BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF045K13

Length=768
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009617474.1|  PREDICTED: transcription factor ILR3-like          226   7e-70   Nicotiana tomentosiformis
ref|XP_009772342.1|  PREDICTED: transcription factor ILR3-like          224   6e-69   Nicotiana sylvestris
ref|XP_004232754.1|  PREDICTED: transcription factor ILR3               213   1e-64   Solanum lycopersicum
ref|XP_006365882.1|  PREDICTED: transcription factor ILR3-like          212   2e-64   Solanum tuberosum [potatoes]
ref|XP_008224874.1|  PREDICTED: transcription factor ILR3-like          196   5e-58   Prunus mume [ume]
ref|XP_007211937.1|  hypothetical protein PRUPE_ppa010730mg             196   7e-58   Prunus persica
emb|CDO99702.1|  unnamed protein product                                194   2e-57   Coffea canephora [robusta coffee]
gb|KDP20820.1|  hypothetical protein JCGZ_21291                         193   7e-57   Jatropha curcas
ref|XP_002273184.2|  PREDICTED: transcription factor ILR3-like is...    185   7e-54   Vitis vinifera
ref|XP_002518568.1|  DNA binding protein, putative                      183   5e-53   Ricinus communis
ref|XP_010267809.1|  PREDICTED: transcription factor ILR3               181   3e-52   Nelumbo nucifera [Indian lotus]
ref|XP_007025918.1|  DNA binding protein, putative isoform 2            181   3e-52   
ref|XP_009366840.1|  PREDICTED: transcription factor ILR3-like          181   4e-52   Pyrus x bretschneideri [bai li]
ref|XP_002316706.2|  hypothetical protein POPTR_0011s03360g             179   1e-51   
ref|XP_002274829.2|  PREDICTED: transcription factor ILR3-like is...    179   2e-51   Vitis vinifera
ref|XP_010247015.1|  PREDICTED: transcription factor ILR3-like          178   4e-51   Nelumbo nucifera [Indian lotus]
ref|XP_004309656.1|  PREDICTED: transcription factor ILR3-like          177   1e-50   Fragaria vesca subsp. vesca
ref|XP_008441610.1|  PREDICTED: transcription factor ILR3-like          176   2e-50   Cucumis melo [Oriental melon]
ref|XP_004145091.1|  PREDICTED: transcription factor ILR3-like          175   6e-50   Cucumis sativus [cucumbers]
ref|XP_010647172.1|  PREDICTED: transcription factor ILR3-like is...    172   3e-49   
ref|XP_010647170.1|  PREDICTED: transcription factor ILR3-like is...    173   4e-49   Vitis vinifera
ref|XP_010657331.1|  PREDICTED: transcription factor ILR3-like is...    173   4e-49   Vitis vinifera
ref|XP_010999542.1|  PREDICTED: transcription factor ILR3-like          172   6e-49   Populus euphratica
ref|XP_007025917.1|  Basic helix-loop-helix DNA-binding superfami...    172   5e-48   
gb|KJB57696.1|  hypothetical protein B456_009G176000                    170   7e-48   Gossypium raimondii
ref|XP_006449136.1|  hypothetical protein CICLE_v10016511mg             169   2e-47   Citrus clementina [clementine]
gb|EYU19205.1|  hypothetical protein MIMGU_mgv1a012900mg                169   2e-47   Erythranthe guttata [common monkey flower]
ref|XP_006467957.1|  PREDICTED: transcription factor ILR3-like          168   3e-47   Citrus sinensis [apfelsine]
ref|XP_010647171.1|  PREDICTED: transcription factor ILR3-like is...    167   4e-47   Vitis vinifera
emb|CBI28976.3|  unnamed protein product                                167   6e-47   Vitis vinifera
gb|KHG15485.1|  Transcription factor ILR3 -like protein                 167   1e-46   Gossypium arboreum [tree cotton]
emb|CDP05806.1|  unnamed protein product                                165   3e-46   Coffea canephora [robusta coffee]
gb|AEJ88330.1|  putative MYC protein                                    163   3e-45   Tamarix hispida
ref|XP_008371203.1|  PREDICTED: transcription factor ILR3-like          161   4e-45   
ref|XP_010035617.1|  PREDICTED: transcription factor ILR3-like          162   9e-45   Eucalyptus grandis [rose gum]
ref|XP_010931430.1|  PREDICTED: transcription factor ILR3-like          161   1e-44   
ref|XP_011097928.1|  PREDICTED: transcription factor ILR3-like          160   4e-44   Sesamum indicum [beniseed]
ref|XP_002282727.1|  PREDICTED: transcription factor ILR3               159   9e-44   Vitis vinifera
ref|XP_010909862.1|  PREDICTED: transcription factor ILR3-like          159   1e-43   Elaeis guineensis
ref|XP_007043353.1|  Basic helix-loop-helix DNA-binding superfami...    158   2e-43   
ref|XP_011003406.1|  PREDICTED: transcription factor ILR3-like          158   2e-43   Populus euphratica
ref|XP_002522828.1|  DNA binding protein, putative                      158   3e-43   Ricinus communis
ref|XP_009383663.1|  PREDICTED: transcription factor ILR3-like          157   5e-43   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009355579.1|  PREDICTED: transcription factor ILR3-like          157   7e-43   Pyrus x bretschneideri [bai li]
ref|XP_006360579.1|  PREDICTED: transcription factor ILR3-like is...    157   7e-43   Solanum tuberosum [potatoes]
ref|XP_006352486.1|  PREDICTED: transcription factor ILR3-like          157   7e-43   Solanum tuberosum [potatoes]
ref|XP_008365724.1|  PREDICTED: transcription factor ILR3               156   8e-43   Malus domestica [apple tree]
ref|XP_002304984.1|  hypothetical protein POPTR_0004s03190g             156   1e-42   
ref|XP_009358090.1|  PREDICTED: transcription factor ILR3-like          155   2e-42   Pyrus x bretschneideri [bai li]
ref|XP_006360098.1|  PREDICTED: transcription factor ILR3-like          155   2e-42   Solanum tuberosum [potatoes]
ref|XP_009393337.1|  PREDICTED: transcription factor ILR3-like          155   2e-42   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011095314.1|  PREDICTED: transcription factor ILR3-like          155   2e-42   Sesamum indicum [beniseed]
ref|XP_009764628.1|  PREDICTED: transcription factor ILR3-like          155   4e-42   Nicotiana sylvestris
ref|XP_009612610.1|  PREDICTED: transcription factor ILR3-like          154   6e-42   Nicotiana tomentosiformis
ref|XP_004244159.1|  PREDICTED: transcription factor ILR3               154   7e-42   Solanum lycopersicum
gb|KDO59874.1|  hypothetical protein CISIN_1g026646mg                   153   1e-41   Citrus sinensis [apfelsine]
ref|XP_011096123.1|  PREDICTED: transcription factor ILR3-like          153   2e-41   
ref|XP_006447466.1|  hypothetical protein CICLE_v10016381mg             153   2e-41   Citrus clementina [clementine]
ref|XP_010323806.1|  PREDICTED: transcription factor ILR3 isoform X1    153   2e-41   Solanum lycopersicum
gb|EYU33597.1|  hypothetical protein MIMGU_mgv1a013092mg                152   3e-41   Erythranthe guttata [common monkey flower]
ref|XP_007211667.1|  hypothetical protein PRUPE_ppa009077mg             154   3e-41   Prunus persica
ref|XP_004505433.1|  PREDICTED: transcription factor ILR3-like          152   4e-41   Cicer arietinum [garbanzo]
ref|XP_008793739.1|  PREDICTED: transcription factor ILR3               150   2e-40   Phoenix dactylifera
ref|XP_004248337.1|  PREDICTED: transcription factor ILR3-like          150   3e-40   Solanum lycopersicum
gb|KCW70120.1|  hypothetical protein EUGRSUZ_F03420                     149   7e-40   Eucalyptus grandis [rose gum]
ref|XP_007132981.1|  hypothetical protein PHAVU_011G141300g             149   1e-39   Phaseolus vulgaris [French bean]
ref|XP_009791575.1|  PREDICTED: transcription factor ILR3-like          148   1e-39   Nicotiana sylvestris
ref|XP_008800495.1|  PREDICTED: transcription factor ILR3-like          148   2e-39   Phoenix dactylifera
ref|XP_007149692.1|  hypothetical protein PHAVU_005G091000g             147   2e-39   Phaseolus vulgaris [French bean]
ref|XP_003607701.1|  Transcription factor ILR3                          147   2e-39   Medicago truncatula
gb|AFK48825.1|  unknown                                                 147   4e-39   Lotus japonicus
gb|ADL36593.1|  BHLH domain class transcription factor                  146   6e-39   Malus domestica [apple tree]
ref|XP_010062960.1|  PREDICTED: transcription factor ILR3-like          146   8e-39   Eucalyptus grandis [rose gum]
ref|XP_009630429.1|  PREDICTED: transcription factor ILR3-like          145   1e-38   Nicotiana tomentosiformis
ref|XP_008349949.1|  PREDICTED: transcription factor ILR3-like          145   1e-38   
ref|XP_009792846.1|  PREDICTED: transcription factor ILR3-like          145   1e-38   Nicotiana sylvestris
ref|XP_010923988.1|  PREDICTED: transcription factor ILR3-like          145   2e-38   Elaeis guineensis
ref|XP_008244399.1|  PREDICTED: transcription factor ILR3               144   2e-37   
gb|KDP39043.1|  hypothetical protein JCGZ_00800                         142   2e-37   Jatropha curcas
ref|XP_006447467.1|  hypothetical protein CICLE_v10016381mg             143   2e-37   
ref|XP_003540036.1|  PREDICTED: transcription factor ILR3               142   2e-37   
ref|XP_010323807.1|  PREDICTED: transcription factor ILR3 isoform X2    142   3e-37   
ref|XP_003527314.1|  PREDICTED: transcription factor ILR3-like is...    142   4e-37   Glycine max [soybeans]
gb|ACU23766.1|  unknown                                                 142   4e-37   Glycine max [soybeans]
ref|XP_008455829.1|  PREDICTED: transcription factor ILR3-like          142   5e-37   Cucumis melo [Oriental melon]
ref|XP_003596613.1|  Transcription factor ILR3                          141   6e-37   Medicago truncatula
ref|XP_009597422.1|  PREDICTED: transcription factor ILR3-like          140   1e-36   Nicotiana tomentosiformis
ref|XP_004151873.1|  PREDICTED: transcription factor ILR3-like          140   1e-36   Cucumis sativus [cucumbers]
ref|XP_008454561.1|  PREDICTED: transcription factor ILR3-like          140   2e-36   Cucumis melo [Oriental melon]
ref|XP_003607702.1|  Transcription factor ILR3                          140   2e-36   
ref|XP_010092311.1|  hypothetical protein L484_021173                   139   4e-36   
gb|KGN57970.1|  hypothetical protein Csa_3G416140                       138   7e-36   Cucumis sativus [cucumbers]
gb|AEI83428.1|  bHLH transcription factor 1                             138   7e-36   Camellia sinensis [black tea]
gb|KGN57965.1|  hypothetical protein Csa_3G415100                       138   8e-36   Cucumis sativus [cucumbers]
ref|XP_004151959.1|  PREDICTED: transcription factor ILR3-like          137   1e-35   
gb|KHG29871.1|  Transcription factor ILR3 -like protein                 137   2e-35   Gossypium arboreum [tree cotton]
gb|AES89899.2|  BHLH domain class transcription factor                  135   3e-35   Medicago truncatula
ref|XP_004151962.1|  PREDICTED: transcription factor ILR3-like          136   4e-35   
ref|XP_008776472.1|  PREDICTED: transcription factor ILR3-like          136   4e-35   Phoenix dactylifera
ref|XP_004173321.1|  PREDICTED: transcription factor ILR3-like          136   5e-35   
ref|XP_006475303.1|  PREDICTED: transcription factor ILR3-like          136   5e-35   Citrus sinensis [apfelsine]
ref|XP_004156771.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...    136   5e-35   
gb|KJB12415.1|  hypothetical protein B456_002G016500                    135   7e-35   Gossypium raimondii
gb|KJB81834.1|  hypothetical protein B456_013G164100                    135   8e-35   Gossypium raimondii
ref|XP_008454558.1|  PREDICTED: transcription factor ILR3-like is...    135   9e-35   Cucumis melo [Oriental melon]
ref|XP_004487616.1|  PREDICTED: transcription factor ILR3-like          135   1e-34   Cicer arietinum [garbanzo]
emb|CAN70830.1|  hypothetical protein VITISV_005283                     139   1e-34   Vitis vinifera
ref|XP_010443048.1|  PREDICTED: transcription factor ILR3               135   1e-34   Camelina sativa [gold-of-pleasure]
dbj|BAK03093.1|  predicted protein                                      135   1e-34   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AHZ94970.1|  helix-loop-helix-like protein                           133   1e-34   Lilium regale
ref|XP_003547112.1|  PREDICTED: transcription factor ILR3-like          134   2e-34   Glycine max [soybeans]
ref|XP_006659812.1|  PREDICTED: transcription factor ILR3-like          135   2e-34   Oryza brachyantha
ref|XP_010482878.1|  PREDICTED: transcription factor ILR3-like          135   2e-34   Camelina sativa [gold-of-pleasure]
gb|EAZ41459.1|  hypothetical protein OsJ_25981                          135   3e-34   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006401546.1|  hypothetical protein EUTSA_v10014564mg             134   3e-34   Eutrema salsugineum [saltwater cress]
ref|XP_009127072.1|  PREDICTED: transcription factor ILR3               134   3e-34   Brassica rapa
ref|XP_004294336.1|  PREDICTED: transcription factor ILR3-like          134   5e-34   Fragaria vesca subsp. vesca
ref|XP_007149945.1|  hypothetical protein PHAVU_005G112500g             134   5e-34   Phaseolus vulgaris [French bean]
ref|XP_010448513.1|  PREDICTED: transcription factor ILR3-like          134   5e-34   Camelina sativa [gold-of-pleasure]
ref|NP_001060960.1|  Os08g0138500                                       134   5e-34   
ref|XP_010694263.1|  PREDICTED: transcription factor ILR3               133   6e-34   Beta vulgaris subsp. vulgaris [field beet]
gb|EAZ05534.1|  hypothetical protein OsI_27750                          134   7e-34   Oryza sativa Indica Group [Indian rice]
gb|AAO72577.1|  helix-loop-helix-like protein                           132   8e-34   Oryza sativa Japonica Group [Japonica rice]
gb|AFK34442.1|  unknown                                                 132   1e-33   Lotus japonicus
ref|NP_175518.1|  transcription factor bHLH115                          132   1e-33   Arabidopsis thaliana [mouse-ear cress]
emb|CDY41004.1|  BnaA02g27940D                                          132   1e-33   Brassica napus [oilseed rape]
emb|CDY28758.1|  BnaA02g09500D                                          132   2e-33   Brassica napus [oilseed rape]
ref|XP_006452147.1|  hypothetical protein CICLE_v10009354mg             132   2e-33   Citrus clementina [clementine]
ref|XP_007148298.1|  hypothetical protein PHAVU_006G196600g             132   2e-33   Phaseolus vulgaris [French bean]
ref|XP_003573355.1|  PREDICTED: transcription factor ILR3-like          132   2e-33   Brachypodium distachyon [annual false brome]
gb|ADC33137.1|  helix-loop-helix-like protein                           132   2e-33   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006658659.1|  PREDICTED: transcription factor ILR3-like          132   3e-33   
ref|XP_002891614.1|  basic helix-loop-helix family protein              131   3e-33   
ref|XP_004972892.1|  PREDICTED: transcription factor ILR3-like          132   3e-33   Setaria italica
ref|XP_006393084.1|  hypothetical protein EUTSA_v10011752mg             131   3e-33   Eutrema salsugineum [saltwater cress]
gb|KJB81836.1|  hypothetical protein B456_013G164100                    131   3e-33   Gossypium raimondii
gb|EEC82221.1|  hypothetical protein OsI_26369                          132   3e-33   Oryza sativa Indica Group [Indian rice]
ref|NP_001059905.1|  Os07g0543000                                       132   3e-33   
ref|XP_003543375.1|  PREDICTED: transcription factor ILR3-like is...    131   4e-33   Glycine max [soybeans]
gb|KJB45598.1|  hypothetical protein B456_007G314800                    131   5e-33   Gossypium raimondii
ref|XP_009132430.1|  PREDICTED: transcription factor ILR3-like          131   5e-33   Brassica rapa
gb|AAM64276.1|  bHLH transcription factor, putative                     131   5e-33   Arabidopsis thaliana [mouse-ear cress]
ref|NP_200279.1|  transcription factor ILR3                             131   5e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010500676.1|  PREDICTED: transcription factor bHLH115-like       130   6e-33   Camelina sativa [gold-of-pleasure]
emb|CDY43028.1|  BnaA03g11750D                                          130   7e-33   Brassica napus [oilseed rape]
ref|XP_009414543.1|  PREDICTED: transcription factor ILR3               130   8e-33   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006280790.1|  hypothetical protein CARUB_v10026758mg             132   1e-32   
gb|ACG38605.1|  bHLH transcription factor                               130   1e-32   Zea mays [maize]
emb|CDY47456.1|  BnaC09g31010D                                          130   1e-32   Brassica napus [oilseed rape]
gb|KJB13568.1|  hypothetical protein B456_002G081900                    130   1e-32   Gossypium raimondii
emb|CDY43809.1|  BnaC03g14420D                                          129   2e-32   Brassica napus [oilseed rape]
gb|KFK35883.1|  hypothetical protein AALP_AA4G049100                    128   4e-32   Arabis alpina [alpine rockcress]
gb|AJO70790.1|  bHLH transcription factor bHLH57                        129   4e-32   Eleusine coracana
ref|NP_001146503.1|  uncharacterized protein LOC100280093               129   4e-32   
ref|XP_006847910.1|  hypothetical protein AMTR_s00029p00112130          128   5e-32   Amborella trichopoda
ref|XP_006594652.1|  PREDICTED: transcription factor ILR3-like          125   5e-32   Glycine max [soybeans]
ref|XP_007021087.1|  DNA binding protein, putative                      128   5e-32   
gb|EMS54079.1|  Transcription factor ILR3                               128   6e-32   Triticum urartu
ref|XP_008677332.1|  PREDICTED: LOC100284429 isoform X1                 128   6e-32   
gb|AFW57417.1|  putative HLH DNA-binding domain superfamily protein     128   8e-32   
ref|XP_010062961.1|  PREDICTED: transcription factor ILR3-like is...    127   1e-31   Eucalyptus grandis [rose gum]
emb|CDY71937.1|  BnaA05g35780D                                          127   1e-31   Brassica napus [oilseed rape]
ref|NP_001242620.1|  uncharacterized protein LOC100806838               127   2e-31   
ref|XP_009144925.1|  PREDICTED: transcription factor bHLH115            126   3e-31   Brassica rapa
ref|XP_006304584.1|  hypothetical protein CARUB_v10011628mg             126   3e-31   Capsella rubella
gb|AFN84533.1|  BHLH domain class transcription factor                  126   4e-31   Fragaria x ananassa
emb|CDY42475.1|  BnaA10g08510D                                          126   4e-31   Brassica napus [oilseed rape]
ref|XP_004957935.1|  PREDICTED: transcription factor ILR3-like is...    126   4e-31   Setaria italica
ref|XP_004957936.1|  PREDICTED: transcription factor ILR3-like is...    126   4e-31   Setaria italica
ref|XP_010479562.1|  PREDICTED: transcription factor bHLH115-like       125   5e-31   Camelina sativa [gold-of-pleasure]
ref|XP_009120001.1|  PREDICTED: transcription factor ILR3-like          125   6e-31   Brassica rapa
ref|XP_009420541.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...    121   3e-30   
gb|KHN36564.1|  Transcription factor bHLH115                            124   3e-30   Glycine soja [wild soybean]
gb|KCW70124.1|  hypothetical protein EUGRSUZ_F03420                     123   3e-30   Eucalyptus grandis [rose gum]
ref|XP_010935491.1|  PREDICTED: transcription factor bHLH115-like       123   3e-30   Elaeis guineensis
gb|EMT27826.1|  Transcription factor ILR3                               123   3e-30   
gb|KFK27081.1|  hypothetical protein AALP_AA8G331500                    123   4e-30   Arabis alpina [alpine rockcress]
ref|XP_003562971.1|  PREDICTED: transcription factor ILR3-like          122   1e-29   Brachypodium distachyon [annual false brome]
gb|KHN25765.1|  Transcription factor ILR3                               122   1e-29   Glycine soja [wild soybean]
emb|CDY35576.1|  BnaC05g27050D                                          121   1e-29   Brassica napus [oilseed rape]
gb|EPS70109.1|  hypothetical protein M569_04652                         122   2e-29   Genlisea aurea
ref|XP_010461939.1|  PREDICTED: transcription factor bHLH115            121   2e-29   Camelina sativa [gold-of-pleasure]
ref|XP_008803703.1|  PREDICTED: transcription factor bHLH115-like       121   2e-29   Phoenix dactylifera
ref|XP_002316971.1|  basic helix-loop-helix family protein              122   2e-29   Populus trichocarpa [western balsam poplar]
ref|NP_001185192.1|  transcription factor bHLH115                       122   3e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010109550.1|  hypothetical protein L484_018285                   122   3e-29   
ref|XP_010092690.1|  hypothetical protein L484_019764                   120   3e-29   
ref|XP_002462974.1|  hypothetical protein SORBIDRAFT_02g035580          121   3e-29   Sorghum bicolor [broomcorn]
ref|NP_001150796.1|  LOC100284429                                       120   4e-29   
ref|XP_011030891.1|  PREDICTED: transcription factor ILR3-like          120   6e-29   Populus euphratica
ref|XP_010940315.1|  PREDICTED: transcription factor ILR3-like is...    119   6e-29   Elaeis guineensis
ref|XP_010940314.1|  PREDICTED: transcription factor ILR3-like is...    119   8e-29   Elaeis guineensis
ref|XP_003597042.1|  Transcription factor ILR3                          120   8e-29   Medicago truncatula
gb|ABK96448.1|  unknown                                                 119   2e-28   Populus trichocarpa x Populus deltoides
ref|XP_006370611.1|  basic helix-loop-helix family protein              119   2e-28   Populus trichocarpa [western balsam poplar]
gb|AFW61272.1|  putative HLH DNA-binding domain superfamily protein     119   2e-28   
ref|XP_006493504.1|  PREDICTED: transcription factor ILR3-like          116   2e-28   
gb|ACL54160.1|  unknown                                                 116   2e-28   Zea mays [maize]
gb|KHN27978.1|  Transcription factor ILR3                               118   3e-28   Glycine soja [wild soybean]
ref|XP_004172808.1|  PREDICTED: transcription factor ILR3-like          115   9e-28   
gb|KHG21334.1|  Transcription factor ILR3 -like protein                 116   1e-27   Gossypium arboreum [tree cotton]
ref|XP_008651108.1|  PREDICTED: uncharacterized protein LOC100273...    117   1e-27   Zea mays [maize]
ref|XP_011048283.1|  PREDICTED: transcription factor ILR3-like          117   1e-27   Populus euphratica
ref|XP_008651109.1|  PREDICTED: uncharacterized protein LOC100273...    117   1e-27   
ref|XP_008813306.1|  PREDICTED: transcription factor ILR3-like is...    115   4e-27   
ref|XP_008813314.1|  PREDICTED: transcription factor ILR3-like is...    115   5e-27   Phoenix dactylifera
gb|KDO50387.1|  hypothetical protein CISIN_1g032672mg                   111   1e-26   Citrus sinensis [apfelsine]
ref|XP_008454559.1|  PREDICTED: transcription factor ILR3-like is...    113   2e-26   Cucumis melo [Oriental melon]
ref|NP_001239799.1|  uncharacterized protein LOC100813088               113   2e-26   Glycine max [soybeans]
gb|ACN40301.1|  unknown                                                 113   2e-26   Picea sitchensis
ref|XP_004487368.1|  PREDICTED: transcription factor bHLH115-like       113   3e-26   Cicer arietinum [garbanzo]
ref|XP_006837018.1|  hypothetical protein AMTR_s00098p00170370          112   4e-26   Amborella trichopoda
ref|XP_010539274.1|  PREDICTED: transcription factor ILR3               112   4e-26   Tarenaya hassleriana [spider flower]
gb|ACG27921.1|  DNA binding protein                                     112   5e-26   Zea mays [maize]
gb|KHN19061.1|  Transcription factor ILR3                               109   8e-26   Glycine soja [wild soybean]
gb|AFW66775.1|  putative HLH DNA-binding domain superfamily protein     111   9e-26   
ref|XP_008676877.1|  PREDICTED: uncharacterized protein LOC100274...    111   9e-26   
dbj|BAK01217.1|  predicted protein                                      112   9e-26   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010274798.1|  PREDICTED: transcription factor bHLH104-like       111   9e-26   Nelumbo nucifera [Indian lotus]
ref|XP_009408169.1|  PREDICTED: transcription factor ILR3-like is...    111   1e-25   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009378999.1|  PREDICTED: transcription factor bHLH104-like       110   1e-25   Pyrus x bretschneideri [bai li]
ref|XP_011030516.1|  PREDICTED: transcription factor bHLH104-like       110   1e-25   Populus euphratica
gb|KHG04921.1|  Transcription factor protein                            109   4e-25   Gossypium arboreum [tree cotton]
gb|EMT07811.1|  Transcription factor ILR3                               110   6e-25   
gb|KJB72345.1|  hypothetical protein B456_011G172500                    108   7e-25   Gossypium raimondii
ref|XP_010241997.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...    107   7e-25   Nelumbo nucifera [Indian lotus]
gb|KJB72343.1|  hypothetical protein B456_011G172500                    108   7e-25   Gossypium raimondii
gb|KJB72344.1|  hypothetical protein B456_011G172500                    108   8e-25   Gossypium raimondii
ref|XP_009408170.1|  PREDICTED: transcription factor ILR3-like is...    107   9e-25   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHN36734.1|  Transcription factor ILR3                               108   1e-24   Glycine soja [wild soybean]
dbj|BAJ40866.1|  bHLH transcriptional factor                            108   1e-24   Coptis japonica
ref|XP_003543288.1|  PREDICTED: transcription factor ILR3-like is...    108   1e-24   Glycine max [soybeans]
ref|NP_001150072.1|  DNA binding protein                                108   2e-24   Zea mays [maize]
ref|XP_002962528.1|  hypothetical protein SELMODRAFT_165556             108   2e-24   Selaginella moellendorffii
ref|XP_008391189.1|  PREDICTED: transcription factor bHLH104-like       107   2e-24   
ref|XP_006447465.1|  hypothetical protein CICLE_v10016381mg             106   2e-24   
ref|XP_008224372.1|  PREDICTED: transcription factor bHLH104            107   3e-24   Prunus mume [ume]
ref|XP_006378346.1|  hypothetical protein POPTR_0010s08360g             107   3e-24   
ref|XP_002314636.1|  basic helix-loop-helix family protein              107   4e-24   Populus trichocarpa [western balsam poplar]
ref|XP_010262298.1|  PREDICTED: transcription factor bHLH104-like       106   5e-24   Nelumbo nucifera [Indian lotus]
ref|XP_010062962.1|  PREDICTED: transcription factor ILR3-like is...    105   8e-24   Eucalyptus grandis [rose gum]
ref|XP_001778884.1|  predicted protein                                  105   1e-23   
ref|XP_004134070.1|  PREDICTED: transcription factor bHLH104-like       105   2e-23   Cucumis sativus [cucumbers]
ref|XP_002881143.1|  predicted protein                                  102   3e-23   
ref|XP_007223393.1|  hypothetical protein PRUPE_ppa011217mg             103   5e-23   
gb|KDP40313.1|  hypothetical protein JCGZ_02311                         103   7e-23   Jatropha curcas
gb|KHN33610.1|  Transcription factor ILR3                               101   8e-23   Glycine soja [wild soybean]
ref|XP_006420196.1|  hypothetical protein CICLE_v10005872mg             102   9e-23   
ref|XP_008438540.1|  PREDICTED: transcription factor bHLH104-like       103   1e-22   Cucumis melo [Oriental melon]
ref|XP_006489748.1|  PREDICTED: transcription factor bHLH104-like...    102   1e-22   Citrus sinensis [apfelsine]
ref|XP_006489749.1|  PREDICTED: transcription factor bHLH104-like...    102   1e-22   
ref|XP_006420195.1|  hypothetical protein CICLE_v10005872mg             102   1e-22   Citrus clementina [clementine]
ref|XP_006827502.1|  hypothetical protein AMTR_s00009p00175450          102   1e-22   Amborella trichopoda
ref|XP_006379889.1|  hypothetical protein POPTR_0008s16560g             102   1e-22   Populus trichocarpa [western balsam poplar]
gb|KJB81835.1|  hypothetical protein B456_013G164100                    102   1e-22   Gossypium raimondii
gb|AFW87276.1|  putative HLH DNA-binding domain superfamily protein     102   2e-22   
ref|XP_009395404.1|  PREDICTED: transcription factor ILR3-like          102   3e-22   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_849383.1|  transcription factor bHLH104                          103   3e-22   Arabidopsis thaliana [mouse-ear cress]
ref|NP_567431.1|  transcription factor bHLH104                          103   3e-22   Arabidopsis thaliana [mouse-ear cress]
gb|ACN40263.1|  unknown                                                 102   3e-22   Picea sitchensis
ref|XP_009409051.1|  PREDICTED: transcription factor ILR3-like is...    101   3e-22   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_001754335.1|  predicted protein                                  101   3e-22   
gb|ABK23190.1|  unknown                                                 102   4e-22   Picea sitchensis
ref|XP_001777933.1|  predicted protein                                  100   4e-22   
ref|XP_002862580.1|  hypothetical protein ARALYDRAFT_920517           99.0    4e-22   
ref|XP_004952164.1|  PREDICTED: transcription factor ILR3-like          101   5e-22   Setaria italica
ref|XP_002268590.2|  PREDICTED: transcription factor bHLH104-like     99.8    2e-21   Vitis vinifera
ref|XP_010544248.1|  PREDICTED: transcription factor bHLH115          99.4    3e-21   Tarenaya hassleriana [spider flower]
ref|NP_001148890.1|  DNA binding protein                              99.4    3e-21   
ref|XP_002870316.1|  basic helix-loop-helix family protein            99.8    5e-21   
ref|XP_010450041.1|  PREDICTED: transcription factor bHLH104-like     99.0    7e-21   Camelina sativa [gold-of-pleasure]
gb|KJB13569.1|  hypothetical protein B456_002G081900                  97.8    7e-21   Gossypium raimondii
ref|XP_009395406.1|  PREDICTED: transcription factor ILR3-like        98.2    8e-21   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009381065.1|  PREDICTED: transcription factor bHLH115-like     98.2    8e-21   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001142225.1|  uncharacterized protein LOC100274393             96.3    8e-21   
ref|XP_010937538.1|  PREDICTED: transcription factor bHLH115-like...  98.2    9e-21   Elaeis guineensis
ref|XP_010937539.1|  PREDICTED: transcription factor ILR3-like is...  97.8    9e-21   Elaeis guineensis
ref|XP_009388594.1|  PREDICTED: transcription factor bHLH115-like     97.8    1e-20   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011073517.1|  PREDICTED: transcription factor bHLH104          97.8    1e-20   Sesamum indicum [beniseed]
ref|XP_009419715.1|  PREDICTED: transcription factor ILR3-like        97.4    1e-20   
ref|XP_010650065.1|  PREDICTED: transcription factor bHLH104 isof...  97.1    1e-20   
ref|XP_004296358.1|  PREDICTED: transcription factor bHLH104          97.4    1e-20   
gb|ACN37104.1|  unknown                                               95.9    2e-20   
ref|XP_002280987.2|  PREDICTED: transcription factor bHLH104 isof...  97.1    2e-20   
ref|XP_002439907.1|  hypothetical protein SORBIDRAFT_09g022280        97.1    2e-20   
ref|XP_003568328.1|  PREDICTED: transcription factor ILR3-like        97.1    2e-20   
emb|CBI23608.3|  unnamed protein product                              97.1    2e-20   
ref|XP_006284189.1|  hypothetical protein CARUB_v10005335mg           97.4    3e-20   
gb|KFK39609.1|  hypothetical protein AALP_AA3G266100                  97.8    3e-20   
ref|XP_008803141.1|  PREDICTED: transcription factor bHLH115-like     96.7    3e-20   
ref|XP_006594877.1|  PREDICTED: transcription factor ILR3-like is...  95.9    3e-20   
ref|XP_010435125.1|  PREDICTED: transcription factor bHLH104          97.1    3e-20   
ref|XP_009409049.1|  PREDICTED: transcription factor bHLH115-like...  96.3    4e-20   
ref|XP_006648231.1|  PREDICTED: transcription factor ILR3-like        95.5    7e-20   
ref|XP_010440465.1|  PREDICTED: transcription factor bHLH104-like     95.9    8e-20   
ref|XP_010532633.1|  PREDICTED: transcription factor bHLH104          96.3    9e-20   
gb|ACF81377.1|  unknown                                               95.1    1e-19   
ref|XP_003590056.1|  Transcription factor bHLH104                     95.1    1e-19   
emb|CDY12770.1|  BnaC04g28710D                                        95.1    2e-19   
ref|XP_008660879.1|  PREDICTED: transcription factor ILR3-like        92.8    2e-19   
ref|XP_004961887.1|  PREDICTED: transcription factor ILR3-like        94.0    3e-19   
ref|XP_009124106.1|  PREDICTED: transcription factor bHLH104 isof...  94.4    3e-19   
ref|XP_009124105.1|  PREDICTED: transcription factor bHLH104 isof...  94.4    3e-19   
emb|CDY49420.1|  BnaCnng17300D                                        94.4    3e-19   
ref|XP_010069141.1|  PREDICTED: transcription factor bHLH104-like     93.6    4e-19   
ref|XP_010937540.1|  PREDICTED: transcription factor ILR3-like is...  92.8    5e-19   
gb|AAM10939.1|AF488573_1  putative bHLH transcription factor          93.6    6e-19   
ref|NP_188962.2|  transcription factor bHLH34                         93.6    8e-19   
gb|EMS59404.1|  Transcription factor ILR3                             93.6    8e-19   
dbj|BAJ87023.1|  predicted protein                                    92.4    8e-19   
gb|KFK23754.1|  hypothetical protein AALP_AAs74096U000300             92.8    9e-19   
ref|XP_004497838.1|  PREDICTED: transcription factor bHLH104-like     92.0    1e-18   
gb|EMT28781.1|  Transcription factor ILR3                             91.7    1e-18   
ref|NP_001045680.1|  Os02g0116600                                     92.0    1e-18   
ref|XP_010512182.1|  PREDICTED: transcription factor bHLH34-like      91.7    3e-18   
gb|EMS59536.1|  Transcription factor ILR3                             90.9    3e-18   
ref|XP_006298151.1|  hypothetical protein CARUB_v10014200mg           91.7    3e-18   
ref|XP_011091209.1|  PREDICTED: transcription factor bHLH104          90.5    4e-18   
ref|XP_006414711.1|  hypothetical protein EUTSA_v10025927mg           90.9    4e-18   
ref|XP_011029840.1|  PREDICTED: transcription factor bHLH104-like...  90.1    5e-18   
ref|XP_010466638.1|  PREDICTED: transcription factor bHLH34-like      90.9    6e-18   
emb|CDO99218.1|  unnamed protein product                              90.1    6e-18   
ref|XP_002885559.1|  basic helix-loop-helix family protein            90.5    8e-18   
ref|XP_009775135.1|  PREDICTED: transcription factor bHLH104 isof...  89.4    1e-17   
gb|KHG15573.1|  Transcription factor ILR3 -like protein               87.0    1e-17   
ref|XP_010488368.1|  PREDICTED: transcription factor bHLH34-like      89.7    1e-17   
ref|XP_009609911.1|  PREDICTED: transcription factor bHLH104-like     88.2    2e-17   
ref|XP_007035086.1|  Basic helix-loop-helix DNA-binding superfami...  87.4    4e-17   
ref|XP_006406065.1|  hypothetical protein EUTSA_v10021177mg           88.2    5e-17   
ref|XP_010674918.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...  85.5    5e-17   
ref|XP_010326757.1|  PREDICTED: transcription factor bHLH104          87.0    6e-17   
ref|XP_006354504.1|  PREDICTED: transcription factor bHLH104-like     87.0    6e-17   
ref|XP_002529295.1|  DNA binding protein, putative                    86.7    7e-17   
dbj|BAK00374.1|  predicted protein                                    86.7    1e-16   
ref|XP_011029839.1|  PREDICTED: transcription factor bHLH104-like...  86.3    1e-16   
ref|XP_003535811.1|  PREDICTED: transcription factor bHLH104-like     85.9    1e-16   
ref|XP_010093421.1|  hypothetical protein L484_012819                 86.3    1e-16   
ref|XP_008350013.1|  PREDICTED: transcription factor bHLH34-like      84.0    2e-16   
ref|XP_010650066.1|  PREDICTED: transcription factor ILR3 isoform X3  84.7    2e-16   
emb|CDX77539.1|  BnaA07g06770D                                        85.9    2e-16   
ref|XP_007035087.1|  Basic helix-loop-helix DNA-binding superfami...  85.1    3e-16   
ref|XP_009102650.1|  PREDICTED: transcription factor bHLH34           85.5    3e-16   
gb|EYU32540.1|  hypothetical protein MIMGU_mgv1a012843mg              84.3    6e-16   
gb|ACU18977.1|  unknown                                               84.0    6e-16   
ref|XP_009775141.1|  PREDICTED: transcription factor bHLH104 isof...  84.0    6e-16   
gb|EYU25978.1|  hypothetical protein MIMGU_mgv1a0142551mg             82.8    7e-16   
ref|XP_003555760.1|  PREDICTED: transcription factor bHLH104-like     83.6    8e-16   
ref|XP_008361598.1|  PREDICTED: transcription factor bHLH34-like      81.3    1e-15   
gb|KHN33607.1|  Transcription factor ILR3                             79.3    1e-15   
ref|XP_002993147.1|  hypothetical protein SELMODRAFT_431241           82.8    2e-15   
ref|XP_007145840.1|  hypothetical protein PHAVU_007G272600g           82.4    2e-15   
gb|EMT29974.1|  Transcription factor ILR3                             82.8    2e-15   
gb|EPS62474.1|  hypothetical protein M569_12315                       80.9    3e-15   
gb|KHN00301.1|  Transcription factor bHLH104                          81.6    4e-15   
gb|ACU21182.1|  unknown                                               80.9    5e-15   
ref|XP_010256783.1|  PREDICTED: transcription factor ILR3-like        81.3    5e-15   
emb|CDX85069.1|  BnaC07g08370D                                        82.0    6e-15   
emb|CDY08983.1|  BnaC01g31080D                                        81.6    8e-15   
ref|XP_010671056.1|  PREDICTED: transcription factor bHLH104          80.1    1e-14   
ref|XP_002964160.1|  hypothetical protein SELMODRAFT_405883           78.2    2e-14   
ref|XP_003573308.1|  PREDICTED: transcription factor ILR3-like        80.1    2e-14   
gb|KHN22198.1|  Transcription factor bHLH104                          79.3    2e-14   
emb|CDY35510.1|  BnaA01g24020D                                        79.0    7e-14   
gb|AFW66778.1|  putative HLH DNA-binding domain superfamily protein   72.4    2e-12   
emb|CAN61035.1|  hypothetical protein VITISV_041750                   72.4    3e-12   
gb|EAY98281.1|  hypothetical protein OsI_20189                        72.0    7e-12   
emb|CBI35161.3|  unnamed protein product                              69.7    2e-11   
gb|EEE63953.1|  hypothetical protein OsJ_18778                        69.7    5e-11   
ref|XP_001758113.1|  predicted protein                                69.3    4e-10   
gb|EEC73066.1|  hypothetical protein OsI_07026                        68.6    5e-10   
ref|NP_001046730.1|  Os02g0433600                                     68.6    5e-10   
ref|XP_008813250.1|  PREDICTED: transcription factor bHLH104-like     65.9    6e-10   
ref|XP_010548277.1|  PREDICTED: transcription factor bHLH11           66.2    3e-09   
gb|ACU17812.1|  unknown                                               62.4    5e-09   
ref|XP_006665082.1|  PREDICTED: transcription factor bHLH121-like     65.1    8e-09   
ref|XP_007133432.1|  hypothetical protein PHAVU_011G178100g           63.9    1e-08   
ref|XP_011396941.1|  Transcription factor                             61.6    2e-08   
gb|KIZ04759.1|  Transcription factor bHLH34                           63.9    2e-08   
ref|XP_001771284.1|  predicted protein                                64.3    2e-08   
ref|XP_002458163.1|  hypothetical protein SORBIDRAFT_03g028030        63.5    2e-08   
ref|NP_001152439.1|  LOC100286079                                     63.2    3e-08   
ref|XP_003059710.1|  predicted protein                                62.8    3e-08   
ref|XP_004952384.1|  PREDICTED: transcription factor bHLH121-like     62.8    4e-08   
emb|CDO96948.1|  unnamed protein product                              63.2    4e-08   
ref|XP_010090287.1|  hypothetical protein L484_024952                 62.4    6e-08   
ref|XP_006851964.1|  hypothetical protein AMTR_s00041p00193340        62.4    6e-08   
ref|XP_003531414.1|  PREDICTED: transcription factor bHLH121-like     61.6    7e-08   
ref|XP_003529225.1|  PREDICTED: transcription factor bHLH121 isof...  62.0    8e-08   
ref|XP_003573201.1|  PREDICTED: transcription factor bHLH121-like     62.0    8e-08   
ref|XP_007153217.1|  hypothetical protein PHAVU_003G016700g           62.0    9e-08   
ref|XP_002505435.1|  predicted protein                                61.2    9e-08   
ref|XP_008440819.1|  PREDICTED: transcription factor bHLH121          62.0    1e-07   
emb|CDY33424.1|  BnaC01g33010D                                        62.0    1e-07   
ref|XP_004134862.1|  PREDICTED: transcription factor bHLH121-like     61.6    1e-07   
gb|KGN48915.1|  hypothetical protein Csa_6G505920                     61.6    1e-07   
ref|XP_004158905.1|  PREDICTED: transcription factor bHLH121-like     61.2    1e-07   
ref|XP_002521657.1|  DNA binding protein, putative                    61.2    1e-07   
gb|EPS66403.1|  hypothetical protein M569_08377                       60.5    1e-07   
ref|XP_006859207.1|  hypothetical protein AMTR_s00070p00188780        61.6    1e-07   
ref|XP_006583728.1|  PREDICTED: transcription factor bHLH121 isof...  61.2    2e-07   
emb|CEG02114.1|  Myc-type, basic helix-loop-helix (bHLH) domain       60.5    2e-07   
ref|XP_010918791.1|  PREDICTED: transcription factor bHLH104-like...  58.5    2e-07   
ref|XP_003083024.1|  unnamed protein product                          60.1    2e-07   
ref|XP_006391636.1|  hypothetical protein EUTSA_v10023630mg           60.5    2e-07   
ref|XP_010487939.1|  PREDICTED: transcription factor bHLH121-like     60.5    3e-07   
ref|NP_188620.1|  transcription factor bHLH121                        60.5    3e-07   
ref|XP_010679934.1|  PREDICTED: transcription factor bHLH121          60.5    3e-07   
ref|NP_001030729.1|  transcription factor bHLH121                     60.5    3e-07   
gb|KEH30588.1|  transcription factor                                  60.1    3e-07   
ref|XP_010466150.1|  PREDICTED: transcription factor bHLH121          60.1    3e-07   
ref|XP_010113346.1|  hypothetical protein L484_026678                 60.5    3e-07   
ref|XP_011092862.1|  PREDICTED: transcription factor bHLH121          60.5    3e-07   
ref|XP_002885338.1|  basic helix-loop-helix family protein            60.1    3e-07   
ref|XP_004289841.1|  PREDICTED: transcription factor bHLH121          60.5    3e-07   
ref|XP_010920215.1|  PREDICTED: transcription factor bHLH121          60.5    3e-07   
ref|XP_010497553.1|  PREDICTED: transcription factor bHLH115-like     57.4    3e-07   
ref|XP_010526564.1|  PREDICTED: transcription factor bHLH121          60.1    3e-07   
ref|XP_010261279.1|  PREDICTED: transcription factor bHLH121          60.1    4e-07   
ref|XP_003546649.1|  PREDICTED: transcription factor bHLH121 isof...  59.7    4e-07   
ref|XP_006487406.1|  PREDICTED: transcription factor bHLH121-like...  60.1    4e-07   
ref|XP_006423595.1|  hypothetical protein CICLE_v10028783mg           60.1    4e-07   
gb|KDP46754.1|  hypothetical protein JCGZ_06542                       60.1    4e-07   
gb|KDP27585.1|  hypothetical protein JCGZ_19590                       60.1    4e-07   
gb|KDO39039.1|  hypothetical protein CISIN_1g022288mg                 59.7    4e-07   
gb|ACU18754.1|  unknown                                               57.0    5e-07   
gb|KEH30589.1|  transcription factor                                  59.7    5e-07   
ref|XP_002529247.1|  DNA binding protein, putative                    59.7    5e-07   
ref|XP_004505689.1|  PREDICTED: transcription factor bHLH121-like...  59.3    5e-07   
ref|XP_008236198.1|  PREDICTED: transcription factor bHLH121          59.7    5e-07   
ref|XP_006406448.1|  hypothetical protein EUTSA_v10021271mg           58.9    8e-07   
ref|XP_009383990.1|  PREDICTED: transcription factor bHLH121          58.9    8e-07   
ref|XP_007200377.1|  hypothetical protein PRUPE_ppa008347mg           59.3    8e-07   
emb|CAN74571.1|  hypothetical protein VITISV_018451                   59.3    8e-07   
ref|XP_008457648.1|  PREDICTED: transcription factor bHLH121 isof...  59.3    8e-07   
ref|XP_009610672.1|  PREDICTED: transcription factor bHLH121-like...  58.9    9e-07   
ref|XP_010508140.1|  PREDICTED: transcription factor bHLH121-like     58.9    9e-07   
gb|KHN05467.1|  Transcription factor bHLH121                          58.5    1e-06   
ref|XP_004147018.1|  PREDICTED: transcription factor bHLH121-like     58.9    1e-06   
ref|XP_009610673.1|  PREDICTED: transcription factor bHLH121-like...  58.5    1e-06   
gb|KEH40640.1|  transcription factor                                  58.9    1e-06   
ref|XP_004158392.1|  PREDICTED: transcription factor bHLH121-like     58.5    1e-06   
ref|XP_002277206.2|  PREDICTED: transcription factor bHLH121          58.5    1e-06   
ref|XP_007046692.1|  Basic helix-loop-helix DNA-binding superfami...  58.2    1e-06   
ref|XP_009783164.1|  PREDICTED: transcription factor bHLH121-like     58.2    2e-06   
ref|XP_010029678.1|  PREDICTED: transcription factor bHLH121 isof...  58.2    2e-06   
ref|XP_004230930.1|  PREDICTED: transcription factor bHLH121          58.2    2e-06   
ref|XP_006359650.1|  PREDICTED: transcription factor bHLH121-like...  58.2    2e-06   
emb|CDY42214.1|  BnaA01g25810D                                        58.2    2e-06   
ref|XP_006359649.1|  PREDICTED: transcription factor bHLH121-like...  58.2    2e-06   
ref|XP_007041927.1|  Basic helix-loop-helix DNA-binding superfami...  58.2    2e-06   
ref|XP_009111465.1|  PREDICTED: transcription factor bHLH121          57.8    2e-06   
ref|XP_009788103.1|  PREDICTED: transcription factor bHLH121          57.8    2e-06   
ref|XP_011037263.1|  PREDICTED: transcription factor bHLH121-like     57.8    2e-06   
gb|KCW56632.1|  hypothetical protein EUGRSUZ_I02346                   57.8    2e-06   
gb|AAL91266.1|  AT4g36060/T19K4_190                                   57.4    2e-06   
ref|XP_008336910.1|  PREDICTED: transcription factor bHLH121-like     56.6    2e-06   
ref|NP_195330.2|  transcription factor bHLH11                         57.4    3e-06   
ref|XP_002306170.1|  hypothetical protein POPTR_0004s17540g           57.4    3e-06   
ref|XP_010029679.1|  PREDICTED: transcription factor bHLH121 isof...  57.4    3e-06   
ref|XP_008788364.1|  PREDICTED: transcription factor bHLH121 isof...  57.4    3e-06   
ref|NP_849566.1|  transcription factor bHLH11                         57.0    3e-06   
ref|XP_002312979.2|  hypothetical protein POPTR_0009s13220g           57.4    3e-06   
ref|XP_006383101.1|  hypothetical protein POPTR_0005s11550g           57.0    4e-06   
ref|XP_002984127.1|  hypothetical protein SELMODRAFT_445783           56.6    4e-06   
ref|XP_006359651.1|  PREDICTED: transcription factor bHLH121-like...  57.0    4e-06   
ref|XP_008788362.1|  PREDICTED: transcription factor bHLH121 isof...  57.0    4e-06   
ref|XP_007131595.1|  hypothetical protein PHAVU_011G026500g           56.6    4e-06   
ref|XP_002265960.1|  PREDICTED: transcription factor bHLH121          56.6    6e-06   
emb|CBI17374.3|  unnamed protein product                              56.6    6e-06   
emb|CAA18500.1|  putative Myc-type transcription factor               56.2    6e-06   
ref|XP_010446832.1|  PREDICTED: transcription factor bHLH11-like      56.6    6e-06   
ref|XP_010690442.1|  PREDICTED: transcription factor bHLH121-like     56.2    7e-06   
ref|XP_011043188.1|  PREDICTED: transcription factor bHLH121-like     56.2    7e-06   
ref|NP_001141709.1|  uncharacterized protein LOC100273838             53.5    8e-06   
gb|KJB32632.1|  hypothetical protein B456_005G252200                  55.8    1e-05   
ref|XP_010066253.1|  PREDICTED: transcription factor bHLH121-like     55.5    1e-05   
gb|KJB32629.1|  hypothetical protein B456_005G252200                  55.5    1e-05   
gb|KJB32630.1|  hypothetical protein B456_005G252200                  55.5    1e-05   
ref|XP_008241823.1|  PREDICTED: transcription factor bHLH121          55.5    1e-05   
ref|XP_011046795.1|  PREDICTED: transcription factor bHLH121-like     55.1    2e-05   
ref|XP_009346632.1|  PREDICTED: transcription factor bHLH121          55.1    2e-05   
ref|XP_009363493.1|  PREDICTED: transcription factor bHLH121-like     55.1    2e-05   
ref|XP_004287813.1|  PREDICTED: transcription factor bHLH121          55.1    2e-05   
ref|XP_010437386.1|  PREDICTED: transcription factor bHLH11-like ...  54.3    2e-05   
gb|KHG29974.1|  Transcription factor protein                          54.3    3e-05   
ref|XP_006406447.1|  hypothetical protein EUTSA_v10021271mg           54.3    3e-05   
ref|XP_010437385.1|  PREDICTED: transcription factor bHLH11-like ...  53.9    3e-05   
ref|XP_007204901.1|  hypothetical protein PRUPE_ppa008596mg           54.3    3e-05   
ref|XP_009379403.1|  PREDICTED: transcription factor bHLH121-like     53.9    4e-05   
emb|CAN69664.1|  hypothetical protein VITISV_029413                   54.7    4e-05   
gb|KJB43327.1|  hypothetical protein B456_007G194400                  53.5    5e-05   
ref|XP_006412028.1|  hypothetical protein EUTSA_v10026039mg           53.5    5e-05   
gb|KJB43326.1|  hypothetical protein B456_007G194400                  53.5    5e-05   
gb|KFK30238.1|  hypothetical protein AALP_AA7G235400                  52.8    9e-05   
ref|XP_005646379.1|  hypothetical protein COCSUDRAFT_42874            52.8    9e-05   
gb|KDP44874.1|  hypothetical protein JCGZ_01374                       51.6    1e-04   
tpg|DAA58568.1|  TPA: putative HLH DNA-binding domain superfamily...  52.4    1e-04   
ref|XP_006285497.1|  hypothetical protein CARUB_v10006934mg           52.0    2e-04   
gb|ABA27067.1|  TO91-1rc                                              49.3    2e-04   
ref|NP_001242300.1|  uncharacterized protein LOC100817000             51.6    3e-04   



>ref|XP_009617474.1| PREDICTED: transcription factor ILR3-like [Nicotiana tomentosiformis]
Length=230

 Score =   226 bits (577),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 142/220 (65%), Positives = 167/220 (76%), Gaps = 10/220 (5%)
 Frame = +1

Query  106  MAAPEVDGSNWLLDLGF-EDIPLPGGKFPPLEPGYQWHssailspappsiRQDESYVKFD  282
            MA  E DGSNWLL+LG  ED+P        LEP  QW S+A   P   S   D+SY   D
Sbjct  1    MAETEEDGSNWLLELGLMEDLP-------SLEPNAQWPSTAFSLPNNLSSGLDDSYDNSD  53

Query  283  VSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILS  462
                C ++KR +SGAC  A+DSKA REKMRR +LNDRFQELS +++PGK PKMDKS ILS
Sbjct  54   SLKDCGSKKRARSGAC--ASDSKAHREKMRRDKLNDRFQELSSILEPGKQPKMDKSVILS  111

Query  463  DAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkalNS  642
            DAVRMV+QLRDEAQKLKES+++LQE+VNELKAEKNEL+DEKQKLK EKDKLE QLK  N+
Sbjct  112  DAVRMVVQLRDEAQKLKESYDNLQEKVNELKAEKNELRDEKQKLKAEKDKLEQQLKTTNA  171

Query  643  RPGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQF  762
            +PGFLPHPPA A PF  PH +   K++P++GYPGIPMWQF
Sbjct  172  QPGFLPHPPAMASPFSAPHQVYASKMMPYLGYPGIPMWQF  211



>ref|XP_009772342.1| PREDICTED: transcription factor ILR3-like [Nicotiana sylvestris]
Length=230

 Score =   224 bits (570),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 140/220 (64%), Positives = 167/220 (76%), Gaps = 10/220 (5%)
 Frame = +1

Query  106  MAAPEVDGSNWLLDLGF-EDIPLPGGKFPPLEPGYQWHssailspappsiRQDESYVKFD  282
            MA  E DGSNWL++LG  ED+P        LEP  QW S+A   P   S   D+SY   D
Sbjct  1    MAETEEDGSNWLIELGLMEDLP-------SLEPNAQWPSTAFSLPNNLSSGLDDSYGNSD  53

Query  283  VSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILS  462
                C ++KR +SGAC  A+DSKA REKMRR +LNDRFQELS +++PGK PKMDKS ILS
Sbjct  54   SLKDCGSKKRARSGAC--ASDSKAHREKMRRDKLNDRFQELSSILEPGKQPKMDKSVILS  111

Query  463  DAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkalNS  642
            DAVRMV+QLRDEAQKL+ES+++LQE+VNELKAEKNEL+DEKQKLK EKDKLE QLK  N+
Sbjct  112  DAVRMVVQLRDEAQKLRESYDNLQEKVNELKAEKNELRDEKQKLKAEKDKLEQQLKTTNA  171

Query  643  RPGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQF  762
            +PGFLPHPPA A PF  PH +   K++P++GYPGIPMWQF
Sbjct  172  QPGFLPHPPAMASPFSAPHQVYSSKMMPYLGYPGIPMWQF  211



>ref|XP_004232754.1| PREDICTED: transcription factor ILR3 [Solanum lycopersicum]
Length=230

 Score =   213 bits (542),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 137/221 (62%), Positives = 164/221 (74%), Gaps = 10/221 (5%)
 Frame = +1

Query  106  MAAPEVDGSNWLLDLGF-EDIPLPGGKFPPLEPGYQWHssailspappsiRQDESYVKFD  282
            MA  E DGSNWL++LG  ED+P        LEP  QW S+A   P   S   ++SY   D
Sbjct  1    MAETEEDGSNWLIELGLMEDLP-------SLEPNAQWPSNAFSLPNNLSSGLEDSYGNSD  53

Query  283  VSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILS  462
                C ++KR++SGAC  A+DSKA REKMRR +LNDRFQELS +++PGK PKMDKS IL 
Sbjct  54   SLKECGSKKRVRSGAC--ASDSKAHREKMRRDKLNDRFQELSSILEPGKQPKMDKSVILG  111

Query  463  DAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkalNS  642
            DAVRMV+QLRDEAQKLKES  +LQE+V ELKAEKNEL+DEKQKLK EKDKLE  LKA+N+
Sbjct  112  DAVRMVVQLRDEAQKLKESNNNLQEKVIELKAEKNELRDEKQKLKAEKDKLEQHLKAMNT  171

Query  643  RPGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQFA  765
            +PGFLPHPPA   PF  PH +   K++P++GYPGIPMWQF 
Sbjct  172  QPGFLPHPPAMPSPFSAPHQVFASKMMPYIGYPGIPMWQFV  212



>ref|XP_006365882.1| PREDICTED: transcription factor ILR3-like [Solanum tuberosum]
Length=230

 Score =   212 bits (540),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 137/221 (62%), Positives = 164/221 (74%), Gaps = 10/221 (5%)
 Frame = +1

Query  106  MAAPEVDGSNWLLDLGF-EDIPLPGGKFPPLEPGYQWHssailspappsiRQDESYVKFD  282
            MA  E DGSNWL++LG  ED+P        LEP  QW S+A   P   S   ++SY   D
Sbjct  1    MAETEEDGSNWLIELGLMEDLP-------SLEPNAQWPSNAFSIPNNLSSGLEDSYGNSD  53

Query  283  VSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILS  462
                C ++KR++SGAC  A+DSKA REKMRR +LNDRFQELS +++PGK PKMDKS IL 
Sbjct  54   SLKECGSKKRVRSGAC--ASDSKAHREKMRRDKLNDRFQELSSILEPGKQPKMDKSVILG  111

Query  463  DAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkalNS  642
            DAVRMV+QLRDEAQKLKES  +LQE+V ELKAEKNEL+DEKQKLK EKDKLE  LKA+N+
Sbjct  112  DAVRMVVQLRDEAQKLKESNNNLQEKVIELKAEKNELRDEKQKLKAEKDKLEQHLKAMNT  171

Query  643  RPGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQFA  765
            +PGFLPHPPA   PF  PH +   K++P++GYPGIPMWQF 
Sbjct  172  QPGFLPHPPAMPSPFSAPHQVFASKMMPYLGYPGIPMWQFV  212



>ref|XP_008224874.1| PREDICTED: transcription factor ILR3-like [Prunus mume]
Length=238

 Score =   196 bits (498),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 128/212 (60%), Positives = 162/212 (76%), Gaps = 3/212 (1%)
 Frame = +1

Query  133  NWLLDLG-FEDIPLPGGKFPPLE-PGYQWHssailspappsiRQDESYVKFDVSNGCSAR  306
            NW+ D G  EDIP+PGG  PPL+ PG+ W S + ++PA PS+  D+S+   D       R
Sbjct  9    NWVFDYGVLEDIPVPGGDLPPLDLPGFTWPSHSFVAPAAPSVDFDDSFGNSDSIKESGCR  68

Query  307  KRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRMVLQ  486
            KR++SG+C+    SKA REKMRR RLNDRF ELS +++PG+PPK DK+AIL DAVR+V Q
Sbjct  69   KRVRSGSCN-VTGSKACREKMRRDRLNDRFLELSSMLEPGRPPKTDKAAILGDAVRVVNQ  127

Query  487  LRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkalNSRPGFLPHP  666
            LR EAQ+LK+S  DLQE++NELKAEKNEL+DEKQ+LK EK+ +E Q+KALN++PGFLPHP
Sbjct  128  LRGEAQQLKDSNGDLQEKINELKAEKNELRDEKQRLKTEKENIERQIKALNTQPGFLPHP  187

Query  667  PATAVPFPTPHHLVGGKLVPFVGYPGIPMWQF  762
             A   PF  P  +VGGKL+PFVGYPG+ MWQF
Sbjct  188  AAIPGPFSAPGQVVGGKLMPFVGYPGVSMWQF  219



>ref|XP_007211937.1| hypothetical protein PRUPE_ppa010730mg [Prunus persica]
 gb|EMJ13136.1| hypothetical protein PRUPE_ppa010730mg [Prunus persica]
Length=238

 Score =   196 bits (497),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 128/212 (60%), Positives = 162/212 (76%), Gaps = 3/212 (1%)
 Frame = +1

Query  133  NWLLDLG-FEDIPLPGGKFPPLE-PGYQWHssailspappsiRQDESYVKFDVSNGCSAR  306
            NW+ D G  EDIP+PGG  PPL+ PG+ W S + ++PA PS+  D+S+   D       R
Sbjct  9    NWVFDYGVLEDIPVPGGDLPPLDLPGFTWPSHSFVAPAAPSVDFDDSFGNSDSIKESGFR  68

Query  307  KRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRMVLQ  486
            KR++SG+C+    SKA REKMRR RLNDRF ELS +++PG+PPK DK+AIL DAVR+V Q
Sbjct  69   KRVRSGSCN-VTGSKACREKMRRDRLNDRFLELSSMLEPGRPPKTDKAAILGDAVRVVNQ  127

Query  487  LRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkalNSRPGFLPHP  666
            LR EAQ+LK+S  DLQE++NELKAEKNEL+DEKQ+LK EK+ +E Q+KALN++PGFLPHP
Sbjct  128  LRGEAQQLKDSNGDLQEKINELKAEKNELRDEKQRLKTEKENIERQIKALNTQPGFLPHP  187

Query  667  PATAVPFPTPHHLVGGKLVPFVGYPGIPMWQF  762
             A   PF  P  +VGGKL+PFVGYPG+ MWQF
Sbjct  188  AAIPGPFSAPGQVVGGKLMPFVGYPGVSMWQF  219



>emb|CDO99702.1| unnamed protein product [Coffea canephora]
Length=245

 Score =   194 bits (494),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 133/230 (58%), Positives = 163/230 (71%), Gaps = 15/230 (7%)
 Frame = +1

Query  106  MAAPEVDGSNWLLDLGF-EDIPLPGGKFPPLEPGYQ-WHssailspappsiRQDESYVKF  279
            MA+PE D SNW+ D G  EDIP+PGG  PPL+PG+Q W +++  +P    +  D ++   
Sbjct  1    MASPEED-SNWVFDFGLIEDIPVPGGDLPPLDPGFQNWSNNSFYNPNSVEL--DGAFQSS  57

Query  280  DVSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDR---------FQELSCVMDPGKP  432
                  S+RKR +SG CS A DSKA REKMRR +LNDR         FQELS ++DP +P
Sbjct  58   QSRKEASSRKRARSGPCS-ATDSKAYREKMRRDKLNDRQTLSLSLYLFQELSFLLDPERP  116

Query  433  PKMDKSAILSDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdk  612
            PK+DKSAIL DA RM++QLRDEA+KLKES+E LQE+VNELKAEKNEL+DEKQK K EKDK
Sbjct  117  PKVDKSAILGDATRMLIQLRDEAEKLKESYERLQEKVNELKAEKNELRDEKQKQKAEKDK  176

Query  613  lelqlkalNSRPGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQF  762
            LE QLKAL+S+ GFL +P A   PF  PH +   K+ PFVGYPG  MW F
Sbjct  177  LEHQLKALSSQTGFLSNPSAILAPFVAPHQVFSSKMTPFVGYPGTSMWHF  226



>gb|KDP20820.1| hypothetical protein JCGZ_21291 [Jatropha curcas]
Length=237

 Score =   193 bits (490),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 125/223 (56%), Positives = 159/223 (71%), Gaps = 5/223 (2%)
 Frame = +1

Query  106  MAAPEVDGSNWLLDLG-FEDIPLPGGKFPPLEP-GYQWHssailspappsiRQDESYVKF  279
            M +P  D +NW+ D     D+P+PGG+ P LEP G  W S+  +  +  S+  D S+ K 
Sbjct  1    MGSPN-DNANWVFDYNMIADVPVPGGELPSLEPAGALWSSTPFIDNSSVSVGLDGSFGKS  59

Query  280  DVSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAIL  459
            DV     +RKR++ G+C+    SKA REKMRR RLNDRF EL  ++DPG PPKMDKS IL
Sbjct  60   DVIEDNGSRKRVRPGSCNSVG-SKACREKMRRDRLNDRFMELGALLDPGMPPKMDKSVIL  118

Query  460  SDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkalN  639
            +DAV+MV QLRDEAQKLKES E LQE++NELK EKNEL+DEKQ+LK EK+ +E Q+K L+
Sbjct  119  ADAVKMVNQLRDEAQKLKESNESLQEKINELKVEKNELRDEKQRLKTEKETIERQVKILS  178

Query  640  SRPGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQFAA  768
            +  GF+PHPPA   PF TP  + G KLVP+VGYPG+PMWQ  +
Sbjct  179  APTGFMPHPPAIPAPF-TPSQVFGSKLVPYVGYPGVPMWQVMS  220



>ref|XP_002273184.2| PREDICTED: transcription factor ILR3-like isoform X1 [Vitis vinifera]
Length=232

 Score =   185 bits (470),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 120/220 (55%), Positives = 155/220 (70%), Gaps = 8/220 (4%)
 Frame = +1

Query  106  MAAPEVDGSNWLLDLGF-EDIPLPGGKFPPLEPGYQWHssailspappsiRQDESYVKFD  282
            M +PE D  NW+ D G  +D+P+P      L+  + W S    + A   +  D+S V  D
Sbjct  1    MVSPEED-PNWIFDYGLIDDVPVPS-----LQATFNWPSHDFTASAALGVEFDDSPVNLD  54

Query  283  VSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILS  462
                  +RKRM+SG CS A+ SKA REK+RR RLNDRF EL  +++PG+PPKMDK+ ILS
Sbjct  55   DVKENHSRKRMRSGLCS-ASGSKACREKVRRDRLNDRFLELGSILEPGRPPKMDKAVILS  113

Query  463  DAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkalNS  642
            DA+RM+ QLR E QKLK+S EDLQE++NELKAEKNEL+DEKQ+LK EK+ +  Q+KAL+S
Sbjct  114  DALRMMTQLRSEGQKLKKSCEDLQEKINELKAEKNELRDEKQRLKTEKENIVQQIKALSS  173

Query  643  RPGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQF  762
            + GFLPHP A   PF  P  +VG KL+PF+GYPG+ MWQF
Sbjct  174  QAGFLPHPSAIPAPFAAPGQVVGSKLMPFIGYPGVSMWQF  213



>ref|XP_002518568.1| DNA binding protein, putative [Ricinus communis]
 gb|EEF43955.1| DNA binding protein, putative [Ricinus communis]
Length=229

 Score =   183 bits (464),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 124/227 (55%), Positives = 155/227 (68%), Gaps = 25/227 (11%)
 Frame = +1

Query  106  MAAPEVDGSNWLLDLGF-EDIPLPGGKFPPLEPGYQWHssailspappsiRQDESYVKFD  282
            M +P  D +NW  D G  EDIP+PGG  P L+P   W S ++              V+FD
Sbjct  1    MVSPS-DNANWAFDYGLIEDIPVPGGDLPSLDP--LWSSPSLS-------------VEFD  44

Query  283  VSNGCS-------ARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKM  441
             S G S       +RKR++ G+CSG   SKA REKMRR +LNDRF EL  ++DPG+PPKM
Sbjct  45   DSLGSSQCLRDNGSRKRVRPGSCSGLG-SKACREKMRRDKLNDRFMELGALLDPGRPPKM  103

Query  442  DKSAILSDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklel  621
            DKS IL+DA++MV QLR EAQKLKES E+LQE+VNELK EKNEL+DEKQ+LK EK+ +E 
Sbjct  104  DKSVILADAMKMVNQLRAEAQKLKESNENLQEKVNELKVEKNELRDEKQRLKTEKESIER  163

Query  622  qlkalNSRPGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQF  762
            Q+ AL++   FLPH PA   PF +P  ++G KLVP VGYPG+PMWQ 
Sbjct  164  QVNALSASARFLPHLPAIPAPFSSPSQVIGSKLVPIVGYPGVPMWQL  210



>ref|XP_010267809.1| PREDICTED: transcription factor ILR3 [Nelumbo nucifera]
Length=237

 Score =   181 bits (460),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 120/221 (54%), Positives = 151/221 (68%), Gaps = 5/221 (2%)
 Frame = +1

Query  106  MAAPEVDGSNWLLDLGF-EDIPLPGGKFPPLEPGYQWHssailspappsiRQDESYVKFD  282
            M +PE    NWL D G  +DI +PGG F     G+ W+S  +      S+  D S+   D
Sbjct  1    MVSPE--NPNWLYDYGLMDDISVPGGDFTASTAGFHWNSQPLNGSTSVSLEADGSFGNSD  58

Query  283  VSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILS  462
                  ++KR+++ +CS A  SKA REKMRR RLND+F EL  ++DPG+PPKMDK+AILS
Sbjct  59   GLKEMGSKKRVRTASCS-AVGSKACREKMRRDRLNDKFVELGSILDPGRPPKMDKAAILS  117

Query  463  DAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkalNS  642
            DAVRMV QLR EAQKLKES E LQE++ ELKAEKNEL+DEKQ+LK EK+KLE Q+K L++
Sbjct  118  DAVRMVTQLRSEAQKLKESNESLQEKIKELKAEKNELRDEKQRLKVEKEKLEQQIKTLSA  177

Query  643  RP-GFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQF  762
            +P  FLPHP      FP      G KL+PF+GYPG+ MWQF
Sbjct  178  QPTSFLPHPSTIPAAFPAQGQAAGNKLMPFIGYPGVAMWQF  218



>ref|XP_007025918.1| DNA binding protein, putative isoform 2 [Theobroma cacao]
 gb|EOY28540.1| DNA binding protein, putative isoform 2 [Theobroma cacao]
Length=229

 Score =   181 bits (459),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 124/214 (58%), Positives = 148/214 (69%), Gaps = 24/214 (11%)
 Frame = +1

Query  130  SNWLLD-LGF-EDIPLPGGKFPPLEPGYQWHssailspappsiRQDESYVKFDVSNGCSA  303
            S W+ D  G  EDIP+PGG  P L+P                     + +    S  CS 
Sbjct  18   SGWIFDDYGLLEDIPVPGGDLPSLDPA--------------------APIWSSQSLTCST  57

Query  304  RK-RMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRMV  480
               R +SG+CS A+ SKA REKMRR RLNDRF EL  ++DPG+P K+DK+ IL DAVRMV
Sbjct  58   PPLRARSGSCS-ASGSKACREKMRRDRLNDRFLELGSILDPGRPLKVDKAVILVDAVRMV  116

Query  481  LQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkalNSRPGFLP  660
             QLRDEAQKL+ES E LQE++NELKAEKNEL+DEKQ+LK EK+ LE Q+KAL ++PGFLP
Sbjct  117  TQLRDEAQKLRESNESLQEKINELKAEKNELRDEKQRLKTEKENLEQQVKALGTQPGFLP  176

Query  661  HPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQF  762
            HPPA   PF TP  +VGGKLVPFVGYPG+ MWQF
Sbjct  177  HPPAIPTPFSTPGQVVGGKLVPFVGYPGVSMWQF  210



>ref|XP_009366840.1| PREDICTED: transcription factor ILR3-like [Pyrus x bretschneideri]
Length=238

 Score =   181 bits (458),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 121/212 (57%), Positives = 150/212 (71%), Gaps = 3/212 (1%)
 Frame = +1

Query  133  NWLLDLG-FEDIPLPGGKFPPLEP-GYQWHssailspappsiRQDESYVKFDVSNGCSAR  306
            NW+ D G  EDI +PGG+ P L+P G+ W   +   P  PS   D+S+   D       R
Sbjct  9    NWVFDYGVIEDILVPGGELPSLDPPGFSWPDHSFAGPTAPSTEFDDSFGNPDSMKETGLR  68

Query  307  KRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRMVLQ  486
            KR ++G+ S  + SKA REKMRR RLNDRF ELS +++PG+PPK DK AIL DAVRMV Q
Sbjct  69   KRARTGSSS-VSGSKACREKMRRDRLNDRFVELSSILEPGRPPKTDKVAILGDAVRMVTQ  127

Query  487  LRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkalNSRPGFLPHP  666
            LR EA +LKES  +LQE +NELKAEKNEL+DEKQ+LK EKD +E Q+KAL ++P FLPHP
Sbjct  128  LRGEALQLKESSANLQETINELKAEKNELRDEKQRLKVEKDNIERQIKALGTQPSFLPHP  187

Query  667  PATAVPFPTPHHLVGGKLVPFVGYPGIPMWQF  762
             A   PF  P  +VGGK++PFVGYPG+ MWQF
Sbjct  188  AAIPTPFSAPGQVVGGKMMPFVGYPGMSMWQF  219



>ref|XP_002316706.2| hypothetical protein POPTR_0011s03360g [Populus trichocarpa]
 gb|EEE97318.2| hypothetical protein POPTR_0011s03360g [Populus trichocarpa]
Length=243

 Score =   179 bits (455),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 125/226 (55%), Positives = 151/226 (67%), Gaps = 9/226 (4%)
 Frame = +1

Query  106  MAAPEVDGSNWLLDLGF-EDIPLPGGKFPPLEP------GYQWHssailspappsiRQDE  264
            M +P  +  NW+ D G  EDI +PGG    LE       G  W S      A  S+  + 
Sbjct  1    MVSPN-ENDNWVFDCGLIEDISVPGGDLLGLESLDETPNGSLWSSHNFTDSAFLSVEFNN  59

Query  265  SYVKFDVSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMD  444
            SY   D      +RKR++ G+ S A  SKA REKMRR RLNDRF EL  ++DPG+PPK+D
Sbjct  60   SYENLDGHKESGSRKRVRPGS-SNATGSKACREKMRRDRLNDRFTELGALLDPGRPPKVD  118

Query  445  KSAILSDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelq  624
            KSAIL DA RMV QLRDE+QKLKES   LQE+++ELKAEKNEL+DEKQ+LK EK+ LE Q
Sbjct  119  KSAILVDAARMVTQLRDESQKLKESNVSLQEKIDELKAEKNELRDEKQRLKTEKENLERQ  178

Query  625  lkalNSRPGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQF  762
            +KAL++ P FLPHP A   PF  P  +VG KL+PFVGYPGI MWQF
Sbjct  179  VKALSTPPNFLPHPSAIPAPFSAPGQVVGSKLMPFVGYPGISMWQF  224



>ref|XP_002274829.2| PREDICTED: transcription factor ILR3-like isoform X2 [Vitis vinifera]
Length=240

 Score =   179 bits (454),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 123/222 (55%), Positives = 154/222 (69%), Gaps = 4/222 (2%)
 Frame = +1

Query  106  MAAPEVDGSNWLLDLGF-EDIPLPGGKFPPLEPG--YQWHssailspappsiRQDESYVK  276
            MA    + SNWL D G  EDI +PGG+FP   PG  + W S A+ S +  S+  D S+  
Sbjct  1    MALDSSENSNWLFDYGLMEDITVPGGEFPEPTPGTGFSWPSQALKSSSSVSLEADCSFGD  60

Query  277  FDVSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAI  456
             D       RKR+K  +C GA  +KA REK+RR RLN+RF EL  +++PG+PPK DK+AI
Sbjct  61   SDGLKELGPRKRLKHESC-GATGTKACREKLRRDRLNERFLELGSILEPGRPPKTDKAAI  119

Query  457  LSDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkal  636
            LSDAVRMV QLR EAQKLKES  DLQE++ ELKAEKNEL+DEKQ+LK EK+KLE Q+KA+
Sbjct  120  LSDAVRMVTQLRSEAQKLKESNGDLQEKIKELKAEKNELRDEKQRLKAEKEKLEQQVKAI  179

Query  637  NSRPGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQF  762
            +++PGFLPHP A    F       G KL+PF+GYP + MWQF
Sbjct  180  SAQPGFLPHPSAMPAAFAAQGRAPGNKLMPFIGYPSVAMWQF  221



>ref|XP_010247015.1| PREDICTED: transcription factor ILR3-like [Nelumbo nucifera]
Length=236

 Score =   178 bits (452),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 117/220 (53%), Positives = 150/220 (68%), Gaps = 4/220 (2%)
 Frame = +1

Query  106  MAAPEVDGSNWLLDLGF-EDIPLPGGKFPPLEPGYQWHssailspappsiRQDESYVKFD  282
            M +PE   SNWL + G  +DI +PGG +     G+QW+S  +      ++  D S+   D
Sbjct  1    MGSPE--NSNWLYEYGLMDDITVPGGDYTAPATGFQWNSQPLNGSTNVNVEIDCSFGDSD  58

Query  283  VSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILS  462
                  +RKR+++ +CS A  SKA REKMRR RLNDRF EL  +++PG+PPKMDK+AILS
Sbjct  59   GFKEVGSRKRVRTESCS-AVGSKACREKMRRDRLNDRFLELGSILEPGRPPKMDKAAILS  117

Query  463  DAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkalNS  642
            DAVRMV QLR EAQKLKES E L E++ ELKAEKNEL+DEKQ+LK E++KLE Q+K L++
Sbjct  118  DAVRMVTQLRSEAQKLKESNESLLEKIKELKAEKNELRDEKQRLKTEREKLEQQVKTLSA  177

Query  643  RPGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQF  762
             P FLPHP      F       G KL+PF+GYPG+ MWQF
Sbjct  178  PPSFLPHPTTIPAAFTAQGQAAGNKLMPFIGYPGVAMWQF  217



>ref|XP_004309656.1| PREDICTED: transcription factor ILR3-like [Fragaria vesca subsp. 
vesca]
Length=245

 Score =   177 bits (449),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 122/227 (54%), Positives = 157/227 (69%), Gaps = 9/227 (4%)
 Frame = +1

Query  106  MAAPEVDGSNWLLDLGF-EDIPLPGGKFPPLEP-GYQWHssailspappsiRQDESYVKF  279
            MAA      NW+ D    E I +PGG  P L+P G+ W S +  +P  PS+  D S+   
Sbjct  1    MAAASSPPQNWVFDYDLIESISVPGGDLPSLDPPGFSWGSDSFAAPTAPSVDFDGSFGNS  60

Query  280  DVSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAIL  459
            ++     + KR++SG+C+  + SKA REKMRR RLND+F ELS +++PG+PPK DK+AIL
Sbjct  61   EIMKETGSNKRVRSGSCN-VSSSKACREKMRRDRLNDKFLELSTILEPGRPPKTDKAAIL  119

Query  460  SDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkalN  639
             DAVRMV QLR EAQ LK+S E LQE++ ELKAEKNEL+DEKQ+LK EK+ LE Q+KAL 
Sbjct  120  VDAVRMVNQLRGEAQNLKDSSESLQEKITELKAEKNELRDEKQRLKAEKENLERQIKALG  179

Query  640  SRPGFLPHPPATAVPFPTPHHLVGGKLVPFV------GYPGIPMWQF  762
            ++PGFLPHP A   PF  P  +VGGKL+PF+      GYPG+ MWQF
Sbjct  180  TQPGFLPHPAAIPAPFSAPGQVVGGKLMPFMGYPGVSGYPGVSMWQF  226



>ref|XP_008441610.1| PREDICTED: transcription factor ILR3-like [Cucumis melo]
Length=234

 Score =   176 bits (447),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 118/221 (53%), Positives = 155/221 (70%), Gaps = 8/221 (4%)
 Frame = +1

Query  106  MAAPEVDGSNWLLDLG-FEDIPLPGGKFPPLE-PGYQWHssailspappsiRQDESYVKF  279
            M +PE+  ++W+ D G  ED P+PGG  P L+ P +        S        DE     
Sbjct  1    MGSPEI--TDWVFDYGVIEDFPVPGGDLPSLDLPSFTLPCDFTASFRADF---DEPLGMA  55

Query  280  DVSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAIL  459
            +      +RKRM SG+ S A +SKA++EKMRR +LNDRF EL+ +++ G+PPK+DKSAIL
Sbjct  56   EDVKESGSRKRMSSGS-SNAFESKARKEKMRRDKLNDRFLELNSILNHGRPPKLDKSAIL  114

Query  460  SDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkalN  639
             DAVRM++QLRDEAQKLKES E   E++NE+KAEKNEL+DEKQ+LKE KD LE ++KA N
Sbjct  115  GDAVRMIIQLRDEAQKLKESNESSLEKINEMKAEKNELRDEKQRLKEAKDGLEKKMKAFN  174

Query  640  SRPGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQF  762
            ++P FLPHPPA    F +P+ +VGGKLVP +GYPG+ MWQF
Sbjct  175  TQPSFLPHPPAIPPGFSSPNQIVGGKLVPVIGYPGVSMWQF  215



>ref|XP_004145091.1| PREDICTED: transcription factor ILR3-like [Cucumis sativus]
 ref|XP_004154169.1| PREDICTED: transcription factor ILR3-like [Cucumis sativus]
 ref|XP_004167401.1| PREDICTED: transcription factor ILR3-like [Cucumis sativus]
 gb|KGN64576.1| hypothetical protein Csa_1G065960 [Cucumis sativus]
Length=235

 Score =   175 bits (444),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 116/221 (52%), Positives = 156/221 (71%), Gaps = 7/221 (3%)
 Frame = +1

Query  106  MAAPEVDGSNWLLDLG-FEDIPLPGGKFPPLE-PGYQWHssailspappsiRQDESYVKF  279
            M +PE+  ++W+ D G  E+IP+PGG  P L+ P +   S    +        DE     
Sbjct  1    MGSPEL--TDWVFDYGVIENIPVPGGDLPSLDLPSFTLPSCDFTASFREDF--DEPLGME  56

Query  280  DVSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAIL  459
            +      +RKRM SG+ S A +SKA++EK+RR +LNDRF EL+ +++ G+PPK+DKSAIL
Sbjct  57   EDVKESRSRKRMSSGS-SNAFESKARKEKIRRDKLNDRFLELNSILNHGRPPKIDKSAIL  115

Query  460  SDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkalN  639
             DAVRM++QLRDEAQKLKES E   E++NE+KAEKNEL+DEKQ+LKE KD LE ++K  N
Sbjct  116  GDAVRMIIQLRDEAQKLKESNESSLEKINEMKAEKNELRDEKQRLKEAKDSLEKKMKGFN  175

Query  640  SRPGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQF  762
            ++P FLPHPPA    F +P+ +VGGKLVP +GYPG+ MWQF
Sbjct  176  TQPTFLPHPPAIPAGFSSPNQIVGGKLVPVIGYPGVSMWQF  216



>ref|XP_010647172.1| PREDICTED: transcription factor ILR3-like isoform X4 [Vitis vinifera]
Length=199

 Score =   172 bits (436),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 105/168 (63%), Positives = 131/168 (78%), Gaps = 1/168 (1%)
 Frame = +1

Query  259  DESYVKFDVSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPK  438
            D+S V  D      +RKRM+SG CS A+ SKA REK+RR RLNDRF EL  +++PG+PPK
Sbjct  14   DDSPVNLDDVKENHSRKRMRSGLCS-ASGSKACREKVRRDRLNDRFLELGSILEPGRPPK  72

Query  439  MDKSAILSDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdkle  618
            MDK+ ILSDA+RM+ QLR E QKLK+S EDLQE++NELKAEKNEL+DEKQ+LK EK+ + 
Sbjct  73   MDKAVILSDALRMMTQLRSEGQKLKKSCEDLQEKINELKAEKNELRDEKQRLKTEKENIV  132

Query  619  lqlkalNSRPGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQF  762
             Q+KAL+S+ GFLPHP A   PF  P  +VG KL+PF+GYPG+ MWQF
Sbjct  133  QQIKALSSQAGFLPHPSAIPAPFAAPGQVVGSKLMPFIGYPGVSMWQF  180



>ref|XP_010647170.1| PREDICTED: transcription factor ILR3-like isoform X2 [Vitis vinifera]
 emb|CBI33226.3| unnamed protein product [Vitis vinifera]
Length=225

 Score =   173 bits (438),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 105/168 (63%), Positives = 131/168 (78%), Gaps = 1/168 (1%)
 Frame = +1

Query  259  DESYVKFDVSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPK  438
            D+S V  D      +RKRM+SG CS A+ SKA REK+RR RLNDRF EL  +++PG+PPK
Sbjct  40   DDSPVNLDDVKENHSRKRMRSGLCS-ASGSKACREKVRRDRLNDRFLELGSILEPGRPPK  98

Query  439  MDKSAILSDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdkle  618
            MDK+ ILSDA+RM+ QLR E QKLK+S EDLQE++NELKAEKNEL+DEKQ+LK EK+ + 
Sbjct  99   MDKAVILSDALRMMTQLRSEGQKLKKSCEDLQEKINELKAEKNELRDEKQRLKTEKENIV  158

Query  619  lqlkalNSRPGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQF  762
             Q+KAL+S+ GFLPHP A   PF  P  +VG KL+PF+GYPG+ MWQF
Sbjct  159  QQIKALSSQAGFLPHPSAIPAPFAAPGQVVGSKLMPFIGYPGVSMWQF  206



>ref|XP_010657331.1| PREDICTED: transcription factor ILR3-like isoform X1 [Vitis vinifera]
Length=244

 Score =   173 bits (439),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 123/226 (54%), Positives = 154/226 (68%), Gaps = 8/226 (4%)
 Frame = +1

Query  106  MAAPEVDGSNWLLDLGF-EDIPLPGGKFPPLEPG--YQWHssailspappsiRQDESYVK  276
            MA    + SNWL D G  EDI +PGG+FP   PG  + W S A+ S +  S+  D S+  
Sbjct  1    MALDSSENSNWLFDYGLMEDITVPGGEFPEPTPGTGFSWPSQALKSSSSVSLEADCSFGD  60

Query  277  FDVSNGCSARKR----MKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMD  444
             D       RKR    +K  +C GA  +KA REK+RR RLN+RF EL  +++PG+PPK D
Sbjct  61   SDGLKELGPRKRCFYRLKHESC-GATGTKACREKLRRDRLNERFLELGSILEPGRPPKTD  119

Query  445  KSAILSDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelq  624
            K+AILSDAVRMV QLR EAQKLKES  DLQE++ ELKAEKNEL+DEKQ+LK EK+KLE Q
Sbjct  120  KAAILSDAVRMVTQLRSEAQKLKESNGDLQEKIKELKAEKNELRDEKQRLKAEKEKLEQQ  179

Query  625  lkalNSRPGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQF  762
            +KA++++PGFLPHP A    F       G KL+PF+GYP + MWQF
Sbjct  180  VKAISAQPGFLPHPSAMPAAFAAQGRAPGNKLMPFIGYPSVAMWQF  225



>ref|XP_010999542.1| PREDICTED: transcription factor ILR3-like [Populus euphratica]
 ref|XP_011012469.1| PREDICTED: transcription factor ILR3-like [Populus euphratica]
Length=243

 Score =   172 bits (437),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 121/220 (55%), Positives = 145/220 (66%), Gaps = 8/220 (4%)
 Frame = +1

Query  124  DGSNWLLDLGF-EDIPLPGGKFPPLEP------GYQWHssailspappsiRQDESYVKFD  282
            +  NW+ D G  EDI +PGG    LE       G  W S      A  S+  + SY   D
Sbjct  6    ENDNWVFDCGLIEDISVPGGDLLGLESLDETPNGSLWSSHNFTDSAFLSVEFNNSYENSD  65

Query  283  VSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILS  462
                   RKR++ G+ S A  SKA REK+RR RLNDRF EL  ++DPG+PPK+DKSAIL 
Sbjct  66   GHKDSGCRKRVRPGS-SNATGSKACREKLRRDRLNDRFMELGALLDPGRPPKVDKSAILV  124

Query  463  DAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkalNS  642
            DA RMV QLRDE+QKLKES   LQE+++ELKAEKNEL+DEKQ+LK EK+ LE Q+KAL +
Sbjct  125  DAARMVTQLRDESQKLKESNVSLQEKIDELKAEKNELRDEKQRLKTEKENLERQVKALRT  184

Query  643  RPGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQF  762
             P FLPHP A   PF  P  + G KL+PFVGYPGI MWQF
Sbjct  185  PPNFLPHPSAIPAPFSAPGQVGGSKLMPFVGYPGISMWQF  224



>ref|XP_007025917.1| Basic helix-loop-helix DNA-binding superfamily protein, putative 
isoform 1 [Theobroma cacao]
 gb|EOY28539.1| Basic helix-loop-helix DNA-binding superfamily protein, putative 
isoform 1 [Theobroma cacao]
Length=287

 Score =   172 bits (435),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 131/252 (52%), Positives = 158/252 (63%), Gaps = 42/252 (17%)
 Frame = +1

Query  130  SNWLLD-LGF-EDIPLPGGKFPPLEPGYQ-WHssailspappsiRQ-DESYVKFDVSNGC  297
            S W+ D  G  EDIP+PGG  P L+P    W S ++    PP   + +ES+   D  N  
Sbjct  18   SGWIFDDYGLLEDIPVPGGDLPSLDPAAPIWSSQSLTCSTPPLSVEFNESFGNSDSLNET  77

Query  298  SARKRM----------------------------------KSGACSGAADSKAQREKMRR  375
              RKR                                   +SG+CS A+ SKA REKMRR
Sbjct  78   GFRKRYTATQPLTFFYCFPLLCFRNAVSALASAPIYCFRARSGSCS-ASGSKACREKMRR  136

Query  376  YRLNDR---FQELSCVMDPGKPPKMDKSAILSDAVRMVLQLRDEAQKLKESFEDLQEQVN  546
             RLNDR   F EL  ++DPG+P K+DK+ IL DAVRMV QLRDEAQKL+ES E LQE++N
Sbjct  137  DRLNDRHVLFLELGSILDPGRPLKVDKAVILVDAVRMVTQLRDEAQKLRESNESLQEKIN  196

Query  547  ELKAeknelkdekqklkeekdklelqlkalNSRPGFLPHPPATAVPFPTPHHLVGGKLVP  726
            ELKAEKNEL+DEKQ+LK EK+ LE Q+KAL ++PGFLPHPPA   PF TP  +VGGKLVP
Sbjct  197  ELKAEKNELRDEKQRLKTEKENLEQQVKALGTQPGFLPHPPAIPTPFSTPGQVVGGKLVP  256

Query  727  FVGYPGIPMWQF  762
            FVGYPG+ MWQF
Sbjct  257  FVGYPGVSMWQF  268



>gb|KJB57696.1| hypothetical protein B456_009G176000 [Gossypium raimondii]
Length=250

 Score =   170 bits (431),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 123/212 (58%), Positives = 151/212 (71%), Gaps = 4/212 (2%)
 Frame = +1

Query  136  WLLD-LGF-EDIPLPGGKFPPLEPGYQ-WHssailspappsiRQDESYVKFDVSNGCSAR  306
            W+ D  G  EDIP+PGG  P L+P    W S ++    P S+   ES+   D  N   +R
Sbjct  21   WIFDDYGLLEDIPVPGGDLPSLDPSAPIWSSPSLTCSTPLSVEFTESFGNSDNLNETGSR  80

Query  307  KRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRMVLQ  486
            KRM+SG+ S +  SKA REKMRR +LNDRF EL  +++PG+  K+DK+ IL DA RMV Q
Sbjct  81   KRMRSGSSSASG-SKACREKMRRDKLNDRFLELGSILEPGRSSKVDKAVILVDAARMVTQ  139

Query  487  LRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkalNSRPGFLPHP  666
            LRDEAQKL+ES E LQE++NELKAEKNEL+DEKQ+LK EKD LE Q+KAL S+PGF+P  
Sbjct  140  LRDEAQKLRESNESLQEKINELKAEKNELRDEKQRLKTEKDNLERQVKALGSQPGFIPQA  199

Query  667  PATAVPFPTPHHLVGGKLVPFVGYPGIPMWQF  762
            PA   PF T   +VGGKLVPFVGYPG+ MWQF
Sbjct  200  PAIPTPFSTSSQVVGGKLVPFVGYPGVSMWQF  231



>ref|XP_006449136.1| hypothetical protein CICLE_v10016511mg [Citrus clementina]
 gb|ESR62376.1| hypothetical protein CICLE_v10016511mg [Citrus clementina]
Length=235

 Score =   169 bits (427),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 122/213 (57%), Positives = 151/213 (71%), Gaps = 5/213 (2%)
 Frame = +1

Query  130  SNWLLDLGFED-IPLPGGKFPPLEP-GYQWHssailspappsiRQDESYVKFDVSNGCSA  303
            SNW+ D G  D I + GG  P L+P    W SS    P       D+S+   D      +
Sbjct  7    SNWIFDCGLLDGIGVSGGDLPSLDPPEVLWSSSTSNPPLSAEF--DDSFGNLDAFKETGS  64

Query  304  RKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRMVL  483
            RKR++SG+CS A+ SKA REKMRR RLNDRF EL+ ++DPG+PPKMDK+ +L+DAV+MV 
Sbjct  65   RKRVRSGSCS-ASGSKACREKMRRDRLNDRFMELASILDPGRPPKMDKTVLLADAVQMVT  123

Query  484  QLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkalNSRPGFLPH  663
            QLRDEAQKLK S E+L  ++NELK EKNEL+DEKQ+LK EK+ LE Q+KAL+S+P FLPH
Sbjct  124  QLRDEAQKLKVSNENLLGKINELKCEKNELRDEKQRLKNEKENLERQVKALSSQPAFLPH  183

Query  664  PPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQF  762
            PP    PF  P  +VGGKLVP VGYPG+ MWQF
Sbjct  184  PPPVPAPFSAPGQVVGGKLVPLVGYPGVSMWQF  216



>gb|EYU19205.1| hypothetical protein MIMGU_mgv1a012900mg [Erythranthe guttata]
Length=236

 Score =   169 bits (427),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 111/220 (50%), Positives = 149/220 (68%), Gaps = 4/220 (2%)
 Frame = +1

Query  106  MAAPEVDGSNWLLDLGFEDIPLPGGKFPPLEPGYQWHssailspappsiRQDESYVKFDV  285
            M +PE   +NWL D GFED P+P   F     G+ W    +   +  S++ D S  + D+
Sbjct  1    MVSPE--NTNWLYDYGFEDNPVPDVNFSAPSAGFSWPMQTLNGSSNVSLQIDGSSGESDM  58

Query  286  SNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSD  465
                 ++KR ++ AC+ ++ SKA REK RR +LND+F EL  +++PG+PPK DK+AIL D
Sbjct  59   QKEAGSKKRTRTEACAPSS-SKACREKQRRDKLNDKFMELGALLEPGRPPKTDKAAILVD  117

Query  466  AVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkalNS-  642
            AVRMV QLR +AQKLK+S  +LQE++ ELKAEK EL+DEKQ+LK EKDKLE QLK +N+ 
Sbjct  118  AVRMVTQLRSDAQKLKDSNLNLQEKIKELKAEKTELRDEKQRLKAEKDKLEQQLKTMNTP  177

Query  643  RPGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQF  762
            +PGFLP PPA    F   +  VG K+VP + YPG+ MWQF
Sbjct  178  QPGFLPAPPAIPTAFAAQNQAVGNKMVPIISYPGVAMWQF  217



>ref|XP_006467957.1| PREDICTED: transcription factor ILR3-like [Citrus sinensis]
 gb|KDO75607.1| hypothetical protein CISIN_1g026702mg [Citrus sinensis]
Length=235

 Score =   168 bits (425),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 121/214 (57%), Positives = 151/214 (71%), Gaps = 5/214 (2%)
 Frame = +1

Query  127  GSNWLLDLGF-EDIPLPGGKFPPLEP-GYQWHssailspappsiRQDESYVKFDVSNGCS  300
             SNW+ D G  +DI + GG  P L+P    W SS    P       ++S+   D      
Sbjct  6    NSNWIFDCGLLDDIGVSGGDLPSLDPPEVLWSSSTSNPPLSAEF--NDSFGNLDAFKETG  63

Query  301  ARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRMV  480
            +RKR++SG+CS A+ SKA REKMRR RLNDRF EL+ ++DPG+PPKMDK+ +L+DAV+MV
Sbjct  64   SRKRVRSGSCS-ASGSKACREKMRRDRLNDRFMELASILDPGRPPKMDKTVLLADAVQMV  122

Query  481  LQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkalNSRPGFLP  660
             QLRDEAQKLK S E L  ++NELK EKNEL+DEKQ+LK EK+ LE Q+KAL+S+P FLP
Sbjct  123  TQLRDEAQKLKVSNEKLLGKINELKCEKNELRDEKQRLKNEKENLERQVKALSSQPAFLP  182

Query  661  HPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQF  762
            HPP    PF  P  +VGGKLVP VGYPG+ MWQF
Sbjct  183  HPPPVPAPFSAPGQVVGGKLVPLVGYPGVSMWQF  216



>ref|XP_010647171.1| PREDICTED: transcription factor ILR3-like isoform X3 [Vitis vinifera]
Length=211

 Score =   167 bits (422),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 114/220 (52%), Positives = 145/220 (66%), Gaps = 29/220 (13%)
 Frame = +1

Query  106  MAAPEVDGSNWLLDLGF-EDIPLPGGKFPPLEPGYQWHssailspappsiRQDESYVKFD  282
            M +PE D  NW+ D G  +D+P+P      L+  + W S                     
Sbjct  1    MVSPEED-PNWIFDYGLIDDVPVPS-----LQATFNWPSHDFT-----------------  37

Query  283  VSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILS  462
                 SA   M+SG CS A+ SKA REK+RR RLNDRF EL  +++PG+PPKMDK+ ILS
Sbjct  38   ----ASAALGMRSGLCS-ASGSKACREKVRRDRLNDRFLELGSILEPGRPPKMDKAVILS  92

Query  463  DAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkalNS  642
            DA+RM+ QLR E QKLK+S EDLQE++NELKAEKNEL+DEKQ+LK EK+ +  Q+KAL+S
Sbjct  93   DALRMMTQLRSEGQKLKKSCEDLQEKINELKAEKNELRDEKQRLKTEKENIVQQIKALSS  152

Query  643  RPGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQF  762
            + GFLPHP A   PF  P  +VG KL+PF+GYPG+ MWQF
Sbjct  153  QAGFLPHPSAIPAPFAAPGQVVGSKLMPFIGYPGVSMWQF  192



>emb|CBI28976.3| unnamed protein product [Vitis vinifera]
Length=223

 Score =   167 bits (423),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 115/205 (56%), Positives = 145/205 (71%), Gaps = 3/205 (1%)
 Frame = +1

Query  154  FEDIPLPGGKFPPLEPG--YQWHssailspappsiRQDESYVKFDVSNGCSARKRMKSGA  327
             EDI +PGG+FP   PG  + W S A+ S +  S+  D S+   D       RKR+K  +
Sbjct  1    MEDITVPGGEFPEPTPGTGFSWPSQALKSSSSVSLEADCSFGDSDGLKELGPRKRLKHES  60

Query  328  CSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRMVLQLRDEAQK  507
            C GA  +KA REK+RR RLN+RF EL  +++PG+PPK DK+AILSDAVRMV QLR EAQK
Sbjct  61   C-GATGTKACREKLRRDRLNERFLELGSILEPGRPPKTDKAAILSDAVRMVTQLRSEAQK  119

Query  508  LKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkalNSRPGFLPHPPATAVPF  687
            LKES  DLQE++ ELKAEKNEL+DEKQ+LK EK+KLE Q+KA++++PGFLPHP A    F
Sbjct  120  LKESNGDLQEKIKELKAEKNELRDEKQRLKAEKEKLEQQVKAISAQPGFLPHPSAMPAAF  179

Query  688  PTPHHLVGGKLVPFVGYPGIPMWQF  762
                   G KL+PF+GYP + MWQF
Sbjct  180  AAQGRAPGNKLMPFIGYPSVAMWQF  204



>gb|KHG15485.1| Transcription factor ILR3 -like protein [Gossypium arboreum]
Length=253

 Score =   167 bits (423),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 124/215 (58%), Positives = 152/215 (71%), Gaps = 7/215 (3%)
 Frame = +1

Query  136  WLLD-LGF-EDIPLPGGKFPPLEPGYQ-WHssailspappsiRQDESYVKFDVSNGCSAR  306
            W+ D  G  EDIP+PGG  P L+P    W S ++    P S+   ES+   D  N   +R
Sbjct  21   WIFDDYGLLEDIPVPGGDLPSLDPSAPIWSSPSLTCSTPLSVEFTESFGNSDSLNETGSR  80

Query  307  KRMKSGACSGAADSKAQREKMRRYRLNDR---FQELSCVMDPGKPPKMDKSAILSDAVRM  477
            KRM+SG+ S +  SKA REKMRR +LNDR   F EL  +++PG+  K+DK+ IL DA RM
Sbjct  81   KRMRSGSSSASG-SKACREKMRRDKLNDRHVLFLELGSILEPGRSSKVDKAVILVDAARM  139

Query  478  VLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkalNSRPGFL  657
            V QLRDEAQKL+ES E LQE++NELKAEKNEL+DEKQ+LK EKD LE Q+KAL S+PGF+
Sbjct  140  VTQLRDEAQKLRESNESLQEKINELKAEKNELRDEKQRLKTEKDNLERQVKALGSQPGFV  199

Query  658  PHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQF  762
            P  PA   PF TP  +VGGKLVPFVGYPG+ MWQF
Sbjct  200  PQAPAIPTPFSTPSQVVGGKLVPFVGYPGVSMWQF  234



>emb|CDP05806.1| unnamed protein product [Coffea canephora]
Length=234

 Score =   165 bits (418),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 111/219 (51%), Positives = 143/219 (65%), Gaps = 4/219 (2%)
 Frame = +1

Query  106  MAAPEVDGSNWLLDLGFEDIPLPGGKFPPLEPGYQWHssailspappsiRQDESYVKFDV  285
            M +PE   +NWL D  FEDI +P G FP    G+ W    +   +  S+  D S    D 
Sbjct  1    MVSPE--NTNWLYDYAFEDIAVPDGNFPASASGFNWPVQTLNGSSNVSVEIDGSLGDSDG  58

Query  286  SNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSD  465
                 +RKR+++ +C+  + SKA REK RR RLND+F EL  ++DPG+PPK DK+AIL D
Sbjct  59   PKETGSRKRLRTESCASTS-SKACREKQRRDRLNDKFVELGALLDPGRPPKTDKAAILVD  117

Query  466  AVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkalNSR  645
            AVR+V QLR EAQKLK+S   LQE++ ELKAEKNEL+DEKQ+LK EK+KLE QLK +N++
Sbjct  118  AVRIVTQLRTEAQKLKDSNLSLQEKIKELKAEKNELRDEKQRLKGEKEKLEQQLKTVNTQ  177

Query  646  PGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQF  762
              F+P PP    PF       G KLVP + YPG+ MWQF
Sbjct  178  ASFMP-PPTMPAPFAAQGQAPGNKLVPIISYPGVAMWQF  215



>gb|AEJ88330.1| putative MYC protein [Tamarix hispida]
Length=238

 Score =   163 bits (413),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 108/217 (50%), Positives = 150/217 (69%), Gaps = 4/217 (2%)
 Frame = +1

Query  121  VDGSNWLLDLGFEDIPLPGGKFPPLEPGYQWHssailspappsiRQDESYVKFDVSNGCS  300
            ++ SNW+ D   EDIPLP   +     G+ W   A+  P+  S+  D ++   +V+    
Sbjct  4    LENSNWIFDYPLEDIPLPVANYDAPNSGFNWPVPALNGPSNVSVEGDGTFRDSEVAKENG  63

Query  301  ARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRMV  480
             +KR +S +C G ++SKA REK+RR RLND+F EL+ +++PG+PPK DK+AIL+DAVRMV
Sbjct  64   LKKRGRSESC-GLSNSKACREKLRRDRLNDKFVELAAILEPGRPPKTDKAAILTDAVRMV  122

Query  481  LQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkalNSRPGFLP  660
             QLR E+QKLK++  DLQE++ ELK+EKNEL+DEKQ+ K EK+KLE QLK++NS+PG+LP
Sbjct  123  TQLRSESQKLKDTNSDLQEKIKELKSEKNELRDEKQRFKAEKEKLEQQLKSVNSQPGYLP  182

Query  661  HPPATAVPFPTPH---HLVGGKLVPFVGYPGIPMWQF  762
             PP     +          G KLVPF+GYPG+ MWQF
Sbjct  183  PPPTMPAAYAAQAPQFQTGGSKLVPFMGYPGVAMWQF  219



>ref|XP_008371203.1| PREDICTED: transcription factor ILR3-like [Malus domestica]
Length=177

 Score =   161 bits (407),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 101/153 (66%), Positives = 122/153 (80%), Gaps = 1/153 (1%)
 Frame = +1

Query  304  RKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRMVL  483
            RKR ++G+ S  + SKA REKMRR RLNDRF ELS +++PG+PPK DK AIL DAVRMV 
Sbjct  7    RKRARTGSNS-VSGSKACREKMRRDRLNDRFAELSSILEPGRPPKTDKVAILGDAVRMVT  65

Query  484  QLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkalNSRPGFLPH  663
            QLR EAQ+LKES  +LQE +NELKAEKNEL+DEKQ+LK EKD +E Q+KAL ++P FLPH
Sbjct  66   QLRGEAQQLKESSANLQETINELKAEKNELRDEKQRLKAEKDNIERQIKALGTQPSFLPH  125

Query  664  PPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQF  762
            P A   PF  P  +VGGK++PFVGYPG+ MWQF
Sbjct  126  PAAIPTPFSAPGQVVGGKMMPFVGYPGMSMWQF  158



>ref|XP_010035617.1| PREDICTED: transcription factor ILR3-like [Eucalyptus grandis]
 gb|KCW47065.1| hypothetical protein EUGRSUZ_K00871 [Eucalyptus grandis]
Length=237

 Score =   162 bits (409),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 110/215 (51%), Positives = 140/215 (65%), Gaps = 5/215 (2%)
 Frame = +1

Query  124  DGSNWLLDLGFEDIPLPGGKFPPLEPGYQWHssailspappsiRQDESYVKFDVSN--GC  297
            D SNWL+D G  D+    G   P   G+ W S +    +  +  +       D  N  G 
Sbjct  7    DNSNWLVDYGLADVS--AGDVLPSAGGFAWSSPSFDVSSSNASIEVNCASTRDSENLKGK  64

Query  298  SARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRM  477
            S  KR+KS +C  +  SKA REK+RR RLN+RF EL  +++PG+PPK DKSAILSDAVRM
Sbjct  65   SCHKRLKSESCLSSG-SKACREKLRRDRLNERFLELGSILEPGRPPKTDKSAILSDAVRM  123

Query  478  VLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkalNSRPGFL  657
            V QLR EAQKLKES E+LQE++ ELKAEKNEL+DEKQ+LK +K+KLE QLK  +  P F 
Sbjct  124  VTQLRTEAQKLKESNEELQEKIKELKAEKNELRDEKQRLKADKEKLEQQLKVSSFHPVFP  183

Query  658  PHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQF  762
            PHP   + PF       G KL+P++G+PG+ MWQF
Sbjct  184  PHPSVVSTPFAAQERAGGNKLMPYIGFPGVAMWQF  218



>ref|XP_010931430.1| PREDICTED: transcription factor ILR3-like [Elaeis guineensis]
Length=237

 Score =   161 bits (408),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 115/221 (52%), Positives = 146/221 (66%), Gaps = 5/221 (2%)
 Frame = +1

Query  106  MAAPEVDGSNWLLDLGF-EDIPLPGGKFPPLEPGYQWHssailspappsiRQDESYVKFD  282
            M +PE   SNW+ D    +D+ + GG FP    G+ W    I S +  S+    S+V   
Sbjct  1    MGSPE--NSNWVFDCPLIDDMSVAGGDFPAPGTGFYWTPQGINSTSNSSVEISGSFVDSA  58

Query  283  VSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILS  462
              N   ++KR++S + S    SKA REKMRR +LN+RF EL  +++PGKPPKMDK+AILS
Sbjct  59   GINESGSKKRVRSESSSQPG-SKACREKMRRDKLNNRFLELGSILEPGKPPKMDKAAILS  117

Query  463  DAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkalNS  642
            DAVRMV QLR EAQKLK+S EDLQE++ ELKAEKNEL+DEKQ+LK EK+ LE Q+K LN+
Sbjct  118  DAVRMVTQLRSEAQKLKDSNEDLQEKIKELKAEKNELRDEKQRLKAEKENLEQQIKILNA  177

Query  643  RPGFLPHPPATAVPFPTPHHLVGGKL-VPFVGYPGIPMWQF  762
            RP F+ HPP     F         KL +P +GYPG PMWQF
Sbjct  178  RPSFVAHPPVIPAAFAPQGQTAAHKLMMPVIGYPGFPMWQF  218



>ref|XP_011097928.1| PREDICTED: transcription factor ILR3-like [Sesamum indicum]
Length=234

 Score =   160 bits (405),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 113/220 (51%), Positives = 147/220 (67%), Gaps = 6/220 (3%)
 Frame = +1

Query  106  MAAPEVDGSNWLLDLGFEDIPLPGGKFPPLEPGYQWHssailspappsiRQDESYVKFDV  285
            M +PE   +NWL D GFEDI +  G F     G  W   A+   +  S+  D S  + D+
Sbjct  1    MVSPE--NTNWLYDYGFEDIAVHDGNFAAHNSGLSWPMQALNGSSNASVEIDGSLGESDL  58

Query  286  SNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSD  465
                 ++KR ++  C+ ++ SKA REK RR RLND+F EL  +++PG+PPK DK+AIL D
Sbjct  59   QKEAGSKKRCRTEPCAPSS-SKACREKQRRDRLNDKFMELGALLEPGRPPKTDKAAILVD  117

Query  466  AVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkalNS-  642
            AVRMV QLR EAQKLK+S  +LQE++ ELKAEKNEL+DEKQ+LK EK+KLE QLK +N+ 
Sbjct  118  AVRMVTQLRGEAQKLKDSNLNLQEKIKELKAEKNELRDEKQRLKAEKEKLEQQLKTMNTP  177

Query  643  RPGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQF  762
            +PGFL  PPA    F T +   G KLVP + YPG+ MWQF
Sbjct  178  QPGFL--PPAIPAAFATQNQGAGNKLVPIISYPGVAMWQF  215



>ref|XP_002282727.1| PREDICTED: transcription factor ILR3 [Vitis vinifera]
 emb|CBI20499.3| unnamed protein product [Vitis vinifera]
Length=237

 Score =   159 bits (402),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 113/221 (51%), Positives = 148/221 (67%), Gaps = 5/221 (2%)
 Frame = +1

Query  106  MAAPEVDGSNWLLDLGF-EDIPLPGGKFPPLEPGYQWHssailspappsiRQ-DESYVKF  279
            M +PE   +NWL + G  EDIP+P   F     G+ W     L+ +     + D S+   
Sbjct  1    MVSPE--ATNWLYEYGLIEDIPVPDSNFANTNSGFAWTPVQALNTSANVSGEIDGSFGDS  58

Query  280  DVSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAIL  459
            D      ++KR++S +C GA+ SKA REK+RR RLND+F EL  +++PG+PPK DKS+IL
Sbjct  59   DGIKETGSKKRVRSESC-GASSSKACREKLRRDRLNDKFMELGSILEPGRPPKTDKSSIL  117

Query  460  SDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkalN  639
             DAVRMV QLR E+QKLK+S   LQE++ ELKAEKNEL+DEKQ+LK EK+KLE QLKA+N
Sbjct  118  IDAVRMVTQLRGESQKLKDSNSSLQEKIKELKAEKNELRDEKQRLKAEKEKLEQQLKAMN  177

Query  640  SRPGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQF  762
            ++P FLP  P+    F       G KLVPF+GYPG+ MWQF
Sbjct  178  AQPSFLPPVPSIPAAFAAQGQAGGNKLVPFIGYPGVAMWQF  218



>ref|XP_010909862.1| PREDICTED: transcription factor ILR3-like [Elaeis guineensis]
Length=237

 Score =   159 bits (402),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 116/221 (52%), Positives = 144/221 (65%), Gaps = 5/221 (2%)
 Frame = +1

Query  106  MAAPEVDGSNWLLDLGF-EDIPLPGGKFPPLEPGYQWHssailspappsiRQDESYVKFD  282
            M +PE   SNW LD    +D+P+PG  F     G+ W+          S     S   FD
Sbjct  1    MGSPE--QSNWFLDCPLIDDMPVPGTDFAAPTGGFNWNPQGFNPYPDVSGEIHGSIANFD  58

Query  283  VSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILS  462
                  ++KRM+S +CSG + SKA REKMRR RLN+RF ELS ++DPGKPPKMDK+ ILS
Sbjct  59   GHKEPGSQKRMRSESCSGPS-SKACREKMRRDRLNERFLELSSILDPGKPPKMDKATILS  117

Query  463  DAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkalNS  642
            DAV MV QLR EAQKLK+S + L+E++ ELKAEK+EL+DEKQ+LK EK+ LE QLK LNS
Sbjct  118  DAVHMVTQLRTEAQKLKQSNDSLEEKIKELKAEKSELRDEKQRLKVEKESLEQQLKLLNS  177

Query  643  RPGFLPHPPATAVPFPTPHHLVGGKL-VPFVGYPGIPMWQF  762
            RP ++P PP     F       G KL +P +GYPG PMWQF
Sbjct  178  RPSYVPPPPVIPTAFAAQGQAAGQKLMMPVIGYPGFPMWQF  218



>ref|XP_007043353.1| Basic helix-loop-helix DNA-binding superfamily protein [Theobroma 
cacao]
 gb|EOX99184.1| Basic helix-loop-helix DNA-binding superfamily protein [Theobroma 
cacao]
Length=231

 Score =   158 bits (399),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 107/214 (50%), Positives = 143/214 (67%), Gaps = 9/214 (4%)
 Frame = +1

Query  124  DGSNWLLDLGFEDIPLPGGKFPPLEPGYQWH-ssailspappsiRQDESYVKFDVSNGCS  300
            + +NWLLD G  D P P         GY W   + + + +  S   D S+   D     +
Sbjct  7    ENTNWLLDYGIPDFPRPAA-------GYGWPPQTTLDARSNLSAAVDCSFPDSDSLKEVA  59

Query  301  ARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRMV  480
            +RKR+KS +C  A+ SKA REK+RR +LNDRF EL  +++PG+PPK DK AIL  AV+MV
Sbjct  60   SRKRLKSESCY-ASGSKACREKLRRNKLNDRFLELGAILEPGRPPKADKVAILIVAVKMV  118

Query  481  LQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkalNSRPGFLP  660
             QLR EAQKLKE  E+LQ ++ ELKAEKNEL+DEKQ+LK +K+KLE Q+ A+++RPGFLP
Sbjct  119  HQLRSEAQKLKELNEELQAKIKELKAEKNELRDEKQRLKADKEKLEQQVNAMSTRPGFLP  178

Query  661  HPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQF  762
            HP   A  F +     G KL+P++G+PG+ MWQF
Sbjct  179  HPTPMAAAFASQGQAAGNKLMPYIGFPGVAMWQF  212



>ref|XP_011003406.1| PREDICTED: transcription factor ILR3-like [Populus euphratica]
Length=243

 Score =   158 bits (400),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 124/226 (55%), Positives = 154/226 (68%), Gaps = 9/226 (4%)
 Frame = +1

Query  106  MAAPEVDGSNWLLDLGF-EDIPLPGGKFPPLEP------GYQWHssailspappsiRQDE  264
            M +P  D ++W+ D G  ED+P+PGG+   LE       G  W S +    A  S   + 
Sbjct  1    MVSPN-DNASWVFDCGLIEDVPVPGGEQLCLESLDETPNGSLWSSHSFNDTAFLSAEFNN  59

Query  265  SYVKFDVSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMD  444
            S+   D       RKR++ G+   A  SKA REKMRR RLNDRF E++ ++DPG+PPK+D
Sbjct  60   SFENSDGLKEIGFRKRVRHGS-GNAPGSKACREKMRRDRLNDRFMEMAALLDPGRPPKVD  118

Query  445  KSAILSDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelq  624
            KSAIL DA RMV QLRDE+QKLKES E LQE+++ELKAEKNEL+DEKQKLK EK+ LE Q
Sbjct  119  KSAILVDAARMVTQLRDESQKLKESNESLQEKIDELKAEKNELRDEKQKLKTEKENLEWQ  178

Query  625  lkalNSRPGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQF  762
            LKAL+  P +LP PPA   PF +P  +VG KL+PFVGYPGI MWQF
Sbjct  179  LKALSPPPTYLPQPPAIPAPFSSPGQVVGSKLMPFVGYPGISMWQF  224



>ref|XP_002522828.1| DNA binding protein, putative [Ricinus communis]
 gb|EEF39526.1| DNA binding protein, putative [Ricinus communis]
Length=235

 Score =   158 bits (399),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 115/220 (52%), Positives = 150/220 (68%), Gaps = 5/220 (2%)
 Frame = +1

Query  106  MAAPEVDGSNWLLDLGF-EDIPLPGGKFPPLEPGYQWHssailspappsiRQDESYVKFD  282
            M +PE   +NWL++ G  +DIP+P   F     G+ W    +   +  S+  D S+   D
Sbjct  1    MVSPE--NTNWLIEYGLIDDIPVPDANFSVPVTGFSWPVQTLNGSSNVSVEIDGSFGNAD  58

Query  283  VSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILS  462
                 +++KR +S +C  A+ SKA REK+RR RLND+F EL  +++PG+PPK DK+AIL 
Sbjct  59   TQKDSTSKKRGRSDSC--ASSSKACREKLRRDRLNDKFLELGSILEPGRPPKTDKAAILI  116

Query  463  DAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkalNS  642
            DAVRMV QLR EAQKLK+S   LQE++ ELKAEKNEL+DEKQ+LK EK+KLE QLKA+N+
Sbjct  117  DAVRMVTQLRGEAQKLKDSNSSLQEKIKELKAEKNELRDEKQRLKVEKEKLEQQLKAVNA  176

Query  643  RPGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQF  762
            +P FLP PPA   PF       G KLVPF+GYPG+ MWQF
Sbjct  177  QPSFLPPPPAIPAPFAAQGQAPGNKLVPFIGYPGVAMWQF  216



>ref|XP_009383663.1| PREDICTED: transcription factor ILR3-like [Musa acuminata subsp. 
malaccensis]
Length=238

 Score =   157 bits (397),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 114/213 (54%), Positives = 140/213 (66%), Gaps = 4/213 (2%)
 Frame = +1

Query  133  NWLLDLGF-EDIPLPGGKFPPLEPG-YQWHssailspappsiRQDESYVKFDVSNGCSAR  306
            NW LD    +DIP  GG F   + G   W      + +  S+  D  +V  D      + 
Sbjct  8    NWFLDCSLIDDIPHAGGDFAANDVGGLCWPPQGFNTSSGVSVDIDSPFVNSDGLKEPGSA  67

Query  307  KRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRMVLQ  486
            KR++S +CS  A SKA REKMRR +LNDRF ELS ++DPG PPK DK+AILSDA R+V+Q
Sbjct  68   KRVRSESCSRPA-SKACREKMRREKLNDRFMELSSLLDPGNPPKTDKAAILSDAARVVIQ  126

Query  487  LRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkalNSRPGFLPHP  666
            LR+EAQKLK+S E LQE++ ELKAEKNEL++EKQKLK EK+ LE Q+K LN+RP F+P P
Sbjct  127  LRNEAQKLKDSNESLQEKIKELKAEKNELREEKQKLKAEKESLEQQVKLLNARPSFVPQP  186

Query  667  PATAVPFPTPHHLVGGKL-VPFVGYPGIPMWQF  762
            P     FP      G KL VP VGYP  PMWQF
Sbjct  187  PLVPSLFPAQGQAAGHKLMVPVVGYPSFPMWQF  219



>ref|XP_009355579.1| PREDICTED: transcription factor ILR3-like [Pyrus x bretschneideri]
Length=229

 Score =   157 bits (396),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 110/220 (50%), Positives = 144/220 (65%), Gaps = 11/220 (5%)
 Frame = +1

Query  106  MAAPEVDGSNWLLDLGF-EDIPLPGGKFPPLEPGYQWHssailspappsiRQDESYVKFD  282
            M +PE   +NWL D G  +D P+ GG F        W    I   +  S+  D S    +
Sbjct  1    MVSPE--NTNWLFDYGLIDDTPVLGGNF-------AWPVQPIAGSSSVSVELDGSLGDAE  51

Query  283  VSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILS  462
                  ++KR+++ +CSG + SKA REK+RR RLND+F EL  +++PG+PPK DK+AIL 
Sbjct  52   GLKESGSKKRVRTESCSGTS-SKACREKLRRDRLNDKFVELGTILEPGRPPKTDKAAILV  110

Query  463  DAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkalNS  642
            DAVRMV QLR E QKLK++   LQE++ ELKAEKNEL+DEK +LK EK+KLE QLK++N 
Sbjct  111  DAVRMVNQLRGEGQKLKDTNSGLQEKIKELKAEKNELRDEKLRLKLEKEKLEQQLKSMNV  170

Query  643  RPGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQF  762
            +PGFLP PPA    F       G K+VPF+GYPG+ MWQF
Sbjct  171  QPGFLPPPPAIPSSFTAQGQARGNKMVPFIGYPGVAMWQF  210



>ref|XP_006360579.1| PREDICTED: transcription factor ILR3-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006360580.1| PREDICTED: transcription factor ILR3-like isoform X2 [Solanum 
tuberosum]
 ref|XP_006360581.1| PREDICTED: transcription factor ILR3-like isoform X3 [Solanum 
tuberosum]
Length=244

 Score =   157 bits (397),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 112/225 (50%), Positives = 144/225 (64%), Gaps = 11/225 (5%)
 Frame = +1

Query  118  EVDGS---NWLLDLGF-EDIPLPGGKF-----PPLEPGYQWHssailspappsiRQDESY  270
            EVD S   NWL D     DI             P    + W +  I + +      D ++
Sbjct  2    EVDSSGNPNWLFDYELITDITSAASVTVTDFQSPATIDFSWPAQTIYASSNLIAETDYTF  61

Query  271  VKFDVSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKS  450
               +VS   S+RKR+KS  CS +  SKA REK+RR RLN+RF ELS V+DPG+PPK +K 
Sbjct  62   ADSEVSKEASSRKRLKSEWCS-SPRSKACREKLRRDRLNERFLELSSVLDPGRPPKTEKV  120

Query  451  AILSDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlk  630
            AILSDA RM+++LR E QKLKES E+LQE++ ELKAEKNEL+DEK++LKEEK+ LE Q+K
Sbjct  121  AILSDAQRMLIELRTETQKLKESNEELQEKIKELKAEKNELRDEKRRLKEEKENLEQQVK  180

Query  631  alNSRPGFLPHPPATAVPFPTPHHLVGG-KLVPFVGYPGIPMWQF  762
            +L S+PGFL HP A    F     +  G KL+PF+GYP + MWQF
Sbjct  181  SLASKPGFLSHPSAVGAAFTAQGQVAAGNKLMPFIGYPSVAMWQF  225



>ref|XP_006352486.1| PREDICTED: transcription factor ILR3-like [Solanum tuberosum]
Length=231

 Score =   157 bits (396),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 108/219 (49%), Positives = 142/219 (65%), Gaps = 7/219 (3%)
 Frame = +1

Query  106  MAAPEVDGSNWLLDLGFEDIPLPGGKFPPLEPGYQWHssailspappsiRQDESYVKFDV  285
            M  PE   +NWL D  +EDI  P   F     GY W           S+  D S  + D 
Sbjct  1    MVLPE--NTNWLYDYNYEDIVSPDVNFSV--SGYSWSMQGFNGSTNASVDIDGSLGESDC  56

Query  286  SNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSD  465
                S +KR ++ +C+ ++ SKA REK+RR +LND+F EL+ +++PG+PPK DKS IL D
Sbjct  57   LKESSCKKRTRAESCTSSS-SKACREKLRREKLNDKFMELAVLLEPGRPPKTDKSGILVD  115

Query  466  AVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkalNSR  645
            AVR+V QLRDEAQKLK+S  DLQE++ ELK EKNEL+DEKQ+LK +K+KLE QLK ++++
Sbjct  116  AVRVVTQLRDEAQKLKDSNLDLQEKIKELKVEKNELRDEKQRLKSQKEKLEQQLKTMSAQ  175

Query  646  PGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQF  762
            P FL  PPA    F +P    G KLVP + YPG+ MWQF
Sbjct  176  PSFL--PPAMPGAFASPIQAAGTKLVPIISYPGVAMWQF  212



>ref|XP_008365724.1| PREDICTED: transcription factor ILR3 [Malus domestica]
Length=229

 Score =   156 bits (395),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 110/219 (50%), Positives = 143/219 (65%), Gaps = 9/219 (4%)
 Frame = +1

Query  106  MAAPEVDGSNWLLDLGFEDIPLPGGKFPPLEPGYQWHssailspappsiRQDESYVKFDV  285
            M +PE   +NWL D G  D        P L+  + W    +   A  S+  D S    + 
Sbjct  1    MVSPE--NTNWLFDYGLID------DTPVLDGNFTWPVQPVAGSASVSVELDGSLGDAEG  52

Query  286  SNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSD  465
                 ++KR++S +CSG + SKA REK+RR RLND+F EL  +++PG+PPK DK+AIL D
Sbjct  53   LKESGSKKRVRSESCSGTS-SKACREKLRRDRLNDKFVELGSILEPGRPPKTDKAAILVD  111

Query  466  AVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkalNSR  645
            AVRMV QLR EAQKLK++   LQE++ ELK EKNEL+DEKQ+LK EK+KLE QLK++N++
Sbjct  112  AVRMVNQLRGEAQKLKDTNSGLQEKIKELKTEKNELRDEKQRLKSEKEKLEQQLKSMNAQ  171

Query  646  PGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQF  762
            PGFLP PP     F       G KLVPF+GYPG+ MWQF
Sbjct  172  PGFLPPPPGIPAAFAAQGQAHGNKLVPFIGYPGVAMWQF  210



>ref|XP_002304984.1| hypothetical protein POPTR_0004s03190g [Populus trichocarpa]
 gb|EEE85495.1| hypothetical protein POPTR_0004s03190g [Populus trichocarpa]
Length=243

 Score =   156 bits (395),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 124/226 (55%), Positives = 151/226 (67%), Gaps = 9/226 (4%)
 Frame = +1

Query  106  MAAPEVDGSNWLLDLGF-EDIPLPGGKFPPLEP------GYQWHssailspappsiRQDE  264
            M +P  D +NW+ D G  ED+P+P G+   LE       G  W S +    A  S   + 
Sbjct  1    MVSPN-DNANWVFDCGLIEDVPVPVGEQLCLESLDETPNGSLWSSHSFNDTAFLSAEFNN  59

Query  265  SYVKFDVSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMD  444
            S+   D       RKR++ G+   A  SKA REKMRR RLNDRF EL  ++DPG+PPK+D
Sbjct  60   SFENSDGLKEIGFRKRVRHGS-GNAPGSKACREKMRRDRLNDRFMELGALLDPGRPPKVD  118

Query  445  KSAILSDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelq  624
            KSA+L DA RMV QLRDE+QKLKES E LQE+++ELKAEKNEL+DEKQKLK EK+ LE Q
Sbjct  119  KSAMLVDAARMVTQLRDESQKLKESIESLQEKIDELKAEKNELRDEKQKLKMEKENLEWQ  178

Query  625  lkalNSRPGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQF  762
             KAL+  P +LPHPPA   PF  P  +VG KL+PFVGYPGI MWQF
Sbjct  179  QKALSPPPTYLPHPPAIPAPFSAPGQVVGSKLMPFVGYPGISMWQF  224



>ref|XP_009358090.1| PREDICTED: transcription factor ILR3-like [Pyrus x bretschneideri]
Length=229

 Score =   155 bits (393),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 110/219 (50%), Positives = 142/219 (65%), Gaps = 9/219 (4%)
 Frame = +1

Query  106  MAAPEVDGSNWLLDLGFEDIPLPGGKFPPLEPGYQWHssailspappsiRQDESYVKFDV  285
            M +PE   +NWL D G  D        P L+  + W    I   A  S+  D S    + 
Sbjct  1    MVSPE--NTNWLFDYGLID------DTPVLDGNFTWPVQPIAGSASVSVELDGSLGDAEA  52

Query  286  SNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSD  465
                 ++KR++S +CSG + SKA REK+RR RLND+F EL  +++PG+PPK DK+AIL D
Sbjct  53   LKESGSKKRVRSESCSGTS-SKACREKLRRDRLNDKFVELGSILEPGRPPKTDKAAILVD  111

Query  466  AVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkalNSR  645
            AVRMV QLR EAQKLK++   LQE++ ELK EKNEL+DEKQ+LK EK+KLE QLK++ ++
Sbjct  112  AVRMVNQLRGEAQKLKDTNSGLQEKIKELKTEKNELRDEKQRLKSEKEKLEQQLKSMTAQ  171

Query  646  PGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQF  762
            PGFLP PP     F       G KLVPF+GYPG+ MWQF
Sbjct  172  PGFLPPPPGIPAAFAAQGQAHGNKLVPFIGYPGVAMWQF  210



>ref|XP_006360098.1| PREDICTED: transcription factor ILR3-like [Solanum tuberosum]
Length=233

 Score =   155 bits (393),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 107/219 (49%), Positives = 138/219 (63%), Gaps = 5/219 (2%)
 Frame = +1

Query  106  MAAPEVDGSNWLLDLGFEDIPLPGGKFPPLEPGYQWHssailspappsiRQDESYVKFDV  285
            M +PE   +NWL D GFED  +P   F     G+ W    +      S   D S  + D 
Sbjct  1    MVSPE--NTNWLYDYGFEDSSVPDSNFSASASGFNWPVQNLNGSRNVSSEIDGSIGESDY  58

Query  286  SNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSD  465
                 ++KR +  +C+  + SKA REK+RR +LND+F EL  +++PG+PPK DKSAIL D
Sbjct  59   PKESGSKKRARVESCAPTS-SKACREKLRRDKLNDKFMELGALLEPGRPPKTDKSAILVD  117

Query  466  AVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkalNSR  645
            AVRMV QLRDEAQKLK+S  +LQE++ ELK EK EL+DEKQ+LK EK+KLE QLK  +++
Sbjct  118  AVRMVTQLRDEAQKLKDSNLNLQEKIKELKVEKTELRDEKQRLKAEKEKLEQQLKTTSAQ  177

Query  646  PGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQF  762
            P FL  PPA    F       G KLVP + YPG+ MWQF
Sbjct  178  PSFL--PPAIPSAFAAHGQFPGSKLVPIMSYPGVAMWQF  214



>ref|XP_009393337.1| PREDICTED: transcription factor ILR3-like [Musa acuminata subsp. 
malaccensis]
Length=230

 Score =   155 bits (393),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 110/212 (52%), Positives = 136/212 (64%), Gaps = 10/212 (5%)
 Frame = +1

Query  133  NWLLDLGF-EDIPLPGGKFPPLEPGYQWHssailspappsiRQDESYVKFDVSNGCSARK  309
            NW LD    +DIP  G  F        W+       +  S+  D S+V  D      + K
Sbjct  8    NWFLDCSLIDDIPDAGADF-------GWNPQGFDPASSVSVEIDSSFVNSDGLKEPGSAK  60

Query  310  RMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRMVLQL  489
            R +S +CS  A SKA REKMRR RLNDRF EL+ ++DPG PPKMDK+AILSDA R+V QL
Sbjct  61   RSRSESCSNPA-SKACREKMRRERLNDRFLELNSLLDPGNPPKMDKAAILSDAARLVTQL  119

Query  490  RDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkalNSRPGFLPHPP  669
            R+EAQKLKES E LQE++ ELKAEKNEL+DEKQKLK E+  LE Q+K LN+R  ++P PP
Sbjct  120  RNEAQKLKESNESLQEKIKELKAEKNELRDEKQKLKAERGSLEQQVKLLNARSSYVPQPP  179

Query  670  ATAVPFPTPHHLVGGKL-VPFVGYPGIPMWQF  762
                P+       G KL VP +G+PG PMWQ+
Sbjct  180  LVPTPYGAQGQAAGHKLMVPIIGFPGFPMWQY  211



>ref|XP_011095314.1| PREDICTED: transcription factor ILR3-like [Sesamum indicum]
Length=236

 Score =   155 bits (393),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 113/220 (51%), Positives = 148/220 (67%), Gaps = 4/220 (2%)
 Frame = +1

Query  106  MAAPEVDGSNWLLDLGFEDIPLPGGKFPPLEPGYQWHssailspappsiRQDESYVKFDV  285
            M +PE   +NWL D GF+DI +P G F     G+ W   A+   +  S+  D S+ + DV
Sbjct  1    MVSPE--NTNWLYDYGFDDIHVPDGNFSAPASGFSWPVQALNGSSNVSVEIDGSFGESDV  58

Query  286  SNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSD  465
                 ++KR ++  C+ ++ SKA REK RR RLND+F EL  +++PG+PPK DK+AIL D
Sbjct  59   QKETGSKKRARTEPCAPSS-SKACREKQRRDRLNDKFMELGALLEPGRPPKTDKAAILVD  117

Query  466  AVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkalNS-  642
            AVRMV QLR EAQKLK+S  +LQE++ ELKAEKNEL+DEKQ+LK EK+KLE QLK +N+ 
Sbjct  118  AVRMVTQLRGEAQKLKDSNSNLQEKIKELKAEKNELRDEKQRLKAEKEKLEQQLKTMNAP  177

Query  643  RPGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQF  762
            +PGFL  PPA    F       G KLVP + YPG+ MWQF
Sbjct  178  QPGFLSAPPAIPAAFAAQSQAAGNKLVPIISYPGVAMWQF  217



>ref|XP_009764628.1| PREDICTED: transcription factor ILR3-like [Nicotiana sylvestris]
Length=243

 Score =   155 bits (392),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 108/224 (48%), Positives = 140/224 (63%), Gaps = 10/224 (4%)
 Frame = +1

Query  118  EVDGS---NWLLDLGF-EDIPLPGGKF-----PPLEPGYQWHssailspappsiRQDESY  270
            E+D S   NWL D     DI             P    + W +  I + +      D ++
Sbjct  2    EIDSSGNPNWLFDYELMTDITSAASVAVTDFQSPATIDFSWPAQTIYASSNLIAETDYTF  61

Query  271  VKFDVSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKS  450
               +VS   S+RKR +   CS +  SKA REK+RR RLN+RF ELS V+DPG+PPK +K 
Sbjct  62   DDSEVSKEASSRKRSRIECCS-SPRSKASREKLRRDRLNERFLELSSVLDPGRPPKTEKV  120

Query  451  AILSDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlk  630
            AILSDA +M+++LR E QKLKES E+LQE++ ELKAEK EL+DEKQ+LKEEK+ LE Q+K
Sbjct  121  AILSDAQKMLIELRTETQKLKESNEELQEKIKELKAEKIELRDEKQRLKEEKENLEQQVK  180

Query  631  alNSRPGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQF  762
             L S+PGFL HP A    F     + G KL+PF+GYP + MWQF
Sbjct  181  TLASKPGFLSHPSAMGAAFTAQGQVAGNKLMPFIGYPSVAMWQF  224



>ref|XP_009612610.1| PREDICTED: transcription factor ILR3-like [Nicotiana tomentosiformis]
Length=243

 Score =   154 bits (390),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 108/224 (48%), Positives = 140/224 (63%), Gaps = 10/224 (4%)
 Frame = +1

Query  118  EVDGS---NWLLDLGF-EDIPLPGGKF-----PPLEPGYQWHssailspappsiRQDESY  270
            E+D S   NWL D     DI             P    + W +  I + +      D ++
Sbjct  2    EIDSSGNPNWLFDYELITDITSAASVAVADFQSPATIDFSWPAQTIYASSNLIAETDYTF  61

Query  271  VKFDVSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKS  450
               +VS   S+RKR +   C  +  SKA REK+RR RLN+RF ELS V+DPG+PPK +K 
Sbjct  62   DDSEVSKEASSRKRSRIECC-NSPRSKASREKLRRDRLNERFLELSSVLDPGRPPKTEKV  120

Query  451  AILSDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlk  630
            AILSDA +M+++LR E QKLKES E+LQE++ ELKAEKNEL+DEKQ LKEEK+ LE Q+K
Sbjct  121  AILSDAQKMLIELRAETQKLKESNEELQEKIKELKAEKNELRDEKQSLKEEKENLEQQVK  180

Query  631  alNSRPGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQF  762
             L+S+PGFL HP A    F     + G KL+PF+GYP + MWQF
Sbjct  181  NLSSKPGFLSHPSAMGAAFTAQGQVAGNKLMPFIGYPSVAMWQF  224



>ref|XP_004244159.1| PREDICTED: transcription factor ILR3 [Solanum lycopersicum]
Length=233

 Score =   154 bits (389),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 105/219 (48%), Positives = 137/219 (63%), Gaps = 5/219 (2%)
 Frame = +1

Query  106  MAAPEVDGSNWLLDLGFEDIPLPGGKFPPLEPGYQWHssailspappsiRQDESYVKFDV  285
            M +PE   +NWL D GFED  +P   F     G+ W    +      S   D S  + D 
Sbjct  1    MVSPE--STNWLYDYGFEDSCVPDSNFSASASGFNWSVQNLNGSRNVSSEIDGSIGESDY  58

Query  286  SNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSD  465
                 ++KR +  +C+  + SKA REK+RR RLND+F EL  +++PG+PPK DKSAIL D
Sbjct  59   PKESGSKKRARVESCAPTS-SKACREKLRRDRLNDKFMELGALLEPGRPPKTDKSAILVD  117

Query  466  AVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkalNSR  645
            AVR+V QLRDEAQKLK+S  +LQE++ ELK EK EL+DEK +LK EK+KLE QLK  +++
Sbjct  118  AVRLVTQLRDEAQKLKDSNLNLQEKIKELKVEKTELRDEKHRLKAEKEKLEQQLKTTSAQ  177

Query  646  PGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQF  762
            P +L  PPA    F       G KLVP + YPG+ MWQF
Sbjct  178  PSYL--PPAIPSAFAAHGQFPGSKLVPIMSYPGVAMWQF  214



>gb|KDO59874.1| hypothetical protein CISIN_1g026646mg [Citrus sinensis]
Length=235

 Score =   153 bits (387),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 108/225 (48%), Positives = 146/225 (65%), Gaps = 15/225 (7%)
 Frame = +1

Query  106  MAAPEVDGSNWLLDLGF-EDIPLPGGKFPPLEPGYQWHssailspappsiRQDESYVKFD  282
            M     D S+WL+D    +DIP+ G         + W S A  +    S         F 
Sbjct  1    MEIASSDNSDWLIDYSIVDDIPIAGN--------FDWPSQAAPAVNASSAASVTIDCSFG  52

Query  283  VSNG-----CSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDK  447
             S+G       +RKR++S +C   + SKA REK+RR RLN+RF EL  +++PG+PPK DK
Sbjct  53   DSDGPKEVEAGSRKRLRSESCC-VSGSKACREKLRRDRLNERFLELGSMLEPGRPPKTDK  111

Query  448  SAILSDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelql  627
            + ILSDAV+M+ QLR EAQKLK+S E+LQE++ ELKAEKNEL+DEKQ+LK +K+KLE Q+
Sbjct  112  ATILSDAVQMMEQLRTEAQKLKQSNENLQEKIKELKAEKNELRDEKQRLKADKEKLEQQV  171

Query  628  kalNSRPGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQF  762
            KA+++  GFLPHP + +  F     + G KLVPF+GYPG+ MWQF
Sbjct  172  KAMSAPSGFLPHPSSMSAAFAAQSQVAGNKLVPFIGYPGVAMWQF  216



>ref|XP_011096123.1| PREDICTED: transcription factor ILR3-like [Sesamum indicum]
Length=221

 Score =   153 bits (386),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 113/222 (51%), Positives = 151/222 (68%), Gaps = 11/222 (5%)
 Frame = +1

Query  106  MAAPEVDGSNWLLDLGF-EDIPLPGGKFPPLEPGYQWHssailspappsiRQD--ESYVK  276
            ++ P    ++W+ D    ED+P       PL+P ++W       P+P ++  +  +S+  
Sbjct  2    VSLPPEHSADWVFDYALLEDMP-------PLDPTFRWPHLQDAFPSPTTLSMEFGDSFGD  54

Query  277  FDVSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAI  456
             D      +RKR++SGA SGA+DSKA +EK+RR RLNDRFQELS +++PG+PPKMDK+ I
Sbjct  55   PDCIKEHGSRKRLRSGA-SGASDSKAYKEKVRRDRLNDRFQELSSILEPGRPPKMDKAGI  113

Query  457  LSDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkal  636
            L+DAVR+V+QLR+EAQKLKES ++LQ +VNELK EKNEL+DEK KLK EK+KLE Q+KAL
Sbjct  114  LNDAVRLVIQLREEAQKLKESHDNLQRKVNELKTEKNELRDEKLKLKAEKEKLEEQVKAL  173

Query  637  NSRPGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQF  762
            +   GF  HP      F     L+  KLVP   YPGIPMWQF
Sbjct  174  SLPSGFSVHPLPVPASFAATSPLLSSKLVPLFRYPGIPMWQF  215



>ref|XP_006447466.1| hypothetical protein CICLE_v10016381mg [Citrus clementina]
 ref|XP_006469731.1| PREDICTED: transcription factor ILR3-like [Citrus sinensis]
 gb|ESR60706.1| hypothetical protein CICLE_v10016381mg [Citrus clementina]
Length=235

 Score =   153 bits (387),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 106/225 (47%), Positives = 145/225 (64%), Gaps = 15/225 (7%)
 Frame = +1

Query  106  MAAPEVDGSNWLLDLGF-EDIPLPGGKFPPLEPGYQWHssailspappsiRQDESYVKFD  282
            M     D S+WL+D    +DIP+ G         + W S A  +    S         F 
Sbjct  1    MEIASSDNSDWLIDYSIVDDIPIAGN--------FDWPSQAAPAVNASSAASVTIDCSFG  52

Query  283  VSNG-----CSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDK  447
             S+G       +RKR++S +C   + SKA REK+RR RLN+RF EL  +++PG+PPK DK
Sbjct  53   DSDGPKEVEAGSRKRLRSESCC-VSGSKACREKLRRDRLNERFLELGSMLEPGRPPKTDK  111

Query  448  SAILSDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelql  627
            + ILSDAV+M+ QLR EAQKLK+S E+LQE++ ELKAEKNEL+DEKQ+LK +K+KL+ Q+
Sbjct  112  ATILSDAVQMMEQLRTEAQKLKQSNENLQEKIKELKAEKNELRDEKQRLKADKEKLQQQV  171

Query  628  kalNSRPGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQF  762
            K +++  GFLPHP + +  F     + G KLVPF+GYPG+ MWQF
Sbjct  172  KVMSAPSGFLPHPSSMSAAFAAQSQVAGNKLVPFIGYPGVAMWQF  216



>ref|XP_010323806.1| PREDICTED: transcription factor ILR3 isoform X1 [Solanum lycopersicum]
Length=244

 Score =   153 bits (387),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 113/225 (50%), Positives = 145/225 (64%), Gaps = 11/225 (5%)
 Frame = +1

Query  118  EVDGS---NWLLDLGF-EDIP----LPGGKF-PPLEPGYQWHssailspappsiRQDESY  270
            EVD S   NWL D     DI     +   +F  P    + W +  I + +      D ++
Sbjct  2    EVDSSGNPNWLFDYELMTDITSAASVTVAEFQSPATIDFSWPAQTIYASSNLITETDYTF  61

Query  271  VKFDVSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKS  450
               +VS   S+RKR+KS  CS +  SKA REK+RR RLN+RF  LS V+DPG+PPK +K 
Sbjct  62   ADSEVSKEASSRKRLKSECCS-SPRSKACREKLRRDRLNERFLALSSVLDPGRPPKTEKV  120

Query  451  AILSDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlk  630
            AILSDA RM+++LR E QKLKES E+LQE++ ELKAEKNEL+DEKQ+LKEEKD LE Q+K
Sbjct  121  AILSDAQRMLIELRTETQKLKESNEELQEKIKELKAEKNELRDEKQRLKEEKDNLEQQVK  180

Query  631  alNSRPGFLPHPPATAVPFPTPHHLVGG-KLVPFVGYPGIPMWQF  762
            +L S+ GFL HP A    F     +  G KL+PF+GYP + MWQF
Sbjct  181  SLASKAGFLSHPSAMGAAFTAQGQVAAGNKLMPFIGYPSVAMWQF  225



>gb|EYU33597.1| hypothetical protein MIMGU_mgv1a013092mg [Erythranthe guttata]
Length=230

 Score =   152 bits (385),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 110/223 (49%), Positives = 145/223 (65%), Gaps = 16/223 (7%)
 Frame = +1

Query  106  MAAPEVDGSNWLLDLGFEDIPLPGGKFPPLEPGYQW--HssailspappsiRQDESYVKF  279
            M  PE   +NWL D GFEDI +P G      PG+ W          +  S+  D S  + 
Sbjct  1    MVTPE--NTNWLYDYGFEDITVPVGNLSSPSPGFSWPVQQPLNGGSSNASVEIDGSLGES  58

Query  280  DVSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAIL  459
            DV     ++KR ++ +C+  +++KA REK RR RLND+F EL  +++PG+PPK DKSAIL
Sbjct  59   DVQKETGSKKRARTESCA-PSNTKACREKQRRDRLNDKFMELGAILEPGRPPKTDKSAIL  117

Query  460  SDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkalN  639
            SDA+RMV QLR EAQKLK++  +LQE++ ELKAEKNEL+DEKQ+LK EK+K+E QLK +N
Sbjct  118  SDALRMVTQLRTEAQKLKDANLNLQEKIKELKAEKNELRDEKQRLKAEKEKVEQQLKTVN  177

Query  640  S--RPGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQF  762
               +PGFLP     A+P        G KLVP + YPG+ MWQF
Sbjct  178  GAPQPGFLPA--HQAMPG-------GNKLVPIISYPGVAMWQF  211



>ref|XP_007211667.1| hypothetical protein PRUPE_ppa009077mg [Prunus persica]
 gb|EMJ12866.1| hypothetical protein PRUPE_ppa009077mg [Prunus persica]
Length=307

 Score =   154 bits (390),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 115/220 (52%), Positives = 150/220 (68%), Gaps = 4/220 (2%)
 Frame = +1

Query  106  MAAPEVDGSNWLLDLGF-EDIPLPGGKFPPLEPGYQWHssailspappsiRQDESYVKFD  282
            M +PE   +NWL D G  +D P+  G FP    G+ W    +   +  S+  D S    +
Sbjct  72   MVSPE--NTNWLFDYGLIDDAPVLDGNFPVSSSGFTWPVQPLAGSSSVSVEIDGSLGDAE  129

Query  283  VSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILS  462
                  ++KR+++ +CSG++ SKA REK+RR RLND+F EL  +++PG+PPK DK+AIL 
Sbjct  130  GVKESGSKKRVRTESCSGSS-SKACREKLRRDRLNDKFLELGSILEPGRPPKTDKAAILV  188

Query  463  DAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkalNS  642
            DAVRMV QLR EAQKLK+S   LQE++ ELKAEKNEL+DEKQ+LK EK+KLE QLKA+N+
Sbjct  189  DAVRMVNQLRGEAQKLKDSNSSLQEKIKELKAEKNELRDEKQRLKLEKEKLEQQLKAMNA  248

Query  643  RPGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQF  762
            +PGFLP PPA    F       G KLVPF+GYPG+ MWQF
Sbjct  249  QPGFLPPPPAIPAAFAAQGQAHGNKLVPFIGYPGVAMWQF  288



>ref|XP_004505433.1| PREDICTED: transcription factor ILR3-like [Cicer arietinum]
Length=237

 Score =   152 bits (384),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 107/215 (50%), Positives = 138/215 (64%), Gaps = 3/215 (1%)
 Frame = +1

Query  124  DGSNWLLDLGF-EDIPLPGGKFP-PLEPGYQWHssailspappsiRQDESYVKFDVSNGC  297
            + +NWL D G  +DIP+P   F  P      W +      +      D S    D     
Sbjct  5    ENTNWLFDYGLIDDIPVPDPTFAVPSSTLLTWPTHPFNISSNVGAEIDGSLGDSDSLKES  64

Query  298  SARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRM  477
             ++KR++S +C+ A  SKA REK+RR RLND+F EL  +++PG+P K DK+AIL DAVRM
Sbjct  65   GSKKRVRSESCA-ATSSKACREKLRRDRLNDKFIELGSILEPGRPAKTDKAAILIDAVRM  123

Query  478  VLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkalNSRPGFL  657
            V QLR EAQKLK+S   LQE++ ELKAEKNEL+DEKQ+LK EK+KLE QLK++N++P FL
Sbjct  124  VTQLRGEAQKLKDSNTGLQEKIKELKAEKNELRDEKQRLKAEKEKLEQQLKSMNAQPSFL  183

Query  658  PHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQF  762
            P P A    F       G KLVPF+ YPG+ MWQF
Sbjct  184  PTPTALPAAFAAQGQAHGNKLVPFISYPGVAMWQF  218



>ref|XP_008793739.1| PREDICTED: transcription factor ILR3 [Phoenix dactylifera]
Length=237

 Score =   150 bits (380),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 110/221 (50%), Positives = 145/221 (66%), Gaps = 5/221 (2%)
 Frame = +1

Query  106  MAAPEVDGSNWLLDLGF-EDIPLPGGKFPPLEPGYQWHssailspappsiRQDESYVKFD  282
            M +PE   +NW+ D    +D+ +  G FP    G+ W+S  I S +  S+    S+V   
Sbjct  1    MGSPE--NTNWVFDCPLIDDMSVASGDFPAPGTGFYWNSQGINSSSNSSVEISGSFVDSA  58

Query  283  VSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILS  462
                  ++KR++S + S    SKA REKMRR +LN++F EL  +++PGKPPKMDK+AILS
Sbjct  59   GIKESDSKKRVRSES-SCQPGSKACREKMRRDKLNNKFLELGSILEPGKPPKMDKAAILS  117

Query  463  DAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkalNS  642
            DAVRMV QLR EAQKLK+S EDLQE++ ELKAEKNEL+DEKQ+LK EK+ LE Q+K LN+
Sbjct  118  DAVRMVTQLRSEAQKLKDSNEDLQEKIKELKAEKNELRDEKQRLKAEKENLEQQIKILNA  177

Query  643  RPGFLPHPPATAVPFPTPHHLVGGKL-VPFVGYPGIPMWQF  762
            R  ++ HPP     F         KL +P +GYPG PMWQF
Sbjct  178  RASYVAHPPVIPAAFAAQGQTAAHKLMMPVIGYPGFPMWQF  218



>ref|XP_004248337.1| PREDICTED: transcription factor ILR3-like [Solanum lycopersicum]
Length=231

 Score =   150 bits (378),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 106/219 (48%), Positives = 140/219 (64%), Gaps = 7/219 (3%)
 Frame = +1

Query  106  MAAPEVDGSNWLLDLGFEDIPLPGGKFPPLEPGYQWHssailspappsiRQDESYVKFDV  285
            M  PE   +NWL D  +EDI  P   F     GY W           S+  D S  + D 
Sbjct  1    MVLPE--NTNWLYDYHYEDIVTPDVNFSV--SGYSWSMQGFNGSTNASVDIDGSLGESDC  56

Query  286  SNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSD  465
                  +KR ++ +C+ ++ SKA REK+RR +LN++F EL+ +++P +PPK DKSAIL D
Sbjct  57   VKESGCKKRTRAESCTSSS-SKACREKLRREKLNEKFMELAVLLEPSRPPKTDKSAILVD  115

Query  466  AVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkalNSR  645
            AVR+V QLR EAQKLK+S  DLQE++ ELK EKNEL+DEKQ+LK EK+KLE QLK ++++
Sbjct  116  AVRVVTQLRGEAQKLKDSNLDLQEKIKELKVEKNELRDEKQRLKSEKEKLEQQLKTMSAQ  175

Query  646  PGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQF  762
            P FL  PPA    F +P    G KLVP + YPG+ MWQF
Sbjct  176  PSFL--PPAMPGAFASPVQAAGTKLVPIISYPGVAMWQF  212



>gb|KCW70120.1| hypothetical protein EUGRSUZ_F03420 [Eucalyptus grandis]
 gb|KCW70121.1| hypothetical protein EUGRSUZ_F03420 [Eucalyptus grandis]
Length=237

 Score =   149 bits (376),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 113/221 (51%), Positives = 147/221 (67%), Gaps = 5/221 (2%)
 Frame = +1

Query  106  MAAPEVDGSNWLLDLGFED--IPLPGGKFPPLEPGYQWHssailspappsiRQDESYVKF  279
            M +PE   +NW+ D G  D    +  G F     GY W    +   +  S   D S+ + 
Sbjct  1    MVSPE--HTNWIYDCGLIDDIAAVADGDFQVSGSGYTWPVQPLNGSSIFSTEIDGSFGES  58

Query  280  DVSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAIL  459
            D      ++KR+++ +C G + SKA REK+RR RLND+F EL+ +++PG+PPK DK+AIL
Sbjct  59   DGVKENGSKKRVRTESC-GTSSSKACREKLRRDRLNDKFLELASLLEPGRPPKADKAAIL  117

Query  460  SDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkalN  639
             DAVRMV QLR EAQKLK+S   LQE++ ELKAEKNEL+DEKQ+LK EK+KLE QLKA+N
Sbjct  118  IDAVRMVTQLRGEAQKLKDSNSSLQEKIKELKAEKNELRDEKQRLKAEKEKLEHQLKAMN  177

Query  640  SRPGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQF  762
            ++P FLP PPA    F T     G KLVPF+GYPG+ MWQF
Sbjct  178  AQPSFLPPPPAIPAAFATQGQAPGNKLVPFIGYPGVAMWQF  218



>ref|XP_007132981.1| hypothetical protein PHAVU_011G141300g [Phaseolus vulgaris]
 gb|ESW04975.1| hypothetical protein PHAVU_011G141300g [Phaseolus vulgaris]
Length=237

 Score =   149 bits (375),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 105/214 (49%), Positives = 140/214 (65%), Gaps = 1/214 (0%)
 Frame = +1

Query  124  DGSNWLLDLGF-EDIPLPGGKFPPLEPGYQWHssailspappsiRQDESYVKFDVSNGCS  300
            + +NWL D G  +DIP+P   F      + W  +A+ + +   +  D S    D      
Sbjct  5    ENTNWLFDYGLIDDIPVPDASFTVPSSAFTWPPNALNATSNVGVEIDGSLADSDGLKEAG  64

Query  301  ARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRMV  480
            ++KR++S  C+ A  SKA REK+RR +LND+F EL  +++P +P K DK+AIL DAVRMV
Sbjct  65   SKKRVRSETCAAATSSKACREKLRRDKLNDKFVELGSILEPERPTKTDKAAILIDAVRMV  124

Query  481  LQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkalNSRPGFLP  660
             QLR EAQKLK+S + LQE++ ELKAEKNEL+DEKQ LK EK+KLE QLK+LN++P F+P
Sbjct  125  TQLRGEAQKLKDSNQGLQEKIKELKAEKNELRDEKQMLKAEKEKLEQQLKSLNAQPNFMP  184

Query  661  HPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQF  762
             P A    F       G KLVPF+ YPG+ MWQF
Sbjct  185  PPAAIPAAFAAQGQAHGNKLVPFISYPGVAMWQF  218



>ref|XP_009791575.1| PREDICTED: transcription factor ILR3-like [Nicotiana sylvestris]
 gb|ACG60665.1| basic helix-loop-helix protein [Nicotiana tabacum]
Length=233

 Score =   148 bits (374),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 112/220 (51%), Positives = 140/220 (64%), Gaps = 7/220 (3%)
 Frame = +1

Query  106  MAAPEVDGSNWLLDLGFEDIPLPGGKFPPLEPGYQWHssailspappsiRQDESYVKFDV  285
            M +PE   +NWL D GFE+  +P   F     G+ W    +      S   D S  + D 
Sbjct  1    MVSPE--NTNWLYDYGFEESAVPDSNFSATASGFNWPMQNLNGSRNVSAEVDGSIGESDY  58

Query  286  SNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSD  465
                 ++KR +  +C+  + SKA REK RR RLND+F EL  +++PG+PPK DKSAIL D
Sbjct  59   PKENGSKKRARVESCAPTS-SKACREKQRRDRLNDKFTELGALLEPGRPPKTDKSAILVD  117

Query  466  AVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkalNSR  645
            AVRMV QLR EAQKLK+S  +LQE++ ELKAEKNEL+DEKQKLK EK+KLE QLK  N++
Sbjct  118  AVRMVTQLRGEAQKLKDSNLNLQEKIKELKAEKNELRDEKQKLKAEKEKLEQQLKTTNAQ  177

Query  646  PGFLPHPPATAVPFPTPHHLV-GGKLVPFVGYPGIPMWQF  762
            PGFLP     A     PH  V G KLVP + YPG+ MWQF
Sbjct  178  PGFLPPAIPAAF---APHGQVPGSKLVPIMSYPGVAMWQF  214



>ref|XP_008800495.1| PREDICTED: transcription factor ILR3-like [Phoenix dactylifera]
Length=231

 Score =   148 bits (373),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 109/220 (50%), Positives = 138/220 (63%), Gaps = 9/220 (4%)
 Frame = +1

Query  106  MAAPEVDGSNWLLDLGFEDIPLPGGKFPPLEPGYQWHssailspappsiRQDESYVKFDV  285
            M +PE   SNW+ D      PL        E G+ W    I S +  S+    S+V    
Sbjct  1    MVSPE--NSNWVFD-----CPLIDDDMSAPETGFYWTPQGINSSSNASVEISGSFVDSGG  53

Query  286  SNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSD  465
                 ++KR++S + S    SKA REK+RR RLNDRF EL  +++PGKPPKMDK+AILSD
Sbjct  54   IKDSGSKKRVRSESSSQPG-SKACREKLRRDRLNDRFLELGSILEPGKPPKMDKAAILSD  112

Query  466  AVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkalNSR  645
            AVRMV QLR EAQKLK+S E+LQE++ ELKAEKNEL++EKQ+LK EK+ LE Q+K LN+R
Sbjct  113  AVRMVTQLRSEAQKLKDSNENLQEKIKELKAEKNELREEKQRLKAEKENLEQQIKMLNTR  172

Query  646  PGFLPHPPATAVPFPTPHHLVGGKL-VPFVGYPGIPMWQF  762
              F+ HPP     F         KL +P + YPG PMWQF
Sbjct  173  ASFVAHPPVIPAAFAAQGQTAAHKLMMPVISYPGFPMWQF  212



>ref|XP_007149692.1| hypothetical protein PHAVU_005G091000g [Phaseolus vulgaris]
 gb|AGZ15364.1| transcription factor ILR3 [Phaseolus vulgaris]
 gb|ESW21686.1| hypothetical protein PHAVU_005G091000g [Phaseolus vulgaris]
Length=231

 Score =   147 bits (372),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 112/221 (51%), Positives = 140/221 (63%), Gaps = 11/221 (5%)
 Frame = +1

Query  106  MAAPEVDGSNWLLD--LGFEDIPLPGGKFPPLEPGYQWHssailspappsiRQDESYVKF  279
            M +PE   SNWL D  L  +DI +  G F      + W               D S V  
Sbjct  1    MVSPE--NSNWLFDYPLIDDDITVGDGSF--TVSAFSWPPPPSNVSVEI----DASLVDS  52

Query  280  DVSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAIL  459
            D     + +KR +S  C+ A+ SKA REK+RR RLND+F EL  +++PG+PPK DK+AIL
Sbjct  53   DGLKDPALKKRGRSDLCT-ASSSKACREKLRRDRLNDKFVELGSILEPGRPPKTDKAAIL  111

Query  460  SDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkalN  639
             DAVRMV QLRDEAQKLKES   LQE++ ELK EKNEL+DEKQ+LK EK+KLELQ+K++N
Sbjct  112  IDAVRMVTQLRDEAQKLKESNTGLQEKIKELKTEKNELRDEKQRLKVEKEKLELQVKSMN  171

Query  640  SRPGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQF  762
            ++P FLP P A    F       G KLVPF+ YPG+ MWQF
Sbjct  172  AQPAFLPPPSAIPAAFAPQGQAPGNKLVPFISYPGVAMWQF  212



>ref|XP_003607701.1| Transcription factor ILR3 [Medicago truncatula]
 gb|ACJ84233.1| unknown [Medicago truncatula]
 gb|AES89898.1| BHLH domain class transcription factor [Medicago truncatula]
 gb|AFK34575.1| unknown [Medicago truncatula]
Length=237

 Score =   147 bits (372),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 104/215 (48%), Positives = 139/215 (65%), Gaps = 3/215 (1%)
 Frame = +1

Query  124  DGSNWLLDLGF-EDIPLPGGKFPPLEPGYQWHssailspappsiRQ-DESYVKFDVSNGC  297
            + +NW+ D GF +DIP+P   F      + W +    + +     + D S    D     
Sbjct  5    ENTNWINDYGFYDDIPVPDSTFALPSSAFTWPTQPPFNLSSNVSAEVDGSLGDSDGLKES  64

Query  298  SARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRM  477
             ++KR++S +C+ A  SKA REK+RR RLND+F EL  +++PG+P K DK+AIL DAVRM
Sbjct  65   GSKKRVRSESCA-ATSSKACREKLRRDRLNDKFIELGSILEPGRPAKTDKAAILIDAVRM  123

Query  478  VLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkalNSRPGFL  657
            V QLR EAQKLK++   LQE++ ELK EKNEL+DEKQ+LK EK+KLE QLK++N+ P FL
Sbjct  124  VTQLRGEAQKLKDANSGLQEKIKELKVEKNELRDEKQRLKAEKEKLEQQLKSMNAPPSFL  183

Query  658  PHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQF  762
            P P A    F       G KLVPF+ YPG+ MWQF
Sbjct  184  PTPTALPAAFAAQGQAHGNKLVPFISYPGVAMWQF  218



>gb|AFK48825.1| unknown [Lotus japonicus]
Length=238

 Score =   147 bits (371),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 106/216 (49%), Positives = 140/216 (65%), Gaps = 4/216 (2%)
 Frame = +1

Query  124  DGSNWLLDLGF-EDIPLPGGKFPPLEPGYQWHssa--ilspappsiRQDESYVKFDVSNG  294
            + +NWL D G  +DIP P   F     G+ W SS     S     +  D S    D    
Sbjct  5    ENTNWLFDYGLIDDIPAPEVTFTVPPSGFTWPSSQPLNSSSNVVGVEIDGSLGDSDSLKE  64

Query  295  CSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVR  474
              ++KR++S +CS A  SKA REK+RR +LND+F EL  +++PG+PPK DK+AIL DAVR
Sbjct  65   PGSKKRVRSESCS-ATSSKACREKLRRDKLNDKFVELGSILEPGRPPKTDKAAILIDAVR  123

Query  475  MVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkalNSRPGF  654
            MV QLR EAQK+K++   LQE++ ELK EKNEL+DEKQ+LK EK++LE QLK++N++P F
Sbjct  124  MVTQLRGEAQKMKDTNMGLQEKIKELKTEKNELRDEKQRLKTEKERLEQQLKSMNAQPSF  183

Query  655  LPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQF  762
            +P P A    F       G KLVPF+ YPG+ MWQF
Sbjct  184  MPPPQALPAAFAAQGQAHGNKLVPFISYPGVAMWQF  219



>gb|ADL36593.1| BHLH domain class transcription factor [Malus domestica]
Length=229

 Score =   146 bits (369),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 111/219 (51%), Positives = 145/219 (66%), Gaps = 9/219 (4%)
 Frame = +1

Query  106  MAAPEVDGSNWLLDLGFEDIPLPGGKFPPLEPGYQWHssailspappsiRQDESYVKFDV  285
            MA+PE   +NWL D G  D        P L+  + W    I   +  S+  D S    + 
Sbjct  1    MASPE--NTNWLFDYGLID------DTPVLDGNFAWPVQPIAGSSSASVELDGSLGDAEG  52

Query  286  SNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSD  465
                 ++KR+++ +CSG + SKA REK+RR RLND+F EL  +++PG+PPK DK+AIL D
Sbjct  53   LKESGSKKRVRTESCSGTS-SKACREKLRRDRLNDKFVELGSILEPGRPPKTDKAAILVD  111

Query  466  AVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkalNSR  645
            AVRMV QLR EAQKLK++   LQE++ ELKAEKNEL+DEKQ+LK EK+KLE QLK++N +
Sbjct  112  AVRMVNQLRGEAQKLKDTNSGLQEKIKELKAEKNELRDEKQRLKSEKEKLEQQLKSMNVQ  171

Query  646  PGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQF  762
            PGFLP PPA    F       G K+VPF+GYPG+ MWQF
Sbjct  172  PGFLPPPPAIPAAFAAQSQARGNKMVPFIGYPGVAMWQF  210



>ref|XP_010062960.1| PREDICTED: transcription factor ILR3-like [Eucalyptus grandis]
Length=237

 Score =   146 bits (369),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 112/221 (51%), Positives = 146/221 (66%), Gaps = 5/221 (2%)
 Frame = +1

Query  106  MAAPEVDGSNWLLDLGFED--IPLPGGKFPPLEPGYQWHssailspappsiRQDESYVKF  279
            M +PE   +NW+ D G  D    +  G F     GY W    +   +  S   D S+ + 
Sbjct  1    MVSPE--HTNWIYDCGLIDDIAAVADGDFQVSGSGYTWPVQPLNGSSIFSTEIDGSFGES  58

Query  280  DVSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAIL  459
            D      ++KR+++ +C G + SKA REK+RR RLND+F EL+ +++PG+PPK DK+AIL
Sbjct  59   DGVKENGSKKRVRTESC-GTSSSKACREKLRRDRLNDKFLELASLLEPGRPPKADKAAIL  117

Query  460  SDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkalN  639
             DAVRMV QLR EAQKLK+S   LQE++ ELKAEKNEL+DEKQ+LK EK+KLE QLKA +
Sbjct  118  IDAVRMVTQLRGEAQKLKDSNSSLQEKIKELKAEKNELRDEKQRLKAEKEKLEHQLKATS  177

Query  640  SRPGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQF  762
            ++P FLP PPA    F T     G KLVPF+GYPG+ MWQF
Sbjct  178  AQPNFLPPPPAMPAAFATQGQAPGNKLVPFLGYPGVAMWQF  218



>ref|XP_009630429.1| PREDICTED: transcription factor ILR3-like [Nicotiana tomentosiformis]
Length=233

 Score =   145 bits (367),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 110/220 (50%), Positives = 140/220 (64%), Gaps = 7/220 (3%)
 Frame = +1

Query  106  MAAPEVDGSNWLLDLGFEDIPLPGGKFPPLEPGYQWHssailspappsiRQDESYVKFDV  285
            M +PE   +NWL D GFE+  +P   F     G+ W    +      S   D S  + D 
Sbjct  1    MVSPE--NTNWLYDYGFEESAVPDSNFSATASGFNWPMQNLNGSRNVSAEVDGSIGESDC  58

Query  286  SNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSD  465
                 ++KR +  +C+  + SKA REK RR RLND+F EL  +++PG+PPK DKSAIL D
Sbjct  59   PKENGSKKRARVESCAPTS-SKACREKQRRDRLNDKFTELGALLEPGRPPKTDKSAILVD  117

Query  466  AVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkalNSR  645
            AVRMV QLR EAQKLK+S  +LQE++ ELKAEKNEL+DEKQKLK EK+KLE QLK ++++
Sbjct  118  AVRMVTQLRGEAQKLKDSNLNLQEKIKELKAEKNELRDEKQKLKAEKEKLEQQLKTMSAQ  177

Query  646  PGFLPHPPATAVPFPTPHHLV-GGKLVPFVGYPGIPMWQF  762
            PGFLP     A      H  V G KLVP + YPG+ MWQF
Sbjct  178  PGFLPPAIPAAF---AAHGQVPGSKLVPIMSYPGVAMWQF  214



>ref|XP_008349949.1| PREDICTED: transcription factor ILR3-like [Malus domestica]
Length=229

 Score =   145 bits (367),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 111/219 (51%), Positives = 145/219 (66%), Gaps = 9/219 (4%)
 Frame = +1

Query  106  MAAPEVDGSNWLLDLGFEDIPLPGGKFPPLEPGYQWHssailspappsiRQDESYVKFDV  285
            MA+PE   +NWL D G  D        P L+  + W    I   +  S+  D S    + 
Sbjct  1    MASPE--NTNWLFDYGLID------DTPVLDGNFAWPVQPIAGSSSASVELDGSLGDAEG  52

Query  286  SNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSD  465
                 ++KR+++ +CSG + SKA REK+RR RLND+F EL  +++PG+PPK DK+AIL D
Sbjct  53   LKESGSKKRVRTESCSGTS-SKACREKLRRDRLNDKFVELGSILEPGRPPKTDKAAILVD  111

Query  466  AVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkalNSR  645
            AVRMV QLR EAQKLK++   LQE++ ELKAEKNEL+DEKQ+LK EK+KLE QLK++N +
Sbjct  112  AVRMVNQLRGEAQKLKDTNSGLQEKIKELKAEKNELRDEKQRLKSEKEKLEQQLKSMNIQ  171

Query  646  PGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQF  762
            PGFLP PPA    F       G K+VPF+GYPG+ MWQF
Sbjct  172  PGFLPPPPAIPAAFAAQGQARGNKMVPFIGYPGVAMWQF  210



>ref|XP_009792846.1| PREDICTED: transcription factor ILR3-like [Nicotiana sylvestris]
Length=235

 Score =   145 bits (367),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 103/221 (47%), Positives = 138/221 (62%), Gaps = 7/221 (3%)
 Frame = +1

Query  106  MAAPEVDGSNWLLDLGFEDIPLPGG-KFPPLEPGYQWHssailspappsiRQ-DESYVKF  279
            MA+PE   +NWL D  FEDI +     F     G+ W                D S  + 
Sbjct  1    MASPET--TNWLYDYNFEDITVSVDPNFSNSTTGFSWSMQPFNGSTTNISVDIDGSIGES  58

Query  280  DVSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAIL  459
            D      ++KR ++ +C+ ++ SKA REK+RR +LND+F EL  +++PG+ PK DKSA+L
Sbjct  59   DCLKESGSKKRARAESCTSSS-SKACREKLRREKLNDKFMELGALLEPGRTPKTDKSALL  117

Query  460  SDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkalN  639
             DAVRMV  LR EA+KLK+S  +LQE++ ELKAEKNEL+DEKQ+LK +K+KLE QLK +N
Sbjct  118  VDAVRMVTHLRGEAEKLKDSNLNLQEKIKELKAEKNELRDEKQRLKADKEKLEQQLKTMN  177

Query  640  SRPGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQF  762
            ++PGF   PP     F  P    G KLVP + YPG+ MWQF
Sbjct  178  AQPGFF--PPVVPGAFAAPGQAAGSKLVPIISYPGVAMWQF  216



>ref|XP_010923988.1| PREDICTED: transcription factor ILR3-like [Elaeis guineensis]
Length=230

 Score =   145 bits (365),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 109/221 (49%), Positives = 138/221 (62%), Gaps = 12/221 (5%)
 Frame = +1

Query  106  MAAPEVDGSNWLLDLGF-EDIPLPGGKFPPLEPGYQWHssailspappsiRQDESYVKFD  282
            M  PE   SNW+ D    +D+  PG        G+ W    I S +  S+    S+V   
Sbjct  1    MVLPE--NSNWVFDGSLIDDMSAPGT-------GFYWTPQGINSSSNASVEISGSFVDSG  51

Query  283  VSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILS  462
                  ++KR++S + S    SKA REK+RR RLNDRF EL  +++PGKPPKMDK+AILS
Sbjct  52   GIKESGSKKRVRSESSSQPG-SKACREKLRRDRLNDRFLELGSILEPGKPPKMDKAAILS  110

Query  463  DAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkalNS  642
            DAVRMV QLR EAQKLK+S E+LQE++ ELK EKNEL+DEKQ+LK EK+ LE Q+K LN+
Sbjct  111  DAVRMVTQLRSEAQKLKDSNENLQEKIKELKVEKNELRDEKQRLKAEKENLEQQIKMLNT  170

Query  643  RPGFLPHPPATAVPFPTPHHLVGGKL-VPFVGYPGIPMWQF  762
            R  F+ HPP     F         KL +P + YPG PMWQF
Sbjct  171  RASFVAHPPVIPAAFAAQGQTAAHKLMMPVISYPGFPMWQF  211



>ref|XP_008244399.1| PREDICTED: transcription factor ILR3 [Prunus mume]
Length=295

 Score =   144 bits (364),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 108/220 (49%), Positives = 140/220 (64%), Gaps = 16/220 (7%)
 Frame = +1

Query  106  MAAPEVDGSNWLLDLGF-EDIPLPGGKFPPLEPGYQWHssailspappsiRQDESYVKFD  282
            M +PE   +NWL D G  +D P+  G FP    G+ W    +   +  S+  D S    +
Sbjct  72   MVSPE--NTNWLFDYGLIDDTPVLDGNFPVSSSGFTWPVQPLAGSSSVSVEIDGSLGDAE  129

Query  283  VSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILS  462
                  ++KR+++ +CSG++ SKA REK+RR RLND+F EL  +++PG+PPK DK+AIL 
Sbjct  130  GVKESGSKKRVRTESCSGSS-SKACREKLRRDRLNDKFLELGSILEPGRPPKTDKAAILV  188

Query  463  DAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkalNS  642
            DAVRMV QLR EAQKLK+S   LQE++ ELKAEKNEL+DEKQ+L  EK+KLE QLKA N 
Sbjct  189  DAVRMVNQLRGEAQKLKDSNSSLQEKIKELKAEKNELRDEKQRLTLEKEKLEQQLKARN-  247

Query  643  RPGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQF  762
                    PA    F       G KLVPF+GYPG+ MWQF
Sbjct  248  --------PAA---FAAQGQAHGNKLVPFIGYPGVAMWQF  276



>gb|KDP39043.1| hypothetical protein JCGZ_00800 [Jatropha curcas]
Length=236

 Score =   142 bits (359),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 108/220 (49%), Positives = 140/220 (64%), Gaps = 4/220 (2%)
 Frame = +1

Query  106  MAAPEVDGSNWLLDLGF-EDIPLPGGKFPPLEPGYQWHssailspappsiRQDESYVKFD  282
            M +PE    NWL D G  ++ P+    F     G+ W    +   +   +  D  +   +
Sbjct  1    MVSPE--NMNWLADYGLIDETPVLDANFSVPVSGFSWPVQTLNGSSDAGVEIDGPFGNSE  58

Query  283  VSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILS  462
                 S++KR +S +C GA+ SKA REK+RR RLND+F EL  +++PG+PPK DK+AIL 
Sbjct  59   AQKESSSKKRGRSESC-GASSSKACREKLRRDRLNDKFLELGSILEPGRPPKTDKAAILV  117

Query  463  DAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkalNS  642
            DA+R V QLR EAQ LK+S   LQE++ ELKAEKNEL+DEKQ+LK EK+KLE QLKA NS
Sbjct  118  DAIRRVTQLRGEAQTLKDSNSSLQEKIKELKAEKNELRDEKQRLKAEKEKLEQQLKAANS  177

Query  643  RPGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQF  762
            +  FLP PPA    F       G KLVPF+GYPG+ MWQF
Sbjct  178  QTSFLPPPPAIPAAFAAQGQASGNKLVPFIGYPGVAMWQF  217



>ref|XP_006447467.1| hypothetical protein CICLE_v10016381mg [Citrus clementina]
 gb|ESR60707.1| hypothetical protein CICLE_v10016381mg [Citrus clementina]
Length=250

 Score =   143 bits (360),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 106/240 (44%), Positives = 145/240 (60%), Gaps = 30/240 (13%)
 Frame = +1

Query  106  MAAPEVDGSNWLLDLGF-EDIPLPGGKFPPLEPGYQWHssailspappsiRQDESYVKFD  282
            M     D S+WL+D    +DIP+ G         + W S A  +    S         F 
Sbjct  1    MEIASSDNSDWLIDYSIVDDIPIAGN--------FDWPSQAAPAVNASSAASVTIDCSFG  52

Query  283  VSNG-----CSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDK  447
             S+G       +RKR++S +C   + SKA REK+RR RLN+RF EL  +++PG+PPK DK
Sbjct  53   DSDGPKEVEAGSRKRLRSESCC-VSGSKACREKLRRDRLNERFLELGSMLEPGRPPKTDK  111

Query  448  SAILSDAVRMVLQLRDEAQKLKESFEDLQEQVNELK---------------Aeknelkde  582
            + ILSDAV+M+ QLR EAQKLK+S E+LQE++ ELK               AEKNEL+DE
Sbjct  112  ATILSDAVQMMEQLRTEAQKLKQSNENLQEKIKELKGLDDHVQLSCCLSMQAEKNELRDE  171

Query  583  kqklkeekdklelqlkalNSRPGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQF  762
            KQ+LK +K+KL+ Q+K +++  GFLPHP + +  F     + G KLVPF+GYPG+ MWQF
Sbjct  172  KQRLKADKEKLQQQVKVMSAPSGFLPHPSSMSAAFAAQSQVAGNKLVPFIGYPGVAMWQF  231



>ref|XP_003540036.1| PREDICTED: transcription factor ILR3 [Glycine max]
 gb|KHN20440.1| Transcription factor ILR3 [Glycine soja]
Length=236

 Score =   142 bits (359),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 105/214 (49%), Positives = 144/214 (67%), Gaps = 2/214 (1%)
 Frame = +1

Query  124  DGSNWLLDLGF-EDIPLPGGKFPPLEPGYQWHssailspappsiRQDESYVKFDVSNGCS  300
            + +NWL D G  +DIP+P   F      + W  +A+ +P+   +  D S    D      
Sbjct  5    ENTNWLFDYGLIDDIPVPDATFGVNSSAFTWPPNALDAPSNVGVDIDGSLGDSDGLKESG  64

Query  301  ARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRMV  480
            ++KR++S +C+ A+ SKA REK+RR RLND+F EL  +++PG+P K DK+AIL DAVRMV
Sbjct  65   SKKRVRSESCA-ASSSKACREKLRRDRLNDKFVELGSILEPGRPAKTDKTAILIDAVRMV  123

Query  481  LQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkalNSRPGFLP  660
             QLR EAQKLK++ + LQE++ +LKAEKNEL+D+KQ+LK EK+KLE QLK+LN +P F+P
Sbjct  124  TQLRGEAQKLKDTNQGLQEKIKDLKAEKNELRDQKQRLKAEKEKLEQQLKSLNGQPSFMP  183

Query  661  HPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQF  762
             P A    F       G KLVPF+ YPG+ MWQF
Sbjct  184  PPAAIPAAFAVQGQAHGNKLVPFISYPGVAMWQF  217



>ref|XP_010323807.1| PREDICTED: transcription factor ILR3 isoform X2 [Solanum lycopersicum]
Length=237

 Score =   142 bits (358),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 109/226 (48%), Positives = 140/226 (62%), Gaps = 20/226 (9%)
 Frame = +1

Query  118  EVDGS---NWLLDLGF-EDIP----LPGGKF-PPLEPGYQWHssailspappsiRQDESY  270
            EVD S   NWL D     DI     +   +F  P    + W +  I + +      D ++
Sbjct  2    EVDSSGNPNWLFDYELMTDITSAASVTVAEFQSPATIDFSWPAQTIYASSNLITETDYTF  61

Query  271  VKFDVSNGCSARKRM-KSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDK  447
               +VS   S+RKR  +S AC         REK+RR RLN+RF  LS V+DPG+PPK +K
Sbjct  62   ADSEVSKEASSRKRSPRSKAC---------REKLRRDRLNERFLALSSVLDPGRPPKTEK  112

Query  448  SAILSDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelql  627
             AILSDA RM+++LR E QKLKES E+LQE++ ELKAEKNEL+DEKQ+LKEEKD LE Q+
Sbjct  113  VAILSDAQRMLIELRTETQKLKESNEELQEKIKELKAEKNELRDEKQRLKEEKDNLEQQV  172

Query  628  kalNSRPGFLPHPPATAVPFPTPHHLVGG-KLVPFVGYPGIPMWQF  762
            K+L S+ GFL HP A    F     +  G KL+PF+GYP + MWQF
Sbjct  173  KSLASKAGFLSHPSAMGAAFTAQGQVAAGNKLMPFIGYPSVAMWQF  218



>ref|XP_003527314.1| PREDICTED: transcription factor ILR3-like isoform 1 [Glycine 
max]
 gb|KHN47843.1| Transcription factor ILR3 [Glycine soja]
Length=236

 Score =   142 bits (357),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 106/214 (50%), Positives = 144/214 (67%), Gaps = 2/214 (1%)
 Frame = +1

Query  124  DGSNWLLDLGF-EDIPLPGGKFPPLEPGYQWHssailspappsiRQDESYVKFDVSNGCS  300
            + +NWL D G  +DIP+P   F      + W  +A+ + +   +  D S    D      
Sbjct  5    ENTNWLFDYGLIDDIPVPDATFGVNSSAFTWPPNALNASSNVGVEIDGSLGDSDSLKESG  64

Query  301  ARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRMV  480
            ++KR++S +C+ A+ SKA REK+RR RLND+F EL  +++PG+P K DK+AIL DAVRMV
Sbjct  65   SKKRVRSESCA-ASGSKACREKLRRDRLNDKFVELGAILEPGRPAKTDKAAILIDAVRMV  123

Query  481  LQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkalNSRPGFLP  660
             QLR EAQKLK++ + LQE++ ELKAEKNEL+DEKQ+LK EK+KLE QLK+LN++P F+P
Sbjct  124  TQLRGEAQKLKDTNQGLQEKIKELKAEKNELRDEKQRLKAEKEKLEQQLKSLNAQPSFMP  183

Query  661  HPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQF  762
             P A    F       G KLVPF+ YPG+ MWQF
Sbjct  184  PPAAMPAAFAAQGQAHGNKLVPFISYPGVAMWQF  217



>gb|ACU23766.1| unknown [Glycine max]
Length=236

 Score =   142 bits (357),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 106/214 (50%), Positives = 144/214 (67%), Gaps = 2/214 (1%)
 Frame = +1

Query  124  DGSNWLLDLGF-EDIPLPGGKFPPLEPGYQWHssailspappsiRQDESYVKFDVSNGCS  300
            + +NWL D G  +DIP+P   F      + W  +A+ + +   +  D S    D      
Sbjct  5    ENTNWLFDYGLIDDIPVPDATFGVNSSAFTWPPNALNASSNVGVEIDGSLGDSDSLKESG  64

Query  301  ARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRMV  480
            ++KR++S +C+ A+ SKA REK+RR RLND+F EL  +++PG+P K DK+AIL DAVRMV
Sbjct  65   SKKRVRSESCA-ASGSKACREKLRRDRLNDKFVELGAILEPGRPAKTDKAAILIDAVRMV  123

Query  481  LQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkalNSRPGFLP  660
             QLR EAQKLK++ + LQE++ ELKAEKNEL+DEKQ+LK EK+KLE QLK+LN++P F+P
Sbjct  124  TQLRGEAQKLKDTSQGLQEKIKELKAEKNELRDEKQRLKAEKEKLEQQLKSLNAQPSFMP  183

Query  661  HPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQF  762
             P A    F       G KLVPF+ YPG+ MWQF
Sbjct  184  PPAAMPAAFAAQGQAHGNKLVPFISYPGVAMWQF  217



>ref|XP_008455829.1| PREDICTED: transcription factor ILR3-like [Cucumis melo]
Length=238

 Score =   142 bits (357),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 104/213 (49%), Positives = 141/213 (66%), Gaps = 5/213 (2%)
 Frame = +1

Query  133  NWLLDLG-FEDIPLPGGKF-PPLEPGYQWHssailspappsiRQDESYVKFDVSNGCSAR  306
            NWL D    +D+ +   +F PP    + W + +I   +  S+  D SY   D +     R
Sbjct  9    NWLFDCSTMDDLAVVDPRFSPPQSISFSWSNPSISFVSKDSLEVDCSYEDLDSTKEV-GR  67

Query  307  KRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRMVLQ  486
            KR++ G  S A+ SKA REK RR +LN+RF EL+ V++PGKPPK DK AILSDA+RM+  
Sbjct  68   KRLR-GETSAASTSKACREKQRRDKLNERFLELAAVLEPGKPPKTDKVAILSDAIRMMTD  126

Query  487  LRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkalNSRPGFLPHP  666
            L+ E QKL+ES EDL+ ++ ELK EKNEL+DEKQ+L+ EK+KLELQ++A+N+R   + HP
Sbjct  127  LQCETQKLRESKEDLKAKIKELKVEKNELRDEKQRLRAEKEKLELQIRAVNTRAADVQHP  186

Query  667  PAT-AVPFPTPHHLVGGKLVPFVGYPGIPMWQF  762
            P T +  F       G KL+PF+GYPGI MWQF
Sbjct  187  PPTLSAAFTAQGQAAGNKLMPFIGYPGIAMWQF  219



>ref|XP_003596613.1| Transcription factor ILR3 [Medicago truncatula]
 gb|ACJ84355.1| unknown [Medicago truncatula]
 gb|AES66864.1| BHLH domain class transcription factor [Medicago truncatula]
 gb|AFK47306.1| unknown [Medicago truncatula]
Length=230

 Score =   141 bits (356),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 106/221 (48%), Positives = 140/221 (63%), Gaps = 12/221 (5%)
 Frame = +1

Query  106  MAAPEVDGSNWLLDLGF-EDIPLP-GGKFPPLEPGYQWHssailspappsiRQDESYVKF  279
            M +PE   +NWL D    ++IP+   G F      + W               D S V  
Sbjct  1    MVSPE--NTNWLFDYPLIDEIPVSVDGSF-----AFTW--PPPHLSNGGIEMDDSSLVDS  51

Query  280  DVSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAIL  459
            D      ++KR +S +C+ ++ SKA REK+RR RLND+F EL  +++PG+PPK DK+AIL
Sbjct  52   DGIKEPGSKKRGRSDSCAPSS-SKACREKLRRDRLNDKFVELGSILEPGRPPKTDKAAIL  110

Query  460  SDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkalN  639
             DAVRMV QLR EAQKLK+S   LQE++ ELK EKNEL+DEKQ+LK EK+KLE Q+K++N
Sbjct  111  IDAVRMVTQLRGEAQKLKDSNSGLQEKIKELKVEKNELRDEKQRLKAEKEKLEQQVKSMN  170

Query  640  SRPGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQF  762
            ++PGFL HPPA    F         KL+PF+ YPG+ MWQF
Sbjct  171  TQPGFLTHPPAIPAAFAHQGQAPSNKLMPFMSYPGVAMWQF  211



>ref|XP_009597422.1| PREDICTED: transcription factor ILR3-like [Nicotiana tomentosiformis]
Length=234

 Score =   140 bits (353),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 104/220 (47%), Positives = 139/220 (63%), Gaps = 6/220 (3%)
 Frame = +1

Query  106  MAAPEVDGSNWLLDLGFEDIPLPGG-KFPPLEPGYQWHssailspappsiRQDESYVKFD  282
            MA+PE   +NWL D  FED+ +     F     G+ W           S+  D S  + D
Sbjct  1    MASPET--TNWLYDYNFEDMAVSVDPNFSNSTSGFSWSMQPFNGSTNVSVDIDGSIGESD  58

Query  283  VSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILS  462
                  ++KR ++ +C+ ++ SKA REK+RR RLND+F EL  +++PG+ P+ DKSAIL 
Sbjct  59   CLKESGSKKRARAESCTSSS-SKACREKLRRERLNDKFLELGALLEPGRTPRTDKSAILV  117

Query  463  DAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkalNS  642
            DAVRMV QLR EA+KLK+S  +LQE++ ELKAEKNEL+DEKQ+LK EK+KLE QLK +N+
Sbjct  118  DAVRMVTQLRGEAEKLKDSNLNLQEKITELKAEKNELRDEKQRLKAEKEKLEQQLKTMNA  177

Query  643  RPGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQF  762
            +P F   PP        P    G KLVP + YPG+ MWQF
Sbjct  178  QPSFF--PPGIPAAIAAPGQAAGSKLVPIISYPGVAMWQF  215



>ref|XP_004151873.1| PREDICTED: transcription factor ILR3-like [Cucumis sativus]
 gb|KGN63279.1| hypothetical protein Csa_2G423590 [Cucumis sativus]
Length=238

 Score =   140 bits (353),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 104/213 (49%), Positives = 141/213 (66%), Gaps = 5/213 (2%)
 Frame = +1

Query  133  NWLLDLG-FEDIPLPGGKF-PPLEPGYQWHssailspappsiRQDESYVKFDVSNGCSAR  306
            NWL D    +D+ +   +F PP    + W + +I   +  S+  D SY   D +     R
Sbjct  9    NWLFDYSTVDDLAVVDPRFSPPQSISFSWSNPSINFLSKDSLEVDCSYEDLDSTKEV-GR  67

Query  307  KRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRMVLQ  486
            KR++ G  S A+ SKA REK RR +LN+RF EL+ V++PGKPPK DK AILSDA+RM+  
Sbjct  68   KRLR-GETSAASTSKACREKQRRDKLNERFLELAAVLEPGKPPKSDKVAILSDAIRMMTD  126

Query  487  LRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkalNSRPGFLPHP  666
            L+ E QKL+ES EDL+ ++ ELK EKNEL+DEKQ+L+ EK+KLELQ++A+N+R   + HP
Sbjct  127  LQCETQKLRESKEDLKAKIKELKVEKNELRDEKQRLRAEKEKLELQIRAVNTRAADVQHP  186

Query  667  PAT-AVPFPTPHHLVGGKLVPFVGYPGIPMWQF  762
            P T +  F       G KL+PF+GYPGI MWQF
Sbjct  187  PPTLSAAFTAQGQSAGNKLMPFIGYPGIAMWQF  219



>ref|XP_008454561.1| PREDICTED: transcription factor ILR3-like [Cucumis melo]
Length=235

 Score =   140 bits (352),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 111/222 (50%), Positives = 142/222 (64%), Gaps = 9/222 (4%)
 Frame = +1

Query  106  MAAPEVDGSNWLLDLGF-EDIPLPGGKFPPLEPGYQWHssailspappsiRQDESYVKFD  282
            M +PE    NWL D G  EDIP+P G FP     + W            +  D S    D
Sbjct  1    MVSPE--NPNWLFDYGLIEDIPVPDGNFPVTSSSFSWAIQTFNGAHDTGVEIDGSLADLD  58

Query  283  VSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILS  462
                  ++KR++S +CS ++ SKA REK+RR RLND+F EL  ++DPG+PPK DK+AIL 
Sbjct  59   GRLESGSKKRVRSDSCSASS-SKACREKLRRDRLNDKFLELGSILDPGRPPKTDKAAILV  117

Query  463  DAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkalNS  642
            DAVRMV QLR E QKLKES   LQE++ ELKAEKNEL+DEKQ+LK +K++LE Q+K++ +
Sbjct  118  DAVRMVNQLRSETQKLKESNSSLQEKIKELKAEKNELRDEKQRLKADKERLEQQVKSMPA  177

Query  643  -RPGFLPHPPATAVPFPTPHHLVGGKLVPFVGY-PGIPMWQF  762
             +PGFLP P  T   FP      G KL PF+GY P + MWQF
Sbjct  178  QQPGFLPPPIPT---FPAQGQAPGNKLFPFIGYHPSVAMWQF  216



>ref|XP_003607702.1| Transcription factor ILR3 [Medicago truncatula]
Length=261

 Score =   140 bits (353),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 107/239 (45%), Positives = 142/239 (59%), Gaps = 27/239 (11%)
 Frame = +1

Query  124  DGSNWLLDLGF-EDIPLPGGKFP--------PLEPGYQWHssailspappsiRQ------  258
            + +NW+ D GF +DIP+P   F         P +P +   S+        + +Q      
Sbjct  5    ENTNWINDYGFYDDIPVPDSTFALPSSAFTWPTQPPFNLSSNVRSGVRCSNFKQCNFPWT  64

Query  259  -----------DESYVKFDVSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQEL  405
                       D S    D      ++KR++S +C+ A  SKA REK+RR RLND+F EL
Sbjct  65   DAVDMRMGAEVDGSLGDSDGLKESGSKKRVRSESCA-ATSSKACREKLRRDRLNDKFIEL  123

Query  406  SCVMDPGKPPKMDKSAILSDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdek  585
              +++PG+P K DK+AIL DAVRMV QLR EAQKLK++   LQE++ ELK EKNEL+DEK
Sbjct  124  GSILEPGRPAKTDKAAILIDAVRMVTQLRGEAQKLKDANSGLQEKIKELKVEKNELRDEK  183

Query  586  qklkeekdklelqlkalNSRPGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQF  762
            Q+LK EK+KLE QLK++N+ P FLP P A    F       G KLVPF+ YPG+ MWQF
Sbjct  184  QRLKAEKEKLEQQLKSMNAPPSFLPTPTALPAAFAAQGQAHGNKLVPFISYPGVAMWQF  242



>ref|XP_010092311.1| hypothetical protein L484_021173 [Morus notabilis]
 gb|EXB50945.1| hypothetical protein L484_021173 [Morus notabilis]
Length=239

 Score =   139 bits (351),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 97/223 (43%), Positives = 133/223 (60%), Gaps = 7/223 (3%)
 Frame = +1

Query  106  MAAPEVDGSNWLLDLGF-EDIPLPGGKFPPLEPGYQWHssailspappsiRQDESYVKFD  282
            M +PE   +NWL D G  +DIP+P   F     G+ W    +   +  S   D S    +
Sbjct  1    MVSPE--NTNWLFDYGLIDDIPVPDANFSVSSSGFTWPVQPLNGSSAVSAEIDGSLGDSE  58

Query  283  VSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILS  462
                  ++KR++S   +GA+ SKA REK RR RLND+F EL  +++PG+PPK DK+AIL 
Sbjct  59   GPKESGSKKRVRS-ESNGASSSKACREKQRRDRLNDKFVELGSILEPGRPPKTDKAAILI  117

Query  463  DAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkal--  636
            DAVRMV QLR EAQKLK+S   LQE++ ELKA   + +   +K + + +K +L+L+    
Sbjct  118  DAVRMVNQLRGEAQKLKDSNLSLQEKIKELKARVEKNELRDEKQRLKGEKEKLELQLKGM  177

Query  637  NSRP-GFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQF  762
            N++P GFLP P A    F       G KLVPF+ YPG+ MWQF
Sbjct  178  NAQPAGFLPPPAAIPAAFAAQGQAPGNKLVPFISYPGVAMWQF  220



>gb|KGN57970.1| hypothetical protein Csa_3G416140 [Cucumis sativus]
Length=230

 Score =   138 bits (348),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 101/221 (46%), Positives = 129/221 (58%), Gaps = 12/221 (5%)
 Frame = +1

Query  106  MAAPEVDGSNWLLDLGF-EDIPLPGGKFPPLEPGYQWHssailspappsiRQDESYVKFD  282
            M +PE    NWL D G  EDIP+P G FP     + W            +  D S    D
Sbjct  1    MVSPE--NPNWLFDYGLIEDIPVPDGNFPVTSSSFSWPIQPFNGSHDSGVEIDGSLADLD  58

Query  283  VSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILS  462
                  ++KR++S +CS ++ SKA REK+RR RLND+F EL  ++DPG+PPK DK+AIL 
Sbjct  59   GRLESGSKKRVRSDSCSASS-SKACREKLRRDRLNDKFLELGSILDPGRPPKTDKAAILV  117

Query  463  DAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkalNS  642
            DAVRMV QLR E QKLKES   LQE++ ELKAEKNE +  K   +  + +++        
Sbjct  118  DAVRMVNQLRSETQKLKESNSSLQEKIKELKAEKNEKQRLKADKERLEQQVKSIPA---Q  174

Query  643  RPGFLPHPPATAVPFPTPHHLVGGKLVPFVGY-PGIPMWQF  762
            +PGFLP P  T   FP      G KLVPF+GY P + MWQF
Sbjct  175  QPGFLPPPIPT---FPA-QGQAGNKLVPFIGYHPSVAMWQF  211



>gb|AEI83428.1| bHLH transcription factor 1 [Camellia sinensis]
Length=235

 Score =   138 bits (348),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 106/221 (48%), Positives = 142/221 (64%), Gaps = 7/221 (3%)
 Frame = +1

Query  106  MAAPEVDGSNWLLDLGF-EDIPLPGGKFPPLEPGYQWHssailspappsiRQDESYVKFD  282
            M +PE   +NWL D G  EDI +P   F     G+ W  +A  S        D S+   D
Sbjct  1    MVSPE--HTNWLFDYGLIEDISVPDPNFSAPTSGFCWPLNASSSVGLEI---DGSFGDSD  55

Query  283  VSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILS  462
                  ++KR +  +C  ++ SKA REK+RR RLND+F EL  +++PG+PPK DK+AIL 
Sbjct  56   SRKETGSKKRPRPESCGASSSSKACREKLRRDRLNDKFVELGSILEPGRPPKTDKAAILV  115

Query  463  DAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkalNS  642
            +A+R+V+QLR +AQKLK+S   LQE++ ELKAEKNEL+DEKQ+LK EK++LE QLK +N 
Sbjct  116  EAIRLVIQLRGDAQKLKDSNLTLQEKIKELKAEKNELRDEKQRLKAEKERLEQQLKTVNV  175

Query  643  RPGFLPHPPATAVPFPTPHHLVGG-KLVPFVGYPGIPMWQF  762
            +PGF+P PPA            GG KLVP + YPG+ MWQF
Sbjct  176  QPGFMPPPPAIPATAFAAQGQAGGNKLVPIISYPGVAMWQF  216



>gb|KGN57965.1| hypothetical protein Csa_3G415100 [Cucumis sativus]
Length=235

 Score =   138 bits (348),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 111/222 (50%), Positives = 142/222 (64%), Gaps = 9/222 (4%)
 Frame = +1

Query  106  MAAPEVDGSNWLLDLGF-EDIPLPGGKFPPLEPGYQWHssailspappsiRQDESYVKFD  282
            M +PE    NWL D G  EDIP+P G FP     + W            +  D S    D
Sbjct  1    MVSPE--NPNWLFDYGLIEDIPVPDGNFPVTSSSFSWPIQPFNGSHDSGVEIDGSLADLD  58

Query  283  VSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILS  462
                  ++KR++S +CS ++ SKA REK+RR RLND+F EL  ++DPG+PPK DK+AIL 
Sbjct  59   GHLESGSKKRVRSDSCSASS-SKACREKLRRDRLNDKFLELGSILDPGRPPKTDKAAILV  117

Query  463  DAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkalNS  642
            DAVRMV QLR E QKLKES   LQE++ ELKAEKNEL+DEKQ+LK +K++LE Q+K++ +
Sbjct  118  DAVRMVNQLRSETQKLKESNSSLQEKIKELKAEKNELRDEKQRLKADKERLEQQVKSMPA  177

Query  643  -RPGFLPHPPATAVPFPTPHHLVGGKLVPFVGY-PGIPMWQF  762
             +PGFLP P  T   FP      G KL PF+GY P + MWQF
Sbjct  178  QQPGFLPPPIPT---FPAQGQAPGNKLFPFIGYHPSVAMWQF  216



>ref|XP_004151959.1| PREDICTED: transcription factor ILR3-like [Cucumis sativus]
Length=234

 Score =   137 bits (346),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 112/222 (50%), Positives = 143/222 (64%), Gaps = 10/222 (5%)
 Frame = +1

Query  106  MAAPEVDGSNWLLDLGF-EDIPLPGGKFPPLEPGYQWHssailspappsiRQDESYVKFD  282
            M +PE    NWL D G  EDIP+P G FP     + W            +  D S    D
Sbjct  1    MVSPE--NPNWLFDYGLIEDIPVPDGNFPVTSSSFSWPIQPFNGSHDSGVEIDGSLADLD  58

Query  283  VSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILS  462
                  ++KR++S +CS ++ SKA REK+RR RLND+F EL  ++DPG+PPK DK+AIL 
Sbjct  59   GRLESGSKKRVRSDSCSASS-SKACREKLRRDRLNDKFLELGSILDPGRPPKTDKAAILV  117

Query  463  DAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkalNS  642
            DAVRMV QLR E QKLKES   LQE++ ELKAEKNEL+DEKQ+LK +K++LE Q+K++ +
Sbjct  118  DAVRMVNQLRSETQKLKESNSSLQEKIKELKAEKNELRDEKQRLKADKERLEQQVKSIPA  177

Query  643  -RPGFLPHPPATAVPFPTPHHLVGGKLVPFVGY-PGIPMWQF  762
             +PGFLP P  T   FP      G KLVPF+GY P + MWQF
Sbjct  178  QQPGFLPPPIPT---FPA-QGQAGNKLVPFIGYHPSVAMWQF  215



>gb|KHG29871.1| Transcription factor ILR3 -like protein [Gossypium arboreum]
Length=237

 Score =   137 bits (345),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 103/205 (50%), Positives = 137/205 (67%), Gaps = 7/205 (3%)
 Frame = +1

Query  154  FEDIPLPGGKFPPLEPGYQWHssailspappsiRQ-DESYVKFDVSNGCSARKRMKSGAC  330
              DIP P G +     G+ W + AI + +       D S+   D      ++KR++S +C
Sbjct  19   INDIPAPDGPYS----GFSWPTQAINASSNVFSVDIDGSFEDSDGLKESGSKKRVRSESC  74

Query  331  SGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRMVLQLRDEAQKL  510
            +  + SKA REK+RR RLN++F EL+ +++P +PPK DK+AIL DAVRMV QLR EAQKL
Sbjct  75   N-VSSSKACREKLRRDRLNEKFMELTSILEPERPPKTDKAAILVDAVRMVTQLRGEAQKL  133

Query  511  KESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkalNSRPGFLPHPPATAVPFP  690
            K+S   L +++ ELKAEKNEL+DEKQ+LK EK+KLE QLKA+N++P F+P  PA    F 
Sbjct  134  KDSNSSLHDRIKELKAEKNELRDEKQRLKAEKEKLEQQLKAMNAQPSFMPPAPAFPTAFA  193

Query  691  TPHHLV-GGKLVPFVGYPGIPMWQF  762
            T    V G KLVPF GYPG+ MWQF
Sbjct  194  TAQGQVPGNKLVPFFGYPGVAMWQF  218



>gb|AES89899.2| BHLH domain class transcription factor [Medicago truncatula]
Length=193

 Score =   135 bits (341),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 90/154 (58%), Positives = 115/154 (75%), Gaps = 1/154 (1%)
 Frame = +1

Query  301  ARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRMV  480
            ++KR++S +C+ A  SKA REK+RR RLND+F EL  +++PG+P K DK+AIL DAVRMV
Sbjct  22   SKKRVRSESCA-ATSSKACREKLRRDRLNDKFIELGSILEPGRPAKTDKAAILIDAVRMV  80

Query  481  LQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkalNSRPGFLP  660
             QLR EAQKLK++   LQE++ ELK EKNEL+DEKQ+LK EK+KLE QLK++N+ P FLP
Sbjct  81   TQLRGEAQKLKDANSGLQEKIKELKVEKNELRDEKQRLKAEKEKLEQQLKSMNAPPSFLP  140

Query  661  HPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQF  762
             P A    F       G KLVPF+ YPG+ MWQF
Sbjct  141  TPTALPAAFAAQGQAHGNKLVPFISYPGVAMWQF  174



>ref|XP_004151962.1| PREDICTED: transcription factor ILR3-like [Cucumis sativus]
Length=235

 Score =   136 bits (343),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 110/222 (50%), Positives = 142/222 (64%), Gaps = 9/222 (4%)
 Frame = +1

Query  106  MAAPEVDGSNWLLDLGF-EDIPLPGGKFPPLEPGYQWHssailspappsiRQDESYVKFD  282
            M +PE    NWL D G  EDIP+P G FP     + W            +  D S    D
Sbjct  1    MVSPE--NPNWLFDYGLIEDIPVPDGNFPVTSSSFSWPIQPFNGSHDSGVEIDGSLADLD  58

Query  283  VSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILS  462
                  ++KR++S +CS ++ SKA REK+RR RLND+F EL  ++DPG+PPK DK+AIL 
Sbjct  59   GHLESGSKKRVRSDSCSASS-SKACREKLRRDRLNDKFLELGSILDPGRPPKTDKAAILV  117

Query  463  DAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkalNS  642
            DAVRMV QLR E +KLKES   LQE++ ELKAEKNEL+DEKQ+LK +K++LE Q+K++ +
Sbjct  118  DAVRMVNQLRGETEKLKESNSSLQEKIKELKAEKNELRDEKQRLKADKERLEQQVKSIPA  177

Query  643  -RPGFLPHPPATAVPFPTPHHLVGGKLVPFVGY-PGIPMWQF  762
             +PGFLP P  T   FP      G KL PF+GY P + MWQF
Sbjct  178  QQPGFLPPPIPT---FPAQGQAPGNKLFPFIGYHPSVAMWQF  216



>ref|XP_008776472.1| PREDICTED: transcription factor ILR3-like [Phoenix dactylifera]
Length=237

 Score =   136 bits (343),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 110/221 (50%), Positives = 141/221 (64%), Gaps = 5/221 (2%)
 Frame = +1

Query  106  MAAPEVDGSNWLLDLGF-EDIPLPGGKFPPLEPGYQWHssailspappsiRQDESYVKFD  282
            M +PE    NW LD    +D+P+P   F     G  W+          S+  + S    D
Sbjct  1    MGSPE--HPNWFLDCPLIDDMPVPETDFAAPTGGLNWNPQGFNPYPDVSVEINGSIANSD  58

Query  283  VSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILS  462
                  ++KRM+S +CSG + SKA REKMRR RLN+RF +LS ++DPGKPPKMDK+ IL+
Sbjct  59   GHKEPGSQKRMRSESCSGPS-SKACREKMRRDRLNERFLDLSSILDPGKPPKMDKATILN  117

Query  463  DAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkalNS  642
            DAV MV QLR EAQKLKES E LQ+++NELKAEK+EL+DEKQ+LK EK+ LE QLK LN 
Sbjct  118  DAVHMVTQLRTEAQKLKESNESLQDKINELKAEKSELRDEKQRLKAEKESLEQQLKLLNP  177

Query  643  RPGFLPHPPATAVPFPTPHHLVGGKL-VPFVGYPGIPMWQF  762
            +P ++P PP     F       G KL +P + +PG PMWQF
Sbjct  178  QPSYVPPPPVMPAAFSAQGQPTGQKLMMPVISFPGFPMWQF  218



>ref|XP_004173321.1| PREDICTED: transcription factor ILR3-like [Cucumis sativus]
Length=235

 Score =   136 bits (343),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 110/222 (50%), Positives = 142/222 (64%), Gaps = 9/222 (4%)
 Frame = +1

Query  106  MAAPEVDGSNWLLDLGF-EDIPLPGGKFPPLEPGYQWHssailspappsiRQDESYVKFD  282
            M +PE    NWL D G  EDIP+P G FP     + W            +  D S    D
Sbjct  1    MVSPE--NPNWLFDYGLIEDIPVPDGNFPVASSSFSWPIQPFNGAHDSGVEIDGSLADLD  58

Query  283  VSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILS  462
                  ++KR++S +CS ++ SKA REK+RR RLND+F EL  ++DPG+PPK DK+AIL 
Sbjct  59   GRLESGSKKRVRSDSCSASS-SKACREKLRRDRLNDKFLELGSILDPGRPPKTDKAAILV  117

Query  463  DAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkalNS  642
            DAVRMV QLR E +KLKES   LQE++ ELKAEKNEL+DEKQ+LK +K++LE Q+K++ +
Sbjct  118  DAVRMVNQLRGETEKLKESNSSLQEKIKELKAEKNELRDEKQRLKADKERLEQQVKSMPA  177

Query  643  -RPGFLPHPPATAVPFPTPHHLVGGKLVPFVGY-PGIPMWQF  762
             +PGFLP P  T   FP      G KL PF+GY P + MWQF
Sbjct  178  QQPGFLPPPIPT---FPAQGQAPGNKLFPFIGYHPSVAMWQF  216



>ref|XP_006475303.1| PREDICTED: transcription factor ILR3-like [Citrus sinensis]
 gb|KDO46376.1| hypothetical protein CISIN_1g026599mg [Citrus sinensis]
Length=236

 Score =   136 bits (343),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 111/222 (50%), Positives = 149/222 (67%), Gaps = 8/222 (4%)
 Frame = +1

Query  106  MAAPEVDGSNWLLDLGF-EDIPLPGGKFPPLEPGYQWHssailspappsiRQDESYVKFD  282
            M +PE   +NWLLD    +DI +P G F     G+ W     ++       + +S   F 
Sbjct  1    MVSPE--NTNWLLDYPLIDDITVPDGNFSVSASGFTWTVQPPINGPSNGCVEIDSA--FG  56

Query  283  VSNGC--SARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAI  456
             SNG   S++KR++S +C  ++ SKA REK+RR RLND+F EL+ +++PG+PPK DK+AI
Sbjct  57   DSNGLKESSKKRVRSESCGSSS-SKACREKLRRDRLNDKFVELASILEPGRPPKTDKAAI  115

Query  457  LSDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkal  636
            L DAVRMV QLR EAQKLK+S   LQE++ ELKAEKNEL+DEKQ+LK EK+K+E QLKA+
Sbjct  116  LIDAVRMVTQLRSEAQKLKDSNSSLQEKIKELKAEKNELRDEKQRLKAEKEKIEQQLKAM  175

Query  637  NSRPGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQF  762
            +++P FL  PPA    F       G KL+PF+ YPG+ MWQF
Sbjct  176  STQPSFLTPPPAIPAAFAAQGQAPGNKLMPFISYPGVAMWQF  217



>ref|XP_004156771.1| PREDICTED: LOW QUALITY PROTEIN: transcription factor ILR3-like 
[Cucumis sativus]
Length=227

 Score =   136 bits (342),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 98/193 (51%), Positives = 131/193 (68%), Gaps = 3/193 (2%)
 Frame = +1

Query  187  PPLEPGYQWHssailspappsiRQDESYVKFDVSNGCSARKRMKSGACSGAADSKAQREK  366
            PP    + W + +I   +  S+  D SY   D +     RKR++ G  S A+ SKA REK
Sbjct  18   PPQSISFSWSNPSINFLSKDSLEVDCSYEDLDSTKEV-GRKRLR-GETSAASTSKACREK  75

Query  367  MRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRMVLQLRDEAQKLKESFEDLQEQVN  546
             RR +LN+RF EL+ V++PGKPPK DK AILSDA+RM+  L+ E QKL+ES EDL+ ++ 
Sbjct  76   QRRDKLNERFLELAAVLEPGKPPKSDKVAILSDAIRMMTDLQCETQKLRESKEDLKAKIK  135

Query  547  ELKAeknelkdekqklkeekdklelqlkalNSRPGFLPHPPAT-AVPFPTPHHLVGGKLV  723
            ELK EKNEL+DEKQ+L+ EK+KLELQ++A+N+R   + HPP T +  F       G KL+
Sbjct  136  ELKVEKNELRDEKQRLRAEKEKLELQIRAVNTRAADVQHPPXTLSAAFTAQGQSAGNKLM  195

Query  724  PFVGYPGIPMWQF  762
            PF+GYPGI MWQF
Sbjct  196  PFIGYPGIAMWQF  208



>gb|KJB12415.1| hypothetical protein B456_002G016500 [Gossypium raimondii]
Length=231

 Score =   135 bits (341),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 90/168 (54%), Positives = 120/168 (71%), Gaps = 1/168 (1%)
 Frame = +1

Query  259  DESYVKFDVSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPK  438
            D S+   D      +RKR+KS +C G+  SKA REK+RR RLNDRF EL  V++P +P K
Sbjct  46   DCSFADSDCLKDVVSRKRLKSESCGGSG-SKAWREKLRRDRLNDRFLELGAVLEPERPMK  104

Query  439  MDKSAILSDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdkle  618
             DK AILSDAVRMV QLR EAQ+LK+S E+LQ ++ ELK EKNEL+DEKQ+LK +K++LE
Sbjct  105  ADKVAILSDAVRMVRQLRSEAQRLKDSNEELQAKIKELKEEKNELRDEKQRLKADKEQLE  164

Query  619  lqlkalNSRPGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQF  762
             Q+KA++++PGFL  PP+ +          G KL+P +G+P + MWQF
Sbjct  165  QQVKAMSAQPGFLTQPPSISAALAAQRQAAGNKLMPVIGFPSLAMWQF  212



>gb|KJB81834.1| hypothetical protein B456_013G164100 [Gossypium raimondii]
Length=239

 Score =   135 bits (341),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 103/207 (50%), Positives = 138/207 (67%), Gaps = 9/207 (4%)
 Frame = +1

Query  154  FEDIPLPGGKFPPLEPGYQWHssailspappsiRQ-DESYVKFDVSNGCSARKRMKSGAC  330
             +DIP+P G +     G+ W +    +P+     + D S+   D      ++KR +S +C
Sbjct  19   IDDIPVPDGPYT----GFSWSTQPTNAPSTAVNVEVDNSFGDLDGLTESGSKKRGRSESC  74

Query  331  SGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRMVLQLRDEAQKL  510
            + ++ SKA REK+RR RLND+F EL  +++PG+PPK DKSAIL DAVRMV QLRDEAQK+
Sbjct  75   NPSS-SKACREKLRRDRLNDKFMELGAILEPGRPPKTDKSAILVDAVRMVTQLRDEAQKM  133

Query  511  KESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkalNSRPGFLPHPPATAVPFP  690
            K+S   LQE++ ELKAEKNEL++EKQ+LK EK+KLE QLK +N++P F+P  PA    F 
Sbjct  134  KDSNSSLQERIKELKAEKNELREEKQRLKAEKEKLEQQLKTMNAQPSFMPPAPAIPSAFA  193

Query  691  TPH---HLVGGKLVPFVGYPGIPMWQF  762
                     G KLVPF GYPG+ MWQF
Sbjct  194  AAAAQGQAHGNKLVPFFGYPGVAMWQF  220



>ref|XP_008454558.1| PREDICTED: transcription factor ILR3-like isoform X1 [Cucumis 
melo]
Length=234

 Score =   135 bits (341),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 110/222 (50%), Positives = 140/222 (63%), Gaps = 10/222 (5%)
 Frame = +1

Query  106  MAAPEVDGSNWLLDLGF-EDIPLPGGKFPPLEPGYQWHssailspappsiRQDESYVKFD  282
            M +PE    NWL D G  EDIP+P G FP     + W            +  D S    D
Sbjct  1    MVSPE--NPNWLFDYGLIEDIPVPDGNFPVTSSSFTWAIQPFNGAHDTGVEIDGSLADVD  58

Query  283  VSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILS  462
                  ++KR++S +CS ++ SKA REK+RR RLND+F EL  ++DPG+PPK DK+AIL 
Sbjct  59   GRLESGSKKRVRSDSCSASS-SKACREKLRRDRLNDKFLELGSILDPGRPPKTDKAAILV  117

Query  463  DAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkalNS  642
            DAVRMV QLR E  KLKES   LQE++ ELKAEKNEL+DEKQ+LK +K++LE Q+K++ +
Sbjct  118  DAVRMVNQLRSETHKLKESNSSLQEKIKELKAEKNELRDEKQRLKADKERLEQQVKSMPA  177

Query  643  -RPGFLPHPPATAVPFPTPHHLVGGKLVPFVGY-PGIPMWQF  762
             +PGFLP  P     FP      G KL PFVGY P + MWQF
Sbjct  178  QQPGFLPPIPT----FPAQGQAPGNKLFPFVGYHPSVAMWQF  215



>ref|XP_004487616.1| PREDICTED: transcription factor ILR3-like [Cicer arietinum]
Length=228

 Score =   135 bits (340),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 107/225 (48%), Positives = 141/225 (63%), Gaps = 20/225 (9%)
 Frame = +1

Query  106  MAAPEVDGSNWLLDLGF-EDIPLPGGKF----PPLEPGYQWHssailspappsiRQDESY  270
            M +PE   +NWL D    +DIP+P G F    PP +P                +  D S 
Sbjct  1    MVSPE--NTNWLFDYALMDDIPVPDGSFNFTWPPPDPS------------NVGVEIDGSL  46

Query  271  VKFDVSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKS  450
               D      ++KR +S +C+ ++ SKA REK+RR RLND+F EL  +++PG+PPK DK+
Sbjct  47   GDSDGIKDPGSKKRGRSDSCAPSS-SKACREKLRRDRLNDKFVELGSILEPGRPPKTDKA  105

Query  451  AILSDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlk  630
            AIL DAVRMV QLR EAQKLK S   LQE++ ELK EKNEL+DEKQ+LK +K+KLE Q+K
Sbjct  106  AILIDAVRMVTQLRGEAQKLKASNSSLQEKIKELKVEKNELRDEKQRLKADKEKLEQQVK  165

Query  631  alNSRPGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQFA  765
            ++N++PGFL  PPA    F         KL+PF+ YPG+ MWQF 
Sbjct  166  SMNTQPGFLTPPPAIPAAFAPQGQAPSNKLMPFISYPGVAMWQFV  210



>emb|CAN70830.1| hypothetical protein VITISV_005283 [Vitis vinifera]
Length=384

 Score =   139 bits (349),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 109/222 (49%), Positives = 136/222 (61%), Gaps = 30/222 (14%)
 Frame = +1

Query  106  MAAPEVDGSNWLLDLGF-EDIPLPGGKFPPLEP--GYQWHssailspappsiRQDESYVK  276
            MA    + SNWL D G  EDI +PGG+FP   P  G+ W S A+ S +  S+  D S+  
Sbjct  1    MALDSSENSNWLFDYGLMEDITVPGGEFPEPTPGTGFSWPSQALKSSSSVSLEADCSF--  58

Query  277  FDVSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAI  456
                                  DS   +E   R     RF EL  +++PG+PPK DK+AI
Sbjct  59   ---------------------GDSDGLKELGPRK----RFLELGSILEPGRPPKTDKAAI  93

Query  457  LSDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkal  636
            LSDAVRMV QLR EAQKLKES  DLQE++ ELKAEKNEL+DEKQ+LK EK+KLE Q+KA+
Sbjct  94   LSDAVRMVTQLRSEAQKLKESNGDLQEKIKELKAEKNELRDEKQRLKAEKEKLEQQVKAI  153

Query  637  NSRPGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQF  762
            +++PGFLPHP A    F       G KL+PF+GYP + MWQF
Sbjct  154  SAQPGFLPHPSAMPAAFAAQGRAPGNKLMPFIGYPSVAMWQF  195



>ref|XP_010443048.1| PREDICTED: transcription factor ILR3 [Camelina sativa]
Length=234

 Score =   135 bits (340),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 109/227 (48%), Positives = 135/227 (59%), Gaps = 20/227 (9%)
 Frame = +1

Query  106  MAAPEVDGSNWLLDLGFEDIPLPGGKFPPLEPGYQWHssailspappsiRQDESYVKFDV  285
            M +PE   +NW+ DL   D     G F    PG+ W     +  +        S V  DV
Sbjct  1    MVSPE--NANWICDLIDADY----GSFTIQGPGFSWPVQQPIGVSS------NSSVGVDV  48

Query  286  SNGCSARKR----MKSGAC--SGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDK  447
            S G S   +     K G C  S A  SKA REK RR RLND+F EL  +++PG PPK DK
Sbjct  49   SAGNSEANKEPGSKKRGRCESSSATSSKACREKQRRDRLNDKFVELGTILEPGNPPKTDK  108

Query  448  SAILSDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelql  627
            +AIL DAVRMV QLR EAQKLK+S   LQ+++ ELK EKNEL+DEKQ+LK EK+KLE QL
Sbjct  109  AAILVDAVRMVTQLRGEAQKLKDSNSSLQDKIKELKTEKNELRDEKQRLKTEKEKLEQQL  168

Query  628  kalNS-RPGFLPHPPATAVPFPTPH-HLVGGKLVPFVGYPGIPMWQF  762
            KA+N+ +P F P PP     F +      G K+VP + YPG+ MWQF
Sbjct  169  KAMNAPQPSFFPAPPMMPTAFASAQGQAPGNKMVPIISYPGVAMWQF  215



>dbj|BAK03093.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ99935.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=240

 Score =   135 bits (340),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 111/232 (48%), Positives = 140/232 (60%), Gaps = 24/232 (10%)
 Frame = +1

Query  106  MAAPEVDG-SNWLLDLG-FEDIPLPG-GKFPPLEPGYQWHssailspappsiRQDESYVK  276
            M+ P  DG  +W LD G  ED+P    G FP       W +S   S     +    SYV 
Sbjct  1    MSLPPTDGGDDWFLDCGILEDLPAAACGAFP-------WDASVSSSNPSAEVG---SYVN  50

Query  277  -FDVSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSA  453
              DV    S+ KR++SG C G   SKA REK+RR +LNDRF EL   +DPGKP K DK+A
Sbjct  51   NSDVPKDSSSNKRLRSGPC-GRPTSKACREKVRRDKLNDRFLELGTTLDPGKPVKADKAA  109

Query  454  ILSDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlka  633
            ILSDA RMV QLR EA++LK++   L++++ ELKAEK+EL+DEKQKLK EK+ LE Q+K 
Sbjct  110  ILSDATRMVTQLRAEAKQLKDTNGSLEDKIKELKAEKDELRDEKQKLKLEKETLEHQMKL  169

Query  634  lNSRPGFLPHPPATAVPFP----TPHHLVGGK-----LVPFVGYPGIPMWQF  762
            L + P ++PHP     PF      P H  G       ++PFVGYPG PMWQ 
Sbjct  170  LTATPAYMPHPTMMHSPFAQAPMAPFHAQGHASAQKLMMPFVGYPGYPMWQL  221



>gb|AHZ94970.1| helix-loop-helix-like protein, partial [Lilium regale]
Length=169

 Score =   133 bits (334),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 91/153 (59%), Positives = 113/153 (74%), Gaps = 5/153 (3%)
 Frame = +1

Query  310  RMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRMVLQL  489
            R +SG   G   SKA REKMRR +LNDRF EL  ++DPGKPPKMDK+AILSDA  MV QL
Sbjct  1    RSESGNVPG---SKACREKMRRDKLNDRFMELGSILDPGKPPKMDKAAILSDAALMVTQL  57

Query  490  RDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkalNSRPGFLPHPP  669
            R EAQKLK+S E LQE++ ELK+EK+EL+DEKQ+LK+EK+ LE Q+K L++RP ++PHPP
Sbjct  58   RSEAQKLKDSNESLQEKIKELKSEKSELRDEKQRLKQEKENLEQQVKMLSARPSYMPHPP  117

Query  670  AT-AVPFPTPHHLVGGK-LVPFVGYPGIPMWQF  762
               A  F       G K ++P + YPG PMWQF
Sbjct  118  VLPAAAFAAQGQPAGHKMMMPVISYPGFPMWQF  150



>ref|XP_003547112.1| PREDICTED: transcription factor ILR3-like [Glycine max]
Length=212

 Score =   134 bits (337),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 109/213 (51%), Positives = 138/213 (65%), Gaps = 23/213 (11%)
 Frame = +1

Query  127  GSNWLLDLGFED-IPLPGGKFPPLEPGYQWHssailspappsiRQDESYVKFDVSNGCSA  303
             SNW+LD  + D IPL       LEP      S+   P   S+  D+S+   D      +
Sbjct  3    NSNWVLDYDYLDNIPLT-----TLEPPNF-SWSSSSPPPTLSVELDDSFGILDGLKENRS  56

Query  304  RKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRMVL  483
            RKR++       +DSKA REKMRR RLNDRF EL  ++DP KP KMDK+ ILSDAVR+V 
Sbjct  57   RKRLR------PSDSKACREKMRRDRLNDRFMELGSILDPRKPLKMDKAVILSDAVRVVS  110

Query  484  QLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkalNSRPGFLPH  663
            QLR+EAQKL+ES E+LQE++N LK EKNEL+DEKQ+LK EK+ LE ++KAL+S+P FL  
Sbjct  111  QLREEAQKLRESTENLQEKINALKDEKNELRDEKQRLKVEKENLEQKVKALSSQPSFL--  168

Query  664  PPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQF  762
                         +VG KLVPF+GYPG+ MWQF
Sbjct  169  --------AAAGQVVGSKLVPFMGYPGVAMWQF  193



>ref|XP_006659812.1| PREDICTED: transcription factor ILR3-like [Oryza brachyantha]
Length=246

 Score =   135 bits (339),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 106/226 (47%), Positives = 139/226 (62%), Gaps = 25/226 (11%)
 Frame = +1

Query  127  GSNWLLDLG-FEDIPLPG-GKFPPLEPGYQWHssailspappsiRQDESYVKF-DVSNGC  297
            G  W LD G  ED+P    G FP       W +S   S       +  S+V   D     
Sbjct  13   GDEWFLDCGILEDLPAAACGAFP-------WDASPSCSNPSV---EVSSFVNTSDALKEP  62

Query  298  SARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRM  477
             + KR++SG+C G   SKA REK+RR ++NDRF EL   ++PGKP K DK+AILSDA RM
Sbjct  63   GSNKRVRSGSC-GRPTSKACREKIRRDKMNDRFLELGTTLEPGKPVKSDKAAILSDATRM  121

Query  478  VLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkalNSRPGFL  657
            V+QLR EA++LK++ E L++++ ELKAEK+EL+DEKQKLK EK+ LE Q+K + S P ++
Sbjct  122  VIQLRAEAKQLKDTNESLEDKIKELKAEKDELRDEKQKLKVEKETLEQQMKIMTSTPAYM  181

Query  658  PHPPATAVPFP----TPHHLVGGK-------LVPFVGYPGIPMWQF  762
            PHP     PFP     P H   G+       ++PFVGYPG PMWQF
Sbjct  182  PHPTLMPAPFPQAPLAPFHPAQGQQAAGQKLMMPFVGYPGYPMWQF  227



>ref|XP_010482878.1| PREDICTED: transcription factor ILR3-like [Camelina sativa]
Length=235

 Score =   135 bits (339),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 108/227 (48%), Positives = 132/227 (58%), Gaps = 19/227 (8%)
 Frame = +1

Query  106  MAAPEVDGSNWLLDLGFEDIPLPGGKFPPLEPGYQWHssailspappsiRQDESYVKFDV  285
            M +PE   +NW+ DL   D     G F    PG+ W                 S    DV
Sbjct  1    MVSPE--NANWICDLIDADY----GSFTIQGPGFSWPVQQQPIGVS-----SNSSAGVDV  49

Query  286  SNGCSARKR----MKSGAC--SGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDK  447
            S G S   +     K G C  S A  SKA REK RR RLND+F EL  +++PG PPK DK
Sbjct  50   SAGNSEASKEPGSKKRGRCESSSATSSKACREKQRRDRLNDKFVELGTILEPGNPPKTDK  109

Query  448  SAILSDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelql  627
            +AIL DAVRMV QLR EAQKLK+S   LQ+++ ELK EKNEL+DEKQ+LK EK+KLE QL
Sbjct  110  AAILVDAVRMVTQLRGEAQKLKDSNSSLQDKIKELKTEKNELRDEKQRLKTEKEKLEQQL  169

Query  628  kalNS-RPGFLPHPPATAVPFPTPH-HLVGGKLVPFVGYPGIPMWQF  762
            KA+N+ +P F P PP     F +      G K+VP + YPG+ MWQF
Sbjct  170  KAMNAPQPSFFPAPPMMTTAFASAQGQAPGNKMVPIISYPGVAMWQF  216



>gb|EAZ41459.1| hypothetical protein OsJ_25981 [Oryza sativa Japonica Group]
Length=253

 Score =   135 bits (339),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 105/224 (47%), Positives = 140/224 (63%), Gaps = 25/224 (11%)
 Frame = +1

Query  133  NWLLDLG-FEDIPLPG-GKFPPLEPGYQWHssailspappsiRQDESYVKFD--VSNGCS  300
            +W LD G  ED+P    G FP       W++S   S       +  SYV     V     
Sbjct  22   DWFLDCGILEDLPAAACGAFP-------WNASPSCSNPSV---EVSSYVNTTSYVLKEPG  71

Query  301  ARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRMV  480
            + KR++SG+C G   SKA REK+RR ++NDRF EL   ++PGKP K DK+AILSDA RMV
Sbjct  72   SNKRVRSGSC-GRPTSKASREKIRRDKMNDRFLELGTTLEPGKPVKSDKAAILSDATRMV  130

Query  481  LQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkalNSRPGFLP  660
            +QLR EA++LK++ E L++++ ELKAEK+EL+DEKQKLK EK+ LE Q+K L + P ++P
Sbjct  131  IQLRAEAKQLKDTNESLEDKIKELKAEKDELRDEKQKLKVEKETLEQQVKILTATPAYMP  190

Query  661  HPPATAVPFP----TPHHLVGGK------LVPFVGYPGIPMWQF  762
            HP     P+P     P H   G+      ++PFVGYPG PMWQF
Sbjct  191  HPTLMPAPYPQAPLAPFHHAQGQAAGQKLMMPFVGYPGYPMWQF  234



>ref|XP_006401546.1| hypothetical protein EUTSA_v10014564mg [Eutrema salsugineum]
 dbj|BAJ33812.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ42999.1| hypothetical protein EUTSA_v10014564mg [Eutrema salsugineum]
Length=234

 Score =   134 bits (337),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 107/227 (47%), Positives = 134/227 (59%), Gaps = 20/227 (9%)
 Frame = +1

Query  106  MAAPEVDGSNWLLDLGFEDIPLPGGKFPPLEPGYQWHssailspappsiRQDESYVKFDV  285
            M +PE   +NW+ DL   D     G F    PG+ W     +  +        S    DV
Sbjct  1    MVSPE--NANWICDLIDADY----GSFTIQGPGFSWPVQQPIGVS------SNSSAGVDV  48

Query  286  SNGCSARKR----MKSGAC--SGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDK  447
            S G S   +     K G C  S A  SKA REK+RR RLND+F EL  +++PG PPK DK
Sbjct  49   SAGNSEASKEPGSKKRGRCESSSATGSKACREKLRRDRLNDKFTELGAILEPGNPPKTDK  108

Query  448  SAILSDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelql  627
            +AIL DAVRMV QLR EAQKLK+S   LQ+++ ELK EKNEL+DEKQ+LK EK+KLE QL
Sbjct  109  AAILVDAVRMVAQLRGEAQKLKDSNSSLQDKIKELKTEKNELRDEKQRLKTEKEKLEQQL  168

Query  628  kalNS-RPGFLPHPPATAVPFPTPH-HLVGGKLVPFVGYPGIPMWQF  762
            K +N+ +P F P PP     F +      G K+VP + YPG+ MWQF
Sbjct  169  KTMNAPQPSFFPAPPMMPTAFASAQGQAPGNKMVPIISYPGVAMWQF  215



>ref|XP_009127072.1| PREDICTED: transcription factor ILR3 [Brassica rapa]
Length=235

 Score =   134 bits (337),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 109/223 (49%), Positives = 138/223 (62%), Gaps = 11/223 (5%)
 Frame = +1

Query  106  MAAPEVDGSNWLLDLGFEDIPLPGGKFPPLEPGYQWHssa-ilspappsiRQDESYVKFD  282
            M +PE   +NW+ DL   D     G F    PG+ W     +   +  S   D S    +
Sbjct  1    MVSPE--NANWISDLIDADY----GGFTIQGPGFSWPVHQPLAVSSNSSAGVDGSAGNSE  54

Query  283  VSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILS  462
             S    ++KR +  + S A  SKA REK RR RLND+F ELS +++PG PPK DK+AIL 
Sbjct  55   ASKEPGSKKRARCESSS-ATSSKACREKQRRDRLNDKFMELSVILEPGNPPKTDKAAILV  113

Query  463  DAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkalNS  642
            DAVRMV QLR EAQKLK++   LQE++ ELK EKNEL+DEKQ+LK EK+KLE QLKA+N+
Sbjct  114  DAVRMVTQLRGEAQKLKDTNSGLQEKIKELKTEKNELRDEKQRLKTEKEKLEQQLKAMNA  173

Query  643  -RPGFLPHPPA--TAVPFPTPHHLVGGKLVPFVGYPGIPMWQF  762
             +P F P PP   TA    T     G K+VPF+ YPG+ MWQF
Sbjct  174  PQPSFFPAPPMMPTAFASATQGQAPGNKMVPFISYPGVAMWQF  216



>ref|XP_004294336.1| PREDICTED: transcription factor ILR3-like [Fragaria vesca subsp. 
vesca]
Length=231

 Score =   134 bits (336),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 105/219 (48%), Positives = 137/219 (63%), Gaps = 7/219 (3%)
 Frame = +1

Query  106  MAAPEVDGSNWLLDLGFEDIPLPGGKFPPLEPGYQWHssailspappsiRQDESYVKFDV  285
            M +PE   +NWL D G  D       FP     + W    +   +  S+  D S    + 
Sbjct  1    MVSPE--NTNWLYDYGLID----DANFPVSSSAFNWPVQPLPGSSSVSVELDGSLGDVEG  54

Query  286  SNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSD  465
                 ++KR++  + S A  SKA REK+RR RLND+F EL  +++PG+PPK DK+AIL D
Sbjct  55   LKESGSKKRVRCESSS-ATSSKACREKLRRDRLNDKFLELGSILEPGRPPKTDKAAILID  113

Query  466  AVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkalNSR  645
            AVRMV QLR EAQKLK+S   LQE++ ELK EK EL+DEKQ+LK EK+KLE QLKA+ ++
Sbjct  114  AVRMVNQLRGEAQKLKDSNSSLQEKIKELKTEKTELRDEKQRLKSEKEKLEQQLKAMTAQ  173

Query  646  PGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQF  762
            P F+P PPA    F       G K+VPF+GYPG+ MWQF
Sbjct  174  PSFMPAPPAIPAAFAAQGQAHGNKMVPFIGYPGVAMWQF  212



>ref|XP_007149945.1| hypothetical protein PHAVU_005G112500g [Phaseolus vulgaris]
 gb|ESW21939.1| hypothetical protein PHAVU_005G112500g [Phaseolus vulgaris]
Length=233

 Score =   134 bits (336),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 106/217 (49%), Positives = 136/217 (63%), Gaps = 16/217 (7%)
 Frame = +1

Query  127  GSNWLLDLGFEDIPLPGGKFPPLEP--GYQWHssailspappsiRQDESYV--KFDVSNG  294
             S WL D GF DIP+ G  F       G+ W        AP +   D  Y      + NG
Sbjct  9    ASGWLYDYGF-DIPVAGADFMAAADSGGFSWGPQNHTLKAPSNTSLDMEYSLDSTVLENG  67

Query  295  CSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVR  474
             S  KR+++ +C+  A  KA REK+RR +LN+RF ELS +++PG+PPK DK AILSDAVR
Sbjct  68   PS--KRLRTESCASGA--KACREKLRRDKLNERFLELSSILEPGRPPKTDKVAILSDAVR  123

Query  475  MVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkalNS-RPG  651
             V+QLR+EA++LKE  ++LQ +V ELKAEKNEL+DEK  LKEEK+KLE Q+K  N  +  
Sbjct  124  AVVQLRNEAERLKEMNDELQGKVKELKAEKNELRDEKNMLKEEKEKLEQQVKLTNVMQHS  183

Query  652  FLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQF  762
            FLP  PA          +   KL+PF+GYPGI MWQF
Sbjct  184  FLPQAPAAK------EQVGSHKLIPFIGYPGIAMWQF  214



>ref|XP_010448513.1| PREDICTED: transcription factor ILR3-like [Camelina sativa]
Length=235

 Score =   134 bits (336),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 108/227 (48%), Positives = 132/227 (58%), Gaps = 19/227 (8%)
 Frame = +1

Query  106  MAAPEVDGSNWLLDLGFEDIPLPGGKFPPLEPGYQWHssailspappsiRQDESYVKFDV  285
            M +PE   +NW+ DL   D     G F    PG+ W                 S    DV
Sbjct  1    MVSPE--NANWICDLIDADY----GSFTIQGPGFSWPVQQQPIGVS-----SNSSAGVDV  49

Query  286  SNGCSARKR----MKSGAC--SGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDK  447
            S G S   +     K G C  S A  SKA REK RR RLND+F EL  +++PG PPK DK
Sbjct  50   SAGNSEASKEPGSKKRGRCESSSATSSKACREKQRRDRLNDKFVELGTILEPGNPPKTDK  109

Query  448  SAILSDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelql  627
            +AIL DAVRMV QLR EAQKLK+S   LQ+++ ELK EKNEL+DEKQ+LK EK+KLE QL
Sbjct  110  AAILVDAVRMVTQLRGEAQKLKDSNSSLQDKIKELKTEKNELRDEKQRLKTEKEKLEQQL  169

Query  628  kalNS-RPGFLPHPPATAVPFPTPH-HLVGGKLVPFVGYPGIPMWQF  762
            KA+N+ +P F P PP     F +      G K+VP + YPG+ MWQF
Sbjct  170  KAMNAPQPSFFPAPPMMPTAFASAQGQAPGNKMVPIISYPGVAMWQF  216



>ref|NP_001060960.1| Os08g0138500 [Oryza sativa Japonica Group]
 dbj|BAD03011.1| helix-loop-helix-like protein [Oryza sativa Japonica Group]
 dbj|BAF22874.1| Os08g0138500 [Oryza sativa Japonica Group]
 dbj|BAG95797.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|ADX60264.1| bHLH transcription factor [Oryza sativa Japonica Group]
Length=253

 Score =   134 bits (337),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 105/224 (47%), Positives = 139/224 (62%), Gaps = 25/224 (11%)
 Frame = +1

Query  133  NWLLDLG-FEDIPLPG-GKFPPLEPGYQWHssailspappsiRQDESYVKFD--VSNGCS  300
            +W LD G  ED+P    G FP       W +S   S       +  SYV     V     
Sbjct  22   DWFLDCGILEDLPAAACGAFP-------WDASPSCSNPSV---EVSSYVNTTSYVLKEPG  71

Query  301  ARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRMV  480
            + KR++SG+C G   SKA REK+RR ++NDRF EL   ++PGKP K DK+AILSDA RMV
Sbjct  72   SNKRVRSGSC-GRPTSKASREKIRRDKMNDRFLELGTTLEPGKPVKSDKAAILSDATRMV  130

Query  481  LQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkalNSRPGFLP  660
            +QLR EA++LK++ E L++++ ELKAEK+EL+DEKQKLK EK+ LE Q+K L + P ++P
Sbjct  131  IQLRAEAKQLKDTNESLEDKIKELKAEKDELRDEKQKLKVEKETLEQQVKILTATPAYMP  190

Query  661  HPPATAVPFP----TPHHLVGGK------LVPFVGYPGIPMWQF  762
            HP     P+P     P H   G+      ++PFVGYPG PMWQF
Sbjct  191  HPTLMPAPYPQAPLAPFHHAQGQAAGQKLMMPFVGYPGYPMWQF  234



>ref|XP_010694263.1| PREDICTED: transcription factor ILR3 [Beta vulgaris subsp. vulgaris]
Length=240

 Score =   133 bits (335),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 94/155 (61%), Positives = 119/155 (77%), Gaps = 1/155 (1%)
 Frame = +1

Query  298  SARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRM  477
            +++KR +S +C+ ++ SKA REK RR RLND+F EL  +++PG+ PK DK+AIL DAVRM
Sbjct  68   NSKKRGRSESCAPSS-SKACREKARRDRLNDKFMELGSILEPGRTPKTDKAAILIDAVRM  126

Query  478  VLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkalNSRPGFL  657
            V QLR EAQKLK+S   LQE++ ELK EKNEL+DEKQ+LK EKDKLE QLK +N++PG+L
Sbjct  127  VTQLRSEAQKLKDSNSSLQEKIKELKTEKNELRDEKQRLKAEKDKLEQQLKTMNTQPGYL  186

Query  658  PHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQF  762
            P P A    F  P    GGKLVPF+GYPG+ MWQF
Sbjct  187  PGPTAIPAAFAPPAQAPGGKLVPFMGYPGVAMWQF  221



>gb|EAZ05534.1| hypothetical protein OsI_27750 [Oryza sativa Indica Group]
Length=247

 Score =   134 bits (336),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 105/223 (47%), Positives = 138/223 (62%), Gaps = 25/223 (11%)
 Frame = +1

Query  136  WLLDLG-FEDIPLPG-GKFPPLEPGYQWHssailspappsiRQDESYVKFD--VSNGCSA  303
            W LD G  ED+P    G FP       W +S   S       +  SYV     V     +
Sbjct  17   WFLDCGILEDLPAAACGAFP-------WDASPSCSNPSV---EVSSYVNTTSYVLKEPGS  66

Query  304  RKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRMVL  483
             KR++SG+C G   SKA REK+RR ++NDRF EL   ++PGKP K DK+AILSDA RMV+
Sbjct  67   NKRVRSGSC-GRPTSKASREKIRRDKMNDRFLELGTTLEPGKPVKSDKAAILSDATRMVI  125

Query  484  QLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkalNSRPGFLPH  663
            QLR EA++LK++ E L++++ ELKAEK+EL+DEKQKLK EK+ LE Q+K L + P ++PH
Sbjct  126  QLRAEAKQLKDTNESLEDKIKELKAEKDELRDEKQKLKVEKETLEQQVKILTATPAYMPH  185

Query  664  PPATAVPFP----TPHHLVGGK------LVPFVGYPGIPMWQF  762
            P     P+P     P H   G+      ++PFVGYPG PMWQF
Sbjct  186  PTLMPAPYPQAPLAPFHHAQGQAAGQKLMMPFVGYPGYPMWQF  228



>gb|AAO72577.1| helix-loop-helix-like protein [Oryza sativa Japonica Group]
Length=216

 Score =   132 bits (333),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 88/164 (54%), Positives = 118/164 (72%), Gaps = 11/164 (7%)
 Frame = +1

Query  301  ARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRMV  480
            + KR++SG+C G   SKA REK+RR ++NDRF EL   ++PGKP K DK+AILSDA RMV
Sbjct  35   SNKRVRSGSC-GRPTSKASREKIRRDKMNDRFLELGTTLEPGKPVKSDKAAILSDATRMV  93

Query  481  LQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkalNSRPGFLP  660
            +QLR EA++LK++ E L++++ ELKAEK+EL+DEKQKLK EK+ LE Q+K L + P ++P
Sbjct  94   IQLRAEAKQLKDTNESLEDKIKELKAEKDELRDEKQKLKVEKETLEQQVKILTATPAYMP  153

Query  661  HPPATAVPFP----TPHHLVGGK------LVPFVGYPGIPMWQF  762
            HP     P+P     P H   G+      ++PFVGYPG PMWQF
Sbjct  154  HPTLMPAPYPQAPLAPFHHAQGQAAGQKLMMPFVGYPGYPMWQF  197



>gb|AFK34442.1| unknown [Lotus japonicus]
Length=226

 Score =   132 bits (333),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 99/218 (45%), Positives = 133/218 (61%), Gaps = 15/218 (7%)
 Frame = +1

Query  118  EVDGSN---WLLDLGFEDIPLPGGKFPPLEPGYQWHssailspappsiRQDESYVKFDVS  288
            E+D S    WL D GF+DI +       +     +               D +  +    
Sbjct  2    EIDSSGDSCWLYDYGFDDISVAAAADFMVADSADFTWVPSNMNLEMEYSLDSTVFE----  57

Query  289  NGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDA  468
            +G S R R +S + SG   SKA REK+RR +LN+RF EL  +++PG+ PK DK+AI+SDA
Sbjct  58   SGPSKRLRTES-SVSG---SKACREKLRRDKLNERFLELGSILEPGRQPKTDKAAIISDA  113

Query  469  VRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkalNSRP  648
            VR+V QLR+EA+KLKE   DLQE++ ELKAEKNE++DEK KLK +K+KLE ++K  N +P
Sbjct  114  VRVVTQLRNEAEKLKEMNNDLQEKIKELKAEKNEIRDEKNKLKLDKEKLEKKVKLRNVQP  173

Query  649  GFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQF  762
            GFLPH  A         H    KL+P++GYPGI MWQF
Sbjct  174  GFLPHADAAVKGKGAASH----KLIPYIGYPGIAMWQF  207



>ref|NP_175518.1| transcription factor bHLH115 [Arabidopsis thaliana]
 sp|Q9C682.1|BH115_ARATH RecName: Full=Transcription factor bHLH115; AltName: Full=Basic 
helix-loop-helix protein 115; Short=AtbHLH115; Short=bHLH 
115; AltName: Full=Transcription factor EN 134; AltName: Full=bHLH 
transcription factor bHLH115 [Arabidopsis thaliana]
 gb|AAG50538.1|AC079828_9 bHLH transcription factor, putative [Arabidopsis thaliana]
 gb|AAM10965.1|AF488632_1 putative bHLH transcription factor [Arabidopsis thaliana]
 gb|AAM62840.1| bHLH transcription factor, putative [Arabidopsis thaliana]
 gb|AAO00793.1| bHLH transcription factor, putative [Arabidopsis thaliana]
 gb|AAP13381.1| At1g51070 [Arabidopsis thaliana]
 gb|AEE32618.1| transcription factor bHLH115 [Arabidopsis thaliana]
Length=226

 Score =   132 bits (332),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 104/223 (47%), Positives = 136/223 (61%), Gaps = 20/223 (9%)
 Frame = +1

Query  106  MAAPEVDGSNWLLDLGFEDIPLPGGKFPPLEPGYQWHssailspappsiRQDESYVKFDV  285
            M +PE   +NWL      D PL  G F    P + W      + +      D      DV
Sbjct  1    MVSPE--NTNWL-----SDYPLIEGAFSDQNPTFPWQIDGSATVSVEV---DGFLCDADV  50

Query  286  SNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSD  465
                S+RKR+K+ +C+G+ +SKA REK RR RLND+F ELS V++PG+ PK DK AI++D
Sbjct  51   IKEPSSRKRIKTESCTGS-NSKACREKQRRDRLNDKFTELSSVLEPGRTPKTDKVAIIND  109

Query  466  AVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkalNSR  645
            A+RMV Q RDEAQKLK+    LQE++ ELK EKNEL+DEKQKLK EK++++ QLKA+ ++
Sbjct  110  AIRMVNQARDEAQKLKDLNSSLQEKIKELKDEKNELRDEKQKLKVEKERIDQQLKAIKTQ  169

Query  646  PG----FLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQF  762
            P     FLP+P        +     G KLVPF  YPG  MWQF
Sbjct  170  PQPQPCFLPNPQTL-----SQAQAPGSKLVPFTTYPGFAMWQF  207



>emb|CDY41004.1| BnaA02g27940D [Brassica napus]
Length=235

 Score =   132 bits (333),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 107/223 (48%), Positives = 137/223 (61%), Gaps = 11/223 (5%)
 Frame = +1

Query  106  MAAPEVDGSNWLLDLGFEDIPLPGGKFPPLEPGYQWHssa-ilspappsiRQDESYVKFD  282
            M +PE   +NW+ DL   D     G F    PG+ W     I   +  S   D S    +
Sbjct  1    MVSPE--NANWISDLIDADY----GSFTIQGPGFSWPVHQPIAVSSNSSAGVDGSAGNSE  54

Query  283  VSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILS  462
             S    ++KR +  + S A  SKA REK RR RLND+F ELS +++PG PPK DK+AIL 
Sbjct  55   TSKEPGSKKRARCESSS-ATSSKACREKQRRDRLNDKFMELSVILEPGNPPKTDKAAILV  113

Query  463  DAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkalNS  642
            DAVRMV QLR EAQKLK++   LQ+++ ELK EKNEL+DEKQ+LK EK+KLE QLKA+N+
Sbjct  114  DAVRMVTQLRGEAQKLKDTNSSLQDKIKELKTEKNELRDEKQRLKTEKEKLEQQLKAMNA  173

Query  643  -RPGFLPHPPATAVPFPTPH--HLVGGKLVPFVGYPGIPMWQF  762
             +P F P PP     F +       G K+VPF+ YPG+ MWQF
Sbjct  174  PQPSFFPAPPMMPTAFTSAAQGQAPGNKMVPFISYPGVAMWQF  216



>emb|CDY28758.1| BnaA02g09500D [Brassica napus]
Length=235

 Score =   132 bits (332),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 107/223 (48%), Positives = 137/223 (61%), Gaps = 11/223 (5%)
 Frame = +1

Query  106  MAAPEVDGSNWLLDLGFEDIPLPGGKFPPLEPGYQWHssa-ilspappsiRQDESYVKFD  282
            M +PE   +NW+ DL   D     G F    PG+ W     +   +  S   D S    +
Sbjct  1    MVSPE--NANWISDLIDADY----GGFTIQGPGFSWPVHQPLAVSSNSSAGVDGSAGNSE  54

Query  283  VSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILS  462
             S    ++KR +  + S A  SKA REK RR RLND+F ELS +++PG PPK DK+AIL 
Sbjct  55   ASKEPGSKKRARCESSS-ATSSKACREKQRRDRLNDKFMELSVILEPGNPPKTDKAAILV  113

Query  463  DAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkalNS  642
            DAVRMV QLR EAQKLK++   LQE++ ELK EKNEL+DEKQ+LK EK+KLE QLKA+N+
Sbjct  114  DAVRMVTQLRGEAQKLKDTNSGLQEKIKELKTEKNELRDEKQRLKTEKEKLEQQLKAMNA  173

Query  643  -RPGFLPHPPATAVPFPTPH--HLVGGKLVPFVGYPGIPMWQF  762
             +P F P PP     F +       G K+VPF+ YPG+ MWQF
Sbjct  174  PQPSFFPAPPMMPTAFASAAQGQAPGNKMVPFISYPGVAMWQF  216



>ref|XP_006452147.1| hypothetical protein CICLE_v10009354mg [Citrus clementina]
 gb|ESR65387.1| hypothetical protein CICLE_v10009354mg [Citrus clementina]
Length=235

 Score =   132 bits (332),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 110/222 (50%), Positives = 148/222 (67%), Gaps = 9/222 (4%)
 Frame = +1

Query  106  MAAPEVDGSNWLLDLGF-EDIPLPGGKFPPLEPGYQWHssailspappsiRQDESYVKFD  282
            M +PE   +NWLLD    +DI +P G F     G+ W     ++       + +S   F 
Sbjct  1    MVSPE--NTNWLLDYPLIDDITVPDGNFSVSASGFTWTVQPPINGPSNGCVEIDSA--FG  56

Query  283  VSNGC--SARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAI  456
             SNG   S++KR++S +C  ++ SKA REK+RR RLND+F EL+ +++PG+PPK DK+AI
Sbjct  57   DSNGLKESSKKRVRSESCGSSS-SKACREKLRRDRLNDKFVELASILEPGRPPKTDKAAI  115

Query  457  LSDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkal  636
            L DAVRMV QLR EAQKLK+S   LQE++ ELKAEKNEL+DEKQ+LK EK+K+E QLKA+
Sbjct  116  LIDAVRMVTQLRSEAQKLKDSNSSLQEKIKELKAEKNELRDEKQRLKAEKEKIEQQLKAM  175

Query  637  NSRPGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQF  762
            +++P FL   PA    F       G KL+PF+ YPG+ MWQF
Sbjct  176  STQPSFLTP-PAIPAAFAAQGQAPGNKLMPFISYPGVAMWQF  216



>ref|XP_007148298.1| hypothetical protein PHAVU_006G196600g [Phaseolus vulgaris]
 gb|ESW20292.1| hypothetical protein PHAVU_006G196600g [Phaseolus vulgaris]
Length=215

 Score =   132 bits (331),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 90/154 (58%), Positives = 116/154 (75%), Gaps = 13/154 (8%)
 Frame = +1

Query  301  ARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRMV  480
            ++KR++S  CS     KA +EKMRR RLNDRF EL  ++DPG+P KMDK+ ILSDAVR+V
Sbjct  56   SKKRLRS-PCS-----KACKEKMRRDRLNDRFLELGSILDPGRPLKMDKAVILSDAVRLV  109

Query  481  LQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkalNSRPGFLP  660
             QLR+EA KL+ES E+LQ ++NELKAEKNEL++EKQ+LK EKD LE +++A +S+  FL 
Sbjct  110  SQLREEAHKLRESIENLQGKINELKAEKNELREEKQRLKAEKDSLEQKIEAFSSQSSFLR  169

Query  661  HPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQF  762
                    FP P  +VG KLVPF+GYPG+ MWQF
Sbjct  170  -------AFPGPGQVVGSKLVPFMGYPGVGMWQF  196



>ref|XP_003573355.1| PREDICTED: transcription factor ILR3-like [Brachypodium distachyon]
Length=246

 Score =   132 bits (333),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 110/219 (50%), Positives = 136/219 (62%), Gaps = 21/219 (10%)
 Frame = +1

Query  136  WLLDLG-FEDIPLPG-GKFPPLEPGYQWHssailspappsiRQDESYVKF-DVSNGCSAR  306
            W LD G  ED+P    G FP       W +SA  S     +    SYV   DVS    + 
Sbjct  20   WFLDCGILEDLPASACGAFP-------WDASASSSNPSVEVG---SYVNTSDVSKVPGSN  69

Query  307  KRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRMVLQ  486
            KR +S +C G   SKA REK+RR +LNDRF EL   +DPGKP K DK+AILSDA RMV Q
Sbjct  70   KRSRSESC-GRPTSKACREKVRRDKLNDRFLELGTTLDPGKPVKSDKAAILSDATRMVTQ  128

Query  487  LRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkalNSRPGFLPHP  666
            LR EAQ+LK++ E L++++ ELK EK+EL+DEKQKLK EK+ LE Q+K L + P ++PHP
Sbjct  129  LRAEAQQLKDTNESLEDKIKELKTEKDELRDEKQKLKVEKETLEHQMKLLTATPAYMPHP  188

Query  667  PATAVPF------PTPHHLVGGK-LVPFVGYPGIPMWQF  762
                 PF      P   H  G K ++PFVGYPG PMWQF
Sbjct  189  AMMPSPFAQAPMAPFHAHGQGQKMMMPFVGYPGYPMWQF  227



>gb|ADC33137.1| helix-loop-helix-like protein [Triticum aestivum]
Length=240

 Score =   132 bits (332),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 110/232 (47%), Positives = 139/232 (60%), Gaps = 24/232 (10%)
 Frame = +1

Query  106  MAAPEVDG-SNWLLDLG-FEDIPLPG-GKFPPLEPGYQWHssailspappsiRQDESYV-  273
            M+ P  DG  +W LD G  ED+P    G FP       W +S   S     +    S+V 
Sbjct  1    MSLPPTDGGDDWFLDCGILEDLPAAACGAFP-------WDASVSSSNPSAEVG---SHVN  50

Query  274  KFDVSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSA  453
            K D+     + KR++S  C G   SKA REK+RR +LNDRF EL   +DPGKP K DK+A
Sbjct  51   KLDLPKDSGSNKRLRSEPC-GRPTSKACREKVRRDKLNDRFLELGTTLDPGKPVKADKAA  109

Query  454  ILSDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlka  633
            ILSDA RMV QLR EAQ+LK++   L++++ ELKAEK+EL+DEKQKLK EK+ LE Q+K 
Sbjct  110  ILSDATRMVTQLRAEAQQLKDTNGSLEDKIKELKAEKDELRDEKQKLKLEKETLEHQMKL  169

Query  634  lNSRPGFLPHPPATAVPFP----TPHHLVGGKL-----VPFVGYPGIPMWQF  762
            L + P ++PHP     PF      P H  G  L     +PFVGYPG PMWQ 
Sbjct  170  LTATPAYMPHPTMMPSPFAQAPMAPFHAQGQALGQKLMMPFVGYPGYPMWQL  221



>ref|XP_006658659.1| PREDICTED: transcription factor ILR3-like [Oryza brachyantha]
Length=238

 Score =   132 bits (331),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 93/156 (60%), Positives = 116/156 (74%), Gaps = 6/156 (4%)
 Frame = +1

Query  298  SARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRM  477
            SA KR +S + S  + SKA REK+RR +LN+RF EL  V++PGK PKMDKSAIL+DA+R+
Sbjct  69   SANKRPRSESVSQPS-SKACREKLRRDKLNERFLELGAVLEPGKTPKMDKSAILNDAIRV  127

Query  478  VLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkalNSRPGFL  657
            + +LR EAQKLKES + LQE++ ELKAEKNEL+DEKQKLK EK+ LE Q+K LN+RP  +
Sbjct  128  MTELRSEAQKLKESNQSLQEKIKELKAEKNELRDEKQKLKAEKESLEQQIKFLNARPSLV  187

Query  658  PHPPATAVPFPTPHHLVGGKL-VPFVGYPGIPMWQF  762
            PHPP      P      G KL +P +GYPG PMWQF
Sbjct  188  PHPPV----IPAAAFAAGQKLMMPVIGYPGFPMWQF  219



>ref|XP_002891614.1| basic helix-loop-helix family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH67873.1| basic helix-loop-helix family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=226

 Score =   131 bits (330),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 103/223 (46%), Positives = 137/223 (61%), Gaps = 20/223 (9%)
 Frame = +1

Query  106  MAAPEVDGSNWLLDLGFEDIPLPGGKFPPLEPGYQWHssailspappsiRQDESYVKFDV  285
            M +PE   +NWL      D PL  G F    P + W   A  + +      D      DV
Sbjct  1    MVSPE--NTNWL-----SDYPLIDGAFSDQNPTFPWQIDASATVSVEV---DGFLCDSDV  50

Query  286  SNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSD  465
                 +RKR+K+ +C+G+ +SKA REK RR RLND+F ELS +++PG+ PK DK AI++D
Sbjct  51   IKEPGSRKRIKTESCAGS-NSKACREKQRRDRLNDKFTELSSILEPGRAPKTDKVAIIND  109

Query  466  AVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkalNSR  645
            A+RMV Q R+EAQKLK+    LQE++ ELK EKNEL+DEKQKLK EK++++ QLKA+ ++
Sbjct  110  AIRMVNQAREEAQKLKDLNSSLQEKIKELKDEKNELRDEKQKLKIEKERIDQQLKAIKTQ  169

Query  646  PG----FLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQF  762
            P     FLP+PP       +     G KLVPF  YPG  MWQF
Sbjct  170  PQPQSCFLPNPPTL-----SQAQAPGSKLVPFTTYPGFAMWQF  207



>ref|XP_004972892.1| PREDICTED: transcription factor ILR3-like [Setaria italica]
Length=249

 Score =   132 bits (331),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 109/222 (49%), Positives = 137/222 (62%), Gaps = 23/222 (10%)
 Frame = +1

Query  133  NWLLDLG-FEDIPLPG-GKFPPLEPGYQWHssailspappsiRQDESYVKF-DVSNGCSA  303
            +W LD G  +D+P    G FP       W +S   S     +    SYV   DV     +
Sbjct  20   DWFLDCGILDDLPAAACGAFP-------WDASPSSSNPSVEVG---SYVNTNDVFKEPGS  69

Query  304  RKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRMVL  483
             KR++SG+ SG   SKA REK RR +LNDRF EL   ++PGKP K DK+AILSDA RMV+
Sbjct  70   NKRLRSGS-SGRPTSKASREKQRRDKLNDRFLELGSTLEPGKPIKADKAAILSDATRMVI  128

Query  484  QLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkalNSRPGFLPH  663
            QLR EAQ+LK++   L+E++ ELKAEK+EL+DEKQKLK EK+ LE Q+K + S P ++PH
Sbjct  129  QLRSEAQQLKDTNGSLEEKIKELKAEKDELRDEKQKLKLEKESLEHQMKLMTSAPAYMPH  188

Query  664  PPATAVPFP----TPHH----LVGGKL-VPFVGYPGIPMWQF  762
            P     PFP     P H      G KL +PFV YPG PMWQF
Sbjct  189  PTLMPAPFPQAPLAPFHPQGQAAGQKLMMPFVSYPGYPMWQF  230



>ref|XP_006393084.1| hypothetical protein EUTSA_v10011752mg [Eutrema salsugineum]
 dbj|BAJ34492.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ30370.1| hypothetical protein EUTSA_v10011752mg [Eutrema salsugineum]
Length=229

 Score =   131 bits (330),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 106/223 (48%), Positives = 137/223 (61%), Gaps = 17/223 (8%)
 Frame = +1

Query  106  MAAPEVDGSNWLLDLGFEDIPLPGGKFPPLEPGYQWHssailspappsiRQDESYVKFDV  285
            M +PE   +NWL      D PL  G F    P + W    I   A  S+  D      DV
Sbjct  1    MVSPE--NTNWL-----SDYPLIDGAFSDQNPTFPWPIDQIDGSASVSVEVDGFLCDSDV  53

Query  286  SNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSD  465
                 +RKR+KS  C G++ SKA REK RR +LN++F ELS +++PG+ PK DK AI++D
Sbjct  54   IKEPGSRKRIKSETCGGSS-SKACREKQRRDKLNEKFTELSSILEPGRLPKTDKVAIIND  112

Query  466  AVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkalNSR  645
            A+RMV Q+RDEAQKLK+    LQE++ ELK EKNEL+DEKQKLK EK+++E QLKA+ ++
Sbjct  113  AIRMVNQVRDEAQKLKDLNSSLQEKIKELKDEKNELRDEKQKLKIEKERIEQQLKAIKTQ  172

Query  646  PG----FLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQF  762
            P     FLP+PP  +          G KLVPF  YPG  MWQF
Sbjct  173  PQPQPLFLPNPPTMSQ-----GQAPGSKLVPFTTYPGFAMWQF  210



>gb|KJB81836.1| hypothetical protein B456_013G164100 [Gossypium raimondii]
Length=237

 Score =   131 bits (330),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 103/207 (50%), Positives = 137/207 (66%), Gaps = 11/207 (5%)
 Frame = +1

Query  154  FEDIPLPGGKFPPLEPGYQWHssailspappsiRQ-DESYVKFDVSNGCSARKRMKSGAC  330
             +DIP+P G +     G+ W +    +P+     + D S+   D      ++KR  S +C
Sbjct  19   IDDIPVPDGPYT----GFSWSTQPTNAPSTAVNVEVDNSFGDLDGLTESGSKKR--SESC  72

Query  331  SGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRMVLQLRDEAQKL  510
            + ++ SKA REK+RR RLND+F EL  +++PG+PPK DKSAIL DAVRMV QLRDEAQK+
Sbjct  73   NPSS-SKACREKLRRDRLNDKFMELGAILEPGRPPKTDKSAILVDAVRMVTQLRDEAQKM  131

Query  511  KESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkalNSRPGFLPHPPATAVPFP  690
            K+S   LQE++ ELKAEKNEL++EKQ+LK EK+KLE QLK +N++P F+P  PA    F 
Sbjct  132  KDSNSSLQERIKELKAEKNELREEKQRLKAEKEKLEQQLKTMNAQPSFMPPAPAIPSAFA  191

Query  691  TPH---HLVGGKLVPFVGYPGIPMWQF  762
                     G KLVPF GYPG+ MWQF
Sbjct  192  AAAAQGQAHGNKLVPFFGYPGVAMWQF  218



>gb|EEC82221.1| hypothetical protein OsI_26369 [Oryza sativa Indica Group]
Length=256

 Score =   132 bits (331),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 88/142 (62%), Positives = 110/142 (77%), Gaps = 3/142 (2%)
 Frame = +1

Query  346  SKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRMVLQLRDEAQKLKESFE  525
            SKA REK+RR +LN+RF EL  V++PGK PKMDKS+IL+DA+R++ +LR EAQKLKES E
Sbjct  96   SKACREKVRRDKLNERFLELGAVLEPGKTPKMDKSSILNDAIRVMAELRSEAQKLKESNE  155

Query  526  DLQEQVNELKAeknelkdekqklkeekdklelqlkalNSRPGFLPHPPAT-AVPFPTPHH  702
             LQE++ ELKAEKNEL+DEKQKLK EK+ LE Q+K LN+RP F+PHPP   A  F  P  
Sbjct  156  SLQEKIKELKAEKNELRDEKQKLKAEKESLEQQIKFLNARPSFVPHPPVIPASAFTAPQG  215

Query  703  LVGGK--LVPFVGYPGIPMWQF  762
               G+  ++P +GYPG PMWQF
Sbjct  216  QAAGQKLMMPVIGYPGFPMWQF  237



>ref|NP_001059905.1| Os07g0543000 [Oryza sativa Japonica Group]
 dbj|BAC78588.1| hypothetical protein [Oryza sativa Japonica Group]
 dbj|BAC83769.1| putative bHLH protein [Oryza sativa Japonica Group]
 dbj|BAE96297.1| bHLH-HALZ myc like protein [Oryza sativa Japonica Group]
 dbj|BAF21819.1| Os07g0543000 [Oryza sativa Japonica Group]
 gb|ACF60478.1| bHLH transcription factor [Oryza sativa Japonica Group]
 dbj|BAG86829.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE67352.1| hypothetical protein OsJ_24621 [Oryza sativa Japonica Group]
Length=256

 Score =   132 bits (331),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 88/142 (62%), Positives = 110/142 (77%), Gaps = 3/142 (2%)
 Frame = +1

Query  346  SKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRMVLQLRDEAQKLKESFE  525
            SKA REK+RR +LN+RF EL  V++PGK PKMDKS+IL+DA+R++ +LR EAQKLKES E
Sbjct  96   SKACREKVRRDKLNERFLELGAVLEPGKTPKMDKSSILNDAIRVMAELRSEAQKLKESNE  155

Query  526  DLQEQVNELKAeknelkdekqklkeekdklelqlkalNSRPGFLPHPPAT-AVPFPTPHH  702
             LQE++ ELKAEKNEL+DEKQKLK EK+ LE Q+K LN+RP F+PHPP   A  F  P  
Sbjct  156  SLQEKIKELKAEKNELRDEKQKLKAEKESLEQQIKFLNARPSFVPHPPVIPASAFTAPQG  215

Query  703  LVGGK--LVPFVGYPGIPMWQF  762
               G+  ++P +GYPG PMWQF
Sbjct  216  QAAGQKLMMPVIGYPGFPMWQF  237



>ref|XP_003543375.1| PREDICTED: transcription factor ILR3-like isoform X1 [Glycine 
max]
 ref|XP_006594876.1| PREDICTED: transcription factor ILR3-like isoform X2 [Glycine 
max]
Length=231

 Score =   131 bits (329),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 103/217 (47%), Positives = 141/217 (65%), Gaps = 14/217 (6%)
 Frame = +1

Query  127  GSNWLLDLGFEDIPLPGGKFPPLEPG-YQW--HssailspappsiRQDESYVKFDVSNGC  297
             S+WL D GF DIP+ G  F   + G ++W   S     P+  S+  + S     + NG 
Sbjct  9    ASDWLYDYGF-DIPVAGSDFMASDSGGFRWGPQSHNFKGPSNMSLEMEYSLDSTVMENGP  67

Query  298  SARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRM  477
            S  KR+++ +C  A+ SKA REK+RR +LN+RF ELS +++P + PK DK AILSDA R+
Sbjct  68   S--KRLRTESC--ASGSKACREKLRRDKLNERFLELSSILEPSRQPKSDKVAILSDAARV  123

Query  478  VLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkalNSRPGFL  657
            V+QLR+EA++LKE  ++LQ +V ELK EKNEL+DEK +LKEEK+KLE Q+K  N +P FL
Sbjct  124  VIQLRNEAKRLKEMNDELQAKVKELKGEKNELRDEKNRLKEEKEKLEQQVKVANIQPSFL  183

Query  658  PHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQFAA  768
            P  P           +   KL+PF+GYPGI MWQF +
Sbjct  184  PQAP------DAKGQVGSHKLIPFIGYPGIAMWQFMS  214



>gb|KJB45598.1| hypothetical protein B456_007G314800 [Gossypium raimondii]
Length=237

 Score =   131 bits (329),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 104/205 (51%), Positives = 137/205 (67%), Gaps = 7/205 (3%)
 Frame = +1

Query  154  FEDIPLPGGKFPPLEPGYQWHssailspappsiRQ-DESYVKFDVSNGCSARKRMKSGAC  330
              DIP P G +     G+ W +  I + +     + D S+   D      ++KR++S +C
Sbjct  19   INDIPAPDGPYS----GFSWPTRPINASSNVFSVEIDGSFEDSDGLKESGSKKRVRSESC  74

Query  331  SGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRMVLQLRDEAQKL  510
            +  + SKA REK+RR +LN++F ELS +++P KPPK DK+AIL DAVRMV QLR EAQKL
Sbjct  75   N-VSSSKACREKLRRDKLNEKFMELSSILEPEKPPKTDKAAILVDAVRMVTQLRGEAQKL  133

Query  511  KESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkalNSRPGFLPHPPATAVPFP  690
            K+S   L +++ ELKAEKNEL+DEKQ+LK EK+KLE QLKA+NS+P F+P  PA    F 
Sbjct  134  KDSISSLHDRIKELKAEKNELRDEKQRLKAEKEKLEQQLKAMNSQPSFMPPAPAFPAAFA  193

Query  691  TPHHLV-GGKLVPFVGYPGIPMWQF  762
            T    V G KLVPF GYPG+ MWQF
Sbjct  194  TAQGQVPGNKLVPFFGYPGVAMWQF  218



>ref|XP_009132430.1| PREDICTED: transcription factor ILR3-like [Brassica rapa]
Length=238

 Score =   131 bits (329),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 109/230 (47%), Positives = 137/230 (60%), Gaps = 22/230 (10%)
 Frame = +1

Query  106  MAAPEVDGSNWLLDLGFEDIPLPGGKFPPLEPGYQWHssailspappsiRQDESYVKFDV  285
            M +PE    NW+ DL   D    GG F    P + W         P  +    S V  D 
Sbjct  1    MVSPE--NGNWICDLIEADY---GGSFTIQAPAFSW-----PLHQPIGVSSHNSSVGVDG  50

Query  286  SNGCS--------ARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKM  441
            S G S        +RKR++    S A +SKA REK RR RLND+F EL  +++PG PPK 
Sbjct  51   SAGISEASKDPPLSRKRVRC-ELSSATNSKACREKQRRDRLNDKFMELGVILEPGHPPKT  109

Query  442  DKSAILSDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklel  621
            DK+AIL DA+RMV QLR EAQKLK+S   L +++ ELK EKNEL+DEKQ+LK EK+KLEL
Sbjct  110  DKAAILVDALRMVTQLRGEAQKLKDSNSSLHDKIKELKTEKNELRDEKQRLKTEKEKLEL  169

Query  622  qlkalNS--RPGFLPHPPATAVPFPTPH-HLVGGKLVPFVGYPGIPMWQF  762
            QLKA+N+  +P F P PP     F +      G K+VPF+ YPG+ MWQF
Sbjct  170  QLKAMNAPPQPSFFPAPPMMPTAFASAQGQAPGNKMVPFISYPGVAMWQF  219



>gb|AAM64276.1| bHLH transcription factor, putative [Arabidopsis thaliana]
Length=234

 Score =   131 bits (329),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 107/227 (47%), Positives = 133/227 (59%), Gaps = 20/227 (9%)
 Frame = +1

Query  106  MAAPEVDGSNWLLDLGFEDIPLPGGKFPPLEPGYQWHssailspappsiRQDESYVKFDV  285
            M +PE   +NW+ DL   D     G F    PG+ W     +  +        S    D 
Sbjct  1    MVSPE--NANWICDLIDADY----GSFTIQGPGFSWPVQQPIGVS------SNSSAGVDG  48

Query  286  SNGCSARKR----MKSGAC--SGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDK  447
            S G S   +     K G C  S A  SKA REK RR RLND+F EL  +++PG PPK DK
Sbjct  49   SAGNSEASKEPGSKKRGRCESSSATSSKACREKQRRDRLNDKFMELGAILEPGNPPKTDK  108

Query  448  SAILSDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelql  627
            +AIL DAVRMV QLR EAQKLK+S   LQ+++ ELK EKNEL+DEKQ+LK EK+KLE QL
Sbjct  109  AAILVDAVRMVTQLRGEAQKLKDSNSSLQDKIKELKTEKNELRDEKQRLKTEKEKLEQQL  168

Query  628  kalNS-RPGFLPHPPATAVPFPTPH-HLVGGKLVPFVGYPGIPMWQF  762
            KA+N+ +P F P PP     F +      G K+VP + YPG+ MWQF
Sbjct  169  KAINAPQPSFFPAPPMMPTAFASAQGQAPGNKMVPIISYPGVAMWQF  215



>ref|NP_200279.1| transcription factor ILR3 [Arabidopsis thaliana]
 ref|XP_002864351.1| hypothetical protein ARALYDRAFT_495549 [Arabidopsis lyrata subsp. 
lyrata]
 sp|Q9FH37.1|ILR3_ARATH RecName: Full=Transcription factor ILR3; AltName: Full=Basic 
helix-loop-helix protein 105; Short=AtbHLH105; Short=bHLH 105; 
AltName: Full=Protein IAA-LEUCINE RESISTANT 3; AltName: Full=Transcription 
factor EN 133; AltName: Full=bHLH transcription 
factor bHLH105 [Arabidopsis thaliana]
 gb|AAM10964.1|AF488629_1 putative bHLH transcription factor [Arabidopsis thaliana]
 dbj|BAB09934.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAK96776.1| Unknown protein [Arabidopsis thaliana]
 gb|AAN72200.1| Unknown protein [Arabidopsis thaliana]
 gb|EFH40610.1| hypothetical protein ARALYDRAFT_495549 [Arabidopsis lyrata subsp. 
lyrata]
 gb|AED96526.1| transcription factor ILR3 [Arabidopsis thaliana]
Length=234

 Score =   131 bits (329),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 107/227 (47%), Positives = 133/227 (59%), Gaps = 20/227 (9%)
 Frame = +1

Query  106  MAAPEVDGSNWLLDLGFEDIPLPGGKFPPLEPGYQWHssailspappsiRQDESYVKFDV  285
            M +PE   +NW+ DL   D     G F    PG+ W     +  +        S    D 
Sbjct  1    MVSPE--NANWICDLIDADY----GSFTIQGPGFSWPVQQPIGVS------SNSSAGVDG  48

Query  286  SNGCSARKR----MKSGAC--SGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDK  447
            S G S   +     K G C  S A  SKA REK RR RLND+F EL  +++PG PPK DK
Sbjct  49   SAGNSEASKEPGSKKRGRCESSSATSSKACREKQRRDRLNDKFMELGAILEPGNPPKTDK  108

Query  448  SAILSDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelql  627
            +AIL DAVRMV QLR EAQKLK+S   LQ+++ ELK EKNEL+DEKQ+LK EK+KLE QL
Sbjct  109  AAILVDAVRMVTQLRGEAQKLKDSNSSLQDKIKELKTEKNELRDEKQRLKTEKEKLEQQL  168

Query  628  kalNS-RPGFLPHPPATAVPFPTPH-HLVGGKLVPFVGYPGIPMWQF  762
            KA+N+ +P F P PP     F +      G K+VP + YPG+ MWQF
Sbjct  169  KAMNAPQPSFFPAPPMMPTAFASAQGQAPGNKMVPIISYPGVAMWQF  215



>ref|XP_010500676.1| PREDICTED: transcription factor bHLH115-like [Camelina sativa]
Length=227

 Score =   130 bits (328),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 99/223 (44%), Positives = 132/223 (59%), Gaps = 19/223 (9%)
 Frame = +1

Query  106  MAAPEVDGSNWLLDLGFEDIPLPGGKFPPLEPGYQWHssailspappsiRQDESYVKFDV  285
            M +PE   +NWL      D PL  G F    P + W      S +      D      DV
Sbjct  1    MVSPE--NTNWL-----SDYPLVDGAFSDHNPSFPWQIDVSSSVSVE---VDGFLCDSDV  50

Query  286  SNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSD  465
                 +RKR+K+ +C+  + SKA REK RR RLND+F ELS +++PG+ PK DK AI++D
Sbjct  51   IKEPGSRKRIKTESCTAGSSSKACREKQRRDRLNDKFTELSSILEPGRTPKTDKVAIIND  110

Query  466  AVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkalNSR  645
            A+RMV   RDEAQKLK+    LQE++ E+K EK+EL+DEK KLK EK+++E QLK + ++
Sbjct  111  AIRMVNHARDEAQKLKDLNSSLQEKIKEVKDEKSELRDEKHKLKIEKERMEQQLKEIKTQ  170

Query  646  PG----FLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQF  762
            P     FLP+PP+ +          G KLVPF  YPG  MWQF
Sbjct  171  PQPQPCFLPNPPSLSQ-----AQAPGSKLVPFTTYPGFAMWQF  208



>emb|CDY43028.1| BnaA03g11750D [Brassica napus]
Length=238

 Score =   130 bits (328),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 109/230 (47%), Positives = 137/230 (60%), Gaps = 22/230 (10%)
 Frame = +1

Query  106  MAAPEVDGSNWLLDLGFEDIPLPGGKFPPLEPGYQWHssailspappsiRQDESYVKFDV  285
            M +PE    NW+ DL   D    GG F    P + W         P  +    S V  D 
Sbjct  1    MVSPE--NGNWICDLIEADY---GGSFTIQAPAFSW-----PLHQPIGVSSHNSSVGVDG  50

Query  286  SNGCS--------ARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKM  441
            S G S        +RKR++  + S A  SKA REK RR RLND+F EL  +++PG PPK 
Sbjct  51   SAGISEASKDPPLSRKRVRCES-SSATSSKACREKQRRDRLNDKFMELGVILEPGHPPKT  109

Query  442  DKSAILSDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklel  621
            DK+AIL DA+RMV QLR EAQKLK+S   L +++ ELK EKNEL+DEKQ+LK EK+KLEL
Sbjct  110  DKAAILVDALRMVTQLRGEAQKLKDSNSSLHDKIKELKTEKNELRDEKQRLKTEKEKLEL  169

Query  622  qlkalNS--RPGFLPHPPATAVPFPTPH-HLVGGKLVPFVGYPGIPMWQF  762
            QLKA+N+  +P F P PP     F +      G K+VPF+ YPG+ MWQF
Sbjct  170  QLKAMNAPPQPSFFPAPPMMPTAFASAQGQAPGNKMVPFISYPGVAMWQF  219



>ref|XP_009414543.1| PREDICTED: transcription factor ILR3 [Musa acuminata subsp. malaccensis]
Length=226

 Score =   130 bits (327),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 103/216 (48%), Positives = 126/216 (58%), Gaps = 20/216 (9%)
 Frame = +1

Query  136  WLLDLGFEDIPLPGGKFPPLEPGYQWHssailspappsiRQDESYVKFDVSNGCS---AR  306
            W LD    D+    G    +  G+ W                 S+  F  SNG +     
Sbjct  9    WFLDDLIGDMHASEGDLAGVNGGFCWAPPGFNI----------SFSSFSDSNGLTEPVTG  58

Query  307  KRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRMVLQ  486
            KR +S  CS  A  KA REKMRR RLNDRF EL  +++PGK  K+DK+AILSDAVR++ Q
Sbjct  59   KRKRSETCSTPA--KACREKMRRDRLNDRFLELGSLLEPGKLSKLDKAAILSDAVRVLTQ  116

Query  487  LRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkalNSRPGFLPH-  663
            LR E +KLKES E LQE++NELKAEKNEL+DEKQKLK E + LE Q+K    R  ++ H 
Sbjct  117  LRSETEKLKESNEILQEKINELKAEKNELRDEKQKLKAENESLEQQIKL---RSSYVSHP  173

Query  664  PPATAVPFPTPHHLVGGKL-VPFVGYPGIPMWQFAA  768
            PP  A PF         KL +P +GYPG PMWQF A
Sbjct  174  PPVIATPFTAKGQAAAQKLMIPIIGYPGFPMWQFMA  209



>ref|XP_006280790.1| hypothetical protein CARUB_v10026758mg [Capsella rubella]
 gb|EOA13688.1| hypothetical protein CARUB_v10026758mg [Capsella rubella]
Length=332

 Score =   132 bits (333),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 106/229 (46%), Positives = 134/229 (59%), Gaps = 20/229 (9%)
 Frame = +1

Query  100  ERMAAPEVDGSNWLLDLGFEDIPLPGGKFPPLEPGYQWHssailspappsiRQDESYVKF  279
            + M +PE   +NW+ DL   D     G F    PG+ W     +  +        S +  
Sbjct  97   QEMVSPE--NANWICDLIDADY----GSFTIQGPGFSWPVQQPIGVS------SNSSIGV  144

Query  280  DVSNGCSARKR----MKSGAC--SGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKM  441
            D S G S   +     K G C  S A  SKA REK RR RLND+F EL  +++PG PPK 
Sbjct  145  DGSAGNSEASKEPGSKKRGRCESSSATSSKACREKQRRDRLNDKFMELGAILEPGNPPKT  204

Query  442  DKSAILSDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklel  621
            DK+AIL DAVRMV QLR EAQKLK+S   LQ+++ ELK EKNEL+DEKQ+LK EK+KLE 
Sbjct  205  DKAAILVDAVRMVTQLRGEAQKLKDSNSSLQDKIKELKTEKNELRDEKQRLKTEKEKLEQ  264

Query  622  qlkalNS-RPGFLPHPPATAVPFPTPH-HLVGGKLVPFVGYPGIPMWQF  762
            QLK +N+ +P F P PP     F +      G K+VP + YPG+ MWQF
Sbjct  265  QLKTMNAPQPSFFPAPPMMPTAFASAQGQAPGNKMVPIISYPGVAMWQF  313



>gb|ACG38605.1| bHLH transcription factor [Zea mays]
Length=253

 Score =   130 bits (327),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 108/231 (47%), Positives = 138/231 (60%), Gaps = 30/231 (13%)
 Frame = +1

Query  127  GSNWLLDLG-FEDIPLPG-GKFPPLEPGYQWHssailspappsiRQDESYVKF-------  279
            G +W LD G  +D+P    G FP       W +S   S     +    SYV         
Sbjct  15   GDDWFLDCGILDDLPAAACGAFP-------WDASPSSSNPSVEVG---SYVNANDAFKEP  64

Query  280  -DVSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAI  456
             DV     + KR++SG+ S    SKA RE+MRR +LNDRF EL   ++PGKP K DK+AI
Sbjct  65   NDVFKEPGSSKRLRSGS-SDMPTSKACRERMRRNKLNDRFLELGSALEPGKPVKADKAAI  123

Query  457  LSDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkal  636
            LSDA RMV+QLR E+Q+LKE+   L+E++ ELKAEK+EL+DEKQKLK EK+ LE Q+K +
Sbjct  124  LSDATRMVIQLRSESQQLKETNGSLEEKIKELKAEKDELRDEKQKLKLEKESLEHQMKLM  183

Query  637  NSRPGFLPHPPATAVPFP----TPHHLVGGK-----LVPFVGYPGIPMWQF  762
             S P ++PHP     PF     TP H  G       ++PFVGYPG PMWQF
Sbjct  184  ASAPAYMPHPTLMPAPFAQAPLTPFHAQGQAAGQKLMMPFVGYPGYPMWQF  234



>emb|CDY47456.1| BnaC09g31010D [Brassica napus]
Length=233

 Score =   130 bits (326),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 108/229 (47%), Positives = 135/229 (59%), Gaps = 25/229 (11%)
 Frame = +1

Query  106  MAAPEVDGSNWLLDLGFEDIPLPGGKFPPLEPGYQWHssailspappsiRQDESYVKFDV  285
            M +PE   +NW+ +L   D     G F    PG+ W                 S V  D 
Sbjct  1    MVSPE--NANWISELIDADY----GSFTIQGPGFSWPVHQQPIGV--------SSVGVDG  46

Query  286  SNGCS-------ARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMD  444
            S G S       ++KR +  + S A  SKA REK RR RLND+F ELS +++PG PPK D
Sbjct  47   SAGNSEATKEPVSKKRARCDSSS-ATSSKACREKQRRDRLNDKFTELSVILEPGNPPKTD  105

Query  445  KSAILSDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelq  624
            K+AIL DAVRMV QLR EAQKLK+S   LQ ++NELK EKNEL+DEKQ+LK EK+KLE Q
Sbjct  106  KAAILVDAVRMVTQLRGEAQKLKDSNSSLQGKINELKTEKNELRDEKQRLKTEKEKLEQQ  165

Query  625  lkalNS--RPGFLPHPPATAVPFPTPH-HLVGGKLVPFVGYPGIPMWQF  762
            LKA+N+  +P F P PP     F +      G K+VP + YPG+ MWQF
Sbjct  166  LKAMNAPPQPSFFPGPPMMPTAFASAQGQAPGNKMVPVISYPGVAMWQF  214



>gb|KJB13568.1| hypothetical protein B456_002G081900 [Gossypium raimondii]
Length=238

 Score =   130 bits (326),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 107/226 (47%), Positives = 146/226 (65%), Gaps = 14/226 (6%)
 Frame = +1

Query  106  MAAPEVDGSNWLLDLGF----EDIPLPGGKFPPLEPGYQWHssailspappsiRQ-DESY  270
            M +PE   SN+     +    +DIP+P   +     G+ W +  I +P+     + D S+
Sbjct  1    MVSPE--NSNYWSHFDYATLIDDIPVPDDPYA----GFAWSTQPIDAPSNVVSVEIDGSF  54

Query  271  VKFDVSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKS  450
               D      ++KR++S +C+ A+ SKA REK+RR RLND+F EL  +++PG+PPK DKS
Sbjct  55   GDSDGLKESGSKKRVRSESCN-ASSSKACREKLRRDRLNDKFMELGSILEPGRPPKTDKS  113

Query  451  AILSDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlk  630
            AIL DAVRMV QLR EAQKLK+S   LQE++ ELK+EKNEL+DEKQ+LK EK++LE QLK
Sbjct  114  AILIDAVRMVTQLRGEAQKLKDSNTSLQERIKELKSEKNELRDEKQRLKAEKERLEQQLK  173

Query  631  alNSRPGFL--PHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQF  762
            A+N++P F+    P   A     P    G KLVP +GYPG+ MWQF
Sbjct  174  AMNAQPSFMPPAPPAIPAAFAAAPGQAPGNKLVPLIGYPGVAMWQF  219



>emb|CDY43809.1| BnaC03g14420D [Brassica napus]
Length=238

 Score =   129 bits (325),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 106/224 (47%), Positives = 135/224 (60%), Gaps = 20/224 (9%)
 Frame = +1

Query  124  DGSNWLLDLGFEDIPLPGGKFPPLEPGYQWHssailspappsiRQDESYVKFDVSNGCS-  300
            +  NW+ DL   D    GG F    PG+ W         P  +  + S V  D S G S 
Sbjct  5    ENGNWICDLIDADY---GGSFTIQGPGFSW-----PLHQPIGVSSNNSSVGVDGSAGSSE  56

Query  301  -------ARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAIL  459
                   +RKR +  + S A +SKA REK RR RLND+F EL+ +++PG PPK DK+AIL
Sbjct  57   ASKEPPVSRKRSRCESSS-ATNSKACREKQRRDRLNDKFMELAVILEPGHPPKTDKAAIL  115

Query  460  SDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkalN  639
             DA+RMV QLR EAQKLK+S   L +++ ELK EKNEL+DEKQ+LK EKDKLE QLKA+N
Sbjct  116  VDALRMVTQLRGEAQKLKDSNSSLHDKIKELKTEKNELRDEKQRLKTEKDKLEQQLKAMN  175

Query  640  S--RPGFLPHPPATAVPFPTPH-HLVGGKLVPFVGYPGIPMWQF  762
            +  +P F P  P     F +      G K+VPF+ YPG+ MWQF
Sbjct  176  APPQPSFFPASPMMPTAFASAQGQAPGNKMVPFISYPGVAMWQF  219



>gb|KFK35883.1| hypothetical protein AALP_AA4G049100 [Arabis alpina]
Length=230

 Score =   128 bits (322),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 107/223 (48%), Positives = 136/223 (61%), Gaps = 16/223 (7%)
 Frame = +1

Query  106  MAAPEVDGSNWLLDLGFEDIPLPGGKFPPLEPGYQWHssailspappsiRQDESYV-KFD  282
            M +PE   +NWL      D PL  G F      + W     +  +     + + ++   D
Sbjct  1    MVSPE--NTNWL-----SDYPLIDGAFSDQNHTFPWQIDHHIDGSASVSVEVDGFLCDSD  53

Query  283  VSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILS  462
            V     +RKR+KS AC G ++SKA +EK RR RLND+F ELS VM+PG+PPK DK AIL+
Sbjct  54   VIKEPGSRKRLKSEAC-GGSNSKACKEKQRRDRLNDKFTELSNVMEPGRPPKTDKVAILN  112

Query  463  DAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkalNS  642
            DA+RMV Q R+EAQKLK+    LQE++ ELK EKNEL+DEKQKLK EK+++E QLKA+  
Sbjct  113  DAIRMVNQAREEAQKLKDLNSSLQEKIKELKDEKNELRDEKQKLKIEKERIEQQLKAIKP  172

Query  643  RPG--FLPHPPA-TAVPFPTPHHLVGGKLVPFVGYPGIPMWQF  762
            +P   FLP P   T      P    G KLVPF  YPG  MWQF
Sbjct  173  QPQPCFLPTPQTLTQAQAQAP----GSKLVPFTTYPGFAMWQF  211



>gb|AJO70790.1| bHLH transcription factor bHLH57 [Eleusine coracana]
Length=256

 Score =   129 bits (324),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 84/147 (57%), Positives = 110/147 (75%), Gaps = 3/147 (2%)
 Frame = +1

Query  331  SGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRMVLQLRDEAQKL  510
            S    +KA REK+RR +LN+RF EL  +++PGK PKMDKSAIL+DA+R+V +LR EAQKL
Sbjct  91   SAQPSTKACREKIRRDKLNERFLELGAILEPGKTPKMDKSAILNDAIRVVSELRTEAQKL  150

Query  511  KESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkalNSRPGFLPHPPAT-AVPF  687
            K+S E LQE++ ELKAEKNEL++EKQ+LK EK+ LE Q+K +N+RP  +PHPP   A  F
Sbjct  151  KDSNESLQEKIKELKAEKNELREEKQRLKAEKENLEQQIKFMNARPSLVPHPPVIPASAF  210

Query  688  PTPHHLVGGK--LVPFVGYPGIPMWQF  762
              P     G+  ++P +GYPG PMWQF
Sbjct  211  TAPQGPAAGQKLMMPVIGYPGFPMWQF  237



>ref|NP_001146503.1| uncharacterized protein LOC100280093 [Zea mays]
 gb|ACG47187.1| bHLH transcription factor [Zea mays]
Length=257

 Score =   129 bits (324),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 93/172 (54%), Positives = 116/172 (67%), Gaps = 12/172 (7%)
 Frame = +1

Query  280  DVSNGCSARKRMKSGACSGAA--DSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSA  453
            DV     + KR++SG C+      SKA REKMRR +LNDRF EL   ++PGKP K DK+A
Sbjct  68   DVFKEPGSNKRLRSG-CNDVHVPTSKASREKMRRNKLNDRFLELGSTLEPGKPVKADKAA  126

Query  454  ILSDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlka  633
            ILSDA RMV+QLR EAQ+LKE+   L+E++ ELKAEK+EL+DEKQKLK EK+ LE Q+K 
Sbjct  127  ILSDATRMVIQLRSEAQQLKETNGSLEEKIKELKAEKDELRDEKQKLKLEKESLEHQMKL  186

Query  634  lNSRPGFLPHPPATAVPFP----TPHHLVGGK-----LVPFVGYPGIPMWQF  762
            + S P ++PHP     PFP     P H  G       ++PFV YPG PMWQF
Sbjct  187  MTSTPTYMPHPTLMPAPFPQAPLAPFHAQGQAAGQKLMMPFVSYPGYPMWQF  238



>ref|XP_006847910.1| hypothetical protein AMTR_s00029p00112130 [Amborella trichopoda]
 gb|ERN09491.1| hypothetical protein AMTR_s00029p00112130 [Amborella trichopoda]
Length=225

 Score =   128 bits (321),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 88/156 (56%), Positives = 112/156 (72%), Gaps = 3/156 (2%)
 Frame = +1

Query  298  SARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRM  477
            S+RKR +  +C  A  SKA REKMRR RLNDRF EL  ++DPG+PPK DK+ ILSDA R 
Sbjct  53   SSRKRARDESCC-APGSKACREKMRRDRLNDRFLELGSILDPGRPPKADKATILSDAARA  111

Query  478  VLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkalNSRP-GF  654
            + QLR EAQKLKE+ E LQE + +LK EKNEL+DEK +LK +K++LE Q+KA++  P GF
Sbjct  112  LSQLRIEAQKLKEANEKLQETIKDLKVEKNELRDEKTRLKADKERLEQQVKAMSMAPTGF  171

Query  655  LPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQF  762
            +PHP A    F  P  + G K VP+ GYP + MWQ+
Sbjct  172  IPHPAAIHA-FAAPSQVGGAKAVPYSGYPAMTMWQW  206



>ref|XP_006594652.1| PREDICTED: transcription factor ILR3-like [Glycine max]
Length=144

 Score =   125 bits (315),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 84/132 (64%), Positives = 104/132 (79%), Gaps = 7/132 (5%)
 Frame = +1

Query  367  MRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRMVLQLRDEAQKLKESFEDLQEQVN  546
            MRR RLNDRF EL  ++ PG P KMDK+ ILSDAVR+V QL++EAQKL+ES E+LQE++N
Sbjct  1    MRRDRLNDRFMELWSIVGPGMPLKMDKAVILSDAVRVVSQLQEEAQKLRESSENLQEKIN  60

Query  547  ELKAeknelkdekqklkeekdklelqlkalNSRPGFLPHPPATAVPFPTPHHLVGGKLVP  726
            ELKAEKNEL+DEKQ+LK EKD +E +L AL+S+P FLP        FP+   +VG KLVP
Sbjct  61   ELKAEKNELRDEKQRLKAEKDSIEQKLIALSSQPSFLPA-------FPSAGQVVGSKLVP  113

Query  727  FVGYPGIPMWQF  762
            F+GYPG+ MWQF
Sbjct  114  FMGYPGVAMWQF  125



>ref|XP_007021087.1| DNA binding protein, putative [Theobroma cacao]
 gb|EOY12612.1| DNA binding protein, putative [Theobroma cacao]
Length=235

 Score =   128 bits (322),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 93/170 (55%), Positives = 123/170 (72%), Gaps = 2/170 (1%)
 Frame = +1

Query  256  QDESYVKFDVSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPP  435
             D S+   D      ++KR++S +C+ ++ SKA REK+RR RLND+F EL  +++PG+PP
Sbjct  48   NDGSFGDLDGLKESGSKKRVRSESCNPSS-SKACREKLRRDRLNDKFMELGSILEPGRPP  106

Query  436  KMDKSAILSDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdkl  615
            K DK+AIL DAVRMV QLR EAQKLK+S   LQE++ ELK+EKNEL+DEKQ+LK EK++L
Sbjct  107  KTDKAAILIDAVRMVTQLRGEAQKLKDSNSSLQEKIKELKSEKNELRDEKQRLKAEKERL  166

Query  616  elqlkalNSRPGFLPHPPATAVPFPTPHHLV-GGKLVPFVGYPGIPMWQF  762
            E QLK +N++P F+P  PA    F        G KLVPF+GYPG+ MWQF
Sbjct  167  EQQLKTMNAQPSFMPPGPAIPAAFAAAQGQAPGNKLVPFIGYPGVAMWQF  216



>gb|EMS54079.1| Transcription factor ILR3 [Triticum urartu]
Length=240

 Score =   128 bits (322),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 109/232 (47%), Positives = 139/232 (60%), Gaps = 24/232 (10%)
 Frame = +1

Query  106  MAAPEVDG-SNWLLDLG-FEDIPLPG-GKFPPLEPGYQWHssailspappsiRQDESYV-  273
            M+ P  DG  +W LD G  ED+P    G FP       W +S   S     +    S+V 
Sbjct  1    MSLPPTDGGDDWFLDCGILEDLPAAACGAFP-------WDASVSSSNPSAEVG---SHVN  50

Query  274  KFDVSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSA  453
            K D+     + KR++S  C G   SKA R K+RR +LNDRF EL   +DPGKP K DK+A
Sbjct  51   KLDLPKDSGSNKRLRSEPC-GRPTSKACRGKVRRDKLNDRFLELGTTLDPGKPVKADKAA  109

Query  454  ILSDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlka  633
            ILSDA RMV QLR EAQ+LK++   L++++ ELKAEK+EL+DEKQKLK EK+ LE Q+K 
Sbjct  110  ILSDATRMVTQLRAEAQQLKDTNGSLEDKIKELKAEKDELRDEKQKLKLEKETLEHQMKL  169

Query  634  lNSRPGFLPHPP--------ATAVPFPTPHHLVGGKL-VPFVGYPGIPMWQF  762
            L + P ++PHP         A   PF      +G KL +PFVGYPG PMWQ 
Sbjct  170  LTATPAYMPHPTMMPSPFAQAPMAPFHAQAQALGQKLMMPFVGYPGYPMWQL  221



>ref|XP_008677332.1| PREDICTED: LOC100284429 isoform X1 [Zea mays]
 gb|ACF84747.1| unknown [Zea mays]
 gb|AFW61271.1| putative HLH DNA-binding domain superfamily protein [Zea mays]
 gb|AIB04286.1| bHLH transcription factor, partial [Zea mays]
Length=253

 Score =   128 bits (322),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 107/231 (46%), Positives = 137/231 (59%), Gaps = 30/231 (13%)
 Frame = +1

Query  127  GSNWLLDLG-FEDIPLPG-GKFPPLEPGYQWHssailspappsiRQDESYVKF-------  279
            G +W LD G  +D+P    G FP       W +S   S     +    SYV         
Sbjct  15   GDDWFLDCGILDDLPAAACGAFP-------WDASPSSSNPSVEVG---SYVNANDAFKEP  64

Query  280  -DVSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAI  456
             DV     + KR++SG+ S    SKA RE+MRR +LNDRF EL   ++PGKP K DK+AI
Sbjct  65   NDVFKEPGSSKRLRSGS-SDMPTSKACRERMRRNKLNDRFLELGSALEPGKPVKADKAAI  123

Query  457  LSDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkal  636
            LSDA RMV+QLR E+Q+LKE+   L+E++ ELKAEK+EL+DEKQKLK EK+ LE Q+K +
Sbjct  124  LSDATRMVIQLRSESQQLKETNGSLEEKIKELKAEKDELRDEKQKLKLEKESLEHQMKLM  183

Query  637  NSRPGFLPHPPATAVPFP----TPHHLVGGK-----LVPFVGYPGIPMWQF  762
             S P ++PHP     PF      P H  G       ++PFVGYPG PMWQF
Sbjct  184  ASAPAYMPHPTLMPAPFAQAPLAPFHAQGQAAGQKLMMPFVGYPGYPMWQF  234



>gb|AFW57417.1| putative HLH DNA-binding domain superfamily protein [Zea mays]
Length=257

 Score =   128 bits (322),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 92/171 (54%), Positives = 114/171 (67%), Gaps = 10/171 (6%)
 Frame = +1

Query  280  DVSNGCSARKRMKSGACS-GAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAI  456
            DV     + KR++SG        SKA REKMRR +LNDRF EL   ++PGKP K DK+AI
Sbjct  68   DVFKEPGSNKRLRSGFNDVHVPTSKASREKMRRNKLNDRFLELGSTLEPGKPVKADKAAI  127

Query  457  LSDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkal  636
            LSDA RMV+QLR EAQ+LKE+   L+E++ ELKAEK+EL+DEKQKLK EK+ LE Q+K +
Sbjct  128  LSDATRMVIQLRSEAQQLKETNGSLEEKIKELKAEKDELRDEKQKLKLEKESLEHQMKLM  187

Query  637  NSRPGFLPHPPATAVPFP----TPHHLVGGK-----LVPFVGYPGIPMWQF  762
             S P ++PHP     PFP     P H  G       ++PFV YPG PMWQF
Sbjct  188  TSTPTYMPHPTLMPAPFPQAPLAPFHAQGQAAGQKLMMPFVSYPGYPMWQF  238



>ref|XP_010062961.1| PREDICTED: transcription factor ILR3-like isoform X1 [Eucalyptus 
grandis]
Length=239

 Score =   127 bits (320),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 114/223 (51%), Positives = 145/223 (65%), Gaps = 7/223 (3%)
 Frame = +1

Query  106  MAAPEVDGSNWLLDLGFEDIPLP----GGKFPPLEPGYQWHssailspappsiRQDESYV  273
            M +PE   +NW+ D G  D        GG F     G+ W    +   +  S   D S  
Sbjct  1    MVSPE--QANWIYDCGLIDDIAAAAADGGPFQVSGSGFSWPDQPLNGSSIFSAEIDGSLG  58

Query  274  KFDVSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSA  453
              D      ++KR++S +CS A+ SKA REK+RR RLND+F EL+ +++PG+PPK DK+A
Sbjct  59   DSDGVKENGSKKRVRSESCS-ASSSKACREKLRRDRLNDKFLELASILEPGRPPKTDKAA  117

Query  454  ILSDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlka  633
            IL D VRMV QLR EAQKLK+S   LQE++ ELKAEKNEL+DEKQ+LK EK+KLE QLKA
Sbjct  118  ILIDVVRMVTQLRGEAQKLKDSNSSLQEKIKELKAEKNELRDEKQRLKAEKEKLEHQLKA  177

Query  634  lNSRPGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQF  762
            +N++P FLP PPA    F T     G KLVPF+GYPG+ MWQF
Sbjct  178  MNAQPSFLPPPPAIPAAFATQGQAPGNKLVPFIGYPGVAMWQF  220



>emb|CDY71937.1| BnaA05g35780D, partial [Brassica napus]
Length=219

 Score =   127 bits (318),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 99/211 (47%), Positives = 130/211 (62%), Gaps = 11/211 (5%)
 Frame = +1

Query  130  SNWLLDLGFEDIPLPGGKFPPLEPGYQWHssailspappsiRQDESYVKFDVSNGCSARK  309
            +NWL D       L  G F    P + W      +        D      DV     ++K
Sbjct  1    TNWLSDYPL----LIDGVFSHHSPTFPWQIDGSATTVSVE-EVDGFLCDSDVIKEPGSKK  55

Query  310  RMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRMVLQL  489
            R+KS + +G + SKA REK RR +LND+F ELS +++PG+ PK DK AI++DA+RMV Q 
Sbjct  56   RVKSESNAGPS-SKACREKQRRDKLNDKFTELSSILEPGRAPKTDKVAIINDAIRMVNQA  114

Query  490  RDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkalNSRPGFLPHPP  669
            RDEAQ+LK+   +LQE++ ELK EKNEL+DEKQKLK EKD++E QLKA+N++P FLP+PP
Sbjct  115  RDEAQRLKDLNSNLQEKIKELKDEKNELRDEKQKLKTEKDRIEQQLKAINTQPCFLPNPP  174

Query  670  ATAVPFPTPHHLVGGKLVPFVGYPGIPMWQF  762
                   +     G KLVPF  YPG  MWQF
Sbjct  175  TL-----SQAQAPGSKLVPFTTYPGFAMWQF  200



>ref|NP_001242620.1| uncharacterized protein LOC100806838 [Glycine max]
 gb|ACU21305.1| unknown [Glycine max]
Length=231

 Score =   127 bits (318),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 96/212 (45%), Positives = 134/212 (63%), Gaps = 10/212 (5%)
 Frame = +1

Query  136  WLLDLGFEDIPLPGGKFPPLEPG-YQWHssailspappsiRQDESYVKFDVSNGCSARKR  312
            WL   GF DIP+ G  F   + G + W   +     P ++  +  Y    +       KR
Sbjct  12   WLYVYGF-DIPVAGSDFMASDSGGFSWGPQSYNFKGPSNMSLEMEYSLDSIVMENGPSKR  70

Query  313  MKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRMVLQLR  492
            +++ +C  A+ SKA REK+RR +LN+RF ELS +++PG+ PK DK A+LSDA R+V+QLR
Sbjct  71   LRTESC--ASGSKACREKLRRDKLNERFLELSSILEPGRQPKTDKVALLSDAARVVIQLR  128

Query  493  DEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkalNSRPGFLPHPPA  672
            +EA++LKE  ++LQ +V ELK EKNEL+DEK +LKEEK+KLE Q+K  N +P FLP  P 
Sbjct  129  NEAERLKEMNDELQAKVKELKGEKNELRDEKNRLKEEKEKLEKQVKLTNIQPSFLPQAP-  187

Query  673  TAVPFPTPHHLVGGKLVPFVGYPGIPMWQFAA  768
                      +   KL+PF+GYPGI MWQF +
Sbjct  188  -----DAKGQVGSHKLIPFIGYPGIAMWQFMS  214



>ref|XP_009144925.1| PREDICTED: transcription factor bHLH115 [Brassica rapa]
Length=225

 Score =   126 bits (316),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 102/219 (47%), Positives = 133/219 (61%), Gaps = 13/219 (6%)
 Frame = +1

Query  106  MAAPEVDGSNWLLDLGFEDIPLPGGKFPPLEPGYQWHssailspappsiRQDESYVKFDV  285
            M  PE   +NWL D       L  G F    P + W      +        D      DV
Sbjct  1    MVFPE--NTNWLSDYPL----LIDGVFSHHSPTFPWQIDGSATTVSVE-EVDGFLCDSDV  53

Query  286  SNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSD  465
                 ++KR+KS + +G + SKA REK RR +LN++F ELS V++PG+ PK DK AI++D
Sbjct  54   IKEPGSKKRVKSESNAGPS-SKACREKQRRDKLNEKFTELSSVLEPGRAPKTDKVAIIND  112

Query  466  AVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkalNSR  645
            A+RMV Q RDEAQ+LK+   +LQE++ ELK EKNEL+DEKQKLK EKD++E QLKA+N++
Sbjct  113  AIRMVNQARDEAQRLKDLNSNLQEKIKELKDEKNELRDEKQKLKTEKDRIEQQLKAINTQ  172

Query  646  PGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQF  762
            P FLP+PP       +     G KLVPF  YPG  MWQF
Sbjct  173  PCFLPNPPTL-----SQAQAPGSKLVPFTTYPGFAMWQF  206



>ref|XP_006304584.1| hypothetical protein CARUB_v10011628mg [Capsella rubella]
 gb|EOA37482.1| hypothetical protein CARUB_v10011628mg [Capsella rubella]
Length=226

 Score =   126 bits (316),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 100/223 (45%), Positives = 133/223 (60%), Gaps = 20/223 (9%)
 Frame = +1

Query  106  MAAPEVDGSNWLLDLGFEDIPLPGGKFPPLEPGYQWHssailspappsiRQDESYVKFDV  285
            M +PE   +NWL      D PL  G F    P + W      S +      D      DV
Sbjct  1    MVSPE--NTNWL-----SDYPLIDGVFSDQNPSFPWQIDGSSSVSVEV---DGFLCDSDV  50

Query  286  SNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSD  465
                 ++KR+K+ +C+G++ SKA REK RR RLND+F ELS +++PG+ PK DK +I++D
Sbjct  51   IKEPGSKKRIKTESCTGSS-SKACREKQRRDRLNDKFTELSSILEPGRTPKTDKVSIIND  109

Query  466  AVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkalNSR  645
            A+RMV   RDEAQKLK+    LQE++ ELK EKNEL+DEK KLK EK+++E QLKA+N++
Sbjct  110  AIRMVNHARDEAQKLKDLNSSLQEKIKELKDEKNELRDEKHKLKTEKERIEQQLKAINTQ  169

Query  646  PG----FLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQF  762
            P     FLP+ P  +          G KLVPF  YP   MWQF
Sbjct  170  PQPQPCFLPNQPTLSQ-----AQAPGSKLVPFTTYPSFAMWQF  207



>gb|AFN84533.1| BHLH domain class transcription factor [Fragaria x ananassa]
Length=231

 Score =   126 bits (316),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 106/219 (48%), Positives = 139/219 (63%), Gaps = 7/219 (3%)
 Frame = +1

Query  106  MAAPEVDGSNWLLDLGFEDIPLPGGKFPPLEPGYQWHssailspappsiRQDESYVKFDV  285
            MA+PE   +NWL D G  D       F      + W    +   +  S+  D S    + 
Sbjct  1    MASPE--NTNWLYDYGLID----DANFHVSSSAFNWPVQPLPGSSSVSVELDGSLGDVEG  54

Query  286  SNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSD  465
                 ++KR++S + S  + SKA REK+RR RLND+F EL  +++PG+PPK DK+AIL D
Sbjct  55   LKESGSKKRVRSESSSATS-SKACREKLRRDRLNDKFMELGSILEPGRPPKTDKAAILID  113

Query  466  AVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkalNSR  645
            AVRMV QLR EAQKLK+S   LQE++ ELK EK EL+DEKQ+LK EK+KLE QLKA+ ++
Sbjct  114  AVRMVNQLRGEAQKLKDSNSSLQEKIKELKTEKTELRDEKQRLKSEKEKLEQQLKAMTAQ  173

Query  646  PGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQF  762
            P F+P PPA    FP      G K+VPF+GYPG+ MWQF
Sbjct  174  PSFMPAPPAIPAAFPAQGQAHGNKMVPFIGYPGVAMWQF  212



>emb|CDY42475.1| BnaA10g08510D [Brassica napus]
Length=233

 Score =   126 bits (316),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 104/224 (46%), Positives = 135/224 (60%), Gaps = 15/224 (7%)
 Frame = +1

Query  106  MAAPEVDGSNWLLDLGFEDIPLPGGKFPPLEPGYQW--HssailspappsiRQDESYVKF  279
            M +PE   +NW+ +L   D     G F    PG+ W  H   I   +      D S    
Sbjct  1    MVSPE--NANWISELIDADY----GSFTIQGPGFSWPLHQQPIGVSSLGV---DGSAGNS  51

Query  280  DVSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAIL  459
            + +    ++KR +  + S A  SKA REK RR RLND+F EL  +++PG PPK DK+AIL
Sbjct  52   EATKEPGSKKRARCESSS-ATSSKACREKQRRDRLNDKFMELGAILEPGNPPKTDKAAIL  110

Query  460  SDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkalN  639
             DAVRMV QLR EAQKLK+S   LQ+++ ELK EKNEL+DEKQ+LK EK+KLE QLKA+N
Sbjct  111  VDAVRMVTQLRGEAQKLKDSNSSLQDKIKELKTEKNELRDEKQRLKTEKEKLEQQLKAMN  170

Query  640  S--RPGFLPHPPATAVPFPTPH-HLVGGKLVPFVGYPGIPMWQF  762
            +  +P F P PP     F +      G K+VP + YPG+ MWQF
Sbjct  171  APPQPSFFPAPPMMPTAFASAQGQAPGNKMVPVISYPGVAMWQF  214



>ref|XP_004957935.1| PREDICTED: transcription factor ILR3-like isoform X1 [Setaria 
italica]
Length=255

 Score =   126 bits (317),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 89/143 (62%), Positives = 109/143 (76%), Gaps = 4/143 (3%)
 Frame = +1

Query  346  SKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRMVLQLRDEAQKLKESFE  525
            +KA REK+RR +LN+RF EL  +++PGK PKMDKSAIL+DA+R V +LR EAQKLK+S E
Sbjct  94   TKACREKIRRDKLNERFLELGAILEPGKTPKMDKSAILNDAIRAVGELRSEAQKLKDSNE  153

Query  526  DLQEQVNELKAeknelkdekqklkeekdklelqlkalNSRPGFLPHPPAT-AVPFPTPHH  702
             LQE++ ELKAEKNEL+DEKQ+LK EK+ LE Q+K LNSRP  +PHPP   A  F TP  
Sbjct  154  SLQEKIKELKAEKNELRDEKQRLKAEKESLEQQIKFLNSRPSLVPHPPVIPASAFTTPKG  213

Query  703  --LVGGKL-VPFVGYPGIPMWQF  762
                G KL +P +GYPG PMWQF
Sbjct  214  PPAAGHKLMMPVIGYPGFPMWQF  236



>ref|XP_004957936.1| PREDICTED: transcription factor ILR3-like isoform X2 [Setaria 
italica]
Length=254

 Score =   126 bits (317),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 89/143 (62%), Positives = 109/143 (76%), Gaps = 4/143 (3%)
 Frame = +1

Query  346  SKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRMVLQLRDEAQKLKESFE  525
            +KA REK+RR +LN+RF EL  +++PGK PKMDKSAIL+DA+R V +LR EAQKLK+S E
Sbjct  93   TKACREKIRRDKLNERFLELGAILEPGKTPKMDKSAILNDAIRAVGELRSEAQKLKDSNE  152

Query  526  DLQEQVNELKAeknelkdekqklkeekdklelqlkalNSRPGFLPHPPAT-AVPFPTPHH  702
             LQE++ ELKAEKNEL+DEKQ+LK EK+ LE Q+K LNSRP  +PHPP   A  F TP  
Sbjct  153  SLQEKIKELKAEKNELRDEKQRLKAEKESLEQQIKFLNSRPSLVPHPPVIPASAFTTPKG  212

Query  703  --LVGGKL-VPFVGYPGIPMWQF  762
                G KL +P +GYPG PMWQF
Sbjct  213  PPAAGHKLMMPVIGYPGFPMWQF  235



>ref|XP_010479562.1| PREDICTED: transcription factor bHLH115-like [Camelina sativa]
Length=227

 Score =   125 bits (315),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 97/223 (43%), Positives = 128/223 (57%), Gaps = 19/223 (9%)
 Frame = +1

Query  106  MAAPEVDGSNWLLDLGFEDIPLPGGKFPPLEPGYQWHssailspappsiRQDESYVKFDV  285
            M +PE    NWL      D PL    F    P + W      S +      D      DV
Sbjct  1    MVSPE--NMNWL-----SDYPLIDSAFSDQNPTFPWQIDGSSSVSVEV---DGFLCDSDV  50

Query  286  SNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSD  465
                 +RKR+K+ +C+  + SKA REK RR RLND+F ELS +++PG+ PK DK AI++D
Sbjct  51   DKEPGSRKRIKTESCTAGSSSKACREKQRRDRLNDKFTELSSILEPGRTPKTDKVAIIND  110

Query  466  AVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkalNSR  645
            A+RMV   RDEAQKLK+    LQ+++ ELK EK+EL+DEK KLK EK+++E QLK + ++
Sbjct  111  AIRMVNHARDEAQKLKDLNSSLQDKIKELKNEKSELRDEKHKLKIEKERIEQQLKEIKTQ  170

Query  646  ----PGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQF  762
                  FLP+PP  +          G KLVPF  YPG  MWQF
Sbjct  171  HQPQSCFLPNPPTLSQA-----QAPGSKLVPFTTYPGFAMWQF  208



>ref|XP_009120001.1| PREDICTED: transcription factor ILR3-like [Brassica rapa]
Length=233

 Score =   125 bits (314),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 104/224 (46%), Positives = 135/224 (60%), Gaps = 15/224 (7%)
 Frame = +1

Query  106  MAAPEVDGSNWLLDLGFEDIPLPGGKFPPLEPGYQW--HssailspappsiRQDESYVKF  279
            M +PE   +NW+ +L    I    G F    PG+ W  H   I   +      D S    
Sbjct  1    MVSPE--NANWISEL----IDAEYGSFTIQGPGFSWPLHQQPIGVSSLGV---DGSAGNS  51

Query  280  DVSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAIL  459
            + +    ++KR +  + S A  SKA REK RR RLND+F EL  +++PG PPK DK+AIL
Sbjct  52   EATKEPGSKKRARCESSS-ATSSKACREKQRRDRLNDKFMELGAILEPGNPPKTDKAAIL  110

Query  460  SDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkalN  639
             DAVRMV QLR EAQKLK+S   LQ+++ ELK EKNEL+DEKQ+LK EK+KLE QLKA+N
Sbjct  111  VDAVRMVTQLRGEAQKLKDSNSSLQDKIKELKTEKNELRDEKQRLKTEKEKLEQQLKAMN  170

Query  640  S--RPGFLPHPPATAVPFPTPH-HLVGGKLVPFVGYPGIPMWQF  762
            +  +P F P PP     F +      G K+VP + YPG+ MWQF
Sbjct  171  APPQPSFFPAPPMMPTAFASAQGQAPGNKMVPVISYPGVAMWQF  214



>ref|XP_009420541.1| PREDICTED: LOW QUALITY PROTEIN: transcription factor ILR3-like 
[Musa acuminata subsp. malaccensis]
Length=149

 Score =   121 bits (304),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 85/135 (63%), Positives = 101/135 (75%), Gaps = 4/135 (3%)
 Frame = +1

Query  367  MRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRMVLQLRDEAQKLKESFEDLQEQVN  546
            MRR +LNDRF ELS ++DPGKPP  DK+AILS A R+V +L DEAQKLK+S E LQE++ 
Sbjct  1    MRREKLNDRFMELSSLLDPGKPPMTDKAAILSGAARLVSRLHDEAQKLKDSNESLQEKIK  60

Query  547  ELKAeknelkdekqklkeekdklelqlkalNSRPGFLPHPPATAVPFPTPHHLVGGKL-V  723
            ELKAEKNEL+DEKQKLK EK+ LE Q+K LN+RP +LPHPP     FPT     G KL V
Sbjct  61   ELKAEKNELRDEKQKLKAEKESLEQQVKLLNARPNYLPHPPLAPSLFPTQSQAAGHKLMV  120

Query  724  PFVGYPGIPMWQFAA  768
            P +G+   PMWQF A
Sbjct  121  PIMGF---PMWQFMA  132



>gb|KHN36564.1| Transcription factor bHLH115 [Glycine soja]
Length=239

 Score =   124 bits (310),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 103/225 (46%), Positives = 141/225 (63%), Gaps = 22/225 (10%)
 Frame = +1

Query  127  GSNWLLDLGFEDIPLPGGKFPPLEPG-YQW--HssailspappsiRQDESYVKFDVSNGC  297
             S+WL D GF DIP+ G  F   + G ++W   S     P+  S+  + S     + NG 
Sbjct  9    ASDWLYDYGF-DIPVAGSDFMASDSGGFRWGPQSHNFKGPSNMSLEMEYSLDSAVMENGP  67

Query  298  SARKRMKSGACSGAADSKAQREKMRRYRLNDR--------FQELSCVMDPGKPPKMDKSA  453
            S  KR+++ +C  A+ SKA REK+RR +LN+R        F ELS +++P + PK DK A
Sbjct  68   S--KRLRTESC--ASGSKACREKLRRDKLNERHAIILHIVFLELSSILEPSRQPKSDKVA  123

Query  454  ILSDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlka  633
            ILSDA R+V+QLR+EA++LKE  ++LQ +V ELK EKNEL+DEK +LKEEK+KLE Q+K 
Sbjct  124  ILSDAARVVIQLRNEAKRLKEMNDELQAKVKELKGEKNELRDEKNRLKEEKEKLEQQVKV  183

Query  634  lNSRPGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQFAA  768
             N +P FLP  P           +   KL+PF+GYPGI MWQF +
Sbjct  184  ANIQPSFLPQAP------DAKGQVGSHKLIPFIGYPGIAMWQFMS  222



>gb|KCW70124.1| hypothetical protein EUGRSUZ_F03420 [Eucalyptus grandis]
Length=226

 Score =   123 bits (309),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 88/135 (65%), Positives = 107/135 (79%), Gaps = 0/135 (0%)
 Frame = +1

Query  358  REKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRMVLQLRDEAQKLKESFEDLQE  537
            REK+RR RLND+F EL+ +++PG+PPK DK+AIL D VRMV QLR EAQKLK+S   LQE
Sbjct  73   REKLRRDRLNDKFLELASILEPGRPPKTDKAAILIDVVRMVTQLRGEAQKLKDSNSSLQE  132

Query  538  QVNELKAeknelkdekqklkeekdklelqlkalNSRPGFLPHPPATAVPFPTPHHLVGGK  717
            ++ ELKAEKNEL+DEKQ+LK EK+KLE QLKA+N++P FLP PPA    F T     G K
Sbjct  133  KIKELKAEKNELRDEKQRLKAEKEKLEHQLKAMNAQPSFLPPPPAIPAAFATQGQAPGNK  192

Query  718  LVPFVGYPGIPMWQF  762
            LVPF+GYPG+ MWQF
Sbjct  193  LVPFIGYPGVAMWQF  207



>ref|XP_010935491.1| PREDICTED: transcription factor bHLH115-like [Elaeis guineensis]
Length=230

 Score =   123 bits (309),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 87/174 (50%), Positives = 120/174 (69%), Gaps = 7/174 (4%)
 Frame = +1

Query  259  DESYVKFDVSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPK  438
            +E+Y         S+RKR++  +C+G   SKA REKMRR +LNDRF ELS ++DPG+PPK
Sbjct  39   EEAYRDVCGLEQTSSRKRIRDESCAGPK-SKACREKMRRDKLNDRFLELSSILDPGRPPK  97

Query  439  MDKSAILSDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdkle  618
             +KS+ILSDA R+++QLR EAQ+LKES E LQE + +LK EKNEL++EK KLK +K++L+
Sbjct  98   FEKSSILSDAARLLVQLRSEAQQLKESNEKLQEAIKDLKVEKNELREEKMKLKADKERLD  157

Query  619  lqlkalNSRP-GFLPHPPA-----TAVPFPTPHHLVGGKLVPFVGYPGIPMWQF  762
             Q+KA++  P GF+PHP A         F    H    K+ PF  +PG+ MWQ+
Sbjct  158  QQVKAMSVPPAGFMPHPIAFHPATATAAFAPHGHTPANKVAPFTAFPGVAMWQW  211



>gb|EMT27826.1| Transcription factor ILR3 [Aegilops tauschii]
Length=218

 Score =   123 bits (309),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 93/176 (53%), Positives = 115/176 (65%), Gaps = 11/176 (6%)
 Frame = +1

Query  265  SYVK-FDVSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKM  441
            SYV   DV     + KR++S  C G   SKA R K+RR +LNDRF EL   +DPGKP K 
Sbjct  25   SYVNNSDVPKDSGSNKRLRSEPC-GRPTSKACRGKVRRDKLNDRFLELGTTLDPGKPVKA  83

Query  442  DKSAILSDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklel  621
            DK+AILSDA RMV QLR EAQ+LK++   L++++ ELKAEK+EL+DEKQKLK EK+ LE 
Sbjct  84   DKAAILSDATRMVTQLRAEAQQLKDTNGSLEDKIKELKAEKDELRDEKQKLKLEKETLEH  143

Query  622  qlkalNSRPGFLPHPPATAVPFP----TPHHLVGGKL-----VPFVGYPGIPMWQF  762
            Q+K L + P ++PHP     PF      P H  G  L     +PFVGYPG PMWQ 
Sbjct  144  QMKLLTATPAYMPHPTMMPSPFAQAPMAPFHAQGQALGQKLMMPFVGYPGYPMWQL  199



>gb|KFK27081.1| hypothetical protein AALP_AA8G331500 [Arabis alpina]
Length=234

 Score =   123 bits (309),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 107/222 (48%), Positives = 136/222 (61%), Gaps = 10/222 (5%)
 Frame = +1

Query  106  MAAPEVDGSNWLLDLGFEDIPLPGGKFPPLEPGYQWHssa-ilspappsiRQDESYVKFD  282
            M +PE   +NW+ DL   D     G F    PG+ W     I   +  S   D S    +
Sbjct  1    MVSPE--NANWICDLIDADY----GSFTIQGPGFSWPVQQPIGVSSNSSAGVDGSVGNSE  54

Query  283  VSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILS  462
             S    ++KR +S + S A  SKA REK RR RLND+F EL  +++PG PPK DK+AIL 
Sbjct  55   ASKEPGSKKRGRSESSS-ATSSKACREKQRRDRLNDKFMELGTILEPGNPPKTDKAAILV  113

Query  463  DAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkalNS  642
            DAVRMV QLR EAQKLK+S   LQ+++ ELK EKNEL+DEKQ+LK EK+KLE QLKA+N+
Sbjct  114  DAVRMVTQLRGEAQKLKDSNSSLQDKIKELKTEKNELRDEKQRLKTEKEKLEQQLKAMNA  173

Query  643  -RPGFLPHPPATAVPFPTPH-HLVGGKLVPFVGYPGIPMWQF  762
             +P F P PP     F +      G K+VP + YPG+ MWQF
Sbjct  174  PQPSFFPAPPMMPTAFASAQGQAPGNKMVPIISYPGVAMWQF  215



>ref|XP_003562971.1| PREDICTED: transcription factor ILR3-like [Brachypodium distachyon]
Length=251

 Score =   122 bits (307),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 109/237 (46%), Positives = 145/237 (61%), Gaps = 23/237 (10%)
 Frame = +1

Query  106  MAAPEVDGSNWLLDLGF-EDIPL------PGGKF---PPLEPGYQWHssailspappsiR  255
            MA+PE  GSNW+ D    +D+ +      P G F   PP++P  Q H+ A    A     
Sbjct  1    MASPE--GSNWVFDCPLMDDLAVADFAAGPAGAFYWTPPMQP--QMHTQAQAVSAASLPN  56

Query  256  ---QDESYVKFDV--SNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMD  420
               +  S V  D   + G    KR +S + S    SKA REK+RR +LN+RF EL  V+D
Sbjct  57   PCAEINSPVSLDCEHAKGHPTNKRPRSES-SAQPSSKACREKVRRDKLNERFLELGAVLD  115

Query  421  PGKPPKMDKSAILSDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklke  600
            PGK PK+DK AIL+DA+R+V +LR EA+KLK+S E LQ+++ ELK+EKNEL+DEKQKLK 
Sbjct  116  PGKTPKIDKCAILNDAIRVVTELRSEAEKLKDSNESLQDKIKELKSEKNELRDEKQKLKA  175

Query  601  ekdklelqlkalNSRPGFLPHP---PATAVPFPTPHHLVGGKLVPFVGYPGIPMWQF  762
            EK+ LE Q+K +N+R   +PHP   PATA             ++P +GYPG PMWQF
Sbjct  176  EKESLEQQIKFMNARQSLVPHPSVIPATAFAAAQGQAAGQKLMMPVIGYPGFPMWQF  232



>gb|KHN25765.1| Transcription factor ILR3 [Glycine soja]
Length=239

 Score =   122 bits (306),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 102/222 (46%), Positives = 139/222 (63%), Gaps = 22/222 (10%)
 Frame = +1

Query  136  WLLDLGFEDIPLPGGKFPPLEPG-YQW--HssailspappsiRQDESYVKFDVSNGCSAR  306
            WL D GF DIP+ G  F   + G + W   S     P+  S+  + S     + NG S  
Sbjct  12   WLYDYGF-DIPVAGSDFMASDSGGFSWGPQSYNFKGPSNMSLEMEYSLDSTVMENGPS--  68

Query  307  KRMKSGACSGAADSKAQREKMRRYRLNDR--------FQELSCVMDPGKPPKMDKSAILS  462
            KR+++ +C  A+ SKA REK+RR +LN+R        F ELS +++PG+ PK DK A+LS
Sbjct  69   KRLRTESC--ASGSKACREKLRRDKLNERHAIILHIVFLELSSILEPGRQPKTDKVALLS  126

Query  463  DAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkalNS  642
            DA R+V+QLR+EA++LKE  ++LQ +V ELK EKNEL+DEK +LKEEK+KLE Q+K  N 
Sbjct  127  DAARVVIQLRNEAERLKEMNDELQAKVKELKGEKNELRDEKNRLKEEKEKLEKQVKLTNI  186

Query  643  RPGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQFAA  768
            +P FLP  P           +   KL+PF+GYPGI MWQF +
Sbjct  187  QPSFLPQAP------DAKGQVGSHKLIPFIGYPGIAMWQFMS  222



>emb|CDY35576.1| BnaC05g27050D [Brassica napus]
Length=228

 Score =   121 bits (304),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 101/224 (45%), Positives = 133/224 (59%), Gaps = 20/224 (9%)
 Frame = +1

Query  106  MAAPEVDGSNWLLDLGFEDIPLPGGKFPPLEPGYQWHssailspappsiRQDESYVKFDV  285
            M  PE   +NWL      D PL  G F    P + W      +     +  D      DV
Sbjct  1    MVFPE--NTNWL-----SDYPLIDGVFSHQSPTFPWQIDGSATVTVEEV--DGFLCDSDV  51

Query  286  SNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSD  465
                 ++KR+KS + +G + SKA REK RR +LND+F ELS +++PG+ PK DK AI++D
Sbjct  52   IKEPGSKKRVKSESYAGPS-SKASREKQRRDKLNDKFTELSSILEPGRAPKTDKVAIIND  110

Query  466  AVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkalNS-  642
             +RMV Q RDEAQ+LK+    LQE++ ELK EKNEL+DEKQKLK EKD++E QLKA+N+ 
Sbjct  111  VIRMVNQARDEAQRLKDLNSSLQEKIKELKDEKNELRDEKQKLKIEKDRIEQQLKAINTQ  170

Query  643  ----RPGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQF  762
                +P FLP+PP  +          G KLVP+  YPG  MWQF
Sbjct  171  PLPAQPCFLPNPPTLSQ-----AQAPGSKLVPYTTYPGFAMWQF  209



>gb|EPS70109.1| hypothetical protein M569_04652 [Genlisea aurea]
Length=232

 Score =   122 bits (305),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 94/213 (44%), Positives = 131/213 (62%), Gaps = 4/213 (2%)
 Frame = +1

Query  124  DGSNWLLDLGFEDIPLPGGKFPPLEPGYQWHssailspappsiRQDESYVKFDVSNGCSA  303
            + +NWL D G  DI    G      PG+ W +      +      + S    D+      
Sbjct  5    ENTNWLCDYGIGDIHENPGIAN--NPGFSWPAQGCNFSSNSGGELEGSLGDSDMQRETGN  62

Query  304  RKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRMVL  483
            +KR +   C+ ++ SKA REK RR RLND+F EL+ +++PG+PPK DK+AIL DAVRM+ 
Sbjct  63   KKRARPNTCASSS-SKACREKQRRDRLNDKFMELAALLEPGRPPKADKAAILVDAVRMLN  121

Query  484  QLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkalNSRPGFLPH  663
            QL+ EAQKLK+S  +L E++ ELKAEK+EL++EKQ+LK EK+ LE +LK +  +P F+P 
Sbjct  122  QLKGEAQKLKDSNLNLHEKIKELKAEKSELREEKQRLKVEKENLEYKLKTM-PQPNFMPA  180

Query  664  PPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQF  762
            P A    F   +   G KLVP + YPG+ MWQF
Sbjct  181  PAAIPAAFAAQNQAGGEKLVPVISYPGVAMWQF  213



>ref|XP_010461939.1| PREDICTED: transcription factor bHLH115 [Camelina sativa]
Length=226

 Score =   121 bits (304),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 96/219 (44%), Positives = 128/219 (58%), Gaps = 12/219 (5%)
 Frame = +1

Query  106  MAAPEVDGSNWLLDLGFEDIPLPGGKFPPLEPGYQWHssailspappsiRQDESYVKFDV  285
            M +PE   +NWL      D PL  G F    P + W      S +      D      DV
Sbjct  1    MVSPE--NTNWL-----SDYPLIDGAFSDHNPTFPWQIDGSSSVSVEV---DGFLCDSDV  50

Query  286  SNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSD  465
                 +RKR+K+ +C+G++ SKA REK RR RLND+F ELS +++PG+ PK +K AI++D
Sbjct  51   IKEPGSRKRIKTESCTGSS-SKACREKQRRDRLNDKFTELSSILEPGRTPKTEKVAIIND  109

Query  466  AVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkalNSR  645
            A+RMV   RDEAQKLK+    LQE++ ELK EK+EL+DEK KLK EK+++E QLK + ++
Sbjct  110  AIRMVNHARDEAQKLKDLNSSLQEKIKELKDEKSELRDEKHKLKIEKERIEQQLKEIKTQ  169

Query  646  PGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQF  762
            P   P          +     G KLVPF  YPG  MWQF
Sbjct  170  PQPPPCFLPNPPTL-SQAQAPGSKLVPFTTYPGFAMWQF  207



>ref|XP_008803703.1| PREDICTED: transcription factor bHLH115-like [Phoenix dactylifera]
Length=230

 Score =   121 bits (304),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 87/176 (49%), Positives = 118/176 (67%), Gaps = 7/176 (4%)
 Frame = +1

Query  253  RQDESYVKFDVSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKP  432
            R +E+Y         S RKRM+  +C+G   SKA REK+RR RLNDRF ELS ++DPG+ 
Sbjct  37   RIEEAYRDASGLEQASLRKRMRDESCAGP-KSKACREKIRRDRLNDRFLELSAILDPGRH  95

Query  433  PKMDKSAILSDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdk  612
            PK DK++ILSDA R+++QLR EAQ+LKES E LQE + +LK EKNEL++EK +LK +K++
Sbjct  96   PKFDKASILSDAARLLVQLRSEAQQLKESNEKLQETIKDLKVEKNELREEKMRLKADKER  155

Query  613  lelqlkalNSRP-GFLPHP----PATAVPFPTPH-HLVGGKLVPFVGYPGIPMWQF  762
            LE Q+K ++  P GF+PHP    P  A     PH      K  PF  +PG+ MW++
Sbjct  156  LEQQIKVMSVPPAGFMPHPIAYHPTAATVAFAPHGQAPPSKCAPFTAFPGVAMWKW  211



>ref|XP_002316971.1| basic helix-loop-helix family protein [Populus trichocarpa]
 gb|EEE97583.1| basic helix-loop-helix family protein [Populus trichocarpa]
Length=249

 Score =   122 bits (305),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 85/135 (63%), Positives = 104/135 (77%), Gaps = 0/135 (0%)
 Frame = +1

Query  358  REKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRMVLQLRDEAQKLKESFEDLQE  537
            REK+RR RLND+F EL  ++DPG+ PK DK+AIL DAVR+V QLR EAQKLK+S   LQE
Sbjct  96   REKLRRDRLNDKFMELGSILDPGRTPKTDKAAILVDAVRIVTQLRGEAQKLKDSNSSLQE  155

Query  538  QVNELKAeknelkdekqklkeekdklelqlkalNSRPGFLPHPPATAVPFPTPHHLVGGK  717
            ++ ELKAEKNEL+DEKQ+LK EK+KLE QLK +NS+P F+P PPA    F T     G K
Sbjct  156  KIKELKAEKNELRDEKQRLKAEKEKLEQQLKTMNSQPSFMPAPPAIPAAFTTQGQAPGNK  215

Query  718  LVPFVGYPGIPMWQF  762
            L+PF+ YPG+ MWQF
Sbjct  216  LMPFISYPGVAMWQF  230



>ref|NP_001185192.1| transcription factor bHLH115 [Arabidopsis thaliana]
 gb|AEE32619.1| transcription factor bHLH115 [Arabidopsis thaliana]
Length=292

 Score =   122 bits (307),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 90/165 (55%), Positives = 117/165 (71%), Gaps = 10/165 (6%)
 Frame = +1

Query  280  DVSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAIL  459
            DV    S+RKR+K+ +C+G+ +SKA REK RR RLND+F ELS V++PG+ PK DK AI+
Sbjct  115  DVIKEPSSRKRIKTESCTGS-NSKACREKQRRDRLNDKFTELSSVLEPGRTPKTDKVAII  173

Query  460  SDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkalN  639
            +DA+RMV Q RDEAQKLK+    LQE++ ELK EKNEL+DEKQKLK EK++++ QLKA+ 
Sbjct  174  NDAIRMVNQARDEAQKLKDLNSSLQEKIKELKDEKNELRDEKQKLKVEKERIDQQLKAIK  233

Query  640  S----RPGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQF  762
            +    +P FLP+P        +     G KLVPF  YPG  MWQF
Sbjct  234  TQPQPQPCFLPNPQTL-----SQAQAPGSKLVPFTTYPGFAMWQF  273



>ref|XP_010109550.1| hypothetical protein L484_018285 [Morus notabilis]
 gb|EXC23154.1| hypothetical protein L484_018285 [Morus notabilis]
Length=308

 Score =   122 bits (307),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 83/155 (54%), Positives = 115/155 (74%), Gaps = 2/155 (1%)
 Frame = +1

Query  301  ARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRMV  480
            +RKR +S   SGA+ SKA REK+RR RLN+RF EL  VM+PG+ PK DK+AILSDA R++
Sbjct  136  SRKRPRSDQSSGASCSKACREKLRRDRLNERFLELVAVMEPGRLPKTDKAAILSDAARIL  195

Query  481  LQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkalNSRPGFLP  660
             QLR E++ LKE+ +DL E++ ELKAEKNEL++E+Q+L+E+K++LE Q+KA+ ++  FLP
Sbjct  196  TQLRSESRHLKETIDDLHEKIKELKAEKNELREERQRLREDKERLEQQVKAMAAQTSFLP  255

Query  661  HPPATAVPFPTPHHLVGGKLVPFVGYP-GIPMWQF  762
            H PA +    T       KL+PF+ YP G+ MWQ 
Sbjct  256  HSPAISSAL-TVQGQSTNKLMPFISYPGGVTMWQM  289



>ref|XP_010092690.1| hypothetical protein L484_019764 [Morus notabilis]
 gb|EXB51987.1| hypothetical protein L484_019764 [Morus notabilis]
Length=210

 Score =   120 bits (301),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 110/221 (50%), Positives = 132/221 (60%), Gaps = 32/221 (14%)
 Frame = +1

Query  106  MAAPEVDGSNWLLDLGF-EDIPLPGGKFPPLE-PGYQWHssailspappsiRQDESYVKF  279
            M +PE    NW+ D    ED+P+PGG  P L+ P + W S +   P   S   DES    
Sbjct  1    MGSPE--NPNWVFDYSLIEDLPIPGGGLPALDPPSFPWPSHSFTPPTTVSADFDESLANS  58

Query  280  DVSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAIL  459
            D       RK                           RF EL  + +PG+PPKMDK+ IL
Sbjct  59   DGFKEAGCRK---------------------------RFLELGSISEPGRPPKMDKAVIL  91

Query  460  SDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkalN  639
             DAVRMV  LR EA+KLKES E LQE++NELKAEKNEL+DEKQ+LK EKD L+ Q+KAL 
Sbjct  92   GDAVRMVTHLRMEAEKLKESNEKLQEKINELKAEKNELRDEKQRLKAEKDVLDKQVKALT  151

Query  640  SRPGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQF  762
            ++P FL HPPA   PFP P  +VGGKL+PFVGYPGI MWQF
Sbjct  152  TQPSFL-HPPAIPPPFPGPGQVVGGKLMPFVGYPGISMWQF  191



>ref|XP_002462974.1| hypothetical protein SORBIDRAFT_02g035580 [Sorghum bicolor]
 gb|EER99495.1| hypothetical protein SORBIDRAFT_02g035580 [Sorghum bicolor]
Length=254

 Score =   121 bits (304),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 84/143 (59%), Positives = 110/143 (77%), Gaps = 4/143 (3%)
 Frame = +1

Query  346  SKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRMVLQLRDEAQKLKESFE  525
            +KA REK+RR +LN+RF EL  +++PGK PKMDKSAIL+DA+R+V +LR EA++LK+S E
Sbjct  93   TKASREKIRRDKLNERFLELGAILEPGKTPKMDKSAILNDAIRVVGELRSEAKELKDSNE  152

Query  526  DLQEQVNELKAeknelkdekqklkeekdklelqlkalNSRPGFLPHPP---ATAVPFPTP  696
             LQE++ ELKAEKNEL+DEKQ+LK EK+ LE Q+K LN+RP  +PH P   A+A   P  
Sbjct  153  SLQEKIKELKAEKNELRDEKQRLKAEKESLEQQIKFLNARPSLVPHHPVISASAFTAPQG  212

Query  697  HHLVGGKL-VPFVGYPGIPMWQF  762
              + G KL +P +GYPG PMWQF
Sbjct  213  PAVAGHKLMMPVLGYPGFPMWQF  235



>ref|NP_001150796.1| LOC100284429 [Zea mays]
 gb|ACG40431.1| bHLH transcription factor [Zea mays]
Length=238

 Score =   120 bits (302),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 98/223 (44%), Positives = 128/223 (57%), Gaps = 29/223 (13%)
 Frame = +1

Query  127  GSNWLLDLG-FEDIPLPG-GKFPPLEPGYQWHssailspappsiRQDESYVKFDVSNGCS  300
            G +W LD G  +D+P    G FP       W +S              S    +V +  +
Sbjct  15   GDDWFLDCGILDDLPAAACGAFP-------WDASPSS-----------SNPSVEVGSYVN  56

Query  301  ARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRMV  480
            A    K           ++RE+MRR +LNDRF EL   ++PGKP K DK+AILSDA RMV
Sbjct  57   ANDAFKEPNDVFKEPGSSKRERMRRNKLNDRFLELGSALEPGKPVKADKAAILSDATRMV  116

Query  481  LQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkalNSRPGFLP  660
            +QLR E+Q+LKE+   L+E++ ELKAEK+EL+DEKQKLK EK+ LE Q+K + S P ++P
Sbjct  117  IQLRSESQQLKETNGSLEEKIKELKAEKDELRDEKQKLKLEKESLEHQMKLMASAPAYMP  176

Query  661  HPPATAVPFP----TPHHLVGGK-----LVPFVGYPGIPMWQF  762
            HP     PF     TP H  G       ++PFVGYPG PMWQF
Sbjct  177  HPTLMPAPFAQAPLTPFHAQGQAAGQKLMMPFVGYPGYPMWQF  219



>ref|XP_011030891.1| PREDICTED: transcription factor ILR3-like [Populus euphratica]
Length=251

 Score =   120 bits (302),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 84/135 (62%), Positives = 103/135 (76%), Gaps = 0/135 (0%)
 Frame = +1

Query  358  REKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRMVLQLRDEAQKLKESFEDLQE  537
            REK+RR RLND+F EL  ++DPG+ PK DK+AIL DAVR+V QLR EAQ LK+S   LQE
Sbjct  98   REKLRRDRLNDKFMELGSILDPGRTPKTDKAAILVDAVRVVTQLRGEAQTLKDSNSSLQE  157

Query  538  QVNELKAeknelkdekqklkeekdklelqlkalNSRPGFLPHPPATAVPFPTPHHLVGGK  717
            ++ ELKAEKNEL+DEKQ+LK EK+KLE QLK +NS+P F+P PPA    F T     G K
Sbjct  158  KIKELKAEKNELRDEKQRLKAEKEKLEQQLKTMNSQPSFMPAPPAIPAAFTTQAQAPGNK  217

Query  718  LVPFVGYPGIPMWQF  762
            L+PF+ YPG+ MWQF
Sbjct  218  LMPFISYPGVAMWQF  232



>ref|XP_010940315.1| PREDICTED: transcription factor ILR3-like isoform X2 [Elaeis 
guineensis]
Length=188

 Score =   119 bits (297),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 88/170 (52%), Positives = 117/170 (69%), Gaps = 9/170 (5%)
 Frame = +1

Query  277  FDVSN--GCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKS  450
             DV N    S+RKR++  +CSG   +KA REKMRR RLNDRF ELS ++DPG+PPK DK+
Sbjct  1    MDVCNLDQASSRKRVRDESCSGP-KTKACREKMRRDRLNDRFLELSSILDPGRPPKSDKA  59

Query  451  AILSDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlk  630
            +IL DA R+++QLR EA++LKES E LQE + +LK EKNEL+DEK +LK +K++LE Q+K
Sbjct  60   SILGDAARVLVQLRSEARQLKESNEKLQETIKDLKVEKNELRDEKTRLKADKERLEQQVK  119

Query  631  alNSRP-GFLPHP----PATAVPFPTPH-HLVGGKLVPFVGYPGIPMWQF  762
            A++  P GF+PHP    PA A     PH      K      +PG+ MWQ+
Sbjct  120  AMSVPPAGFMPHPIAFHPAAATVAFAPHGQAPANKAGSVTAFPGVAMWQW  169



>ref|XP_010940314.1| PREDICTED: transcription factor ILR3-like isoform X1 [Elaeis 
guineensis]
Length=230

 Score =   119 bits (299),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 87/173 (50%), Positives = 119/173 (69%), Gaps = 7/173 (4%)
 Frame = +1

Query  262  ESYVKFDVSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKM  441
            E+Y+     +  S+RKR++  +CSG   +KA REKMRR RLNDRF ELS ++DPG+PPK 
Sbjct  40   EAYMDVCNLDQASSRKRVRDESCSGPK-TKACREKMRRDRLNDRFLELSSILDPGRPPKS  98

Query  442  DKSAILSDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklel  621
            DK++IL DA R+++QLR EA++LKES E LQE + +LK EKNEL+DEK +LK +K++LE 
Sbjct  99   DKASILGDAARVLVQLRSEARQLKESNEKLQETIKDLKVEKNELRDEKTRLKADKERLEQ  158

Query  622  qlkalNSRP-GFLPHP----PATAVPFPTPHHLV-GGKLVPFVGYPGIPMWQF  762
            Q+KA++  P GF+PHP    PA A     PH      K      +PG+ MWQ+
Sbjct  159  QVKAMSVPPAGFMPHPIAFHPAAATVAFAPHGQAPANKAGSVTAFPGVAMWQW  211



>ref|XP_003597042.1| Transcription factor ILR3 [Medicago truncatula]
 gb|AES67293.1| BHLH domain class transcription factor [Medicago truncatula]
 gb|AFK41880.1| unknown [Medicago truncatula]
Length=260

 Score =   120 bits (301),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 102/245 (42%), Positives = 137/245 (56%), Gaps = 41/245 (17%)
 Frame = +1

Query  127  GSNWLLDLGFEDIPLPGGKF--------------------------PP-----LEPGYQW  213
             S WL D G++DI +    F                          PP     LE  Y  
Sbjct  9    SSIWLYDYGYDDISISAADFMASDSSAAASTFTWMPQPQSQTQIINPPSSHMSLEMDYSL  68

Query  214  HssailspappsiRQDESYVKFDVSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDR  393
             S+ + S     +  + S     + NG S R R +S A S    SKA REK+RR +LNDR
Sbjct  69   DSTVMESNPSKRMEMEYSLDSTVLENGPSKRLRTESYASS----SKAGREKVRRDKLNDR  124

Query  394  FQELSCVMDPGKPPKMDKSAILSDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknel  573
            F ELS V++P   PK DK ++L+DAVR+V QLR+EA++LKE  ++L+E+V ELKAEK EL
Sbjct  125  FMELSSVLEPDTLPKTDKVSLLNDAVRVVTQLRNEAERLKERNDELREKVKELKAEKKEL  184

Query  574  kdekqklkeekdklelqlkalNSRPGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPM  753
            +DEK KLK +K+KLE Q+K  + +  FL +  A A    T +H    KL+PF+GYPGI M
Sbjct  185  RDEKNKLKLDKEKLEQQVKLASVQSNFLSN--AMAAKGQTANH----KLMPFIGYPGISM  238

Query  754  WQFAA  768
            WQF +
Sbjct  239  WQFMS  243



>gb|ABK96448.1| unknown [Populus trichocarpa x Populus deltoides]
Length=263

 Score =   119 bits (299),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 97/168 (58%), Positives = 126/168 (75%), Gaps = 1/168 (1%)
 Frame = +1

Query  259  DESYVKFDVSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPK  438
            D S+ + DV     ++KR +S +CS ++ SKA REK+RR RLND+F EL  +++PG+ PK
Sbjct  78   DGSFGECDVQKEPCSKKRGRSESCSASS-SKACREKLRRDRLNDKFIELGSILEPGRTPK  136

Query  439  MDKSAILSDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdkle  618
             DK+AIL DAVRMV QLRDEAQKL++S   LQE++ ELKAEK EL+DEKQ+LK EK+KLE
Sbjct  137  TDKAAILVDAVRMVTQLRDEAQKLRDSNSSLQEKIKELKAEKIELRDEKQRLKAEKEKLE  196

Query  619  lqlkalNSRPGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQF  762
             QLKA++S+P F+P PPA    F T     G KL+PF+GYPG+ MWQF
Sbjct  197  HQLKAMSSQPSFMPAPPAIPAAFATQGQAPGNKLMPFIGYPGVAMWQF  244



>ref|XP_006370611.1| basic helix-loop-helix family protein [Populus trichocarpa]
 gb|ERP67180.1| basic helix-loop-helix family protein [Populus trichocarpa]
Length=264

 Score =   119 bits (299),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 97/168 (58%), Positives = 126/168 (75%), Gaps = 1/168 (1%)
 Frame = +1

Query  259  DESYVKFDVSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPK  438
            D S+ + DV     ++KR +S +CS ++ SKA REK+RR RLND+F EL  +++PG+ PK
Sbjct  79   DGSFGECDVQKEPCSKKRGRSESCSASS-SKACREKLRRDRLNDKFIELGSILEPGRTPK  137

Query  439  MDKSAILSDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdkle  618
             DK+AIL DAVRMV QLRDEAQKL++S   LQE++ ELKAEK EL+DEKQ+LK EK+KLE
Sbjct  138  TDKAAILVDAVRMVTQLRDEAQKLRDSNSSLQEKIKELKAEKIELRDEKQRLKAEKEKLE  197

Query  619  lqlkalNSRPGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQF  762
             QLKA++S+P F+P PPA    F T     G KL+PF+GYPG+ MWQF
Sbjct  198  HQLKAMSSQPSFMPAPPAIPAAFATQGQAPGNKLMPFIGYPGVAMWQF  245



>gb|AFW61272.1| putative HLH DNA-binding domain superfamily protein [Zea mays]
Length=238

 Score =   119 bits (297),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 97/223 (43%), Positives = 127/223 (57%), Gaps = 29/223 (13%)
 Frame = +1

Query  127  GSNWLLDLG-FEDIPLPG-GKFPPLEPGYQWHssailspappsiRQDESYVKFDVSNGCS  300
            G +W LD G  +D+P    G FP       W +S              S    +V +  +
Sbjct  15   GDDWFLDCGILDDLPAAACGAFP-------WDASPSS-----------SNPSVEVGSYVN  56

Query  301  ARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRMV  480
            A    K           ++RE+MRR +LNDRF EL   ++PGKP K DK+AILSDA RMV
Sbjct  57   ANDAFKEPNDVFKEPGSSKRERMRRNKLNDRFLELGSALEPGKPVKADKAAILSDATRMV  116

Query  481  LQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkalNSRPGFLP  660
            +QLR E+Q+LKE+   L+E++ ELKAEK+EL+DEKQKLK EK+ LE Q+K + S P ++P
Sbjct  117  IQLRSESQQLKETNGSLEEKIKELKAEKDELRDEKQKLKLEKESLEHQMKLMASAPAYMP  176

Query  661  HPPATAVPFP----TPHHLVGGK-----LVPFVGYPGIPMWQF  762
            HP     PF      P H  G       ++PFVGYPG PMWQF
Sbjct  177  HPTLMPAPFAQAPLAPFHAQGQAAGQKLMMPFVGYPGYPMWQF  219



>ref|XP_006493504.1| PREDICTED: transcription factor ILR3-like, partial [Citrus sinensis]
Length=157

 Score =   116 bits (291),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 75/129 (58%), Positives = 98/129 (76%), Gaps = 0/129 (0%)
 Frame = +1

Query  376  YRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRMVLQLRDEAQKLKESFEDLQEQVNELK  555
            + L   F EL  +++PG+PPK DK+ ILSD VRM+ QLR EAQKLK+S EDLQE++ ELK
Sbjct  10   HILQRSFLELGSMLEPGRPPKTDKATILSDVVRMMEQLRTEAQKLKQSTEDLQEKIKELK  69

Query  556  AeknelkdekqklkeekdklelqlkalNSRPGFLPHPPATAVPFPTPHHLVGGKLVPFVG  735
            AEKNEL+DEKQ+LK +K+KLE Q+KA+++  GFLPHP + +  F     +   KLVPF+G
Sbjct  70   AEKNELRDEKQRLKADKEKLEQQVKAMSAPSGFLPHPSSMSAAFAAQSQVASNKLVPFIG  129

Query  736  YPGIPMWQF  762
            YPG+ MWQF
Sbjct  130  YPGVAMWQF  138



>gb|ACL54160.1| unknown [Zea mays]
 gb|ACN26446.1| unknown [Zea mays]
 gb|AFW57419.1| putative HLH DNA-binding domain superfamily protein isoform 1 
[Zea mays]
 gb|AFW57420.1| putative HLH DNA-binding domain superfamily protein isoform 2 
[Zea mays]
Length=160

 Score =   116 bits (291),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 80/141 (57%), Positives = 99/141 (70%), Gaps = 9/141 (6%)
 Frame = +1

Query  367  MRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRMVLQLRDEAQKLKESFEDLQEQVN  546
            MRR +LNDRF EL   ++PGKP K DK+AILSDA RMV+QLR EAQ+LKE+   L+E++ 
Sbjct  1    MRRNKLNDRFLELGSTLEPGKPVKADKAAILSDATRMVIQLRSEAQQLKETNGSLEEKIK  60

Query  547  ELKAeknelkdekqklkeekdklelqlkalNSRPGFLPHPPATAVPFP----TPHHLVGG  714
            ELKAEK+EL+DEKQKLK EK+ LE Q+K + S P ++PHP     PFP     P H  G 
Sbjct  61   ELKAEKDELRDEKQKLKLEKESLEHQMKLMTSTPTYMPHPTLMPAPFPQAPLAPFHAQGQ  120

Query  715  K-----LVPFVGYPGIPMWQF  762
                  ++PFV YPG PMWQF
Sbjct  121  AAGQKLMMPFVSYPGYPMWQF  141



>gb|KHN27978.1| Transcription factor ILR3 [Glycine soja]
Length=234

 Score =   118 bits (296),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 106/222 (48%), Positives = 136/222 (61%), Gaps = 10/222 (5%)
 Frame = +1

Query  106  MAAPEVDGSNWLLDLGFED---IPLPGGKFPPLEPGYQWHssailspappsiRQDESYVK  276
            M +PE   SNWL D    D   IP+    F      + W               D S   
Sbjct  1    MVSPE--NSNWLFDYPLIDDDVIPVGDSSFAVSASTFSWPPPPANVSVEI----DASLGD  54

Query  277  FDVSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAI  456
             D     + +KR +  + S A+ SKA REK+RR RLND+F EL  +++PG+PPK DK+AI
Sbjct  55   SDGPKDTALKKRARCDS-STASSSKACREKLRRDRLNDKFVELGSILEPGRPPKTDKAAI  113

Query  457  LSDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkal  636
            L DA RMV QLRDEA KLK+S   LQE++ ELKAEKNEL+DEKQ+LK EK+KLE+Q+K++
Sbjct  114  LIDAARMVTQLRDEALKLKDSNTSLQEKIKELKAEKNELRDEKQRLKAEKEKLEMQVKSM  173

Query  637  NSRPGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQF  762
            N++P FLP PPA    F       G KL+PF+ YPG+ MWQF
Sbjct  174  NAQPAFLPPPPAIPAAFAPQGQAPGNKLMPFIRYPGVAMWQF  215



>ref|XP_004172808.1| PREDICTED: transcription factor ILR3-like, partial [Cucumis sativus]
Length=168

 Score =   115 bits (288),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 84/137 (61%), Positives = 103/137 (75%), Gaps = 6/137 (4%)
 Frame = +1

Query  358  REKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRMVLQLRDEAQKLKESFEDLQE  537
            REK+RR RLND+F EL  ++DPG+PPK DK+AIL DAVRMV QLR E QKLKES   LQE
Sbjct  17   REKLRRDRLNDKFLELGSILDPGRPPKTDKAAILVDAVRMVNQLRSETQKLKESNSSLQE  76

Query  538  QVNELKAeknelkdekqklkeekdklelqlkal-NSRPGFLPHPPATAVPFPTPHHLVGG  714
            ++ ELKAEKNEL+DEKQ+LK +K++LE Q+K++   +PGFLP P  T   FP      G 
Sbjct  77   KIKELKAEKNELRDEKQRLKADKERLEQQVKSIPAQQPGFLPPPIPT---FPA-QGQAGN  132

Query  715  KLVPFVGY-PGIPMWQF  762
            KLVPF+GY P + MWQF
Sbjct  133  KLVPFIGYHPSVAMWQF  149



>gb|KHG21334.1| Transcription factor ILR3 -like protein [Gossypium arboreum]
Length=238

 Score =   116 bits (291),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 102/206 (50%), Positives = 137/206 (67%), Gaps = 8/206 (4%)
 Frame = +1

Query  154  FEDIPLPGGKFPPLEPGYQWHssailspappsiRQ-DESYVKFDVSNGCSARKRMKSGAC  330
             +DIP+P   +     G+ W +  I +P+     + D S+   D      ++KR++S +C
Sbjct  19   IDDIPVPDDPYA----GFAWSTQPIDAPSNVVSVEIDGSFGDSDGLKESGSKKRVRSESC  74

Query  331  SGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRMVLQLRDEAQKL  510
            S ++ SKA REK+RR RLND+F EL  +++PG+PPK DKSAIL DAVRMV QLR EAQKL
Sbjct  75   SASS-SKACREKLRRDRLNDKFMELGSILEPGRPPKTDKSAILIDAVRMVTQLRGEAQKL  133

Query  511  KESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkalNSRPGFL--PHPPATAVP  684
            K+S   LQE++ ELKAEKNEL+DEKQ+LK EK++LE QLKA+N++P F+        A  
Sbjct  134  KDSNTSLQERIKELKAEKNELRDEKQRLKAEKERLEQQLKAMNAQPSFMPPAPSAIPAAF  193

Query  685  FPTPHHLVGGKLVPFVGYPGIPMWQF  762
               P    G KLVP +GYPG+ MWQF
Sbjct  194  AAAPGQAPGNKLVPLIGYPGVAMWQF  219



>ref|XP_008651108.1| PREDICTED: uncharacterized protein LOC100273838 isoform X1 [Zea 
mays]
Length=253

 Score =   117 bits (292),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 84/161 (52%), Positives = 114/161 (71%), Gaps = 14/161 (9%)
 Frame = +1

Query  307  KRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRMVLQ  486
            KR +S + + ++ +KA REK+RR +LN+RF EL  +++PGK PKMDK+AILSDA+R+V +
Sbjct  79   KRPRSESTTESS-TKASREKIRRDKLNERFLELGAILEPGKTPKMDKTAILSDAIRVVGE  137

Query  487  LRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkalNSRPGFLPHP  666
            LR EA+KLK+S E+LQE++ ELKAEKNEL+DEKQ+LK EK+ LE Q+K LN+RP  +PH 
Sbjct  138  LRSEAKKLKDSNENLQEKIKELKAEKNELRDEKQRLKAEKESLEQQIKFLNARPSLVPHH  197

Query  667  PATAVPFPTP---------HHLVGGKLVPFVGYPGIPMWQF  762
            P                  H L    ++P +GYPG PMWQF
Sbjct  198  PVIPASAFPAPQGPAAAARHKL----MMPVIGYPGFPMWQF  234



>ref|XP_011048283.1| PREDICTED: transcription factor ILR3-like [Populus euphratica]
Length=269

 Score =   117 bits (293),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 96/168 (57%), Positives = 126/168 (75%), Gaps = 1/168 (1%)
 Frame = +1

Query  259  DESYVKFDVSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPK  438
            D S+ + DV     ++KR +S +CS ++ SKA REK+RR RLND+F EL  +++PG+ PK
Sbjct  84   DGSFGECDVQKEPCSKKRGRSESCSASS-SKACREKLRRDRLNDKFIELGSILEPGRTPK  142

Query  439  MDKSAILSDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdkle  618
             DK+AIL DAVRMV QLR EAQKL++S  +LQE++ ELKAEK EL+DEKQ+LK EK+KLE
Sbjct  143  TDKAAILVDAVRMVTQLRGEAQKLRDSNSNLQEKIKELKAEKIELRDEKQRLKAEKEKLE  202

Query  619  lqlkalNSRPGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQF  762
             QLKA++S+P F+P PPA    F T     G KL+PF+GYPG+ MWQF
Sbjct  203  YQLKAMSSQPSFMPAPPAIPAAFATQGQAPGNKLMPFIGYPGVAMWQF  250



>ref|XP_008651109.1| PREDICTED: uncharacterized protein LOC100273838 isoform X2 [Zea 
mays]
 gb|ADX60077.1| bHLH transcription factor [Zea mays]
 tpg|DAA63013.1| TPA: putative HLH DNA-binding domain superfamily protein [Zea 
mays]
Length=252

 Score =   117 bits (292),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 84/161 (52%), Positives = 114/161 (71%), Gaps = 14/161 (9%)
 Frame = +1

Query  307  KRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRMVLQ  486
            KR +S + + ++ +KA REK+RR +LN+RF EL  +++PGK PKMDK+AILSDA+R+V +
Sbjct  78   KRPRSESTTESS-TKASREKIRRDKLNERFLELGAILEPGKTPKMDKTAILSDAIRVVGE  136

Query  487  LRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkalNSRPGFLPHP  666
            LR EA+KLK+S E+LQE++ ELKAEKNEL+DEKQ+LK EK+ LE Q+K LN+RP  +PH 
Sbjct  137  LRSEAKKLKDSNENLQEKIKELKAEKNELRDEKQRLKAEKESLEQQIKFLNARPSLVPHH  196

Query  667  PATAVPFPTP---------HHLVGGKLVPFVGYPGIPMWQF  762
            P                  H L    ++P +GYPG PMWQF
Sbjct  197  PVIPASAFPAPQGPAAAARHKL----MMPVIGYPGFPMWQF  233



>ref|XP_008813306.1| PREDICTED: transcription factor ILR3-like isoform X1 [Phoenix 
dactylifera]
Length=235

 Score =   115 bits (288),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 82/161 (51%), Positives = 114/161 (71%), Gaps = 7/161 (4%)
 Frame = +1

Query  298  SARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRM  477
            S+RKR++  +CSG   +KA REKMRR RLNDRF ELS ++DPG+PPK D+++ILSDA R+
Sbjct  57   SSRKRVRDESCSGPK-TKACREKMRRDRLNDRFLELSSILDPGRPPKSDRASILSDAARV  115

Query  478  VLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkalNSRP-GF  654
            ++QLR EAQ+LKES E+LQE + +LK EKNEL+DEK +LK +K++LE Q+KA++  P GF
Sbjct  116  LVQLRSEAQQLKESNENLQETIKDLKVEKNELRDEKTRLKADKERLEQQVKAMSVPPAGF  175

Query  655  LPHPPATAVPFPTPHHLVGG-----KLVPFVGYPGIPMWQF  762
            +PHP +         +   G     K      +PG+ MWQ+
Sbjct  176  MPHPISFHAAAAPVAYAPHGQAPANKAASVTAFPGVAMWQW  216



>ref|XP_008813314.1| PREDICTED: transcription factor ILR3-like isoform X2 [Phoenix 
dactylifera]
Length=230

 Score =   115 bits (287),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 82/161 (51%), Positives = 114/161 (71%), Gaps = 7/161 (4%)
 Frame = +1

Query  298  SARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRM  477
            S+RKR++  +CSG   +KA REKMRR RLNDRF ELS ++DPG+PPK D+++ILSDA R+
Sbjct  52   SSRKRVRDESCSGPK-TKACREKMRRDRLNDRFLELSSILDPGRPPKSDRASILSDAARV  110

Query  478  VLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkalNSRP-GF  654
            ++QLR EAQ+LKES E+LQE + +LK EKNEL+DEK +LK +K++LE Q+KA++  P GF
Sbjct  111  LVQLRSEAQQLKESNENLQETIKDLKVEKNELRDEKTRLKADKERLEQQVKAMSVPPAGF  170

Query  655  LPHPPATAVPFPTPHHLVGG-----KLVPFVGYPGIPMWQF  762
            +PHP +         +   G     K      +PG+ MWQ+
Sbjct  171  MPHPISFHAAAAPVAYAPHGQAPANKAASVTAFPGVAMWQW  211



>gb|KDO50387.1| hypothetical protein CISIN_1g032672mg [Citrus sinensis]
 gb|KDO50388.1| hypothetical protein CISIN_1g032672mg [Citrus sinensis]
 gb|KDO50389.1| hypothetical protein CISIN_1g032672mg [Citrus sinensis]
Length=136

 Score =   111 bits (277),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 71/117 (61%), Positives = 93/117 (79%), Gaps = 0/117 (0%)
 Frame = +1

Query  412  VMDPGKPPKMDKSAILSDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqk  591
            +++PG+PPK DK+ ILSD VRM+ QLR EAQKLK+S EDLQE++ ELKAEKNEL+DEKQ+
Sbjct  1    MLEPGRPPKTDKATILSDVVRMMEQLRTEAQKLKQSTEDLQEKIKELKAEKNELRDEKQR  60

Query  592  lkeekdklelqlkalNSRPGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQF  762
            LK +K+KLE Q+KA+++  GFLPHP + +  F     +   KLVPF+GYPG+ MWQF
Sbjct  61   LKADKEKLEQQVKAMSAPSGFLPHPSSMSAAFAAQSQVASNKLVPFIGYPGVAMWQF  117



>ref|XP_008454559.1| PREDICTED: transcription factor ILR3-like isoform X2 [Cucumis 
melo]
Length=207

 Score =   113 bits (282),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 82/137 (60%), Positives = 100/137 (73%), Gaps = 6/137 (4%)
 Frame = +1

Query  358  REKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRMVLQLRDEAQKLKESFEDLQE  537
            REK+RR RLND+F EL  ++DPG+PPK DK+AIL DAVRMV QLR E  KLKES   LQE
Sbjct  56   REKLRRDRLNDKFLELGSILDPGRPPKTDKAAILVDAVRMVNQLRSETHKLKESNSSLQE  115

Query  538  QVNELKAeknelkdekqklkeekdklelqlkal-NSRPGFLPHPPATAVPFPTPHHLVGG  714
            ++ ELKAEKNEL+DEKQ+LK +K++LE Q+K++   +PGFLP  P     FP      G 
Sbjct  116  KIKELKAEKNELRDEKQRLKADKERLEQQVKSMPAQQPGFLPPIPT----FPAQGQAPGN  171

Query  715  KLVPFVGY-PGIPMWQF  762
            KL PFVGY P + MWQF
Sbjct  172  KLFPFVGYHPSVAMWQF  188



>ref|NP_001239799.1| uncharacterized protein LOC100813088 [Glycine max]
 gb|ACU21616.1| unknown [Glycine max]
Length=233

 Score =   113 bits (283),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 95/170 (56%), Positives = 120/170 (71%), Gaps = 6/170 (4%)
 Frame = +1

Query  271  VKFDVSNGCS------ARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKP  432
            V+ D S G S      A K+      S A+ SKA REK+RR RLND+F EL  +++PG+P
Sbjct  45   VEIDASLGDSDGPKDTALKKRARCDSSTASSSKACREKLRRDRLNDKFVELGSILEPGRP  104

Query  433  PKMDKSAILSDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdk  612
            PK DK+AIL DA RMV QLRDEA KLK+S   LQE++ ELKAEKNEL+DEKQ+LK EK+K
Sbjct  105  PKTDKAAILIDAARMVTQLRDEALKLKDSNTSLQEKIKELKAEKNELRDEKQRLKAEKEK  164

Query  613  lelqlkalNSRPGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQF  762
            LE+Q+K++N++P FLP PPA    F       G KL+PF+ YPG+ MWQF
Sbjct  165  LEMQVKSMNAQPAFLPPPPAIPAAFAPQGQAPGNKLMPFIRYPGVAMWQF  214



>gb|ACN40301.1| unknown [Picea sitchensis]
Length=232

 Score =   113 bits (282),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 72/154 (47%), Positives = 98/154 (64%), Gaps = 3/154 (2%)
 Frame = +1

Query  304  RKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRMVL  483
            RKR +  +CS     KA REKMRR RLNDRF ELS +++PG+PPK DKSAILSDA+ +V 
Sbjct  62   RKRPRDESCSKHG-IKACREKMRRERLNDRFTELSILLEPGRPPKTDKSAILSDALSLVN  120

Query  484  QLRDEAQKLKESFEDLQEQVNELKAekne-lkdekqklkeekdklelqlkalNSRPGFLP  660
            QLR+EA KLK+S E L++ + ELK EKNE   ++ +   E++   +     + S PGF+P
Sbjct  121  QLREEAGKLKDSNEQLRQSIKELKTEKNELRDEKTRLKAEKERLDQQMKAMMTSPPGFMP  180

Query  661  HPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQF  762
            H  A +  F         K +P  G+PG+ MWQ+
Sbjct  181  H-LAVSHAFSAQSQAANSKTLPIPGFPGMAMWQW  213



>ref|XP_004487368.1| PREDICTED: transcription factor bHLH115-like [Cicer arietinum]
Length=236

 Score =   113 bits (282),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 96/218 (44%), Positives = 132/218 (61%), Gaps = 15/218 (7%)
 Frame = +1

Query  127  GSNWLLDLGFEDIPLPGGKF---PPLEPGYQW--HssailspappsiRQDESYVKFDVSN  291
             S WL D GF DI +    F         + W  H++    P+     + E  +   V  
Sbjct  9    SSCWLYDYGF-DISVAASDFMASDSTTAAFTWIPHTNITNPPSSNISLEMEYSLDSTVLE  67

Query  292  GCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAV  471
               + KR+K+   S A+ SKA REK+RR +LNDRF ELS V++P K PK DK  +L+DA 
Sbjct  68   NAPS-KRLKTE--SYASGSKACREKLRRDKLNDRFLELSSVLEPDKLPKTDKVTLLNDAA  124

Query  472  RMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkalN-SRP  648
            R++ QLR+EA++LKE  ++L+E+V ELKAEKNEL+DEK KLK +K+KLE Q+++    + 
Sbjct  125  RVITQLRNEAERLKERNDELREKVKELKAEKNELRDEKNKLKLDKEKLEQQVRSTTVQQS  184

Query  649  GFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQF  762
             FLP+  A A      H     KL+PF+GYPGI MWQF
Sbjct  185  SFLPNALAAAKGQTGSH-----KLMPFIGYPGISMWQF  217



>ref|XP_006837018.1| hypothetical protein AMTR_s00098p00170370 [Amborella trichopoda]
 gb|ERM99871.1| hypothetical protein AMTR_s00098p00170370 [Amborella trichopoda]
Length=224

 Score =   112 bits (281),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 86/160 (54%), Positives = 117/160 (73%), Gaps = 4/160 (3%)
 Frame = +1

Query  289  NGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDA  468
            N CS RKR +S  CSG+  SKA REKMRR RLNDRF EL  +++PG+PPK DK+ ILSDA
Sbjct  48   NLCS-RKRPRSEPCSGSG-SKACREKMRRDRLNDRFLELGAILEPGRPPKTDKATILSDA  105

Query  469  VRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkalNSRP  648
            +R++ QL+ EA+KLKE+ ++LQE++ +LKAEKNEL+DEK +LK +K++LE Q+KA+N+ P
Sbjct  106  IRVLNQLQSEARKLKEANDELQEKIKDLKAEKNELRDEKLRLKADKERLEQQVKAINTPP  165

Query  649  GFLPHPPATAVPFPT-PHHLVGGKLVPFVGY-PGIPMWQF  762
                 P   A   P  P    G K++PF+GY P + MWQ+
Sbjct  166  PSPFIPHPMAFSSPQGPAVGAGAKMMPFMGYQPTVAMWQW  205



>ref|XP_010539274.1| PREDICTED: transcription factor ILR3 [Tarenaya hassleriana]
Length=231

 Score =   112 bits (281),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 106/221 (48%), Positives = 132/221 (60%), Gaps = 11/221 (5%)
 Frame = +1

Query  106  MAAPEVDGSNWLLDLGFEDIPLPGGKFPPLEPGYQWHssa-ilspappsiRQDESYVKFD  282
            M +PE    NWL DL      +    F    PG+ W     I S +  S   D S    +
Sbjct  1    MVSPE--NPNWLYDL------IDDESFTIQGPGFSWPVQQPIGSSSIASAGADGSVSNLE  52

Query  283  VSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILS  462
             S    ++KR +    S A+ SKA REK RR RLND+F EL  +++PG P K DK+AIL 
Sbjct  53   TSKEPGSKKRGRP-ELSCASSSKACREKQRRDRLNDKFMELGSILEPGSPLKTDKAAILI  111

Query  463  DAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkalNS  642
            DAVRMV QLR EAQKLK+S   LQE++ ELKAEKNEL+DEKQ+LK EK+KLE Q+KA+N+
Sbjct  112  DAVRMVTQLRGEAQKLKDSNSSLQEKIKELKAEKNELRDEKQRLKAEKEKLEQQMKAMNA  171

Query  643  RPGFLPHPPATAVPFPTPHHLV-GGKLVPFVGYPGIPMWQF  762
            +  F P PP     F        G KLVP + YPG+ MWQF
Sbjct  172  QASFFPAPPPMPAAFAAAQGQAPGNKLVPIISYPGVAMWQF  212



>gb|ACG27921.1| DNA binding protein [Zea mays]
 gb|ACG35050.1| DNA binding protein [Zea mays]
 gb|ACG37454.1| DNA binding protein [Zea mays]
Length=231

 Score =   112 bits (280),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 88/161 (55%), Positives = 108/161 (67%), Gaps = 9/161 (6%)
 Frame = +1

Query  307  KRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRMVLQ  486
            KR +   CS    SKA REKMRR +LNDRF ELS VM+PGK  K+DK+ ILSDA RMV Q
Sbjct  52   KRSRDEPCSSGLKSKACREKMRRDKLNDRFLELSSVMNPGKQAKLDKANILSDAARMVAQ  111

Query  487  LRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkalNSRP-GF---  654
            LR EA+KLKES E L+E + +LK EKNEL++EK +LK EKD+LE Q+KA++  P G+   
Sbjct  112  LRGEAEKLKESNEKLRENIKDLKEEKNELREEKVRLKVEKDRLEQQVKAMSVAPTGYVPH  171

Query  655  LPHP----PATAVPFPTPHHLVGGKLVPFVG-YPGIPMWQF  762
            LPHP    PA   PF  P    G K  P    +PG+ MWQ+
Sbjct  172  LPHPASYHPAAFAPFVPPQQAAGNKSAPIPAPFPGMAMWQW  212



>gb|KHN19061.1| Transcription factor ILR3 [Glycine soja]
Length=134

 Score =   109 bits (272),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 76/121 (63%), Positives = 95/121 (79%), Gaps = 7/121 (6%)
 Frame = +1

Query  400  ELSCVMDPGKPPKMDKSAILSDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkd  579
            EL  ++ PG P KMDK+ ILSDAVR+V QLR+EAQKL+ES E+LQE++NELKAEKNEL+D
Sbjct  2    ELWSIVGPGMPLKMDKAVILSDAVRVVSQLREEAQKLRESSENLQEKINELKAEKNELRD  61

Query  580  ekqklkeekdklelqlkalNSRPGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQ  759
            EKQ+LK EKD +E +L AL+S+P FLP        FP+   +VG KLVPF+GYPG+ MWQ
Sbjct  62   EKQRLKAEKDSIEQKLIALSSQPSFLPA-------FPSAGQVVGSKLVPFMGYPGVAMWQ  114

Query  760  F  762
            F
Sbjct  115  F  115



>gb|AFW66775.1| putative HLH DNA-binding domain superfamily protein [Zea mays]
Length=232

 Score =   111 bits (278),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 88/161 (55%), Positives = 108/161 (67%), Gaps = 9/161 (6%)
 Frame = +1

Query  307  KRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRMVLQ  486
            KR +   CS    SKA REKMRR +LNDRF ELS VM+PGK  K+DK+ ILSDA RMV Q
Sbjct  53   KRGRDEPCSSGLKSKACREKMRRDKLNDRFLELSSVMNPGKQAKLDKANILSDAARMVAQ  112

Query  487  LRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkalNSRP-GF---  654
            LR EA+KLKES E L+E + +LK EKNEL++EK +LK EKD+LE Q+KA++  P G+   
Sbjct  113  LRGEAEKLKESNEKLRENIKDLKEEKNELREEKVRLKVEKDRLEQQVKAMSVAPTGYVPH  172

Query  655  LPHP----PATAVPFPTPHHLVGGKLVPFVG-YPGIPMWQF  762
            LPHP    PA   PF  P    G K  P    +PG+ MWQ+
Sbjct  173  LPHPASYHPAAFAPFVPPQQAAGNKSAPIPAPFPGMAMWQW  213



>ref|XP_008676877.1| PREDICTED: uncharacterized protein LOC100274393 isoform X1 [Zea 
mays]
 gb|AFW66776.1| putative HLH DNA-binding domain superfamily protein [Zea mays]
 gb|AIB05497.1| bHLH transcription factor, partial [Zea mays]
Length=231

 Score =   111 bits (278),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 88/161 (55%), Positives = 108/161 (67%), Gaps = 9/161 (6%)
 Frame = +1

Query  307  KRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRMVLQ  486
            KR +   CS    SKA REKMRR +LNDRF ELS VM+PGK  K+DK+ ILSDA RMV Q
Sbjct  52   KRGRDEPCSSGLKSKACREKMRRDKLNDRFLELSSVMNPGKQAKLDKANILSDAARMVAQ  111

Query  487  LRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkalNSRP-GF---  654
            LR EA+KLKES E L+E + +LK EKNEL++EK +LK EKD+LE Q+KA++  P G+   
Sbjct  112  LRGEAEKLKESNEKLRENIKDLKEEKNELREEKVRLKVEKDRLEQQVKAMSVAPTGYVPH  171

Query  655  LPHP----PATAVPFPTPHHLVGGKLVPFVG-YPGIPMWQF  762
            LPHP    PA   PF  P    G K  P    +PG+ MWQ+
Sbjct  172  LPHPASYHPAAFAPFVPPQQAAGNKSAPIPAPFPGMAMWQW  212



>dbj|BAK01217.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=251

 Score =   112 bits (279),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 107/237 (45%), Positives = 137/237 (58%), Gaps = 23/237 (10%)
 Frame = +1

Query  106  MAAPEVDGSNWLLDLGF--------EDIPLPGGKF--PPLEPGYQWHssailspappsiR  255
            MA+PE  GSNW+ D                 GG +  PP+ P  Q H+ A    A P+  
Sbjct  1    MASPE--GSNWVFDCPLMDDLAAADFAAVPAGGFYWNPPMPP--QMHTLAQAVSATPAPN  56

Query  256  -----QDESYVKFDVSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMD  420
                      V +D + G    KR +S        SKA REK+RR +LN+RF EL  V+D
Sbjct  57   PCAEINSSVSVDWDHAKGQPKNKRPRSET-GAQPSSKACREKVRRDKLNERFLELGAVLD  115

Query  421  PGKPPKMDKSAILSDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklke  600
            PGK PK+DK AIL+DA+R V +LR EA+KLK+S E LQE++ ELKAEKNEL+DEKQKLK 
Sbjct  116  PGKTPKIDKCAILNDAIRAVTELRSEAEKLKDSNESLQEKIRELKAEKNELRDEKQKLKA  175

Query  601  ekdklelqlkalNSRPGFLPHP---PATAVPFPTPHHLVGGKLVPFVGYPGIPMWQF  762
            EK+ LE Q+K +N+R   +PHP   PATA             ++P + YPG PMWQF
Sbjct  176  EKESLEQQIKFMNARQRLVPHPSVIPATAFAAAQGQAAGHKLMMPVMSYPGFPMWQF  232



>ref|XP_010274798.1| PREDICTED: transcription factor bHLH104-like [Nelumbo nucifera]
Length=215

 Score =   111 bits (277),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 80/155 (52%), Positives = 111/155 (72%), Gaps = 9/155 (6%)
 Frame = +1

Query  301  ARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRMV  480
            ARKR ++ +CS    SKA REKMRR R+NDRF +LS V++PG+P K DKSAI+SDA+R++
Sbjct  50   ARKRGRNQSCSDPG-SKACREKMRRDRMNDRFLDLSSVLEPGRPAKTDKSAIVSDAIRVL  108

Query  481  LQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkalNSRP-GFL  657
             QLR EAQ+LK++ E L+E +  LKAEKNEL++EK +LK +K+K+E Q+KA++  P GF+
Sbjct  109  NQLRTEAQELKDASEKLREVIKNLKAEKNELREEKLQLKADKEKMEQQVKAMSLLPAGFV  168

Query  658  PHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQF  762
            P       P P  +H    KL+ +  Y G PMWQ+
Sbjct  169  P-------PLPATYHTGANKLMAYPSYGGFPMWQW  196



>ref|XP_009408169.1| PREDICTED: transcription factor ILR3-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=226

 Score =   111 bits (277),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 83/162 (51%), Positives = 112/162 (69%), Gaps = 7/162 (4%)
 Frame = +1

Query  295  CSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVR  474
             S +KR +  + +G   SKA REKMRR +LNDRF ELS ++DPG+ PK DK++ILSDA R
Sbjct  47   TSLKKRARDDSTTGLK-SKACREKMRRDKLNDRFSELSLILDPGRTPKSDKASILSDAAR  105

Query  475  MVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkalNSRP-G  651
            +++QL+ +AQ+LKES + LQE + +LK EKNEL+DEK KLK +K+ LE Q+KA++  P G
Sbjct  106  VLVQLKADAQELKESNDKLQETIKDLKVEKNELRDEKMKLKADKETLEQQVKAISMAPSG  165

Query  652  FLPHP----PATAVPFPTPH-HLVGGKLVPFVGYPGIPMWQF  762
            F+PHP    PA A    +PH      K   F  YPG+ MWQ+
Sbjct  166  FMPHPLAYHPAAAPTTFSPHVQAPSNKAAHFPAYPGMAMWQW  207



>ref|XP_009378999.1| PREDICTED: transcription factor bHLH104-like [Pyrus x bretschneideri]
Length=223

 Score =   110 bits (276),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 77/154 (50%), Positives = 108/154 (70%), Gaps = 5/154 (3%)
 Frame = +1

Query  304  RKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRMVL  483
            RKR ++ +CSG + +KA REK+RR RLNDRF +LS V++PG+PPK DK+AIL DA+R++ 
Sbjct  55   RKRGRTDSCSGGSGAKACREKLRRERLNDRFVDLSGVLEPGRPPKTDKAAILDDAIRVLN  114

Query  484  QLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkalNSRP-GFLP  660
            QLR EAQ+L E+ + L E+V  LKAEKNEL++EK  LK +K++LE QLK ++  P GF+P
Sbjct  115  QLRAEAQELTETNQKLLEEVKSLKAEKNELREEKLVLKADKERLEQQLKGMSISPSGFVP  174

Query  661  HPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQF  762
              PA     P  +H    K+  +  Y  +PMW +
Sbjct  175  THPAV----PAAYHPGANKMAVYPSYSLVPMWHY  204



>ref|XP_011030516.1| PREDICTED: transcription factor bHLH104-like [Populus euphratica]
Length=221

 Score =   110 bits (276),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 79/154 (51%), Positives = 107/154 (69%), Gaps = 9/154 (6%)
 Frame = +1

Query  304  RKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRMVL  483
            RKR +S +CSGA  +KA  EK+RR RLNDRFQ+LS V++PG+P K DK AIL DA+R++ 
Sbjct  57   RKRGRSDSCSGAG-TKACHEKLRRERLNDRFQDLSSVLEPGRPAKTDKPAILDDAIRVLN  115

Query  484  QLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkalN-SRPGFLP  660
            QL++EAQ+LKE+ E L E++  LKAEK EL++EK  LK +K+K+E QLK L  +  GF+P
Sbjct  116  QLKNEAQELKETNEKLLEEIKSLKAEKTELREEKLMLKADKEKMEQQLKTLALTTSGFMP  175

Query  661  HPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQF  762
              PAT       +H    K+  F GY  +PMW +
Sbjct  176  AYPAT-------YHAAANKIPVFPGYGLMPMWHY  202



>gb|KHG04921.1| Transcription factor protein [Gossypium arboreum]
Length=213

 Score =   109 bits (273),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 79/161 (49%), Positives = 109/161 (68%), Gaps = 10/161 (6%)
 Frame = +1

Query  283  VSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILS  462
            V   CS RKR +SG+CS    +KA REK+RR +LN+RF +LS +++PG+P + DKSAIL 
Sbjct  43   VDRDCS-RKRGRSGSCSRPG-TKACREKLRREKLNERFLDLSSILEPGRPARTDKSAILD  100

Query  463  DAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkalNS  642
            DA+R++ QLR +AQ+LKE+ E L E++  LKAEKNE++DEK  LK  K+++E QLK LN 
Sbjct  101  DAIRVLTQLRTDAQELKETNEKLLEEIKSLKAEKNEIRDEKLVLKANKERIEQQLKTLNV  160

Query  643  RPG-FLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQF  762
             P  +LP  PA        +H    K+  F GY  +PMWQ+
Sbjct  161  SPARYLPAHPAG-------YHAATNKMAVFPGYGLVPMWQY  194



>gb|EMT07811.1| Transcription factor ILR3 [Aegilops tauschii]
Length=315

 Score =   110 bits (276),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 81/142 (57%), Positives = 102/142 (72%), Gaps = 3/142 (2%)
 Frame = +1

Query  346  SKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRMVLQLRDEAQKLKESFE  525
            SKA REK+RR +LN+RF EL  V+DPGK PK+DK AIL+DA+R V +LR EA+KLK+S E
Sbjct  155  SKACREKVRRDKLNERFLELGAVLDPGKTPKIDKCAILNDAIRAVTELRSEAEKLKDSNE  214

Query  526  DLQEQVNELKAeknelkdekqklkeekdklelqlkalNSRPGFLPHP---PATAVPFPTP  696
             LQE++ ELKAEKNEL+DEKQKLK EK+ LE Q+K +N+R   +PHP   PA A      
Sbjct  215  SLQEKIRELKAEKNELRDEKQKLKAEKESLEQQIKFMNARQSLVPHPSVIPAAAFAAAQG  274

Query  697  HHLVGGKLVPFVGYPGIPMWQF  762
                   ++P + YPG PMWQF
Sbjct  275  QAAGHKLMMPVMSYPGFPMWQF  296



>gb|KJB72345.1| hypothetical protein B456_011G172500 [Gossypium raimondii]
Length=210

 Score =   108 bits (271),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 78/161 (48%), Positives = 109/161 (68%), Gaps = 10/161 (6%)
 Frame = +1

Query  283  VSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILS  462
            V   CS RKR +SG+CS    +KA REK+RR +LN+RF +LS  ++PG+P + DKSAIL 
Sbjct  40   VDRDCS-RKRGRSGSCSRPG-TKACREKLRREKLNERFLDLSSTLEPGRPARTDKSAILD  97

Query  463  DAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkalN-  639
            DA+R++ QLR +AQ+LKE+ E L E++  LKAEKNE+++EK  LK  K+++E QLK LN 
Sbjct  98   DAIRVLTQLRTDAQELKETNEKLLEEIKSLKAEKNEIREEKLVLKANKERIEQQLKTLNV  157

Query  640  SRPGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQF  762
            S  G+LP  PA        +H    K+  F GY  +P+WQ+
Sbjct  158  SAAGYLPAHPAG-------YHAAANKMAVFPGYGLVPVWQY  191



>ref|XP_010241997.1| PREDICTED: LOW QUALITY PROTEIN: transcription factor ILR3-like, 
partial [Nelumbo nucifera]
Length=141

 Score =   107 bits (266),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 69/119 (58%), Positives = 82/119 (69%), Gaps = 1/119 (1%)
 Frame = +1

Query  409  CVMDPGKPPKMDKSAILSDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekq  588
             +++PG+PPKMDK+AILSD VRMV QL+ EAQKLKES E L E++ ELKAEKNEL DEKQ
Sbjct  4    TILEPGRPPKMDKAAILSDVVRMVTQLQSEAQKLKESNESLLEKIKELKAEKNELGDEKQ  63

Query  589  klkeekdklelqlkalNSR-PGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQF  762
            +LK EK +   Q     S  P FLPHP      F       G KL+PF+GYPG+ MWQF
Sbjct  64   RLKTEKXEKLEQQVKNLSAPPSFLPHPTTILAAFTAQGQAAGNKLMPFIGYPGVAMWQF  122



>gb|KJB72343.1| hypothetical protein B456_011G172500 [Gossypium raimondii]
Length=213

 Score =   108 bits (271),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 78/161 (48%), Positives = 109/161 (68%), Gaps = 10/161 (6%)
 Frame = +1

Query  283  VSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILS  462
            V   CS RKR +SG+CS    +KA REK+RR +LN+RF +LS  ++PG+P + DKSAIL 
Sbjct  43   VDRDCS-RKRGRSGSCSRPG-TKACREKLRREKLNERFLDLSSTLEPGRPARTDKSAILD  100

Query  463  DAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkalN-  639
            DA+R++ QLR +AQ+LKE+ E L E++  LKAEKNE+++EK  LK  K+++E QLK LN 
Sbjct  101  DAIRVLTQLRTDAQELKETNEKLLEEIKSLKAEKNEIREEKLVLKANKERIEQQLKTLNV  160

Query  640  SRPGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQF  762
            S  G+LP  PA        +H    K+  F GY  +P+WQ+
Sbjct  161  SAAGYLPAHPAG-------YHAAANKMAVFPGYGLVPVWQY  194



>gb|KJB72344.1| hypothetical protein B456_011G172500 [Gossypium raimondii]
Length=212

 Score =   108 bits (270),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 78/161 (48%), Positives = 109/161 (68%), Gaps = 10/161 (6%)
 Frame = +1

Query  283  VSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILS  462
            V   CS RKR +SG+CS    +KA REK+RR +LN+RF +LS  ++PG+P + DKSAIL 
Sbjct  42   VDRDCS-RKRGRSGSCSRPG-TKACREKLRREKLNERFLDLSSTLEPGRPARTDKSAILD  99

Query  463  DAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkalN-  639
            DA+R++ QLR +AQ+LKE+ E L E++  LKAEKNE+++EK  LK  K+++E QLK LN 
Sbjct  100  DAIRVLTQLRTDAQELKETNEKLLEEIKSLKAEKNEIREEKLVLKANKERIEQQLKTLNV  159

Query  640  SRPGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQF  762
            S  G+LP  PA        +H    K+  F GY  +P+WQ+
Sbjct  160  SAAGYLPAHPAG-------YHAAANKMAVFPGYGLVPVWQY  193



>ref|XP_009408170.1| PREDICTED: transcription factor ILR3-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=177

 Score =   107 bits (267),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 79/145 (54%), Positives = 104/145 (72%), Gaps = 6/145 (4%)
 Frame = +1

Query  346  SKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRMVLQLRDEAQKLKESFE  525
            SKA REKMRR +LNDRF ELS ++DPG+ PK DK++ILSDA R+++QL+ +AQ+LKES +
Sbjct  14   SKACREKMRRDKLNDRFSELSLILDPGRTPKSDKASILSDAARVLVQLKADAQELKESND  73

Query  526  DLQEQVNELKAeknelkdekqklkeekdklelqlkalNSRP-GFLPHP----PATAVPFP  690
             LQE + +LK EKNEL+DEK KLK +K+ LE Q+KA++  P GF+PHP    PA A    
Sbjct  74   KLQETIKDLKVEKNELRDEKMKLKADKETLEQQVKAISMAPSGFMPHPLAYHPAAAPTTF  133

Query  691  TPH-HLVGGKLVPFVGYPGIPMWQF  762
            +PH      K   F  YPG+ MWQ+
Sbjct  134  SPHVQAPSNKAAHFPAYPGMAMWQW  158



>gb|KHN36734.1| Transcription factor ILR3 [Glycine soja]
Length=234

 Score =   108 bits (271),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 108/228 (47%), Positives = 136/228 (60%), Gaps = 22/228 (10%)
 Frame = +1

Query  106  MAAPEVDGSNWLLDLGFED---IPLPGGKFPPLEPGYQWHssailspappsiRQDESYVK  276
            M +PE   SNWL D    D   IP+    F      + W                   V+
Sbjct  1    MVSPE--NSNWLFDYPLIDDDVIPVGDSSFAVSASTFSWPPPPANVS-----------VE  47

Query  277  FDVSNGCS------ARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPK  438
             D S G S      A K+      S A+ SKA REK+RR RLND+F EL  +++PG+PPK
Sbjct  48   IDTSLGDSDGLKNPALKKRTKSDSSTASSSKACREKLRRDRLNDKFVELGSILEPGRPPK  107

Query  439  MDKSAILSDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdkle  618
             DK++IL DA RMV QLRDEA KLK+S   LQE++ ELKAEKNEL+DEKQ+LK EK+KLE
Sbjct  108  TDKASILIDAARMVTQLRDEALKLKDSNTSLQEKIKELKAEKNELRDEKQRLKAEKEKLE  167

Query  619  lqlkalNSRPGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQF  762
            +Q+K++N++P FLP PPA    F       G KLVPF+ YPG+ MWQF
Sbjct  168  VQVKSMNAQPAFLPPPPAIPAAFAPQGQAPGNKLVPFISYPGVAMWQF  215



>dbj|BAJ40866.1| bHLH transcriptional factor [Coptis japonica]
Length=219

 Score =   108 bits (269),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 79/160 (49%), Positives = 107/160 (67%), Gaps = 8/160 (5%)
 Frame = +1

Query  283  VSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILS  462
            V  GC A+KR ++ +C G   SKA REKMRR +LNDRF +LS  ++PG+P K DKSAILS
Sbjct  49   VEKGC-AKKRGRNESCGGLG-SKACREKMRRDKLNDRFADLSSALEPGRPAKTDKSAILS  106

Query  463  DAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkalNS  642
            DA+R++ QLR E+Q+LKE+ E LQE +  LKAEKNEL++EK  LK +K+++E Q+KA+  
Sbjct  107  DAIRVLNQLRTESQELKEANEKLQEDIKNLKAEKNELREEKNLLKADKERIEQQMKAMAI  166

Query  643  RPGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQF  762
             PG +        P P  +     K + F  Y G PMWQ+
Sbjct  167  VPGGI------VPPHPATYQAGVNKFMAFPSYGGYPMWQY  200



>ref|XP_003543288.1| PREDICTED: transcription factor ILR3-like isoform 1 [Glycine 
max]
Length=234

 Score =   108 bits (270),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 108/228 (47%), Positives = 136/228 (60%), Gaps = 22/228 (10%)
 Frame = +1

Query  106  MAAPEVDGSNWLLDLGFED---IPLPGGKFPPLEPGYQWHssailspappsiRQDESYVK  276
            M +PE   SNWL D    D   IP+    F      + W                   V+
Sbjct  1    MVSPE--NSNWLFDYPLIDDDVIPVGDSSFAVSASTFSWPPPPANVS-----------VE  47

Query  277  FDVSNGCS------ARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPK  438
             D S G S      A K+      S A+ SKA REK+RR RLND+F EL  +++PG+PPK
Sbjct  48   IDASLGDSDGLKNPALKKRTKSDSSTASSSKACREKLRRDRLNDKFVELGSILEPGRPPK  107

Query  439  MDKSAILSDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdkle  618
             DK++IL DA RMV QLRDEA KLK+S   LQE++ ELKAEKNEL+DEKQ+LK EK+KLE
Sbjct  108  TDKASILIDAARMVTQLRDEALKLKDSNTSLQEKIKELKAEKNELRDEKQRLKAEKEKLE  167

Query  619  lqlkalNSRPGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQF  762
            +Q+K++N++P FLP PPA    F       G KLVPF+ YPG+ MWQF
Sbjct  168  VQVKSMNAQPAFLPPPPAIPAAFAPQGQAPGNKLVPFISYPGVAMWQF  215



>ref|NP_001150072.1| DNA binding protein [Zea mays]
 ref|XP_008643673.1| PREDICTED: DNA binding protein isoform X1 [Zea mays]
 gb|ACF85925.1| unknown [Zea mays]
 gb|ACG37703.1| DNA binding protein [Zea mays]
 gb|AFW69800.1| putative HLH DNA-binding domain superfamily protein [Zea mays]
 gb|AIB04361.1| bHLH transcription factor, partial [Zea mays]
Length=235

 Score =   108 bits (270),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 86/161 (53%), Positives = 107/161 (66%), Gaps = 9/161 (6%)
 Frame = +1

Query  307  KRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRMVLQ  486
            KR +   CS    SKA REKMRR +LNDRF ELS +M+PGK  K+DK+ ILSDA RMV Q
Sbjct  56   KRGRDEPCSSGPTSKACREKMRRDKLNDRFLELSSIMNPGKEAKLDKANILSDAARMVAQ  115

Query  487  LRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkalNSRP-GF---  654
            LR EA+KLKES E L+E + +LK EKNEL++EK +LK EKD+LE Q+KA++  P G+   
Sbjct  116  LRGEAEKLKESNEKLRENIKDLKEEKNELREEKVRLKVEKDRLEQQVKAMSVAPTGYVPH  175

Query  655  LPHP----PATAVPFPTPHHLVGGKLVPFVG-YPGIPMWQF  762
            LPHP    PA   PF  P      K  P    +PG+ MWQ+
Sbjct  176  LPHPASYHPAAFTPFAPPQQAPANKSAPIPAPFPGMAMWQW  216



>ref|XP_002962528.1| hypothetical protein SELMODRAFT_165556 [Selaginella moellendorffii]
 ref|XP_002962764.1| hypothetical protein SELMODRAFT_165311 [Selaginella moellendorffii]
 gb|EFJ35991.1| hypothetical protein SELMODRAFT_165556 [Selaginella moellendorffii]
 gb|EFJ36227.1| hypothetical protein SELMODRAFT_165311 [Selaginella moellendorffii]
Length=246

 Score =   108 bits (270),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 88/183 (48%), Positives = 111/183 (61%), Gaps = 16/183 (9%)
 Frame = +1

Query  259  DESYVKFDVSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPK  438
            D S V  D       +KR +  +C GA  +KA REKMRR RLNDRF ELS  ++PG+PPK
Sbjct  46   DSSKVDSDEFEKTCPKKRSREESC-GAPGNKACREKMRRDRLNDRFVELSAALEPGRPPK  104

Query  439  MDKSAILSDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdkle  618
             DK+ ILSDAVR++ QLR EAQ+LKES E L++ + ELKAEKNEL++EK +LK EKD+LE
Sbjct  105  SDKATILSDAVRVITQLRAEAQQLKESNEQLRDGIKELKAEKNELREEKMRLKSEKDRLE  164

Query  619  lqlkalNSRPGFLPHPPATAVPFPTPHHL-------------VGGKLV--PFVGYPGIPM  753
             QLK +   P F+PHP A                         GG     P  G+PG+ M
Sbjct  165  QQLKTMAMPPSFMPHPAAALHAHHAAAAAAAFHAQIQAASTKTGGASAAGPLPGFPGMAM  224

Query  754  WQF  762
            WQ+
Sbjct  225  WQW  227



>ref|XP_008391189.1| PREDICTED: transcription factor bHLH104-like [Malus domestica]
 ref|XP_008351308.1| PREDICTED: transcription factor bHLH104-like [Malus domestica]
Length=224

 Score =   107 bits (268),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 78/154 (51%), Positives = 104/154 (68%), Gaps = 5/154 (3%)
 Frame = +1

Query  304  RKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRMVL  483
            RKR ++ +CSG + +KA REK+RR RLNDRF ELS V++PG  PK DK+AIL DAVR++ 
Sbjct  56   RKRGRTDSCSGGSGAKACREKLRRERLNDRFVELSGVLEPGXXPKTDKAAILDDAVRVLN  115

Query  484  QLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkalNSRP-GFLP  660
            QLR EAQ+L E+ + L E+V  LKAEKNEL+ EK  LK +K++LE QLK +   P GF+P
Sbjct  116  QLRAEAQELTETNQKLLEEVKSLKAEKNELRXEKLVLKADKERLEQQLKGMAISPSGFVP  175

Query  661  HPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQF  762
              PA     P  +H    K+  +  Y  +PMW +
Sbjct  176  THPAV----PAAYHPGANKMAVYPSYSLVPMWHY  205



>ref|XP_006447465.1| hypothetical protein CICLE_v10016381mg [Citrus clementina]
 gb|ESR60705.1| hypothetical protein CICLE_v10016381mg [Citrus clementina]
Length=179

 Score =   106 bits (265),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 68/156 (44%), Positives = 93/156 (60%), Gaps = 15/156 (10%)
 Frame = +1

Query  106  MAAPEVDGSNWLLDLGF-EDIPLPGGKFPPLEPGYQWHssailspappsiRQDESYVKFD  282
            M     D S+WL+D    +DIP+ G         + W S A  +    S         F 
Sbjct  1    MEIASSDNSDWLIDYSIVDDIPIAGN--------FDWPSQAAPAVNASSAASVTIDCSFG  52

Query  283  VSNG-----CSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDK  447
             S+G       +RKR++S +C   + SKA REK+RR RLN+RF EL  +++PG+PPK DK
Sbjct  53   DSDGPKEVEAGSRKRLRSESCC-VSGSKACREKLRRDRLNERFLELGSMLEPGRPPKTDK  111

Query  448  SAILSDAVRMVLQLRDEAQKLKESFEDLQEQVNELK  555
            + ILSDAV+M+ QLR EAQKLK+S E+LQE++ ELK
Sbjct  112  ATILSDAVQMMEQLRTEAQKLKQSNENLQEKIKELK  147



>ref|XP_008224372.1| PREDICTED: transcription factor bHLH104 [Prunus mume]
Length=223

 Score =   107 bits (267),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 79/163 (48%), Positives = 106/163 (65%), Gaps = 6/163 (4%)
 Frame = +1

Query  277  FDVSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAI  456
            F     C  ++     +CSG+  +KA REK+RR RLNDRF ELS V++PG+PPK DK AI
Sbjct  47   FSPEKECPRKRGRTDSSCSGSG-AKACREKLRRERLNDRFVELSAVLEPGRPPKSDKPAI  105

Query  457  LSDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkal  636
            L DA+R++ QLR EAQ+LKE+ E L E+V  LKAEKNEL++EK  LK +K++LE QLK +
Sbjct  106  LDDAIRVLTQLRAEAQELKETNEKLLEEVKSLKAEKNELREEKLVLKADKERLEKQLKGM  165

Query  637  NSRP-GFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQF  762
               P GF+P  PA     P  +H    K+  +  Y  +PMW +
Sbjct  166  AISPSGFVPTHPAV----PAAYHPGASKMAMYPSYSLVPMWHY  204



>ref|XP_006378346.1| hypothetical protein POPTR_0010s08360g [Populus trichocarpa]
 gb|ERP56143.1| hypothetical protein POPTR_0010s08360g [Populus trichocarpa]
Length=218

 Score =   107 bits (266),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 79/157 (50%), Positives = 106/157 (68%), Gaps = 10/157 (6%)
 Frame = +1

Query  295  CSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVR  474
            CS RKR +S  CS A  +KA REK+RR RLNDRFQ+LS V++PG+P K DK AIL DA+R
Sbjct  52   CS-RKRERSDLCSRAG-TKACREKLRRERLNDRFQDLSSVLEPGRPAKTDKPAILDDAIR  109

Query  475  MVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkalN-SRPG  651
            ++ QL++EAQ+LKE+ E L E++  LKAEK EL++EK  LK +K+K+E QLK L     G
Sbjct  110  VLNQLKNEAQELKETNEKLLEEIRSLKAEKTELREEKLMLKADKEKMEQQLKTLALPTSG  169

Query  652  FLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQF  762
            F+P        +P  +H    K+  F GY  +PMW +
Sbjct  170  FMP-------TYPAAYHAAANKIPVFPGYGLMPMWHY  199



>ref|XP_002314636.1| basic helix-loop-helix family protein [Populus trichocarpa]
 gb|EEF00807.1| basic helix-loop-helix family protein [Populus trichocarpa]
Length=221

 Score =   107 bits (266),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 79/157 (50%), Positives = 106/157 (68%), Gaps = 10/157 (6%)
 Frame = +1

Query  295  CSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVR  474
            CS RKR +S  CS A  +KA REK+RR RLNDRFQ+LS V++PG+P K DK AIL DA+R
Sbjct  55   CS-RKRERSDLCSRAG-TKACREKLRRERLNDRFQDLSSVLEPGRPAKTDKPAILDDAIR  112

Query  475  MVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkalN-SRPG  651
            ++ QL++EAQ+LKE+ E L E++  LKAEK EL++EK  LK +K+K+E QLK L     G
Sbjct  113  VLNQLKNEAQELKETNEKLLEEIRSLKAEKTELREEKLMLKADKEKMEQQLKTLALPTSG  172

Query  652  FLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQF  762
            F+P        +P  +H    K+  F GY  +PMW +
Sbjct  173  FMP-------TYPAAYHAAANKIPVFPGYGLMPMWHY  202



>ref|XP_010262298.1| PREDICTED: transcription factor bHLH104-like [Nelumbo nucifera]
Length=216

 Score =   106 bits (265),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 80/173 (46%), Positives = 113/173 (65%), Gaps = 18/173 (10%)
 Frame = +1

Query  271  VKFDVS--------NGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPG  426
            + FDVS          C+ RKR ++ +CSG   SKA REKMRR R+ND F +L+ +++PG
Sbjct  34   LDFDVSPIESILQEKACT-RKRGRNESCSGPG-SKACREKMRRDRMNDMFSDLTSILEPG  91

Query  427  KPPKMDKSAILSDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeek  606
            +P K DKSAIL DA+R++ QLR EAQ+LK++ E LQE +  LKAEKNEL++EK  LK +K
Sbjct  92   RPAKTDKSAILGDAIRVLNQLRTEAQELKDANEKLQEDIKNLKAEKNELREEKLLLKADK  151

Query  607  dklelqlkalNSRP-GFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQF  762
            +++E QLK ++  P GF+P       P P  +     KL+ +  + G PMWQ+
Sbjct  152  ERMEQQLKTMSIMPTGFVP-------PVPATYQAGANKLMTYPSFGGFPMWQW  197



>ref|XP_010062962.1| PREDICTED: transcription factor ILR3-like isoform X2 [Eucalyptus 
grandis]
 gb|KCW70123.1| hypothetical protein EUGRSUZ_F03420 [Eucalyptus grandis]
Length=213

 Score =   105 bits (263),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 80/124 (65%), Positives = 97/124 (78%), Gaps = 0/124 (0%)
 Frame = +1

Query  391  RFQELSCVMDPGKPPKMDKSAILSDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAekne  570
            RF EL+ +++PG+PPK DK+AIL D VRMV QLR EAQKLK+S   LQE++ ELKAEKNE
Sbjct  71   RFLELASILEPGRPPKTDKAAILIDVVRMVTQLRGEAQKLKDSNSSLQEKIKELKAEKNE  130

Query  571  lkdekqklkeekdklelqlkalNSRPGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIP  750
            L+DEKQ+LK EK+KLE QLKA+N++P FLP PPA    F T     G KLVPF+GYPG+ 
Sbjct  131  LRDEKQRLKAEKEKLEHQLKAMNAQPSFLPPPPAIPAAFATQGQAPGNKLVPFIGYPGVA  190

Query  751  MWQF  762
            MWQF
Sbjct  191  MWQF  194



>ref|XP_001778884.1| predicted protein [Physcomitrella patens]
 gb|EDQ56334.1| predicted protein [Physcomitrella patens]
Length=238

 Score =   105 bits (263),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 79/164 (48%), Positives = 105/164 (64%), Gaps = 4/164 (2%)
 Frame = +1

Query  280  DVSNGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAIL  459
            DV     +RKR +    SG+ + KA REKMRR RLNDRF +LS  ++PG+PPK DK+ IL
Sbjct  57   DVPEKSCSRKRSREEGSSGSGN-KACREKMRRDRLNDRFLDLSAALEPGRPPKTDKATIL  115

Query  460  SDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkalN  639
            SDAVR++ QLR EAQ L ES   L+E + +LK EKNEL++EK +LK +K++LE Q+KA+ 
Sbjct  116  SDAVRILTQLRAEAQGLTESNNQLRETIKDLKNEKNELREEKTRLKADKERLEQQVKAMT  175

Query  640  SRPGFLPHP---PATAVPFPTPHHLVGGKLVPFVGYPGIPMWQF  762
               G++PHP    A    F         K     GYPG+ MWQ+
Sbjct  176  IPAGYMPHPAALHAAVAAFAAQTQAASNKAAQIAGYPGMAMWQW  219



>ref|XP_004134070.1| PREDICTED: transcription factor bHLH104-like [Cucumis sativus]
 ref|XP_004169970.1| PREDICTED: transcription factor bHLH104-like [Cucumis sativus]
 gb|KGN56869.1| hypothetical protein Csa_3G135660 [Cucumis sativus]
Length=226

 Score =   105 bits (261),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 77/159 (48%), Positives = 111/159 (70%), Gaps = 10/159 (6%)
 Frame = +1

Query  289  NGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDA  468
            N CS RKR + G+C+GA+ SKA RE++RR +LNDRF +LS  ++P +  K +K AIL DA
Sbjct  58   NDCS-RKRARDGSCAGAS-SKACRERLRREKLNDRFLDLSIALEPSRHTKTNKPAILDDA  115

Query  469  VRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkalN-SR  645
            +R++ QL++EA++LK++ E L+E+V  LKAEKN+L+ EK  LKE+K+K+E QLK++    
Sbjct  116  IRVLNQLKNEAEELKQTNEKLREEVESLKAEKNDLRKEKIILKEDKEKMEQQLKSIAIPS  175

Query  646  PGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQF  762
            PG +P  PA        +H   GK+  F GY  IPMWQ+
Sbjct  176  PGLIPGHPAA-------YHAASGKMAVFPGYGLIPMWQY  207



>ref|XP_002881143.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH57402.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=123

 Score =   102 bits (253),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 52/86 (60%), Positives = 68/86 (79%), Gaps = 1/86 (1%)
 Frame = +1

Query  298  SARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRM  477
            SA  R+KS +C+G++ SKA REK RR RLND+F ELS +++PG+ PK DK AI+SDA+RM
Sbjct  7    SASVRIKSESCAGSS-SKACREKQRRDRLNDKFTELSSILEPGRAPKTDKVAIISDAIRM  65

Query  478  VLQLRDEAQKLKESFEDLQEQVNELK  555
            V Q+RDEAQKLK+    LQE++ ELK
Sbjct  66   VNQVRDEAQKLKDLNSSLQEKIKELK  91



>ref|XP_007223393.1| hypothetical protein PRUPE_ppa011217mg [Prunus persica]
 gb|EMJ24592.1| hypothetical protein PRUPE_ppa011217mg [Prunus persica]
Length=219

 Score =   103 bits (258),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 76/154 (49%), Positives = 104/154 (68%), Gaps = 5/154 (3%)
 Frame = +1

Query  304  RKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRMVL  483
            RKR ++ +    + +KA REK+RR RLNDRF ELS V++PG+PPK DK AIL DA+R++ 
Sbjct  51   RKRGRTDSSCPGSGAKACREKLRRERLNDRFVELSAVLEPGRPPKSDKPAILDDAIRVLT  110

Query  484  QLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkalNSRP-GFLP  660
            QLR EAQ+LKE+ + L E+V  LKAEKNEL++EK  LK +K++LE QLK +   P GF+P
Sbjct  111  QLRAEAQELKETNQKLLEEVKSLKAEKNELREEKLVLKADKERLEQQLKGMAISPSGFVP  170

Query  661  HPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQF  762
              PA     P  +H    K+  +  Y  +PMW +
Sbjct  171  THPAV----PAAYHPGASKMAMYPSYSLVPMWHY  200



>gb|KDP40313.1| hypothetical protein JCGZ_02311 [Jatropha curcas]
Length=222

 Score =   103 bits (257),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 75/154 (49%), Positives = 104/154 (68%), Gaps = 8/154 (5%)
 Frame = +1

Query  301  ARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRMV  480
            +RKR +S +CS    +KA REK+RR RLNDRF +LS V++PG+P + DK AIL DA+R++
Sbjct  59   SRKRGRSDSCSKPV-TKACREKLRRERLNDRFHDLSSVLEPGRPARTDKPAILDDAIRVL  117

Query  481  LQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkalNSRPGFLP  660
             QL+ EAQ+LKE+ + L E++  LKAEKNEL++EK  LK +K+++E QLK +    GF+P
Sbjct  118  NQLKTEAQELKETNQKLLEEIKSLKAEKNELREEKLTLKADKERMEQQLKVMAVPHGFMP  177

Query  661  HPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQF  762
              PAT       +H    K+  F  Y  IPMWQ 
Sbjct  178  AHPAT-------YHTGVNKMAVFPSYGLIPMWQL  204



>gb|KHN33610.1| Transcription factor ILR3 [Glycine soja]
Length=131

 Score =   101 bits (251),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 72/121 (60%), Positives = 91/121 (75%), Gaps = 10/121 (8%)
 Frame = +1

Query  400  ELSCVMDPGKPPKMDKSAILSDAVRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkd  579
            EL  ++DP KP KMDK+ ILSDAVR+V QLR+EAQKL+ES E+LQE++N LK EKNEL+D
Sbjct  2    ELGSILDPRKPLKMDKAVILSDAVRVVSQLREEAQKLRESTENLQEKINALKDEKNELRD  61

Query  580  ekqklkeekdklelqlkalNSRPGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQ  759
            EKQ+LK EK+ LE ++KAL+S+P FL               +VG KLVPF+GYPG+ MWQ
Sbjct  62   EKQRLKVEKENLEQKVKALSSQPSFL----------AAAGQVVGSKLVPFMGYPGVAMWQ  111

Query  760  F  762
            F
Sbjct  112  F  112



>ref|XP_006420196.1| hypothetical protein CICLE_v10005872mg [Citrus clementina]
 gb|ESR33436.1| hypothetical protein CICLE_v10005872mg [Citrus clementina]
 gb|KDO57624.1| hypothetical protein CISIN_1g028060mg [Citrus sinensis]
Length=200

 Score =   102 bits (255),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 77/157 (49%), Positives = 108/157 (69%), Gaps = 11/157 (7%)
 Frame = +1

Query  298  SARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRM  477
            + RKR +S +CS    SKA REK+RR RLNDRF +LSC+++PG+P + DK AIL DA+R+
Sbjct  34   NTRKRARSDSCSRPG-SKACREKLRRERLNDRFLDLSCILEPGRPARTDKPAILDDAIRV  92

Query  478  VLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkalNSRP--G  651
            + QLR E+Q+LKE+ E LQE++  LKAEKNEL++EK  LK +K+KLE QLK + + P  G
Sbjct  93   LNQLRTESQELKETNEKLQEEIKSLKAEKNELREEKLILKADKEKLEQQLKVM-AMPTGG  151

Query  652  FLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQF  762
            ++P  PA        +H    K+  +  Y  +PMWQ+
Sbjct  152  YMPTHPAA-------YHAGLNKMAVYPSYGLMPMWQY  181



>ref|XP_008438540.1| PREDICTED: transcription factor bHLH104-like [Cucumis melo]
Length=226

 Score =   103 bits (256),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 77/159 (48%), Positives = 110/159 (69%), Gaps = 10/159 (6%)
 Frame = +1

Query  289  NGCSARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDA  468
            N CS RKR + G+C+G + SKA RE++RR +LNDRF +LS  ++P +  K +K AIL DA
Sbjct  58   NDCS-RKRTRDGSCAGPS-SKACRERLRREKLNDRFLDLSIALEPSRHTKTNKPAILDDA  115

Query  469  VRMVLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkalN-SR  645
            +R++ QL++EA+ LK++ E L+E++  LKAEKN+L+ EK  LKEEK+K+E QLK++    
Sbjct  116  IRVLNQLKNEAEDLKQTNEKLREELKNLKAEKNDLRKEKIILKEEKEKMEQQLKSIAIPS  175

Query  646  PGFLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQF  762
            PG +P  PAT       +H   GK+  F GY  IPMWQ+
Sbjct  176  PGLIPGHPAT-------YHAASGKMAVFPGYGLIPMWQY  207



>ref|XP_006489748.1| PREDICTED: transcription factor bHLH104-like isoform X1 [Citrus 
sinensis]
Length=214

 Score =   102 bits (255),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 77/157 (49%), Positives = 108/157 (69%), Gaps = 11/157 (7%)
 Frame = +1

Query  298  SARKRMKSGACSGAADSKAQREKMRRYRLNDRFQELSCVMDPGKPPKMDKSAILSDAVRM  477
            + RKR +S +CS    SKA REK+RR RLNDRF +LSC+++PG+P + DK AIL DA+R+
Sbjct  48   NTRKRARSDSCSRPG-SKACREKLRRERLNDRFLDLSCILEPGRPARTDKPAILDDAIRV  106

Query  478  VLQLRDEAQKLKESFEDLQEQVNELKAeknelkdekqklkeekdklelqlkalNSRP--G  651
            + QLR E+Q+LKE+ E LQE++  LKAEKNEL++EK  LK +K+KLE QLK + + P  G
Sbjct  107  LNQLRTESQELKETNEKLQEEIKSLKAEKNELREEKLILKADKEKLEQQLKVM-AMPTGG  165

Query  652  FLPHPPATAVPFPTPHHLVGGKLVPFVGYPGIPMWQF  762
            ++P  PA        +H    K+  +  Y  +PMWQ+
Sbjct  166  YMPTHPAA-------YHAGLNKMAVYPSYGLMPMWQY  195



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1467725733100