAYYKQTLSFACALLIVLTTQILGYGWAGLLRRYLVDPAEMWWPSNLAQVSLFRAL  180

Query  656  HETEV---KSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  799
            HE E    KS G +RMRFFL+V  ASF YY LPGYL PILTFFSW CW WP
Sbjct  181  HEKEEEGGKSRGPSRMRFFLIVFFASFAYYALPGYLLPILTFFSWACWAWP  231



>dbj|BAK07444.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=745

 Score =   353 bits (905),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 179/247 (72%), Positives = 203/247 (82%), Gaps = 5/247 (2%)
 Frame = +2

Query  74   PATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYR  253
            PA  G+     G R PVEEVALVVPETDDP  PV+TFRAW LG+TSC++LIFLNTFF YR
Sbjct  8    PAAGGKGAQGEGERYPVEEVALVVPETDDPATPVMTFRAWTLGLTSCVVLIFLNTFFTYR  67

Query  254  TQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRW--SFTLNPGPFNIKEHVIITVMA  427
            TQPL+IS IL QI VLP+G+FMA+ LP+R+    G    SF LNPGPFNIKEHVIIT+ A
Sbjct  68   TQPLTISGILAQILVLPVGRFMASVLPDREVRLLGGRLGSFNLNPGPFNIKEHVIITIFA  127

Query  428  NCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVD  607
            NCGVS GGGDAYSIGAIT+MKAYYKQ+LSFLC L+IVL+TQ++GYGWAG+LRR+LVDP +
Sbjct  128  NCGVSYGGGDAYSIGAITVMKAYYKQSLSFLCALLIVLSTQILGYGWAGMLRRFLVDPAE  187

Query  608  MWWPSNLAQVSLFRALHETEVK---SSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFS  778
            MWWPSNLAQVSLFRALHET+     S G +RMRFFL+   ASF YY LPGYL PILTFFS
Sbjct  188  MWWPSNLAQVSLFRALHETKEGGKPSKGPSRMRFFLIFFFASFAYYALPGYLLPILTFFS  247

Query  779  WVCWVWP  799
            W CWVWP
Sbjct  248  WACWVWP  254



>ref|XP_006651827.1| PREDICTED: oligopeptide transporter 3-like [Oryza brachyantha]
Length=742

 Score =   351 bits (900),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 181/245 (74%), Positives = 197/245 (80%), Gaps = 10/245 (4%)
 Frame = +2

Query  95   TAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSIS  274
             A  G RCPVEEVALVVPETDDPT PV+TFRAW LG+TSC++LIFLNTFF YRTQPL+IS
Sbjct  6    AALQGERCPVEEVALVVPETDDPTTPVMTFRAWTLGLTSCVVLIFLNTFFTYRTQPLTIS  65

Query  275  AILMQISVLPIGKFMAATLPERKFAPFGR--WSFTLNPGPFNIKEHVIITVMANCGVSPG  448
             IL QI VLP G+FMAA LP R+    G    SF LNPGPFNIKEHVIIT+ ANCGVS G
Sbjct  66   GILAQILVLPAGQFMAAVLPNREGRLLGGRLGSFNLNPGPFNIKEHVIITIFANCGVSYG  125

Query  449  GGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNL  628
            GGDAYSIGAIT+MKAYYKQ+L F+C L+IVLTTQ++GYGWAG+LRRYLVDP DMWWPSNL
Sbjct  126  GGDAYSIGAITVMKAYYKQSLGFVCALLIVLTTQILGYGWAGMLRRYLVDPADMWWPSNL  185

Query  629  AQVSLFRALHETEV--------KSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWV  784
            AQVSLFRALHE E          S G TRMRFFL+   ASF YY LPGYL PILTFFSW 
Sbjct  186  AQVSLFRALHEKEDGDGRKGSPSSRGPTRMRFFLIFFFASFAYYALPGYLLPILTFFSWA  245

Query  785  CWVWP  799
            CW WP
Sbjct  246  CWAWP  250



>gb|AAO32313.1| putative oligopeptide transporter protein [Oryza sativa Japonica 
Group]
Length=726

 Score =   350 bits (898),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 180/241 (75%), Positives = 195/241 (81%), Gaps = 9/241 (4%)
 Frame = +2

Query  104  SGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAIL  283
             G RCPVEEVALVVPETDDPT PV+TFRAW LG+ SC++LIFLNTFF YRTQPL+IS IL
Sbjct  25   EGERCPVEEVALVVPETDDPTTPVMTFRAWTLGLASCVVLIFLNTFFTYRTQPLTISGIL  84

Query  284  MQISVLPIGKFMAATLPERKFAPFGRW--SFTLNPGPFNIKEHVIITVMANCGVSPGGGD  457
             QI VLP G+FMAA LP R+    G    SF LNPGPFNIKEHVIIT+ ANCGVS GGGD
Sbjct  85   AQILVLPAGQFMAAVLPSREVRLLGGRLGSFNLNPGPFNIKEHVIITIFANCGVSYGGGD  144

Query  458  AYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQV  637
            AYSIGAIT+MKAYYKQ+LSFLC L+IVLTTQ++GYGWAG+LRRYLVDP DMWWPSNLAQV
Sbjct  145  AYSIGAITVMKAYYKQSLSFLCALLIVLTTQILGYGWAGMLRRYLVDPADMWWPSNLAQV  204

Query  638  SLFRALHETEVKSSGM-------TRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVW  796
            SLFRALHE E    G        TRMRFFL+   ASF YY LPGYL PILTFFSW CW W
Sbjct  205  SLFRALHEKEGGDGGKGSSSRGPTRMRFFLIFFFASFAYYALPGYLLPILTFFSWACWAW  264

Query  797  P  799
            P
Sbjct  265  P  265



>gb|KHN42268.1| Oligopeptide transporter 3 [Glycine soja]
Length=698

 Score =   348 bits (894),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 163/208 (78%), Positives = 188/208 (90%), Gaps = 1/208 (0%)
 Frame = +2

Query  176  LTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPF  355
            +TFRAWFLGI SC++LIFLNTFF +RTQPL+ISAILMQI+VLPIG+FMAATLP +++   
Sbjct  1    MTFRAWFLGIASCVLLIFLNTFFTFRTQPLTISAILMQIAVLPIGRFMAATLPTKEYGFL  60

Query  356  GRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLII  535
            G W FT NPGPFN+KEHVIIT+ ANCGVS GGGDAYSIGAIT+MKAYYKQ+LSFLC L I
Sbjct  61   G-WRFTFNPGPFNMKEHVIITIFANCGVSFGGGDAYSIGAITVMKAYYKQSLSFLCALFI  119

Query  536  VLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFRALHETEVKSSGMTRMRFFLLVM  715
            VLTTQ++GYGWAG+LRRYLVDPV+MWWP+NLAQVSLFRALHE E KS G+TRM+FFL+ M
Sbjct  120  VLTTQMLGYGWAGILRRYLVDPVEMWWPANLAQVSLFRALHEKEPKSKGLTRMQFFLIAM  179

Query  716  GASFVYYTLPGYLFPILTFFSWVCWVWP  799
            GASF+YY LPGYLF +LTFFSW+CW WP
Sbjct  180  GASFLYYALPGYLFMVLTFFSWICWAWP  207



>gb|ADW66457.1| oligopeptide transporter [Phytolacca americana]
Length=733

 Score =   350 bits (897),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 170/227 (75%), Positives = 190/227 (84%), Gaps = 2/227 (1%)
 Frame = +2

Query  119  PVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISV  298
            PVEEV L VP TDDP+LPVLTFR WFLG+ SCI+L FLN FF YRTQPL+ISAI  QI+V
Sbjct  19   PVEEVRLTVPITDDPSLPVLTFRMWFLGLCSCILLSFLNDFFWYRTQPLTISAI-SQIAV  77

Query  299  LPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIGAI  478
            LP+G FMA  LP   F P   WS++LNPGPFN+KEHVI+T+ ANCGVS GGGDAYSIGAI
Sbjct  78   LPLGGFMARILPTTPF-PGRGWSYSLNPGPFNLKEHVIVTIFANCGVSQGGGDAYSIGAI  136

Query  479  TIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFRALH  658
            T+MKAYYKQ+L FLC + IVLTTQ +GYGWAG+LRRYLVDPV+MWWP+NLAQVS FRALH
Sbjct  137  TVMKAYYKQSLGFLCAIFIVLTTQALGYGWAGMLRRYLVDPVEMWWPANLAQVSFFRALH  196

Query  659  ETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  799
            E E KS G TRM+FFL+ M ASF YY LPGYL PILTFFSWVCW WP
Sbjct  197  EREPKSKGFTRMQFFLVFMAASFAYYALPGYLLPILTFFSWVCWAWP  243



>ref|NP_001051290.1| Os03g0751100 [Oryza sativa Japonica Group]
 gb|AAR87263.1| putative oligopeptide transporter protein [Oryza sativa Japonica 
Group]
 gb|ABF98905.1| oligopeptide transporter 3, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF13204.1| Os03g0751100 [Oryza sativa Japonica Group]
 gb|EEC76189.1| hypothetical protein OsI_13528 [Oryza sativa Indica Group]
 gb|EEE59939.1| hypothetical protein OsJ_12589 [Oryza sativa Japonica Group]
Length=757

 Score =   350 bits (898),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 180/241 (75%), Positives = 195/241 (81%), Gaps = 9/241 (4%)
 Frame = +2

Query  104  SGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAIL  283
             G RCPVEEVALVVPETDDPT PV+TFRAW LG+ SC++LIFLNTFF YRTQPL+IS IL
Sbjct  25   EGERCPVEEVALVVPETDDPTTPVMTFRAWTLGLASCVVLIFLNTFFTYRTQPLTISGIL  84

Query  284  MQISVLPIGKFMAATLPERKFAPFGRW--SFTLNPGPFNIKEHVIITVMANCGVSPGGGD  457
             QI VLP G+FMAA LP R+    G    SF LNPGPFNIKEHVIIT+ ANCGVS GGGD
Sbjct  85   AQILVLPAGQFMAAVLPSREVRLLGGRLGSFNLNPGPFNIKEHVIITIFANCGVSYGGGD  144

Query  458  AYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQV  637
            AYSIGAIT+MKAYYKQ+LSFLC L+IVLTTQ++GYGWAG+LRRYLVDP DMWWPSNLAQV
Sbjct  145  AYSIGAITVMKAYYKQSLSFLCALLIVLTTQILGYGWAGMLRRYLVDPADMWWPSNLAQV  204

Query  638  SLFRALHETEVKSSGM-------TRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVW  796
            SLFRALHE E    G        TRMRFFL+   ASF YY LPGYL PILTFFSW CW W
Sbjct  205  SLFRALHEKEGGDGGKGSSSRGPTRMRFFLIFFFASFAYYALPGYLLPILTFFSWACWAW  264

Query  797  P  799
            P
Sbjct  265  P  265



>gb|EMT33592.1| Oligopeptide transporter 3 [Aegilops tauschii]
Length=750

 Score =   349 bits (895),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 179/253 (71%), Positives = 205/253 (81%), Gaps = 8/253 (3%)
 Frame = +2

Query  56   EMSGLNPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLN  235
            + +G   A  GE     G R PVEEVALVVPETDDP  PV+TFRAW LG+ SC++LIFLN
Sbjct  10   DATGGKAAAQGEG---EGERYPVEEVALVVPETDDPATPVMTFRAWTLGLASCVVLIFLN  66

Query  236  TFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRW--SFTLNPGPFNIKEHV  409
            TFF YRTQPL+IS IL QI VLP+G+FMA+ LP+R+    G    SF LNPGPFNIKEHV
Sbjct  67   TFFTYRTQPLTISGILAQILVLPVGRFMASVLPDREVRLLGGRLGSFNLNPGPFNIKEHV  126

Query  410  IITVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRY  589
            IIT+ ANCGVS GGGDAYSIGAIT+MKAYYKQ+LSFLC L+IVL+TQ++GYGWAG+LRR+
Sbjct  127  IITIFANCGVSYGGGDAYSIGAITVMKAYYKQSLSFLCALLIVLSTQILGYGWAGMLRRF  186

Query  590  LVDPVDMWWPSNLAQVSLFRALHETEVK---SSGMTRMRFFLLVMGASFVYYTLPGYLFP  760
            LVDP +MWWPSNLAQVSLFRALHET+     S+G +RMRFFL+   ASF YY LPGYL P
Sbjct  187  LVDPAEMWWPSNLAQVSLFRALHETKEGGKPSTGPSRMRFFLIFFFASFAYYALPGYLLP  246

Query  761  ILTFFSWVCWVWP  799
            ILTFFSW CWVWP
Sbjct  247  ILTFFSWACWVWP  259



>ref|XP_010039443.1| PREDICTED: oligopeptide transporter 3-like [Eucalyptus grandis]
Length=697

 Score =   332 bits (850),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 153/208 (74%), Positives = 181/208 (87%), Gaps = 1/208 (0%)
 Frame = +2

Query  176  LTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPF  355
            +TFR W LG+TSC++LIFLNTFF++RTQPL+IS+ILMQI++LPIGKFMA TLP +++  F
Sbjct  1    MTFRVWVLGLTSCVVLIFLNTFFMFRTQPLTISSILMQITMLPIGKFMARTLPAKRYQVF  60

Query  356  GRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLII  535
            G +SFTLNPGPFN+KEHV+IT+ ANCGV+ GG DAYSIG IT+MK YYKQ LSFLC LII
Sbjct  61   G-YSFTLNPGPFNVKEHVLITIFANCGVATGGVDAYSIGPITVMKTYYKQNLSFLCALII  119

Query  536  VLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFRALHETEVKSSGMTRMRFFLLVM  715
            VLTTQL GYGWAG+ R+YLVDP +MWWP+NLAQVSLFRALHE E K+ G+TRM+FFL  +
Sbjct  120  VLTTQLAGYGWAGMFRKYLVDPAEMWWPANLAQVSLFRALHEKEHKTKGLTRMQFFLAAL  179

Query  716  GASFVYYTLPGYLFPILTFFSWVCWVWP  799
              SF YY LPGYLFP+LTFFSWVCW WP
Sbjct  180  AVSFAYYLLPGYLFPVLTFFSWVCWAWP  207



>emb|CAB10414.1| isp4 like protein [Arabidopsis thaliana]
 emb|CAB78679.1| isp4 like protein [Arabidopsis thaliana]
Length=691

 Score =   329 bits (844),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 167/248 (67%), Positives = 189/248 (76%), Gaps = 27/248 (11%)
 Frame = +2

Query  68   LNPATAGEKT----APSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLN  235
            ++   A +KT    +    RCPVEEVALVVPETDDP+LPV+TFRA               
Sbjct  1    MDAEKATDKTNVHLSSDHERCPVEEVALVVPETDDPSLPVMTFRACH-------------  47

Query  236  TFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVII  415
                  +QP      LMQI+ LPIGKFMA TLP       G WSF+LNPGPFNIKEHVII
Sbjct  48   ----SPSQP-----SLMQIAGLPIGKFMARTLPTTSHNLLG-WSFSLNPGPFNIKEHVII  97

Query  416  TVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  595
            T+ ANCGV+ GGGDAYSIGAIT+MKAYYKQ+LSF+CGL IVLTTQ++GYGWAG+LRRYLV
Sbjct  98   TIFANCGVAYGGGDAYSIGAITVMKAYYKQSLSFICGLFIVLTTQILGYGWAGILRRYLV  157

Query  596  DPVDMWWPSNLAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFF  775
            DPVDMWWPSNLAQVSLFRALHE E KS G+TRM+FFL+ +GASF+YY LPGYLFPILTF 
Sbjct  158  DPVDMWWPSNLAQVSLFRALHEKENKSKGLTRMKFFLVALGASFIYYALPGYLFPILTFS  217

Query  776  SWVCWVWP  799
            SWVCW WP
Sbjct  218  SWVCWAWP  225



>ref|XP_002522882.1| Oligopeptide transporter, putative [Ricinus communis]
 gb|EEF39482.1| Oligopeptide transporter, putative [Ricinus communis]
Length=734

 Score =   326 bits (835),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 166/255 (65%), Positives = 192/255 (75%), Gaps = 12/255 (5%)
 Frame = +2

Query  35   LSEHIVVEMSGLNPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSC  214
            ++    ++ +G  P       A    RC VEEVALVVPETDDPTLPV+TFRAWFLG+TSC
Sbjct  1    MASKTQIQDNGFKPNGEHSSAAEEHERCSVEEVALVVPETDDPTLPVMTFRAWFLGLTSC  60

Query  215  IILIFLNTFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFN  394
            ++LIFLNTFF YRTQPL+ISAILMQI VLPIGKFMA  LP +++  FG W F+LNPGPFN
Sbjct  61   VLLIFLNTFFTYRTQPLTISAILMQIGVLPIGKFMAKALPTKQYKIFG-WGFSLNPGPFN  119

Query  395  IKEHVIITVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAG  574
            IKEHVIIT+ ANCGVS GGGDAYSIGAIT+MKAYYKQ+L+FLC L+IVLTTQ     W  
Sbjct  120  IKEHVIITIFANCGVSFGGGDAYSIGAITVMKAYYKQSLNFLCALLIVLTTQ--HAYWLL  177

Query  575  VLRRYLVDPVDMWWPSNLAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYL  754
            + +   +          L++     ALHE + KS GMTRMRFFLLVM ASF+YY LPGYL
Sbjct  178  IFQEETLP---------LSRGINILALHEKDPKSKGMTRMRFFLLVMIASFLYYALPGYL  228

Query  755  FPILTFFSWVCWVWP  799
            FPILTFFSWVCW WP
Sbjct  229  FPILTFFSWVCWAWP  243



>gb|KHN03544.1| Oligopeptide transporter 3 [Glycine soja]
Length=725

 Score =   305 bits (781),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 143/184 (78%), Positives = 165/184 (90%), Gaps = 1/184 (1%)
 Frame = +2

Query  248  YRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMA  427
            +RTQPL+ISAILMQI+VLPIG+FMAATLP +++   G   FT NPGPFN+KEHVIIT+ A
Sbjct  52   FRTQPLTISAILMQIAVLPIGRFMAATLPTKEYGFLGS-RFTFNPGPFNMKEHVIITIFA  110

Query  428  NCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVD  607
            NCGVS GGGDAYSIGAIT+MKAYYKQ+LSFLC L IVLTTQ++GYGWAG+LRRYLVDPV+
Sbjct  111  NCGVSFGGGDAYSIGAITVMKAYYKQSLSFLCALFIVLTTQMMGYGWAGILRRYLVDPVE  170

Query  608  MWWPSNLAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVC  787
            MWWP+NLAQVSLFRALHE E KS G+TRM+FFL+ MGASF+YY LPGYLF +LTFFSW+C
Sbjct  171  MWWPANLAQVSLFRALHEKEPKSKGLTRMQFFLIAMGASFLYYALPGYLFMVLTFFSWIC  230

Query  788  WVWP  799
            W WP
Sbjct  231  WAWP  234



>emb|CDP04527.1| unnamed protein product [Coffea canephora]
Length=678

 Score =   295 bits (756),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 137/200 (69%), Positives = 168/200 (84%), Gaps = 2/200 (1%)
 Frame = +2

Query  203  ITSCIILIFLNTFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWS-FTLN  379
            +TSC ILIFLNTFF YRTQPL ISAILMQI  LP+G+ MAA LP R ++  GRWS F+LN
Sbjct  1    MTSCFILIFLNTFFSYRTQPLFISAILMQILTLPMGRLMAAALPTRSYS-VGRWSSFSLN  59

Query  380  PGPFNIKEHVIITVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIG  559
            PGPFN+KEHV++T++ANCG + GG +AYS+GAIT+MK YY   L+F    +IV+TTQL+G
Sbjct  60   PGPFNVKEHVMVTILANCGAATGGFEAYSMGAITVMKTYYNLNLTFFAAFLIVVTTQLMG  119

Query  560  YGWAGVLRRYLVDPVDMWWPSNLAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYT  739
            YGWAG++RRYL++P +MWWP+NLAQVSLFRALHE E K +GMTRM+FFL+ + ASF YYT
Sbjct  120  YGWAGMMRRYLIEPAEMWWPANLAQVSLFRALHEKESKKAGMTRMQFFLMFLVASFAYYT  179

Query  740  LPGYLFPILTFFSWVCWVWP  799
             PGYLFP+LTFFSW CW+WP
Sbjct  180  FPGYLFPLLTFFSWTCWLWP  199



>gb|AEJ88342.1| putative oligopeptide transporter [Tamarix hispida]
Length=516

 Score =   286 bits (731),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 134/231 (58%), Positives = 171/231 (74%), Gaps = 5/231 (2%)
 Frame = +2

Query  104  SGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAIL  283
            S    PV++VAL VP TDDPTLPVLT R W LG  SCI+L FLN FF YR +PL+I+AI 
Sbjct  51   SEENSPVKQVALTVPTTDDPTLPVLTCRMWILGALSCILLSFLNQFFWYREEPLTITAIS  110

Query  284  MQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAY  463
             QI+V+PIG++MA+ LP R F    RW FTLNPGPFN+KEHV+IT+ AN     G G  Y
Sbjct  111  AQIAVVPIGRYMASRLPTRIFFKGTRWEFTLNPGPFNVKEHVLITIFANA----GAGTVY  166

Query  464  SIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSL  643
            +I  +T++K +YK+ ++F   LI+VLTTQ++G+GWAG+ RRYLV+P +MWWP+NL QVSL
Sbjct  167  AIHVVTVVKVFYKKQITFFVSLIVVLTTQVLGFGWAGIFRRYLVEPPEMWWPANLVQVSL  226

Query  644  FRALHETEVK-SSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWV  793
            FRALHE E +   G+TR +FFL+    SF YY  PGYLF +LT  SW+CW+
Sbjct  227  FRALHEKEERPKGGLTRTQFFLIAFICSFAYYVFPGYLFEMLTSLSWICWI  277



>emb|CAD91127.1| glutathione transporter GT1 [Brassica juncea]
Length=661

 Score =   290 bits (741),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 136/172 (79%), Positives = 153/172 (89%), Gaps = 1/172 (1%)
 Frame = +2

Query  284  MQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAY  463
            MQI+VLPIGKFMA TLP       G W ++LNPGPFNIKEH+IIT+ ANCGV+ GGGDAY
Sbjct  1    MQIAVLPIGKFMARTLPTTSHRLMG-WEWSLNPGPFNIKEHIIITIFANCGVAYGGGDAY  59

Query  464  SIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSL  643
            SIGAIT+MKAYYKQ+LSF+CGL IVLTTQ++GYGWAG+LRRYLVDPVDMWWPSNLAQVSL
Sbjct  60   SIGAITVMKAYYKQSLSFICGLFIVLTTQILGYGWAGILRRYLVDPVDMWWPSNLAQVSL  119

Query  644  FRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  799
            FRALHE E KS G+TRM+FFL+ +GASF+YY LPGYLFPILTFFSWVCW WP
Sbjct  120  FRALHEKEHKSKGLTRMQFFLVALGASFLYYALPGYLFPILTFFSWVCWAWP  171



>ref|XP_006376658.1| hypothetical protein POPTR_0012s02660g [Populus trichocarpa]
 gb|ERP54455.1| hypothetical protein POPTR_0012s02660g [Populus trichocarpa]
Length=381

 Score =   280 bits (717),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 138/246 (56%), Positives = 175/246 (71%), Gaps = 7/246 (3%)
 Frame = +2

Query  59   MSGLNPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNT  238
            M+G N   A E        CPV++V L V +TDDPTLPVLTFR W LG+ SC++L F+N 
Sbjct  1    MAGANEVQAMEIEDEE--ECPVKQVDLTVLKTDDPTLPVLTFRMWVLGLGSCVLLSFVNQ  58

Query  239  FFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIIT  418
            FF YRTQP+ IS+I  QI+V+P+G  MA  L  RKF     W FT+NPGPFNIKEHV+IT
Sbjct  59   FFWYRTQPMFISSISAQIAVVPLGHLMAKKLTTRKFFEGTSWEFTMNPGPFNIKEHVLIT  118

Query  419  VMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVD  598
            + AN     G G  Y+   +T +K YYK+ L+F+  L +++TTQ++G+GWAG+ R+YLV+
Sbjct  119  IFANS----GAGTVYATHILTAVKLYYKRKLTFVPALFVMITTQVLGFGWAGLFRKYLVE  174

Query  599  PVDMWWPSNLAQVSLFRALHETEVKSSGMT-RMRFFLLVMGASFVYYTLPGYLFPILTFF  775
            P +MWWPSNL QVSLFRALHE E +  G T R +FFLLV+  SF YY LPGYLF +LT F
Sbjct  175  PGEMWWPSNLVQVSLFRALHEKEKRLKGYTSRTQFFLLVIICSFAYYVLPGYLFTMLTSF  234

Query  776  SWVCWV  793
            SWVCW+
Sbjct  235  SWVCWL  240



>gb|EYU33488.1| hypothetical protein MIMGU_mgv1a0023121mg, partial [Erythranthe 
guttata]
Length=548

 Score =   285 bits (730),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 132/233 (57%), Positives = 173/233 (74%), Gaps = 5/233 (2%)
 Frame = +2

Query  104  SGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAIL  283
            +G   P+E+VAL V   DDP+LPVLTFR WFLG  SC++L FLN FF YRT+PLSI+AI 
Sbjct  35   NGENSPIEQVALTVSTADDPSLPVLTFRMWFLGTLSCVLLSFLNQFFWYRTEPLSITAIS  94

Query  284  MQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAY  463
             QI+V+P+G+ MAA + +R F    R+ FTLNPGPFN+KEHV+IT+ AN     G G  Y
Sbjct  95   AQIAVVPLGQLMAARITDRSFFRGSRFEFTLNPGPFNVKEHVLITIFANS----GAGTVY  150

Query  464  SIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSL  643
            +I  +T +K +YKQ +SF   LI+V+TTQ++G+GWAG+ RRYLV+P  MWWP+NL QVSL
Sbjct  151  AIHVVTAVKIFYKQHISFFVSLIVVITTQVLGFGWAGIYRRYLVEPAAMWWPANLVQVSL  210

Query  644  FRALHETEVKSS-GMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  799
            FRALHE + ++  G+TR +FF++    SF YY  PGYLF +LT  SW+CWV+P
Sbjct  211  FRALHEKDERAKGGVTRTQFFIIAFITSFAYYIFPGYLFEMLTSLSWICWVFP  263



>ref|XP_008361590.1| PREDICTED: oligopeptide transporter 2-like, partial [Malus domestica]
Length=564

 Score =   286 bits (731),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 136/244 (56%), Positives = 179/244 (73%), Gaps = 7/244 (3%)
 Frame = +2

Query  68   LNPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFI  247
            + PAT  ++   S    PVEEV L V   DDPTLPV TFR W LG+ SC +L FLNTFF 
Sbjct  7    IEPATKHDENDVS----PVEEVRLTVSNDDDPTLPVWTFRMWTLGLASCALLSFLNTFFS  62

Query  248  YRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMA  427
            YRT+PL IS I +Q++ LPIG+FMA  LP+RKF   G   F+LNPGPFN+KEHV+I++ A
Sbjct  63   YRTEPLXISXISVQVATLPIGRFMARXLPKRKFQ-IGXKEFSLNPGPFNMKEHVLISIFA  121

Query  428  NCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVD  607
            N G   G G AY+I  + I+KA+Y + +SFL   I+V+TTQ++GYGWAG+LRRY+VDP +
Sbjct  122  NAGSGFGSGTAYAISIVDIIKAFYHRKISFLASWILVITTQVLGYGWAGILRRYVVDPAE  181

Query  608  MWWPSNLAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVC  787
            MWWPS+L QVSLFRALHE +  ++ M+R +FF + +  SF ++ +PGYLFP L+  SWVC
Sbjct  182  MWWPSSLVQVSLFRALHEKD--NNRMSRGKFFFIALXCSFAWFVVPGYLFPTLSTISWVC  239

Query  788  WVWP  799
            W++P
Sbjct  240  WIYP  243



>ref|XP_002323123.2| OLIGOPEPTIDE TRANSPORTER family protein [Populus trichocarpa]
 gb|EEF04884.2| OLIGOPEPTIDE TRANSPORTER family protein [Populus trichocarpa]
Length=661

 Score =   288 bits (737),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 135/172 (78%), Positives = 153/172 (89%), Gaps = 1/172 (1%)
 Frame = +2

Query  284  MQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAY  463
            MQI+VLP+GKFMA TLP + +   G WSF+LNPGPFN+KEHVIIT+ ANCGVS GGGDAY
Sbjct  1    MQIAVLPVGKFMAKTLPTKDYRILG-WSFSLNPGPFNMKEHVIITIFANCGVSYGGGDAY  59

Query  464  SIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSL  643
            SIGAIT+MKAYY+Q+LSFLCGL+IVLTTQ++GYGWAG+LRRYLV PV+MWWPSNLAQVSL
Sbjct  60   SIGAITVMKAYYRQSLSFLCGLLIVLTTQILGYGWAGMLRRYLVYPVEMWWPSNLAQVSL  119

Query  644  FRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  799
            FRALHE E +S GMTRMRFFL+ M  SF YY +PGYLFPILTFFSWVCW WP
Sbjct  120  FRALHEKEPQSKGMTRMRFFLIAMTVSFFYYAVPGYLFPILTFFSWVCWAWP  171



>gb|EMS48793.1| Oligopeptide transporter 3 [Triticum urartu]
Length=561

 Score =   285 bits (729),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 146/209 (70%), Positives = 166/209 (79%), Gaps = 10/209 (5%)
 Frame = +2

Query  59   MSGLNP---ATAGEKTAPSGG-----RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSC  214
            MS   P   AT G+  A   G     R PVEEVAL VPETDDP  PV+TFRAW LG+ SC
Sbjct  1    MSSTKPPADATGGKAAAQGEGEGEGERYPVEEVALGVPETDDPATPVMTFRAWTLGLASC  60

Query  215  IILIFLNTFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRW--SFTLNPGP  388
            ++LIFLNTFF YRTQPL+IS IL QI VLP+G+FMA+ LP+RK    G    SF LNPGP
Sbjct  61   VVLIFLNTFFTYRTQPLTISGILAQILVLPVGRFMASVLPDRKVRLLGGRLGSFNLNPGP  120

Query  389  FNIKEHVIITVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGW  568
            FNIKEHVIIT+ ANCGVS GGGDAYSIGAIT+MKAYYKQ+LSFLC L+IVL+TQ++GYGW
Sbjct  121  FNIKEHVIITIFANCGVSYGGGDAYSIGAITVMKAYYKQSLSFLCALLIVLSTQILGYGW  180

Query  569  AGVLRRYLVDPVDMWWPSNLAQVSLFRAL  655
            AG+LRR+LVDP +MWWPSNLAQVSLF  L
Sbjct  181  AGMLRRFLVDPAEMWWPSNLAQVSLFSPL  209



>ref|XP_010676880.1| PREDICTED: oligopeptide transporter 7-like [Beta vulgaris subsp. 
vulgaris]
Length=763

 Score =   290 bits (742),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 135/230 (59%), Positives = 172/230 (75%), Gaps = 5/230 (2%)
 Frame = +2

Query  113  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  292
              PV++VA+ VP  DDP LPVLTFR W LG  SC++L FLN FF YRT+PLSI+AI  QI
Sbjct  49   NSPVKQVAMTVPTIDDPELPVLTFRMWALGTLSCVVLSFLNQFFWYRTEPLSITAISAQI  108

Query  293  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            +V+P+G+ MAA LP R F    RW FTLNPGPFNIKEHV+IT+ AN     G G  Y+I 
Sbjct  109  AVVPLGQLMAAKLPSRPFLRGTRWEFTLNPGPFNIKEHVLITIFANA----GAGSVYAIH  164

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFRA  652
             +T++K +YK+ ++F   LI+VLTTQ++G+GWAG+ RRYLV+P +MWWP+NL QVSLFRA
Sbjct  165  VVTVVKIFYKKQITFFVSLIVVLTTQVLGFGWAGIFRRYLVEPAEMWWPANLVQVSLFRA  224

Query  653  LHETEVKSS-GMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  799
            LHE E ++  G+TR +FFL+    SF YY  PGYLF +LT  SW+CW+WP
Sbjct  225  LHEKEERAKGGLTRTQFFLISFICSFAYYVFPGYLFQMLTSLSWICWLWP  274



>gb|KJB32170.1| hypothetical protein B456_005G227300 [Gossypium raimondii]
Length=754

 Score =   289 bits (739),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 137/245 (56%), Positives = 181/245 (74%), Gaps = 4/245 (2%)
 Frame = +2

Query  71   NPATAGEKTAPSGGR-CPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFI  247
            N A  GE  A       P+EEV L V  TDDPTLPV TFR WFLG+ SC +L FLN FF 
Sbjct  19   NHAIKGENAAADDDELSPIEEVRLTVTNTDDPTLPVWTFRMWFLGLISCALLSFLNQFFA  78

Query  248  YRTQPLSISAILMQISVLPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITV  421
            YRT+PL I+ I +Q++ LPIG+FMAA LP R+F     G   F+LNPGPFN+KEHV+I++
Sbjct  79   YRTEPLIITQITVQVATLPIGQFMAAVLPRRQFKLPGVGSRKFSLNPGPFNMKEHVLISI  138

Query  422  MANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDP  601
             AN G + G G AY++G +TI+KA+Y++ +SFL G ++++TTQ++GYGWAG+LR+Y+V+P
Sbjct  139  FANAGSAFGSGSAYAVGIVTIIKAFYQRKISFLAGWLLIITTQVLGYGWAGLLRKYVVEP  198

Query  602  VDMWWPSNLAQVSLFRALHETEVKSS-GMTRMRFFLLVMGASFVYYTLPGYLFPILTFFS  778
              MWWPS L QVSLFRALHE + K+   MTR +FFL+++  SFV+Y +PGYLF  LT  S
Sbjct  199  AHMWWPSTLVQVSLFRALHEKDDKNDRRMTRAKFFLIILICSFVWYLVPGYLFTTLTSIS  258

Query  779  WVCWV  793
            W+CW+
Sbjct  259  WICWI  263



>dbj|BAJ97716.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=551

 Score =   283 bits (725),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 133/244 (55%), Positives = 169/244 (69%), Gaps = 5/244 (2%)
 Frame = +2

Query  71   NPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIY  250
            +P    +    S    P+E+VAL VP  DDP  PVLTFR W LG+ SC +L FLN FF Y
Sbjct  45   SPEHQNDDGNLSSENSPIEQVALTVPVGDDPDTPVLTFRMWVLGMASCAVLSFLNQFFWY  104

Query  251  RTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMAN  430
            R +PL+I+AI  QI+V+P+G+ MAA LPER F    RW FTLNPGPFN+KEHV+IT+ AN
Sbjct  105  RKEPLTITAISAQIAVVPLGRLMAAALPERVFLRGSRWEFTLNPGPFNVKEHVLITIFAN  164

Query  431  CGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDM  610
                 G G  Y+I  +T ++ +Y + L+F   L++VLTTQ++G+GWAG+ RRYLV+P  M
Sbjct  165  A----GAGTVYAIHVVTAVRVFYGKNLTFFVSLLVVLTTQVLGFGWAGIFRRYLVEPATM  220

Query  611  WWPSNLAQVSLFRALHETEVKSS-GMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVC  787
            WWPSNL QVSLFRALH+ E +   G TR +FFL+    SF YY  PGYLF +LT  SW+C
Sbjct  221  WWPSNLVQVSLFRALHDDERRQKGGFTRNQFFLVAFACSFAYYAFPGYLFQMLTSLSWIC  280

Query  788  WVWP  799
            WV P
Sbjct  281  WVLP  284



>gb|KJB32172.1| hypothetical protein B456_005G227300 [Gossypium raimondii]
Length=493

 Score =   281 bits (720),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 132/244 (54%), Positives = 176/244 (72%), Gaps = 3/244 (1%)
 Frame = +2

Query  71   NPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIY  250
            +  + G          P+E+V L V  TDDPTLPV TFR WFLG+ SC +L FLN FF Y
Sbjct  19   DATSGGNHDVEDDEISPIEQVRLTVTNTDDPTLPVWTFRMWFLGLFSCALLSFLNQFFSY  78

Query  251  RTQPLSISAILMQISVLPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVM  424
            RT+PL I+ I +Q+S LPIG FMA+ LP+ +F    FG   F+LNPGPFN+KEHV+I + 
Sbjct  79   RTEPLIITQITVQVSTLPIGHFMASVLPKTQFGIPGFGSKRFSLNPGPFNMKEHVLICIF  138

Query  425  ANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPV  604
            AN G + G G AY+IG + I+KA+Y + +SFL G ++++TTQ++GYGWAG+LR+Y+V+P 
Sbjct  139  ANAGSAFGNGSAYAIGIVNIIKAFYGRNISFLAGWLLIITTQVLGYGWAGLLRKYVVEPA  198

Query  605  DMWWPSNLAQVSLFRALHETEVKSS-GMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSW  781
             MWWPS L QVSLFRALHE + K+   MTR +FFL+++  SFV+Y +PGYLF  LT  SW
Sbjct  199  HMWWPSTLVQVSLFRALHEKDDKNDRRMTRAKFFLIILICSFVWYLVPGYLFTTLTSISW  258

Query  782  VCWV  793
            +CW+
Sbjct  259  ICWI  262



>ref|XP_010090590.1| Oligopeptide transporter 7 [Morus notabilis]
 gb|EXB39949.1| Oligopeptide transporter 7 [Morus notabilis]
Length=707

 Score =   287 bits (734),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 138/242 (57%), Positives = 176/242 (73%), Gaps = 9/242 (4%)
 Frame = +2

Query  77   ATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRT  256
            A A EK   S    PVE+VAL VP TDDP+LPVLTFR WFLGI SC++L FLN FF YR 
Sbjct  39   AEAAEKEENS----PVEQVALTVPITDDPSLPVLTFRMWFLGILSCVLLSFLNQFFWYRK  94

Query  257  QPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCG  436
            +PLSI+AI  QI+V+P+G+ MAA +P   F    RW F+LNPGPFN+KEHV+IT+ AN  
Sbjct  95   EPLSITAISAQIAVVPLGQLMAAKIPNHVFFRGTRWEFSLNPGPFNVKEHVLITIFANS-  153

Query  437  VSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWW  616
               G G  Y+I  +T++K +YKQ ++F   LI+VLTTQ++G+GWAG+ RRYLV+P  MWW
Sbjct  154  ---GAGTVYAIHVVTVVKIFYKQHMTFFVSLIVVLTTQVLGFGWAGIFRRYLVEPAAMWW  210

Query  617  PSNLAQVSLFRALHETEVKSSG-MTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWV  793
            P NL QVSLFRALHE E +  G ++R +FF++    SF YY  PGYLF +LT  SW+CW+
Sbjct  211  PENLVQVSLFRALHEKEERPKGSLSRTQFFVIAFFCSFAYYVFPGYLFEMLTSISWICWL  270

Query  794  WP  799
            +P
Sbjct  271  FP  272



>ref|XP_010267481.1| PREDICTED: oligopeptide transporter 7-like [Nelumbo nucifera]
Length=734

 Score =   287 bits (735),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 133/248 (54%), Positives = 182/248 (73%), Gaps = 5/248 (2%)
 Frame = +2

Query  59   MSGLNPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNT  238
            M+G   ++  E  +P  G   +++VAL VP TDD ++PVLTFR W LG+ SC++L FLN 
Sbjct  1    MTGNPLSSEMEMESPESGNSTIKQVALTVPTTDDSSIPVLTFRMWVLGLVSCVLLSFLNQ  60

Query  239  FFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIIT  418
            FF YRT+P+SI+A+  QI+V+P+G  MA+T+ +R F    RW FT+NPGPFN+KEHV+IT
Sbjct  61   FFWYRTEPISITALSAQIAVVPLGHLMASTITKRVFFKGSRWEFTMNPGPFNVKEHVLIT  120

Query  419  VMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVD  598
            + AN     G G  Y+   ++ +K YYK+ L+F   L+I+LTTQ++G+GWAG+ RRYLV+
Sbjct  121  IFANA----GAGTVYATHILSAIKLYYKRKLTFFPALLIILTTQILGFGWAGMFRRYLVE  176

Query  599  PVDMWWPSNLAQVSLFRALHETEVK-SSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFF  775
            P +MWWPSNL QVSLFRALHE E +   G+TR +FFL+ +  SF YY LPGY+FP+LT  
Sbjct  177  PAEMWWPSNLVQVSLFRALHEKEKRPRGGVTRTQFFLIALTCSFAYYLLPGYIFPMLTSL  236

Query  776  SWVCWVWP  799
            SWVCW++P
Sbjct  237  SWVCWIFP  244



>ref|XP_006851884.1| hypothetical protein AMTR_s00041p00121000 [Amborella trichopoda]
 gb|ERN13351.1| hypothetical protein AMTR_s00041p00121000 [Amborella trichopoda]
Length=734

 Score =   287 bits (734),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 135/244 (55%), Positives = 177/244 (73%), Gaps = 5/244 (2%)
 Frame = +2

Query  71   NPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIY  250
            + +T  E+   S    P+E+VAL VP TDDP+LPVLTFR WFLG  SC++L FLN FF Y
Sbjct  6    SSSTTIEEPNTSPENSPIEQVALTVPVTDDPSLPVLTFRMWFLGGLSCVVLSFLNQFFWY  65

Query  251  RTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMAN  430
            RT+PLSI+++  QI+V+P+G  MAA LP R F    RW FTLNPGPFN+KEHV+IT+ AN
Sbjct  66   RTEPLSITSVSAQIAVVPLGHLMAAVLPTRPFFKGKRWEFTLNPGPFNVKEHVLITIFAN  125

Query  431  CGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDM  610
                 G G  Y+I  ++ +K +YK+ LSF    ++V+TTQ++G+GWAG+ R+YLV+P  M
Sbjct  126  S----GAGSVYAIHIVSAVKIFYKETLSFFVAFLVVITTQVLGFGWAGIFRKYLVEPAAM  181

Query  611  WWPSNLAQVSLFRALHETEVKSSG-MTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVC  787
            WWP NL QVSLF ALHE E +  G +TR +FFL+ +  SF YY LPGYLFP+LT  SW+C
Sbjct  182  WWPYNLVQVSLFGALHEKEERRKGSLTRNQFFLIALMCSFAYYVLPGYLFPMLTSLSWIC  241

Query  788  WVWP  799
            W++P
Sbjct  242  WIFP  245



>ref|XP_004136415.1| PREDICTED: oligopeptide transporter 2-like [Cucumis sativus]
 ref|XP_004164895.1| PREDICTED: oligopeptide transporter 2-like [Cucumis sativus]
 gb|KGN60282.1| hypothetical protein Csa_3G893320 [Cucumis sativus]
Length=742

 Score =   286 bits (732),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 136/245 (56%), Positives = 180/245 (73%), Gaps = 4/245 (2%)
 Frame = +2

Query  71   NPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIY  250
            +  T  +K  P     P+E+V L V   DDP++PV TFR WFLG+ SCIIL FLNTFF Y
Sbjct  11   DSTTTTQKPIPDDEISPIEQVRLTVSNEDDPSIPVWTFRMWFLGLLSCIILSFLNTFFGY  70

Query  251  RTQPLSISAILMQISVLPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVM  424
            RT+PL IS I +Q++ LPIG+FMA  LP + F    FG  +F+LNPGPFNIKEHV+I++ 
Sbjct  71   RTEPLVISMISVQVATLPIGRFMANVLPTKTFRIPGFGDRNFSLNPGPFNIKEHVLISIF  130

Query  425  ANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPV  604
            AN G + G G AY+IG + I+ A+Y + +SFL G I+V+TTQ++GYGWAG+LR+Y+VDP 
Sbjct  131  ANAGSAFGNGAAYAIGIVDIVMAFYHRKISFLTGWILVITTQVMGYGWAGILRKYVVDPA  190

Query  605  DMWWPSNLAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWV  784
            +MWWPS+L QVSLFRA+HE +   S M+R +FFL+ +  SF +Y  PGYLFP L+  SWV
Sbjct  191  EMWWPSSLVQVSLFRAMHEKD--ESRMSRGKFFLITLICSFSWYVFPGYLFPTLSTISWV  248

Query  785  CWVWP  799
            CW++P
Sbjct  249  CWIYP  253



>ref|XP_002981747.1| hypothetical protein SELMODRAFT_179057 [Selaginella moellendorffii]
 gb|EFJ17229.1| hypothetical protein SELMODRAFT_179057 [Selaginella moellendorffii]
Length=771

 Score =   286 bits (732),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 135/230 (59%), Positives = 172/230 (75%), Gaps = 6/230 (3%)
 Frame = +2

Query  113  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  292
            + P+EEVAL V  +DDP+LPV TFR W LG+ SC++L F N FF YRT+PL I+AI  QI
Sbjct  55   QSPIEEVALTVDTSDDPSLPVYTFRMWTLGVVSCVLLAFFNQFFAYRTEPLIITAISAQI  114

Query  293  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
              LP+GK MAATLP RKF+ FGR  F+LNPG FN KEHV+IT+ AN G     G AY++G
Sbjct  115  VTLPLGKLMAATLPTRKFSIFGR-EFSLNPGAFNKKEHVLITIFANTG----AGSAYAVG  169

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFRA  652
             +TI+KA+YK+ + F  GL+I +TTQ+IGYGWAG+ R+YLVDP +MWWPSNL QVS+FR 
Sbjct  170  IVTIVKAFYKRRMDFGVGLLITITTQIIGYGWAGIFRKYLVDPAEMWWPSNLVQVSIFRT  229

Query  653  LHETEV-KSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  799
            LHE +V +  G+TR++FFL+ +  SF YYT P Y F  L+  SWVC+ WP
Sbjct  230  LHEKDVRRKGGLTRLQFFLIALTFSFCYYTFPDYWFISLSSLSWVCYAWP  279



>ref|XP_011070370.1| PREDICTED: oligopeptide transporter 7 [Sesamum indicum]
Length=753

 Score =   286 bits (731),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 134/232 (58%), Positives = 173/232 (75%), Gaps = 5/232 (2%)
 Frame = +2

Query  107  GGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILM  286
            G   P+++VAL VP TDDPTLPVLTFR WFLG  SC++L FLN FF YRT+PLSI+AI  
Sbjct  39   GENSPIKQVALTVPTTDDPTLPVLTFRMWFLGTLSCVLLSFLNQFFWYRTEPLSITAISA  98

Query  287  QISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYS  466
            QI+V+P+G+ MAA + +R F    RW FTLNPGPFN+KEHV+IT+ AN     G G  Y+
Sbjct  99   QIAVVPLGQLMAAKITDRVFFRGTRWEFTLNPGPFNVKEHVLITIFANS----GAGTVYA  154

Query  467  IGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLF  646
            I  +T +K +YKQ +SF   LI+V+TTQ++G+GWAG+ RRYLV+P  MWWP+NL QVSLF
Sbjct  155  IHVVTAVKVFYKQHISFFVSLIVVITTQVLGFGWAGIYRRYLVEPAAMWWPANLVQVSLF  214

Query  647  RALHETEVK-SSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  799
            RALHE + +   G+TR +FF++    SF YY  PGYLF +LT  SW+CW++P
Sbjct  215  RALHEKDERPKGGVTRTQFFIIAFICSFAYYIFPGYLFQMLTSLSWICWIFP  266



>ref|XP_002967597.1| hypothetical protein SELMODRAFT_88962 [Selaginella moellendorffii]
 gb|EFJ30944.1| hypothetical protein SELMODRAFT_88962 [Selaginella moellendorffii]
Length=771

 Score =   286 bits (731),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 135/230 (59%), Positives = 172/230 (75%), Gaps = 6/230 (3%)
 Frame = +2

Query  113  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  292
            + P+EEVAL V  +DDP+LPV TFR W LG+ SC++L F N FF YRT+PL I+AI  QI
Sbjct  55   QSPIEEVALTVDTSDDPSLPVYTFRMWTLGVVSCVLLAFFNQFFAYRTEPLIITAISAQI  114

Query  293  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
              LP+GK MAATLP RKF+ FGR  F+LNPG FN KEHV+IT+ AN G     G AY++G
Sbjct  115  VTLPLGKLMAATLPTRKFSIFGR-EFSLNPGAFNKKEHVLITIFANTG----AGSAYAVG  169

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFRA  652
             +TI+KA+YK+ + F  GL+I +TTQ+IGYGWAG+ R+YLVDP +MWWPSNL QVS+FR 
Sbjct  170  IVTIVKAFYKRRMEFGVGLLITITTQIIGYGWAGIFRKYLVDPAEMWWPSNLVQVSIFRT  229

Query  653  LHETEV-KSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  799
            LHE +V +  G+TR++FFL+ +  SF YYT P Y F  L+  SWVC+ WP
Sbjct  230  LHEKDVRRKGGLTRLQFFLIALTFSFCYYTFPDYWFISLSSLSWVCYAWP  279



>gb|KJB24153.1| hypothetical protein B456_004G130200 [Gossypium raimondii]
Length=759

 Score =   286 bits (731),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 132/230 (57%), Positives = 172/230 (75%), Gaps = 5/230 (2%)
 Frame = +2

Query  113  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  292
              PV +VAL VP TDDP+LPVLTFR W LG  SC++L FLN FF YRT+PL+I+AI  QI
Sbjct  46   NSPVRQVALTVPTTDDPSLPVLTFRMWVLGTISCVLLSFLNQFFWYRTEPLTITAISAQI  105

Query  293  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            +V+P+G+ MAA + +R F    RW FTLNPGPFN+KEHV+IT+ AN     G G  Y+I 
Sbjct  106  AVVPLGQLMAAKITKRVFFKGSRWEFTLNPGPFNVKEHVLITIFANS----GAGSVYAIH  161

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFRA  652
             +T++K +YKQ ++F   LI++LTTQ++G+GWAG+ RRYLV+P  MWWP+NL QVSLFRA
Sbjct  162  VVTVVKVFYKQHITFFVSLIVILTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRA  221

Query  653  LHETEVKSS-GMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  799
            LHE E ++  G+TR +FFL+    SF YY  PGYLF +LT  SW+CW++P
Sbjct  222  LHEKEERAKGGVTRTQFFLIAFICSFAYYVFPGYLFQMLTSLSWICWIFP  271



>ref|XP_006376659.1| hypothetical protein POPTR_0012s02660g [Populus trichocarpa]
 gb|ERP54456.1| hypothetical protein POPTR_0012s02660g [Populus trichocarpa]
Length=532

 Score =   280 bits (716),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 138/246 (56%), Positives = 175/246 (71%), Gaps = 7/246 (3%)
 Frame = +2

Query  59   MSGLNPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNT  238
            M+G N   A E        CPV++V L V +TDDPTLPVLTFR W LG+ SC++L F+N 
Sbjct  1    MAGANEVQAME--IEDEEECPVKQVDLTVLKTDDPTLPVLTFRMWVLGLGSCVLLSFVNQ  58

Query  239  FFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIIT  418
            FF YRTQP+ IS+I  QI+V+P+G  MA  L  RKF     W FT+NPGPFNIKEHV+IT
Sbjct  59   FFWYRTQPMFISSISAQIAVVPLGHLMAKKLTTRKFFEGTSWEFTMNPGPFNIKEHVLIT  118

Query  419  VMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVD  598
            + AN     G G  Y+   +T +K YYK+ L+F+  L +++TTQ++G+GWAG+ R+YLV+
Sbjct  119  IFANS----GAGTVYATHILTAVKLYYKRKLTFVPALFVMITTQVLGFGWAGLFRKYLVE  174

Query  599  PVDMWWPSNLAQVSLFRALHETEVKSSGMT-RMRFFLLVMGASFVYYTLPGYLFPILTFF  775
            P +MWWPSNL QVSLFRALHE E +  G T R +FFLLV+  SF YY LPGYLF +LT F
Sbjct  175  PGEMWWPSNLVQVSLFRALHEKEKRLKGYTSRTQFFLLVIICSFAYYVLPGYLFTMLTSF  234

Query  776  SWVCWV  793
            SWVCW+
Sbjct  235  SWVCWL  240



>gb|EMT01286.1| Oligopeptide transporter 4 [Aegilops tauschii]
Length=730

 Score =   285 bits (728),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 135/239 (56%), Positives = 182/239 (76%), Gaps = 7/239 (3%)
 Frame = +2

Query  83   AGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQP  262
            AG++   S    PVE+V L VP TDDP+LPV TFR W +G  SC +L FLN FF YR +P
Sbjct  9    AGDEDDAS----PVEQVRLTVPVTDDPSLPVWTFRMWTMGFLSCALLSFLNQFFAYRAEP  64

Query  263  LSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVS  442
            + IS I +Q++ LPIG F+A  LPE+KF  FGR   ++NPGPFN+KEHV+I++ AN G S
Sbjct  65   IIISQITIQVAALPIGHFLARVLPEKKFRVFGR-ECSVNPGPFNVKEHVLISIFANAGAS  123

Query  443  PGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPS  622
             GGG+AY+IG +TI+KA+YK+ +SF+  L++V+TTQ++GYGWAG++R+Y+V+P  MWWP+
Sbjct  124  FGGGNAYAIGIVTIIKAFYKRNISFVTSLLLVITTQVLGYGWAGLMRKYVVEPAHMWWPT  183

Query  623  NLAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  799
            +L QVSL RA+HE E +   MTR +FFL+ +  SF +YT+PGYLFP LT  SWVCWV+P
Sbjct  184  SLVQVSLMRAMHEKEKRR--MTRGKFFLIALICSFAWYTVPGYLFPTLTAVSWVCWVFP  240



>ref|XP_002963418.1| hypothetical protein SELMODRAFT_166204 [Selaginella moellendorffii]
 gb|EFJ35289.1| hypothetical protein SELMODRAFT_166204 [Selaginella moellendorffii]
Length=743

 Score =   285 bits (729),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 136/245 (56%), Positives = 175/245 (71%), Gaps = 2/245 (1%)
 Frame = +2

Query  71   NPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIY  250
             P  A +  A    + PVEEVAL V   DDPTLPV TFR WFLG+ SCI+L FLN FF Y
Sbjct  11   EPLVAPQVEAEGDDQSPVEEVALTVDTRDDPTLPVGTFRMWFLGLLSCILLSFLNQFFSY  70

Query  251  RTQPLSISAILMQISVLPIGKFMAATLPERKF-APFGRWSFTLNPGPFNIKEHVIITVMA  427
            RT+P  I  I +QI  LP G+FMA  LPER F  PF   SF+LNPGPFN+KEHV+IT+ A
Sbjct  71   RTEPFIIGLISVQIVALPFGRFMANVLPERSFRVPFTSSSFSLNPGPFNVKEHVLITIFA  130

Query  428  NCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVD  607
            N G   G G AY++G + I +A+YK+++ F  GL++V+TTQ++GYGWAG+++++LV+P  
Sbjct  131  NAGSGFGNGGAYAMGIVNITRAFYKRSMGFTAGLLLVMTTQVLGYGWAGLMKKHLVEPAH  190

Query  608  MWWPSNLAQVSLFRALH-ETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWV  784
            MWWP NL QVSLFR LH E + +  G +R +FF +VM  SF YY LPGY+F +LT  SWV
Sbjct  191  MWWPGNLVQVSLFRTLHEEDQQQKKGFSRSQFFAIVMTLSFCYYVLPGYMFMMLTSMSWV  250

Query  785  CWVWP  799
            CW++P
Sbjct  251  CWIFP  255



>ref|XP_010676881.1| PREDICTED: oligopeptide transporter 7 [Beta vulgaris subsp. vulgaris]
Length=754

 Score =   285 bits (729),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 133/255 (52%), Positives = 175/255 (69%), Gaps = 5/255 (2%)
 Frame = +2

Query  38   SEHIVVEMSGLNPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCI  217
             EH   E +  +       +  S    PV++VAL VP TDDP LPVLTFR W LG+ SCI
Sbjct  16   DEHHQDEKNEESQRLISSSSTKSTENSPVKQVALTVPITDDPELPVLTFRTWVLGMVSCI  75

Query  218  ILIFLNTFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNI  397
            +L FLN FF YRT+PLS++ I  QI+V+P+G +MA+ LP        RW F++NPGPFN+
Sbjct  76   VLSFLNQFFWYRTEPLSVTGIAAQIAVVPLGHWMASNLPNGSLFRGTRWEFSMNPGPFNV  135

Query  398  KEHVIITVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGV  577
            KEHV+IT+ AN     G G  Y+I  +T +K +YK+ ++F   L++VLTTQ++G+GWAGV
Sbjct  136  KEHVLITIFANA----GAGTVYAIHVVTAVKIFYKKNITFFVSLLVVLTTQVLGFGWAGV  191

Query  578  LRRYLVDPVDMWWPSNLAQVSLFRALHETEVK-SSGMTRMRFFLLVMGASFVYYTLPGYL  754
             RRYLV+P +MWWP+NL QVSLFRALHE E +   G+TR +FFL+    SF YY  PGY+
Sbjct  192  FRRYLVEPAEMWWPANLVQVSLFRALHEKEERPKGGLTRTQFFLIAFTCSFAYYVFPGYI  251

Query  755  FPILTFFSWVCWVWP  799
            F +LT  SW+CW WP
Sbjct  252  FQMLTSLSWICWAWP  266



>ref|XP_010538850.1| PREDICTED: oligopeptide transporter 7 [Tarenaya hassleriana]
Length=757

 Score =   285 bits (729),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 130/230 (57%), Positives = 173/230 (75%), Gaps = 5/230 (2%)
 Frame = +2

Query  113  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  292
              P+ +VAL VP TDDP+LPVLTFR W LG  SC++L FLN FF YRT+PL+ISAI  QI
Sbjct  44   NSPIRQVALTVPTTDDPSLPVLTFRMWVLGTVSCVVLSFLNQFFWYRTEPLTISAISAQI  103

Query  293  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            +V+P+G+ MAA L ++ F    +W F+LNPGPFN+KEHV+IT+ AN     G G  Y+I 
Sbjct  104  AVVPLGRLMAAKLSDKVFLRGSKWEFSLNPGPFNVKEHVLITIFANA----GAGSVYAIH  159

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFRA  652
             +T++KA+Y + ++F   LI+++TTQ++G+GWAG+ RRYLV+P  MWWPSNL QVSLFRA
Sbjct  160  VVTVVKAFYMKNITFFVSLIVIITTQVLGFGWAGIFRRYLVEPAAMWWPSNLVQVSLFRA  219

Query  653  LHETEVKSS-GMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  799
            LHE E ++  G+TR +FFL+ +  SF YY LPGYLF +LT  SW+CW +P
Sbjct  220  LHEKEERTKGGLTRTQFFLIALACSFAYYVLPGYLFQMLTSLSWLCWAFP  269



>ref|XP_006343795.1| PREDICTED: oligopeptide transporter 7-like [Solanum tuberosum]
Length=749

 Score =   285 bits (728),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 131/230 (57%), Positives = 173/230 (75%), Gaps = 5/230 (2%)
 Frame = +2

Query  113  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  292
              P+E+VAL VP TDDP+LPVLTFR WFLG  SC++L FLN FF YRT+PL+I+AI  QI
Sbjct  36   NSPIEQVALTVPTTDDPSLPVLTFRMWFLGTLSCVLLSFLNQFFWYRTEPLTITAISAQI  95

Query  293  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            +V+P+G+ MAA + +R F    +W FTLNPGPFN+KEHV+IT+ AN     G G  Y+I 
Sbjct  96   AVVPLGQLMAAKITKRVFLQGSKWEFTLNPGPFNVKEHVLITIFANS----GAGTVYAIH  151

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFRA  652
             +T +K +YK+ ++F   LI+++TTQ++G+GWAG+ R+YLV+P  MWWPSNL QVSLFRA
Sbjct  152  VVTAVKVFYKKDITFFVSLIVIITTQVLGFGWAGIFRKYLVEPAAMWWPSNLVQVSLFRA  211

Query  653  LHETEVKSS-GMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  799
            LHE E +S  G+TR +FF++    SF YY  PGYLF +LT  SWVCW++P
Sbjct  212  LHEKEERSKGGLTRTQFFIVAFICSFAYYIFPGYLFSMLTSLSWVCWIFP  261



>gb|KHG17687.1| Oligopeptide transporter 7 [Gossypium arboreum]
Length=759

 Score =   285 bits (728),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 132/230 (57%), Positives = 172/230 (75%), Gaps = 5/230 (2%)
 Frame = +2

Query  113  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  292
              PV +VAL VP TDDP+LPVLTFR W LG  SC +L FLN FF YRT+PL+I+AI  QI
Sbjct  46   NSPVRQVALTVPTTDDPSLPVLTFRMWVLGTISCFLLSFLNQFFWYRTEPLTITAISAQI  105

Query  293  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            +V+P+G+ MAA + +R F    RW FTLNPGPFN+KEHV+IT+ AN     G G  Y+I 
Sbjct  106  AVVPLGQLMAAKITKRVFFKGSRWEFTLNPGPFNVKEHVLITIFANS----GAGSVYAIH  161

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFRA  652
             +T++K +YKQ ++F   LI++LTTQ++G+GWAG+ RRYLV+P  MWWP+NL QVSLFRA
Sbjct  162  VVTVVKVFYKQHITFFVSLIVILTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRA  221

Query  653  LHETEVKSS-GMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  799
            LHE E +++ G+TR +FFL+    SF YY  PGYLF +LT  SW+CW++P
Sbjct  222  LHEKEERANGGVTRTQFFLIAFICSFAYYVFPGYLFQMLTSLSWICWIFP  271



>ref|XP_008466130.1| PREDICTED: oligopeptide transporter 2 [Cucumis melo]
Length=741

 Score =   284 bits (727),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 136/251 (54%), Positives = 182/251 (73%), Gaps = 4/251 (2%)
 Frame = +2

Query  53   VEMSGLNPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFL  232
            +E+     +T  +K  P     P+E+V L V   DDP++PV TFR WFLG+ SC+IL FL
Sbjct  4    LEIELEQDSTTTQKPIPDDEISPIEQVRLTVSNEDDPSIPVWTFRMWFLGLLSCMILSFL  63

Query  233  NTFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEH  406
            NTFF YRT+PL IS I +Q++ LPIG+FMA  LP   F    FG  +F+LNPGPFNIKEH
Sbjct  64   NTFFGYRTEPLVISMISVQVATLPIGRFMANVLPTTTFRIPGFGDRNFSLNPGPFNIKEH  123

Query  407  VIITVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRR  586
            V+I++ AN G + G G AY+IG + I+ A+Y + +SFL G I+V+TTQ++GYGWAG+LR+
Sbjct  124  VLISIFANAGSAFGNGAAYAIGIVDIVMAFYHRKISFLAGWILVITTQVMGYGWAGILRK  183

Query  587  YLVDPVDMWWPSNLAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPIL  766
            Y+VDP +MWWPS+L QVSLFRA+HE +   S M+R +FFL+ +  SF +Y  PGYLFP L
Sbjct  184  YVVDPAEMWWPSSLVQVSLFRAMHEKD--ESRMSRGKFFLITLICSFSWYVFPGYLFPTL  241

Query  767  TFFSWVCWVWP  799
            +  SWVCW++P
Sbjct  242  STISWVCWIYP  252



>gb|KHG17686.1| Oligopeptide transporter 7 [Gossypium arboreum]
Length=783

 Score =   285 bits (729),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 132/230 (57%), Positives = 172/230 (75%), Gaps = 5/230 (2%)
 Frame = +2

Query  113  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  292
              PV +VAL VP TDDP+LPVLTFR W LG  SC +L FLN FF YRT+PL+I+AI  QI
Sbjct  70   NSPVRQVALTVPTTDDPSLPVLTFRMWVLGTISCFLLSFLNQFFWYRTEPLTITAISAQI  129

Query  293  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            +V+P+G+ MAA + +R F    RW FTLNPGPFN+KEHV+IT+ AN     G G  Y+I 
Sbjct  130  AVVPLGQLMAAKITKRVFFKGSRWEFTLNPGPFNVKEHVLITIFANS----GAGSVYAIH  185

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFRA  652
             +T++K +YKQ ++F   LI++LTTQ++G+GWAG+ RRYLV+P  MWWP+NL QVSLFRA
Sbjct  186  VVTVVKVFYKQHITFFVSLIVILTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRA  245

Query  653  LHETEVKSS-GMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  799
            LHE E +++ G+TR +FFL+    SF YY  PGYLF +LT  SW+CW++P
Sbjct  246  LHEKEERANGGVTRTQFFLIAFICSFAYYVFPGYLFQMLTSLSWICWIFP  295



>gb|EPS60835.1| hypothetical protein M569_13965 [Genlisea aurea]
Length=743

 Score =   284 bits (726),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 139/243 (57%), Positives = 177/243 (73%), Gaps = 7/243 (3%)
 Frame = +2

Query  74   PATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYR  253
            P +A +   P     P+EEV L VP TDDP+LP LTFR WFLGI SC  L +LN FF YR
Sbjct  12   PESAAKNDEPLN-DSPIEEVRLTVPTTDDPSLPCLTFRTWFLGIISCAALSYLNQFFSYR  70

Query  254  TQPLSISAILMQISVLPIGKFMAATLPERKFA-PFGRWSFTLNPGPFNIKEHVIITVMAN  430
              PLSI+++  QI VLP+GKFMAATLPER+F  P   WSF+LNPGPFN+KEH +IT+ AN
Sbjct  71   RNPLSITSVSAQILVLPVGKFMAATLPERRFRFPGTNWSFSLNPGPFNMKEHCLITIFAN  130

Query  431  CGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDM  610
             G S      Y+IG +TI+KA+Y + L  L  +I+  +TQL+GYGWAG+ R++LVD   M
Sbjct  131  AGAS----GVYAIGIVTIVKAFYHRKLHPLAAMILTHSTQLLGYGWAGIFRKFLVDSPYM  186

Query  611  WWPSNLAQVSLFRALHETEV-KSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVC  787
            WWPSNL QVSLFRALH+ EV +  G+TR++FF +V+ +SF YY +PGYLFP +T  S+VC
Sbjct  187  WWPSNLVQVSLFRALHDVEVRRKGGLTRLQFFAIVLVSSFSYYVVPGYLFPSITALSFVC  246

Query  788  WVW  796
            W+W
Sbjct  247  WIW  249



>ref|XP_009358688.1| PREDICTED: LOW QUALITY PROTEIN: oligopeptide transporter 7-like 
[Pyrus x bretschneideri]
Length=749

 Score =   284 bits (726),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 131/230 (57%), Positives = 171/230 (74%), Gaps = 5/230 (2%)
 Frame = +2

Query  113  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  292
              PVE+VAL VP TDDP+LPVLTFR W LG  SC++L FLN FF YRT+PL+I+AI  QI
Sbjct  38   NSPVEQVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLTITAISAQI  97

Query  293  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            +V+P+G+ MA+ +  R F    RW FTLNPGPFN+KEHV+IT+ AN     G G  Y+I 
Sbjct  98   AVVPLGQLMASKITNRVFFKGSRWEFTLNPGPFNVKEHVLITIFANS----GAGTVYAIH  153

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFRA  652
             +T +K +YK+ ++F   L+++LTTQ++G+GWAG+ RRYLV+P  MWWP+NL QVSLFRA
Sbjct  154  IVTAVKVFYKKHITFFVSLLVILTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRA  213

Query  653  LHETEVKSS-GMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  799
            LHE EV+   G+TR +FFL+    SF YY  PGYLF +LT  SW+CW++P
Sbjct  214  LHEKEVRHKGGLTRTQFFLIAFMCSFAYYVFPGYLFQMLTSLSWICWIFP  263



>ref|XP_010553673.1| PREDICTED: oligopeptide transporter 2 [Tarenaya hassleriana]
Length=734

 Score =   283 bits (725),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 134/237 (57%), Positives = 174/237 (73%), Gaps = 3/237 (1%)
 Frame = +2

Query  89   EKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLS  268
            ++        PVEEV L VP  DDP+LPV TFR WFLG+ SC++L FLNTFF YRTQPL 
Sbjct  12   DEEEGDNDESPVEEVRLTVPNHDDPSLPVWTFRMWFLGLFSCVLLSFLNTFFGYRTQPLM  71

Query  269  ISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPG  448
            IS I +Q+  LPIGK MA  LP++KF   G + F+LNPGPFN+KEHV+I++ AN G   G
Sbjct  72   ISMISIQVVTLPIGKMMARVLPDKKFR-VGSFEFSLNPGPFNVKEHVLISMFANAGAGYG  130

Query  449  GGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNL  628
             G AY++G + I+KA+YK+ +SFL   ++V+TTQ++GYGWAG++RR LV+P  MWWPS+L
Sbjct  131  SGTAYAVGIVDIIKAFYKRNISFLASWLLVITTQVLGYGWAGIMRRLLVEPAQMWWPSSL  190

Query  629  AQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  799
             QVSLFRALHE + +   M+R +FFL+    SF +Y  PGYLFP L+  SWVCWV+P
Sbjct  191  LQVSLFRALHEKDTQR--MSRGKFFLIAFLCSFAWYIFPGYLFPTLSAISWVCWVFP  245



>ref|XP_008338986.1| PREDICTED: oligopeptide transporter 2-like [Malus domestica]
Length=733

 Score =   283 bits (725),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 136/244 (56%), Positives = 179/244 (73%), Gaps = 7/244 (3%)
 Frame = +2

Query  68   LNPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFI  247
            + PAT  ++   S    PVEEV L V   DDPTLPV TFR W LG+ SC +L FLNTFF 
Sbjct  7    IEPATKHDENDVS----PVEEVRLTVSNDDDPTLPVWTFRMWTLGLASCALLSFLNTFFS  62

Query  248  YRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMA  427
            YRT+PL IS I +Q++ LPIG+FMA  LP+RKF   G   F+LNPGPFN+KEHV+I++ A
Sbjct  63   YRTEPLXISXISVQVATLPIGRFMARXLPKRKFQ-IGXKEFSLNPGPFNMKEHVLISIFA  121

Query  428  NCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVD  607
            N G   G G AY+I  + I+KA+Y + +SFL   I+V+TTQ++GYGWAG+LRRY+VDP +
Sbjct  122  NAGSGFGSGTAYAISIVDIIKAFYHRKISFLASWILVITTQVLGYGWAGILRRYVVDPAE  181

Query  608  MWWPSNLAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVC  787
            MWWPS+L QVSLFRALHE +  ++ M+R +FF + +  SF ++ +PGYLFP L+  SWVC
Sbjct  182  MWWPSSLVQVSLFRALHEKD--NNRMSRGKFFFIALXCSFAWFVVPGYLFPTLSTISWVC  239

Query  788  WVWP  799
            W++P
Sbjct  240  WIYP  243



>gb|EMS68344.1| Oligopeptide transporter 4 [Triticum urartu]
Length=727

 Score =   283 bits (725),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 131/237 (55%), Positives = 179/237 (76%), Gaps = 3/237 (1%)
 Frame = +2

Query  89   EKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLS  268
            E+        PVE+V L VP TDD +LPV TFR W +G  SC +L FLN FF YR +P+ 
Sbjct  4    ERAGDEDDASPVEQVRLTVPVTDDHSLPVWTFRMWTMGFLSCALLSFLNQFFAYRAEPII  63

Query  269  ISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPG  448
            IS I +Q++ LPIG+F++  LPE+KF  FGR   ++NPGPFN+KEHV+I++ AN G S G
Sbjct  64   ISQITIQVAALPIGRFLSRVLPEKKFRVFGR-ECSVNPGPFNVKEHVLISIFANAGASFG  122

Query  449  GGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNL  628
            GG+AY+IG +TI+KA+YK+ +SF+  L++V+TTQ++GYGWAG++R+Y+V+P  MWWP++L
Sbjct  123  GGNAYAIGIVTIIKAFYKRNISFVTSLLLVITTQVLGYGWAGLMRKYVVEPAHMWWPTSL  182

Query  629  AQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  799
             QVSL RA+HE E +   MTR +FFL+ +  SF +YT+PGYLFP LT  SWVCWV+P
Sbjct  183  VQVSLMRAMHEKEKRR--MTRGKFFLIALICSFAWYTVPGYLFPTLTAVSWVCWVFP  237



>ref|XP_009359568.1| PREDICTED: LOW QUALITY PROTEIN: oligopeptide transporter 7-like 
[Pyrus x bretschneideri]
Length=757

 Score =   284 bits (726),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 131/228 (57%), Positives = 171/228 (75%), Gaps = 5/228 (2%)
 Frame = +2

Query  119  PVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISV  298
            PVE+VAL VP TDDP+LPVLTFR W LG  SC++L FLN FF YRT+PLSI+AI  QI+V
Sbjct  48   PVEQVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLSITAISAQIAV  107

Query  299  LPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIGAI  478
            +P+G+ MA+ +  R F    RW FTLNPGPFN+KEHV+IT+ AN     G G  Y+I  +
Sbjct  108  VPLGQLMASKITNRVFFKGSRWEFTLNPGPFNVKEHVLITIFANS----GAGTVYAIHIV  163

Query  479  TIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFRALH  658
            T++K +YK+ ++F   L+++LTTQ++G+GWAG+ RRYLV+P  MWWP+NL QVSLFRALH
Sbjct  164  TVVKVFYKKHITFFVSLLVILTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALH  223

Query  659  ETEVK-SSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  799
            E E +   G+TR +FFL+    SF YY  PGYLF +LT  SW+CW++P
Sbjct  224  EKEARPKGGLTRTQFFLISFMCSFAYYVFPGYLFQMLTSLSWICWIFP  271



>gb|KDP25233.1| hypothetical protein JCGZ_20389 [Jatropha curcas]
Length=756

 Score =   284 bits (726),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 131/238 (55%), Positives = 176/238 (74%), Gaps = 5/238 (2%)
 Frame = +2

Query  89   EKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLS  268
             K   +    PV++VAL VP TDDP+LPVLTFR W LG  SC++L FLN FF YRT+PLS
Sbjct  35   NKLQETEENSPVKQVALTVPTTDDPSLPVLTFRMWVLGTISCVLLSFLNQFFWYRTEPLS  94

Query  269  ISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPG  448
            I+AI  QI+V+P+G+ MAA + +R F    RW FTLNPGPFN+KEHV+IT+ AN     G
Sbjct  95   ITAISAQIAVVPLGQLMAAKITDRVFLKGTRWEFTLNPGPFNVKEHVLITIFANS----G  150

Query  449  GGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNL  628
             G  Y+I  +T++K +YK+ ++F   LI+++TTQ++G+GWAG+ R+YLV+P  MWWP+NL
Sbjct  151  AGSVYAIHIVTVVKMFYKKHITFFVSLIVIITTQVLGFGWAGIFRKYLVEPAAMWWPANL  210

Query  629  AQVSLFRALHETEVKSS-GMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  799
             QVSLFRALHE E ++  G+TR++FF++    SF YY  PGYLF +LT  SWVCW++P
Sbjct  211  VQVSLFRALHEKEERAKGGVTRIQFFVIAFICSFAYYVFPGYLFQMLTSLSWVCWIFP  268



>gb|EMS65129.1| Oligopeptide transporter 7 [Triticum urartu]
Length=798

 Score =   285 bits (728),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 134/244 (55%), Positives = 170/244 (70%), Gaps = 5/244 (2%)
 Frame = +2

Query  71   NPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIY  250
            +P    +    S    P+E+VAL VP  DDP  PVLTFR W LG+ SC +L FLN FF Y
Sbjct  103  SPERHDDGHGRSSENSPIEQVALTVPVGDDPDTPVLTFRMWVLGMASCAVLSFLNQFFWY  162

Query  251  RTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMAN  430
            R +PL+I+AI  QI+V+P+G+ MAA LPER F    RW FTLNPGPFN+KEHV+IT+ AN
Sbjct  163  RKEPLTITAISAQIAVVPLGRLMAAALPERAFLRGSRWEFTLNPGPFNVKEHVLITIFAN  222

Query  431  CGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDM  610
                 G G  Y+I  +T ++ +Y + L+F   L++VLTTQ++G+GWAG+ RRYLV+P  M
Sbjct  223  A----GAGTVYAIHVVTAVRVFYGKNLTFFVSLLVVLTTQVLGFGWAGIFRRYLVEPAAM  278

Query  611  WWPSNLAQVSLFRALHETE-VKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVC  787
            WWPSNL QVSLFRALHE E  +  G TR +FFL+    SF YY  PGYLF +LT  SW+C
Sbjct  279  WWPSNLVQVSLFRALHEDERRRKGGFTRNQFFLVAFACSFAYYAFPGYLFQMLTSLSWIC  338

Query  788  WVWP  799
            WV+P
Sbjct  339  WVFP  342



>ref|XP_002971556.1| hypothetical protein SELMODRAFT_172313 [Selaginella moellendorffii]
 gb|EFJ27305.1| hypothetical protein SELMODRAFT_172313 [Selaginella moellendorffii]
Length=743

 Score =   283 bits (723),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 135/245 (55%), Positives = 173/245 (71%), Gaps = 2/245 (1%)
 Frame = +2

Query  71   NPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIY  250
             P    E       + PVEEVAL V   DDPTLPV TFR WFLG+ SCI+L FLN FF Y
Sbjct  11   EPLVTREVEPEGDDQSPVEEVALTVDTRDDPTLPVGTFRMWFLGLLSCILLSFLNQFFSY  70

Query  251  RTQPLSISAILMQISVLPIGKFMAATLPERKF-APFGRWSFTLNPGPFNIKEHVIITVMA  427
            RT+P  I  I +QI  LP G+FMA  LPER F  PF   SF+LNPGPFN+KEHV+IT+ A
Sbjct  71   RTEPFIIGLISVQIVALPFGRFMANVLPERSFRVPFTSSSFSLNPGPFNVKEHVLITIFA  130

Query  428  NCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVD  607
            N G   G G AY++G + I +A+YK+++ F  GL++V+TTQ++GYGWAG+++++LV+P  
Sbjct  131  NAGSGFGNGGAYAMGIVNITRAFYKRSMGFTAGLLLVMTTQVLGYGWAGLMKKHLVEPAH  190

Query  608  MWWPSNLAQVSLFRALHETEVKS-SGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWV  784
            MWWP NL QVSLFR LHE + +   G +R +FF +VM  SF YY LPGY+F +LT  SWV
Sbjct  191  MWWPGNLVQVSLFRTLHEEDQQQKKGFSRSQFFAIVMTLSFCYYVLPGYMFMMLTSMSWV  250

Query  785  CWVWP  799
            CW++P
Sbjct  251  CWIFP  255



>ref|XP_009765351.1| PREDICTED: oligopeptide transporter 7-like [Nicotiana sylvestris]
Length=757

 Score =   283 bits (724),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 130/238 (55%), Positives = 175/238 (74%), Gaps = 5/238 (2%)
 Frame = +2

Query  89   EKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLS  268
            ++        P+++VAL VP TDDP+LPVLTFR WFLG  SC++L FLN FF YRT+PL+
Sbjct  36   KQEEDEEENSPIKQVALTVPITDDPSLPVLTFRMWFLGTVSCVLLSFLNQFFWYRTEPLT  95

Query  269  ISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPG  448
            I+AI  QI+V+P+G+ MAA + +R F    +W FTLNPGPFN+KEHV+IT+ AN     G
Sbjct  96   ITAISAQIAVVPLGQLMAAKITKRVFFQGSKWEFTLNPGPFNVKEHVLITIFANS----G  151

Query  449  GGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNL  628
             G  Y+I  +T +K +Y++ ++F   LI+V+TTQ++G+GWAG+ RRYLV+P  MWWP+NL
Sbjct  152  AGTVYAIHVVTAVKVFYQKNITFFVSLIVVITTQVLGFGWAGIFRRYLVEPAAMWWPANL  211

Query  629  AQVSLFRALHETEVKSS-GMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  799
             QVSLFRALHE E +S  G+TR +FFL+    SF YY  PGYLF +LT  SW+CW++P
Sbjct  212  VQVSLFRALHEKEERSKGGLTRTQFFLIAFICSFAYYVFPGYLFSMLTSLSWICWIFP  269



>emb|CDP12213.1| unnamed protein product [Coffea canephora]
Length=763

 Score =   283 bits (724),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 132/230 (57%), Positives = 173/230 (75%), Gaps = 5/230 (2%)
 Frame = +2

Query  113  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  292
              P+ +VAL VP TDDP+LPVLTFR W LG  SCI+L FLN FF YRT+PL+I+AI  Q+
Sbjct  50   NSPIPQVALTVPTTDDPSLPVLTFRMWVLGTLSCILLSFLNQFFWYRTEPLTITAISAQV  109

Query  293  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            +V+P+G+ MAA LP+  F    RW F+LNPGPFN+KEHV+IT+ AN     G G  Y+I 
Sbjct  110  AVVPLGQLMAAKLPKGAFFKGSRWEFSLNPGPFNVKEHVLITIFANS----GAGTVYAIH  165

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFRA  652
             +T++KA+YK+ ++F   LI+VLTTQ++G+GWAG+ RRYLV+P  MWWP+NL QVSLFRA
Sbjct  166  IVTVVKAFYKRHITFFVSLIVVLTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRA  225

Query  653  LHETEVK-SSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  799
            LHE E +   G+TR +FFL+   +SF YY  PGYLF +LT  SW+CW++P
Sbjct  226  LHEKEERPKGGVTRTQFFLIAFISSFAYYVFPGYLFQMLTSLSWLCWIFP  275



>ref|XP_008239235.1| PREDICTED: oligopeptide transporter 7-like [Prunus mume]
Length=759

 Score =   283 bits (724),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 130/230 (57%), Positives = 170/230 (74%), Gaps = 5/230 (2%)
 Frame = +2

Query  113  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  292
              PVE+VAL VP TDDP+LPVLTFR W LG  SC++L FLN FF YRT+PLSI+AI  QI
Sbjct  48   NSPVEQVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLSITAISAQI  107

Query  293  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            +V+P+G+ MA+ +    F    RW FTLNPGPFN+KEHV+IT+ AN     G G  Y+I 
Sbjct  108  AVVPLGQLMASKITTHAFFKGSRWEFTLNPGPFNVKEHVLITIFANS----GAGTVYAIH  163

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFRA  652
             +T++K +YK+ ++F   L+++LTTQ++G+GWAG+ RRYLV+P  MWWP+NL QVSLFRA
Sbjct  164  VVTVVKVFYKKHITFFVSLLVILTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRA  223

Query  653  LHETEVK-SSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  799
            LHE E +   G+TR +FFL+    SF YY  PGYLF +LT  SW+CW++P
Sbjct  224  LHEKEARPKGGLTRTQFFLIAFMCSFAYYVFPGYLFEMLTSLSWICWIFP  273



>ref|XP_009366376.1| PREDICTED: oligopeptide transporter 2-like [Pyrus x bretschneideri]
Length=734

 Score =   282 bits (722),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 136/244 (56%), Positives = 179/244 (73%), Gaps = 7/244 (3%)
 Frame = +2

Query  68   LNPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFI  247
            + PAT  ++   S    PVEEV L V   DDPTLPV TFR W LG+ SC +L FLNTFF 
Sbjct  8    IEPATKHDENDVS----PVEEVRLTVSNDDDPTLPVWTFRMWTLGLASCALLSFLNTFFS  63

Query  248  YRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMA  427
            YRT+PL IS I +Q++ LPIG+FMA  LP+RKF   G   F+LNPGPFN+KEHV+I++ A
Sbjct  64   YRTEPLIISMISVQVATLPIGRFMARALPKRKFQ-IGSKEFSLNPGPFNMKEHVLISIFA  122

Query  428  NCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVD  607
            N G   G G AY+I  + I+KA+Y + +SFL   I+V+TTQ++GYGWAG+LRRY+VDP +
Sbjct  123  NAGSGFGSGTAYAISIVDIIKAFYHRKISFLASWILVITTQVLGYGWAGILRRYVVDPAE  182

Query  608  MWWPSNLAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVC  787
            MWWPS+L QVSLFRALHE +  ++ M+R +FF + +  SF ++ +PGYLFP L+  SWVC
Sbjct  183  MWWPSSLVQVSLFRALHEKD--NNRMSRGKFFFIALICSFAWFVVPGYLFPTLSTISWVC  240

Query  788  WVWP  799
            W++P
Sbjct  241  WIYP  244



>ref|XP_007220230.1| hypothetical protein PRUPE_ppa002014mg [Prunus persica]
 gb|EMJ21429.1| hypothetical protein PRUPE_ppa002014mg [Prunus persica]
Length=729

 Score =   282 bits (722),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 137/248 (55%), Positives = 178/248 (72%), Gaps = 6/248 (2%)
 Frame = +2

Query  59   MSGLNPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNT  238
            M+ ++  T G  +      CP+++V L VP+TDDP +PVLTFR W LG+ SCI+L F+N 
Sbjct  1    MAEIHSGTMGA-SEEENDDCPIKQVELTVPKTDDPNMPVLTFRMWVLGLASCILLSFVNQ  59

Query  239  FFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIIT  418
            FF YRTQPLSI++I  QI+VLPIG  MA TLP R      R+ FT+NPGPFNIKEHV+IT
Sbjct  60   FFWYRTQPLSITSISAQIAVLPIGHLMARTLPTRLIFKGTRFEFTMNPGPFNIKEHVLIT  119

Query  419  VMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVD  598
            + AN     G G  Y+   ++ +K +YK+ L+F+  L+++ TTQ++G+GWAG+ RR LVD
Sbjct  120  IFANS----GAGSVYATHILSAVKLFYKRKLTFIPALLVLFTTQVLGFGWAGIFRRILVD  175

Query  599  PVDMWWPSNLAQVSLFRALHETEVK-SSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFF  775
            PV MWWPSNL QVSLFRALHE E +   GM+R +FFL+VM  SF YY  PGYLF ++T F
Sbjct  176  PVQMWWPSNLVQVSLFRALHEKEKRPKGGMSRTQFFLVVMICSFAYYIFPGYLFIMITSF  235

Query  776  SWVCWVWP  799
            SWVCW+ P
Sbjct  236  SWVCWLAP  243



>ref|XP_002272972.2| PREDICTED: oligopeptide transporter 7 [Vitis vinifera]
Length=749

 Score =   283 bits (723),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 131/237 (55%), Positives = 173/237 (73%), Gaps = 5/237 (2%)
 Frame = +2

Query  92   KTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSI  271
            K  P     P+++VAL VP TDDP+LPVLTFR W LG  SC++L FLN FF YRT+PL+I
Sbjct  29   KPDPDEENSPIKQVALTVPTTDDPSLPVLTFRMWVLGTVSCVLLSFLNQFFWYRTEPLTI  88

Query  272  SAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGG  451
            +AI  QI+V+P+G+ MAA + +R F     W FTLNPGPFN+KEHV+IT+ AN     G 
Sbjct  89   TAISAQIAVVPLGRLMAAKITDRVFFKGTPWEFTLNPGPFNVKEHVLITIFANS----GA  144

Query  452  GDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLA  631
            G  Y+I  +T++K +YK+ +SF   LI+V+TTQ++G+GWAG+ RRYLV+P  MWWP+NL 
Sbjct  145  GTVYAIHVVTVVKVFYKKHISFFVSLIVVITTQVLGFGWAGIFRRYLVEPAAMWWPANLV  204

Query  632  QVSLFRALHETEVK-SSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  799
            QVSLFRALHE E +   G+TR +FFL+    SF YY  PGY+F +LT  SW+CW++P
Sbjct  205  QVSLFRALHEKEERPKGGVTRTQFFLIAFICSFAYYVFPGYMFEMLTSLSWICWIFP  261



>ref|XP_008234693.1| PREDICTED: oligopeptide transporter 6-like [Prunus mume]
Length=729

 Score =   282 bits (721),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 137/248 (55%), Positives = 178/248 (72%), Gaps = 6/248 (2%)
 Frame = +2

Query  59   MSGLNPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNT  238
            M+ ++  T G  +      CP+++V L VP+TDDP +PVLTFR W LG+ SCI+L F+N 
Sbjct  1    MAEIHSGTMGA-SDEENDDCPIKQVELTVPKTDDPNMPVLTFRMWVLGLASCILLSFVNQ  59

Query  239  FFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIIT  418
            FF YRTQPLSI++I  QI+VLPIG  MA TLP R      R+ FT+NPGPFNIKEHV+IT
Sbjct  60   FFWYRTQPLSITSISAQIAVLPIGHLMARTLPTRLIFKGTRFEFTMNPGPFNIKEHVLIT  119

Query  419  VMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVD  598
            + AN     G G  Y+   ++ +K +YK+ L+F+  L+++ TTQ++G+GWAG+ RR LVD
Sbjct  120  IFANS----GAGSVYATHILSAVKLFYKRKLTFIPALLVLFTTQVLGFGWAGIFRRILVD  175

Query  599  PVDMWWPSNLAQVSLFRALHETEVK-SSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFF  775
            PV MWWPSNL QVSLFRALHE E +   GM+R +FFL+VM  SF YY  PGYLF ++T F
Sbjct  176  PVQMWWPSNLVQVSLFRALHEKEKRPKGGMSRTQFFLVVMICSFAYYIFPGYLFVMITSF  235

Query  776  SWVCWVWP  799
            SWVCW+ P
Sbjct  236  SWVCWLAP  243



>ref|XP_007039426.1| Oligopeptide transporter 7 isoform 1 [Theobroma cacao]
 gb|EOY23927.1| Oligopeptide transporter 7 isoform 1 [Theobroma cacao]
Length=762

 Score =   283 bits (723),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 129/230 (56%), Positives = 173/230 (75%), Gaps = 5/230 (2%)
 Frame = +2

Query  113  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  292
              PV +VAL VP TDDP+LPVLTFR W LG  SC++L FLN FF YRT+PL+I+AI  QI
Sbjct  49   NSPVRQVALTVPTTDDPSLPVLTFRMWVLGTISCVLLSFLNQFFWYRTEPLTITAISAQI  108

Query  293  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            +V+P+G+ MAA + +R F    RW F+LNPGPFN+KEHV+IT+ AN     G G  Y+I 
Sbjct  109  AVVPLGQLMAAKITDRVFFKGTRWEFSLNPGPFNVKEHVLITIFANS----GAGSVYAIH  164

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFRA  652
             +T++K +YK+ ++F   LI+++TTQ++G+GWAG+ RRYLV+P  MWWP+NL QVSLFRA
Sbjct  165  VVTVVKVFYKKHITFFVSLIVIITTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRA  224

Query  653  LHETEVKSS-GMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  799
            LHE E ++  G+TR +FFL+ +  SF YY  PGYLF +LT  SW+CW++P
Sbjct  225  LHEKEERAKGGVTRTQFFLIALICSFAYYVFPGYLFQMLTSLSWICWIFP  274



>ref|XP_002437735.1| hypothetical protein SORBIDRAFT_10g001530 [Sorghum bicolor]
 gb|EER89102.1| hypothetical protein SORBIDRAFT_10g001530 [Sorghum bicolor]
Length=785

 Score =   283 bits (724),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 134/240 (56%), Positives = 172/240 (72%), Gaps = 5/240 (2%)
 Frame = +2

Query  83   AGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQP  262
            + + ++  G   P+E+VAL VP  DDPT PVLTFR W LG  SC +L FLN FF YR +P
Sbjct  60   SDDLSSSEGENSPIEQVALTVPVGDDPTTPVLTFRMWVLGTASCALLSFLNQFFWYRKEP  119

Query  263  LSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVS  442
            L+I+AI  QI+V+P+G+ MAA LPER F    RW F+LNPGPFN+KEHV+IT+ AN    
Sbjct  120  LTITAISAQIAVVPLGRLMAAALPERAFLRGTRWEFSLNPGPFNVKEHVLITIFANS---  176

Query  443  PGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPS  622
             G G  Y+I  IT ++ +Y + ++F   L++VLTTQ++G+GWAG+ RRYLV+P  MWWPS
Sbjct  177  -GAGTVYAIHVITAVRVFYGKNITFFVSLLVVLTTQVLGFGWAGIFRRYLVEPAAMWWPS  235

Query  623  NLAQVSLFRALHETEVK-SSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  799
            NL QVSLFRALHE E +   GMTR +FFL+    SF YY  PGYLF +LT  SW+CWV+P
Sbjct  236  NLVQVSLFRALHERERRVKGGMTRNQFFLVAFICSFAYYIFPGYLFQMLTSLSWICWVFP  295



>ref|XP_004245468.1| PREDICTED: oligopeptide transporter 7-like [Solanum lycopersicum]
Length=749

 Score =   282 bits (722),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 132/254 (52%), Positives = 178/254 (70%), Gaps = 10/254 (4%)
 Frame = +2

Query  41   EHIVVEMSGLNPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCII  220
            +H +   S +      E         PVE+VAL VP TDDP+LPVLTFR WFLG  SC++
Sbjct  17   DHGIASSSNVKVHKDDEDE-----NSPVEQVALTVPTTDDPSLPVLTFRMWFLGTVSCVL  71

Query  221  LIFLNTFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIK  400
            L FLN FF YRT+PL+I+AI  QI+V+P+G+ MAA + +R F    +W F+LNPGPFN+K
Sbjct  72   LSFLNQFFWYRTEPLTITAISAQIAVVPLGQLMAAKITKRVFLQGSKWEFSLNPGPFNVK  131

Query  401  EHVIITVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVL  580
            EHV+IT+ AN     G G  Y+I  +T +K +YK+ ++F   LI+++TTQ++G+GWAG+ 
Sbjct  132  EHVLITIFAN----SGAGTVYAIHVVTAVKVFYKKDITFFVSLIVIITTQVLGFGWAGIF  187

Query  581  RRYLVDPVDMWWPSNLAQVSLFRALHETEVK-SSGMTRMRFFLLVMGASFVYYTLPGYLF  757
            R+YLV+P  MWWPSNL QVSLFRALHE E +   G+TR +FF++    SF YY  PGYLF
Sbjct  188  RKYLVEPAAMWWPSNLVQVSLFRALHEKEERCKGGLTRTQFFIVAFICSFAYYIFPGYLF  247

Query  758  PILTFFSWVCWVWP  799
             +LT  SW+CW++P
Sbjct  248  SMLTSLSWICWIFP  261



>ref|XP_002303684.2| hypothetical protein POPTR_0003s14540g [Populus trichocarpa]
 gb|EEE78663.2| hypothetical protein POPTR_0003s14540g [Populus trichocarpa]
Length=800

 Score =   283 bits (724),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 134/247 (54%), Positives = 176/247 (71%), Gaps = 5/247 (2%)
 Frame = +2

Query  62   SGLNPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTF  241
            S     T+    A      PV++VAL VP TDDP+LPVLTFR W LG  SC++L FLN F
Sbjct  70   SSSKSQTSEINQAHDEENSPVKQVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQF  129

Query  242  FIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITV  421
            F YRT+PLSI+AI  QI+V+P+G+ MAA + +R F    R  FTLNPGPFN+KEHV+IT+
Sbjct  130  FWYRTEPLSITAISAQIAVVPLGQLMAAKITDRVFFKGTRCEFTLNPGPFNVKEHVLITI  189

Query  422  MANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDP  601
             AN     G G  Y+I  +T++KA+YK+ ++F    I+++TTQ++G+GWAG+ RRYLV+P
Sbjct  190  FANS----GAGSVYAIHIVTVVKAFYKKNITFFVSFIVIITTQVLGFGWAGIFRRYLVEP  245

Query  602  VDMWWPSNLAQVSLFRALHETEVKSS-GMTRMRFFLLVMGASFVYYTLPGYLFPILTFFS  778
              MWWP+NL QVSLFRALHE E +S  G+TR +FFL+    SF YY  PGYLF +LT  S
Sbjct  246  AAMWWPANLVQVSLFRALHEKEERSKGGVTRTQFFLIAFTCSFAYYVFPGYLFEMLTSLS  305

Query  779  WVCWVWP  799
            W+CW++P
Sbjct  306  WICWIFP  312



>ref|XP_008390299.1| PREDICTED: oligopeptide transporter 7 isoform X1 [Malus domestica]
Length=757

 Score =   281 bits (720),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 130/228 (57%), Positives = 171/228 (75%), Gaps = 5/228 (2%)
 Frame = +2

Query  119  PVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISV  298
            PV++VAL VP TDDP+LPVLTFR W LG  SC++L FLN FF YRT+PLSI+AI  QI+V
Sbjct  48   PVKQVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLSITAISAQIAV  107

Query  299  LPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIGAI  478
            +P+G+ MA+ +  R F    RW FTLNPGPFN+KEHV+IT+ AN     G G  Y+I  +
Sbjct  108  VPLGQLMASKITNRVFFKGSRWEFTLNPGPFNVKEHVLITIFANS----GAGTVYAIHIV  163

Query  479  TIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFRALH  658
            T++K +YK+ ++F   L+++LTTQ++G+GWAG+ RRYLV+P  MWWP+NL QVSLFRALH
Sbjct  164  TVVKVFYKRHITFFVSLLVILTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALH  223

Query  659  ETEVK-SSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  799
            E E +   G+TR +FFL+    SF YY  PGYLF +LT  SW+CW++P
Sbjct  224  EKEARPKGGLTRTQFFLISFMCSFAYYVFPGYLFQMLTSLSWICWIFP  271



>ref|XP_004143945.1| PREDICTED: oligopeptide transporter 7-like [Cucumis sativus]
 gb|KGN49990.1| hypothetical protein Csa_5G148610 [Cucumis sativus]
Length=757

 Score =   281 bits (719),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 130/237 (55%), Positives = 174/237 (73%), Gaps = 5/237 (2%)
 Frame = +2

Query  92   KTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSI  271
            + + S    P+ +VAL VP TDDP+LPVLTFR WFLG  SC++L FLN FF YR +PLSI
Sbjct  39   EISESDENSPIPQVALTVPTTDDPSLPVLTFRMWFLGTLSCVLLSFLNQFFWYRKEPLSI  98

Query  272  SAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGG  451
            +AI  QI+V+P+G+ MA+ + +R F    RW F+LNPGPFN+KEHV+IT+ AN     G 
Sbjct  99   TAISAQIAVVPLGRLMASKITDRVFFKGKRWEFSLNPGPFNVKEHVLITIFANS----GA  154

Query  452  GDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLA  631
            G  Y+I  +T++K +YKQ L+F   LI+V+TTQ++G+GWAG+ R+YLV+P  MWWPSNL 
Sbjct  155  GSVYAIHVVTVVKTFYKQHLTFFVSLIVVVTTQVLGFGWAGIFRKYLVEPAAMWWPSNLV  214

Query  632  QVSLFRALHETEVKSSG-MTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  799
            QVSLFRALHE E +  G ++R +FF++    SF YY +PGYLF +L   SWVCW++P
Sbjct  215  QVSLFRALHEKEERIKGSLSRTQFFVIAFICSFAYYVIPGYLFQMLISLSWVCWIFP  271



>ref|XP_002313213.2| hypothetical protein POPTR_0009s08290g [Populus trichocarpa]
 gb|EEE87168.2| hypothetical protein POPTR_0009s08290g [Populus trichocarpa]
Length=752

 Score =   281 bits (719),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 134/229 (59%), Positives = 173/229 (76%), Gaps = 3/229 (1%)
 Frame = +2

Query  119  PVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISV  298
            P+EEV L V  TDDPTLPV TFR WFLG+ SC +L FLN FF YRT+PL IS I +QI+ 
Sbjct  33   PIEEVRLTVANTDDPTLPVWTFRMWFLGLISCSLLAFLNQFFSYRTEPLIISQITVQIAS  92

Query  299  LPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            LPIG+ MAA LP+ KF    FG  +F+LNPGPFNIKEHV+I++ AN G + G G AY++G
Sbjct  93   LPIGRSMAAVLPKTKFKIPGFGSRTFSLNPGPFNIKEHVLISIFANAGSAFGSGSAYAVG  152

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFRA  652
             +TI+KA+Y +++SFL G +++ TTQ++GYGWAG+LR+Y+V+P  MWWP  L QVSLFRA
Sbjct  153  IVTIIKAFYGRSISFLAGWLLITTTQVLGYGWAGLLRKYVVEPAHMWWPGTLVQVSLFRA  212

Query  653  LHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  799
            LHE +     MTR +FF++ +  SFV+Y  PGYLF  L+  SWVCWV+P
Sbjct  213  LHEKD-DGHRMTRAKFFVIALACSFVWYLFPGYLFTTLSSISWVCWVFP  260



>ref|XP_006397011.1| hypothetical protein EUTSA_v10028453mg [Eutrema salsugineum]
 gb|ESQ38464.1| hypothetical protein EUTSA_v10028453mg [Eutrema salsugineum]
Length=764

 Score =   281 bits (719),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 133/249 (53%), Positives = 177/249 (71%), Gaps = 6/249 (2%)
 Frame = +2

Query  56   EMSGLNPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLN  235
            E  GL    +G+ +       P+ +VAL VP TDDP+LPVLTFR W LG  SCI+L FLN
Sbjct  34   ETEGLCLPISGD-SGEDEENSPIRQVALTVPTTDDPSLPVLTFRMWVLGTLSCILLSFLN  92

Query  236  TFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVII  415
             FF YRT+PL+ISAI  QI+V+P+G+ MAA + +R F    +W FTLNPGPFN+KEHV+I
Sbjct  93   QFFWYRTEPLTISAISAQIAVVPLGRLMAAKISDRVFLQGSKWEFTLNPGPFNVKEHVLI  152

Query  416  TVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  595
            T+ AN     G G  Y+I  +T+++A+Y + L+F    I+++TTQ++G+GWAG+ R+YLV
Sbjct  153  TIFANA----GAGSVYAIHIVTVVRAFYMKNLTFFVSFIVIVTTQVLGFGWAGIFRKYLV  208

Query  596  DPVDMWWPSNLAQVSLFRALHETEVKSS-GMTRMRFFLLVMGASFVYYTLPGYLFPILTF  772
            +P  MWWP+NL QVSLFRALHE E ++  G+TR +FFL+    SF YY  PGYLF ILT 
Sbjct  209  EPAAMWWPANLVQVSLFRALHEKEERTKGGLTRTQFFLIAFVCSFAYYVFPGYLFQILTS  268

Query  773  FSWVCWVWP  799
             SW+CW +P
Sbjct  269  LSWICWFFP  277



>ref|XP_004309550.1| PREDICTED: oligopeptide transporter 7 [Fragaria vesca subsp. 
vesca]
Length=749

 Score =   281 bits (718),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 131/230 (57%), Positives = 170/230 (74%), Gaps = 5/230 (2%)
 Frame = +2

Query  113  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  292
              PV++VAL VP  DDP+LPVLTFR W LG  SC++L FLN FF YRT+PLSI+AI  QI
Sbjct  38   NSPVKQVALTVPTGDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLSITAISAQI  97

Query  293  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            +V+P+G+ MAA +  R F    RW FTLNPGPFN+KEHV+IT+ AN     G G  Y+I 
Sbjct  98   AVVPLGQLMAANITTRVFFKGTRWEFTLNPGPFNVKEHVLITIFANS----GAGTVYAIH  153

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFRA  652
             +T++K +YKQ ++F   L+++LTTQ++G+GWAG+ RRYLV+P  MWWP+NL QVSLFRA
Sbjct  154  IVTVVKVFYKQHITFFVSLLVILTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRA  213

Query  653  LHETEVK-SSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  799
            LHE E +   G+TR +FFL+    SF YY  PGYLF +LT  SW+CW++P
Sbjct  214  LHEREERPKGGVTRTQFFLIAFMCSFAYYVFPGYLFTMLTSLSWICWIFP  263



>ref|XP_010267482.1| PREDICTED: oligopeptide transporter 7-like [Nelumbo nucifera]
Length=766

 Score =   281 bits (719),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 132/228 (58%), Positives = 170/228 (75%), Gaps = 5/228 (2%)
 Frame = +2

Query  119  PVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISV  298
            P+++VAL VP TDD TLPVLTFR W LG  SCI+L FLN FF YRT+PL+I+AI  QI+V
Sbjct  53   PIKQVALTVPTTDDHTLPVLTFRMWVLGTVSCILLSFLNQFFWYRTEPLTITAISAQIAV  112

Query  299  LPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIGAI  478
            +P+G+ MA+ +  R F    RW FTLNPGPFN+KEHV+IT+ AN     G G  Y+I  +
Sbjct  113  VPLGRLMASMITNRVFFKGSRWEFTLNPGPFNVKEHVLITIFANS----GAGTVYAIHIV  168

Query  479  TIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFRALH  658
            T +K +YK+ ++F   LI+V+TTQ++G+GWAG+ RRYLV+P  MWWP+NL QVSLFRALH
Sbjct  169  TAVKIFYKKNITFFVSLIVVITTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRALH  228

Query  659  ETEVK-SSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  799
            E E +   G+TR +FFL+    SF YY  PGYLFP+LT  SWVCW++P
Sbjct  229  EKEERGKGGLTRTQFFLIAFICSFAYYIFPGYLFPMLTSLSWVCWIFP  276



>ref|XP_011022429.1| PREDICTED: oligopeptide transporter 7-like [Populus euphratica]
Length=760

 Score =   281 bits (718),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 133/247 (54%), Positives = 175/247 (71%), Gaps = 5/247 (2%)
 Frame = +2

Query  62   SGLNPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTF  241
            S     T+    A      PV++VAL VP TDDP+LPVLTFR W LG  SC++L FLN F
Sbjct  30   SSSKSQTSEINQAHDEENSPVKQVALTVPTTDDPSLPVLTFRMWVLGTISCVLLSFLNQF  89

Query  242  FIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITV  421
            F YRT+PLSI+AI  QI+V+P+G+ MAA + +R F    R  FTLNPGPFN+KEHV+IT+
Sbjct  90   FWYRTEPLSITAISAQIAVVPLGQLMAAKITDRVFFKGTRCEFTLNPGPFNVKEHVLITI  149

Query  422  MANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDP  601
             AN     G G  Y+I  +T++KA+YK+ ++     I+++TTQ++G+GWAG+ RRYLV+P
Sbjct  150  FAN----SGAGSVYAIHIVTVVKAFYKKNITLFVSFIVIITTQVLGFGWAGIFRRYLVEP  205

Query  602  VDMWWPSNLAQVSLFRALHETEVKSS-GMTRMRFFLLVMGASFVYYTLPGYLFPILTFFS  778
              MWWP+NL QVSLFRALHE E +S  G+TR +FFL+    SF YY  PGYLF +LT  S
Sbjct  206  AAMWWPANLVQVSLFRALHEKEERSKGGVTRTQFFLIAFTCSFAYYVFPGYLFEMLTSLS  265

Query  779  WVCWVWP  799
            W+CW++P
Sbjct  266  WICWIFP  272



>ref|XP_010246854.1| PREDICTED: oligopeptide transporter 7-like [Nelumbo nucifera]
Length=757

 Score =   281 bits (718),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 131/230 (57%), Positives = 171/230 (74%), Gaps = 5/230 (2%)
 Frame = +2

Query  113  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  292
              P+E+VAL VP TDDPTLP+LTFR W LG  +C +L FLN FF YR +PLSI++I  QI
Sbjct  43   NSPIEQVALTVPITDDPTLPILTFRMWVLGTLACALLSFLNQFFWYRKEPLSITSISAQI  102

Query  293  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            +V+P+G  MA+T+ +R F    RW FTLNPGPFNIKEHV+IT+ AN     G G+ Y+I 
Sbjct  103  AVVPLGHLMASTITDRVFFKKSRWEFTLNPGPFNIKEHVLITIFANS----GAGNVYAIH  158

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFRA  652
             ++ +K +YK+ L+FL  L++V+T+Q++G+GWAG+ RRYLV+P  MWWP NL QVSLFRA
Sbjct  159  IVSAVKLFYKKNLTFLVSLLVVITSQVLGFGWAGLFRRYLVEPAAMWWPHNLVQVSLFRA  218

Query  653  LHETEVK-SSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  799
            LHE E K   G+TR +FFL+    SF YY  PGYLFP+LT  SW+CW++P
Sbjct  219  LHEKEQKPKGGLTRNQFFLVAFMCSFAYYVFPGYLFPMLTSLSWICWIFP  268



>ref|XP_009801973.1| PREDICTED: oligopeptide transporter 6-like [Nicotiana sylvestris]
Length=732

 Score =   280 bits (716),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 131/243 (54%), Positives = 173/243 (71%), Gaps = 5/243 (2%)
 Frame = +2

Query  74   PATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYR  253
            P             CP++EV + VP+TDDPT PVLTFR WFLGITSC++L F+N FF YR
Sbjct  5    PVNMAAANEADEDLCPIKEVDMTVPKTDDPTTPVLTFRMWFLGITSCVLLSFVNQFFWYR  64

Query  254  TQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANC  433
            T+PL+IS+  +QI+V+PIG  MA T+ +R F    RW FTLNPGPFNIKEHV+IT+ AN 
Sbjct  65   TEPLTISSTAVQIAVVPIGHLMAKTITKRLFFEGTRWEFTLNPGPFNIKEHVLITIFANA  124

Query  434  GVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMW  613
                G G  Y+   ++ +K YYK+ LSF   L+I+ TTQ++G+GWAG+ R++LV+P +MW
Sbjct  125  ----GAGSVYATHILSAVKLYYKRPLSFFPALLIMATTQMLGFGWAGIFRKHLVEPAEMW  180

Query  614  WPSNLAQVSLFRALHETEVK-SSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCW  790
            WP +L QVSLFRALHE E +   G TR++FFL+ +  SF YY  PGYLF +L+ FSW+CW
Sbjct  181  WPGSLVQVSLFRALHEKETRPKGGTTRIQFFLIALVFSFAYYIFPGYLFQMLSSFSWICW  240

Query  791  VWP  799
            + P
Sbjct  241  LAP  243



>ref|XP_009608843.1| PREDICTED: oligopeptide transporter 7-like [Nicotiana tomentosiformis]
Length=757

 Score =   280 bits (717),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 129/238 (54%), Positives = 174/238 (73%), Gaps = 5/238 (2%)
 Frame = +2

Query  89   EKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLS  268
            ++        P+++VAL VP TDDP+LPVLTFR WFLG  SC++L FLN FF YRT+PL+
Sbjct  36   KQEEDEEENSPIKQVALTVPITDDPSLPVLTFRMWFLGTLSCVLLSFLNQFFWYRTEPLT  95

Query  269  ISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPG  448
            I+AI  QI+V+P+G+ MAA + +R F    +W FTLNPGPFN+KEHV+IT+ AN     G
Sbjct  96   ITAISAQIAVVPLGQLMAAKITKRVFFQGSKWEFTLNPGPFNVKEHVLITIFANS----G  151

Query  449  GGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNL  628
             G  Y+I  +T +K +Y++ ++F   LI+V+TTQ++G+GWAG+ RRYLV+P  MWWP+NL
Sbjct  152  AGTVYAIHVVTAVKVFYQKNITFFVSLIVVITTQVLGFGWAGIFRRYLVEPAAMWWPANL  211

Query  629  AQVSLFRALHETEVK-SSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  799
             QVSLFRALHE E +   G+TR +FFL+    SF YY  PGYLF +LT  SW+CW++P
Sbjct  212  VQVSLFRALHEKEERPKCGLTRTQFFLIAFICSFAYYVFPGYLFSMLTSLSWICWIFP  269



>ref|XP_008437437.1| PREDICTED: LOW QUALITY PROTEIN: oligopeptide transporter 7 [Cucumis 
melo]
Length=752

 Score =   280 bits (717),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 130/237 (55%), Positives = 175/237 (74%), Gaps = 6/237 (3%)
 Frame = +2

Query  92   KTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSI  271
            + + S    P+ +VAL VP +DDP+LPVLTFR WFLG  SC++L FLN FF YR +PLSI
Sbjct  35   EISESDENSPIPQVALTVPTSDDPSLPVLTFRMWFLGTLSCVLLSFLNQFFWYRKEPLSI  94

Query  272  SAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGG  451
            +AI  QI+V+P+G+ MA+ + +R F    RW F+LNPGPFN+KEHV+IT+ AN G     
Sbjct  95   TAISAQIAVVPLGRLMASKITDRVFKG-KRWEFSLNPGPFNVKEHVLITIFANSG----A  149

Query  452  GDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLA  631
            G  Y+I  +T++K +YKQ L+F   LI+V+TTQ++G+GWAG+ R+YLV+P  MWWP+NL 
Sbjct  150  GSVYAIHVVTVVKTFYKQHLTFFVSLIVVVTTQVLGFGWAGIFRKYLVEPAAMWWPANLV  209

Query  632  QVSLFRALHETEVKSSG-MTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  799
            QVSLFRALHE E +S G ++R +FF++    SF YY  PGYLF +LT  SWVCW++P
Sbjct  210  QVSLFRALHEKEERSKGSLSRTQFFVIAFICSFAYYVFPGYLFQMLTSLSWVCWIFP  266



>ref|XP_004163578.1| PREDICTED: oligopeptide transporter 7-like [Cucumis sativus]
Length=835

 Score =   282 bits (721),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 130/237 (55%), Positives = 174/237 (73%), Gaps = 5/237 (2%)
 Frame = +2

Query  92   KTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSI  271
            + + S    P+ +VAL VP TDDP+LPVLTFR WFLG  SC++L FLN FF YR +PLSI
Sbjct  117  EISESDENSPIPQVALTVPTTDDPSLPVLTFRMWFLGTLSCVLLSFLNQFFWYRKEPLSI  176

Query  272  SAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGG  451
            +AI  QI+V+P+G+ MA+ + +R F    RW F+LNPGPFN+KEHV+IT+ AN     G 
Sbjct  177  TAISAQIAVVPLGRLMASKITDRVFFKGKRWEFSLNPGPFNVKEHVLITIFANS----GA  232

Query  452  GDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLA  631
            G  Y+I  +T++K +YKQ L+F   LI+V+TTQ++G+GWAG+ R+YLV+P  MWWPSNL 
Sbjct  233  GSVYAIHVVTVVKTFYKQHLTFFVSLIVVVTTQVLGFGWAGIFRKYLVEPAAMWWPSNLV  292

Query  632  QVSLFRALHETEVKSSG-MTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  799
            QVSLFRALHE E +  G ++R +FF++    SF YY +PGYLF +L   SWVCW++P
Sbjct  293  QVSLFRALHEKEERIKGSLSRTQFFVIAFICSFAYYVIPGYLFQMLISLSWVCWIFP  349



>ref|XP_007210345.1| hypothetical protein PRUPE_ppa001827mg [Prunus persica]
 gb|EMJ11544.1| hypothetical protein PRUPE_ppa001827mg [Prunus persica]
Length=760

 Score =   280 bits (717),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 130/230 (57%), Positives = 169/230 (73%), Gaps = 5/230 (2%)
 Frame = +2

Query  113  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  292
              PVE+VAL VP TDDP+LPVLTFR W LG  SCI+L FLN FF YR +PLSI+AI  QI
Sbjct  49   NSPVEQVALTVPTTDDPSLPVLTFRMWVLGTLSCILLSFLNQFFWYRKEPLSITAISAQI  108

Query  293  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            +V+P+G+ MA+ +    F    RW FTLNPGPFN+KEHV+IT+ AN     G G  Y+I 
Sbjct  109  AVVPLGQLMASKITTHAFFKGSRWEFTLNPGPFNVKEHVLITIFANS----GAGTVYAIH  164

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFRA  652
             +T++K +YK+ ++F   L+++LTTQ++G+GWAG+ RRYLV+P  MWWP+NL QVSLFRA
Sbjct  165  IVTVVKVFYKKHITFFVSLLVILTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRA  224

Query  653  LHETEVK-SSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  799
            LHE E +   G+TR +FFL+    SF YY  PGYLF +LT  SW+CW++P
Sbjct  225  LHEKEARPKGGVTRTQFFLIAFICSFAYYVFPGYLFEMLTSLSWICWIFP  274



>gb|KJB40152.1| hypothetical protein B456_007G049100 [Gossypium raimondii]
Length=623

 Score =   277 bits (709),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 126/230 (55%), Positives = 169/230 (73%), Gaps = 5/230 (2%)
 Frame = +2

Query  113  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  292
             CP+E+VAL VP  DDP+LP LTFR W LG  +C++L FLN FF YR +PLSIS+I  QI
Sbjct  39   NCPIEQVALTVPTADDPSLPTLTFRTWILGTLACLLLSFLNQFFWYRREPLSISSISAQI  98

Query  293  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            +V+P+G  +AAT+ +R F    ++ FTLNPGPFN+KEHV++T+  N     G G+ Y+I 
Sbjct  99   AVVPLGHLLAATVTDRVFFKDRKFEFTLNPGPFNVKEHVLVTIFGNS----GAGNVYAIH  154

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFRA  652
             +T +K +YK+ +SFL  L++V TTQ++G+GWAG+ RRYLV+P  MWWP NL QVSLFRA
Sbjct  155  LVTAVKIFYKKRMSFLVALLVVFTTQVLGFGWAGIFRRYLVEPAAMWWPQNLVQVSLFRA  214

Query  653  LHETEVKSSG-MTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  799
            LHE E ++ G +TR +FFL+    SF YY +PGYL P L+  SW+CWV+P
Sbjct  215  LHEKEERAKGRLTRNQFFLIAFTCSFAYYVIPGYLVPTLSSLSWICWVFP  264



>ref|XP_008239237.1| PREDICTED: oligopeptide transporter 7 [Prunus mume]
Length=760

 Score =   280 bits (717),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 129/230 (56%), Positives = 169/230 (73%), Gaps = 5/230 (2%)
 Frame = +2

Query  113  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  292
              PVE+VAL VP TDDP+LPVLTFR W LG  SC++L FLN FF YR +PLSI+AI  QI
Sbjct  49   NSPVEQVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRKEPLSITAISAQI  108

Query  293  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            +V+P+G+ MA+ +    F    RW FTLNPGPFN+KEHV+IT+ AN     G G  Y+I 
Sbjct  109  AVVPLGQLMASKITTHAFFKGSRWEFTLNPGPFNVKEHVLITIFANS----GAGTVYAIH  164

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFRA  652
             +T++K +YK+ ++F   L+++LTTQ++G+GWAG+ RRYLV+P  MWWP+NL QVSLFRA
Sbjct  165  IVTVVKVFYKKHITFFVSLLVILTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRA  224

Query  653  LHETEVK-SSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  799
            LHE E +   G+TR +FFL+    SF YY  PGYLF +LT  SW+CW++P
Sbjct  225  LHEKEARPKGGLTRTQFFLIAFICSFAYYVFPGYLFEMLTSLSWICWIFP  274



>ref|XP_008394097.1| PREDICTED: oligopeptide transporter 7-like [Malus domestica]
Length=735

 Score =   280 bits (715),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 132/249 (53%), Positives = 178/249 (71%), Gaps = 9/249 (4%)
 Frame = +2

Query  68   LNPATAGEKTA----PSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLN  235
            L P T  + +A    P+    P+E+VAL VP TDDP+LP +TFR W LG  +C++L FLN
Sbjct  13   LIPKTQYDASASSPPPADENSPIEQVALTVPVTDDPSLPTVTFRTWTLGALACVLLSFLN  72

Query  236  TFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVII  415
             FF YR +PLS+++I  QI+V+P+G  MA+ + +R F    +W FTLNPGPFN+KEHV+I
Sbjct  73   QFFWYRREPLSLTSISAQIAVVPLGHLMASLITDRVFFKGRKWEFTLNPGPFNVKEHVLI  132

Query  416  TVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  595
            T+ AN     G G+ Y+I  ++ +K +YK+ LSF   L++VLTTQ++G+GWAG+ RRYLV
Sbjct  133  TIFANS----GAGNVYAIHIVSAVKIFYKKNLSFFVALLVVLTTQVLGFGWAGLFRRYLV  188

Query  596  DPVDMWWPSNLAQVSLFRALHETEVK-SSGMTRMRFFLLVMGASFVYYTLPGYLFPILTF  772
            +P  MWWP NL QVSLFRALHE E +   G+TR +FFL+    SF YY LPGYLFP+LT 
Sbjct  189  EPAAMWWPQNLVQVSLFRALHEKEERPKGGLTRNQFFLIAFTCSFAYYVLPGYLFPMLTS  248

Query  773  FSWVCWVWP  799
             SW+CW++P
Sbjct  249  LSWICWIFP  257



>ref|XP_003581597.1| PREDICTED: oligopeptide transporter 4-like [Brachypodium distachyon]
Length=736

 Score =   279 bits (714),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 133/243 (55%), Positives = 175/243 (72%), Gaps = 7/243 (3%)
 Frame = +2

Query  71   NPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIY  250
            +PA   E    S    PVE+V L VP TDDPTLP+ TFR W +G  SC +L F N FF Y
Sbjct  11   HPAAVDEDDDVS----PVEQVRLTVPVTDDPTLPLWTFRMWTIGFVSCALLSFFNQFFAY  66

Query  251  RTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMAN  430
            RT+P+ IS I +Q++ LPIG FMA  LPERK   FG    +LNPGPFN+KEHV+I++ AN
Sbjct  67   RTEPIIISQITIQVAALPIGHFMARVLPERKLRVFGH-ECSLNPGPFNVKEHVLISIFAN  125

Query  431  CGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDM  610
             G + G G AY++G + I+KA+YK+ +SF   L++++TTQ++GYGWAG+LR+Y+V+P  M
Sbjct  126  AGAAFGSGSAYAVGIVNIVKAFYKRNISFFTSLLLIITTQVLGYGWAGLLRKYVVEPAHM  185

Query  611  WWPSNLAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCW  790
            WWP +L QVSL RA+HE E +   MTR +FFL+ +  SF +YT+PGYLFP LT  SWVCW
Sbjct  186  WWPQSLVQVSLMRAMHEKENRR--MTRGKFFLIALICSFAWYTVPGYLFPTLTAISWVCW  243

Query  791  VWP  799
            V+P
Sbjct  244  VFP  246



>emb|CDX86844.1| BnaA09g22340D [Brassica napus]
Length=765

 Score =   280 bits (716),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 128/228 (56%), Positives = 170/228 (75%), Gaps = 5/228 (2%)
 Frame = +2

Query  119  PVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISV  298
            P+ EVAL VP TDDP+LPVLTFR W LG  SCI+L FLN FF YR +PLSISAI  QI+V
Sbjct  55   PIREVALTVPTTDDPSLPVLTFRMWVLGTLSCILLSFLNQFFWYRREPLSISAISAQIAV  114

Query  299  LPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIGAI  478
            +P+G+ MAA + +R F    +W FTLNPGPFN+KEHV+IT+ AN     G G  Y+I  +
Sbjct  115  VPLGRLMAAKISDRVFLQGSKWEFTLNPGPFNVKEHVLITIFANA----GAGSVYAIHVV  170

Query  479  TIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFRALH  658
            T++KA+Y + ++F    ++++TTQ++G+GWAG+ R+YLV+P +MWWP+NL QVSLFRALH
Sbjct  171  TVVKAFYMKNITFFVSFVVIVTTQVLGFGWAGIFRKYLVEPAEMWWPANLVQVSLFRALH  230

Query  659  ETEVKSS-GMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  799
            E E ++  G+TR +FF++    SF YY  PGYLF +LT  SWVCW +P
Sbjct  231  EKEERTKGGLTRTQFFVIAFVCSFAYYVFPGYLFQMLTSLSWVCWFFP  278



>gb|KHG27803.1| Oligopeptide transporter 7 -like protein [Gossypium arboreum]
Length=753

 Score =   280 bits (715),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 129/229 (56%), Positives = 171/229 (75%), Gaps = 5/229 (2%)
 Frame = +2

Query  116  CPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQIS  295
            CP+E+VAL VP  DDP+LP LTFR W LG  +C++L FLN FF YR +PLSIS+I  QI+
Sbjct  40   CPIEQVALTVPTADDPSLPTLTFRTWILGTLACLLLSFLNQFFWYRREPLSISSISAQIA  99

Query  296  VLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIGA  475
            V+P+G  +AAT+ +R F     + FTLNPGPFN+KEHV++T+ +N     G G+ Y+I  
Sbjct  100  VVPLGHLLAATVTDRVFFKDWNFEFTLNPGPFNVKEHVLVTIFSNS----GAGNVYAIHL  155

Query  476  ITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFRAL  655
            +T +K +YK+ +SFL  L++V TTQ++G+GWAG+ RRYLV+P  MWWP NL QVSLFRAL
Sbjct  156  VTAVKIFYKKRMSFLVALLVVFTTQVLGFGWAGIFRRYLVEPAAMWWPQNLVQVSLFRAL  215

Query  656  HETEVKSSG-MTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  799
            HE E ++ G +TR +FFL+ +  SF YY LPGYLFP LT  SW+CWV+P
Sbjct  216  HEKEERAKGRLTRNQFFLIALTCSFAYYVLPGYLFPTLTSLSWICWVFP  264



>ref|XP_009108224.1| PREDICTED: oligopeptide transporter 7 [Brassica rapa]
Length=765

 Score =   280 bits (715),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 128/228 (56%), Positives = 170/228 (75%), Gaps = 5/228 (2%)
 Frame = +2

Query  119  PVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISV  298
            P+ EVAL VP TDDP+LPVLTFR W LG  SCI+L FLN FF YR +PLSISAI  QI+V
Sbjct  55   PIREVALTVPTTDDPSLPVLTFRMWVLGTLSCILLSFLNQFFWYRREPLSISAISAQIAV  114

Query  299  LPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIGAI  478
            +P+G+ MAA + +R F    +W FTLNPGPFN+KEHV+IT+ AN     G G  Y+I  +
Sbjct  115  VPLGRLMAAKISDRVFLQGSKWEFTLNPGPFNVKEHVLITIFANA----GAGSVYAIHVV  170

Query  479  TIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFRALH  658
            T++KA+Y + ++F    ++++TTQ++G+GWAG+ R+YLV+P +MWWP+NL QVSLFRALH
Sbjct  171  TVVKAFYMKNITFFVSFVVIVTTQVLGFGWAGIFRKYLVEPAEMWWPANLVQVSLFRALH  230

Query  659  ETEVKSS-GMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  799
            E E ++  G+TR +FF++    SF YY  PGYLF +LT  SWVCW +P
Sbjct  231  EKEERTKGGLTRTQFFVIAFVCSFAYYVFPGYLFQMLTSLSWVCWFFP  278



>gb|KJB32169.1| hypothetical protein B456_005G227300 [Gossypium raimondii]
Length=753

 Score =   280 bits (715),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 132/244 (54%), Positives = 176/244 (72%), Gaps = 3/244 (1%)
 Frame = +2

Query  71   NPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIY  250
            +  + G          P+E+V L V  TDDPTLPV TFR WFLG+ SC +L FLN FF Y
Sbjct  19   DATSGGNHDVEDDEISPIEQVRLTVTNTDDPTLPVWTFRMWFLGLFSCALLSFLNQFFSY  78

Query  251  RTQPLSISAILMQISVLPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVM  424
            RT+PL I+ I +Q+S LPIG FMA+ LP+ +F    FG   F+LNPGPFN+KEHV+I + 
Sbjct  79   RTEPLIITQITVQVSTLPIGHFMASVLPKTQFGIPGFGSKRFSLNPGPFNMKEHVLICIF  138

Query  425  ANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPV  604
            AN G + G G AY+IG + I+KA+Y + +SFL G ++++TTQ++GYGWAG+LR+Y+V+P 
Sbjct  139  ANAGSAFGNGSAYAIGIVNIIKAFYGRNISFLAGWLLIITTQVLGYGWAGLLRKYVVEPA  198

Query  605  DMWWPSNLAQVSLFRALHETEVKSS-GMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSW  781
             MWWPS L QVSLFRALHE + K+   MTR +FFL+++  SFV+Y +PGYLF  LT  SW
Sbjct  199  HMWWPSTLVQVSLFRALHEKDDKNDRRMTRAKFFLIILICSFVWYLVPGYLFTTLTSISW  258

Query  782  VCWV  793
            +CW+
Sbjct  259  ICWI  262



>dbj|BAJ87692.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=735

 Score =   279 bits (713),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 131/244 (54%), Positives = 174/244 (71%), Gaps = 8/244 (3%)
 Frame = +2

Query  71   NPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIY  250
            +P   G++ A +     VE+VAL VP  DDP+ PVLTFR W LG  SC+ L FLNTFF Y
Sbjct  43   SPEEVGDREAENSA---VEQVALTVPVGDDPSTPVLTFRMWVLGAASCVALSFLNTFFWY  99

Query  251  RTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMAN  430
            R +PL I+AI  Q++V+P+G+ MAA LPER F    RW FTLNPGPF++KEHV+IT+ AN
Sbjct  100  RKEPLEITAISAQVAVVPLGRLMAAALPERAFFRGRRWEFTLNPGPFSVKEHVLITIFAN  159

Query  431  CGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDM  610
                 G G  ++I  +T ++ +Y + +SFL  L++VLT+Q++G+GWAG+ RRYLV+P  M
Sbjct  160  A----GAGSVFAINLVTAVRVFYGKPISFLVSLLVVLTSQVVGFGWAGIFRRYLVEPAAM  215

Query  611  WWPSNLAQVSLFRALHETE-VKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVC  787
            WWPSNL QVSLFRALHE E  +  G+TR +FF++  G SF YY  PGYL  +LT  SW+C
Sbjct  216  WWPSNLVQVSLFRALHEKERRRKGGLTRTQFFMVAFGCSFAYYIFPGYLLEMLTSISWIC  275

Query  788  WVWP  799
            W++P
Sbjct  276  WIFP  279



>gb|KHG09371.1| Oligopeptide transporter 4 -like protein [Gossypium arboreum]
Length=753

 Score =   279 bits (714),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 131/244 (54%), Positives = 176/244 (72%), Gaps = 3/244 (1%)
 Frame = +2

Query  71   NPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIY  250
            +  + G          P+E+V L V  TDDPTLPV TFR WFLG+ SC +L FLN FF Y
Sbjct  19   DATSGGNHDVEDDEISPIEQVRLTVTNTDDPTLPVWTFRMWFLGLFSCALLSFLNQFFSY  78

Query  251  RTQPLSISAILMQISVLPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVM  424
            RT+PL I+ I +Q+S LPIG FMA+ LP+ +F    FG   F+LNPGPFN+KEHV+I + 
Sbjct  79   RTEPLIITQITVQVSTLPIGHFMASVLPKTQFGIPGFGSKRFSLNPGPFNMKEHVLICIF  138

Query  425  ANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPV  604
            AN G + G G AY++G + I+KA+Y + +SFL G ++++TTQ++GYGWAG+LR+Y+V+P 
Sbjct  139  ANAGSAFGNGSAYAVGIVNIIKAFYGRNISFLAGWLLIITTQVLGYGWAGLLRKYVVEPA  198

Query  605  DMWWPSNLAQVSLFRALHETEVKSS-GMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSW  781
             MWWPS L QVSLFRALHE + K+   MTR +FFL+++  SFV+Y +PGYLF  LT  SW
Sbjct  199  HMWWPSTLVQVSLFRALHEKDDKNDRRMTRAKFFLIILICSFVWYLVPGYLFTTLTSISW  258

Query  782  VCWV  793
            +CW+
Sbjct  259  ICWI  262



>ref|XP_010455470.1| PREDICTED: oligopeptide transporter 7-like [Camelina sativa]
Length=767

 Score =   280 bits (715),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 129/230 (56%), Positives = 170/230 (74%), Gaps = 5/230 (2%)
 Frame = +2

Query  113  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  292
              P+ +VAL VP TDDP+LPVLTFR W LG  SCI+L FLN FF YRT+PL+ISAI  QI
Sbjct  55   NSPIRQVALTVPTTDDPSLPVLTFRMWVLGTLSCILLSFLNQFFWYRTEPLTISAISAQI  114

Query  293  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            +V+P+G+ MAA + ER +    +W FTLNPGPFN+KEHV+IT+ AN     G G  Y+I 
Sbjct  115  AVVPLGRLMAAKISERVYFQGSKWQFTLNPGPFNVKEHVLITIFANA----GAGSVYAIH  170

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFRA  652
             +T++KA+Y + ++F    I+++TTQ++G+GWAG+ R+YLV+P  MWWP+NL QVSLFRA
Sbjct  171  VVTVVKAFYMKNITFFVSFIVIVTTQVLGFGWAGIFRKYLVEPAAMWWPANLVQVSLFRA  230

Query  653  LHETEVKSS-GMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  799
            LHE E ++  G+TR +FFL+    SF YY  PGYLF I+T  SWVCW +P
Sbjct  231  LHEKEERTKGGLTRTQFFLIAFVCSFAYYVFPGYLFQIMTSLSWVCWFFP  280



>ref|XP_006289826.1| hypothetical protein CARUB_v10003431mg [Capsella rubella]
 gb|EOA22724.1| hypothetical protein CARUB_v10003431mg [Capsella rubella]
Length=766

 Score =   280 bits (715),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 129/230 (56%), Positives = 170/230 (74%), Gaps = 5/230 (2%)
 Frame = +2

Query  113  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  292
              P+ +VAL VP TDDP+LPVLTFR W LG  SCI+L FLN FF YRT+PL+ISAI  QI
Sbjct  54   NSPIRQVALTVPTTDDPSLPVLTFRMWVLGTLSCILLSFLNQFFWYRTEPLTISAISAQI  113

Query  293  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            +V+P+G+ MAA + ER +    +W FTLNPGPFN+KEHV+IT+ AN     G G  Y+I 
Sbjct  114  AVVPLGRLMAAKISERVYFQGSKWQFTLNPGPFNVKEHVLITIFANA----GAGSVYAIH  169

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFRA  652
             +T++KA+Y + ++F    I+++TTQ++G+GWAG+ R+YLV+P  MWWP+NL QVSLFRA
Sbjct  170  VVTVVKAFYMKNITFFVSFIVIVTTQVLGFGWAGIFRKYLVEPAAMWWPANLVQVSLFRA  229

Query  653  LHETEVKSS-GMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  799
            LHE E ++  G+TR +FFL+    SF YY  PGYLF I+T  SWVCW +P
Sbjct  230  LHEKEERTKGGLTRTQFFLIAFICSFAYYVFPGYLFQIMTSLSWVCWFFP  279



>ref|XP_002263530.1| PREDICTED: oligopeptide transporter 4 [Vitis vinifera]
Length=744

 Score =   279 bits (713),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 134/243 (55%), Positives = 181/243 (74%), Gaps = 8/243 (3%)
 Frame = +2

Query  77   ATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRT  256
            AT G++   S    P+EEV L V  TDDP+LPV TFR WF+G+ SC +L FL+ FF YRT
Sbjct  19   ATDGDEDELS----PIEEVRLTVTNTDDPSLPVWTFRMWFMGLFSCALLSFLDQFFAYRT  74

Query  257  QPLSISAILMQISVLPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVMAN  430
            +PL I+ I +Q++ LPIG FMAA LP  +F    FG  SF+LNPGPFN+KEHV+I++ AN
Sbjct  75   EPLIITQITVQVATLPIGHFMAAVLPTTRFRIPGFGSRSFSLNPGPFNMKEHVLISIFAN  134

Query  431  CGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDM  610
             G + G G AY++G +TI+KA+Y++ +SFL G ++++TTQ++GYGWAG+LR+Y+V+P  M
Sbjct  135  AGSAFGSGSAYAVGIVTIIKAFYQRKISFLSGWLLIITTQVLGYGWAGLLRKYVVEPAHM  194

Query  611  WWPSNLAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCW  790
            WWPS+L QVSLFRALHE E +   MTR +FF++ +  SF +Y +PGYLF  LT  SWVCW
Sbjct  195  WWPSSLVQVSLFRALHEKEEQR--MTRAKFFVIALICSFSWYLIPGYLFSTLTSISWVCW  252

Query  791  VWP  799
             +P
Sbjct  253  AFP  255



>ref|XP_011003045.1| PREDICTED: oligopeptide transporter 4 [Populus euphratica]
Length=749

 Score =   279 bits (714),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 132/229 (58%), Positives = 172/229 (75%), Gaps = 3/229 (1%)
 Frame = +2

Query  119  PVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISV  298
            P+EEV L V  TDDPTLP+ TFR WFLG+ SC +L FLN FF YRT+PL IS I +Q++ 
Sbjct  33   PIEEVRLTVANTDDPTLPIWTFRMWFLGLISCSLLAFLNQFFSYRTEPLIISQITVQVAS  92

Query  299  LPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            LPIG+ MAA LP+ KF    FG  +F+LNPGPFNIKEHV+I++ AN G + G G AY++G
Sbjct  93   LPIGRSMAAVLPKTKFKIPGFGSRTFSLNPGPFNIKEHVLISIFANAGSAFGSGSAYAVG  152

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFRA  652
             +TI+KA+Y + +SFL G +++ TTQ++GYGWAG+LR+Y+V+P  MWWP  L QVSLFRA
Sbjct  153  IVTIIKAFYGRRISFLAGWLLITTTQVLGYGWAGLLRKYVVEPAHMWWPGTLVQVSLFRA  212

Query  653  LHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  799
            LHE +     MTR +FF++ +  SFV+Y  PGYLF  L+  SWVCWV+P
Sbjct  213  LHEKD-DGHRMTRAKFFVIALACSFVWYLFPGYLFTTLSSISWVCWVFP  260



>gb|EEC79904.1| hypothetical protein OsI_21444 [Oryza sativa Indica Group]
 gb|EEE65007.1| hypothetical protein OsJ_19952 [Oryza sativa Japonica Group]
Length=758

 Score =   279 bits (714),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 136/246 (55%), Positives = 173/246 (70%), Gaps = 6/246 (2%)
 Frame = +2

Query  68   LNPATA-GEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFF  244
            L P+T+ G          P+E+VAL VP +D+P  PVLTFR W LG  SC +L FLN FF
Sbjct  27   LRPSTSRGSPELEEEENSPIEQVALTVPVSDEPETPVLTFRMWVLGTASCAVLSFLNQFF  86

Query  245  IYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVM  424
             YR +PL+I+AI  QI+V+P+G+ MAA LPER F     W FTLNPGPFN+KEHV+IT+ 
Sbjct  87   WYRKEPLTITAISAQIAVVPLGRLMAAALPERAFFRGRPWEFTLNPGPFNVKEHVLITIF  146

Query  425  ANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPV  604
            AN     G G  Y+I  IT ++ +Y + +SF   L++VLTTQ++G+GWAG+ RRYLV+P 
Sbjct  147  ANS----GAGTVYAIHVITAVRVFYGKHISFFVSLLVVLTTQVLGFGWAGIFRRYLVEPA  202

Query  605  DMWWPSNLAQVSLFRALHETEVKSS-GMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSW  781
             MWWPSNL QVSLFRALHE E +S  G+TR +FFL+    SF YY  PGYLF +LT  SW
Sbjct  203  AMWWPSNLVQVSLFRALHEKEARSKGGLTRNQFFLVAFICSFAYYIFPGYLFQMLTSLSW  262

Query  782  VCWVWP  799
            +CWV+P
Sbjct  263  ICWVFP  268



>gb|KDO76688.1| hypothetical protein CISIN_1g010747mg [Citrus sinensis]
Length=424

 Score =   270 bits (691),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 128/238 (54%), Positives = 166/238 (70%), Gaps = 5/238 (2%)
 Frame = +2

Query  89   EKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLS  268
            E         PV++VAL V   DD  LPVLTFR W LG  SC++L FLN FF YRT+PLS
Sbjct  43   EAVVEEEENSPVKQVALTVSTEDDTCLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLS  102

Query  269  ISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPG  448
            I+AI  QI+V+P+G+ MAA L +R F       FTLNPGPFN+KEHV+IT+ AN     G
Sbjct  103  ITAISAQIAVVPLGQLMAAKLTDRVFFKSTPLEFTLNPGPFNVKEHVLITIFANS----G  158

Query  449  GGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNL  628
             G  Y+I  +T++K +YKQ  +F   L++V TTQ++G+GWAG+ RRYLV+P  MWWP+NL
Sbjct  159  AGSVYAIHIVTVVKVFYKQHFTFFVSLLVVFTTQVLGFGWAGIFRRYLVEPAAMWWPANL  218

Query  629  AQVSLFRALHETEVKSS-GMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  799
             QVSLFRALHE E ++S G+TR +FF++    SF YY  PGYL  +LT  SW+CW++P
Sbjct  219  VQVSLFRALHEREKRASGGVTRTQFFMMGFVCSFAYYVFPGYLLEMLTSLSWICWIFP  276



>ref|XP_002283691.1| PREDICTED: oligopeptide transporter 2 [Vitis vinifera]
Length=740

 Score =   278 bits (712),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 131/229 (57%), Positives = 174/229 (76%), Gaps = 4/229 (2%)
 Frame = +2

Query  119  PVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISV  298
            P+EEV L VP TDDP+LPV TFR WFLG+ SC++L FLNTFF YRT+PL I+ I +Q++ 
Sbjct  25   PIEEVRLTVPTTDDPSLPVWTFRMWFLGLISCVLLSFLNTFFGYRTEPLVITMISVQVAT  84

Query  299  LPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            LP+G+FMA  LP+ KF    FG   ++LNPGPFN+KEHV+I++ AN G + G G AY+I 
Sbjct  85   LPVGRFMAKVLPKTKFRVPGFGSREYSLNPGPFNVKEHVLISIFANAGAAFGSGTAYAIS  144

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFRA  652
             + I+KA+Y + +SF    I+V+TTQ++GYGWAG+LR+++VDP +MWWPS+L QVSLF A
Sbjct  145  IVDIIKAFYHREISFSACWILVITTQVLGYGWAGILRKFVVDPAEMWWPSSLTQVSLFSA  204

Query  653  LHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  799
            LHE + K   MTR +FFL+ +  SF +Y +PGYLFP L   SWVCWV+P
Sbjct  205  LHEKDKKR--MTRAKFFLIALICSFSWYVVPGYLFPTLGTISWVCWVFP  251



>ref|XP_010252553.1| PREDICTED: oligopeptide transporter 7-like [Nelumbo nucifera]
Length=731

 Score =   278 bits (712),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 131/248 (53%), Positives = 180/248 (73%), Gaps = 7/248 (3%)
 Frame = +2

Query  59   MSGLNPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNT  238
            M+G   + A E  +P      +++VAL VP TDDP  PVLTFR W LGI SC++L FLN 
Sbjct  1    MAGNTTSPAVE--SPESENSSIKQVALTVPTTDDPNQPVLTFRMWVLGIVSCVLLSFLNQ  58

Query  239  FFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIIT  418
            FF YRT+P+SI+ +  QI+V+P+G  MA+T+ +R F    RW F++NPGPFN+KEHV+IT
Sbjct  59   FFWYRTEPISITGLSAQIAVVPLGHLMASTVTKRVFFKGTRWEFSMNPGPFNVKEHVLIT  118

Query  419  VMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVD  598
            + AN     G G  Y+   ++ +K +YK+ L+F+  L+++LTTQ++G+GWAG+ RRYLV+
Sbjct  119  IFANA----GAGTVYATHILSAVKLFYKRKLTFIPALLVILTTQMLGFGWAGLFRRYLVE  174

Query  599  PVDMWWPSNLAQVSLFRALHETEVK-SSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFF  775
            P +MWWP+NL QVSLFRALHE E +   G+TR +FFL+V+  SF YY  PGYLFP+LT  
Sbjct  175  PAEMWWPNNLVQVSLFRALHEKEKRPKGGVTRTQFFLMVLVCSFAYYVFPGYLFPMLTSL  234

Query  776  SWVCWVWP  799
            SWVCW++P
Sbjct  235  SWVCWIFP  242



>ref|XP_011016978.1| PREDICTED: oligopeptide transporter 2 [Populus euphratica]
Length=738

 Score =   278 bits (712),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 140/255 (55%), Positives = 179/255 (70%), Gaps = 9/255 (4%)
 Frame = +2

Query  41   EHIVVEMSGLNPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCII  220
            + + +E    NP    E      G  P+EEV L VP  DD TLPV TFR WFLGI SCII
Sbjct  2    DSLEIEGKPQNP-NMNENIEEDDGVSPIEEVRLTVPTRDDHTLPVWTFRMWFLGIASCII  60

Query  221  LIFLNTFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFA--PFGRWSFTLNPGPFN  394
            L FLNTFF YRT+PL+IS I +Q+  LP+G+FMA TLP  KF    FG   F+LNPGPFN
Sbjct  61   LSFLNTFFSYRTEPLTISMISVQVVTLPVGRFMAKTLPTTKFRVPGFGGREFSLNPGPFN  120

Query  395  IKEHVIITVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAG  574
            +KEHV+I++ AN G S     AY++G I I+ A+YK+ +SFL   I+VLTTQ++GYGWAG
Sbjct  121  VKEHVLISIFANVGSS----TAYAVGIIDIIMAFYKRKISFLASWILVLTTQMLGYGWAG  176

Query  575  VLRRYLVDPVDMWWPSNLAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYL  754
            ++R+Y+VDP +MWWP +L QVSLFRALHE +  +S M+R +FFL+ +  SF +Y  PGYL
Sbjct  177  IMRKYVVDPAEMWWPLSLMQVSLFRALHEKD--NSRMSRGKFFLVALICSFSWYVFPGYL  234

Query  755  FPILTFFSWVCWVWP  799
            FP +   SWVCW +P
Sbjct  235  FPAIGTISWVCWAFP  249



>ref|NP_001056665.1| Os06g0127700 [Oryza sativa Japonica Group]
 dbj|BAD67748.1| putative isp4 protein [Oryza sativa Japonica Group]
 dbj|BAD67928.1| putative isp4 protein [Oryza sativa Japonica Group]
 dbj|BAF18579.1| Os06g0127700 [Oryza sativa Japonica Group]
 gb|EEC79910.1| hypothetical protein OsI_21457 [Oryza sativa Indica Group]
 gb|EEE65014.1| hypothetical protein OsJ_19965 [Oryza sativa Japonica Group]
Length=760

 Score =   279 bits (713),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 132/230 (57%), Positives = 168/230 (73%), Gaps = 5/230 (2%)
 Frame = +2

Query  113  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  292
              PVE+VAL VP  DDP  PVLTFR W LG  SC++L FLNTFF YR +PL+++AI  QI
Sbjct  44   NSPVEQVALTVPVGDDPATPVLTFRIWVLGTASCVVLSFLNTFFWYRKEPLTVTAISAQI  103

Query  293  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            +V+P+G+ MAA LPER F     W FTLNPGPFN+KEHV+IT+ AN     G G  ++I 
Sbjct  104  AVVPLGRLMAAALPERVFFRGRPWEFTLNPGPFNVKEHVLITIFANA----GAGSVFAIN  159

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFRA  652
             IT ++ +Y + +SF   L++VLT+Q++G+GWAG+ RRYLV+P  MWWPSNL QVSLFRA
Sbjct  160  VITAVRVFYGKRISFFVSLLVVLTSQVLGFGWAGIFRRYLVEPAAMWWPSNLVQVSLFRA  219

Query  653  LHETEVKSS-GMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  799
            LHE E +S  GMTR +FFL+    SF YY  PGYLF +LT  SW+CW++P
Sbjct  220  LHEKERRSKGGMTRTQFFLVAFVCSFAYYIFPGYLFQMLTSLSWICWIFP  269



>ref|XP_011087976.1| PREDICTED: oligopeptide transporter 4 [Sesamum indicum]
Length=744

 Score =   278 bits (712),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 130/226 (58%), Positives = 172/226 (76%), Gaps = 3/226 (1%)
 Frame = +2

Query  113  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  292
              P+EEV L V  TDDPTLPV TFR WFLG+ SC +L FLN FF YRT+PL I+ I +Q+
Sbjct  30   ESPIEEVRLTVTNTDDPTLPVWTFRMWFLGLLSCALLSFLNQFFAYRTEPLLITQITVQV  89

Query  293  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            + LPIG F+AA LPE KF  FG   F+LNPGPFN+KEHV+I++ AN G + G G AY++G
Sbjct  90   ATLPIGHFLAAVLPETKFR-FGGRVFSLNPGPFNMKEHVLISIFANAGSAFGNGSAYAVG  148

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFRA  652
             +TI+KA+Y++ +SFL G ++++TTQ++GYGWAG+LR+Y+++P  MWWP  L QVSLFRA
Sbjct  149  IVTIVKAFYRRNISFLAGWLLIITTQVLGYGWAGLLRKYVIEPAHMWWPGTLVQVSLFRA  208

Query  653  LHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCW  790
            LHE + +   M+R +FFL+ +  SF +Y +PGYLFP LT  SWVCW
Sbjct  209  LHEKDDQR--MSRAKFFLIALICSFSWYLVPGYLFPTLTSISWVCW  252



>emb|CDY19030.1| BnaC01g20380D [Brassica napus]
Length=735

 Score =   278 bits (711),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 134/230 (58%), Positives = 172/230 (75%), Gaps = 5/230 (2%)
 Frame = +2

Query  113  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  292
            RC V EV L VP+TDDP+LPVLTFR WFLGI++CI+L F+N FF YRT PLSI+ I  QI
Sbjct  17   RCVVPEVELTVPKTDDPSLPVLTFRMWFLGISACIVLSFINQFFWYRTMPLSITGISAQI  76

Query  293  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            +V+P+G  MA  LP R+F    R+ FTLNPG FN+KEHV+IT+ AN     G G  Y+  
Sbjct  77   AVVPLGHLMARVLPSRRFLEGTRFQFTLNPGAFNVKEHVLITIFANS----GAGSVYATH  132

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFRA  652
             ++ +K YYK++L FL   ++++TTQ++G+GWAG+ R++LV+P +MWWPSNL QVSLF A
Sbjct  133  ILSAIKLYYKRSLPFLPAFLVMITTQILGFGWAGLFRKHLVEPGEMWWPSNLVQVSLFGA  192

Query  653  LHETEVKSSG-MTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  799
            LHE E KS G M+R +FFL+V+ ASF YY LPGYLF +LT  SWVCW  P
Sbjct  193  LHEKEKKSKGHMSRTQFFLIVLVASFAYYILPGYLFTMLTSISWVCWFNP  242



>ref|XP_006851891.1| hypothetical protein AMTR_s00041p00133990 [Amborella trichopoda]
 gb|ERN13358.1| hypothetical protein AMTR_s00041p00133990 [Amborella trichopoda]
Length=800

 Score =   280 bits (715),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 130/248 (52%), Positives = 177/248 (71%), Gaps = 5/248 (2%)
 Frame = +2

Query  59   MSGLNPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNT  238
            M   + +T  E+   S    P+E+VAL VP TDDP+LPV+TFR WFLG  SC+I+ FLN 
Sbjct  68   MDKPSSSTTTEEPNTSPENSPIEQVALTVPVTDDPSLPVITFRMWFLGCLSCVIISFLNQ  127

Query  239  FFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIIT  418
            FF +RT+PL+I+++  QI+V+P+G  MAA LP R F    RW FTLNPGPFN+KEHV+IT
Sbjct  128  FFWFRTEPLTITSVSAQIAVVPLGHLMAAVLPTRPFFKGKRWEFTLNPGPFNVKEHVLIT  187

Query  419  VMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVD  598
            + AN     G G  ++I  ++ +K +YK+ LSF    ++V+TTQ++G+GWAG+ R+YLV+
Sbjct  188  IFANS----GAGSVFAIHIVSSVKVFYKETLSFFVAFLVVITTQVMGFGWAGMFRKYLVE  243

Query  599  PVDMWWPSNLAQVSLFRALHETEVK-SSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFF  775
            P  MWWP NL QVS+F ALHE E +    +TR +FFL+ +  SF YY LPGYLFP+LT  
Sbjct  244  PAAMWWPYNLVQVSIFGALHEKEERPKESLTRNQFFLVALICSFAYYALPGYLFPMLTSL  303

Query  776  SWVCWVWP  799
            SW+CW++P
Sbjct  304  SWICWIFP  311



>ref|XP_010537060.1| PREDICTED: oligopeptide transporter 6-like [Tarenaya hassleriana]
Length=742

 Score =   278 bits (712),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 138/255 (54%), Positives = 180/255 (71%), Gaps = 14/255 (5%)
 Frame = +2

Query  38   SEHIVVEMSGLNPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCI  217
            +E I +E+ G      GE       RC VE+V L VP+TDDPT+PVLTFR W LG+ +CI
Sbjct  7    AEAIAMEIDG-----DGEDE----DRCVVEQVELTVPKTDDPTIPVLTFRMWVLGLGACI  57

Query  218  ILIFLNTFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNI  397
            +L F+N FF YRT PLSIS I  QI+V+P+G  MA  LP  K+    RW F+LNPGPFN+
Sbjct  58   VLSFVNQFFWYRTMPLSISGISAQIAVVPLGHLMARILPTSKYLEGTRWEFSLNPGPFNV  117

Query  398  KEHVIITVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGV  577
            KEHV+IT+ AN     G G  Y+   ++ +K YYK+AL FL   ++++TTQ++G+GWAG+
Sbjct  118  KEHVLITIFANS----GAGSVYATHILSAIKLYYKRALPFLPAFLVMITTQVLGFGWAGL  173

Query  578  LRRYLVDPVDMWWPSNLAQVSLFRALHETEVKS-SGMTRMRFFLLVMGASFVYYTLPGYL  754
             R++LV+P +MWWPSNL QVSLF ALHE E ++  G TR +FFL+V+ ASF YY LPGYL
Sbjct  174  FRKHLVEPGEMWWPSNLVQVSLFSALHEKEKRTRGGTTRTQFFLVVLVASFAYYVLPGYL  233

Query  755  FPILTFFSWVCWVWP  799
            F +LT  SWVCW+ P
Sbjct  234  FTMLTSISWVCWLGP  248



>gb|KDO76687.1| hypothetical protein CISIN_1g010747mg [Citrus sinensis]
Length=417

 Score =   270 bits (689),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 128/238 (54%), Positives = 166/238 (70%), Gaps = 5/238 (2%)
 Frame = +2

Query  89   EKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLS  268
            E         PV++VAL V   DD  LPVLTFR W LG  SC++L FLN FF YRT+PLS
Sbjct  43   EAVVEEEENSPVKQVALTVSTEDDTCLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLS  102

Query  269  ISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPG  448
            I+AI  QI+V+P+G+ MAA L +R F       FTLNPGPFN+KEHV+IT+ AN     G
Sbjct  103  ITAISAQIAVVPLGQLMAAKLTDRVFFKSTPLEFTLNPGPFNVKEHVLITIFANS----G  158

Query  449  GGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNL  628
             G  Y+I  +T++K +YKQ  +F   L++V TTQ++G+GWAG+ RRYLV+P  MWWP+NL
Sbjct  159  AGSVYAIHIVTVVKVFYKQHFTFFVSLLVVFTTQVLGFGWAGIFRRYLVEPAAMWWPANL  218

Query  629  AQVSLFRALHETEVKSS-GMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  799
             QVSLFRALHE E ++S G+TR +FF++    SF YY  PGYL  +LT  SW+CW++P
Sbjct  219  VQVSLFRALHEREKRASGGVTRTQFFMMGFVCSFAYYVFPGYLLEMLTSLSWICWIFP  276



>ref|XP_004309115.1| PREDICTED: oligopeptide transporter 6-like [Fragaria vesca subsp. 
vesca]
 ref|XP_011470202.1| PREDICTED: oligopeptide transporter 6-like [Fragaria vesca subsp. 
vesca]
Length=728

 Score =   278 bits (710),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 135/233 (58%), Positives = 168/233 (72%), Gaps = 5/233 (2%)
 Frame = +2

Query  104  SGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAIL  283
               RC +E+V L VP+TDDPTLPVLTFR W LG+ SCI+L F+N FF YRTQPL+ISAI 
Sbjct  14   EDDRCLIEQVELTVPKTDDPTLPVLTFRMWVLGLVSCILLSFVNQFFWYRTQPLTISAIS  73

Query  284  MQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAY  463
             QI+V+P+G FMA  LP R F    +  FT+NPGPFN+KEHV+IT+ ANC    G G  Y
Sbjct  74   AQIAVVPLGHFMARVLPTRSFFQGTQLEFTMNPGPFNVKEHVLITIFANC----GAGTVY  129

Query  464  SIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSL  643
            +   +T +K  YK+ L+FL   I++LTTQ++G+GWAG+ R+YLV+P  MWWP NL QVSL
Sbjct  130  ASHILTAVKLLYKRKLTFLPAFIVMLTTQVLGFGWAGIFRKYLVEPEKMWWPGNLVQVSL  189

Query  644  FRALHETEVKSSG-MTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  799
            F ALHE   +  G MTR +FFL+VM ASF YY  PGYL  +LT  SWVCW+ P
Sbjct  190  FSALHEKSKRPKGSMTRTQFFLVVMIASFAYYIFPGYLLIMLTTISWVCWIRP  242



>emb|CDY14374.1| BnaA10g06810D [Brassica napus]
Length=709

 Score =   277 bits (709),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 131/238 (55%), Positives = 171/238 (72%), Gaps = 5/238 (2%)
 Frame = +2

Query  89   EKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLS  268
            E+      RC VEEV L VP+TDDPTLPVLTFR W LG+ +CIIL F+N FF YR  PL+
Sbjct  15   EEAVDELDRCAVEEVELTVPKTDDPTLPVLTFRMWVLGLAACIILSFVNQFFWYRQMPLT  74

Query  269  ISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPG  448
            I+ I  QI+V+P+G  MA  LP +K+    RW F +NPGPFNIKEHV+IT+ AN     G
Sbjct  75   ITGISAQIAVVPLGHLMARVLPNKKYLEGSRWEFNMNPGPFNIKEHVMITIFANS----G  130

Query  449  GGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNL  628
             G  Y+   ++ +K YYK++L FL   +I++TTQ +G+GWAG+ R++LV+P +MWWPSNL
Sbjct  131  AGTVYATHILSAIKLYYKRSLPFLPAFLIMITTQFLGFGWAGLFRKHLVEPGEMWWPSNL  190

Query  629  AQVSLFRALHETEVKSS-GMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  799
             QVSLF ALHE E K+  GMTR++FF++V+  SF YY LPGYLF ++   SWVCW+ P
Sbjct  191  VQVSLFSALHEKEKKTKGGMTRIQFFIIVLVTSFAYYILPGYLFTMIPSISWVCWLSP  248



>ref|XP_006376657.1| hypothetical protein POPTR_0012s02650g [Populus trichocarpa]
 gb|ERP54454.1| hypothetical protein POPTR_0012s02650g [Populus trichocarpa]
Length=732

 Score =   278 bits (710),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 130/228 (57%), Positives = 172/228 (75%), Gaps = 5/228 (2%)
 Frame = +2

Query  113  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  292
             C +++V L VP+TDDPT+PVLTFR W LG+ SCIIL F+N FF YR+QPL++++I  QI
Sbjct  18   ECSIKQVDLTVPKTDDPTMPVLTFRMWVLGLGSCIILSFVNQFFWYRSQPLTVTSISAQI  77

Query  293  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            +V+P+G  MA  L  RKF    RW FTLNPGPFNIKEHV+IT+ AN     G G  Y+  
Sbjct  78   AVVPLGHLMAKKLSTRKFFEGTRWEFTLNPGPFNIKEHVLITIFANS----GAGTVYAAH  133

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFRA  652
             +T +K YY++ L+F+  L I++TTQ++G+GWAG+ R+YLV+P +MWWPSNL QVSLFRA
Sbjct  134  ILTSVKIYYQRKLTFIPALFIMITTQMLGFGWAGIFRKYLVEPGEMWWPSNLVQVSLFRA  193

Query  653  LHETEVK-SSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWV  793
            LHE E +   G TR ++FLLVM ++F YY LPGYLF +L+ FSW+CW+
Sbjct  194  LHEREKRPKGGTTRTQYFLLVMISAFAYYILPGYLFTMLSSFSWICWL  241



>emb|CAN79818.1| hypothetical protein VITISV_040328 [Vitis vinifera]
Length=701

 Score =   277 bits (708),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 143/262 (55%), Positives = 183/262 (70%), Gaps = 16/262 (6%)
 Frame = +2

Query  17   TVPAQ*LSEHIVVEMSGLNPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWF  196
            T P     +H+ +E      AT  E+       CP+E+V L VP TDDPT PVLTFR W 
Sbjct  9    TQPKPQEQQHLDIE------ATGDEEV----NDCPIEQVRLTVPITDDPTEPVLTFRTWV  58

Query  197  LGITSCIILIFLNTFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFA-PFGRWSFT  373
            LG+ SC+IL F+N FF YR+  LSIS++  QI  LP+GKFMAATLPE+    P  +WSF+
Sbjct  59   LGVASCVILSFVNQFFGYRSNQLSISSVSAQIVTLPLGKFMAATLPEKPIKVPCTKWSFS  118

Query  374  LNPGPFNIKEHVIITVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQL  553
            LNPGPFNIKEHV+IT+ AN G     G  Y++G +TI+KA+YK++LS   G ++V TTQL
Sbjct  119  LNPGPFNIKEHVLITMFANSG----SGGVYAVGILTIVKAFYKRSLSPGAGYLLVQTTQL  174

Query  554  IGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFRALHETEVKSS-GMTRMRFFLLVMGASFV  730
            +GYGWAG+ R+YLVD   MWWPSNL QVSLFRALHE E +S  G+TR++FFL+V  +SF 
Sbjct  175  LGYGWAGLFRKYLVDSPYMWWPSNLVQVSLFRALHEKEKRSKGGLTRLQFFLIVFISSFA  234

Query  731  YYTLPGYLFPILTFFSWVCWVW  796
            YY +P YLFP +   S +C +W
Sbjct  235  YYLVPNYLFPSIGTVSIICLIW  256



>ref|XP_009601745.1| PREDICTED: oligopeptide transporter 7-like [Nicotiana tomentosiformis]
 ref|XP_009601746.1| PREDICTED: oligopeptide transporter 7-like [Nicotiana tomentosiformis]
Length=732

 Score =   278 bits (710),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 130/243 (53%), Positives = 172/243 (71%), Gaps = 5/243 (2%)
 Frame = +2

Query  74   PATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYR  253
            P             CP++EV + VP+TDDPT PV+TFR WFLGITSC++L F+N FF YR
Sbjct  5    PVNMAAANEADEDLCPIKEVDMTVPKTDDPTTPVVTFRMWFLGITSCVLLSFVNQFFWYR  64

Query  254  TQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANC  433
            T+PL+IS+  +QI+V+PIG  MA T+ +R F    RW FTLNPGPFNIKEHV+IT+ AN 
Sbjct  65   TEPLTISSTAVQIAVVPIGHLMAKTITKRVFFEGTRWEFTLNPGPFNIKEHVLITIFANA  124

Query  434  GVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMW  613
                G G  Y+   ++ +K YYK+ LSF   L+I+ TTQ++G+GWAG+ R+ LV+P +MW
Sbjct  125  ----GAGSVYATHILSAVKLYYKRPLSFFPALLIMATTQMLGFGWAGIFRKQLVEPAEMW  180

Query  614  WPSNLAQVSLFRALHETEVK-SSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCW  790
            WP +L QVSLFRALHE E +   G TR++FFL+ +  SF YY  PGYLF +L+ FSW+CW
Sbjct  181  WPGSLVQVSLFRALHEKETRPKGGTTRIQFFLIALVFSFAYYIFPGYLFQMLSSFSWICW  240

Query  791  VWP  799
            + P
Sbjct  241  LAP  243



>ref|XP_002317799.2| hypothetical protein POPTR_0012s02660g [Populus trichocarpa]
 gb|EEE96019.2| hypothetical protein POPTR_0012s02660g [Populus trichocarpa]
Length=731

 Score =   278 bits (710),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 138/246 (56%), Positives = 175/246 (71%), Gaps = 7/246 (3%)
 Frame = +2

Query  59   MSGLNPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNT  238
            M+G N   A E        CPV++V L V +TDDPTLPVLTFR W LG+ SC++L F+N 
Sbjct  1    MAGANEVQAMEIEDEE--ECPVKQVDLTVLKTDDPTLPVLTFRMWVLGLGSCVLLSFVNQ  58

Query  239  FFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIIT  418
            FF YRTQP+ IS+I  QI+V+P+G  MA  L  RKF     W FT+NPGPFNIKEHV+IT
Sbjct  59   FFWYRTQPMFISSISAQIAVVPLGHLMAKKLTTRKFFEGTSWEFTMNPGPFNIKEHVLIT  118

Query  419  VMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVD  598
            + AN     G G  Y+   +T +K YYK+ L+F+  L +++TTQ++G+GWAG+ R+YLV+
Sbjct  119  IFANS----GAGTVYATHILTAVKLYYKRKLTFVPALFVMITTQVLGFGWAGLFRKYLVE  174

Query  599  PVDMWWPSNLAQVSLFRALHETEVKSSGMT-RMRFFLLVMGASFVYYTLPGYLFPILTFF  775
            P +MWWPSNL QVSLFRALHE E +  G T R +FFLLV+  SF YY LPGYLF +LT F
Sbjct  175  PGEMWWPSNLVQVSLFRALHEKEKRLKGYTSRTQFFLLVIICSFAYYVLPGYLFTMLTSF  234

Query  776  SWVCWV  793
            SWVCW+
Sbjct  235  SWVCWL  240



>ref|XP_006655737.1| PREDICTED: oligopeptide transporter 7-like [Oryza brachyantha]
Length=762

 Score =   278 bits (711),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 133/245 (54%), Positives = 175/245 (71%), Gaps = 6/245 (2%)
 Frame = +2

Query  68   LNPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFI  247
            L P+T G +    G   PVE+VAL VP  D+P+ PVLT R W LG  SC++L FLNTFF 
Sbjct  32   LRPST-GPEEVEEGENSPVEQVALTVPVGDEPSAPVLTARTWVLGTASCVVLSFLNTFFW  90

Query  248  YRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMA  427
            YR +PL+++AI  QI+V+P+G+ MAA LPER F     W FTLNPGPFN+KEHV+IT+ A
Sbjct  91   YRKEPLTVTAISAQIAVVPLGRLMAAVLPERAFFRGRPWEFTLNPGPFNVKEHVLITIFA  150

Query  428  NCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVD  607
            N     G G  ++I  IT ++ +Y + +SF   L++VLT+Q++G+GWAG+ RRYLV+P  
Sbjct  151  NA----GAGSVFAINVITAVRVFYGKRISFFVSLLVVLTSQVLGFGWAGIFRRYLVEPAA  206

Query  608  MWWPSNLAQVSLFRALHETEVKSS-GMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWV  784
            MWWPSNL QVSLFRALHE + +S  GMTR +FFL+    SF YY  PGYLF +L+  SW+
Sbjct  207  MWWPSNLVQVSLFRALHEKKQRSKGGMTRNQFFLVAFVCSFAYYIFPGYLFQMLSSLSWI  266

Query  785  CWVWP  799
            CW++P
Sbjct  267  CWIFP  271



>ref|XP_002301110.1| oligopeptide transporter OPT family protein [Populus trichocarpa]
 gb|EEE80383.1| oligopeptide transporter OPT family protein [Populus trichocarpa]
Length=724

 Score =   277 bits (709),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 138/240 (58%), Positives = 173/240 (72%), Gaps = 8/240 (3%)
 Frame = +2

Query  86   GEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPL  265
             E      G  P+EEV L VP  DD TLPV TFR WFLGI SCIIL FLNTFF YRT+PL
Sbjct  2    NENIEEDDGVSPIEEVRLTVPTRDDHTLPVWTFRMWFLGIASCIILSFLNTFFSYRTEPL  61

Query  266  SISAILMQISVLPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVMANCGV  439
            +IS I +Q+  LPIG+FMA TLP  KF    FG   F+LNPGPFN+KEHV+I++ AN G 
Sbjct  62   TISMISVQVVTLPIGRFMAKTLPTAKFRVPGFGGREFSLNPGPFNVKEHVLISIFANVGS  121

Query  440  SPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWP  619
            S     AY++G I I+ A+YK+ +SFL   I+VLTTQ++GYGWAG++R+Y+VDP +MWWP
Sbjct  122  S----TAYAVGIIDIIMAFYKRKISFLASWILVLTTQMLGYGWAGIMRKYVVDPAEMWWP  177

Query  620  SNLAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  799
             +L QVSLFRALHE +  +S M+R +FFL+ +  SF +Y  PGYLFP +   SWVCW +P
Sbjct  178  LSLMQVSLFRALHEKD--NSRMSRGKFFLIALICSFSWYVFPGYLFPAIGTISWVCWAFP  235



>ref|XP_010254620.1| PREDICTED: oligopeptide transporter 4-like [Nelumbo nucifera]
Length=738

 Score =   278 bits (710),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 131/226 (58%), Positives = 172/226 (76%), Gaps = 4/226 (2%)
 Frame = +2

Query  119  PVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISV  298
            P+E+V L V  TDDPTLPV TFR WFLG+ SC +L FLN FF YRT+PL I+ I +Q++ 
Sbjct  23   PIEQVRLTVTNTDDPTLPVWTFRMWFLGLISCALLSFLNQFFAYRTEPLIITQITVQVAT  82

Query  299  LPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            LPIG+FMA+ LP  KF    FG   F+LNPGPFN+KEHV+I++ AN G + G G AY++G
Sbjct  83   LPIGRFMASVLPRTKFRLPGFGSTEFSLNPGPFNMKEHVLISIFANAGSAFGSGYAYAVG  142

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFRA  652
             + I+KA+Y++ +SFL G I+V+TTQ++GYGWAG+LR+Y+V+P  MWWPS L QVSLFRA
Sbjct  143  IVNIIKAFYRKNISFLAGWILVITTQVLGYGWAGLLRKYVVEPAHMWWPSTLVQVSLFRA  202

Query  653  LHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCW  790
            LHE + +   M+R +FFL+ +  SF +Y +PGYLFP LT  SWVCW
Sbjct  203  LHEKDEER--MSRGKFFLIALICSFSWYAIPGYLFPTLTSISWVCW  246



>ref|XP_011043664.1| PREDICTED: oligopeptide transporter 9-like [Populus euphratica]
Length=731

 Score =   277 bits (709),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 138/246 (56%), Positives = 175/246 (71%), Gaps = 7/246 (3%)
 Frame = +2

Query  59   MSGLNPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNT  238
            M+G N   A E        CPV++V L V +TDDPTLPVLTFR W LG+ SC++L F+N 
Sbjct  1    MAGANEVQAMEIEDEE--ECPVKQVDLTVLKTDDPTLPVLTFRMWVLGLGSCVLLSFVNQ  58

Query  239  FFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIIT  418
            FF YRTQP+ IS+I  QI+V+P+G  MA  L  RKF     W FT+NPGPFNIKEHV+IT
Sbjct  59   FFWYRTQPMFISSISAQIAVVPLGHLMAKKLTTRKFFEGTSWEFTMNPGPFNIKEHVLIT  118

Query  419  VMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVD  598
            + AN     G G  Y+   +T +K YYK+ L+F+  L +++TTQ++G+GWAG+ RRYLV+
Sbjct  119  IFANS----GAGTVYATHILTAVKLYYKRKLTFVPALFVMITTQVLGFGWAGLFRRYLVE  174

Query  599  PVDMWWPSNLAQVSLFRALHETEVKSSG-MTRMRFFLLVMGASFVYYTLPGYLFPILTFF  775
            P +MWWPSNL QVSLFRALHE + +  G  TR +FFLLV+  SF YY LPGYLF +LT F
Sbjct  175  PGEMWWPSNLVQVSLFRALHEKDKRLKGYTTRTQFFLLVIICSFAYYVLPGYLFTMLTSF  234

Query  776  SWVCWV  793
            SWVCW+
Sbjct  235  SWVCWL  240



>ref|XP_008241834.1| PREDICTED: oligopeptide transporter 7-like [Prunus mume]
Length=738

 Score =   278 bits (710),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 127/230 (55%), Positives = 171/230 (74%), Gaps = 5/230 (2%)
 Frame = +2

Query  113  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  292
              P+E+VAL VP TDDP+LP +TFR W LG  +C++L FLN FF YR +PLS+++I  QI
Sbjct  35   NSPIEQVALTVPVTDDPSLPTVTFRTWTLGALACVLLSFLNQFFWYRREPLSLTSISAQI  94

Query  293  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            +V+P+G+ MA+ + +R F    +W FTLNPGPFN+KEHV+IT+ AN     G G+ Y+I 
Sbjct  95   AVVPLGRLMASLITKRVFFKGQKWEFTLNPGPFNVKEHVLITIFANS----GAGNVYAIH  150

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFRA  652
             ++ +K +YK+ LSF   L++VLTTQ++G+GWAG+ RRYLV+P  MWWP NL QVSLFRA
Sbjct  151  IVSTVKLFYKKNLSFFVALLVVLTTQVLGFGWAGLFRRYLVEPAAMWWPQNLVQVSLFRA  210

Query  653  LHETEVK-SSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  799
            LHE E +   G+TR +FFL+    SF YY LPGYLFP+LT  SW+CW++P
Sbjct  211  LHEKEKRPRGGLTRNQFFLIAFTCSFAYYVLPGYLFPMLTSLSWICWIFP  260



>ref|XP_009128701.1| PREDICTED: LOW QUALITY PROTEIN: oligopeptide transporter 7-like 
[Brassica rapa]
Length=760

 Score =   278 bits (710),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 131/230 (57%), Positives = 168/230 (73%), Gaps = 5/230 (2%)
 Frame = +2

Query  113  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  292
              P+ EVAL VP TDD +LPVLTFR WFLG  SCI+L FLN FF YR +PL ISAI  QI
Sbjct  50   NSPIREVALTVPTTDDHSLPVLTFRMWFLGSISCILLSFLNQFFWYRREPLVISAISAQI  109

Query  293  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            +V+P+G+ MAA + +R F    +W FTLNPGPFN+KEHV+IT+ AN     G G  Y+I 
Sbjct  110  AVVPLGRLMAAKITDRVFLQGSKWEFTLNPGPFNVKEHVLITIFANA----GAGSVYAIH  165

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFRA  652
             IT++KAYY + ++F    I+++TTQ++G+GWAG+ R+YLV+P  MWWP+NL QVSLFRA
Sbjct  166  IITVVKAYYMKNMTFFVSFIVIVTTQVLGFGWAGIFRKYLVEPAAMWWPANLVQVSLFRA  225

Query  653  LHETEVKSS-GMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  799
            LHE E ++  G+TR +FFL+    SF YY  PGYLF +LT  SWVCW +P
Sbjct  226  LHEKEERAKGGLTRTQFFLIAFICSFAYYVFPGYLFQMLTSLSWVCWFFP  275



>gb|KFK31865.1| hypothetical protein AALP_AA6G168500 [Arabis alpina]
Length=755

 Score =   278 bits (710),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 129/230 (56%), Positives = 170/230 (74%), Gaps = 5/230 (2%)
 Frame = +2

Query  113  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  292
              P+ +VAL VP TDDP+LPVLTFR W LG  SCI+L FLN FF YRT+PL+ISAI  QI
Sbjct  43   NSPIRQVALTVPTTDDPSLPVLTFRMWVLGTLSCILLSFLNQFFWYRTEPLTISAISAQI  102

Query  293  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            +V+P+G+ MAA + +R F     W FTLNPGPFN+KEHV+IT+ AN     G G  Y+I 
Sbjct  103  AVVPLGRLMAAKISDRVFLQGSYWEFTLNPGPFNVKEHVLITIFANA----GAGSVYAIH  158

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFRA  652
             +T++KA+Y + ++F   LI+++TTQ++G+GWAG+ R+YLV+P  MWWP+NL QVSLFRA
Sbjct  159  VVTVVKAFYMKNITFFVSLIVIVTTQVLGFGWAGIFRKYLVEPAAMWWPANLVQVSLFRA  218

Query  653  LHETEVKSS-GMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  799
            LHE E ++  G+TR +FFL+    SF YY  PGYLF ++T  SWVCW +P
Sbjct  219  LHEKEERAKGGVTRTQFFLIAFVCSFAYYVFPGYLFQMMTSLSWVCWFFP  268



>ref|XP_010436760.1| PREDICTED: oligopeptide transporter 7-like [Camelina sativa]
Length=766

 Score =   278 bits (710),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 129/240 (54%), Positives = 175/240 (73%), Gaps = 8/240 (3%)
 Frame = +2

Query  83   AGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQP  262
            +GE+   +    P+ +VAL VP TDDP+LPVLTFR W LG  SCI+L FLN FF YRT+P
Sbjct  47   SGEEEEENS---PIRQVALTVPTTDDPSLPVLTFRMWVLGTLSCILLSFLNQFFWYRTEP  103

Query  263  LSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVS  442
            L+ISAI  QI+V+P+G+ MAA + ER +    +W FTLNPGPFN+KEHV+IT+ AN    
Sbjct  104  LTISAISAQIAVVPLGRLMAAKISERVYFQGSKWQFTLNPGPFNVKEHVLITIFANA---  160

Query  443  PGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPS  622
             G G  Y+I  +T++KA+Y + ++F    ++++TTQ++G+GWAG+ R+YLV+P  MWWP+
Sbjct  161  -GAGSVYAIHVVTVVKAFYMKNITFFVSFLVIVTTQVLGFGWAGIFRKYLVEPAAMWWPA  219

Query  623  NLAQVSLFRALHETEVKSS-GMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  799
            NL QVSLFRALHE E ++  G+TR +FF++    SF YY  PGYLF I+T  SWVCW +P
Sbjct  220  NLVQVSLFRALHEKEERTKGGLTRTQFFVIAFVCSFAYYVFPGYLFQIMTSLSWVCWCFP  279



>ref|XP_010422002.1| PREDICTED: oligopeptide transporter 7 [Camelina sativa]
Length=769

 Score =   278 bits (710),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 127/230 (55%), Positives = 170/230 (74%), Gaps = 5/230 (2%)
 Frame = +2

Query  113  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  292
              P+ +VAL VP TDDP+LPVLTFR W LG  SCI+L FLN FF YRT+PL+ISAI  QI
Sbjct  57   NSPIRQVALTVPTTDDPSLPVLTFRMWVLGTLSCILLSFLNQFFWYRTEPLTISAISAQI  116

Query  293  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            +V+P+G+ MAA + ER +    +W FTLNPGPFN+KEHV+IT+ AN     G G  Y+I 
Sbjct  117  AVVPLGRLMAAKISERVYFQGSKWQFTLNPGPFNVKEHVLITIFANA----GAGSVYAIH  172

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFRA  652
             +T++KA+Y + ++F    ++++TTQ++G+GWAG+ R+YLV+P  MWWP+NL QVSLFRA
Sbjct  173  VVTVVKAFYMKNITFFVSFLVIVTTQVLGFGWAGIFRKYLVEPAAMWWPANLVQVSLFRA  232

Query  653  LHETEVKSS-GMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  799
            LHE E ++  G+TR +FF++    SF YY  PGYLF I+T  SWVCW +P
Sbjct  233  LHEKEERTKGGLTRTQFFVIAFVCSFAYYVFPGYLFQIMTSLSWVCWFFP  282



>gb|EPS60258.1| hypothetical protein M569_14546, partial [Genlisea aurea]
Length=705

 Score =   276 bits (706),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 127/230 (55%), Positives = 170/230 (74%), Gaps = 5/230 (2%)
 Frame = +2

Query  113  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  292
              P++EVAL V  +DD ++PVLTFR WFLG  SC++L FLN FF YRT+PLSI+AI  QI
Sbjct  6    NSPIKEVALTVSTSDDASIPVLTFRMWFLGTVSCVLLSFLNQFFWYRTEPLSITAISAQI  65

Query  293  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            +V+P+G+ MAA LP R F     W FTLNPGPFN+KEHV+IT+ AN     G G  Y+I 
Sbjct  66   AVVPLGRLMAARLPARVFFRNTGWEFTLNPGPFNVKEHVLITIFANS----GAGTVYAIH  121

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFRA  652
             +T +K +Y++ ++F   L++V+TTQ++G+GWAG+ RRYLV+P +MWWP+NL QVSLFRA
Sbjct  122  VVTAVKVFYRKHINFFVSLVVVITTQVLGFGWAGIFRRYLVEPAEMWWPANLVQVSLFRA  181

Query  653  LHETEV-KSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  799
            LHE E  +  G+TR +FF++    SF YY  PGYLF +LT  SW+CW++P
Sbjct  182  LHEKEERRKGGVTRTQFFVIAFICSFAYYVFPGYLFQMLTSLSWICWIFP  231



>ref|NP_192815.1| oligopeptide transporter 7 [Arabidopsis thaliana]
 sp|O82485.1|OPT7_ARATH RecName: Full=Oligopeptide transporter 7; Short=AtOPT7 [Arabidopsis 
thaliana]
 gb|AAC35527.1| similar to Schizosaccharomyces pombe isp4 protein (GB:D14061) 
[Arabidopsis thaliana]
 emb|CAB81178.1| putative oligopeptide transporter [Arabidopsis thaliana]
 gb|AAK74026.1| AT4g10770/T12H20_7 [Arabidopsis thaliana]
 gb|AAO42765.1| At4g10770/T12H20_7 [Arabidopsis thaliana]
 gb|AEE82927.1| oligopeptide transporter 7 [Arabidopsis thaliana]
Length=766

 Score =   277 bits (709),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 128/228 (56%), Positives = 170/228 (75%), Gaps = 5/228 (2%)
 Frame = +2

Query  119  PVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISV  298
            P+ +VAL VP TDDP+LPVLTFR W LG  SCI+L FLN FF YRT+PL+ISAI  QI+V
Sbjct  56   PIRQVALTVPTTDDPSLPVLTFRMWVLGTLSCILLSFLNQFFWYRTEPLTISAISAQIAV  115

Query  299  LPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIGAI  478
            +P+G+ MAA + +R F    +W FTLNPGPFN+KEHV+IT+ AN     G G  Y+I  +
Sbjct  116  VPLGRLMAAKITDRVFFQGSKWQFTLNPGPFNVKEHVLITIFANA----GAGSVYAIHVV  171

Query  479  TIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFRALH  658
            T++KA+Y + ++F    I+++TTQ++G+GWAG+ R+YLV+P  MWWP+NL QVSLFRALH
Sbjct  172  TVVKAFYMKNITFFVSFIVIVTTQVLGFGWAGIFRKYLVEPAAMWWPANLVQVSLFRALH  231

Query  659  ETEVKSS-GMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  799
            E E ++  G+TR +FF++    SF YY  PGYLF I+T  SWVCW +P
Sbjct  232  EKEERTKGGLTRTQFFVIAFVCSFAYYVFPGYLFQIMTSLSWVCWFFP  279



>gb|KDP41518.1| hypothetical protein JCGZ_15925 [Jatropha curcas]
Length=730

 Score =   276 bits (707),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 134/239 (56%), Positives = 173/239 (72%), Gaps = 4/239 (2%)
 Frame = +2

Query  89   EKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLS  268
            E    S    P+EEV L V   DDPTLPV TFR WFLGI SC++L FLNTFF YRT+PL+
Sbjct  5    EIETISDDVSPIEEVRLTVSNHDDPTLPVWTFRMWFLGIVSCVLLSFLNTFFAYRTEPLT  64

Query  269  ISAILMQISVLPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVMANCGVS  442
            IS I +Q++ LPIG+FMA TLP  KFA   FG   F+LNPGPFN+KEHV+I++ AN G +
Sbjct  65   ISMISVQVATLPIGRFMAKTLPTTKFAIPGFGNKKFSLNPGPFNVKEHVLISIFANVGSN  124

Query  443  PGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPS  622
             G G AY+I  I I+ A+Y + +SFL   I+V+TTQ++GYGWAG++R+++VDP  MWWP 
Sbjct  125  AGSGAAYAISIIDIIVAFYHRKISFLASWILVITTQVLGYGWAGIMRKFVVDPAHMWWPI  184

Query  623  NLAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  799
            +L QVSLFRA+HE + K   M+R +FFL+ +  SF +Y  PGYLF  L   SWVCW++P
Sbjct  185  SLVQVSLFRAMHERDNKR--MSRGKFFLIALICSFSWYLFPGYLFQTLGTISWVCWLFP  241



>ref|XP_004964383.1| PREDICTED: oligopeptide transporter 7-like isoform X2 [Setaria 
italica]
Length=775

 Score =   278 bits (710),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 132/230 (57%), Positives = 167/230 (73%), Gaps = 5/230 (2%)
 Frame = +2

Query  113  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  292
              P+E+VAL VP  DDP+ PVLTFR W LG  SC +L FLN FF YR +PL+I+AI  QI
Sbjct  60   NSPIEQVALTVPVGDDPSTPVLTFRMWVLGTASCALLSFLNQFFWYRKEPLTITAISAQI  119

Query  293  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            +V+P+G+ MAA LPER F    RW F+LNPGPFN+KEHV+IT+ AN     G G  Y+I 
Sbjct  120  AVVPLGRLMAAALPERAFLRGTRWEFSLNPGPFNVKEHVLITIFANS----GAGTVYAIH  175

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFRA  652
             IT ++ +Y + ++F   L++VLTTQ++G+GWAG+ RRYLV+P  MWWPSNL QVSLFRA
Sbjct  176  VITAVRVFYGKHITFFVSLLVVLTTQVLGFGWAGIFRRYLVEPAAMWWPSNLVQVSLFRA  235

Query  653  LHETEVK-SSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  799
            LHE E +   G+TR +FFL+    SF YY  PGYLF +LT  SWVCWV+P
Sbjct  236  LHEKEQRVKGGLTRNQFFLVAFICSFAYYIFPGYLFQMLTSLSWVCWVFP  285



>ref|XP_007204095.1| hypothetical protein PRUPE_ppa002122mg [Prunus persica]
 gb|EMJ05294.1| hypothetical protein PRUPE_ppa002122mg [Prunus persica]
Length=713

 Score =   276 bits (706),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 127/230 (55%), Positives = 170/230 (74%), Gaps = 5/230 (2%)
 Frame = +2

Query  113  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  292
              P+E+VAL VP TDDP+LP +TFR W LG  +C++L FLN FF YR +PLS+++I  QI
Sbjct  10   NSPIEQVALTVPVTDDPSLPTVTFRTWTLGALACVLLSFLNQFFWYRREPLSLTSISAQI  69

Query  293  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            +V+P+G  MA+ + +R F    +W FTLNPGPFN+KEHV+IT+ AN     G G+ Y+I 
Sbjct  70   AVVPLGHLMASLITKRVFFKGQKWEFTLNPGPFNVKEHVLITIFANS----GAGNVYAIH  125

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFRA  652
             ++ +K +YK+ LSF   L++VLTTQ++G+GWAG+ RRYLV+P  MWWP NL QVSLFRA
Sbjct  126  IVSTVKLFYKKNLSFFVALLVVLTTQVLGFGWAGLFRRYLVEPAAMWWPQNLVQVSLFRA  185

Query  653  LHETEVK-SSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  799
            LHE E +   G+TR +FFL+    SF YY LPGYLFP+LT  SW+CW++P
Sbjct  186  LHEKEKRPKGGLTRNQFFLIAFTCSFAYYVLPGYLFPMLTSLSWICWIFP  235



>ref|XP_008349603.1| PREDICTED: oligopeptide transporter 5-like [Malus domestica]
Length=400

 Score =   268 bits (684),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 130/229 (57%), Positives = 165/229 (72%), Gaps = 6/229 (3%)
 Frame = +2

Query  116  CPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQIS  295
             P+EEV L VP TDDP+ P LTFR W LGI SC+IL F+N FF +RT  LS+S++  QI 
Sbjct  35   SPIEEVWLTVPITDDPSQPTLTFRTWVLGILSCVILSFVNEFFGFRTNQLSVSSVSAQIV  94

Query  296  VLPIGKFMAATLPERKF-APFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            VLP+GK MAATLP RKF  PF +WSFT+NPGPFN+KEHV+IT+ AN     G G  Y++ 
Sbjct  95   VLPLGKLMAATLPTRKFRVPFTKWSFTMNPGPFNLKEHVLITIFANS----GAGGVYAVH  150

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFRA  652
             ITI+KA+Y +        ++  TTQ++GYGWAG+ R+YLVD   MWWP+NL QVSLFRA
Sbjct  151  IITIVKAFYHRKQHPAAAFLLAQTTQMLGYGWAGLFRKYLVDSPYMWWPANLVQVSLFRA  210

Query  653  LHETEVK-SSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVW  796
            LHE E +   G+TR++FFL+V   SF YY  PG+LFP ++ FS VC +W
Sbjct  211  LHEKEKRPXGGVTRLQFFLMVFVCSFAYYIFPGFLFPSISAFSIVCLIW  259



>ref|XP_010048814.1| PREDICTED: oligopeptide transporter 6 [Eucalyptus grandis]
 gb|KCW89113.1| hypothetical protein EUGRSUZ_A01435 [Eucalyptus grandis]
Length=732

 Score =   276 bits (707),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 133/237 (56%), Positives = 170/237 (72%), Gaps = 5/237 (2%)
 Frame = +2

Query  92   KTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSI  271
            K       CPVE+V L VP TDDPTLPVLTFR W LG+ SC++L F+N FF YR  PLSI
Sbjct  10   KEEEVDEECPVEQVKLTVPITDDPTLPVLTFRMWVLGVGSCVVLSFVNQFFWYRQNPLSI  69

Query  272  SAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGG  451
            ++I  QI+V+PIG  MA T+ +R F    +W F+LNPGPFNIKEHV+IT+ AN     G 
Sbjct  70   TSISAQIAVVPIGHLMARTITKRVFLQGTKWEFSLNPGPFNIKEHVLITIFANS----GA  125

Query  452  GDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLA  631
            G  Y+   ++ +K YYK+ L+FL  L++++TTQ++G+GWAG+ R YLV+P +MWWP NL 
Sbjct  126  GSVYATHILSSVKLYYKRKLTFLPALLVMMTTQVLGFGWAGLFREYLVEPGEMWWPYNLV  185

Query  632  QVSLFRALHETEVKSSG-MTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  799
            QVSLFRALHE E +  G  TR +FFL+ +  SF YY LPGYLF +LT FSWVCW+ P
Sbjct  186  QVSLFRALHEKEKRQKGRFTRNQFFLIALITSFAYYVLPGYLFMMLTAFSWVCWIAP  242



>ref|XP_010691453.1| PREDICTED: oligopeptide transporter 4 [Beta vulgaris subsp. vulgaris]
Length=746

 Score =   276 bits (707),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 133/241 (55%), Positives = 175/241 (73%), Gaps = 6/241 (2%)
 Frame = +2

Query  89   EKTAPSGGR---CPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQ  259
            EK+ P        P+EEV L V  TDDPTLPV TFR WFLG+ SC +L FLN FF YRT+
Sbjct  15   EKSKPDIDEDDISPIEEVRLTVTNTDDPTLPVWTFRMWFLGLVSCGMLSFLNQFFSYRTE  74

Query  260  PLSISAILMQISVLPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVMANC  433
            PL I+ I +Q++ LP+G F+A  LPE KF    FG  +F+LNPGPFN+KEHV+IT+ AN 
Sbjct  75   PLIITQITVQVATLPLGHFLARILPETKFRIPGFGPRTFSLNPGPFNVKEHVLITIFANA  134

Query  434  GVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMW  613
            G + G G AY++G + I+KA+YK+ +SFL   I+++TTQ++GYGWAG++R+Y+V+P  MW
Sbjct  135  GSAFGNGSAYAVGIVNIIKAFYKRNISFLAAWILIITTQVLGYGWAGLMRKYVVEPAHMW  194

Query  614  WPSNLAQVSLFRALHETEVKSSGMT-RMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCW  790
            WP+ L QVSLFRALHE + K    T R +FFL+ +  SF++Y +PGYLF  LT  SWVCW
Sbjct  195  WPNTLVQVSLFRALHEKDDKEEKRTSRAKFFLIALMCSFLWYAVPGYLFSTLTSISWVCW  254

Query  791  V  793
            V
Sbjct  255  V  255



>ref|XP_009379386.1| PREDICTED: oligopeptide transporter 7-like [Pyrus x bretschneideri]
Length=735

 Score =   276 bits (707),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 130/249 (52%), Positives = 176/249 (71%), Gaps = 9/249 (4%)
 Frame = +2

Query  68   LNPATAGEKTA----PSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLN  235
            L P T  + +A    P+    P+E+VAL VP TDDP+L  +TFR W LG  +C++L FLN
Sbjct  13   LIPKTQSDASASSPPPADENSPIEQVALTVPVTDDPSLSTVTFRTWTLGALACVLLSFLN  72

Query  236  TFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVII  415
             FF YR +PLS+++I  QI+V+P+G  MA+ + +R F    +W FT NPGPFN+KEHV+I
Sbjct  73   QFFWYRREPLSLTSISAQIAVVPLGHLMASLITDRVFFKGRKWEFTFNPGPFNVKEHVLI  132

Query  416  TVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  595
            T+ AN     G G+ Y+I  ++ +K +YK+ LSF   L++VLTTQ++G+GWAG+ RRYLV
Sbjct  133  TIFANS----GAGNVYAIHIVSAVKIFYKKNLSFFVALLVVLTTQVLGFGWAGLFRRYLV  188

Query  596  DPVDMWWPSNLAQVSLFRALHETEVK-SSGMTRMRFFLLVMGASFVYYTLPGYLFPILTF  772
            +P  MWWP NL QVSLFRALHE E +   G+TR +FFL+    SF YY LPGYLFP+LT 
Sbjct  189  EPAAMWWPQNLVQVSLFRALHEKEERPKGGLTRNQFFLIAFTCSFAYYVLPGYLFPMLTS  248

Query  773  FSWVCWVWP  799
             SW+CW++P
Sbjct  249  LSWICWIFP  257



>emb|CBI19303.3| unnamed protein product [Vitis vinifera]
Length=859

 Score =   279 bits (713),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 131/229 (57%), Positives = 174/229 (76%), Gaps = 4/229 (2%)
 Frame = +2

Query  119  PVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISV  298
            P+EEV L VP TDDP+LPV TFR WFLG+ SC++L FLNTFF YRT+PL I+ I +Q++ 
Sbjct  144  PIEEVRLTVPTTDDPSLPVWTFRMWFLGLISCVLLSFLNTFFGYRTEPLVITMISVQVAT  203

Query  299  LPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            LP+G+FMA  LP+ KF    FG   ++LNPGPFN+KEHV+I++ AN G + G G AY+I 
Sbjct  204  LPVGRFMAKVLPKTKFRVPGFGSREYSLNPGPFNVKEHVLISIFANAGAAFGSGTAYAIS  263

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFRA  652
             + I+KA+Y + +SF    I+V+TTQ++GYGWAG+LR+++VDP +MWWPS+L QVSLF A
Sbjct  264  IVDIIKAFYHREISFSACWILVITTQVLGYGWAGILRKFVVDPAEMWWPSSLTQVSLFSA  323

Query  653  LHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  799
            LHE + K   MTR +FFL+ +  SF +Y +PGYLFP L   SWVCWV+P
Sbjct  324  LHEKDKKR--MTRAKFFLIALICSFSWYVVPGYLFPTLGTISWVCWVFP  370



>gb|KCW53168.1| hypothetical protein EUGRSUZ_J02449 [Eucalyptus grandis]
Length=550

 Score =   272 bits (695),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 123/228 (54%), Positives = 167/228 (73%), Gaps = 5/228 (2%)
 Frame = +2

Query  119  PVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISV  298
            P+E+VAL VPE DDP+LP +TFR + LG  +C +L FLN FF YR +PLS++++  QI+V
Sbjct  41   PIEQVALTVPEEDDPSLPAVTFRTFVLGTLACSLLSFLNQFFWYRREPLSVTSVSAQIAV  100

Query  299  LPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIGAI  478
            +P+G  +A  + +R F    +W FTLNPGPFN+KEHV+IT+ AN     G    Y+I  I
Sbjct  101  VPLGHLLAGVITKRVFFEGSKWQFTLNPGPFNVKEHVLITIFANS----GAASVYAIHII  156

Query  479  TIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFRALH  658
            +++K +Y++ +SFL  L++VLTTQ++G+GWAG+ RRYLV+P  MWWP NL QVSLFRALH
Sbjct  157  SVVKIFYRKEMSFLVALVVVLTTQILGFGWAGMFRRYLVEPAAMWWPQNLVQVSLFRALH  216

Query  659  ETEVKSSG-MTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  799
            E E +  G +TR  FFL+    SF YY LPGYLFP+LT  SW+CW++P
Sbjct  217  EKEQRLKGRLTRNHFFLIAFVCSFSYYVLPGYLFPMLTSLSWICWIFP  264



>emb|CDY25261.1| BnaA02g21950D [Brassica napus]
Length=730

 Score =   276 bits (706),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 131/230 (57%), Positives = 167/230 (73%), Gaps = 5/230 (2%)
 Frame = +2

Query  113  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  292
              P+ EVAL VP TDD +LPVLTFR WFLG  SCI+L FLN FF YR +PL ISAI  QI
Sbjct  50   NSPIREVALTVPTTDDHSLPVLTFRMWFLGSISCILLSFLNQFFWYRREPLVISAISAQI  109

Query  293  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            +V+P+G+ MAA + +R F    +W FTLNPGPFN+KEHV+IT+ AN     G G  Y+I 
Sbjct  110  AVVPLGRLMAAKITDRVFLQGSKWEFTLNPGPFNVKEHVLITIFANA----GAGSVYAIH  165

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFRA  652
             IT++KAYY + ++F    I+ +TTQ++G+GWAG+ R+YLV+P  MWWP+NL QVSLFRA
Sbjct  166  IITVVKAYYMKNMTFFVSFIVKVTTQVLGFGWAGIFRKYLVEPAAMWWPANLVQVSLFRA  225

Query  653  LHETEVKSS-GMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  799
            LHE E ++  G+TR +FFL+    SF YY  PGYLF +LT  SWVCW +P
Sbjct  226  LHEKEERAKGGLTRTQFFLIAFICSFAYYVFPGYLFQMLTSLSWVCWFFP  275



>ref|XP_008803572.1| PREDICTED: oligopeptide transporter 4-like isoform X2 [Phoenix 
dactylifera]
Length=606

 Score =   273 bits (698),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 130/250 (52%), Positives = 177/250 (71%), Gaps = 6/250 (2%)
 Frame = +2

Query  59   MSGLNPATAGEKTAPSGGR--CPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFL  232
            M+    A   EKTA        P+E+V L VP TD+PTLPV TFR WF+GI SC ++ FL
Sbjct  26   MTATVSAMDVEKTAGGDEEEVSPIEQVRLTVPTTDNPTLPVWTFRMWFIGILSCSLMSFL  85

Query  233  NTFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEH  406
            N FF YRT+PL I+ I +Q++ LP+G F+A  LP  KF    FG   F+LNPGPFN+KEH
Sbjct  86   NQFFSYRTEPLIITQISIQVASLPVGHFLARVLPAAKFRLPGFGDRQFSLNPGPFNMKEH  145

Query  407  VIITVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRR  586
            V+I++ AN G + G G AY +G + I++A+YK+ +SF  G I+++TTQ++GYGWAG++R+
Sbjct  146  VLISIFANAGYAFGNGPAYGVGIVNIIRAFYKRTISFTAGWILIITTQVLGYGWAGLMRK  205

Query  587  YLVDPVDMWWPSNLAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPIL  766
            Y+V+P  MWWP+ L QVSLFRALHE E +   MTR +FF++ +  SF +Y +PGYLF  +
Sbjct  206  YVVEPAHMWWPTTLVQVSLFRALHEKEDRR--MTRAKFFVIALACSFAWYAVPGYLFSTV  263

Query  767  TFFSWVCWVW  796
            T  SWVCWV+
Sbjct  264  TSMSWVCWVF  273



>dbj|BAJ85948.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=755

 Score =   276 bits (707),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 131/237 (55%), Positives = 168/237 (71%), Gaps = 5/237 (2%)
 Frame = +2

Query  92   KTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSI  271
            +   S    P+E+VAL VP  DDP  PVLTFR W LG+ SC +L FLN FF YR +PL++
Sbjct  33   RDEASEENSPIEQVALTVPVGDDPDTPVLTFRMWVLGMASCAVLSFLNQFFWYRKEPLTV  92

Query  272  SAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGG  451
            +AI  QI+V+P+G+ MAA LPER F P   + FTLNPGPFN+KEHV+IT+ AN     G 
Sbjct  93   TAISAQIAVVPLGRLMAAALPERAFFPDRPYEFTLNPGPFNVKEHVLITIFANA----GA  148

Query  452  GDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLA  631
            G  Y+I  +T ++ +Y + L+F   L++VLTTQ++G+GWAG+ RRYLV+P  MWWPSNL 
Sbjct  149  GTVYAIHVVTAVRVFYGKNLTFFVSLLVVLTTQVLGFGWAGIFRRYLVEPAAMWWPSNLV  208

Query  632  QVSLFRALHETEVKSS-GMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  799
            QVSLFRALHE E +   G TR +FFL+    SF YY  PGYLF +LT  SW+CWV+P
Sbjct  209  QVSLFRALHEKEGRQKGGFTRNQFFLVAFTCSFTYYVFPGYLFQMLTSLSWICWVFP  265



>emb|CDO97358.1| unnamed protein product [Coffea canephora]
Length=309

 Score =   264 bits (675),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 135/253 (53%), Positives = 177/253 (70%), Gaps = 8/253 (3%)
 Frame = +2

Query  53   VEMSGLNPATAG----EKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCII  220
            +E+  LN  T       +        P+EEV L V   DDPTLPV TFR W LG+ SC +
Sbjct  4    LEVESLNTTTTATNDHHQKYEDEDDSPIEEVRLTVSNYDDPTLPVWTFRMWLLGLLSCAL  63

Query  221  LIFLNTFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFA--PFGRWSFTLNPGPFN  394
            L FLN FF YRT+PL IS I +Q++ LPIG FMAA LPE+KF    FG+  F+ NPGPFN
Sbjct  64   LSFLNQFFSYRTEPLIISQITVQVASLPIGHFMAAVLPEKKFRLPGFGQRLFSFNPGPFN  123

Query  395  IKEHVIITVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAG  574
            +KEHV+IT+ AN G + G G AY++G I I+ A+YK+ +SFL G ++++TTQ++GYGWAG
Sbjct  124  MKEHVLITIFANAGAAFGNGSAYAVGIINIIIAFYKRKISFLAGWLLIITTQVLGYGWAG  183

Query  575  VLRRYLVDPVDMWWPSNLAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYL  754
            +LR+Y+V+P  MWWP+ L QVSLFRALHE + +   +TR +FFL+ +  SF +Y LPGYL
Sbjct  184  LLRKYVVEPAHMWWPNTLVQVSLFRALHEKDEQR--VTRAKFFLVALICSFSWYLLPGYL  241

Query  755  FPILTFFSWVCWV  793
            F  L+  SWVCWV
Sbjct  242  FTTLSSISWVCWV  254



>ref|XP_008803573.1| PREDICTED: oligopeptide transporter 4-like isoform X3 [Phoenix 
dactylifera]
Length=600

 Score =   273 bits (697),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 130/250 (52%), Positives = 177/250 (71%), Gaps = 6/250 (2%)
 Frame = +2

Query  59   MSGLNPATAGEKTAPSGGR--CPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFL  232
            M+    A   EKTA        P+E+V L VP TD+PTLPV TFR WF+GI SC ++ FL
Sbjct  26   MTATVSAMDVEKTAGGDEEEVSPIEQVRLTVPTTDNPTLPVWTFRMWFIGILSCSLMSFL  85

Query  233  NTFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEH  406
            N FF YRT+PL I+ I +Q++ LP+G F+A  LP  KF    FG   F+LNPGPFN+KEH
Sbjct  86   NQFFSYRTEPLIITQISIQVASLPVGHFLARVLPAAKFRLPGFGDRQFSLNPGPFNMKEH  145

Query  407  VIITVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRR  586
            V+I++ AN G + G G AY +G + I++A+YK+ +SF  G I+++TTQ++GYGWAG++R+
Sbjct  146  VLISIFANAGYAFGNGPAYGVGIVNIIRAFYKRTISFTAGWILIITTQVLGYGWAGLMRK  205

Query  587  YLVDPVDMWWPSNLAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPIL  766
            Y+V+P  MWWP+ L QVSLFRALHE E +   MTR +FF++ +  SF +Y +PGYLF  +
Sbjct  206  YVVEPAHMWWPTTLVQVSLFRALHEKEDRR--MTRAKFFVIALACSFAWYAVPGYLFSTV  263

Query  767  TFFSWVCWVW  796
            T  SWVCWV+
Sbjct  264  TSMSWVCWVF  273



>ref|XP_009407958.1| PREDICTED: oligopeptide transporter 7-like [Musa acuminata subsp. 
malaccensis]
Length=759

 Score =   276 bits (707),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 128/230 (56%), Positives = 168/230 (73%), Gaps = 5/230 (2%)
 Frame = +2

Query  113  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  292
              P+E+VAL VP  DDPT+PVLTFR W LG  SC++L FLN FF YR +PLSI++I  QI
Sbjct  45   NSPIEQVALTVPVEDDPTMPVLTFRMWVLGTASCVLLSFLNQFFWYRKEPLSITSISAQI  104

Query  293  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            +V+P+G  MA+T+ +R F    RW FTLNPGPFNIKEHV+IT+ AN     G G  Y+I 
Sbjct  105  AVVPLGHLMASTITDRVFFKGSRWEFTLNPGPFNIKEHVLITIFANS----GAGSVYAIH  160

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFRA  652
             +T +K +Y + ++F   L++V+TTQ++G+GWAG+ RRYLV+P  MWWP NL QVSLFRA
Sbjct  161  VVTAVKIFYGKHITFFVSLLVVITTQVLGFGWAGIFRRYLVEPAAMWWPYNLVQVSLFRA  220

Query  653  LHETEVKSS-GMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  799
            LHE E ++  GMTR +FF++    SF YY  PGYLF +LT  SW+CW++P
Sbjct  221  LHEREDRAKGGMTRNQFFMMAFICSFAYYVFPGYLFSMLTSLSWICWIFP  270



>gb|KJB32171.1| hypothetical protein B456_005G227300 [Gossypium raimondii]
Length=951

 Score =   280 bits (715),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 132/244 (54%), Positives = 176/244 (72%), Gaps = 3/244 (1%)
 Frame = +2

Query  71   NPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIY  250
            +  + G          P+E+V L V  TDDPTLPV TFR WFLG+ SC +L FLN FF Y
Sbjct  217  DATSGGNHDVEDDEISPIEQVRLTVTNTDDPTLPVWTFRMWFLGLFSCALLSFLNQFFSY  276

Query  251  RTQPLSISAILMQISVLPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVM  424
            RT+PL I+ I +Q+S LPIG FMA+ LP+ +F    FG   F+LNPGPFN+KEHV+I + 
Sbjct  277  RTEPLIITQITVQVSTLPIGHFMASVLPKTQFGIPGFGSKRFSLNPGPFNMKEHVLICIF  336

Query  425  ANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPV  604
            AN G + G G AY+IG + I+KA+Y + +SFL G ++++TTQ++GYGWAG+LR+Y+V+P 
Sbjct  337  ANAGSAFGNGSAYAIGIVNIIKAFYGRNISFLAGWLLIITTQVLGYGWAGLLRKYVVEPA  396

Query  605  DMWWPSNLAQVSLFRALHETEVKSS-GMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSW  781
             MWWPS L QVSLFRALHE + K+   MTR +FFL+++  SFV+Y +PGYLF  LT  SW
Sbjct  397  HMWWPSTLVQVSLFRALHEKDDKNDRRMTRAKFFLIILICSFVWYLVPGYLFTTLTSISW  456

Query  782  VCWV  793
            +CW+
Sbjct  457  ICWI  460


 Score =   183 bits (464),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 89/164 (54%), Positives = 117/164 (71%), Gaps = 3/164 (2%)
 Frame = +2

Query  71   NPATAGEKTAPSGGR-CPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFI  247
            N A  GE  A       P+EEV L V  TDDPTLPV TFR WFLG+ SC +L FLN FF 
Sbjct  19   NHAIKGENAAADDDELSPIEEVRLTVTNTDDPTLPVWTFRMWFLGLISCALLSFLNQFFA  78

Query  248  YRTQPLSISAILMQISVLPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITV  421
            YRT+PL I+ I +Q++ LPIG+FMAA LP R+F     G   F+LNPGPFN+KEHV+I++
Sbjct  79   YRTEPLIITQITVQVATLPIGQFMAAVLPRRQFKLPGVGSRKFSLNPGPFNMKEHVLISI  138

Query  422  MANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQL  553
             AN G + G G AY++G +TI+KA+Y++ +SFL G ++++TTQL
Sbjct  139  FANAGSAFGSGSAYAVGIVTIIKAFYQRKISFLAGWLLIITTQL  182



>gb|KFK29294.1| hypothetical protein AALP_AA7G114600 [Arabis alpina]
Length=735

 Score =   276 bits (705),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 138/242 (57%), Positives = 174/242 (72%), Gaps = 7/242 (3%)
 Frame = +2

Query  83   AGEKTA--PSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRT  256
            A E TA      RC V EV L VP+TDDPTLPVLTFR W LGI +CI+L F+N FF YRT
Sbjct  5    AAEFTAAMEDDDRCVVPEVELTVPKTDDPTLPVLTFRMWVLGIGACIVLSFINQFFWYRT  64

Query  257  QPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCG  436
             PLSI+ I  QI+V+P+G  MA  LP R+F    R  FTLNPG FN+KEHV+IT+ AN  
Sbjct  65   MPLSITGISAQIAVVPLGHLMARVLPTRRFCQGTRLEFTLNPGDFNVKEHVLITIFANS-  123

Query  437  VSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWW  616
               G G  Y+   ++ +K YYK++L FL   ++++TTQ++G+GWAG+ R++LV+P +MWW
Sbjct  124  ---GAGSVYATHILSAIKLYYKRSLPFLPAFLVMITTQILGFGWAGLFRKHLVEPGEMWW  180

Query  617  PSNLAQVSLFRALHETEVKSSG-MTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWV  793
            PSNL QVSLF ALHE E KS G M+R +FFL+V+ ASF YY LPGYLF +LT  SWVCW+
Sbjct  181  PSNLVQVSLFGALHEREKKSKGDMSRTQFFLIVLVASFAYYILPGYLFTMLTSISWVCWL  240

Query  794  WP  799
             P
Sbjct  241  NP  242



>gb|KDO76686.1| hypothetical protein CISIN_1g010747mg [Citrus sinensis]
Length=502

 Score =   270 bits (690),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 128/238 (54%), Positives = 166/238 (70%), Gaps = 5/238 (2%)
 Frame = +2

Query  89   EKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLS  268
            E         PV++VAL V   DD  LPVLTFR W LG  SC++L FLN FF YRT+PLS
Sbjct  43   EAVVEEEENSPVKQVALTVSTEDDTCLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLS  102

Query  269  ISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPG  448
            I+AI  QI+V+P+G+ MAA L +R F       FTLNPGPFN+KEHV+IT+ AN     G
Sbjct  103  ITAISAQIAVVPLGQLMAAKLTDRVFFKSTPLEFTLNPGPFNVKEHVLITIFANS----G  158

Query  449  GGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNL  628
             G  Y+I  +T++K +YKQ  +F   L++V TTQ++G+GWAG+ RRYLV+P  MWWP+NL
Sbjct  159  AGSVYAIHIVTVVKVFYKQHFTFFVSLLVVFTTQVLGFGWAGIFRRYLVEPAAMWWPANL  218

Query  629  AQVSLFRALHETEVKSS-GMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  799
             QVSLFRALHE E ++S G+TR +FF++    SF YY  PGYL  +LT  SW+CW++P
Sbjct  219  VQVSLFRALHEREKRASGGVTRTQFFMMGFVCSFAYYVFPGYLLEMLTSLSWICWIFP  276



>ref|XP_002267184.1| PREDICTED: oligopeptide transporter 1-like [Vitis vinifera]
Length=753

 Score =   276 bits (705),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 143/262 (55%), Positives = 183/262 (70%), Gaps = 16/262 (6%)
 Frame = +2

Query  17   TVPAQ*LSEHIVVEMSGLNPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWF  196
            T P     +H+ +E      AT  E+       CP+E+V L VP TDDPT PVLTFR W 
Sbjct  9    TQPKPQEQQHLDIE------ATGDEEV----NDCPIEQVRLTVPITDDPTEPVLTFRTWV  58

Query  197  LGITSCIILIFLNTFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFA-PFGRWSFT  373
            LG+ SC+IL F+N FF YR+  LSIS++  QI  LP+GKFMAATLPE+    P  +WSF+
Sbjct  59   LGVASCVILSFVNQFFGYRSNQLSISSVSAQIVTLPLGKFMAATLPEKPIKVPCTKWSFS  118

Query  374  LNPGPFNIKEHVIITVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQL  553
            LNPGPFNIKEHV+IT+ AN G     G  Y++G +TI+KA+YK++LS   G ++V TTQL
Sbjct  119  LNPGPFNIKEHVLITMFANSG----SGGVYAVGILTIVKAFYKRSLSPGAGYLLVQTTQL  174

Query  554  IGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFRALHETEVKSS-GMTRMRFFLLVMGASFV  730
            +GYGWAG+ R+YLVD   MWWPSNL QVSLFRALHE E +S  G+TR++FFL+V  +SF 
Sbjct  175  LGYGWAGLFRKYLVDSPYMWWPSNLVQVSLFRALHEKEKRSKGGLTRLQFFLIVFISSFA  234

Query  731  YYTLPGYLFPILTFFSWVCWVW  796
            YY +P YLFP +   S +C +W
Sbjct  235  YYLVPNYLFPSIGTVSIICLIW  256



>ref|XP_011078837.1| PREDICTED: oligopeptide transporter 7-like isoform X2 [Sesamum 
indicum]
Length=744

 Score =   276 bits (705),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 134/253 (53%), Positives = 171/253 (68%), Gaps = 5/253 (2%)
 Frame = +2

Query  38   SEHIVVEMSGLNPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCI  217
             E I   +    P  +   T+      PVE+VAL VP TDDPTLPV+TFR W LG  +C+
Sbjct  5    EEEISAPLIIHQPQASAASTSEEEENSPVEQVALTVPPTDDPTLPVVTFRMWTLGAAACV  64

Query  218  ILIFLNTFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNI  397
            +L FLN FF YR +PLSI+AI  QI+V+P+G  MAA LP R F    +W F+ NPG FN+
Sbjct  65   MLSFLNQFFWYRREPLSITAISAQIAVVPLGHLMAAALPRRVFFEGQKWEFSFNPGKFNV  124

Query  398  KEHVIITVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGV  577
            KEHV+IT+ AN G +    + YSI  ++ +K +Y Q L+F   L +VLTTQ++G+GWAG+
Sbjct  125  KEHVLITIFANAGAA----NPYSIHIVSAVKIFYGQKLTFWVALGVVLTTQVLGFGWAGL  180

Query  578  LRRYLVDPVDMWWPSNLAQVSLFRALHETEVKSSG-MTRMRFFLLVMGASFVYYTLPGYL  754
             RRYLV+P  MWWP NL QVSLFRALHE EV+  G +TR +FFL+    SF YY  PGYL
Sbjct  181  FRRYLVEPASMWWPQNLVQVSLFRALHEKEVRDRGALTRNQFFLIAFLCSFAYYVFPGYL  240

Query  755  FPILTFFSWVCWV  793
            FP LT  SW+CW+
Sbjct  241  FPKLTSVSWLCWI  253



>ref|XP_010053083.1| PREDICTED: oligopeptide transporter 7 [Eucalyptus grandis]
Length=751

 Score =   276 bits (705),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 128/230 (56%), Positives = 170/230 (74%), Gaps = 5/230 (2%)
 Frame = +2

Query  113  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  292
              PV +VAL V  TDDP+LPVLTFR W LG  SC++L FLN FF YRT+PL+I+AI  QI
Sbjct  41   NSPVPQVALTVQTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLTITAISAQI  100

Query  293  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            +V+P+G+ MAA + +R F    RW FTLNPGPFN+KEHV+IT+ AN     G G  Y+I 
Sbjct  101  AVVPLGRLMAARITDRVFLKGTRWEFTLNPGPFNVKEHVLITIFANS----GAGTVYAIY  156

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFRA  652
             +T++K +YK+ ++F   LI+V+TTQ++G+GWAG+ R+YLV+P  MWWP+NL QVSLFRA
Sbjct  157  VVTVVKVFYKKQITFFVSLIVVITTQVLGFGWAGIFRKYLVEPAAMWWPANLVQVSLFRA  216

Query  653  LHETEVK-SSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  799
            LHE E +   G+TR +FFL+    SF YY  PGY+F +LT  SW+CW++P
Sbjct  217  LHEKEERPKGGVTRTQFFLIAFICSFAYYVFPGYIFEMLTSMSWICWIFP  266



>ref|XP_004147543.1| PREDICTED: oligopeptide transporter 4-like [Cucumis sativus]
 ref|XP_004170983.1| PREDICTED: oligopeptide transporter 4-like [Cucumis sativus]
Length=738

 Score =   275 bits (704),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 130/244 (53%), Positives = 175/244 (72%), Gaps = 4/244 (2%)
 Frame = +2

Query  74   PATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYR  253
            P +  +  A      P+E+V L V  +DDPTLPV TFR W LG+ SC +L FLN FF YR
Sbjct  8    PLSGSDPAADDDDISPIEQVRLTVTNSDDPTLPVWTFRMWTLGLLSCALLSFLNQFFYYR  67

Query  254  TQPLSISAILMQISVLPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVMA  427
            T+PL I+ I +Q++ LPIG+FMAA LP  +F    FG   F+LNPGPFN+KEHV+I++ A
Sbjct  68   TEPLIITQITVQVATLPIGQFMAAVLPASRFRLPGFGSRRFSLNPGPFNMKEHVLISIFA  127

Query  428  NCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVD  607
            N G + GGG AY++G + I+KA+Y + +SF+   ++++TTQ++GYGWAG+LR+Y+V+P  
Sbjct  128  NAGTAFGGGSAYAVGIVNIIKAFYGRNISFVAAWLLIVTTQVLGYGWAGLLRKYVVEPAH  187

Query  608  MWWPSNLAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVC  787
            MWWPS L QVSLFRALHE E     M+R +FFL+ +  SF +Y +PGYLFP LT  SWVC
Sbjct  188  MWWPSTLVQVSLFRALHEKE--DCRMSRGKFFLIALICSFSWYVIPGYLFPTLTSISWVC  245

Query  788  WVWP  799
            W +P
Sbjct  246  WAFP  249



>ref|XP_009790410.1| PREDICTED: oligopeptide transporter 4 [Nicotiana sylvestris]
Length=738

 Score =   275 bits (704),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 133/241 (55%), Positives = 175/241 (73%), Gaps = 8/241 (3%)
 Frame = +2

Query  74   PATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYR  253
            PA A +    S    P+EEV L V  TDDPTLPV TFR WFLG+ SC +L FLN FF YR
Sbjct  12   PAGAADDDDES----PIEEVRLTVTNTDDPTLPVWTFRMWFLGLFSCCLLSFLNQFFSYR  67

Query  254  TQPLSISAILMQISVLPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVMA  427
            T+PL I+ I +Q++ LPIG F+A  LP  KF    FG  SF+LNPGPFN+KEHV+I++ A
Sbjct  68   TEPLVITQITVQVATLPIGHFLATVLPTTKFRLPGFGSRSFSLNPGPFNMKEHVLISIFA  127

Query  428  NCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVD  607
            N G + G G AY++G +TI+KA+Y + +SFL G ++++TTQ++GYGWAG+LR+Y+V+P  
Sbjct  128  NAGSAFGNGSAYAVGIVTIIKAFYHRNISFLAGWLLIITTQVLGYGWAGLLRKYVVEPAH  187

Query  608  MWWPSNLAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVC  787
            MWWPS L QVSLFRALHE + +   M+R +FFL+ +  SF +Y +PGYLF  LT  SW+C
Sbjct  188  MWWPSTLVQVSLFRALHEKDDRR--MSRAKFFLIALVCSFCWYLVPGYLFSTLTSISWIC  245

Query  788  W  790
            W
Sbjct  246  W  246



>ref|XP_011078828.1| PREDICTED: oligopeptide transporter 7-like isoform X1 [Sesamum 
indicum]
Length=751

 Score =   276 bits (705),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 132/242 (55%), Positives = 168/242 (69%), Gaps = 5/242 (2%)
 Frame = +2

Query  71   NPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIY  250
             P  +   T+      PVE+VAL VP TDDPTLPV+TFR W LG  +C++L FLN FF Y
Sbjct  23   QPQASAASTSEEEENSPVEQVALTVPPTDDPTLPVVTFRMWTLGAAACVMLSFLNQFFWY  82

Query  251  RTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMAN  430
            R +PLSI+AI  QI+V+P+G  MAA LP R F    +W F+ NPG FN+KEHV+IT+ AN
Sbjct  83   RREPLSITAISAQIAVVPLGHLMAAALPRRVFFEGQKWEFSFNPGKFNVKEHVLITIFAN  142

Query  431  CGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDM  610
             G +    + YSI  ++ +K +Y Q L+F   L +VLTTQ++G+GWAG+ RRYLV+P  M
Sbjct  143  AGAA----NPYSIHIVSAVKIFYGQKLTFWVALGVVLTTQVLGFGWAGLFRRYLVEPASM  198

Query  611  WWPSNLAQVSLFRALHETEVKSSG-MTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVC  787
            WWP NL QVSLFRALHE EV+  G +TR +FFL+    SF YY  PGYLFP LT  SW+C
Sbjct  199  WWPQNLVQVSLFRALHEKEVRDRGALTRNQFFLIAFLCSFAYYVFPGYLFPKLTSVSWLC  258

Query  788  WV  793
            W+
Sbjct  259  WI  260



>ref|XP_006380596.1| hypothetical protein POPTR_0007s09650g [Populus trichocarpa]
 gb|ERP58393.1| hypothetical protein POPTR_0007s09650g [Populus trichocarpa]
Length=750

 Score =   275 bits (704),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 128/233 (55%), Positives = 169/233 (73%), Gaps = 5/233 (2%)
 Frame = +2

Query  104  SGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAIL  283
            S    P+E+VAL VP TDDPTLP +TFR W LG  +CI+L FLN FF YR +PLSI++I 
Sbjct  33   SKENSPIEQVALTVPTTDDPTLPAVTFRTWTLGSLACILLSFLNQFFWYRREPLSITSIC  92

Query  284  MQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAY  463
             QI+V+P+G  MA+T+  + F    +W FTLNPGPFN+KEHV+IT+ AN     G G+ Y
Sbjct  93   AQIAVVPLGHLMASTITNKTFFIGKKWEFTLNPGPFNVKEHVLITIFANS----GAGNVY  148

Query  464  SIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSL  643
            +I  ++ +K +YK+ L+F   L++VLTTQ++G+GWAG+ RRYLV+P  MWWP NL QVSL
Sbjct  149  AIHIVSAVKLFYKKELTFFVALLVVLTTQMLGFGWAGLFRRYLVEPASMWWPQNLVQVSL  208

Query  644  FRALHETEVK-SSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  799
            FRALHE E +   G+TR +FF++    SF YY  PGYLFP LT  SW+CW++P
Sbjct  209  FRALHEKEERHKDGLTRNQFFIIAFICSFAYYAFPGYLFPKLTSISWLCWIFP  261



>ref|XP_007039133.1| Oligopeptide transporter 1 isoform 2 [Theobroma cacao]
 gb|EOY23634.1| Oligopeptide transporter 1 isoform 2 [Theobroma cacao]
Length=613

 Score =   272 bits (696),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 128/230 (56%), Positives = 171/230 (74%), Gaps = 5/230 (2%)
 Frame = +2

Query  113  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  292
             CPV++V L VP+TDDPTLP +TFR W LG+ + +IL F+N FF YR  PL+I++I   I
Sbjct  17   ECPVKQVELTVPKTDDPTLPAVTFRMWVLGLGTSVILSFVNQFFWYRKMPLNITSISAMI  76

Query  293  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            +V+P+G  MA TLP R+F    RW FT+NPGPFN+KEHV+IT+ AN     G G  Y+  
Sbjct  77   AVVPLGHLMARTLPHRRFLSNTRWEFTMNPGPFNMKEHVLITIFANS----GAGTVYATH  132

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFRA  652
             ++ +K YYK+ L+FL  L++++TTQ++G+GWAG+ R+YLV+P +MWWPSNL  VSLFRA
Sbjct  133  ILSAVKLYYKRKLTFLPALLVMITTQVLGFGWAGIFRKYLVEPGEMWWPSNLVMVSLFRA  192

Query  653  LHETEVKSSGMTRM-RFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  799
            LHE E ++ G T + +FFLLV+ +SF YY LPGYLF  LT FSWVCW+ P
Sbjct  193  LHEKEKRAKGGTTLNQFFLLVLISSFAYYVLPGYLFSTLTSFSWVCWLAP  242



>ref|XP_003555686.1| PREDICTED: oligopeptide transporter 7 [Glycine max]
Length=749

 Score =   275 bits (704),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 127/230 (55%), Positives = 170/230 (74%), Gaps = 5/230 (2%)
 Frame = +2

Query  113  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  292
              P+++VAL VP TDDP+LPVLTFR W LG  SC++L FLN FF YR QPL+I+AI  QI
Sbjct  38   NSPIKQVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRIQPLTITAISAQI  97

Query  293  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            +V+P+G+ MAAT+ +R F    RW FTLNPGPFN+KEHV+IT+ AN     G G  Y+I 
Sbjct  98   AVVPLGQLMAATITKRVFFRGTRWEFTLNPGPFNVKEHVLITIFANS----GAGTVYAIH  153

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFRA  652
             +T +K +Y + +SF   L++V+TTQ++G+GWAG+ RRYLV+P  MWWP+NL QVSLFRA
Sbjct  154  VVTAVKIFYHKHISFFVSLLVVITTQVLGFGWAGIFRRYLVEPAAMWWPANLVQVSLFRA  213

Query  653  LHETEVK-SSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  799
            LHE + +   G+TR +FF++    SF YY  PGY+F +LT  SW+CW++P
Sbjct  214  LHEKDERPKGGLTRSQFFVIAFLCSFAYYVFPGYIFQMLTSLSWICWLYP  263



>ref|XP_010065750.1| PREDICTED: oligopeptide transporter 4-like [Eucalyptus grandis]
 gb|KCW63397.1| hypothetical protein EUGRSUZ_G01043 [Eucalyptus grandis]
Length=752

 Score =   275 bits (704),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 129/243 (53%), Positives = 174/243 (72%), Gaps = 4/243 (2%)
 Frame = +2

Query  71   NPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIY  250
             PA   +         P+EEV L V  TDDPTLPV TFR WFLG+ SC +L FLN FF Y
Sbjct  21   KPAAPNDVDDAEDDLSPIEEVRLTVTNTDDPTLPVWTFRMWFLGVLSCALLSFLNQFFAY  80

Query  251  RTQPLSISAILMQISVLPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVM  424
            RT+PL I+ I +Q++ LPIG+FMAA LP  KF     G  +F+LNPGPFN+KEHV+I++ 
Sbjct  81   RTEPLVITQITVQVATLPIGRFMAAVLPTAKFRIPGLGPRTFSLNPGPFNMKEHVLISIF  140

Query  425  ANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPV  604
            AN G + G G AY++  + I+KA+Y +++SF  G ++++TTQ++GYGWAG+LR+Y+V+P 
Sbjct  141  ANAGSAFGSGSAYAVSIVNIIKAFYVRSISFFAGWLLIITTQVLGYGWAGLLRKYVVEPA  200

Query  605  DMWWPSNLAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWV  784
             MWWPS L QVSLFRALHE + +   M+R +FF++ +  SF +Y +PGYLFP LT  SWV
Sbjct  201  HMWWPSTLVQVSLFRALHEKDDQR--MSRAKFFVIALTCSFSWYVVPGYLFPTLTSISWV  258

Query  785  CWV  793
            CW+
Sbjct  259  CWI  261



>gb|KJB40153.1| hypothetical protein B456_007G049100 [Gossypium raimondii]
Length=753

 Score =   275 bits (704),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 126/230 (55%), Positives = 169/230 (73%), Gaps = 5/230 (2%)
 Frame = +2

Query  113  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  292
             CP+E+VAL VP  DDP+LP LTFR W LG  +C++L FLN FF YR +PLSIS+I  QI
Sbjct  39   NCPIEQVALTVPTADDPSLPTLTFRTWILGTLACLLLSFLNQFFWYRREPLSISSISAQI  98

Query  293  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            +V+P+G  +AAT+ +R F    ++ FTLNPGPFN+KEHV++T+  N     G G+ Y+I 
Sbjct  99   AVVPLGHLLAATVTDRVFFKDRKFEFTLNPGPFNVKEHVLVTIFGNS----GAGNVYAIH  154

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFRA  652
             +T +K +YK+ +SFL  L++V TTQ++G+GWAG+ RRYLV+P  MWWP NL QVSLFRA
Sbjct  155  LVTAVKIFYKKRMSFLVALLVVFTTQVLGFGWAGIFRRYLVEPAAMWWPQNLVQVSLFRA  214

Query  653  LHETEVKSSG-MTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  799
            LHE E ++ G +TR +FFL+    SF YY +PGYL P L+  SW+CWV+P
Sbjct  215  LHEKEERAKGRLTRNQFFLIAFTCSFAYYVIPGYLVPTLSSLSWICWVFP  264



>gb|KCW53167.1| hypothetical protein EUGRSUZ_J02449 [Eucalyptus grandis]
Length=602

 Score =   271 bits (694),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 123/228 (54%), Positives = 167/228 (73%), Gaps = 5/228 (2%)
 Frame = +2

Query  119  PVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISV  298
            P+E+VAL VPE DDP+LP +TFR + LG  +C +L FLN FF YR +PLS++++  QI+V
Sbjct  41   PIEQVALTVPEEDDPSLPAVTFRTFVLGTLACSLLSFLNQFFWYRREPLSVTSVSAQIAV  100

Query  299  LPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIGAI  478
            +P+G  +A  + +R F    +W FTLNPGPFN+KEHV+IT+ AN     G    Y+I  I
Sbjct  101  VPLGHLLAGVITKRVFFEGSKWQFTLNPGPFNVKEHVLITIFANS----GAASVYAIHII  156

Query  479  TIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFRALH  658
            +++K +Y++ +SFL  L++VLTTQ++G+GWAG+ RRYLV+P  MWWP NL QVSLFRALH
Sbjct  157  SVVKIFYRKEMSFLVALVVVLTTQILGFGWAGMFRRYLVEPAAMWWPQNLVQVSLFRALH  216

Query  659  ETEVKSSG-MTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  799
            E E +  G +TR  FFL+    SF YY LPGYLFP+LT  SW+CW++P
Sbjct  217  EKEQRLKGRLTRNHFFLIAFVCSFSYYVLPGYLFPMLTSLSWICWIFP  264



>ref|XP_010644607.1| PREDICTED: oligopeptide transporter 1-like [Vitis vinifera]
Length=745

 Score =   275 bits (703),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 138/249 (55%), Positives = 180/249 (72%), Gaps = 9/249 (4%)
 Frame = +2

Query  56   EMSGLNPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLN  235
            E++  N    G++       CP+E+V L VP TDDPT PVLTFR W LG+ +C+IL F+N
Sbjct  7    EVTQKNFKVDGDEEE---NDCPIEQVRLTVPITDDPTEPVLTFRTWVLGVAACVILSFVN  63

Query  236  TFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFA-PFGRWSFTLNPGPFNIKEHVI  412
             FF YR+  LSIS++  QI  LP+GKFMAATLPE+    P  +WSF+LNPGPFNIKEHV+
Sbjct  64   QFFGYRSNQLSISSVSAQIVTLPLGKFMAATLPEKPIKVPCTKWSFSLNPGPFNIKEHVL  123

Query  413  ITVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYL  592
            IT+ AN G     G  Y++G +TI+KA+YK++LS   G ++V TTQL+GYGWAG+ R+YL
Sbjct  124  ITMFANSG----SGGVYAVGILTIVKAFYKRSLSPGAGYLLVQTTQLLGYGWAGLFRKYL  179

Query  593  VDPVDMWWPSNLAQVSLFRALHETEVKSS-GMTRMRFFLLVMGASFVYYTLPGYLFPILT  769
            VD   MWWPSNL QVSLFRALHE E +S  G+TR++FFL+V  +SF YY +P YLFP ++
Sbjct  180  VDSPYMWWPSNLVQVSLFRALHEKEKRSKGGVTRLQFFLIVFISSFAYYLVPNYLFPSIS  239

Query  770  FFSWVCWVW  796
              S +C +W
Sbjct  240  TVSIICLIW  248



>ref|XP_002518892.1| Oligopeptide transporter, putative [Ricinus communis]
 gb|EEF43425.1| Oligopeptide transporter, putative [Ricinus communis]
Length=760

 Score =   275 bits (703),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 129/238 (54%), Positives = 173/238 (73%), Gaps = 5/238 (2%)
 Frame = +2

Query  89   EKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLS  268
            ++   +    PV++VAL V  TDD +LPVLTFR WFLG  SCI+L FLN FF YRT+PLS
Sbjct  39   QQLQETEENSPVKQVALTVSTTDDTSLPVLTFRMWFLGAISCILLSFLNQFFWYRTEPLS  98

Query  269  ISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPG  448
            I+AI  QI+V+P+G+ MAA + +R F    R  FTLNPGPFN+KEHV+IT+ AN     G
Sbjct  99   ITAISAQIAVVPLGQLMAAKITDRVFFKGTRCEFTLNPGPFNVKEHVLITIFANS----G  154

Query  449  GGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNL  628
             G  Y+I  +T++K +YK+ ++F    I+++TTQ++G+GWAG+ RRYLV+P  MWWP+NL
Sbjct  155  AGSVYAIHVVTVVKVFYKKHITFFVSFIVIITTQVLGFGWAGIFRRYLVEPAAMWWPANL  214

Query  629  AQVSLFRALHETEVK-SSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  799
             QVSLFRALHE E +   G+TR++FFL+    SF YY  PGYLF +LT  SW+CW++P
Sbjct  215  VQVSLFRALHEKEERPKGGVTRIQFFLIAFICSFAYYFFPGYLFQMLTSLSWICWIFP  272



>ref|XP_002447030.1| hypothetical protein SORBIDRAFT_06g027230 [Sorghum bicolor]
 gb|EES11358.1| hypothetical protein SORBIDRAFT_06g027230 [Sorghum bicolor]
Length=736

 Score =   274 bits (701),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 131/241 (54%), Positives = 175/241 (73%), Gaps = 4/241 (2%)
 Frame = +2

Query  77   ATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRT  256
            A  GE+    G    VE+V L VP TDDPTLPV TFR W +GI SC +L F N FF YRT
Sbjct  12   AAVGEEE-DDGDVALVEQVRLTVPTTDDPTLPVWTFRMWTIGIVSCALLSFFNQFFAYRT  70

Query  257  QPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCG  436
            +P+ IS I +Q++ LP+G FMA  LPE K +  GR  +T+NPGPFN+KEHV+I + AN G
Sbjct  71   EPIIISQITVQVAALPVGHFMARVLPETKRSALGR-EWTMNPGPFNVKEHVLICIFANAG  129

Query  437  VSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWW  616
             + G G AY++  I I+KA+YK+ +SF+ GL++++TTQ++GYGWAG+LR+Y+V+P  MWW
Sbjct  130  TAFGNGGAYAVLIIDIIKAFYKRNISFVVGLLLIITTQVLGYGWAGLLRKYVVEPAQMWW  189

Query  617  PSNLAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVW  796
            P +L QVSL RALHE E +  GMTR +FFL+ +  SF +Y +PGYLFP ++  SWVCW +
Sbjct  190  PQSLVQVSLLRALHEKEER--GMTRGKFFLIALICSFAWYLVPGYLFPTISTVSWVCWAF  247

Query  797  P  799
            P
Sbjct  248  P  248



>ref|XP_007200086.1| hypothetical protein PRUPE_ppa021086mg [Prunus persica]
 gb|EMJ01285.1| hypothetical protein PRUPE_ppa021086mg [Prunus persica]
Length=743

 Score =   274 bits (701),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 130/237 (55%), Positives = 170/237 (72%), Gaps = 4/237 (2%)
 Frame = +2

Query  89   EKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLS  268
            +  A      P+E+V L V  TDDPTLPV TFR WFLG+ SC +L FLN FF YRT+PL 
Sbjct  19   DSDAEDDDVSPIEQVRLTVTNTDDPTLPVWTFRMWFLGLLSCALLSFLNQFFSYRTEPLI  78

Query  269  ISAILMQISVLPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVMANCGVS  442
            I+ I +Q+S LPIG FMA  LP  KF    FG  SF+LNPGPFNIKEHV+IT+ AN G +
Sbjct  79   ITQITVQVSTLPIGNFMAKVLPTNKFHIPGFGSRSFSLNPGPFNIKEHVLITIFANAGSA  138

Query  443  PGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPS  622
             G G AY++G + I+KA+Y++ +S L   ++++TTQ++GYGWAG+LR+Y+V+P  MWWP+
Sbjct  139  FGLGSAYAVGIVNIIKAFYRRKISLLASWLLIITTQVLGYGWAGLLRKYVVEPAHMWWPN  198

Query  623  NLAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWV  793
             L QVSLFRALHE + +   M+R +FFL+ +  SF +Y  PGYLF  LT  SWVCW+
Sbjct  199  TLVQVSLFRALHEKDEQR--MSRAKFFLIALVCSFTWYAFPGYLFTTLTNISWVCWL  253



>ref|XP_009143920.1| PREDICTED: oligopeptide transporter 6 [Brassica rapa]
Length=735

 Score =   274 bits (701),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 133/230 (58%), Positives = 170/230 (74%), Gaps = 5/230 (2%)
 Frame = +2

Query  113  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  292
            RC V EV L VP+TDDP+LPVLTFR W LGI +CI+L F+N FF YRT PLSI+ I  QI
Sbjct  17   RCVVPEVELTVPKTDDPSLPVLTFRMWVLGIGACIVLSFINQFFWYRTMPLSITGISAQI  76

Query  293  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            +V+P+G  MA  LP R+F    R+ FTLNPG FN+KEHV+IT+ AN     G G  Y+  
Sbjct  77   AVVPLGHLMARVLPTRRFLEGTRFQFTLNPGAFNVKEHVLITIFANS----GAGSVYATH  132

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFRA  652
             ++ +K YYK++L FL   ++++TTQ++G+GWAG+ R++LV+P +MWWPSNL QVSLF A
Sbjct  133  ILSAIKLYYKRSLPFLPAFLVMITTQILGFGWAGLFRKHLVEPGEMWWPSNLVQVSLFGA  192

Query  653  LHETEVKSSG-MTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  799
            LHE E KS G M+R +FFL+V+ ASF YY LPGYLF +LT  SWVCW  P
Sbjct  193  LHEKEKKSKGHMSRTQFFLIVLVASFAYYILPGYLFTMLTSISWVCWFNP  242



>ref|XP_003601453.1| Oligopeptide transporter [Medicago truncatula]
Length=741

 Score =   274 bits (701),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 127/238 (53%), Positives = 171/238 (72%), Gaps = 5/238 (2%)
 Frame = +2

Query  89   EKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLS  268
             K   S    P+++VAL VP TDDP+LPVLTFR W LG  SC++L FLN FF YRT+PL+
Sbjct  22   SKKNDSEENSPIKQVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLT  81

Query  269  ISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPG  448
            I+AI  QI+V+P+G+ MA+ + +R F     W FTLNPGPFN+KEHV+IT+ AN     G
Sbjct  82   ITAISAQIAVVPLGQLMASKITKRVFFKGKSWEFTLNPGPFNVKEHVLITIFANS----G  137

Query  449  GGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNL  628
             G  Y+I  +T +K +Y Q ++F    ++++TTQ++G+GWAG+ RRYLV+P  MWWP+NL
Sbjct  138  AGTVYAIHIVTAVKVFYHQHITFCVSFLVIITTQVLGFGWAGIFRRYLVEPAAMWWPANL  197

Query  629  AQVSLFRALHETEVKSS-GMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  799
             QVSLFRALHE E ++  G+TR +FF++    SF YY  PGYLF +LT  SW+CWV+P
Sbjct  198  VQVSLFRALHEKEERTKGGLTRSQFFVISFLCSFAYYVFPGYLFQMLTSLSWICWVFP  255



>emb|CBI39770.3| unnamed protein product [Vitis vinifera]
Length=749

 Score =   274 bits (701),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 138/249 (55%), Positives = 180/249 (72%), Gaps = 9/249 (4%)
 Frame = +2

Query  56   EMSGLNPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLN  235
            E++  N    G++       CP+E+V L VP TDDPT PVLTFR W LG+ +C+IL F+N
Sbjct  7    EVTQKNFKVDGDEEE---NDCPIEQVRLTVPITDDPTEPVLTFRTWVLGVAACVILSFVN  63

Query  236  TFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFA-PFGRWSFTLNPGPFNIKEHVI  412
             FF YR+  LSIS++  QI  LP+GKFMAATLPE+    P  +WSF+LNPGPFNIKEHV+
Sbjct  64   QFFGYRSNQLSISSVSAQIVTLPLGKFMAATLPEKPIKVPCTKWSFSLNPGPFNIKEHVL  123

Query  413  ITVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYL  592
            IT+ AN G     G  Y++G +TI+KA+YK++LS   G ++V TTQL+GYGWAG+ R+YL
Sbjct  124  ITMFANSG----SGGVYAVGILTIVKAFYKRSLSPGAGYLLVQTTQLLGYGWAGLFRKYL  179

Query  593  VDPVDMWWPSNLAQVSLFRALHETEVKSS-GMTRMRFFLLVMGASFVYYTLPGYLFPILT  769
            VD   MWWPSNL QVSLFRALHE E +S  G+TR++FFL+V  +SF YY +P YLFP ++
Sbjct  180  VDSPYMWWPSNLVQVSLFRALHEKEKRSKGGVTRLQFFLIVFISSFAYYLVPNYLFPSIS  239

Query  770  FFSWVCWVW  796
              S +C +W
Sbjct  240  TVSIICLIW  248



>ref|XP_004502063.1| PREDICTED: oligopeptide transporter 7-like [Cicer arietinum]
Length=740

 Score =   274 bits (701),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 127/244 (52%), Positives = 174/244 (71%), Gaps = 5/244 (2%)
 Frame = +2

Query  71   NPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIY  250
            +P  + E+        P+++VAL VP TDDP+LPVLTFR W LG  SC++L FLN FF Y
Sbjct  15   SPLLSKEEDEKLEENSPIKQVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWY  74

Query  251  RTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMAN  430
            RT+PL+I+AI  QI+V+P+G+ MA+ + +R F     W FTLNPGPFN+KEHV+IT+ AN
Sbjct  75   RTEPLTITAISAQIAVVPLGQLMASKITKRVFFKGTSWEFTLNPGPFNVKEHVLITIFAN  134

Query  431  CGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDM  610
                 G G  Y+I  +T +K +Y + +SF   L++V+TTQ++G+GWAG+ RRYLV+P  M
Sbjct  135  S----GAGTVYAIHIVTAVKVFYHKHISFSVSLLVVITTQVLGFGWAGIFRRYLVEPAAM  190

Query  611  WWPSNLAQVSLFRALHETEVK-SSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVC  787
            WWP+NL QVSLFRALHE E +   G+TR +FF++    SF YY  PGY+F +LT  SW+C
Sbjct  191  WWPANLVQVSLFRALHEKEERPKGGLTRSQFFVIAFFCSFAYYVFPGYIFQMLTSLSWIC  250

Query  788  WVWP  799
            W++P
Sbjct  251  WIFP  254



>ref|XP_002518328.1| Oligopeptide transporter, putative [Ricinus communis]
 gb|EEF44088.1| Oligopeptide transporter, putative [Ricinus communis]
Length=754

 Score =   274 bits (701),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 133/228 (58%), Positives = 174/228 (76%), Gaps = 2/228 (1%)
 Frame = +2

Query  116  CPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQIS  295
             P+EEV L V  TDDPTLPV TFR WFLG+ SC +L FLN FF YRT+PL I+ I +Q++
Sbjct  36   SPIEEVRLTVSNTDDPTLPVWTFRMWFLGLLSCGLLSFLNQFFAYRTEPLVITQITVQVA  95

Query  296  VLPIGKFMAATLPERKF--APFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSI  469
             LPIG F+A+ LP+ KF  A FG  +F+LNPGPFN+KEHV+I++ AN G + G G AY++
Sbjct  96   TLPIGHFLASVLPKTKFRIAGFGSKTFSLNPGPFNMKEHVLISIFANAGSAFGSGSAYAV  155

Query  470  GAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFR  649
            G +TI+KA+Y++ +SF    I+++TTQ++GYGWAG+LR+Y+V+P  MWWPS L QVSLFR
Sbjct  156  GIVTIIKAFYQRKISFFASWILIVTTQVLGYGWAGLLRKYVVEPAHMWWPSTLVQVSLFR  215

Query  650  ALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWV  793
            ALHE + K  GMTR +FFL+ +  SF +Y +PGYLF  LT  SWVCWV
Sbjct  216  ALHEKDDKGQGMTRAKFFLIALVCSFSWYVVPGYLFTTLTSISWVCWV  263



>gb|AES71704.2| oligopeptide transporter OPT family protein [Medicago truncatula]
Length=737

 Score =   274 bits (700),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 127/238 (53%), Positives = 171/238 (72%), Gaps = 5/238 (2%)
 Frame = +2

Query  89   EKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLS  268
             K   S    P+++VAL VP TDDP+LPVLTFR W LG  SC++L FLN FF YRT+PL+
Sbjct  18   SKKNDSEENSPIKQVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLT  77

Query  269  ISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPG  448
            I+AI  QI+V+P+G+ MA+ + +R F     W FTLNPGPFN+KEHV+IT+ AN     G
Sbjct  78   ITAISAQIAVVPLGQLMASKITKRVFFKGKSWEFTLNPGPFNVKEHVLITIFANS----G  133

Query  449  GGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNL  628
             G  Y+I  +T +K +Y Q ++F    ++++TTQ++G+GWAG+ RRYLV+P  MWWP+NL
Sbjct  134  AGTVYAIHIVTAVKVFYHQHITFCVSFLVIITTQVLGFGWAGIFRRYLVEPAAMWWPANL  193

Query  629  AQVSLFRALHETEVKSS-GMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  799
             QVSLFRALHE E ++  G+TR +FF++    SF YY  PGYLF +LT  SW+CWV+P
Sbjct  194  VQVSLFRALHEKEERTKGGLTRSQFFVISFLCSFAYYVFPGYLFQMLTSLSWICWVFP  251



>ref|XP_004235114.1| PREDICTED: oligopeptide transporter 6 [Solanum lycopersicum]
Length=738

 Score =   274 bits (700),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 130/240 (54%), Positives = 173/240 (72%), Gaps = 5/240 (2%)
 Frame = +2

Query  83   AGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQP  262
            + E+T      CP++EV + VP+TDDPT+PVLTFR W LGITSCI+L F+N FF YRTQP
Sbjct  12   SKEETNNDDEECPIKEVEMTVPKTDDPTIPVLTFRMWLLGITSCILLSFVNQFFWYRTQP  71

Query  263  LSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVS  442
            L+IS+  +QI+V+PIG  MA  + +R F     W+FTLNPG FNIKEHV+IT+ AN    
Sbjct  72   LTISSTAVQIAVVPIGHLMAKIITKRVFFEGTSWAFTLNPGRFNIKEHVLITIFANA---  128

Query  443  PGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPS  622
             G G  Y+   ++ +K YYK+ L F   L+I++TTQ++G+GWAG+ R+ LV+P +MWWP 
Sbjct  129  -GAGTVYATHILSAVKLYYKRPLDFFPALLIMVTTQMLGFGWAGIFRKLLVEPAEMWWPG  187

Query  623  NLAQVSLFRALHETEVKSS-GMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  799
            +L QVSLFRALHE E ++  G TR++FFL+ +  SF YY  PGYLF +LT FSW+CW  P
Sbjct  188  SLVQVSLFRALHEKENRAKGGTTRIQFFLIALVFSFAYYVFPGYLFQMLTSFSWLCWFAP  247



>ref|XP_010482752.1| PREDICTED: oligopeptide transporter 9 [Camelina sativa]
Length=741

 Score =   274 bits (700),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 130/230 (57%), Positives = 169/230 (73%), Gaps = 5/230 (2%)
 Frame = +2

Query  113  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  292
            RC VEEV L VP+TDDPTLPVLTFR W LG+ +CIIL F+N FF YR  PL+I+ I  QI
Sbjct  23   RCVVEEVELTVPKTDDPTLPVLTFRMWTLGLGACIILSFVNQFFWYRQMPLTITGISAQI  82

Query  293  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            +V+P+G  MA  LP R F    +W F++NPGPFN+KEHV+IT+ AN     G G  Y+  
Sbjct  83   AVVPLGHLMAKVLPTRMFFEGSKWEFSMNPGPFNVKEHVLITIFANS----GAGTVYATH  138

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFRA  652
             ++ +K YYK++L FL   ++++TTQ +G+GWAG+ R++LV+P +MWWPSNL QVSLF A
Sbjct  139  ILSAIKLYYKRSLPFLPAFLLMITTQFLGFGWAGLFRKHLVEPGEMWWPSNLVQVSLFNA  198

Query  653  LHETEVK-SSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  799
            LHE E K   GMTR++FFL+V+  SF YY LPGYLF ++T  SWVCW+ P
Sbjct  199  LHEKEKKRKGGMTRIQFFLIVLVTSFAYYILPGYLFTMITSISWVCWLSP  248



>ref|XP_010039447.1| PREDICTED: oligopeptide transporter 3-like isoform X2 [Eucalyptus 
grandis]
Length=704

 Score =   273 bits (698),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 128/181 (71%), Positives = 151/181 (83%), Gaps = 1/181 (1%)
 Frame = +2

Query  257  QPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCG  436
            +P++    + +I+VLPIGKFMA  LP +++  FG +SFTLNPGPFNIKEHV+IT+ ANCG
Sbjct  34   RPVTSGDDIPRITVLPIGKFMARALPAKRYRFFG-YSFTLNPGPFNIKEHVLITIFANCG  92

Query  437  VSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWW  616
            V+ GG DAYSIG IT+MK YYKQ LSFLC LIIVLTTQL GYGWAG+ R+YLVDP +MWW
Sbjct  93   VATGGVDAYSIGPITVMKTYYKQNLSFLCALIIVLTTQLAGYGWAGMFRKYLVDPAEMWW  152

Query  617  PSNLAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVW  796
            P+NLAQVSLFRALHE E KS G+TRM+FFL+ +  SF YY LPGYLFP+LTFFSWVCW W
Sbjct  153  PANLAQVSLFRALHEKEHKSKGLTRMQFFLIALAVSFAYYVLPGYLFPVLTFFSWVCWAW  212

Query  797  P  799
            P
Sbjct  213  P  213



>ref|XP_011078507.1| PREDICTED: oligopeptide transporter 4-like [Sesamum indicum]
Length=754

 Score =   274 bits (701),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 133/245 (54%), Positives = 179/245 (73%), Gaps = 9/245 (4%)
 Frame = +2

Query  71   NPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIY  250
             PA   E+        PVE+V L VP  DDPTLPV TFR WFLG+ SC++L FLNTFF Y
Sbjct  28   EPAVDDEEEV-----SPVEQVRLTVPNEDDPTLPVWTFRMWFLGLFSCMLLSFLNTFFSY  82

Query  251  RTQPLSISAILMQISVLPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVM  424
            R++PL I+ I +Q++ LPIG+FMA  LP  KF    FG   F+LNPGPFN+KEHV+I++ 
Sbjct  83   RSEPLIITMISVQVATLPIGRFMANVLPTTKFRLPGFGSREFSLNPGPFNMKEHVLISIF  142

Query  425  ANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPV  604
            AN G + GGG AY++G + I+KA+YK+ +SFL   I+V+TTQ++GYGWAG+LR+Y+V+P 
Sbjct  143  ANAGSAFGGGSAYAVGIVDIIKAFYKRNISFLASWILVITTQVLGYGWAGILRKYVVEPA  202

Query  605  DMWWPSNLAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWV  784
            +MWWPS+L QVSLFRALHE +  S   +R RFFL+ +  SF++Y +PGYLF  L+  S +
Sbjct  203  EMWWPSSLVQVSLFRALHERD--SGKHSRARFFLIALACSFLWYIVPGYLFSTLSNLSLL  260

Query  785  CWVWP  799
            C ++P
Sbjct  261  CLIFP  265



>ref|XP_002275134.2| PREDICTED: oligopeptide transporter 6-like [Vitis vinifera]
Length=731

 Score =   274 bits (700),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 133/245 (54%), Positives = 174/245 (71%), Gaps = 8/245 (3%)
 Frame = +2

Query  77   ATAGEKTAPSGG---RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFI  247
            A  GE  A   G    CP+++V + VP+TDDPT+PVLTFR W LG++SCI+L F+N FF 
Sbjct  2    AEIGEAAAMEAGVSYECPIKQVDVTVPKTDDPTIPVLTFRMWVLGLSSCIVLSFVNQFFW  61

Query  248  YRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMA  427
            YR+QPL IS+I  QI+V+PIG  MA  + +R F    RW FTLNPGPFN+KEHV+IT+ A
Sbjct  62   YRSQPLIISSISAQIAVVPIGHLMAKKITKRVFLKGSRWEFTLNPGPFNVKEHVLITIFA  121

Query  428  NCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVD  607
            N     G G  Y+   +T +K  YK+ L+F+  L+++ TTQ++G+GWAG+ R++LV+P +
Sbjct  122  NS----GAGTVYATHILTAVKLLYKRNLTFIPALLVMTTTQVLGFGWAGLFRKFLVEPGE  177

Query  608  MWWPSNLAQVSLFRALHETEVK-SSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWV  784
            MWWPSNL QVSLFRALHE E +   G TR +FFL+V   SF YY  PGYL  +LT FSWV
Sbjct  178  MWWPSNLVQVSLFRALHEKEKRPKGGTTRTQFFLIVFICSFTYYVAPGYLINMLTSFSWV  237

Query  785  CWVWP  799
            CW+ P
Sbjct  238  CWLAP  242



>ref|XP_006350626.1| PREDICTED: oligopeptide transporter 7-like [Solanum tuberosum]
Length=738

 Score =   274 bits (700),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 131/240 (55%), Positives = 172/240 (72%), Gaps = 5/240 (2%)
 Frame = +2

Query  83   AGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQP  262
            + E+T      CP++EV + VP+TDDPT PVLTFR WFLGITSCI+L F+N FF YRTQP
Sbjct  12   SKEETNNDDEECPIKEVEMTVPKTDDPTTPVLTFRMWFLGITSCILLSFVNQFFWYRTQP  71

Query  263  LSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVS  442
            L+IS+  +QI+V+PIG  MA  + +R F     W+FTLNPG FNIKEHV+IT+ AN    
Sbjct  72   LTISSTAVQIAVVPIGHLMAKIITKRVFFEGTGWAFTLNPGRFNIKEHVLITIFANA---  128

Query  443  PGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPS  622
             G G  Y+   ++ +K YYK+ L F   L+I+ TTQ++G+GWAG+ R+ LV+P +MWWP 
Sbjct  129  -GAGTVYATHILSAVKLYYKRPLDFFPALLIMATTQMLGFGWAGIFRKLLVEPAEMWWPG  187

Query  623  NLAQVSLFRALHETEVKSS-GMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  799
            +L QVSLFRALHE E ++  G TR++FFL+ +  SF YY  PGYLF +LT FSW+CW  P
Sbjct  188  SLVQVSLFRALHEKENRAKGGTTRIQFFLIALVFSFAYYVFPGYLFQMLTSFSWLCWFAP  247



>ref|XP_002283680.1| PREDICTED: oligopeptide transporter 4 [Vitis vinifera]
Length=757

 Score =   274 bits (701),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 133/262 (51%), Positives = 181/262 (69%), Gaps = 14/262 (5%)
 Frame = +2

Query  53   VEMSGLNPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFL  232
            VE+      T  ++        P+EEV L VP  DDP+LPV TFR WFLG+ SC +L FL
Sbjct  4    VEIEAPIIKTRTDEDVKEDELSPIEEVRLTVPNDDDPSLPVWTFRMWFLGLISCALLSFL  63

Query  233  NTFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAP----FGRWSFTLNPGPFNIK  400
            N FF YR +PL IS I +Q++ LPIG+FMA+ LP+ KF      FG+   +LNPGPFN+K
Sbjct  64   NQFFSYRKEPLVISQITVQVATLPIGRFMASVLPDIKFHVHIPFFGKKELSLNPGPFNMK  123

Query  401  EHVIITVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVL  580
            EHV+I++ AN G + GGG AY++G +TI+KA+YK+ +S+L G I+++TTQ++GYGWAG+L
Sbjct  124  EHVLISIFANAGSAFGGGSAYAVGIVTIIKAFYKRNISYLAGWILIITTQVLGYGWAGLL  183

Query  581  RRYLVDPVDMWWPSNLAQVSLFRALH---------ETEVKSSGMTRMRFFLLVMGASFVY  733
            R+Y+V+P  MWWPS L Q+SLFR LH         ETEV+    +R +FFL+ M  SF++
Sbjct  184  RKYVVEPAHMWWPSTLVQISLFRTLHGKENEVDEQETEVQQR-TSRSKFFLIAMLCSFLW  242

Query  734  YTLPGYLFPILTFFSWVCWVWP  799
            Y +PGYLF  L   +WVCW +P
Sbjct  243  YMVPGYLFQSLQSIAWVCWAFP  264



>gb|EYU45286.1| hypothetical protein MIMGU_mgv1a0020142mg, partial [Erythranthe 
guttata]
Length=521

 Score =   268 bits (685),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 121/230 (53%), Positives = 169/230 (73%), Gaps = 5/230 (2%)
 Frame = +2

Query  113  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  292
             CP+++V + VP+TDDPT+PV TFR WFLGIT+C++L F+N FF YR++PL I +I  QI
Sbjct  10   ECPIKQVEVTVPKTDDPTVPVYTFRMWFLGITACLLLSFVNQFFWYRSEPLVIGSISAQI  69

Query  293  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            +V+P+G  MA  L +R F    R+ F+LNPGPFN+KEHV+IT++AN     G G  Y+  
Sbjct  70   AVVPLGHLMARILTKRVFLQGTRFEFSLNPGPFNMKEHVMITMLANA----GAGSVYATH  125

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFRA  652
             ++ +K YYK++  FL   I+++T+QL+GYGWAG+ R++LV+P +MWWPSNL QVSLFRA
Sbjct  126  ILSAVKLYYKKSFGFLPAFIVMMTSQLLGYGWAGIFRKHLVEPAEMWWPSNLVQVSLFRA  185

Query  653  LHETEVK-SSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  799
            LHE E +   G +R +FFL+ +  SF YY  PGY+F +LT  SW+CW+ P
Sbjct  186  LHEKETRPKGGTSRTQFFLIALVCSFAYYIFPGYIFQMLTSLSWICWLAP  235



>dbj|BAD67732.1| putative sexual differentiation process protein isp4 [Oryza sativa 
Japonica Group]
Length=763

 Score =   274 bits (700),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 136/251 (54%), Positives = 173/251 (69%), Gaps = 11/251 (4%)
 Frame = +2

Query  68   LNPATA-GEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFF  244
            L P+T+ G          P+E+VAL VP +D+P  PVLTFR W LG  SC +L FLN FF
Sbjct  27   LRPSTSRGSPELEEEENSPIEQVALTVPVSDEPETPVLTFRMWVLGTASCAVLSFLNQFF  86

Query  245  IYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVM  424
             YR +PL+I+AI  QI+V+P+G+ MAA LPER F     W FTLNPGPFN+KEHV+IT+ 
Sbjct  87   WYRKEPLTITAISAQIAVVPLGRLMAAALPERAFFRGRPWEFTLNPGPFNVKEHVLITIF  146

Query  425  ANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLI-----GYGWAGVLRRY  589
            AN     G G  Y+I  IT ++ +Y + +SF   L++VLTTQ++     G+GWAG+ RRY
Sbjct  147  ANS----GAGTVYAIHVITAVRVFYGKHISFFVSLLVVLTTQVVDDQVLGFGWAGIFRRY  202

Query  590  LVDPVDMWWPSNLAQVSLFRALHETEVKSS-GMTRMRFFLLVMGASFVYYTLPGYLFPIL  766
            LV+P  MWWPSNL QVSLFRALHE E +S  G+TR +FFL+    SF YY  PGYLF +L
Sbjct  203  LVEPAAMWWPSNLVQVSLFRALHEKEARSKGGLTRNQFFLVAFICSFAYYIFPGYLFQML  262

Query  767  TFFSWVCWVWP  799
            T  SW+CWV+P
Sbjct  263  TSLSWICWVFP  273



>ref|XP_003564333.1| PREDICTED: oligopeptide transporter 7-like [Brachypodium distachyon]
Length=772

 Score =   274 bits (700),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 130/244 (53%), Positives = 170/244 (70%), Gaps = 5/244 (2%)
 Frame = +2

Query  71   NPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIY  250
             P  + +    S    P+E+VAL VP  DDPT PVLTFR W LG  SC++L FLN FF Y
Sbjct  43   KPPPSPQGLGASEENSPIEQVALTVPVGDDPTTPVLTFRMWVLGTASCVVLSFLNQFFWY  102

Query  251  RTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMAN  430
            R +PL+I+AI  QI+V+P+G+ MAA LP R F     + FTLNPGPFN+KEHV+IT+ AN
Sbjct  103  RKEPLTITAISAQIAVVPMGRLMAALLPSRPFFSGTSYEFTLNPGPFNVKEHVLITIFAN  162

Query  431  CGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDM  610
                 G G  Y+I  +T ++ +Y + L+F   LI+VLTTQ++G+GWAG+ RRYLV+P  M
Sbjct  163  A----GAGSVYAIHVVTAVRVFYGKELTFFVSLIVVLTTQVLGFGWAGIFRRYLVEPAAM  218

Query  611  WWPSNLAQVSLFRALHETE-VKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVC  787
            WWP+NL QVSLFRALHE E +   G+TR +FF++    SF YY  PGYLF +LT  SW+C
Sbjct  219  WWPTNLVQVSLFRALHEKEKLSKGGLTRSQFFVVAFVCSFAYYVFPGYLFQMLTSLSWIC  278

Query  788  WVWP  799
            W++P
Sbjct  279  WLYP  282



>gb|EMS45172.1| Oligopeptide transporter 7 [Triticum urartu]
Length=925

 Score =   276 bits (707),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 132/227 (58%), Positives = 167/227 (74%), Gaps = 5/227 (2%)
 Frame = +2

Query  122  VEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISVL  301
            +E+VAL VP  DDP  PVLTFR W LG+ SC +L FLN FF YR +PL+I+AI  QI+V+
Sbjct  52   IEQVALTVPVGDDPDTPVLTFRMWVLGMASCAVLSFLNQFFWYRKEPLTITAISAQIAVV  111

Query  302  PIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIGAIT  481
            P+G+ MAA LPER F     + FTLNPGPFN+KEHV+IT+ AN     G G  Y+I  +T
Sbjct  112  PLGRLMAAALPERAFFRGRAYEFTLNPGPFNVKEHVLITIFANA----GAGTVYAIHVVT  167

Query  482  IMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFRALHE  661
             ++ +Y + L+F   L++VLTTQ++G+GWAG+ RRYLV+P  MWWPSNL QVSLFRALHE
Sbjct  168  AVRVFYGKNLTFFVSLLVVLTTQVLGFGWAGIFRRYLVEPAAMWWPSNLVQVSLFRALHE  227

Query  662  TEVKSS-GMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  799
             EV+S  G TR +FFL+    SFVYY  PGYLF +LT  SW+CWV+P
Sbjct  228  KEVRSKGGFTRSQFFLVAFVCSFVYYIFPGYLFQMLTSLSWICWVFP  274



>ref|XP_006364982.1| PREDICTED: oligopeptide transporter 4-like [Solanum tuberosum]
Length=755

 Score =   273 bits (699),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 130/250 (52%), Positives = 175/250 (70%), Gaps = 13/250 (5%)
 Frame = +2

Query  89   EKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLS  268
            E+        P+EEV L VP TDDPTLPV TFR W LG+ SC++L FLN FF YR +PL 
Sbjct  17   EEEINEDELSPIEEVRLTVPNTDDPTLPVWTFRMWILGVFSCVLLSFLNQFFSYRKEPLI  76

Query  269  ISAILMQISVLPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVMANCGVS  442
            I+ I +Q++ LPIG+FMAA LP  KF    FG   F+LNPGPFN+KEHV+IT+ AN G +
Sbjct  77   ITQITVQVATLPIGRFMAAVLPTTKFRILGFGSREFSLNPGPFNMKEHVLITIFANAGFA  136

Query  443  PGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPS  622
             G G AY++G + I+KA+Y + +SF+   ++++TTQ++GYGWAG+LR+Y+V+P  MWWPS
Sbjct  137  FGNGSAYAVGIVNIIKAFYHRNISFVASWLLIITTQVLGYGWAGLLRKYVVEPAHMWWPS  196

Query  623  NLAQVSLFRALHETE-------VKSSG----MTRMRFFLLVMGASFVYYTLPGYLFPILT  769
             L Q+SLFRALHE E       V ++G    M+R +FF++ +  SF +Y  PGYLF  L+
Sbjct  197  TLVQISLFRALHEKEDDDDNEIVNANGNKRPMSRAKFFVIALVCSFSWYIFPGYLFQTLS  256

Query  770  FFSWVCWVWP  799
              SWVCW +P
Sbjct  257  SISWVCWAYP  266



>ref|XP_010649021.1| PREDICTED: oligopeptide transporter 7-like [Vitis vinifera]
 emb|CBI17364.3| unnamed protein product [Vitis vinifera]
Length=745

 Score =   273 bits (698),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 129/230 (56%), Positives = 166/230 (72%), Gaps = 5/230 (2%)
 Frame = +2

Query  113  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  292
              P+E+VAL VP TDD TLPV+TFR W LG  +C +L FLN FF YR +PLSI++I  QI
Sbjct  31   NSPIEQVALTVPITDDRTLPVVTFRMWTLGTLACALLSFLNQFFWYRREPLSITSISAQI  90

Query  293  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            +V+P+G  MA  +  R F    RW FTLNPGPFNIKEHV+IT+ AN     G G+ Y+I 
Sbjct  91   AVVPLGHLMATVITNRVFFKGKRWEFTLNPGPFNIKEHVLITIFANS----GAGNVYAIH  146

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFRA  652
             ++ +K +YKQ L+F   L++V+TTQ++G+GWAG+ RRYLV+P  MWWP NL QVSLFRA
Sbjct  147  IVSAVKIFYKQNLTFFVSLLVVITTQVLGFGWAGIFRRYLVEPAAMWWPQNLVQVSLFRA  206

Query  653  LHETEVK-SSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  799
            LHE E +   G+TR +FFL+    SF YY  PGYLFP+LT  SW+CW++P
Sbjct  207  LHEREKRIKGGLTRNQFFLIAFICSFAYYIFPGYLFPMLTSLSWICWIFP  256



>ref|XP_006394156.1| hypothetical protein EUTSA_v10003716mg [Eutrema salsugineum]
 gb|ESQ31442.1| hypothetical protein EUTSA_v10003716mg [Eutrema salsugineum]
Length=729

 Score =   273 bits (697),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 127/229 (55%), Positives = 172/229 (75%), Gaps = 4/229 (2%)
 Frame = +2

Query  119  PVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISV  298
            P+EEV L V  TDDPTLPV TFR WFLGI SC +L FLN FF YRT+PL I+ I +Q++ 
Sbjct  14   PIEEVRLTVTNTDDPTLPVWTFRMWFLGIISCSLLSFLNQFFSYRTEPLVITQITVQVAT  73

Query  299  LPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            LPIG F+A  LP+ +F     G   F+LNPGPFN+KEHV+I++ AN G + G G AY++G
Sbjct  74   LPIGHFLAKVLPKTRFGLPGLGSTRFSLNPGPFNMKEHVLISIFANAGSAFGSGSAYAVG  133

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFRA  652
             +TI+KA+Y++ +SF+ G ++++TTQ++GYGWAG+LR+Y+V+P  MWWPS L QVSLFRA
Sbjct  134  IVTIIKAFYRRNISFVAGWLLIITTQVLGYGWAGLLRKYVVEPAHMWWPSTLVQVSLFRA  193

Query  653  LHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  799
            LHE + +   MTR +FF++ +  SF +Y +PGYLF  LT  SW+CW +P
Sbjct  194  LHEKDEQR--MTRAKFFVIALVCSFGWYIVPGYLFTTLTSISWICWAFP  240



>ref|XP_007039132.1| Oligopeptide transporter 1 isoform 1 [Theobroma cacao]
 gb|EOY23633.1| Oligopeptide transporter 1 isoform 1 [Theobroma cacao]
Length=732

 Score =   273 bits (697),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 128/230 (56%), Positives = 171/230 (74%), Gaps = 5/230 (2%)
 Frame = +2

Query  113  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  292
             CPV++V L VP+TDDPTLP +TFR W LG+ + +IL F+N FF YR  PL+I++I   I
Sbjct  17   ECPVKQVELTVPKTDDPTLPAVTFRMWVLGLGTSVILSFVNQFFWYRKMPLNITSISAMI  76

Query  293  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            +V+P+G  MA TLP R+F    RW FT+NPGPFN+KEHV+IT+ AN     G G  Y+  
Sbjct  77   AVVPLGHLMARTLPHRRFLSNTRWEFTMNPGPFNMKEHVLITIFANS----GAGTVYATH  132

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFRA  652
             ++ +K YYK+ L+FL  L++++TTQ++G+GWAG+ R+YLV+P +MWWPSNL  VSLFRA
Sbjct  133  ILSAVKLYYKRKLTFLPALLVMITTQVLGFGWAGIFRKYLVEPGEMWWPSNLVMVSLFRA  192

Query  653  LHETEVKSSGMTRM-RFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  799
            LHE E ++ G T + +FFLLV+ +SF YY LPGYLF  LT FSWVCW+ P
Sbjct  193  LHEKEKRAKGGTTLNQFFLLVLISSFAYYVLPGYLFSTLTSFSWVCWLAP  242



>ref|XP_002874647.1| ATOPT7 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50906.1| ATOPT7 [Arabidopsis lyrata subsp. lyrata]
Length=764

 Score =   273 bits (699),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 127/230 (55%), Positives = 169/230 (73%), Gaps = 5/230 (2%)
 Frame = +2

Query  113  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  292
              P+ +VAL VP TDDP+LPVLTFR W LG  S I+L FLN FF YRT+PL+ISAI  QI
Sbjct  52   NSPIRQVALTVPTTDDPSLPVLTFRMWVLGTLSGILLSFLNQFFWYRTEPLTISAISAQI  111

Query  293  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            +V+P+G+ MAA + +R F    +W FTLNPGPFN+KEHV+IT+ AN     G G  Y+I 
Sbjct  112  AVVPLGRLMAAKISDRVFFQGSKWQFTLNPGPFNVKEHVLITIFANA----GAGSVYAIH  167

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLFRA  652
             +T++KA+Y + ++F    I+++TTQ++G+GWAG+ R+YLV+P  MWWP+NL QVSLFRA
Sbjct  168  VVTVVKAFYMKNITFFVSFIVIVTTQVLGFGWAGIFRKYLVEPAAMWWPANLVQVSLFRA  227

Query  653  LHETEVKSS-GMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  799
            LHE E ++  G+TR +FF++    SF YY  PGYLF I+T  SWVCW +P
Sbjct  228  LHEKEERTKGGLTRTQFFVIAFVCSFAYYVFPGYLFQIMTSLSWVCWFFP  277



>ref|XP_004238028.1| PREDICTED: oligopeptide transporter 4-like [Solanum lycopersicum]
Length=755

 Score =   273 bits (698),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 130/250 (52%), Positives = 175/250 (70%), Gaps = 13/250 (5%)
 Frame = +2

Query  89   EKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLS  268
            E+        P+EEV L VP TDDPTLPV TFR W LG+ SC++L FLN FF YR +PL 
Sbjct  17   EEEINEDELSPIEEVRLTVPNTDDPTLPVWTFRMWILGVFSCVLLSFLNQFFSYRKEPLI  76

Query  269  ISAILMQISVLPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVMANCGVS  442
            I+ I +Q++ LPIG+FMAA LP  KF    FG   F+LNPGPFN+KEHV+IT+ AN G +
Sbjct  77   ITQITVQVATLPIGRFMAAVLPTTKFRILGFGSREFSLNPGPFNMKEHVLITIFANAGFA  136

Query  443  PGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPS  622
             G G AY++G + I+KA+Y++ +SF    ++++TTQ++GYGWAG+LR+Y+V+P  MWWPS
Sbjct  137  FGNGSAYAVGIVNIIKAFYRRNISFAASWLLIITTQVLGYGWAGLLRKYVVEPAHMWWPS  196

Query  623  NLAQVSLFRALHETE-------VKSSG----MTRMRFFLLVMGASFVYYTLPGYLFPILT  769
             L Q+SLFRALHE E       V ++G    M+R +FF++ +  SF +Y  PGYLF  L+
Sbjct  197  TLVQISLFRALHEQEDDDDNETVNANGNKRPMSRAKFFVIALVCSFSWYIFPGYLFQALS  256

Query  770  FFSWVCWVWP  799
              SWVCW +P
Sbjct  257  SISWVCWAYP  266



>ref|XP_006474841.1| PREDICTED: oligopeptide transporter 1-like [Citrus sinensis]
Length=756

 Score =   273 bits (698),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 129/231 (56%), Positives = 169/231 (73%), Gaps = 6/231 (3%)
 Frame = +2

Query  110  GRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQ  289
               P+E+V L VP TDDP+ P LTFR WFLGI SC++L FLN FF +R   LS+ +I  Q
Sbjct  33   NDSPIEQVRLTVPITDDPSQPALTFRTWFLGIISCVVLSFLNRFFGFRQNQLSVGSISAQ  92

Query  290  ISVLPIGKFMAATLPERKF-APFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYS  466
            I VLP+GK MAATLP +    P  +W+F++NPGPFN+KEHV+IT+ ANCG     G  Y+
Sbjct  93   IIVLPLGKLMAATLPSKPIRVPLTKWTFSMNPGPFNLKEHVLITIFANCG----AGGVYA  148

Query  467  IGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSNLAQVSLF  646
            +  ITI+KA+YK+ L+ L  +++  TTQL+GYGWAG+ R+YLVD   MWWP+NL QVSLF
Sbjct  149  VYIITIVKAFYKRKLNPLAAMLLAQTTQLLGYGWAGLFRKYLVDSPFMWWPANLVQVSLF  208

Query  647  RALHETEVK-SSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVW  796
            RALHE E +   G+TR++FF +V  +SF YY +PGYLFP L+  S+VCW+W
Sbjct  209  RALHEKEKRPKGGLTRLQFFFMVFASSFAYYVVPGYLFPTLSALSFVCWIW  259



>ref|XP_007046673.1| Oligopeptide transporter 7 isoform 1 [Theobroma cacao]
 ref|XP_007046674.1| Oligopeptide transporter 7 isoform 1 [Theobroma cacao]
 gb|EOX90830.1| Oligopeptide transporter 7 isoform 1 [Theobroma cacao]
 gb|EOX90831.1| Oligopeptide transporter 7 isoform 1 [Theobroma cacao]
Length=741

 Score =   273 bits (697),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 134/255 (53%), Positives = 177/255 (69%), Gaps = 10/255 (4%)
 Frame = +2

Query  38   SEHIVVEMSGLNPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCI  217
            S+ I  + SG  P +  +         P+E+VAL VP TDD +LP LTFR W LG  +C+
Sbjct  18   SDQIQPDASGSIPLSPDDLE-----NSPIEQVALTVPTTDDLSLPTLTFRTWILGTLACV  72

Query  218  ILIFLNTFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNI  397
            +L FLN FF YR +PLSIS+I  QI+V+P+G  MAA + +R F    ++ FTLNPGPFN+
Sbjct  73   LLSFLNQFFWYRREPLSISSISAQIAVVPLGHLMAAMVTDRVFFKGRKFEFTLNPGPFNV  132

Query  398  KEHVIITVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGV  577
            KEHV+IT+  N     G G+ Y+I  I+ +K +YK+ +SFL  L++V TTQ++G+GWAGV
Sbjct  133  KEHVLITIFTNS----GAGNVYAIHLISTVKIFYKKEMSFLVALLVVFTTQVLGFGWAGV  188

Query  578  LRRYLVDPVDMWWPSNLAQVSLFRALHETEVKSSG-MTRMRFFLLVMGASFVYYTLPGYL  754
             RRYLV+P  MWWP NL QVSLFRALHE E ++ G +TR +FFL+    SF YY LPGYL
Sbjct  189  FRRYLVEPAAMWWPQNLVQVSLFRALHEKEERAKGRLTRNQFFLIAFICSFAYYVLPGYL  248

Query  755  FPILTFFSWVCWVWP  799
            FP L+  SW+CWV+P
Sbjct  249  FPALSSLSWLCWVFP  263



>ref|XP_009368318.1| PREDICTED: oligopeptide transporter 4 [Pyrus x bretschneideri]
Length=750

 Score =   273 bits (697),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 129/243 (53%), Positives = 170/243 (70%), Gaps = 4/243 (2%)
 Frame = +2

Query  71   NPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIY  250
             P  + E         P+E+V L V  TDDPTLPV TFR WFLG+ SC +L FLN FF Y
Sbjct  20   KPTHSLEPDTEDDDVSPIEQVRLTVTNTDDPTLPVWTFRMWFLGLVSCALLSFLNQFFSY  79

Query  251  RTQPLSISAILMQISVLPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVM  424
            RT+PL I+ I +Q+S LPIG FMA  LP + F    FG  +F+LNPGPFNIKEHV+IT+ 
Sbjct  80   RTEPLIITQITVQVSTLPIGYFMAKVLPTKTFHIPGFGSRTFSLNPGPFNIKEHVLITIF  139

Query  425  ANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPV  604
            AN G + G G AY++G + I+KA+Y + +S L   ++++TTQ++GYGWAG+LR+Y+V+P 
Sbjct  140  ANAGSAFGAGSAYAVGIVNIIKAFYHRKISLLASWLLIITTQVLGYGWAGLLRKYVVEPA  199

Query  605  DMWWPSNLAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWV  784
             MWWP+ L QVSLFRALHE + +   M+R +FFL+ +  SF +Y  PGYLF  LT  SWV
Sbjct  200  HMWWPNTLVQVSLFRALHEKDEQR--MSRAKFFLITLVCSFTWYAFPGYLFTTLTNISWV  257

Query  785  CWV  793
            CW+
Sbjct  258  CWL  260



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1580279231195