BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF045J15

Length=776
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004248297.1|  PREDICTED: peroxisome biogenesis protein 5         322   3e-101   Solanum lycopersicum
ref|XP_009613026.1|  PREDICTED: peroxisome biogenesis protein 5         320   5e-101   Nicotiana tomentosiformis
ref|XP_006352575.1|  PREDICTED: peroxisome biogenesis protein 5-like    322   8e-101   Solanum tuberosum [potatoes]
gb|AAC69177.1|  peroxisomal targeting signal 1 receptor                 318   1e-99    Nicotiana tabacum [American tobacco]
ref|XP_011095665.1|  PREDICTED: peroxisome biogenesis protein 5         314   7e-98    Sesamum indicum [beniseed]
ref|XP_009787957.1|  PREDICTED: peroxisome biogenesis protein 5         314   8e-98    Nicotiana sylvestris
emb|CDP13627.1|  unnamed protein product                                287   7e-88    Coffea canephora [robusta coffee]
ref|XP_002535309.1|  peroxisomal targeting signal type 1 (pts1) r...    277   1e-87    Ricinus communis
gb|KDP29519.1|  hypothetical protein JCGZ_19232                         287   1e-87    Jatropha curcas
gb|EYU27520.1|  hypothetical protein MIMGU_mgv1a001936mg                284   2e-86    Erythranthe guttata [common monkey flower]
gb|EPS66664.1|  peroxisomal targeting signal 1 receptor                 279   2e-84    Genlisea aurea
ref|XP_010644705.1|  PREDICTED: peroxisome biogenesis protein 5 i...    278   3e-84    Vitis vinifera
ref|XP_011000400.1|  PREDICTED: peroxisome biogenesis protein 5         276   1e-83    Populus euphratica
ref|XP_010644706.1|  PREDICTED: peroxisome biogenesis protein 5 i...    273   1e-82    Vitis vinifera
ref|XP_006452789.1|  hypothetical protein CICLE_v10007566mg             271   9e-82    Citrus clementina [clementine]
ref|XP_006474746.1|  PREDICTED: peroxisome biogenesis protein 5-like    271   1e-81    Citrus sinensis [apfelsine]
ref|XP_008359037.1|  PREDICTED: peroxisome biogenesis protein 5-like    259   5e-81    
ref|XP_006378020.1|  peroxisomal targeting signal-1 receptor fami...    268   2e-80    
ref|XP_010263067.1|  PREDICTED: peroxisome biogenesis protein 5         265   4e-79    Nelumbo nucifera [Indian lotus]
ref|XP_010089724.1|  hypothetical protein L484_013918                   249   3e-78    
ref|XP_009374433.1|  PREDICTED: peroxisome biogenesis protein 5-l...    261   1e-77    Pyrus x bretschneideri [bai li]
ref|XP_002299082.1|  peroxisomal targeting signal-1 receptor fami...    261   1e-77    
ref|XP_008246513.1|  PREDICTED: peroxisome biogenesis protein 5         260   2e-77    Prunus mume [ume]
ref|XP_007207214.1|  hypothetical protein PRUPE_ppa001874mg             259   3e-77    Prunus persica
ref|XP_009379078.1|  PREDICTED: peroxisome biogenesis protein 5-l...    258   1e-76    Pyrus x bretschneideri [bai li]
ref|XP_008355107.1|  PREDICTED: peroxisome biogenesis protein 5-like    246   6e-76    
ref|XP_009374434.1|  PREDICTED: peroxisome biogenesis protein 5-l...    255   1e-75    Pyrus x bretschneideri [bai li]
ref|XP_009132316.1|  PREDICTED: peroxisome biogenesis protein 5-like    255   1e-75    Brassica rapa
emb|CDY11941.1|  BnaC03g13670D                                          254   2e-75    Brassica napus [oilseed rape]
gb|KFK27205.1|  hypothetical protein AALP_AA8G349500                    254   2e-75    Arabis alpina [alpine rockcress]
ref|XP_010539370.1|  PREDICTED: peroxisome biogenesis protein 5 i...    254   2e-75    Tarenaya hassleriana [spider flower]
emb|CDY36789.1|  BnaA03g10970D                                          254   3e-75    Brassica napus [oilseed rape]
ref|XP_010539369.1|  PREDICTED: peroxisome biogenesis protein 5 i...    254   3e-75    Tarenaya hassleriana [spider flower]
ref|XP_009379080.1|  PREDICTED: peroxisome biogenesis protein 5-l...    254   4e-75    Pyrus x bretschneideri [bai li]
ref|XP_006401353.1|  hypothetical protein EUTSA_v10012791mg             251   3e-74    Eutrema salsugineum [saltwater cress]
ref|XP_006401352.1|  hypothetical protein EUTSA_v10012791mg             251   3e-74    Eutrema salsugineum [saltwater cress]
gb|ABB92565.1|  peroxisomal import receptor PTS1                        249   1e-73    Brassica napus [oilseed rape]
ref|XP_006280156.1|  hypothetical protein CARUB_v10026055mg             248   2e-73    
ref|XP_008448966.1|  PREDICTED: peroxisome biogenesis protein 5         249   2e-73    Cucumis melo [Oriental melon]
ref|NP_200440.1|  peroxisome biogenesis protein 5                       249   2e-73    Arabidopsis thaliana [mouse-ear cress]
gb|AAC62012.1|  peroxisomal targeting signal type 1 receptor            249   2e-73    Arabidopsis thaliana [mouse-ear cress]
emb|CDY69423.1|  BnaA10g29080D                                          242   2e-73    Brassica napus [oilseed rape]
ref|XP_002864444.1|  hypothetical protein ARALYDRAFT_495719             248   6e-73    Arabidopsis lyrata subsp. lyrata
ref|XP_010450908.1|  PREDICTED: peroxisome biogenesis protein 5-l...    247   7e-73    Camelina sativa [gold-of-pleasure]
gb|KGN55958.1|  hypothetical protein Csa_3G039290                       248   9e-73    Cucumis sativus [cucumbers]
ref|XP_010450900.1|  PREDICTED: peroxisome biogenesis protein 5-l...    247   1e-72    Camelina sativa [gold-of-pleasure]
ref|XP_010483103.1|  PREDICTED: peroxisome biogenesis protein 5         246   3e-72    Camelina sativa [gold-of-pleasure]
ref|XP_009120148.1|  PREDICTED: LOW QUALITY PROTEIN: peroxisome b...    245   8e-72    Brassica rapa
ref|XP_004147973.1|  PREDICTED: peroxisome biogenesis protein 5-like    245   8e-72    
ref|XP_004499675.1|  PREDICTED: peroxisome biogenesis protein 5-like    243   6e-71    Cicer arietinum [garbanzo]
ref|XP_007020296.1|  Peroxin 5 isoform 6                                240   1e-70    
ref|XP_007020297.1|  Peroxin 5 isoform 7                                240   1e-70    
gb|AES68523.2|  peroxisomal targeting signal 1 receptor                 241   2e-70    Medicago truncatula
ref|XP_007020295.1|  Peroxin 5 isoform 5                                240   3e-70    
ref|XP_007020294.1|  Peroxin 5 isoform 4                                240   3e-70    
ref|XP_007020292.1|  Peroxin 5 isoform 2                                240   5e-70    
ref|XP_007020291.1|  Peroxin 5 isoform 1                                240   6e-70    
ref|XP_007020293.1|  Peroxin 5 isoform 3                                239   7e-70    
ref|XP_010443280.1|  PREDICTED: peroxisome biogenesis protein 5-like    239   1e-69    Camelina sativa [gold-of-pleasure]
gb|KCW68311.1|  hypothetical protein EUGRSUZ_F01979                     237   4e-69    Eucalyptus grandis [rose gum]
ref|XP_010061377.1|  PREDICTED: peroxisome biogenesis protein 5         237   5e-69    Eucalyptus grandis [rose gum]
gb|KJB63153.1|  hypothetical protein B456_009G455400                    229   1e-68    Gossypium raimondii
gb|KJB63155.1|  hypothetical protein B456_009G455400                    228   5e-68    Gossypium raimondii
ref|XP_008806178.1|  PREDICTED: peroxisome biogenesis protein 5-like    234   1e-67    Phoenix dactylifera
gb|KJB63151.1|  hypothetical protein B456_009G455400                    229   6e-67    Gossypium raimondii
gb|KJB63157.1|  hypothetical protein B456_009G455400                    230   7e-67    Gossypium raimondii
gb|KJB63160.1|  hypothetical protein B456_009G455400                    229   1e-66    Gossypium raimondii
gb|KJB63152.1|  hypothetical protein B456_009G455400                    230   1e-66    Gossypium raimondii
gb|KJB63150.1|  hypothetical protein B456_009G455400                    231   2e-66    Gossypium raimondii
ref|XP_007148691.1|  hypothetical protein PHAVU_005G006500g             230   2e-66    Phaseolus vulgaris [French bean]
ref|XP_010928166.1|  PREDICTED: peroxisome biogenesis protein 5-like    229   1e-65    Elaeis guineensis
ref|XP_010913243.1|  PREDICTED: peroxisome biogenesis protein 5-like    228   2e-65    Elaeis guineensis
gb|KJB63159.1|  hypothetical protein B456_009G455400                    228   2e-65    Gossypium raimondii
ref|XP_009410316.1|  PREDICTED: peroxisome biogenesis protein 5         224   3e-64    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008796597.1|  PREDICTED: peroxisome biogenesis protein 5-like    222   3e-64    
ref|XP_008344789.1|  PREDICTED: peroxisome biogenesis protein 5-like    213   4e-63    
gb|KHN20585.1|  Peroxisome biogenesis protein 5                         221   7e-63    Glycine soja [wild soybean]
ref|XP_011461534.1|  PREDICTED: peroxisome biogenesis protein 5         219   2e-62    Fragaria vesca subsp. vesca
ref|XP_008355814.1|  PREDICTED: peroxisome biogenesis protein 5-like    218   5e-62    
emb|CDY49390.1|  BnaC09g53570D                                          213   4e-60    Brassica napus [oilseed rape]
ref|XP_010676141.1|  PREDICTED: peroxisome biogenesis protein 5         209   9e-59    Beta vulgaris subsp. vulgaris [field beet]
gb|KHN44770.1|  Peroxisome biogenesis protein 5                         194   3e-53    Glycine soja [wild soybean]
ref|XP_003523862.1|  PREDICTED: peroxisome biogenesis protein 5-l...    194   3e-53    Glycine max [soybeans]
ref|XP_004973819.1|  PREDICTED: peroxisome biogenesis protein 5-l...    175   1e-46    Setaria italica
ref|XP_004973818.1|  PREDICTED: peroxisome biogenesis protein 5-l...    175   1e-46    Setaria italica
ref|XP_002980203.1|  hypothetical protein SELMODRAFT_444455             170   6e-45    
ref|XP_003574713.1|  PREDICTED: peroxisome biogenesis protein 5         169   2e-44    Brachypodium distachyon [annual false brome]
ref|XP_006659548.1|  PREDICTED: peroxisome biogenesis protein 5-l...    167   5e-44    Oryza brachyantha
ref|XP_006659547.1|  PREDICTED: peroxisome biogenesis protein 5-l...    167   8e-44    Oryza brachyantha
ref|XP_008679527.1|  PREDICTED: peroxisome biogenesis protein 5-l...    166   1e-43    Zea mays [maize]
ref|XP_008679528.1|  PREDICTED: peroxisome biogenesis protein 5-l...    166   2e-43    Zea mays [maize]
ref|XP_008679526.1|  PREDICTED: peroxisome biogenesis protein 5-l...    166   2e-43    Zea mays [maize]
ref|XP_008666997.1|  PREDICTED: uncharacterized protein LOC100191...    166   2e-43    Zea mays [maize]
ref|XP_008666974.1|  PREDICTED: uncharacterized protein LOC100191...    166   2e-43    Zea mays [maize]
tpg|DAA47839.1|  TPA: hypothetical protein ZEAMMB73_779817              166   2e-43    
ref|NP_001130381.1|  uncharacterized protein LOC100191477               166   2e-43    Zea mays [maize]
dbj|BAD08811.1|  putative peroxisomal targeting signal 1 receptor       165   3e-43    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002963119.1|  hypothetical protein SELMODRAFT_78782              166   3e-43    
gb|EMS62055.1|  Peroxisome biogenesis protein 5                         167   4e-43    Triticum urartu
gb|EEC83824.1|  hypothetical protein OsI_29764                          165   5e-43    Oryza sativa Indica Group [Indian rice]
ref|NP_001062153.1|  Os08g0500100                                       165   5e-43    
gb|AAX11256.1|  peroxisomal targeting signal 1 receptor short form      163   2e-42    Oryza sativa Japonica Group [Japonica rice]
gb|AAX11255.1|  peroxisomal targeting signal 1 receptor long form       163   3e-42    Oryza sativa Japonica Group [Japonica rice]
gb|AFW65172.1|  hypothetical protein ZEAMMB73_964933                    159   7e-41    
ref|XP_002445936.1|  hypothetical protein SORBIDRAFT_07g028340          159   8e-41    Sorghum bicolor [broomcorn]
gb|EMS46697.1|  hypothetical protein TRIUR3_08788                       157   2e-40    Triticum urartu
gb|EMT18446.1|  Peroxisomal targeting signal 1 receptor                 150   1e-37    
ref|XP_006857544.1|  hypothetical protein AMTR_s00061p00043210          149   4e-37    
gb|AAC97489.1|  peroxisomal targeting signal-1 receptor                 143   2e-35    Citrullus lanatus subsp. vulgaris
ref|NP_001237339.1|  uncharacterized protein LOC100527272               127   2e-32    
ref|XP_008351197.1|  PREDICTED: peroxisome biogenesis protein 5-like    119   2e-29    
ref|XP_008343460.1|  PREDICTED: peroxisome biogenesis protein 5-like    116   1e-28    
gb|EMT00979.1|  Peroxisomal targeting signal 1 receptor                 119   3e-27    
gb|AFW65171.1|  hypothetical protein ZEAMMB73_964933                  72.0    1e-12    
gb|KIZ06207.1|  peroxin-5                                             71.6    9e-11    Monoraphidium neglectum
ref|XP_008782941.1|  PREDICTED: uncharacterized protein LOC103702335  59.7    6e-08    
ref|XP_005645163.1|  TPR-like protein                                 57.0    6e-06    Coccomyxa subellipsoidea C-169
gb|KDO36345.1|  hypothetical protein CISIN_1g026371mg                 54.7    2e-05    Citrus sinensis [apfelsine]



>ref|XP_004248297.1| PREDICTED: peroxisome biogenesis protein 5 [Solanum lycopersicum]
Length=744

 Score =   322 bits (826),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 155/210 (74%), Positives = 178/210 (85%), Gaps = 8/210 (4%)
 Frame = +1

Query  160  MAMRDLVTGGAACAVPGSSSSNPFGALANTLIGSSSKTQERLKEIPTSVSTPSDGNFGVG  339
            MAMRDLVTG  +C  P SSSSNP GALAN LIGSSSKTQERLKEIPTSVST S+GNF  G
Sbjct  1    MAMRDLVTGAPSCGEP-SSSSNPLGALANALIGSSSKTQERLKEIPTSVSTSSNGNFLAG  59

Query  340  FQEPLATLPGSEIDHPFQPNLQGSEFLEGFRTADQNSFADVWDGIQRPQLP-------HS  498
             +EP  +LPGSE +HP QPN+QGS+FL+G+R+ADQN  AD WD IQRPQLP        +
Sbjct  60   VEEPFVSLPGSEFEHPLQPNIQGSQFLQGYRSADQNKLADAWDEIQRPQLPFPHGSQNMT  119

Query  499  NFPLDNSQLQPELNGPPQRVLSNFLHSFVNSSHGGIPFRPASLPVLGLSQGEKQCIRDRS  678
            N PL++++LQP+LNGPPQ+VLS+FLHSFVNS HGG+PFRPASLP+LGLS+G+KQCIRDRS
Sbjct  120  NIPLEHARLQPDLNGPPQQVLSSFLHSFVNSGHGGVPFRPASLPLLGLSEGDKQCIRDRS  179

Query  679  TIMARHFFADKNEDFINAQVNALLCSLDID  768
            TIMARHFFADK EDFIN QVNALL SL+ID
Sbjct  180  TIMARHFFADKTEDFINGQVNALLSSLEID  209



>ref|XP_009613026.1| PREDICTED: peroxisome biogenesis protein 5 [Nicotiana tomentosiformis]
Length=676

 Score =   320 bits (821),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 156/210 (74%), Positives = 178/210 (85%), Gaps = 6/210 (3%)
 Frame = +1

Query  160  MAMRDLVTGGAACAVPGSSSSNPFGALANTLIGSSSKTQERLKEIPTSVSTPSDGNFGVG  339
            MAMRDLVTG  +C  P SSSSNP GALAN LIGSSSKTQERLKEIPTSVST SDGNF  G
Sbjct  1    MAMRDLVTGAPSCGEP-SSSSNPLGALANALIGSSSKTQERLKEIPTSVSTSSDGNFLAG  59

Query  340  FQEPLATLPGSEIDHPFQPNLQGSEFLEGFRTADQNSFADVWDGIQRPQLP-----HSNF  504
            FQEPL +LPGSE + P  PN+QGS+FL+GFR+ADQN  +D WD IQRPQLP      +N 
Sbjct  60   FQEPLVSLPGSEFEQPLHPNIQGSQFLQGFRSADQNRLSDAWDEIQRPQLPFGSQNMTNI  119

Query  505  PLDNSQLQPELNGPPQRVLSNFLHSFVNSSHGGIPFRPASLPVLGLSQGEKQCIRDRSTI  684
            PL+++++QP+LNGPPQ+VLS+FLHSFVNSS GG+PFRP SLP+LGLS+G+KQCIRDRSTI
Sbjct  120  PLEHARVQPDLNGPPQQVLSSFLHSFVNSSQGGMPFRPTSLPLLGLSEGDKQCIRDRSTI  179

Query  685  MARHFFADKNEDFINAQVNALLCSLDIDAD  774
            MARHFFADK EDFIN QVNALL SL+ID D
Sbjct  180  MARHFFADKGEDFINGQVNALLSSLEIDND  209



>ref|XP_006352575.1| PREDICTED: peroxisome biogenesis protein 5-like [Solanum tuberosum]
Length=744

 Score =   322 bits (824),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 155/210 (74%), Positives = 178/210 (85%), Gaps = 8/210 (4%)
 Frame = +1

Query  160  MAMRDLVTGGAACAVPGSSSSNPFGALANTLIGSSSKTQERLKEIPTSVSTPSDGNFGVG  339
            MAMRDLVTG  +C  P SSSSNP GALAN LIGSSSKTQERLKEIPTSV+T S+GNF  G
Sbjct  1    MAMRDLVTGAPSCGEP-SSSSNPLGALANALIGSSSKTQERLKEIPTSVTTSSNGNFLAG  59

Query  340  FQEPLATLPGSEIDHPFQPNLQGSEFLEGFRTADQNSFADVWDGIQRPQLP-------HS  498
             +EP  +LPGSE +HP QPN+QGS+FL+GFR+ADQN  AD WD IQRPQLP        +
Sbjct  60   VEEPFVSLPGSEFEHPLQPNIQGSQFLQGFRSADQNRLADAWDEIQRPQLPFAHGSQNMT  119

Query  499  NFPLDNSQLQPELNGPPQRVLSNFLHSFVNSSHGGIPFRPASLPVLGLSQGEKQCIRDRS  678
            N PL++++LQP+LNGPPQ+VLS+FLHSFVNS HGG+PFRPASLP+LGLS+G+KQCIRDRS
Sbjct  120  NIPLEHARLQPDLNGPPQQVLSSFLHSFVNSGHGGVPFRPASLPLLGLSEGDKQCIRDRS  179

Query  679  TIMARHFFADKNEDFINAQVNALLCSLDID  768
            TIMARHFFADK EDFIN QVNALL SL+ID
Sbjct  180  TIMARHFFADKTEDFINRQVNALLSSLEID  209



>gb|AAC69177.1| peroxisomal targeting signal 1 receptor [Nicotiana tabacum]
Length=741

 Score =   318 bits (816),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 155/210 (74%), Positives = 177/210 (84%), Gaps = 6/210 (3%)
 Frame = +1

Query  160  MAMRDLVTGGAACAVPGSSSSNPFGALANTLIGSSSKTQERLKEIPTSVSTPSDGNFGVG  339
            MAMRDLVTG  +C  P SSSSNP GALAN LIGSSSKTQERLKEIPTSVST SDGNF  G
Sbjct  1    MAMRDLVTGAPSCGEP-SSSSNPLGALANALIGSSSKTQERLKEIPTSVSTSSDGNFLAG  59

Query  340  FQEPLATLPGSEIDHPFQPNLQGSEFLEGFRTADQNSFADVWDGIQRPQLP-----HSNF  504
            FQEPL +LPGSE + P  PN+QGS+FL+GFR+ADQN  +D WD IQRPQLP      +N 
Sbjct  60   FQEPLVSLPGSEFEQPLHPNIQGSQFLQGFRSADQNRLSDAWDEIQRPQLPFGSQNMTNI  119

Query  505  PLDNSQLQPELNGPPQRVLSNFLHSFVNSSHGGIPFRPASLPVLGLSQGEKQCIRDRSTI  684
            PL+++++QP+LNGPPQ+VLS+FLHSFVNSS GG+ FRP SLP+LGLS+G+KQCIRDRSTI
Sbjct  120  PLEHARVQPDLNGPPQQVLSSFLHSFVNSSQGGMQFRPTSLPLLGLSEGDKQCIRDRSTI  179

Query  685  MARHFFADKNEDFINAQVNALLCSLDIDAD  774
            MARHFFADK EDFIN QVNALL SL+ID D
Sbjct  180  MARHFFADKGEDFINGQVNALLSSLEIDND  209



>ref|XP_011095665.1| PREDICTED: peroxisome biogenesis protein 5 [Sesamum indicum]
Length=743

 Score =   314 bits (804),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 152/213 (71%), Positives = 178/213 (84%), Gaps = 11/213 (5%)
 Frame = +1

Query  160  MAMRDLVTGGAACAVPGSSSS-NPFGALANTLIGSSSKTQERLKEIPTSVSTPSDGNFGV  336
            MAMR+LVTGGAACAVPGSSSS NP GALAN LIGSSSKTQERL+EIPT+ +T SDGN   
Sbjct  1    MAMRELVTGGAACAVPGSSSSSNPLGALANALIGSSSKTQERLREIPTATATTSDGNLYA  60

Query  337  GFQEPLATLPGSEIDHPFQPNLQGSEFLEGFRTADQNSFADVWDGIQRPQLPH-------  495
            G +EP A+LPGSE++H  +PNLQGSEFL+GFR+ DQ  F+D WD +QRPQ+PH       
Sbjct  61   GVEEPFASLPGSELEHTLRPNLQGSEFLQGFRSVDQGRFSDAWDEVQRPQVPHYQGRDGL  120

Query  496  SNFPLDNSQLQPELNGPPQRVLSNFLHSFVNSSHGGIPFRPASLPVLGLSQGEKQCIRDR  675
            +NFPL+  Q     +GPPQRVLSNFLHSF++SSHGGIPFRP SLPVLGLS+G+KQCIRDR
Sbjct  121  TNFPLEQPQ---NFDGPPQRVLSNFLHSFLHSSHGGIPFRPTSLPVLGLSEGDKQCIRDR  177

Query  676  STIMARHFFADKNEDFINAQVNALLCSLDIDAD  774
            S+IMARH FADK+E+FI++QVNALL SLDID D
Sbjct  178  SSIMARHLFADKSEEFIHSQVNALLSSLDIDND  210



>ref|XP_009787957.1| PREDICTED: peroxisome biogenesis protein 5 [Nicotiana sylvestris]
Length=743

 Score =   314 bits (804),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 154/212 (73%), Positives = 176/212 (83%), Gaps = 8/212 (4%)
 Frame = +1

Query  160  MAMRDLVTGGAACAVPGSSSSNPFGALANTLIGSSSKTQERLKEIPTSVSTPSDGNFGVG  339
            MAMRDLVTG  +C  P SSSSNP GALAN LIGSSSKTQERLKEIPTSVST S+GNF  G
Sbjct  1    MAMRDLVTGAPSCGEP-SSSSNPLGALANALIGSSSKTQERLKEIPTSVSTSSNGNFLAG  59

Query  340  FQEPLATLPGSEIDHPFQPNLQGSEFLEGFRTADQNSFADVWDGIQRPQLP-------HS  498
             QEPL +LPGSE + P  PN+QGS+FL+GFR+ADQN  +DVWD IQRPQLP        +
Sbjct  60   SQEPLVSLPGSEFEQPLHPNIQGSQFLQGFRSADQNRLSDVWDEIQRPQLPFAHGSQNMT  119

Query  499  NFPLDNSQLQPELNGPPQRVLSNFLHSFVNSSHGGIPFRPASLPVLGLSQGEKQCIRDRS  678
            N PL+ +++QP+LNGPPQ+VLS+FLHSFVNSS GG+PFRP SLP+LGLS+G+KQCI DRS
Sbjct  120  NIPLEYARVQPDLNGPPQQVLSSFLHSFVNSSQGGMPFRPTSLPLLGLSEGDKQCIHDRS  179

Query  679  TIMARHFFADKNEDFINAQVNALLCSLDIDAD  774
            TIMARHFFADK EDFIN QVNALL SL+ID D
Sbjct  180  TIMARHFFADKGEDFINGQVNALLSSLEIDND  211



>emb|CDP13627.1| unnamed protein product [Coffea canephora]
Length=730

 Score =   287 bits (735),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 151/207 (73%), Positives = 172/207 (83%), Gaps = 5/207 (2%)
 Frame = +1

Query  160  MAMRDLVTGGAACAVPGSSSSNPFGAL-ANTLIGSSSKTQ-ERLKEIPTSVSTPSDGNFG  333
            MAMR+LV+GGAACA  GSSSS+      AN L+GSSSKTQ ERL+EIPTS + PSDG+  
Sbjct  1    MAMRELVSGGAACATSGSSSSSNPLGSLANALLGSSSKTQQERLREIPTSTAIPSDGSAS  60

Query  334  VGFQEPLATLPGSEIDHPFQPNLQGSEFLEGFRTADQNSFADVWDGIQRPQLPHSNFPLD  513
            VG  EPL+ LPGSE+DHP QPN QGSEFL GFR+ADQ+  ADVWD IQRPQ+   NFP +
Sbjct  61   VGTGEPLSGLPGSELDHPLQPNAQGSEFLRGFRSADQHGLADVWDDIQRPQV---NFPPE  117

Query  514  NSQLQPELNGPPQRVLSNFLHSFVNSSHGGIPFRPASLPVLGLSQGEKQCIRDRSTIMAR  693
            +   QP+ NGPPQRVLS+FLHSFVNSSHGGIPF PA+LPVLGLS G+KQCIRDRS+IMAR
Sbjct  118  HVLRQPDTNGPPQRVLSSFLHSFVNSSHGGIPFCPATLPVLGLSAGDKQCIRDRSSIMAR  177

Query  694  HFFADKNEDFINAQVNALLCSLDIDAD  774
            HFFADK+EDFINAQVNALL SL+ID D
Sbjct  178  HFFADKSEDFINAQVNALLSSLEIDND  204



>ref|XP_002535309.1| peroxisomal targeting signal type 1 (pts1) receptor, putative 
[Ricinus communis]
 gb|EEF27074.1| peroxisomal targeting signal type 1 (pts1) receptor, putative 
[Ricinus communis]
Length=392

 Score =   277 bits (709),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 146/217 (67%), Positives = 169/217 (78%), Gaps = 12/217 (6%)
 Frame = +1

Query  160  MAMRDLVTGGAACAVPGSSSS-NPFGALANTLIGSSSKTQERLKEIPTSVSTPSDGNFGV  336
            M+MR+LV+GGAACAVPGSSSS NP GALAN L+GSSSKTQERLKEIPTS +T S+ +F  
Sbjct  1    MSMRELVSGGAACAVPGSSSSSNPLGALANNLLGSSSKTQERLKEIPTSTATSSENHFYQ  60

Query  337  GFQEPLATLPGSEIDHPF--QPNLQGSEFLEGFRTADQNSFADVWDGIQR---PQLPHSN  501
              Q+PL  LPG+E +      P  QGSEF  GFR+ADQ+  AD WD IQR   P  P +N
Sbjct  61   DVQDPLRALPGAEFEQKSFPHPGAQGSEFFRGFRSADQHGLADAWDEIQRSHGPPPPQAN  120

Query  502  FP-LDN-----SQLQPELNGPPQRVLSNFLHSFVNSSHGGIPFRPASLPVLGLSQGEKQC  663
             P LDN      QLQP L+GPPQR+LS+FLHSFV SS GGIPFRP  LP+LGLS+G+KQC
Sbjct  121  IPQLDNIYNRGPQLQPTLDGPPQRILSSFLHSFVESSRGGIPFRPTQLPMLGLSEGDKQC  180

Query  664  IRDRSTIMARHFFADKNEDFINAQVNALLCSLDIDAD  774
            IR+RS+IMARHFFADK+EDFINAQVNALL SL+ID D
Sbjct  181  IRNRSSIMARHFFADKSEDFINAQVNALLSSLEIDGD  217



>gb|KDP29519.1| hypothetical protein JCGZ_19232 [Jatropha curcas]
Length=749

 Score =   287 bits (734),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 151/215 (70%), Positives = 170/215 (79%), Gaps = 10/215 (5%)
 Frame = +1

Query  160  MAMRDLVTGGAACAVPGSSSS-NPFGALANTLIGSSSKTQERLKEIPTSVSTPSDGNFGV  336
            MAMRDLVTGGAACAVPGSSSS NP GALANTL+GSSSKTQERLKEIPTS +T S+  F  
Sbjct  1    MAMRDLVTGGAACAVPGSSSSSNPLGALANTLLGSSSKTQERLKEIPTSTATSSENRFYQ  60

Query  337  GFQEPLATLPGSEIDHPFQPNLQGSEFLEGFRTADQNSFADVWDGIQRPQ--LPH-SNFP  507
              Q+PL  LPG+E +     + Q SEFL GFR+ADQN FAD WD +QR    LPH +N P
Sbjct  61   DVQDPLRALPGAEFEQQPFSHTQSSEFLRGFRSADQNGFADAWDEVQRSHGPLPHQANIP  120

Query  508  -LDNS-----QLQPELNGPPQRVLSNFLHSFVNSSHGGIPFRPASLPVLGLSQGEKQCIR  669
             LD+      QLQP L+GPPQRVLS+FLHSFV SS GGIPF P  LP+LGLS+G+KQCIR
Sbjct  121  QLDHVYDRGPQLQPTLDGPPQRVLSSFLHSFVESSRGGIPFHPTPLPLLGLSEGDKQCIR  180

Query  670  DRSTIMARHFFADKNEDFINAQVNALLCSLDIDAD  774
            DRS+IMARHFFADK+EDFINAQVNALL SL+ID D
Sbjct  181  DRSSIMARHFFADKSEDFINAQVNALLSSLEIDGD  215



>gb|EYU27520.1| hypothetical protein MIMGU_mgv1a001936mg [Erythranthe guttata]
Length=736

 Score =   284 bits (726),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 147/212 (69%), Positives = 165/212 (78%), Gaps = 16/212 (8%)
 Frame = +1

Query  160  MAMRDLVTGGAACAVPGSSSS-NPFGALANTLIGSSSKTQERLKEIPTSVSTPSDGNFGV  336
            MAMRDLV+GGAACAVPGSSSS NP GALAN LIGSSSKTQERL+EIPT+ +T SDGN   
Sbjct  1    MAMRDLVSGGAACAVPGSSSSSNPLGALANALIGSSSKTQERLREIPTATATTSDGNLYA  60

Query  337  GFQEPL-ATLPGSEIDHPFQPNLQGSEFLEGFRTADQNSFADVWDGIQRPQLPHSNFPLD  513
            G  EP  A LPGSE++H   PN QGSEFL+GFR+ DQN F+D WD IQ PQ   S+F   
Sbjct  61   GVGEPFTAALPGSELEHALYPNAQGSEFLQGFRSMDQNRFSDAWDDIQNPQ---SHF---  114

Query  514  NSQLQP-----ELNGPPQRVLSNFLHSFVNSSHGGIPFRPASLPVLGLSQGEKQCIRDRS  678
               +QP       NGPPQRVLSNFLHSF++S  G  PF P SLPVLGLS+G+KQCIRDRS
Sbjct  115  ---IQPMNGPTNFNGPPQRVLSNFLHSFLHSGQGSAPFGPTSLPVLGLSEGDKQCIRDRS  171

Query  679  TIMARHFFADKNEDFINAQVNALLCSLDIDAD  774
            +IMARH FADK+EDFI+AQVNALL SLDID D
Sbjct  172  SIMARHLFADKSEDFIHAQVNALLSSLDIDGD  203



>gb|EPS66664.1| peroxisomal targeting signal 1 receptor [Genlisea aurea]
Length=742

 Score =   279 bits (713),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 135/210 (64%), Positives = 170/210 (81%), Gaps = 8/210 (4%)
 Frame = +1

Query  160  MAMRDLVTGGAACAVPGSSSSNPFGALANTLIGSSSKTQERLKEIPTSVSTPSDGNFGVG  339
            MAMR+LVTGGAACAVP +SSSNP GALAN+LIGSSSKTQERL+EIP++  T S G+  +G
Sbjct  1    MAMRELVTGGAACAVPETSSSNPLGALANSLIGSSSKTQERLREIPSATVT-SHGSLDLG  59

Query  340  FQEPLATLPGSEIDHPFQPNLQGSEFLEGFRTADQNSFADVWDGIQRPQLPHS-------  498
             +EP A+LPGSE+++   PN QGSEFL+GFR+ DQ+ F+D W+ I+RPQ+P         
Sbjct  60   VEEPFASLPGSELEYIQPPNAQGSEFLKGFRSVDQSGFSDAWNEIRRPQIPQYHVREGLF  119

Query  499  NFPLDNSQLQPELNGPPQRVLSNFLHSFVNSSHGGIPFRPASLPVLGLSQGEKQCIRDRS  678
            N      QLQ + +GPPQRVLSNFLHSF+++SHGGIPF+PA++P LGLS  +K+CIRDRS
Sbjct  120  NIASAQPQLQQDFDGPPQRVLSNFLHSFLHTSHGGIPFQPAAMPTLGLSNEDKRCIRDRS  179

Query  679  TIMARHFFADKNEDFINAQVNALLCSLDID  768
            +IMARH FADK+E+FI++QVNALL SLDID
Sbjct  180  SIMARHIFADKSEEFIHSQVNALLSSLDID  209



>ref|XP_010644705.1| PREDICTED: peroxisome biogenesis protein 5 isoform X1 [Vitis 
vinifera]
 emb|CBI39871.3| unnamed protein product [Vitis vinifera]
Length=736

 Score =   278 bits (710),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 145/214 (68%), Positives = 166/214 (78%), Gaps = 9/214 (4%)
 Frame = +1

Query  160  MAMRDLVTGGAACAVPGSSSS-NPFGALANTLIGSSSKTQERLKEIPTSVSTPSDGNFGV  336
            MAMR+LVTGGAACAVPGSSSS NP GALAN LIGSSSKTQERL EIPT++ T SDG F  
Sbjct  1    MAMRELVTGGAACAVPGSSSSSNPLGALANALIGSSSKTQERLNEIPTAIPTSSDGQFYS  60

Query  337  GFQEPLATLPGSEIDHP--FQPNLQGSEFLEGFRTADQNSFADVWDGIQRPQLP-HSNFP  507
               + LATLPGSE D     QPN  GSEFL GF +A Q+  AD W+ I  P +P H    
Sbjct  61   ETNDRLATLPGSEFDQQQFLQPNASGSEFLRGFHSAGQSDLADAWNEIHHPPVPAHPELG  120

Query  508  LDN-----SQLQPELNGPPQRVLSNFLHSFVNSSHGGIPFRPASLPVLGLSQGEKQCIRD  672
              +     +QLQP L+G PQRVLS+FLH+FV+SS GGIPFRP  LP+LGLS+G+KQCIRD
Sbjct  121  RIHDGGVRTQLQPTLDGTPQRVLSSFLHTFVDSSRGGIPFRPTPLPLLGLSEGDKQCIRD  180

Query  673  RSTIMARHFFADKNEDFINAQVNALLCSLDIDAD  774
            RS+IMARHFFADK+EDFINAQVNALLCSL+ID+D
Sbjct  181  RSSIMARHFFADKSEDFINAQVNALLCSLEIDSD  214



>ref|XP_011000400.1| PREDICTED: peroxisome biogenesis protein 5 [Populus euphratica]
Length=749

 Score =   276 bits (707),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 148/215 (69%), Positives = 164/215 (76%), Gaps = 10/215 (5%)
 Frame = +1

Query  160  MAMRDLVTGGAACAVPGSSSS-NPFGALANTLIGSSSKTQERLKEIPTSVSTPSDGNF--  330
            MAMR+LVTGGAACAVPGSSSS NPFGALAN LIGSSSKTQERLKEIPTS +T ++  F  
Sbjct  1    MAMRELVTGGAACAVPGSSSSSNPFGALANALIGSSSKTQERLKEIPTSTTTGTEPPFYQ  60

Query  331  GVGFQEPLATLPGSEIDHPFQPNL--QGSEFLEGFRTADQNSFADVWDGIQRPQLPHSNF  504
                ++ L  LPG++ DH F  +   Q SEFL GFR+ADQN FAD W+ I R   P    
Sbjct  61   DATAEDRLRALPGADFDHSFSHHSTPQSSEFLRGFRSADQNGFADAWEDIHRSGPPPPPP  120

Query  505  PLDNS-----QLQPELNGPPQRVLSNFLHSFVNSSHGGIPFRPASLPVLGLSQGEKQCIR  669
             L +      Q QP L GPPQRVLSNFLHSFV SSHGGIPFRPA LP LGLS+G+KQCIR
Sbjct  121  ALLDHRLPPPQFQPTLEGPPQRVLSNFLHSFVGSSHGGIPFRPAPLPALGLSEGDKQCIR  180

Query  670  DRSTIMARHFFADKNEDFINAQVNALLCSLDIDAD  774
            DRS+IMARHFFADK+EDFINAQVNALL SLDID D
Sbjct  181  DRSSIMARHFFADKSEDFINAQVNALLSSLDIDGD  215



>ref|XP_010644706.1| PREDICTED: peroxisome biogenesis protein 5 isoform X2 [Vitis 
vinifera]
Length=734

 Score =   273 bits (699),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 145/214 (68%), Positives = 166/214 (78%), Gaps = 11/214 (5%)
 Frame = +1

Query  160  MAMRDLVTGGAACAVPGSSSS-NPFGALANTLIGSSSKTQERLKEIPTSVSTPSDGNFGV  336
            MAMR+LVTGGAACAVPGSSSS NP GALAN LIGSSSKTQERL EIPT++ T SDG F  
Sbjct  1    MAMRELVTGGAACAVPGSSSSSNPLGALANALIGSSSKTQERLNEIPTAIPTSSDGQFYS  60

Query  337  GFQEPLATLPGSEIDHP--FQPNLQGSEFLEGFRTADQNSFADVWDGIQRPQLP-HSNFP  507
               + LATLPGSE D     QPN  GSEFL GF +A Q+  AD W+ I  P +P H    
Sbjct  61   ETNDRLATLPGSEFDQQQFLQPN--GSEFLRGFHSAGQSDLADAWNEIHHPPVPAHPELG  118

Query  508  LDN-----SQLQPELNGPPQRVLSNFLHSFVNSSHGGIPFRPASLPVLGLSQGEKQCIRD  672
              +     +QLQP L+G PQRVLS+FLH+FV+SS GGIPFRP  LP+LGLS+G+KQCIRD
Sbjct  119  RIHDGGVRTQLQPTLDGTPQRVLSSFLHTFVDSSRGGIPFRPTPLPLLGLSEGDKQCIRD  178

Query  673  RSTIMARHFFADKNEDFINAQVNALLCSLDIDAD  774
            RS+IMARHFFADK+EDFINAQVNALLCSL+ID+D
Sbjct  179  RSSIMARHFFADKSEDFINAQVNALLCSLEIDSD  212



>ref|XP_006452789.1| hypothetical protein CICLE_v10007566mg [Citrus clementina]
 gb|ESR66029.1| hypothetical protein CICLE_v10007566mg [Citrus clementina]
Length=744

 Score =   271 bits (694),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 142/211 (67%), Positives = 159/211 (75%), Gaps = 6/211 (3%)
 Frame = +1

Query  160  MAMRDLVTGGAACAVPGSSSS-NPFGALANTLIGSSSKTQERLKEIPTSVSTPSDGNFGV  336
            MAMR+LVTGGAACAVPGSSSS NP GALAN LIGSSSKTQERL+E+PTS    S+ NF  
Sbjct  1    MAMRELVTGGAACAVPGSSSSSNPLGALANALIGSSSKTQERLQEVPTSTPVTSEPNFYA  60

Query  337  GFQEPLATLPGSEIDHPFQP-NLQGSEFLEGFRTADQNSFADVWDGIQR----PQLPHSN  501
                 L  LPGSE D    P N QGSEFL GFR+ADQN F D WD IQ     P   H  
Sbjct  61   ETDNHLGALPGSEFDQSLLPPNAQGSEFLRGFRSADQNGFTDAWDEIQHQSDGPPFDHFY  120

Query  502  FPLDNSQLQPELNGPPQRVLSNFLHSFVNSSHGGIPFRPASLPVLGLSQGEKQCIRDRST  681
                  QLQP L+GPPQRVLS+FLHSFV SS  GIPF PA+LP+LGLS+G+K+CIRDRS+
Sbjct  121  DRAAAPQLQPTLDGPPQRVLSSFLHSFVESSRSGIPFHPAALPLLGLSEGDKKCIRDRSS  180

Query  682  IMARHFFADKNEDFINAQVNALLCSLDIDAD  774
            IMARHFFAD++EDFINAQVN LL SL+ID+D
Sbjct  181  IMARHFFADQSEDFINAQVNTLLSSLEIDSD  211



>ref|XP_006474746.1| PREDICTED: peroxisome biogenesis protein 5-like [Citrus sinensis]
Length=744

 Score =   271 bits (694),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 142/211 (67%), Positives = 159/211 (75%), Gaps = 6/211 (3%)
 Frame = +1

Query  160  MAMRDLVTGGAACAVPGSSSS-NPFGALANTLIGSSSKTQERLKEIPTSVSTPSDGNFGV  336
            MAMR+LVTGGAACAVPGSSSS NP GALAN LIGSSSKTQERL+E+PTS    S+ NF  
Sbjct  1    MAMRELVTGGAACAVPGSSSSSNPLGALANALIGSSSKTQERLQEVPTSTPVTSEPNFYA  60

Query  337  GFQEPLATLPGSEIDHPFQP-NLQGSEFLEGFRTADQNSFADVWDGIQR----PQLPHSN  501
                 L  LPGSE D    P N QGSEFL GFR+ADQN F D WD IQ     P   H  
Sbjct  61   ETDNHLGALPGSEFDQSLLPPNAQGSEFLRGFRSADQNGFTDAWDEIQHQSHGPPFDHFY  120

Query  502  FPLDNSQLQPELNGPPQRVLSNFLHSFVNSSHGGIPFRPASLPVLGLSQGEKQCIRDRST  681
                  QLQP L+GPPQRVLS+FLHSFV SS  GIPF PA+LP+LGLS+G+K+CIRDRS+
Sbjct  121  DRAAAPQLQPTLDGPPQRVLSSFLHSFVESSRSGIPFHPAALPLLGLSEGDKKCIRDRSS  180

Query  682  IMARHFFADKNEDFINAQVNALLCSLDIDAD  774
            IMARHFFAD++EDFINAQVN LL SL+ID+D
Sbjct  181  IMARHFFADQSEDFINAQVNTLLSSLEIDSD  211



>ref|XP_008359037.1| PREDICTED: peroxisome biogenesis protein 5-like [Malus domestica]
Length=368

 Score =   259 bits (663),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 144/216 (67%), Positives = 159/216 (74%), Gaps = 11/216 (5%)
 Frame = +1

Query  160  MAMRDLVTGGAACAVPG-SSSSNPFGALANTLIGSSSKTQERLKEIPTSVSTPSDGNFGV  336
            MAMRDLVTGGAACAVPG SSSSNPFGALAN LIGSSSK QERLKEIP+S  T S+  F  
Sbjct  1    MAMRDLVTGGAACAVPGQSSSSNPFGALANALIGSSSKQQERLKEIPSSTPTASEPQFYP  60

Query  337  GFQEPLATLPGSEIDHPF-QPNLQGSEFLEGFRTADQNSFAD-VWDGIQRPQ-----LPH  495
                 L  LPGSE D PF QP  Q S+FL  F + D N   D  WD IQ  Q     +P 
Sbjct  61   DGHGHLQQLPGSEFDQPFMQPGTQSSDFLRNFNSVDGNRLLDNAWDEIQSSQPGPMHMPQ  120

Query  496  SNFPLD---NSQLQPELNGPPQRVLSNFLHSFVNSSHGGIPFRPASLPVLGLSQGEKQCI  666
             +   D   + QLQP L+GPPQRVLS+FLHSFV SS GG+PFRPA LPVLGLS G+KQCI
Sbjct  121  HDXIYDMGASPQLQPTLDGPPQRVLSSFLHSFVESSRGGMPFRPAPLPVLGLSAGDKQCI  180

Query  667  RDRSTIMARHFFADKNEDFINAQVNALLCSLDIDAD  774
            RDR++IMARHFFADK+EDFIN QVNALL SLDID+D
Sbjct  181  RDRTSIMARHFFADKSEDFINGQVNALLSSLDIDSD  216



>ref|XP_006378020.1| peroxisomal targeting signal-1 receptor family protein [Populus 
trichocarpa]
 gb|ERP55817.1| peroxisomal targeting signal-1 receptor family protein [Populus 
trichocarpa]
Length=750

 Score =   268 bits (685),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 148/214 (69%), Positives = 164/214 (77%), Gaps = 9/214 (4%)
 Frame = +1

Query  160  MAMRDLVTGGAACAVPGSSSS-NPFGALANTLIGSSSKTQERLKEIPTSVSTPSDGNF--  330
            MAMR+LVTGGAACAVPGSSSS NPFGALAN LIGSSSKT+ER+KEIPTS +T ++  F  
Sbjct  1    MAMRELVTGGAACAVPGSSSSSNPFGALANALIGSSSKTRERVKEIPTSTTTGTEPPFYQ  60

Query  331  GVGFQEPLATLPGSEIDHPF--QPNLQGSEFLEGFRTADQNSFADVWDGIQRPQLPHSNF  504
                ++ L  LPG + DH F   P  Q SEFL GFR+ADQN FAD W+ I R   P    
Sbjct  61   DATAEDRLRALPGDDFDHSFSHHPTPQSSEFLRGFRSADQNGFADAWEDIHRSGPPPPPA  120

Query  505  PLDN----SQLQPELNGPPQRVLSNFLHSFVNSSHGGIPFRPASLPVLGLSQGEKQCIRD  672
             LD+     Q QP L GPPQRVLSNFLHSFV SSHGGIPFRPA LP LGLS+G+KQCIRD
Sbjct  121  LLDHRLPPPQFQPPLEGPPQRVLSNFLHSFVGSSHGGIPFRPAPLPALGLSEGDKQCIRD  180

Query  673  RSTIMARHFFADKNEDFINAQVNALLCSLDIDAD  774
            RS+IMARHFFADK+EDFINAQVNALL SLDID D
Sbjct  181  RSSIMARHFFADKSEDFINAQVNALLSSLDIDGD  214



>ref|XP_010263067.1| PREDICTED: peroxisome biogenesis protein 5 [Nelumbo nucifera]
Length=758

 Score =   265 bits (676),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 143/222 (64%), Positives = 164/222 (74%), Gaps = 17/222 (8%)
 Frame = +1

Query  160  MAMRDLVTGGAACAVPGS-SSSNPFGALANTLIGSSSKTQERLKEIPTSVSTPSDGNFGV  336
            M+MRDLV+GGAACAVPGS S+SNP GALANTL+GSSSKTQERLKE+P +  T  D     
Sbjct  1    MSMRDLVSGGAACAVPGSASTSNPLGALANTLLGSSSKTQERLKELPGATLTGPDAPLYP  60

Query  337  GFQEPLATLPGSEIDHPFQ-PNLQGSEFLEGFRTADQNSFADVWDGIQRPQLPH------  495
            G    L+TLPG E D   Q P+ QGSEFL  FR A Q+ F D W+ I RPQ+PH      
Sbjct  61   GSDGQLSTLPGLEYDQQHQHPDAQGSEFLPSFRNAVQDGFGDAWNEIHRPQVPHVEGSEG  120

Query  496  ----SNFP--LD---NSQLQPELNGPPQRVLSNFLHSFVNSSHGGIPFRPASLPVLGLSQ  648
                + F    D   NSQ+Q   +GPPQRVLS+FLHSFV+SS  GIPFRPA LPVLGLS+
Sbjct  121  QPYFAEFENIYDHGVNSQMQRAWDGPPQRVLSSFLHSFVDSSRAGIPFRPAPLPVLGLSE  180

Query  649  GEKQCIRDRSTIMARHFFADKNEDFINAQVNALLCSLDIDAD  774
            G+KQCIRDRS+IMARHFFADK+EDFIN+QVNALL SLDID D
Sbjct  181  GDKQCIRDRSSIMARHFFADKSEDFINSQVNALLHSLDIDYD  222



>ref|XP_010089724.1| hypothetical protein L484_013918 [Morus notabilis]
 gb|EXB38285.1| hypothetical protein L484_013918 [Morus notabilis]
Length=283

 Score =   249 bits (637),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 138/209 (66%), Positives = 162/209 (78%), Gaps = 8/209 (4%)
 Frame = +1

Query  160  MAMRDLVTGGAACAVPGSSSS-NPFGALANTLIGSSSKTQERLKEIPTSVSTPSDGNFGV  336
            MAMR++VTGGAACAVPGSSSS NP GALAN L+GSSSKT+ERL+EIPTS +  +  +   
Sbjct  1    MAMREVVTGGAACAVPGSSSSSNPLGALANALLGSSSKTKERLEEIPTSAAAAAAASSER  60

Query  337  GFQ---EPLAT-LPGSEIDHPFQP-NLQGSEFLEGFRTADQNSFADVWDGIQRPQLPHSN  501
              Q   +PL   LPGSE D P  P + QGS+F+  FR+AD +S +D WD  Q+     S+
Sbjct  61   DAQLLDQPLINQLPGSEFDRPLLPPSSQGSDFIGAFRSADYSSLSDAWDETQQAS-SQSH  119

Query  502  FPLDNSQLQPELNGPPQRVLSNFLHSFVNSSHGGIPFRPASLPVLGLSQGEKQCIRDRST  681
             P  + QLQP L+GPPQRVLSNFLHSFV SS GGIPFRPA LP+LGLSQG+KQCIRDR++
Sbjct  120  LP-SHLQLQPTLDGPPQRVLSNFLHSFVESSRGGIPFRPAPLPLLGLSQGDKQCIRDRTS  178

Query  682  IMARHFFADKNEDFINAQVNALLCSLDID  768
            IMARH FADK E+FINAQVNALLCSLDID
Sbjct  179  IMARHIFADKGEEFINAQVNALLCSLDID  207



>ref|XP_009374433.1| PREDICTED: peroxisome biogenesis protein 5-like isoform X1 [Pyrus 
x bretschneideri]
Length=748

 Score =   261 bits (666),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 142/216 (66%), Positives = 160/216 (74%), Gaps = 11/216 (5%)
 Frame = +1

Query  160  MAMRDLVTGGAACAVPG-SSSSNPFGALANTLIGSSSKTQERLKEIPTSVSTPSDGNFGV  336
            MAMRDLVTGGAACAVPG +SSSNPFGALAN LIGSSSK QERLKEIP+S  T S+  F  
Sbjct  1    MAMRDLVTGGAACAVPGQTSSSNPFGALANALIGSSSKQQERLKEIPSSTPTASEPQFYP  60

Query  337  GFQEPLATLPGSEIDHPF-QPNLQGSEFLEGFRTADQNSFAD-VWDGIQRPQ-----LPH  495
                 L  LPGS  D PF QP+ Q S+FL  F + D N   D  WD IQ  Q     +P 
Sbjct  61   DGHGHLQQLPGSGFDQPFMQPSTQSSDFLRKFNSVDGNRLLDNAWDEIQSSQPGPMHMPQ  120

Query  496  SNFPLD---NSQLQPELNGPPQRVLSNFLHSFVNSSHGGIPFRPASLPVLGLSQGEKQCI  666
             +   D   ++QLQP L+GPPQRVLS+FLHSFV SS GG+PFRPA LPVLGLS G+KQCI
Sbjct  121  HDRIYDMGASTQLQPTLDGPPQRVLSSFLHSFVESSRGGMPFRPAPLPVLGLSAGDKQCI  180

Query  667  RDRSTIMARHFFADKNEDFINAQVNALLCSLDIDAD  774
            RDR++IMARHFFADK+EDFIN QVNALL SLDID+D
Sbjct  181  RDRTSIMARHFFADKSEDFINGQVNALLSSLDIDSD  216



>ref|XP_002299082.1| peroxisomal targeting signal-1 receptor family protein [Populus 
trichocarpa]
 gb|EEE83887.1| peroxisomal targeting signal-1 receptor family protein [Populus 
trichocarpa]
Length=752

 Score =   261 bits (666),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 145/215 (67%), Positives = 161/215 (75%), Gaps = 10/215 (5%)
 Frame = +1

Query  160  MAMRDLVTGGAACAVPGSSSS--NPFGALANTLIGSSSKTQERLKEIPTSVSTPSDGNF-  330
            MAMR+LVTG AACAVPGSSSS  NP GALAN LIGSSSK  E LKEIPTS +T ++    
Sbjct  1    MAMRELVTGAAACAVPGSSSSSSNPLGALANALIGSSSKPLEGLKEIPTSTTTATEPPLY  60

Query  331  -GVGFQEPLATLPGSEIDHPF--QPNLQGSEFLEGFRTADQNSFADVWDGIQRPQLPHSN  501
                 ++ L  LPG++ DH F   P  QGSEFL  FRT+DQN FA+ WD IQR   P   
Sbjct  61   QDATAEDRLRGLPGADFDHSFSQHPTSQGSEFLRRFRTSDQNGFANAWDEIQRSGPPPPP  120

Query  502  FPLDNS----QLQPELNGPPQRVLSNFLHSFVNSSHGGIPFRPASLPVLGLSQGEKQCIR  669
              LD+     QLQP L+GPPQRVLSNFLHSFV SSHGGIPFRPA LP LGLS+G+KQCIR
Sbjct  121  ALLDHGLPPPQLQPTLDGPPQRVLSNFLHSFVGSSHGGIPFRPAPLPALGLSEGDKQCIR  180

Query  670  DRSTIMARHFFADKNEDFINAQVNALLCSLDIDAD  774
            DRS+IMARHFFADK+EDFIN QVNALL SLDID D
Sbjct  181  DRSSIMARHFFADKSEDFINTQVNALLSSLDIDGD  215



>ref|XP_008246513.1| PREDICTED: peroxisome biogenesis protein 5 [Prunus mume]
Length=750

 Score =   260 bits (664),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 143/216 (66%), Positives = 159/216 (74%), Gaps = 11/216 (5%)
 Frame = +1

Query  160  MAMRDLVTGGAACAVPGSSSS-NPFGALANTLIGSSSKTQERLKEIPTSVSTPSDGNFGV  336
            MAMR+LVTGGAACAVPGSSSS NPFGALAN LIGSSSKTQERLKEIP S  T S+  F  
Sbjct  1    MAMRELVTGGAACAVPGSSSSANPFGALANALIGSSSKTQERLKEIPQSTPTASEPQFYP  60

Query  337  GFQEPLATLPGSEIDHPF-QPNLQGSEFLEGFRTADQNSFAD-VWDGIQRPQLPHSNFP-  507
                 L  LPGSE + PF QP  Q S+FL  F + D N   D  WD IQ  Q P  + P 
Sbjct  61   DAHGHLQQLPGSEFEQPFMQPGTQSSDFLRNFNSVDGNRLLDNAWDEIQSSQPPPMHVPQ  120

Query  508  LDN-------SQLQPELNGPPQRVLSNFLHSFVNSSHGGIPFRPASLPVLGLSQGEKQCI  666
            LD         QLQP L+GPPQRVLS+FLHSFV SS GG+PFRPA LPVLGLS G+K+CI
Sbjct  121  LDRIYDLGAAPQLQPTLDGPPQRVLSSFLHSFVESSRGGMPFRPAPLPVLGLSAGDKRCI  180

Query  667  RDRSTIMARHFFADKNEDFINAQVNALLCSLDIDAD  774
            RDR++IMARHFFADK+EDFIN QVNALL SLDI++D
Sbjct  181  RDRTSIMARHFFADKSEDFINGQVNALLSSLDIESD  216



>ref|XP_007207214.1| hypothetical protein PRUPE_ppa001874mg [Prunus persica]
 gb|EMJ08413.1| hypothetical protein PRUPE_ppa001874mg [Prunus persica]
Length=750

 Score =   259 bits (663),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 143/216 (66%), Positives = 159/216 (74%), Gaps = 11/216 (5%)
 Frame = +1

Query  160  MAMRDLVTGGAACAVPGSSSS-NPFGALANTLIGSSSKTQERLKEIPTSVSTPSDGNFGV  336
            MAMR+LVTGGAACAVPGSSSS NPFGALAN LIGSSSKTQERLKEIP S  T S+  F  
Sbjct  1    MAMRELVTGGAACAVPGSSSSANPFGALANALIGSSSKTQERLKEIPQSTPTASEQQFYP  60

Query  337  GFQEPLATLPGSEIDHPF-QPNLQGSEFLEGFRTADQNSFAD-VWDGIQRPQLPHSNFP-  507
                 L  LPGSE + PF QP  Q S+FL  F + D N   D  WD IQ  Q P  + P 
Sbjct  61   DAHGHLQQLPGSEFEQPFMQPGTQSSDFLRNFNSVDGNRLLDNAWDEIQISQPPPMHVPQ  120

Query  508  LDN-------SQLQPELNGPPQRVLSNFLHSFVNSSHGGIPFRPASLPVLGLSQGEKQCI  666
            LD         QLQP L+GPPQRVLS+FLHSFV SS GG+PFRPA LPVLGLS G+K+CI
Sbjct  121  LDRIYDLGAAPQLQPTLDGPPQRVLSSFLHSFVESSRGGMPFRPAPLPVLGLSAGDKRCI  180

Query  667  RDRSTIMARHFFADKNEDFINAQVNALLCSLDIDAD  774
            RDR++IMARHFFADK+EDFIN QVNALL SLDI++D
Sbjct  181  RDRTSIMARHFFADKSEDFINGQVNALLSSLDIESD  216



>ref|XP_009379078.1| PREDICTED: peroxisome biogenesis protein 5-like isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009379079.1| PREDICTED: peroxisome biogenesis protein 5-like isoform X1 [Pyrus 
x bretschneideri]
Length=746

 Score =   258 bits (659),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 140/214 (65%), Positives = 157/214 (73%), Gaps = 9/214 (4%)
 Frame = +1

Query  160  MAMRDLVTGGAACAVPG-SSSSNPFGALANTLIGSSSKTQERLKEIPTSVSTPSDGNFGV  336
            MAMR+LVTGGAACAVPG SSSSNPFGALAN LIGSSSK QERLKEIP+S  T S+  F  
Sbjct  1    MAMRELVTGGAACAVPGQSSSSNPFGALANALIGSSSKQQERLKEIPSSTPTASEPQFYP  60

Query  337  GFQEPLATLPGSEIDHPF-QPNLQGSEFLEGFRTADQNSF-ADVWDGIQRPQ-----LPH  495
                 L  LPGSE+D PF QP  Q SEFL  F + D N    + WD +Q  Q     +P 
Sbjct  61   DGHGHLQQLPGSELDQPFMQPRTQSSEFLRNFNSVDGNRLLGNAWDEVQSSQPEPMHMPQ  120

Query  496  SNFPLD-NSQLQPELNGPPQRVLSNFLHSFVNSSHGGIPFRPASLPVLGLSQGEKQCIRD  672
             +   D   QLQ  L+GPPQRVLS+FLHSFV SS GG+PFRP  LPVLGLS G+KQCIRD
Sbjct  121  HDRIYDMRPQLQTTLDGPPQRVLSSFLHSFVESSRGGMPFRPTPLPVLGLSAGDKQCIRD  180

Query  673  RSTIMARHFFADKNEDFINAQVNALLCSLDIDAD  774
            R++IMARHFFADK+EDFIN QVNALL SLDID+D
Sbjct  181  RTSIMARHFFADKSEDFINGQVNALLSSLDIDSD  214



>ref|XP_008355107.1| PREDICTED: peroxisome biogenesis protein 5-like [Malus domestica]
Length=347

 Score =   246 bits (627),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 141/216 (65%), Positives = 154/216 (71%), Gaps = 14/216 (6%)
 Frame = +1

Query  160  MAMRDLVTGGAACAVPG-SSSSNPFGALANTLIGSSSKTQERLKEIPTSVSTPSDGNFGV  336
            MAMR+LVTGGAACAVPG SSSSNPFGALAN LIGSSSK QE LKEIP+S  T S+  F  
Sbjct  1    MAMRELVTGGAACAVPGQSSSSNPFGALANALIGSSSK-QEGLKEIPSSTPTASEPQFYP  59

Query  337  GFQEPLATLPGSEIDHPF-QPNLQGSEFLEGFRTADQNSFAD-VWDGIQ--------RPQ  486
                 L  LPGSE+D PF QP  Q SEFL  F + D N   D  WD IQ         PQ
Sbjct  60   DGHGHLQQLPGSELDQPFMQPRTQSSEFLRNFNSVDGNRLLDNAWDEIQSSXPEPMHXPQ  119

Query  487  LPHSNFPLDNSQLQPELNGPPQRVLSNFLHSFVNSSHGGIPFRPASLPVLGLSQGEKQCI  666
              H         LQP L+GPPQRVLS+FLHSFV SS GG+PFRP  LPVLGLS G+KQCI
Sbjct  120  --HDRIYDMRPXLQPTLDGPPQRVLSSFLHSFVESSRGGMPFRPTPLPVLGLSAGDKQCI  177

Query  667  RDRSTIMARHFFADKNEDFINAQVNALLCSLDIDAD  774
            RDR++IMARHFFADK+EDFIN QVNALL SLDID+D
Sbjct  178  RDRTSIMARHFFADKSEDFINGQVNALLSSLDIDSD  213



>ref|XP_009374434.1| PREDICTED: peroxisome biogenesis protein 5-like isoform X2 [Pyrus 
x bretschneideri]
Length=747

 Score =   255 bits (652),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 141/216 (65%), Positives = 160/216 (74%), Gaps = 12/216 (6%)
 Frame = +1

Query  160  MAMRDLVTGGAACAVPG-SSSSNPFGALANTLIGSSSKTQERLKEIPTSVSTPSDGNFGV  336
            MAMRDLVTGGAACAVPG +SSSNPFGALAN LIGSSSK Q+RLKEIP+S  T S+  F  
Sbjct  1    MAMRDLVTGGAACAVPGQTSSSNPFGALANALIGSSSK-QQRLKEIPSSTPTASEPQFYP  59

Query  337  GFQEPLATLPGSEIDHPF-QPNLQGSEFLEGFRTADQNSFAD-VWDGIQRPQ-----LPH  495
                 L  LPGS  D PF QP+ Q S+FL  F + D N   D  WD IQ  Q     +P 
Sbjct  60   DGHGHLQQLPGSGFDQPFMQPSTQSSDFLRKFNSVDGNRLLDNAWDEIQSSQPGPMHMPQ  119

Query  496  SNFPLD---NSQLQPELNGPPQRVLSNFLHSFVNSSHGGIPFRPASLPVLGLSQGEKQCI  666
             +   D   ++QLQP L+GPPQRVLS+FLHSFV SS GG+PFRPA LPVLGLS G+KQCI
Sbjct  120  HDRIYDMGASTQLQPTLDGPPQRVLSSFLHSFVESSRGGMPFRPAPLPVLGLSAGDKQCI  179

Query  667  RDRSTIMARHFFADKNEDFINAQVNALLCSLDIDAD  774
            RDR++IMARHFFADK+EDFIN QVNALL SLDID+D
Sbjct  180  RDRTSIMARHFFADKSEDFINGQVNALLSSLDIDSD  215



>ref|XP_009132316.1| PREDICTED: peroxisome biogenesis protein 5-like [Brassica rapa]
Length=730

 Score =   255 bits (651),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 134/205 (65%), Positives = 150/205 (73%), Gaps = 4/205 (2%)
 Frame = +1

Query  160  MAMRDLVTGGAACAVPGSSSS-NPFGALANTLIGSSSKTQERLKEIPTSVSTPSDGNFGV  336
            MAMRDLV GGAACAVPGSSSS NP GAL N L+GSSSKTQERLKEIP + S+     F  
Sbjct  1    MAMRDLVNGGAACAVPGSSSSSNPLGALTNALLGSSSKTQERLKEIPNATSSGPGPQFYS  60

Query  337  GFQEPLATLPGSEIDHPF-QPNLQGSEFLEGFRTADQNSFADVWDGIQRPQLPHSNFPLD  513
              Q  L++LPGSE+D P  QP  QG+EF  GFR+ DQN     WD +QR           
Sbjct  61   QDQH-LSSLPGSELDQPLLQPGAQGTEFFRGFRSVDQNGLGAAWDEVQRGGPMPPM-GPM  118

Query  514  NSQLQPELNGPPQRVLSNFLHSFVNSSHGGIPFRPASLPVLGLSQGEKQCIRDRSTIMAR  693
               +QP   GPPQRVLSNFLHSFV SS GGIPFRPA +PVLGLSQ +KQCIRDRS+IMAR
Sbjct  119  YEPVQPTFEGPPQRVLSNFLHSFVESSRGGIPFRPAPVPVLGLSQSDKQCIRDRSSIMAR  178

Query  694  HFFADKNEDFINAQVNALLCSLDID  768
            HFFAD+ E+FIN+QVNALL SLDID
Sbjct  179  HFFADRGEEFINSQVNALLSSLDID  203



>emb|CDY11941.1| BnaC03g13670D [Brassica napus]
Length=730

 Score =   254 bits (650),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 134/205 (65%), Positives = 150/205 (73%), Gaps = 4/205 (2%)
 Frame = +1

Query  160  MAMRDLVTGGAACAVPGSSSS-NPFGALANTLIGSSSKTQERLKEIPTSVSTPSDGNFGV  336
            MAMRDLV GGAACAVPGSSSS NP GAL N L+GSSSKTQERLKEIP + S+     F  
Sbjct  1    MAMRDLVNGGAACAVPGSSSSSNPLGALTNALLGSSSKTQERLKEIPNATSSGPGPQFYS  60

Query  337  GFQEPLATLPGSEIDHP-FQPNLQGSEFLEGFRTADQNSFADVWDGIQRPQLPHSNFPLD  513
              Q  L++LPGSE+D P  QP  QG+EF  GFR+ DQN     WD +QR           
Sbjct  61   QDQH-LSSLPGSELDQPVLQPGAQGTEFFRGFRSVDQNGLGAAWDEVQRGGPMPPM-GPM  118

Query  514  NSQLQPELNGPPQRVLSNFLHSFVNSSHGGIPFRPASLPVLGLSQGEKQCIRDRSTIMAR  693
               +QP   GPPQRVLSNFLHSFV SS GGIPFRPA +PVLGLSQ +KQCIRDRS+IMAR
Sbjct  119  YEPVQPTFEGPPQRVLSNFLHSFVESSRGGIPFRPAPVPVLGLSQSDKQCIRDRSSIMAR  178

Query  694  HFFADKNEDFINAQVNALLCSLDID  768
            HFFAD+ E+FIN+QVNALL SLDID
Sbjct  179  HFFADRGEEFINSQVNALLSSLDID  203



>gb|KFK27205.1| hypothetical protein AALP_AA8G349500 [Arabis alpina]
Length=728

 Score =   254 bits (649),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 136/205 (66%), Positives = 149/205 (73%), Gaps = 4/205 (2%)
 Frame = +1

Query  160  MAMRDLVTGGAACAVPGSSSS-NPFGALANTLIGSSSKTQERLKEIPTSVSTPSDGNFGV  336
            MAMRDLV GGAACAVPGSSSS NP GAL N L+GSSSKTQERLKEIP +  T     F  
Sbjct  1    MAMRDLVNGGAACAVPGSSSSSNPLGALTNALLGSSSKTQERLKEIPNASRTGPGPQF-Y  59

Query  337  GFQEPLATLPGSEIDHPF-QPNLQGSEFLEGFRTADQNSFADVWDGIQRPQLPHSNFPLD  513
               +PL +LPGSE+D P  QP  QGSEF  GFR+ DQN F   WD +Q   +P       
Sbjct  60   SEDQPLRSLPGSELDQPLLQPGAQGSEFFSGFRSVDQNGFGAAWDEVQH-GVPMPPLGPM  118

Query  514  NSQLQPELNGPPQRVLSNFLHSFVNSSHGGIPFRPASLPVLGLSQGEKQCIRDRSTIMAR  693
                QP   GPPQRVLSNFLHSFV SS GGIPFRPA LPVLGLSQ +KQCIRDRS+IMAR
Sbjct  119  YEPAQPTFEGPPQRVLSNFLHSFVESSRGGIPFRPAPLPVLGLSQSDKQCIRDRSSIMAR  178

Query  694  HFFADKNEDFINAQVNALLCSLDID  768
            HFFAD+ E+FIN QVNALL SL+ID
Sbjct  179  HFFADRGEEFINNQVNALLSSLEID  203



>ref|XP_010539370.1| PREDICTED: peroxisome biogenesis protein 5 isoform X2 [Tarenaya 
hassleriana]
Length=707

 Score =   254 bits (648),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 141/209 (67%), Positives = 155/209 (74%), Gaps = 7/209 (3%)
 Frame = +1

Query  160  MAMRDLVTGGAACAVPGSSSS-NPFGALANTLIGSSSKTQERLKEIPTSVSTPSDGNFGV  336
            MAMRDLVTGGAAC+VPGSSSS NP GAL N L+GSSSKTQERLKEIPT+  + S   F  
Sbjct  1    MAMRDLVTGGAACSVPGSSSSSNPLGALTNALLGSSSKTQERLKEIPTATPSGSGPQF-Y  59

Query  337  GFQEPLATLPGSEIDHP-FQPNLQGSEFLEGFRTADQNSFADVWDGIQR--PQLPHSNFP  507
               E L  LPGSE+D P  QP  QGSEF  GFR+ DQN  A  WD +Q   P  P S+  
Sbjct  60   SENEQLRALPGSELDQPILQPGAQGSEFFRGFRSVDQNGLAAAWDEVQHGGPMPPVSS--  117

Query  508  LDNSQLQPELNGPPQRVLSNFLHSFVNSSHGGIPFRPASLPVLGLSQGEKQCIRDRSTIM  687
            L    +QP   GPPQRVLS+FLHSFV SS GGIPFRPA LP+LGLS  +KQCIRDRS+IM
Sbjct  118  LYERPVQPTFEGPPQRVLSSFLHSFVESSRGGIPFRPAPLPMLGLSASDKQCIRDRSSIM  177

Query  688  ARHFFADKNEDFINAQVNALLCSLDIDAD  774
            ARH FADK+EDFINAQVNALL SLDID D
Sbjct  178  ARHIFADKSEDFINAQVNALLSSLDIDND  206



>emb|CDY36789.1| BnaA03g10970D [Brassica napus]
Length=755

 Score =   254 bits (650),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 134/205 (65%), Positives = 150/205 (73%), Gaps = 4/205 (2%)
 Frame = +1

Query  160  MAMRDLVTGGAACAVPGSSSS-NPFGALANTLIGSSSKTQERLKEIPTSVSTPSDGNFGV  336
            MAMRDLV GGAACAVPGSSSS NP GAL N L+GSSSKTQERLKEIP + S+     F  
Sbjct  1    MAMRDLVNGGAACAVPGSSSSSNPLGALTNALLGSSSKTQERLKEIPNATSSGPGPQFYS  60

Query  337  GFQEPLATLPGSEIDHPF-QPNLQGSEFLEGFRTADQNSFADVWDGIQRPQLPHSNFPLD  513
              Q  L++LPGSE+D P  QP  QG+EF  GFR+ DQN     WD +QR           
Sbjct  61   QDQH-LSSLPGSELDQPLLQPGAQGTEFFRGFRSVDQNGLGAAWDEVQRGGPMPPM-GPM  118

Query  514  NSQLQPELNGPPQRVLSNFLHSFVNSSHGGIPFRPASLPVLGLSQGEKQCIRDRSTIMAR  693
               +QP   GPPQRVLSNFLHSFV SS GGIPFRPA +PVLGLSQ +KQCIRDRS+IMAR
Sbjct  119  YEPVQPTFEGPPQRVLSNFLHSFVESSRGGIPFRPAPVPVLGLSQSDKQCIRDRSSIMAR  178

Query  694  HFFADKNEDFINAQVNALLCSLDID  768
            HFFAD+ E+FIN+QVNALL SLDID
Sbjct  179  HFFADRGEEFINSQVNALLSSLDID  203



>ref|XP_010539369.1| PREDICTED: peroxisome biogenesis protein 5 isoform X1 [Tarenaya 
hassleriana]
Length=729

 Score =   254 bits (648),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 141/209 (67%), Positives = 155/209 (74%), Gaps = 7/209 (3%)
 Frame = +1

Query  160  MAMRDLVTGGAACAVPGSSSS-NPFGALANTLIGSSSKTQERLKEIPTSVSTPSDGNFGV  336
            MAMRDLVTGGAAC+VPGSSSS NP GAL N L+GSSSKTQERLKEIPT+  + S   F  
Sbjct  1    MAMRDLVTGGAACSVPGSSSSSNPLGALTNALLGSSSKTQERLKEIPTATPSGSGPQF-Y  59

Query  337  GFQEPLATLPGSEIDHP-FQPNLQGSEFLEGFRTADQNSFADVWDGIQR--PQLPHSNFP  507
               E L  LPGSE+D P  QP  QGSEF  GFR+ DQN  A  WD +Q   P  P S+  
Sbjct  60   SENEQLRALPGSELDQPILQPGAQGSEFFRGFRSVDQNGLAAAWDEVQHGGPMPPVSS--  117

Query  508  LDNSQLQPELNGPPQRVLSNFLHSFVNSSHGGIPFRPASLPVLGLSQGEKQCIRDRSTIM  687
            L    +QP   GPPQRVLS+FLHSFV SS GGIPFRPA LP+LGLS  +KQCIRDRS+IM
Sbjct  118  LYERPVQPTFEGPPQRVLSSFLHSFVESSRGGIPFRPAPLPMLGLSASDKQCIRDRSSIM  177

Query  688  ARHFFADKNEDFINAQVNALLCSLDIDAD  774
            ARH FADK+EDFINAQVNALL SLDID D
Sbjct  178  ARHIFADKSEDFINAQVNALLSSLDIDND  206



>ref|XP_009379080.1| PREDICTED: peroxisome biogenesis protein 5-like isoform X2 [Pyrus 
x bretschneideri]
Length=745

 Score =   254 bits (648),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 140/214 (65%), Positives = 157/214 (73%), Gaps = 10/214 (5%)
 Frame = +1

Query  160  MAMRDLVTGGAACAVPG-SSSSNPFGALANTLIGSSSKTQERLKEIPTSVSTPSDGNFGV  336
            MAMR+LVTGGAACAVPG SSSSNPFGALAN LIGSSSK QERLKEIP+S  T S+  F  
Sbjct  1    MAMRELVTGGAACAVPGQSSSSNPFGALANALIGSSSK-QERLKEIPSSTPTASEPQFYP  59

Query  337  GFQEPLATLPGSEIDHPF-QPNLQGSEFLEGFRTADQNSF-ADVWDGIQRPQ-----LPH  495
                 L  LPGSE+D PF QP  Q SEFL  F + D N    + WD +Q  Q     +P 
Sbjct  60   DGHGHLQQLPGSELDQPFMQPRTQSSEFLRNFNSVDGNRLLGNAWDEVQSSQPEPMHMPQ  119

Query  496  SNFPLD-NSQLQPELNGPPQRVLSNFLHSFVNSSHGGIPFRPASLPVLGLSQGEKQCIRD  672
             +   D   QLQ  L+GPPQRVLS+FLHSFV SS GG+PFRP  LPVLGLS G+KQCIRD
Sbjct  120  HDRIYDMRPQLQTTLDGPPQRVLSSFLHSFVESSRGGMPFRPTPLPVLGLSAGDKQCIRD  179

Query  673  RSTIMARHFFADKNEDFINAQVNALLCSLDIDAD  774
            R++IMARHFFADK+EDFIN QVNALL SLDID+D
Sbjct  180  RTSIMARHFFADKSEDFINGQVNALLSSLDIDSD  213



>ref|XP_006401353.1| hypothetical protein EUTSA_v10012791mg [Eutrema salsugineum]
 gb|ESQ42806.1| hypothetical protein EUTSA_v10012791mg [Eutrema salsugineum]
Length=727

 Score =   251 bits (641),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 136/209 (65%), Positives = 152/209 (73%), Gaps = 12/209 (6%)
 Frame = +1

Query  160  MAMRDLVTGGAACAVPGSSSS-NPFGALANTLIGSSSKTQERLKEIPTSVSTPSDGNFGV  336
            MAMRDLV GGAACAVPGSSSS NP GAL N L+GSSSKTQERLKEIP +  +     F  
Sbjct  1    MAMRDLVNGGAACAVPGSSSSSNPLGALTNALLGSSSKTQERLKEIPNANRSGPGPQFYS  60

Query  337  GFQEPLATLPGSEIDHP-FQPNLQGSEFLEGFRTADQNSFADVWDGIQR----PQLPHSN  501
              Q  L++LPGSE++ P  QP  QG+EF  GFR+ DQN     WD +QR    P L    
Sbjct  61   EDQH-LSSLPGSELEQPILQPGAQGTEFFRGFRSVDQNGLGAAWDEVQRGGPMPPLGPMY  119

Query  502  FPLDNSQLQPELNGPPQRVLSNFLHSFVNSSHGGIPFRPASLPVLGLSQGEKQCIRDRST  681
             P+     QP   GPPQRVLSNFLHSFV SS GGIPFRPA +PVLGLSQ +KQCIRDRS+
Sbjct  120  EPV-----QPTFEGPPQRVLSNFLHSFVESSRGGIPFRPAPVPVLGLSQSDKQCIRDRSS  174

Query  682  IMARHFFADKNEDFINAQVNALLCSLDID  768
            IMARHFFAD+ E+FINAQVNALL SLDID
Sbjct  175  IMARHFFADRGEEFINAQVNALLSSLDID  203



>ref|XP_006401352.1| hypothetical protein EUTSA_v10012791mg [Eutrema salsugineum]
 gb|ESQ42805.1| hypothetical protein EUTSA_v10012791mg [Eutrema salsugineum]
Length=725

 Score =   251 bits (641),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 136/209 (65%), Positives = 152/209 (73%), Gaps = 12/209 (6%)
 Frame = +1

Query  160  MAMRDLVTGGAACAVPGSSSS-NPFGALANTLIGSSSKTQERLKEIPTSVSTPSDGNFGV  336
            MAMRDLV GGAACAVPGSSSS NP GAL N L+GSSSKTQERLKEIP +  +     F  
Sbjct  1    MAMRDLVNGGAACAVPGSSSSSNPLGALTNALLGSSSKTQERLKEIPNANRSGPGPQFYS  60

Query  337  GFQEPLATLPGSEIDHP-FQPNLQGSEFLEGFRTADQNSFADVWDGIQR----PQLPHSN  501
              Q  L++LPGSE++ P  QP  QG+EF  GFR+ DQN     WD +QR    P L    
Sbjct  61   EDQH-LSSLPGSELEQPILQPGAQGTEFFRGFRSVDQNGLGAAWDEVQRGGPMPPLGPMY  119

Query  502  FPLDNSQLQPELNGPPQRVLSNFLHSFVNSSHGGIPFRPASLPVLGLSQGEKQCIRDRST  681
             P+     QP   GPPQRVLSNFLHSFV SS GGIPFRPA +PVLGLSQ +KQCIRDRS+
Sbjct  120  EPV-----QPTFEGPPQRVLSNFLHSFVESSRGGIPFRPAPVPVLGLSQSDKQCIRDRSS  174

Query  682  IMARHFFADKNEDFINAQVNALLCSLDID  768
            IMARHFFAD+ E+FINAQVNALL SLDID
Sbjct  175  IMARHFFADRGEEFINAQVNALLSSLDID  203



>gb|ABB92565.1| peroxisomal import receptor PTS1 [Brassica napus]
Length=731

 Score =   249 bits (637),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 134/206 (65%), Positives = 148/206 (72%), Gaps = 5/206 (2%)
 Frame = +1

Query  160  MAMRDLVTGGAACAVPGSSSS-NPFGALANTLIGSSSKTQERLKEIPTSV-STPSDGNFG  333
            MAMRDLV GGAACAVPGSSSS NP GAL N L+GSSSKTQERLKEIP +  S P    F 
Sbjct  1    MAMRDLVNGGAACAVPGSSSSSNPLGALTNALLGSSSKTQERLKEIPNATRSGPGRPQFY  60

Query  334  VGFQEPLATLPGSEIDHP-FQPNLQGSEFLEGFRTADQNSFADVWDGIQRPQLPHSNFPL  510
               Q  L +LPGSE+D P  QP  QG+EF  GF + DQN     WD +QR          
Sbjct  61   SQDQH-LTSLPGSELDQPVLQPGAQGAEFFRGFSSVDQNGLGAAWDEVQRGGPMPPM-GP  118

Query  511  DNSQLQPELNGPPQRVLSNFLHSFVNSSHGGIPFRPASLPVLGLSQGEKQCIRDRSTIMA  690
                +QP   GPPQRVLSNFLHSFV SS GGIPFRPA +PVLGLSQ +KQCIRDRS+IMA
Sbjct  119  MYEPVQPTFEGPPQRVLSNFLHSFVESSRGGIPFRPAPVPVLGLSQSDKQCIRDRSSIMA  178

Query  691  RHFFADKNEDFINAQVNALLCSLDID  768
            RHFFAD+ E+FIN+QVNALL SLDID
Sbjct  179  RHFFADRGEEFINSQVNALLSSLDID  204



>ref|XP_006280156.1| hypothetical protein CARUB_v10026055mg [Capsella rubella]
 gb|EOA13054.1| hypothetical protein CARUB_v10026055mg [Capsella rubella]
Length=652

 Score =   248 bits (632),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 134/207 (65%), Positives = 153/207 (74%), Gaps = 8/207 (4%)
 Frame = +1

Query  160  MAMRDLVTGGAACAVPGSSSS-NPFGALANTLIGSSSKTQERLKEIPTSVSTPSDGNFGV  336
            MAMRDLV GGAACAVPGSSSS NP GAL N L+GSSSKTQERLKEIP +  +     F  
Sbjct  1    MAMRDLVNGGAACAVPGSSSSSNPLGALTNALLGSSSKTQERLKEIPNANRSGPGPQFYS  60

Query  337  GFQEPLATLPGSEIDHP-FQPNLQGSEFLEGFRTADQNSFADVWDGIQR--PQLPHSNFP  507
              Q+ + +LPGSE+D P  QP  QGSEF   FR+ DQN     WD +Q+  P  P    P
Sbjct  61   EDQQ-IRSLPGSELDQPGLQPGGQGSEFFRTFRSVDQNGLGAAWDEVQQGVPMPPMG--P  117

Query  508  LDNSQLQPELNGPPQRVLSNFLHSFVNSSHGGIPFRPASLPVLGLSQGEKQCIRDRSTIM  687
            +    +QP   GPPQRVLSNFLHSFV+SS GGIPFRPA +P+LGLSQ +KQCIRDRS+IM
Sbjct  118  M-YEPVQPTFEGPPQRVLSNFLHSFVDSSRGGIPFRPAPVPILGLSQSDKQCIRDRSSIM  176

Query  688  ARHFFADKNEDFINAQVNALLCSLDID  768
            ARHFFAD+ E+FINAQVNALL SLDID
Sbjct  177  ARHFFADRGEEFINAQVNALLSSLDID  203



>ref|XP_008448966.1| PREDICTED: peroxisome biogenesis protein 5 [Cucumis melo]
Length=743

 Score =   249 bits (637),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 137/218 (63%), Positives = 152/218 (70%), Gaps = 18/218 (8%)
 Frame = +1

Query  160  MAMRDLVTGGAACAVPGSSSSNPFGALANTLIGSSSKTQERLKEIPTSVSTPSDGNFGVG  339
            MAMRDLVTGGA CA PGSSSSNP GALAN LIGSSSKTQERL+EIPTS  T  +  F   
Sbjct  1    MAMRDLVTGGADCAAPGSSSSNPLGALANALIGSSSKTQERLREIPTSQLTGPERPFAP-  59

Query  340  FQEPLATLPGSEIDHP-FQPNLQGSEFLEGFRTADQNSFADVWDGIQ-----------RP  483
              E    LPGSE DHP  QPN Q S FL  F +A     A  W+ +Q           +P
Sbjct  60   --ETHGQLPGSEFDHPPLQPNQQASNFLNAFHSAADPGLASAWNEVQAGPPPAHLREMQP  117

Query  484  QLPHSNFPLDN---SQLQPELNGPPQRVLSNFLHSFVNSSHGGIPFRPASLPVLGLSQGE  654
             L   +   D    SQ QP L+GPPQRVLSNFLHSFV SS GG+PF P  LP+LGLS+G+
Sbjct  118  SLAEFDRIYDQVPASQHQPILDGPPQRVLSNFLHSFVESSRGGVPFHPTPLPLLGLSEGD  177

Query  655  KQCIRDRSTIMARHFFADKNEDFINAQVNALLCSLDID  768
            KQCIRDRS+IMARHFFADK+EDFINAQ+NALL SLDID
Sbjct  178  KQCIRDRSSIMARHFFADKSEDFINAQLNALLSSLDID  215



>ref|NP_200440.1| peroxisome biogenesis protein 5 [Arabidopsis thaliana]
 sp|Q9FMA3.1|PEX5_ARATH RecName: Full=Peroxisome biogenesis protein 5; AltName: Full=Peroxin-5; 
Short=AtPEX5; AltName: Full=Peroxisomal targeting 
signal type 1 receptor; AltName: Full=Pex5p [Arabidopsis thaliana]
 dbj|BAB11256.1| peroxisomal targeting signal type 1 receptor [Arabidopsis thaliana]
 gb|AAL07148.1| putative peroxisomal targeting signal type 1 receptor protein 
[Arabidopsis thaliana]
 gb|AAM20313.1| putative peroxisomal targeting signal type 1 receptor protein 
[Arabidopsis thaliana]
 gb|AED96745.1| peroxin 5 [Arabidopsis thaliana]
Length=728

 Score =   249 bits (636),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 133/205 (65%), Positives = 151/205 (74%), Gaps = 4/205 (2%)
 Frame = +1

Query  160  MAMRDLVTGGAACAVPGSSSS-NPFGALANTLIGSSSKTQERLKEIPTSVSTPSDGNFGV  336
            MAMRDLV GGAACAVPGSSSS NP GAL N L+GSSSKTQERLKEIP +  +     F  
Sbjct  1    MAMRDLVNGGAACAVPGSSSSSNPLGALTNALLGSSSKTQERLKEIPNANRSGPRPQFYS  60

Query  337  GFQEPLATLPGSEIDHPF-QPNLQGSEFLEGFRTADQNSFADVWDGIQRPQLPHSNFPLD  513
              Q+ + +LPGSE+D P  QP  QGSEF  GFR+ DQN     WD +Q+        P+ 
Sbjct  61   EDQQ-IRSLPGSELDQPLLQPGAQGSEFFRGFRSVDQNGLGAAWDEVQQGGPMPPMGPMF  119

Query  514  NSQLQPELNGPPQRVLSNFLHSFVNSSHGGIPFRPASLPVLGLSQGEKQCIRDRSTIMAR  693
               +QP   GPPQRVLSNFLHSFV SS GGIPFRPA +PVLGLSQ +KQCIRDRS+IMAR
Sbjct  120  EP-VQPTFEGPPQRVLSNFLHSFVESSRGGIPFRPAPVPVLGLSQSDKQCIRDRSSIMAR  178

Query  694  HFFADKNEDFINAQVNALLCSLDID  768
            HFFAD+ E+FIN+QVNALL SLDID
Sbjct  179  HFFADRGEEFINSQVNALLSSLDID  203



>gb|AAC62012.1| peroxisomal targeting signal type 1 receptor [Arabidopsis thaliana]
Length=728

 Score =   249 bits (635),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 133/205 (65%), Positives = 151/205 (74%), Gaps = 4/205 (2%)
 Frame = +1

Query  160  MAMRDLVTGGAACAVPGSSSS-NPFGALANTLIGSSSKTQERLKEIPTSVSTPSDGNFGV  336
            MAMRDLV GGAACAVPGSSSS NP GAL N L+GSSSKTQERLKEIP +  +     F  
Sbjct  1    MAMRDLVNGGAACAVPGSSSSSNPLGALTNALLGSSSKTQERLKEIPNANRSGPRPQFYS  60

Query  337  GFQEPLATLPGSEIDHPF-QPNLQGSEFLEGFRTADQNSFADVWDGIQRPQLPHSNFPLD  513
              Q+ + +LPGSE+D P  QP  QGSEF  GFR+ DQN     WD +Q+        P+ 
Sbjct  61   EDQQ-IRSLPGSELDQPLLQPGAQGSEFFRGFRSVDQNGLGAAWDEVQQGGPMPPMGPMF  119

Query  514  NSQLQPELNGPPQRVLSNFLHSFVNSSHGGIPFRPASLPVLGLSQGEKQCIRDRSTIMAR  693
               +QP   GPPQRVLSNFLHSFV SS GGIPFRPA +PVLGLSQ +KQCIRDRS+IMAR
Sbjct  120  EP-VQPTFEGPPQRVLSNFLHSFVESSRGGIPFRPAPVPVLGLSQSDKQCIRDRSSIMAR  178

Query  694  HFFADKNEDFINAQVNALLCSLDID  768
            HFFAD+ E+FIN+QVNALL SLDID
Sbjct  179  HFFADRGEEFINSQVNALLSSLDID  203



>emb|CDY69423.1| BnaA10g29080D, partial [Brassica napus]
Length=434

 Score =   242 bits (617),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 131/206 (64%), Positives = 146/206 (71%), Gaps = 5/206 (2%)
 Frame = +1

Query  160  MAMRDLVTGGAACAVPGSSSS-NPFGALANTLIGSSSKTQERLKEIPTSV-STPSDGNFG  333
            MAMRDLV GGAACAVPGSSSS NP GAL N L+GSSSKTQERLKEIP +  S P    F 
Sbjct  1    MAMRDLVNGGAACAVPGSSSSSNPLGALTNALLGSSSKTQERLKEIPNATRSGPGRPQFY  60

Query  334  VGFQEPLATLPGSEIDHP-FQPNLQGSEFLEGFRTADQNSFADVWDGIQRPQLPHSNFPL  510
               Q  L +LPGSE+D P  QP  QG+EF  GF + DQN     WD +QR          
Sbjct  61   SQDQH-LTSLPGSELDQPVLQPGAQGAEFFRGFSSVDQNGLGAAWDEVQRGGPMPPM-GP  118

Query  511  DNSQLQPELNGPPQRVLSNFLHSFVNSSHGGIPFRPASLPVLGLSQGEKQCIRDRSTIMA  690
                + P   GPPQRVLSNFLHSFV SS GGIPFRP  +PVLGLSQ +KQCIRDRS+IMA
Sbjct  119  MYEPVHPTFEGPPQRVLSNFLHSFVESSRGGIPFRPPPVPVLGLSQSDKQCIRDRSSIMA  178

Query  691  RHFFADKNEDFINAQVNALLCSLDID  768
            RHFFAD+ E+FIN+QVNALL SL+ID
Sbjct  179  RHFFADRGEEFINSQVNALLSSLEID  204



>ref|XP_002864444.1| hypothetical protein ARALYDRAFT_495719 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40703.1| hypothetical protein ARALYDRAFT_495719 [Arabidopsis lyrata subsp. 
lyrata]
Length=726

 Score =   248 bits (632),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 131/205 (64%), Positives = 148/205 (72%), Gaps = 4/205 (2%)
 Frame = +1

Query  160  MAMRDLVTGGAACAVPGSSSS-NPFGALANTLIGSSSKTQERLKEIPTSVSTPSDGNFGV  336
            MAMRDLV GGAACAVPGSSSS NP GAL N L+GSSSKTQERLKEIP +  +     F  
Sbjct  1    MAMRDLVNGGAACAVPGSSSSSNPLGALTNALLGSSSKTQERLKEIPNANRSGPGPQFYS  60

Query  337  GFQEPLATLPGSEIDHP-FQPNLQGSEFLEGFRTADQNSFADVWDGIQRPQLPHSNFPLD  513
              Q+ + +LPGSE+D P  QP  QGSEF  GFR+ DQN     WD + +           
Sbjct  61   EDQQ-IRSLPGSELDQPGLQPGAQGSEFFRGFRSVDQNGLGAAWDEVHQGGPMPPM-GPM  118

Query  514  NSQLQPELNGPPQRVLSNFLHSFVNSSHGGIPFRPASLPVLGLSQGEKQCIRDRSTIMAR  693
               +QP   GPPQRVLSNFLHSFV SS GGIPFRPA +PVLGLSQ +KQCIRDRS+IMAR
Sbjct  119  YEPVQPTFEGPPQRVLSNFLHSFVESSRGGIPFRPAPVPVLGLSQSDKQCIRDRSSIMAR  178

Query  694  HFFADKNEDFINAQVNALLCSLDID  768
            HFFAD+ E+FIN+QVNALL SLDID
Sbjct  179  HFFADRGEEFINSQVNALLSSLDID  203



>ref|XP_010450908.1| PREDICTED: peroxisome biogenesis protein 5-like isoform X2 [Camelina 
sativa]
Length=694

 Score =   247 bits (630),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 132/207 (64%), Positives = 152/207 (73%), Gaps = 8/207 (4%)
 Frame = +1

Query  160  MAMRDLVTGGAACAVPGSSSS-NPFGALANTLIGSSSKTQERLKEIPTSVSTPSDGNFGV  336
            MAMRDLV GGAACAVPGSSSS NP GAL N L+GSSSKTQERLKEIP +  +  +  F  
Sbjct  1    MAMRDLVNGGAACAVPGSSSSSNPLGALTNALLGSSSKTQERLKEIPNANRSGPEPQFYS  60

Query  337  GFQEPLATLPGSEIDHP-FQPNLQGSEFLEGFRTADQNSFADVWDGIQR--PQLPHSNFP  507
              Q  + +LPGSE+D P  QP  QG+EF   FR+ DQN     WD +Q+  P  P    P
Sbjct  61   EDQH-IRSLPGSELDQPGLQPGAQGAEFFRSFRSVDQNGLGAAWDEVQQGVPMPPMG--P  117

Query  508  LDNSQLQPELNGPPQRVLSNFLHSFVNSSHGGIPFRPASLPVLGLSQGEKQCIRDRSTIM  687
            +    +QP   GPPQRVLSNFLHSFV SS GGIPFRPA +P+LGLSQ +KQCIRDRS+IM
Sbjct  118  M-YEPVQPTFEGPPQRVLSNFLHSFVESSRGGIPFRPAPVPILGLSQSDKQCIRDRSSIM  176

Query  688  ARHFFADKNEDFINAQVNALLCSLDID  768
            ARHFFAD+ E+FIN+QVNALL SLDID
Sbjct  177  ARHFFADRGEEFINSQVNALLSSLDID  203



>gb|KGN55958.1| hypothetical protein Csa_3G039290 [Cucumis sativus]
Length=743

 Score =   248 bits (632),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 137/218 (63%), Positives = 151/218 (69%), Gaps = 18/218 (8%)
 Frame = +1

Query  160  MAMRDLVTGGAACAVPGSSSSNPFGALANTLIGSSSKTQERLKEIPTSVSTPSDGNFGVG  339
            MAMRDLVTGGA CAVPGSSSSNP GALAN LIGSSSKTQERL+EIPTS  T     F   
Sbjct  1    MAMRDLVTGGADCAVPGSSSSNPLGALANALIGSSSKTQERLREIPTSQLTGPGRPFA--  58

Query  340  FQEPLATLPGSEIDHP-FQPNLQGSEFLEGFRTADQNSFADVWDGIQ-----------RP  483
              E    LPGSE DHP  QPN Q S FL  F +A     A  W+ +Q           +P
Sbjct  59   -PETHGQLPGSEFDHPPLQPNQQASNFLNAFHSAADPGLASAWNEVQAGPPPAHLREMQP  117

Query  484  QLPHSNFPLDN---SQLQPELNGPPQRVLSNFLHSFVNSSHGGIPFRPASLPVLGLSQGE  654
             L   +   D    SQ QP L+GPPQRVLS FLHSFV SS GG+PF P  LP+LGLS+G+
Sbjct  118  SLAEFDRIYDQVPGSQHQPILDGPPQRVLSTFLHSFVESSRGGVPFHPTPLPLLGLSEGD  177

Query  655  KQCIRDRSTIMARHFFADKNEDFINAQVNALLCSLDID  768
            KQCIRDRS+IMARHFFADK+EDFINAQ+NALL SLDID
Sbjct  178  KQCIRDRSSIMARHFFADKSEDFINAQLNALLSSLDID  215



>ref|XP_010450900.1| PREDICTED: peroxisome biogenesis protein 5-like isoform X1 [Camelina 
sativa]
Length=728

 Score =   247 bits (630),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 132/207 (64%), Positives = 152/207 (73%), Gaps = 8/207 (4%)
 Frame = +1

Query  160  MAMRDLVTGGAACAVPGSSSS-NPFGALANTLIGSSSKTQERLKEIPTSVSTPSDGNFGV  336
            MAMRDLV GGAACAVPGSSSS NP GAL N L+GSSSKTQERLKEIP +  +  +  F  
Sbjct  1    MAMRDLVNGGAACAVPGSSSSSNPLGALTNALLGSSSKTQERLKEIPNANRSGPEPQFYS  60

Query  337  GFQEPLATLPGSEIDHP-FQPNLQGSEFLEGFRTADQNSFADVWDGIQR--PQLPHSNFP  507
              Q  + +LPGSE+D P  QP  QG+EF   FR+ DQN     WD +Q+  P  P    P
Sbjct  61   EDQH-IRSLPGSELDQPGLQPGAQGAEFFRSFRSVDQNGLGAAWDEVQQGVPMPPMG--P  117

Query  508  LDNSQLQPELNGPPQRVLSNFLHSFVNSSHGGIPFRPASLPVLGLSQGEKQCIRDRSTIM  687
            +    +QP   GPPQRVLSNFLHSFV SS GGIPFRPA +P+LGLSQ +KQCIRDRS+IM
Sbjct  118  M-YEPVQPTFEGPPQRVLSNFLHSFVESSRGGIPFRPAPVPILGLSQSDKQCIRDRSSIM  176

Query  688  ARHFFADKNEDFINAQVNALLCSLDID  768
            ARHFFAD+ E+FIN+QVNALL SLDID
Sbjct  177  ARHFFADRGEEFINSQVNALLSSLDID  203



>ref|XP_010483103.1| PREDICTED: peroxisome biogenesis protein 5 [Camelina sativa]
Length=728

 Score =   246 bits (627),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 132/207 (64%), Positives = 151/207 (73%), Gaps = 8/207 (4%)
 Frame = +1

Query  160  MAMRDLVTGGAACAVPGSSSS-NPFGALANTLIGSSSKTQERLKEIPTSVSTPSDGNFGV  336
            MAMRDLV GGAACAVPGSSSS NP GAL N L+GSSSKTQERLKEIP +  +     F  
Sbjct  1    MAMRDLVNGGAACAVPGSSSSSNPLGALTNALLGSSSKTQERLKEIPNANRSGPGPQFYS  60

Query  337  GFQEPLATLPGSEIDHP-FQPNLQGSEFLEGFRTADQNSFADVWDGIQR--PQLPHSNFP  507
              Q  + +LPGSE+D P  QP  QG+EF   FR+ DQN     WD +Q+  P  P    P
Sbjct  61   EDQH-IRSLPGSELDQPGLQPGAQGAEFFRSFRSVDQNGLGAAWDEVQQGVPMPPMG--P  117

Query  508  LDNSQLQPELNGPPQRVLSNFLHSFVNSSHGGIPFRPASLPVLGLSQGEKQCIRDRSTIM  687
            +    +QP   GPPQRVLSNFLHSFV SS GGIPFRPA +P+LGLSQ +KQCIRDRS+IM
Sbjct  118  M-YEPVQPTFEGPPQRVLSNFLHSFVESSRGGIPFRPAPVPILGLSQSDKQCIRDRSSIM  176

Query  688  ARHFFADKNEDFINAQVNALLCSLDID  768
            ARHFFAD+ E+FIN+QVNALL SLDID
Sbjct  177  ARHFFADRGEEFINSQVNALLSSLDID  203



>ref|XP_009120148.1| PREDICTED: LOW QUALITY PROTEIN: peroxisome biogenesis protein 
5-like [Brassica rapa]
Length=726

 Score =   245 bits (625),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 133/207 (64%), Positives = 150/207 (72%), Gaps = 8/207 (4%)
 Frame = +1

Query  160  MAMRDLVTGGAACAVPGSSSS-NPFGALANTLIGSSSKTQERLKEIPTSVSTPSDGNFGV  336
            MAMRDLV GGAACAVPGSSSS NP GAL N L+GSSSKTQERLKEIP +  +     F  
Sbjct  1    MAMRDLVNGGAACAVPGSSSSSNPLGALTNALLGSSSKTQERLKEIPNATRSGPGPQFYS  60

Query  337  GFQEPLATLPGSEIDHP-FQPNLQGSEFLEGFRTADQNSFADVWDGIQR--PQLPHSNFP  507
              Q  L++LPGSE+D P  QP  QG+EF  GF + DQN     WD +QR  P  P    P
Sbjct  61   QDQH-LSSLPGSELDQPVLQPGAQGAEFFRGFSSVDQNGLGAAWDEVQRGGPMPPMG--P  117

Query  508  LDNSQLQPELNGPPQRVLSNFLHSFVNSSHGGIPFRPASLPVLGLSQGEKQCIRDRSTIM  687
            L    + P   GPPQRVLSNFLHSFV SS GGIPFRP  +PVLGLSQ +KQCIRDRS+IM
Sbjct  118  L-YEPVHPTFEGPPQRVLSNFLHSFVESSRGGIPFRPPPVPVLGLSQSDKQCIRDRSSIM  176

Query  688  ARHFFADKNEDFINAQVNALLCSLDID  768
            ARHFFAD+ E+FIN+QVNALL SL+ID
Sbjct  177  ARHFFADRGEEFINSQVNALLSSLEID  203



>ref|XP_004147973.1| PREDICTED: peroxisome biogenesis protein 5-like [Cucumis sativus]
Length=748

 Score =   245 bits (625),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 135/219 (62%), Positives = 151/219 (69%), Gaps = 18/219 (8%)
 Frame = +1

Query  157  NMAMRDLVTGGAACAVPGSSSSNPFGALANTLIGSSSKTQERLKEIPTSVSTPSDGNFGV  336
            ++ MRDLVTGGA CAVPGSSSSNP GALAN LIGSSSKTQERL+EIPTS  T     F  
Sbjct  5    DLVMRDLVTGGADCAVPGSSSSNPLGALANALIGSSSKTQERLREIPTSQLTGPGRPFA-  63

Query  337  GFQEPLATLPGSEIDHP-FQPNLQGSEFLEGFRTADQNSFADVWDGIQ-----------R  480
               E    LPGSE DHP  QPN Q S FL  F +A     A  W+ +Q           +
Sbjct  64   --PETHGQLPGSEFDHPPLQPNQQASNFLNAFHSAADPGLASAWNEVQAGPPPAHLREMQ  121

Query  481  PQLPHSNFPLDN---SQLQPELNGPPQRVLSNFLHSFVNSSHGGIPFRPASLPVLGLSQG  651
            P L   +   D    SQ QP L+GPPQRVLS FLHSFV SS GG+PF P  LP+LGLS+G
Sbjct  122  PSLAEFDRIYDQVPGSQHQPILDGPPQRVLSTFLHSFVESSRGGVPFHPTPLPLLGLSEG  181

Query  652  EKQCIRDRSTIMARHFFADKNEDFINAQVNALLCSLDID  768
            +KQCIRDRS+IMARHFFADK+EDFINAQ+NALL SLDID
Sbjct  182  DKQCIRDRSSIMARHFFADKSEDFINAQLNALLSSLDID  220



>ref|XP_004499675.1| PREDICTED: peroxisome biogenesis protein 5-like [Cicer arietinum]
Length=745

 Score =   243 bits (619),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 135/222 (61%), Positives = 155/222 (70%), Gaps = 31/222 (14%)
 Frame = +1

Query  160  MAMRDLVTGGAACAVPGSSSS--NPFGALANTLIGSSSKTQERLKEIPTSVSTPSDGNFG  333
            MAMRDL+TG  +C  P SS+S  NP G+LAN L+GSSSKTQERLKEIPTS ST     F 
Sbjct  1    MAMRDLITGATSCPDPSSSTSSQNPLGSLANALLGSSSKTQERLKEIPTSNSTGIASQF-  59

Query  334  VGFQEPLAT-LPGSEIDHPF-QPNLQGSEFLEGFRTADQNSFADVWDGIQRPQLPHSNFP  507
              + EPL T LPGSE+D PF   N QGSEFL  FR+A    F + WD IQR         
Sbjct  60   --YAEPLLTQLPGSELDKPFLDANSQGSEFLNRFRSAGAGGFEETWDEIQR---------  108

Query  508  LDNSQL--------------QPELNGPPQRVLSNFLHSFVNSSHGGIPFRPASLPVLGLS  645
             D +QL              QP L+G PQRVLS FLHSF++SS GGIPF PA LPVLGLS
Sbjct  109  -DGTQLRLYDGRGQPPPQLHQPTLDGTPQRVLSTFLHSFLDSSRGGIPFHPAPLPVLGLS  167

Query  646  QGEKQCIRDRSTIMARHFFADKNEDFINAQVNALLCSLDIDA  771
            +G+KQCIRDRS+IMARH FADK+E+FI+AQVNALLCSLDID+
Sbjct  168  EGDKQCIRDRSSIMARHLFADKSEEFIHAQVNALLCSLDIDS  209



>ref|XP_007020296.1| Peroxin 5 isoform 6 [Theobroma cacao]
 gb|EOY11821.1| Peroxin 5 isoform 6 [Theobroma cacao]
Length=669

 Score =   240 bits (613),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 139/209 (67%), Positives = 161/209 (77%), Gaps = 7/209 (3%)
 Frame = +1

Query  160  MAMRDLVTGGAACAVPGSSSS--NPFGALANTLIGSSSKTQERLKEIPTSVSTPSDGNFG  333
            M+MR+LVTGGAACAV GSSSS  NP GALAN LIGSSSKTQERLKEIP + +  S   F 
Sbjct  1    MSMRELVTGGAACAVSGSSSSSSNPLGALANALIGSSSKTQERLKEIPNAAAATSHTQF-  59

Query  334  VGFQEPLATLPGSEIDHPF-QPNLQGSEFLEGFRTADQNSFADVWDGIQR-PQLPHSNFP  507
              + +P+A LPGSE+DHPF Q N QGS+F+ GFRTA  N  AD WD IQR P L      
Sbjct  60   --YDDPVAALPGSELDHPFLQSNAQGSDFIRGFRTAHDNGLADAWDEIQRQPHLDRVYNA  117

Query  508  LDNSQLQPELNGPPQRVLSNFLHSFVNSSHGGIPFRPASLPVLGLSQGEKQCIRDRSTIM  687
                 +QP L+GPPQRVLS+FLHSFV+SS  GIP  P  LP+LGLSQG+KQCIRDRS+IM
Sbjct  118  APAPPIQPTLDGPPQRVLSSFLHSFVDSSRSGIPLHPTPLPLLGLSQGDKQCIRDRSSIM  177

Query  688  ARHFFADKNEDFINAQVNALLCSLDIDAD  774
            ARHFFADK+E+FIN+QVNALL SL+ID+D
Sbjct  178  ARHFFADKSEEFINSQVNALLSSLEIDSD  206



>ref|XP_007020297.1| Peroxin 5 isoform 7 [Theobroma cacao]
 gb|EOY11822.1| Peroxin 5 isoform 7 [Theobroma cacao]
Length=642

 Score =   240 bits (612),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 139/209 (67%), Positives = 161/209 (77%), Gaps = 7/209 (3%)
 Frame = +1

Query  160  MAMRDLVTGGAACAVPGSSSS--NPFGALANTLIGSSSKTQERLKEIPTSVSTPSDGNFG  333
            M+MR+LVTGGAACAV GSSSS  NP GALAN LIGSSSKTQERLKEIP + +  S   F 
Sbjct  1    MSMRELVTGGAACAVSGSSSSSSNPLGALANALIGSSSKTQERLKEIPNAAAATSHTQF-  59

Query  334  VGFQEPLATLPGSEIDHPF-QPNLQGSEFLEGFRTADQNSFADVWDGIQR-PQLPHSNFP  507
              + +P+A LPGSE+DHPF Q N QGS+F+ GFRTA  N  AD WD IQR P L      
Sbjct  60   --YDDPVAALPGSELDHPFLQSNAQGSDFIRGFRTAHDNGLADAWDEIQRQPHLDRVYNA  117

Query  508  LDNSQLQPELNGPPQRVLSNFLHSFVNSSHGGIPFRPASLPVLGLSQGEKQCIRDRSTIM  687
                 +QP L+GPPQRVLS+FLHSFV+SS  GIP  P  LP+LGLSQG+KQCIRDRS+IM
Sbjct  118  APAPPIQPTLDGPPQRVLSSFLHSFVDSSRSGIPLHPTPLPLLGLSQGDKQCIRDRSSIM  177

Query  688  ARHFFADKNEDFINAQVNALLCSLDIDAD  774
            ARHFFADK+E+FIN+QVNALL SL+ID+D
Sbjct  178  ARHFFADKSEEFINSQVNALLSSLEIDSD  206



>gb|AES68523.2| peroxisomal targeting signal 1 receptor [Medicago truncatula]
Length=744

 Score =   241 bits (615),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 134/220 (61%), Positives = 154/220 (70%), Gaps = 26/220 (12%)
 Frame = +1

Query  160  MAMRDLVTGGAACAVPGSSSS--NPFGALANTLIGSSSKTQERLKEIPTSVSTPSDGNFG  333
            MAMRDL+TG  +C  P +SSS  NP G+LAN L+GSSSK QERLKEIPTS STPS   F 
Sbjct  1    MAMRDLITGATSCPDPSASSSSQNPLGSLANALLGSSSKNQERLKEIPTSTSTPSASQF-  59

Query  334  VGFQEPLATLPGSEIDHPF-QPNLQGSEFLEGFRTADQNSFADVWDGIQ-----------  477
              + +P   LPGSE D PF   N QGSEFL  FR+A    F + WD IQ           
Sbjct  60   --YSQPHTQLPGSEFDKPFLDANSQGSEFLNRFRSAGAGGFDETWDEIQGDGNQLRLYDG  117

Query  478  RPQLPHSNFPLDNSQL-QPELNGPPQRVLSNFLHSFVNSSHGGIPFRPASLPVLGLSQGE  654
            R QLP         QL QP L+G PQRVLS FLHSF++SS GGIPF PA LPVLGLS+G+
Sbjct  118  RGQLP--------PQLHQPTLDGTPQRVLSTFLHSFLDSSRGGIPFHPAPLPVLGLSEGD  169

Query  655  KQCIRDRSTIMARHFFADKNEDFINAQVNALLCSLDIDAD  774
            KQCIRDRS+IMARH FADK+E+FI+AQVNALL SLDID++
Sbjct  170  KQCIRDRSSIMARHLFADKSEEFIHAQVNALLSSLDIDSN  209



>ref|XP_007020295.1| Peroxin 5 isoform 5 [Theobroma cacao]
 gb|EOY11820.1| Peroxin 5 isoform 5 [Theobroma cacao]
Length=683

 Score =   240 bits (612),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 139/209 (67%), Positives = 161/209 (77%), Gaps = 7/209 (3%)
 Frame = +1

Query  160  MAMRDLVTGGAACAVPGSSSS--NPFGALANTLIGSSSKTQERLKEIPTSVSTPSDGNFG  333
            M+MR+LVTGGAACAV GSSSS  NP GALAN LIGSSSKTQERLKEIP + +  S   F 
Sbjct  1    MSMRELVTGGAACAVSGSSSSSSNPLGALANALIGSSSKTQERLKEIPNAAAATSHTQF-  59

Query  334  VGFQEPLATLPGSEIDHPF-QPNLQGSEFLEGFRTADQNSFADVWDGIQR-PQLPHSNFP  507
              + +P+A LPGSE+DHPF Q N QGS+F+ GFRTA  N  AD WD IQR P L      
Sbjct  60   --YDDPVAALPGSELDHPFLQSNAQGSDFIRGFRTAHDNGLADAWDEIQRQPHLDRVYNA  117

Query  508  LDNSQLQPELNGPPQRVLSNFLHSFVNSSHGGIPFRPASLPVLGLSQGEKQCIRDRSTIM  687
                 +QP L+GPPQRVLS+FLHSFV+SS  GIP  P  LP+LGLSQG+KQCIRDRS+IM
Sbjct  118  APAPPIQPTLDGPPQRVLSSFLHSFVDSSRSGIPLHPTPLPLLGLSQGDKQCIRDRSSIM  177

Query  688  ARHFFADKNEDFINAQVNALLCSLDIDAD  774
            ARHFFADK+E+FIN+QVNALL SL+ID+D
Sbjct  178  ARHFFADKSEEFINSQVNALLSSLEIDSD  206



>ref|XP_007020294.1| Peroxin 5 isoform 4 [Theobroma cacao]
 gb|EOY11819.1| Peroxin 5 isoform 4 [Theobroma cacao]
Length=694

 Score =   240 bits (612),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 139/209 (67%), Positives = 161/209 (77%), Gaps = 7/209 (3%)
 Frame = +1

Query  160  MAMRDLVTGGAACAVPGSSSS--NPFGALANTLIGSSSKTQERLKEIPTSVSTPSDGNFG  333
            M+MR+LVTGGAACAV GSSSS  NP GALAN LIGSSSKTQERLKEIP + +  S   F 
Sbjct  1    MSMRELVTGGAACAVSGSSSSSSNPLGALANALIGSSSKTQERLKEIPNAAAATSHTQF-  59

Query  334  VGFQEPLATLPGSEIDHPF-QPNLQGSEFLEGFRTADQNSFADVWDGIQR-PQLPHSNFP  507
              + +P+A LPGSE+DHPF Q N QGS+F+ GFRTA  N  AD WD IQR P L      
Sbjct  60   --YDDPVAALPGSELDHPFLQSNAQGSDFIRGFRTAHDNGLADAWDEIQRQPHLDRVYNA  117

Query  508  LDNSQLQPELNGPPQRVLSNFLHSFVNSSHGGIPFRPASLPVLGLSQGEKQCIRDRSTIM  687
                 +QP L+GPPQRVLS+FLHSFV+SS  GIP  P  LP+LGLSQG+KQCIRDRS+IM
Sbjct  118  APAPPIQPTLDGPPQRVLSSFLHSFVDSSRSGIPLHPTPLPLLGLSQGDKQCIRDRSSIM  177

Query  688  ARHFFADKNEDFINAQVNALLCSLDIDAD  774
            ARHFFADK+E+FIN+QVNALL SL+ID+D
Sbjct  178  ARHFFADKSEEFINSQVNALLSSLEIDSD  206



>ref|XP_007020292.1| Peroxin 5 isoform 2 [Theobroma cacao]
 gb|EOY11817.1| Peroxin 5 isoform 2 [Theobroma cacao]
Length=736

 Score =   240 bits (612),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 139/209 (67%), Positives = 161/209 (77%), Gaps = 7/209 (3%)
 Frame = +1

Query  160  MAMRDLVTGGAACAVPGSSSS--NPFGALANTLIGSSSKTQERLKEIPTSVSTPSDGNFG  333
            M+MR+LVTGGAACAV GSSSS  NP GALAN LIGSSSKTQERLKEIP + +  S   F 
Sbjct  1    MSMRELVTGGAACAVSGSSSSSSNPLGALANALIGSSSKTQERLKEIPNAAAATSHTQF-  59

Query  334  VGFQEPLATLPGSEIDHPF-QPNLQGSEFLEGFRTADQNSFADVWDGIQR-PQLPHSNFP  507
              + +P+A LPGSE+DHPF Q N QGS+F+ GFRTA  N  AD WD IQR P L      
Sbjct  60   --YDDPVAALPGSELDHPFLQSNAQGSDFIRGFRTAHDNGLADAWDEIQRQPHLDRVYNA  117

Query  508  LDNSQLQPELNGPPQRVLSNFLHSFVNSSHGGIPFRPASLPVLGLSQGEKQCIRDRSTIM  687
                 +QP L+GPPQRVLS+FLHSFV+SS  GIP  P  LP+LGLSQG+KQCIRDRS+IM
Sbjct  118  APAPPIQPTLDGPPQRVLSSFLHSFVDSSRSGIPLHPTPLPLLGLSQGDKQCIRDRSSIM  177

Query  688  ARHFFADKNEDFINAQVNALLCSLDIDAD  774
            ARHFFADK+E+FIN+QVNALL SL+ID+D
Sbjct  178  ARHFFADKSEEFINSQVNALLSSLEIDSD  206



>ref|XP_007020291.1| Peroxin 5 isoform 1 [Theobroma cacao]
 gb|EOY11816.1| Peroxin 5 isoform 1 [Theobroma cacao]
Length=735

 Score =   240 bits (612),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 139/209 (67%), Positives = 161/209 (77%), Gaps = 7/209 (3%)
 Frame = +1

Query  160  MAMRDLVTGGAACAVPGSSSS--NPFGALANTLIGSSSKTQERLKEIPTSVSTPSDGNFG  333
            M+MR+LVTGGAACAV GSSSS  NP GALAN LIGSSSKTQERLKEIP + +  S   F 
Sbjct  1    MSMRELVTGGAACAVSGSSSSSSNPLGALANALIGSSSKTQERLKEIPNAAAATSHTQF-  59

Query  334  VGFQEPLATLPGSEIDHPF-QPNLQGSEFLEGFRTADQNSFADVWDGIQR-PQLPHSNFP  507
              + +P+A LPGSE+DHPF Q N QGS+F+ GFRTA  N  AD WD IQR P L      
Sbjct  60   --YDDPVAALPGSELDHPFLQSNAQGSDFIRGFRTAHDNGLADAWDEIQRQPHLDRVYNA  117

Query  508  LDNSQLQPELNGPPQRVLSNFLHSFVNSSHGGIPFRPASLPVLGLSQGEKQCIRDRSTIM  687
                 +QP L+GPPQRVLS+FLHSFV+SS  GIP  P  LP+LGLSQG+KQCIRDRS+IM
Sbjct  118  APAPPIQPTLDGPPQRVLSSFLHSFVDSSRSGIPLHPTPLPLLGLSQGDKQCIRDRSSIM  177

Query  688  ARHFFADKNEDFINAQVNALLCSLDIDAD  774
            ARHFFADK+E+FIN+QVNALL SL+ID+D
Sbjct  178  ARHFFADKSEEFINSQVNALLSSLEIDSD  206



>ref|XP_007020293.1| Peroxin 5 isoform 3 [Theobroma cacao]
 gb|EOY11818.1| Peroxin 5 isoform 3 [Theobroma cacao]
Length=735

 Score =   239 bits (611),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 139/209 (67%), Positives = 161/209 (77%), Gaps = 7/209 (3%)
 Frame = +1

Query  160  MAMRDLVTGGAACAVPGSSSS--NPFGALANTLIGSSSKTQERLKEIPTSVSTPSDGNFG  333
            M+MR+LVTGGAACAV GSSSS  NP GALAN LIGSSSKTQERLKEIP + +  S   F 
Sbjct  1    MSMRELVTGGAACAVSGSSSSSSNPLGALANALIGSSSKTQERLKEIPNAAAATSHTQF-  59

Query  334  VGFQEPLATLPGSEIDHPF-QPNLQGSEFLEGFRTADQNSFADVWDGIQR-PQLPHSNFP  507
              + +P+A LPGSE+DHPF Q N QGS+F+ GFRTA  N  AD WD IQR P L      
Sbjct  60   --YDDPVAALPGSELDHPFLQSNAQGSDFIRGFRTAHDNGLADAWDEIQRQPHLDRVYNA  117

Query  508  LDNSQLQPELNGPPQRVLSNFLHSFVNSSHGGIPFRPASLPVLGLSQGEKQCIRDRSTIM  687
                 +QP L+GPPQRVLS+FLHSFV+SS  GIP  P  LP+LGLSQG+KQCIRDRS+IM
Sbjct  118  APAPPIQPTLDGPPQRVLSSFLHSFVDSSRSGIPLHPTPLPLLGLSQGDKQCIRDRSSIM  177

Query  688  ARHFFADKNEDFINAQVNALLCSLDIDAD  774
            ARHFFADK+E+FIN+QVNALL SL+ID+D
Sbjct  178  ARHFFADKSEEFINSQVNALLSSLEIDSD  206



>ref|XP_010443280.1| PREDICTED: peroxisome biogenesis protein 5-like [Camelina sativa]
Length=729

 Score =   239 bits (609),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 132/208 (63%), Positives = 151/208 (73%), Gaps = 9/208 (4%)
 Frame = +1

Query  160  MAMRDLVTGGAACAVPGSSSS--NPFGALANTLIGSSSKTQERLKEIPTSVSTPSDGNFG  333
            MAMRDLV GGAACAVPGSSSS  NP GAL N L+GSSSKTQERLKEIP +  +     F 
Sbjct  1    MAMRDLVNGGAACAVPGSSSSSSNPLGALTNALLGSSSKTQERLKEIPNANRSGPGPQFY  60

Query  334  VGFQEPLATLPGSEIDHP-FQPNLQGSEFLEGFRTADQNSFADVWDGIQR--PQLPHSNF  504
               Q  + +LPGSE+D P  QP  QG+EF   FR+ DQN     WD +Q+  P  P    
Sbjct  61   SEDQH-IRSLPGSELDQPGLQPGAQGAEFFRSFRSVDQNGLGAAWDEVQQGVPMPPMG--  117

Query  505  PLDNSQLQPELNGPPQRVLSNFLHSFVNSSHGGIPFRPASLPVLGLSQGEKQCIRDRSTI  684
            P+    +QP   GPPQRVLSNFLHSFV SS GGIPFRPA +P+LGLSQ +KQCIRDRS+I
Sbjct  118  PM-YEPVQPTFEGPPQRVLSNFLHSFVESSRGGIPFRPAPVPILGLSQSDKQCIRDRSSI  176

Query  685  MARHFFADKNEDFINAQVNALLCSLDID  768
            MARHFFAD+ E+FIN+QVNALL SLDID
Sbjct  177  MARHFFADRGEEFINSQVNALLSSLDID  204



>gb|KCW68311.1| hypothetical protein EUGRSUZ_F01979 [Eucalyptus grandis]
Length=720

 Score =   237 bits (605),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 129/210 (61%), Positives = 153/210 (73%), Gaps = 9/210 (4%)
 Frame = +1

Query  160  MAMRDLVTGGAACAVPGSSSSNPFGALANTLIGSSSKTQERLKEIPTSVSTPS-DGNFGV  336
            MAMR+L TG A C    S+SSNP GALAN L+GSSSKTQERLKEIPT+  TP+ +  F  
Sbjct  1    MAMRELATGAANC--DPSASSNPLGALANALVGSSSKTQERLKEIPTT--TPAAERQFFA  56

Query  337  GFQEPLATLPGSEIDHPFQP-NLQGSEFLEGFRTADQNSFADVWDGIQR---PQLPHSNF  504
              ++ L  +PGSE D    P N QGSEF+  F   +  +F   W+ IQ+   P +PH   
Sbjct  57   QPEDRLRAIPGSESDQSLLPVNAQGSEFIRRFHAVEHGAFEGAWNDIQQANLPPVPHDLR  116

Query  505  PLDNSQLQPELNGPPQRVLSNFLHSFVNSSHGGIPFRPASLPVLGLSQGEKQCIRDRSTI  684
               N QLQP L+GPPQRVLS  LHSFV+SS GG+PFRPA LP+LGLS+G+K+CIRDRSTI
Sbjct  117  VGINPQLQPTLDGPPQRVLSGLLHSFVDSSRGGLPFRPAQLPLLGLSEGDKRCIRDRSTI  176

Query  685  MARHFFADKNEDFINAQVNALLCSLDIDAD  774
            MARHFFADK+EDFINAQVN LL SLDID+D
Sbjct  177  MARHFFADKSEDFINAQVNTLLHSLDIDSD  206



>ref|XP_010061377.1| PREDICTED: peroxisome biogenesis protein 5 [Eucalyptus grandis]
 gb|KCW68312.1| hypothetical protein EUGRSUZ_F01979 [Eucalyptus grandis]
Length=729

 Score =   237 bits (605),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 129/210 (61%), Positives = 153/210 (73%), Gaps = 9/210 (4%)
 Frame = +1

Query  160  MAMRDLVTGGAACAVPGSSSSNPFGALANTLIGSSSKTQERLKEIPTSVSTPS-DGNFGV  336
            MAMR+L TG A C    S+SSNP GALAN L+GSSSKTQERLKEIPT+  TP+ +  F  
Sbjct  1    MAMRELATGAANC--DPSASSNPLGALANALVGSSSKTQERLKEIPTT--TPAAERQFFA  56

Query  337  GFQEPLATLPGSEIDHPFQP-NLQGSEFLEGFRTADQNSFADVWDGIQR---PQLPHSNF  504
              ++ L  +PGSE D    P N QGSEF+  F   +  +F   W+ IQ+   P +PH   
Sbjct  57   QPEDRLRAIPGSESDQSLLPVNAQGSEFIRRFHAVEHGAFEGAWNDIQQANLPPVPHDLR  116

Query  505  PLDNSQLQPELNGPPQRVLSNFLHSFVNSSHGGIPFRPASLPVLGLSQGEKQCIRDRSTI  684
               N QLQP L+GPPQRVLS  LHSFV+SS GG+PFRPA LP+LGLS+G+K+CIRDRSTI
Sbjct  117  VGINPQLQPTLDGPPQRVLSGLLHSFVDSSRGGLPFRPAQLPLLGLSEGDKRCIRDRSTI  176

Query  685  MARHFFADKNEDFINAQVNALLCSLDIDAD  774
            MARHFFADK+EDFINAQVN LL SLDID+D
Sbjct  177  MARHFFADKSEDFINAQVNTLLHSLDIDSD  206



>gb|KJB63153.1| hypothetical protein B456_009G455400 [Gossypium raimondii]
 gb|KJB63154.1| hypothetical protein B456_009G455400 [Gossypium raimondii]
Length=395

 Score =   229 bits (583),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 135/212 (64%), Positives = 158/212 (75%), Gaps = 9/212 (4%)
 Frame = +1

Query  160  MAMRDLVTGGAACAVPGSSSS--NPFGALANTLIGSSSKTQERLKEIPTSVSTPSDGNFG  333
            M+MR+LVTGGAACAVPGSSSS  NP GA AN LIGSSSKTQ  LKEIP + +      F 
Sbjct  1    MSMRELVTGGAACAVPGSSSSSSNPLGAFANALIGSSSKTQGVLKEIPNAAAASPHAQFY  60

Query  334  VGFQEPLATLPGSEIDHPF-QPNLQGSEFLEGFRTADQNSFADVWDGIQRPQLPHSNFPL  510
                +P+A LPGSE+D PF Q N QGSEF+ GFRTAD N  AD W+ IQR   PH +   
Sbjct  61   PHADDPVAALPGSELDRPFLQSNPQGSEFIRGFRTADANGLADAWEEIQRQ--PHFDRVY  118

Query  511  DNSQ----LQPELNGPPQRVLSNFLHSFVNSSHGGIPFRPASLPVLGLSQGEKQCIRDRS  678
            + +     +QP L+GPPQRVLS+FLHSFV+SS  GIP  P  LP+LGLSQG+KQCIRDRS
Sbjct  119  EGATPAPPIQPSLDGPPQRVLSSFLHSFVDSSRSGIPLHPTPLPLLGLSQGDKQCIRDRS  178

Query  679  TIMARHFFADKNEDFINAQVNALLCSLDIDAD  774
            +IMARH FADK+E+FINAQVNALL SL+I+ D
Sbjct  179  SIMARHIFADKSEEFINAQVNALLSSLEIEND  210



>gb|KJB63155.1| hypothetical protein B456_009G455400 [Gossypium raimondii]
 gb|KJB63156.1| hypothetical protein B456_009G455400 [Gossypium raimondii]
Length=439

 Score =   228 bits (581),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 135/212 (64%), Positives = 158/212 (75%), Gaps = 9/212 (4%)
 Frame = +1

Query  160  MAMRDLVTGGAACAVPGSSSS--NPFGALANTLIGSSSKTQERLKEIPTSVSTPSDGNFG  333
            M+MR+LVTGGAACAVPGSSSS  NP GA AN LIGSSSKTQ  LKEIP + +      F 
Sbjct  1    MSMRELVTGGAACAVPGSSSSSSNPLGAFANALIGSSSKTQGVLKEIPNAAAASPHAQFY  60

Query  334  VGFQEPLATLPGSEIDHPF-QPNLQGSEFLEGFRTADQNSFADVWDGIQRPQLPHSNFPL  510
                +P+A LPGSE+D PF Q N QGSEF+ GFRTAD N  AD W+ IQR   PH +   
Sbjct  61   PHADDPVAALPGSELDRPFLQSNPQGSEFIRGFRTADANGLADAWEEIQRQ--PHFDRVY  118

Query  511  DNSQ----LQPELNGPPQRVLSNFLHSFVNSSHGGIPFRPASLPVLGLSQGEKQCIRDRS  678
            + +     +QP L+GPPQRVLS+FLHSFV+SS  GIP  P  LP+LGLSQG+KQCIRDRS
Sbjct  119  EGATPAPPIQPSLDGPPQRVLSSFLHSFVDSSRSGIPLHPTPLPLLGLSQGDKQCIRDRS  178

Query  679  TIMARHFFADKNEDFINAQVNALLCSLDIDAD  774
            +IMARH FADK+E+FINAQVNALL SL+I+ D
Sbjct  179  SIMARHIFADKSEEFINAQVNALLSSLEIEND  210



>ref|XP_008806178.1| PREDICTED: peroxisome biogenesis protein 5-like [Phoenix dactylifera]
Length=757

 Score =   234 bits (597),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 138/226 (61%), Positives = 164/226 (73%), Gaps = 25/226 (11%)
 Frame = +1

Query  160  MAMRDLVTGGAACAVPGS-SSSNPFGALANTLIGSSSKTQERLKEIP-TSVSTP-SDGNF  330
            MA RDLVTGGAACAVPG+ SSSNPFGALANT++GSSSK QE LK +P TSV+ P S  +F
Sbjct  1    MAARDLVTGGAACAVPGTASSSNPFGALANTILGSSSKAQE-LKGLPGTSVNVPGSSSDF  59

Query  331  GVGFQEPLATLPGSEID--HPFQPNLQGSEFLEGFRTADQNSFADVWDGIQRPQL-----  489
            G   + PL T+PGSE +     Q + + SEFL GFRTAD + F D WD I RP +     
Sbjct  60   GP--EAPLTTIPGSEYEGQQHQQLDARNSEFLHGFRTAD-HGFEDAWDEIHRPPVLSHAQ  116

Query  490  -----PH-SNFPL-----DNSQLQPELNGPPQRVLSNFLHSFVNSSHGGIPFRPASLPVL  636
                 PH + F        +S LQP  +GPPQRVLS+FLHSFV+S   G+PFRPA+LPVL
Sbjct  117  GREGQPHFAEFEQIYDHSGSSVLQPTWDGPPQRVLSSFLHSFVDSGRAGVPFRPAALPVL  176

Query  637  GLSQGEKQCIRDRSTIMARHFFADKNEDFINAQVNALLCSLDIDAD  774
            GLS+ +KQCIRDRS IMARH FADK+E+FI+AQVNALL SLDID+D
Sbjct  177  GLSEVDKQCIRDRSCIMARHIFADKSEEFISAQVNALLHSLDIDSD  222



>gb|KJB63151.1| hypothetical protein B456_009G455400 [Gossypium raimondii]
Length=574

 Score =   229 bits (583),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 135/212 (64%), Positives = 158/212 (75%), Gaps = 9/212 (4%)
 Frame = +1

Query  160  MAMRDLVTGGAACAVPGSSSS--NPFGALANTLIGSSSKTQERLKEIPTSVSTPSDGNFG  333
            M+MR+LVTGGAACAVPGSSSS  NP GA AN LIGSSSKTQ  LKEIP + +      F 
Sbjct  1    MSMRELVTGGAACAVPGSSSSSSNPLGAFANALIGSSSKTQGVLKEIPNAAAASPHAQFY  60

Query  334  VGFQEPLATLPGSEIDHPF-QPNLQGSEFLEGFRTADQNSFADVWDGIQRPQLPHSNFPL  510
                +P+A LPGSE+D PF Q N QGSEF+ GFRTAD N  AD W+ IQR   PH +   
Sbjct  61   PHADDPVAALPGSELDRPFLQSNPQGSEFIRGFRTADANGLADAWEEIQRQ--PHFDRVY  118

Query  511  DNSQ----LQPELNGPPQRVLSNFLHSFVNSSHGGIPFRPASLPVLGLSQGEKQCIRDRS  678
            + +     +QP L+GPPQRVLS+FLHSFV+SS  GIP  P  LP+LGLSQG+KQCIRDRS
Sbjct  119  EGATPAPPIQPSLDGPPQRVLSSFLHSFVDSSRSGIPLHPTPLPLLGLSQGDKQCIRDRS  178

Query  679  TIMARHFFADKNEDFINAQVNALLCSLDIDAD  774
            +IMARH FADK+E+FINAQVNALL SL+I+ D
Sbjct  179  SIMARHIFADKSEEFINAQVNALLSSLEIEND  210



>gb|KJB63157.1| hypothetical protein B456_009G455400 [Gossypium raimondii]
 gb|KJB63158.1| hypothetical protein B456_009G455400 [Gossypium raimondii]
 gb|KJB63163.1| hypothetical protein B456_009G455400 [Gossypium raimondii]
Length=665

 Score =   230 bits (587),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 135/212 (64%), Positives = 158/212 (75%), Gaps = 9/212 (4%)
 Frame = +1

Query  160  MAMRDLVTGGAACAVPGSSSS--NPFGALANTLIGSSSKTQERLKEIPTSVSTPSDGNFG  333
            M+MR+LVTGGAACAVPGSSSS  NP GA AN LIGSSSKTQ  LKEIP + +      F 
Sbjct  1    MSMRELVTGGAACAVPGSSSSSSNPLGAFANALIGSSSKTQGVLKEIPNAAAASPHAQFY  60

Query  334  VGFQEPLATLPGSEIDHPF-QPNLQGSEFLEGFRTADQNSFADVWDGIQRPQLPHSNFPL  510
                +P+A LPGSE+D PF Q N QGSEF+ GFRTAD N  AD W+ IQR   PH +   
Sbjct  61   PHADDPVAALPGSELDRPFLQSNPQGSEFIRGFRTADANGLADAWEEIQRQ--PHFDRVY  118

Query  511  DNSQ----LQPELNGPPQRVLSNFLHSFVNSSHGGIPFRPASLPVLGLSQGEKQCIRDRS  678
            + +     +QP L+GPPQRVLS+FLHSFV+SS  GIP  P  LP+LGLSQG+KQCIRDRS
Sbjct  119  EGATPAPPIQPSLDGPPQRVLSSFLHSFVDSSRSGIPLHPTPLPLLGLSQGDKQCIRDRS  178

Query  679  TIMARHFFADKNEDFINAQVNALLCSLDIDAD  774
            +IMARH FADK+E+FINAQVNALL SL+I+ D
Sbjct  179  SIMARHIFADKSEEFINAQVNALLSSLEIEND  210



>gb|KJB63160.1| hypothetical protein B456_009G455400 [Gossypium raimondii]
Length=612

 Score =   229 bits (583),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 135/212 (64%), Positives = 158/212 (75%), Gaps = 9/212 (4%)
 Frame = +1

Query  160  MAMRDLVTGGAACAVPGSSSS--NPFGALANTLIGSSSKTQERLKEIPTSVSTPSDGNFG  333
            M+MR+LVTGGAACAVPGSSSS  NP GA AN LIGSSSKTQ  LKEIP + +      F 
Sbjct  1    MSMRELVTGGAACAVPGSSSSSSNPLGAFANALIGSSSKTQGVLKEIPNAAAASPHAQFY  60

Query  334  VGFQEPLATLPGSEIDHPF-QPNLQGSEFLEGFRTADQNSFADVWDGIQRPQLPHSNFPL  510
                +P+A LPGSE+D PF Q N QGSEF+ GFRTAD N  AD W+ IQR   PH +   
Sbjct  61   PHADDPVAALPGSELDRPFLQSNPQGSEFIRGFRTADANGLADAWEEIQRQ--PHFDRVY  118

Query  511  DNSQ----LQPELNGPPQRVLSNFLHSFVNSSHGGIPFRPASLPVLGLSQGEKQCIRDRS  678
            + +     +QP L+GPPQRVLS+FLHSFV+SS  GIP  P  LP+LGLSQG+KQCIRDRS
Sbjct  119  EGATPAPPIQPSLDGPPQRVLSSFLHSFVDSSRSGIPLHPTPLPLLGLSQGDKQCIRDRS  178

Query  679  TIMARHFFADKNEDFINAQVNALLCSLDIDAD  774
            +IMARH FADK+E+FINAQVNALL SL+I+ D
Sbjct  179  SIMARHIFADKSEEFINAQVNALLSSLEIEND  210



>gb|KJB63152.1| hypothetical protein B456_009G455400 [Gossypium raimondii]
 gb|KJB63162.1| hypothetical protein B456_009G455400 [Gossypium raimondii]
Length=665

 Score =   230 bits (586),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 135/212 (64%), Positives = 158/212 (75%), Gaps = 9/212 (4%)
 Frame = +1

Query  160  MAMRDLVTGGAACAVPGSSSS--NPFGALANTLIGSSSKTQERLKEIPTSVSTPSDGNFG  333
            M+MR+LVTGGAACAVPGSSSS  NP GA AN LIGSSSKTQ  LKEIP + +      F 
Sbjct  1    MSMRELVTGGAACAVPGSSSSSSNPLGAFANALIGSSSKTQGVLKEIPNAAAASPHAQFY  60

Query  334  VGFQEPLATLPGSEIDHPF-QPNLQGSEFLEGFRTADQNSFADVWDGIQRPQLPHSNFPL  510
                +P+A LPGSE+D PF Q N QGSEF+ GFRTAD N  AD W+ IQR   PH +   
Sbjct  61   PHADDPVAALPGSELDRPFLQSNPQGSEFIRGFRTADANGLADAWEEIQRQ--PHFDRVY  118

Query  511  DNSQ----LQPELNGPPQRVLSNFLHSFVNSSHGGIPFRPASLPVLGLSQGEKQCIRDRS  678
            + +     +QP L+GPPQRVLS+FLHSFV+SS  GIP  P  LP+LGLSQG+KQCIRDRS
Sbjct  119  EGATPAPPIQPSLDGPPQRVLSSFLHSFVDSSRSGIPLHPTPLPLLGLSQGDKQCIRDRS  178

Query  679  TIMARHFFADKNEDFINAQVNALLCSLDIDAD  774
            +IMARH FADK+E+FINAQVNALL SL+I+ D
Sbjct  179  SIMARHIFADKSEEFINAQVNALLSSLEIEND  210



>gb|KJB63150.1| hypothetical protein B456_009G455400 [Gossypium raimondii]
 gb|KJB63161.1| hypothetical protein B456_009G455400 [Gossypium raimondii]
Length=740

 Score =   231 bits (588),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 135/212 (64%), Positives = 158/212 (75%), Gaps = 9/212 (4%)
 Frame = +1

Query  160  MAMRDLVTGGAACAVPGSSSS--NPFGALANTLIGSSSKTQERLKEIPTSVSTPSDGNFG  333
            M+MR+LVTGGAACAVPGSSSS  NP GA AN LIGSSSKTQ  LKEIP + +      F 
Sbjct  1    MSMRELVTGGAACAVPGSSSSSSNPLGAFANALIGSSSKTQGVLKEIPNAAAASPHAQFY  60

Query  334  VGFQEPLATLPGSEIDHPF-QPNLQGSEFLEGFRTADQNSFADVWDGIQRPQLPHSNFPL  510
                +P+A LPGSE+D PF Q N QGSEF+ GFRTAD N  AD W+ IQR   PH +   
Sbjct  61   PHADDPVAALPGSELDRPFLQSNPQGSEFIRGFRTADANGLADAWEEIQRQ--PHFDRVY  118

Query  511  DNSQ----LQPELNGPPQRVLSNFLHSFVNSSHGGIPFRPASLPVLGLSQGEKQCIRDRS  678
            + +     +QP L+GPPQRVLS+FLHSFV+SS  GIP  P  LP+LGLSQG+KQCIRDRS
Sbjct  119  EGATPAPPIQPSLDGPPQRVLSSFLHSFVDSSRSGIPLHPTPLPLLGLSQGDKQCIRDRS  178

Query  679  TIMARHFFADKNEDFINAQVNALLCSLDIDAD  774
            +IMARH FADK+E+FINAQVNALL SL+I+ D
Sbjct  179  SIMARHIFADKSEEFINAQVNALLSSLEIEND  210



>ref|XP_007148691.1| hypothetical protein PHAVU_005G006500g [Phaseolus vulgaris]
 ref|XP_007148692.1| hypothetical protein PHAVU_005G006500g [Phaseolus vulgaris]
 gb|ESW20685.1| hypothetical protein PHAVU_005G006500g [Phaseolus vulgaris]
 gb|ESW20686.1| hypothetical protein PHAVU_005G006500g [Phaseolus vulgaris]
Length=733

 Score =   230 bits (586),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 123/207 (59%), Positives = 147/207 (71%), Gaps = 6/207 (3%)
 Frame = +1

Query  160  MAMRDLVTGGAACAVPGSSSSNPFGALANTLIGSSSKTQERLKEIPTSVST-PSDGNFGV  336
            MAMRDLV+G AAC    SSS+NP  +LAN L+GSSSKTQERLKEIPTS  T P+   +  
Sbjct  1    MAMRDLVSGAAACGDSSSSSANPLASLANALVGSSSKTQERLKEIPTSTLTDPTSQFYST  60

Query  337  GFQEPLATLPGSEIDHPF-QPNLQGSEFLEGFRTADQNSFADVWDGIQRPQLPHSNFPLD  513
                P+  LPGSE D P    N Q SEFL  FR A  +   + WD IQR         L 
Sbjct  61   AL--PVNHLPGSEFDKPLLDANYQASEFLHRFRGA--SGLEETWDEIQREGGVAGQRQLV  116

Query  514  NSQLQPELNGPPQRVLSNFLHSFVNSSHGGIPFRPASLPVLGLSQGEKQCIRDRSTIMAR  693
             +  QP L+G PQRVLS+FLHSF++SS GG+PF P  LP+LGLS+G+KQCIRDRS+IMAR
Sbjct  117  PAIQQPPLDGTPQRVLSSFLHSFLDSSRGGVPFHPTPLPMLGLSEGDKQCIRDRSSIMAR  176

Query  694  HFFADKNEDFINAQVNALLCSLDIDAD  774
            H FADK+E+FI+AQVNALLCSLDID++
Sbjct  177  HLFADKSEEFIDAQVNALLCSLDIDSN  203



>ref|XP_010928166.1| PREDICTED: peroxisome biogenesis protein 5-like [Elaeis guineensis]
Length=757

 Score =   229 bits (583),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 135/226 (60%), Positives = 159/226 (70%), Gaps = 25/226 (11%)
 Frame = +1

Query  160  MAMRDLVTGGAACAVPG-SSSSNPFGALANTLIGSSSKTQERLKEIP-TSVSTPS-DGNF  330
            MAMRDLVTGGAACAVPG SSSSNPFGALAN ++GSSSK QE LK +P TSV+ P    +F
Sbjct  1    MAMRDLVTGGAACAVPGTSSSSNPFGALANAILGSSSKAQE-LKGLPETSVNVPGPSSDF  59

Query  331  GVGFQEPLATLPGSEIDHPFQPNLQG--SEFLEGFRTADQNSFADVWDGIQRP-QLPH--  495
                + PL T+PGSE ++     L    SEFL GFR+A+ +   D WD I RP  LPH  
Sbjct  60   RP--EAPLTTIPGSEYENQQHQQLDAGNSEFLYGFRSAN-HGLEDAWDEIHRPSNLPHAR  116

Query  496  -----SNFPL--------DNSQLQPELNGPPQRVLSNFLHSFVNSSHGGIPFRPASLPVL  636
                 S+F           NS LQP  +GPPQRVLS+FLHSFV+S   GIPFRPA  PVL
Sbjct  117  GRESESHFAEFEQIYNHSGNSVLQPTWDGPPQRVLSSFLHSFVDSGRAGIPFRPAVQPVL  176

Query  637  GLSQGEKQCIRDRSTIMARHFFADKNEDFINAQVNALLCSLDIDAD  774
            GLS+G+KQCIRDRS IMARH F DK+E++I++QVNALL SLDID+D
Sbjct  177  GLSEGDKQCIRDRSCIMARHIFVDKSEEYISSQVNALLHSLDIDSD  222



>ref|XP_010913243.1| PREDICTED: peroxisome biogenesis protein 5-like [Elaeis guineensis]
Length=759

 Score =   228 bits (581),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 137/228 (60%), Positives = 160/228 (70%), Gaps = 27/228 (12%)
 Frame = +1

Query  160  MAMRDLVTGGAACAVPG---SSSSNPFGALANTLIGSSSKTQERLKEIP-TSVSTP-SDG  324
            MAMRDLVTGGAACAVPG   SSSSNPFG LAN ++GSSSK QE LK +P TSV+ P S  
Sbjct  1    MAMRDLVTGGAACAVPGTASSSSSNPFGGLANAILGSSSKAQE-LKGLPETSVNVPGSSS  59

Query  325  NFGVGFQEPLATLPGSEIDHPFQPNLQG--SEFLEGFRTADQNSFADVWDGIQRP-QLPH  495
            +FG   +  L T+PGSE +      L    SEFL GFRTAD +   D WD I RP  LPH
Sbjct  60   DFGP--EASLTTIPGSEYESQQYQQLDAPTSEFLHGFRTAD-HGLEDAWDEIHRPPVLPH  116

Query  496  S-------NFP-----LDN---SQLQPELNGPPQRVLSNFLHSFVNSSHGGIPFRPASLP  630
            +       +F       D+   S LQP  +GPPQRVLS+FLHSFV+S   G+PFRP +LP
Sbjct  117  ALGREGQPHFAEFEQIYDHGGSSILQPTWDGPPQRVLSSFLHSFVDSGRAGVPFRPTALP  176

Query  631  VLGLSQGEKQCIRDRSTIMARHFFADKNEDFINAQVNALLCSLDIDAD  774
            VLGLS+ +KQCIRDRS IMARH FADK+E+FI+AQVNALL SLDID+D
Sbjct  177  VLGLSEVDKQCIRDRSCIMARHIFADKSEEFISAQVNALLHSLDIDSD  224



>gb|KJB63159.1| hypothetical protein B456_009G455400 [Gossypium raimondii]
Length=741

 Score =   228 bits (580),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 135/213 (63%), Positives = 159/213 (75%), Gaps = 10/213 (5%)
 Frame = +1

Query  160  MAMRDLVTGGAACAVPGSSSS--NPFGALANTLIGSSSKTQE-RLKEIPTSVSTPSDGNF  330
            M+MR+LVTGGAACAVPGSSSS  NP GA AN LIGSSSKTQ+  LKEIP + +      F
Sbjct  1    MSMRELVTGGAACAVPGSSSSSSNPLGAFANALIGSSSKTQQGVLKEIPNAAAASPHAQF  60

Query  331  GVGFQEPLATLPGSEIDHPF-QPNLQGSEFLEGFRTADQNSFADVWDGIQRPQLPHSNFP  507
                 +P+A LPGSE+D PF Q N QGSEF+ GFRTAD N  AD W+ IQR   PH +  
Sbjct  61   YPHADDPVAALPGSELDRPFLQSNPQGSEFIRGFRTADANGLADAWEEIQRQ--PHFDRV  118

Query  508  LDNSQ----LQPELNGPPQRVLSNFLHSFVNSSHGGIPFRPASLPVLGLSQGEKQCIRDR  675
             + +     +QP L+GPPQRVLS+FLHSFV+SS  GIP  P  LP+LGLSQG+KQCIRDR
Sbjct  119  YEGATPAPPIQPSLDGPPQRVLSSFLHSFVDSSRSGIPLHPTPLPLLGLSQGDKQCIRDR  178

Query  676  STIMARHFFADKNEDFINAQVNALLCSLDIDAD  774
            S+IMARH FADK+E+FINAQVNALL SL+I+ D
Sbjct  179  SSIMARHIFADKSEEFINAQVNALLSSLEIEND  211



>ref|XP_009410316.1| PREDICTED: peroxisome biogenesis protein 5 [Musa acuminata subsp. 
malaccensis]
Length=758

 Score =   224 bits (572),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 131/226 (58%), Positives = 154/226 (68%), Gaps = 24/226 (11%)
 Frame = +1

Query  160  MAMRDLVTGGAACAVPGS--SSSNPFGALANTLIGSSSKTQERLKEIP-TSVSTPS-DGN  327
            MAMRDLVTGGAACAVPG+  SSSNPFGALAN ++GSSSKTQE LK +P ++V+ P    +
Sbjct  1    MAMRDLVTGGAACAVPGTAASSSNPFGALANAILGSSSKTQE-LKGLPGSAVNVPGPSSD  59

Query  328  FGVGFQEPLATLPGSEID--HPFQPNLQGSEFLEGFRTADQNSFADVWDGI-QRPQLPHS  498
            F  G   PL T+PG E +     QP  Q  EFL GFRTAD    AD W+ I Q P L   
Sbjct  60   FRTG--APLTTIPGLETEGQQHHQPVGQNYEFLAGFRTADHGVLADAWNEIHQPPALQTQ  117

Query  499  NFPLD--------------NSQLQPELNGPPQRVLSNFLHSFVNSSHGGIPFRPASLPVL  636
               ++              NS L P  +GPPQ VLS FLHSFV+S   G+PFRPA+LPVL
Sbjct  118  GGKIEAQFQEFEQIYNRGANSMLPPAWDGPPQGVLSRFLHSFVDSGRAGVPFRPAALPVL  177

Query  637  GLSQGEKQCIRDRSTIMARHFFADKNEDFINAQVNALLCSLDIDAD  774
            GLS+G+KQCIRDRS IMA H FADK+E++INAQVNALL SLDID +
Sbjct  178  GLSEGDKQCIRDRSFIMAHHIFADKSEEYINAQVNALLHSLDIDGN  223



>ref|XP_008796597.1| PREDICTED: peroxisome biogenesis protein 5-like [Phoenix dactylifera]
Length=597

 Score =   222 bits (565),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 134/226 (59%), Positives = 159/226 (70%), Gaps = 25/226 (11%)
 Frame = +1

Query  160  MAMRDLVTGGAACAVPGSSS-SNPFGALANTLIGSSSKTQERLKEIP-TSVSTP-SDGNF  330
            MAMRDLVTGGAACAVPG+SS SNPFGALAN ++GSSSK QE LK +P  SV+ P S  +F
Sbjct  1    MAMRDLVTGGAACAVPGTSSPSNPFGALANAILGSSSKAQE-LKGLPEASVNVPGSSPDF  59

Query  331  GVGFQEPLATLPGSEIDHPF--QPNLQGSEFLEGFRTADQNSFADVWDGIQRPQ-LPH--  495
                + PL T PGSE ++    Q N + SEFL GFR+A+ +   D WD I RP  LP   
Sbjct  60   RP--EAPLTTFPGSEYENQQHQQLNSRNSEFLYGFRSAN-HGLEDAWDEIHRPPILPQIR  116

Query  496  -----SNFPL--------DNSQLQPELNGPPQRVLSNFLHSFVNSSHGGIPFRPASLPVL  636
                 S+F           +S +QP  +GPPQRVLS+FLHSFV+S   GIPFRPA LPVL
Sbjct  117  GREGESHFAEFEQIYNHSGSSAIQPTWDGPPQRVLSSFLHSFVDSGRAGIPFRPAVLPVL  176

Query  637  GLSQGEKQCIRDRSTIMARHFFADKNEDFINAQVNALLCSLDIDAD  774
            GLS+G+KQCIRDRS IMARH F DK+E++I+AQVNALL SLDID D
Sbjct  177  GLSEGDKQCIRDRSCIMARHIFVDKSEEYISAQVNALLHSLDIDGD  222



>ref|XP_008344789.1| PREDICTED: peroxisome biogenesis protein 5-like, partial [Malus 
domestica]
Length=355

 Score =   213 bits (542),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 121/195 (62%), Positives = 134/195 (69%), Gaps = 9/195 (5%)
 Frame = +1

Query  214  SSSNPFGALANTLIGSSSKTQERLKEIPTSVSTPSDGNFGVGFQEPLATLPGSEIDHPF-  390
            +SSNPFGALAN LIGSSSK QE LKEIP+S  T S+  F       L  LPGSE+D PF 
Sbjct  7    TSSNPFGALANALIGSSSK-QEGLKEIPSSTPTASEPQFYPDGHGHLQQLPGSELDQPFM  65

Query  391  QPNLQGSEFLEGFRTADQNSFAD-VWDGIQRPQ------LPHSNFPLDNSQLQPELNGPP  549
            QP  Q SEFL  F + D N   D  WD IQ           H         LQP L+GPP
Sbjct  66   QPRTQSSEFLRNFNSVDGNRLLDNAWDEIQSSXPEPMHXXQHDRIYDMRPXLQPTLDGPP  125

Query  550  QRVLSNFLHSFVNSSHGGIPFRPASLPVLGLSQGEKQCIRDRSTIMARHFFADKNEDFIN  729
            QRVLS+FLHSFV SS GG+PFRP  LPVLGLS G+KQCIRDR++IMARHFFADK+EDFIN
Sbjct  126  QRVLSSFLHSFVESSRGGMPFRPTPLPVLGLSAGDKQCIRDRTSIMARHFFADKSEDFIN  185

Query  730  AQVNALLCSLDIDAD  774
             QVNALL SLDID+D
Sbjct  186  GQVNALLSSLDIDSD  200



>gb|KHN20585.1| Peroxisome biogenesis protein 5 [Glycine soja]
Length=736

 Score =   221 bits (562),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 124/206 (60%), Positives = 142/206 (69%), Gaps = 6/206 (3%)
 Frame = +1

Query  160  MAMRDLVTGGAACAVPGSSSSNPFGALANTLIGSSSKTQERLKEIPTSVST-PSDGNFGV  336
            MAMRDLV+G AAC    SSSSNP  +LAN LIGSSSKTQERLKEIPTS  T P+   +  
Sbjct  1    MAMRDLVSGAAACGDSSSSSSNPLASLANALIGSSSKTQERLKEIPTSTPTDPASQFYST  60

Query  337  GFQEPLATLPGSEIDHPF-QPNLQGSEFLEGFRTADQNSFADVWDGIQRPQLPHSNFPLD  513
                P   LPGSE D P    N Q SEFL  FR +      + WD IQR         L 
Sbjct  61   AL--PANQLPGSEFDKPLLNLNSQASEFLHRFRGS--TGLEETWDEIQRDGAAAQMRQLP  116

Query  514  NSQLQPELNGPPQRVLSNFLHSFVNSSHGGIPFRPASLPVLGLSQGEKQCIRDRSTIMAR  693
                QP L+G PQRVLSN LHSF++SS GG+PF PA LP+LGLS+G+KQCIRDRS+IMAR
Sbjct  117  PGIQQPPLDGTPQRVLSNILHSFLDSSRGGVPFHPAPLPMLGLSEGDKQCIRDRSSIMAR  176

Query  694  HFFADKNEDFINAQVNALLCSLDIDA  771
            H F DK+E+FI+AQVNALLCSLDID+
Sbjct  177  HLFVDKSEEFIDAQVNALLCSLDIDS  202



>ref|XP_011461534.1| PREDICTED: peroxisome biogenesis protein 5 [Fragaria vesca subsp. 
vesca]
Length=749

 Score =   219 bits (559),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 132/215 (61%), Positives = 148/215 (69%), Gaps = 11/215 (5%)
 Frame = +1

Query  160  MAMRDLVTGGAACAVPGSSSS-NPFGALANTLIGSSSKTQERLKEIPTSVSTPSDGNFGV  336
            MAMR+LVTGGAACAVPGSSSS NPFG LAN L+ SS+K Q+ LKE+P+S+ T S G    
Sbjct  1    MAMRELVTGGAACAVPGSSSSSNPFGNLANALLNSSAKGQD-LKELPSSLPTSSSGAQFY  59

Query  337  GFQEPLATLPGSEIDHPFQP-NLQGSEFLEGFRTADQNS-FADVWDGIQRPQLPHSNFP-  507
                    LPGSE D    P   Q  EFL  F +   N    + WD +Q  Q P  + P 
Sbjct  60   PEAHGQQQLPGSEFDQQLIPPGAQSLEFLRNFNSVGGNGMLENAWDEVQGSQPPPMHRPQ  119

Query  508  --LDNS----QLQPELNGPPQRVLSNFLHSFVNSSHGGIPFRPASLPVLGLSQGEKQCIR  669
               D      QLQP L+GPPQRVLS+FLHSFV SS GGIPFRP  LPVLGLS G+KQCIR
Sbjct  120  VMYDRGGPAPQLQPALDGPPQRVLSSFLHSFVESSRGGIPFRPTQLPVLGLSAGDKQCIR  179

Query  670  DRSTIMARHFFADKNEDFINAQVNALLCSLDIDAD  774
            DRS+IMARHFFADK+EDFIN QVNALLCSLDID D
Sbjct  180  DRSSIMARHFFADKSEDFINGQVNALLCSLDIDGD  214



>ref|XP_008355814.1| PREDICTED: peroxisome biogenesis protein 5-like, partial [Malus 
domestica]
Length=732

 Score =   218 bits (556),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 122/196 (62%), Positives = 136/196 (69%), Gaps = 9/196 (5%)
 Frame = +1

Query  211  SSSSNPFGALANTLIGSSSKTQERLKEIPTSVSTPSDGNFGVGFQEPLATLPGSEIDHPF  390
            ++SSNPFGALAN LIGSSSK QE LKEIP+S  T S+  F       L  LPGSE+D PF
Sbjct  6    NTSSNPFGALANALIGSSSK-QEGLKEIPSSTPTASEPQFYPDGHGHLQQLPGSELDQPF  64

Query  391  -QPNLQGSEFLEGFRTADQNSFAD-VWDGIQRPQ------LPHSNFPLDNSQLQPELNGP  546
             QP  Q SEFL  F + D N   D  WD IQ  Q        H         LQP L+GP
Sbjct  65   MQPRTQSSEFLRNFNSVDGNRLLDNAWDEIQSSQPEPMHVXQHDRIYDMRPHLQPTLDGP  124

Query  547  PQRVLSNFLHSFVNSSHGGIPFRPASLPVLGLSQGEKQCIRDRSTIMARHFFADKNEDFI  726
            PQRVLS+FLHSFV SS GG+PFRP  LPVLGLS G+KQCIRDR++IMARHFFADK+EDFI
Sbjct  125  PQRVLSSFLHSFVESSRGGMPFRPTPLPVLGLSAGDKQCIRDRTSIMARHFFADKSEDFI  184

Query  727  NAQVNALLCSLDIDAD  774
            N QVNALL SLDID+D
Sbjct  185  NGQVNALLSSLDIDSD  200



>emb|CDY49390.1| BnaC09g53570D [Brassica napus]
Length=697

 Score =   213 bits (541),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 122/208 (59%), Positives = 138/208 (66%), Gaps = 34/208 (16%)
 Frame = +1

Query  160  MAMRDLVTGGAACAVPGSSSS----NPFGALANTLIGSSSKTQERLKEIPTSVSTPSDGN  327
            MAMRDLV GGAACAVPGSSSS    NP GAL N L+GSSSKTQERL+EIP +        
Sbjct  1    MAMRDLVNGGAACAVPGSSSSSSTSNPLGALTNALLGSSSKTQERLREIPNATRAGPGPQ  60

Query  328  FGVGFQEPLATLPGSEIDHPF-QPNLQGSEFLEGFRTADQNSFADVWDGIQRPQLPHSNF  504
            F    Q  L++LPGSE+D P  QP  QG+EF  GF                         
Sbjct  61   FYSQDQH-LSSLPGSELDQPLLQPGAQGAEFFRGF-------------------------  94

Query  505  PLDNSQLQPELNGPPQRVLSNFLHSFVNSSHGGIPFRPASLPVLGLSQGEKQCIRDRSTI  684
               +S + P   GPPQRVLSNFLHSFV SS GGIPFRPA +PVLGLSQ +KQCIRDRS+I
Sbjct  95   ---SSPVHPTFEGPPQRVLSNFLHSFVESSRGGIPFRPAPVPVLGLSQSDKQCIRDRSSI  151

Query  685  MARHFFADKNEDFINAQVNALLCSLDID  768
            MA HFFAD+ E+FIN+QVNALL SL+ID
Sbjct  152  MAGHFFADRGEEFINSQVNALLSSLEID  179



>ref|XP_010676141.1| PREDICTED: peroxisome biogenesis protein 5 [Beta vulgaris subsp. 
vulgaris]
Length=741

 Score =   209 bits (533),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 117/215 (54%), Positives = 143/215 (67%), Gaps = 15/215 (7%)
 Frame = +1

Query  160  MAMRDLVTGGAACAVPGSSSSNPFGALANTLIGSSSKTQERLKEIPTSVSTPSDGNFGVG  339
            MAMRDLVT  A+C     S+ NP G+LAN LIGSSSKTQERLKEIPTS S+ S       
Sbjct  1    MAMRDLVTNDASC----DSAPNPLGSLANALIGSSSKTQERLKEIPTSTSSGSSSQVYSN  56

Query  340  FQEPLATLPGSEIDHPFQPNLQGSE--FLEGFRTADQNSFADVWDGIQRPQLPHSNFPLD  513
              + L  LPG+E ++    +  G +  FL  +R+A    F + WD  Q      SNFP  
Sbjct  57   SVDQLTALPGTESEYQLNQHSVGQDLGFLHNYRSASHGGFTEAWDDAQYSG-RESNFPQS  115

Query  514  N--------SQLQPELNGPPQRVLSNFLHSFVNSSHGGIPFRPASLPVLGLSQGEKQCIR  669
                     +Q QP  +GPPQ+VLS FLHSFV+SS  G+P RP +LP+LGL++GEKQCIR
Sbjct  116  RHVHNEGYLAQTQPSWDGPPQKVLSGFLHSFVDSSRFGVPLRPTALPMLGLTKGEKQCIR  175

Query  670  DRSTIMARHFFADKNEDFINAQVNALLCSLDIDAD  774
            +RS+IMARH FADK+EDFINAQV+ALL SLDID D
Sbjct  176  NRSSIMARHMFADKSEDFINAQVDALLYSLDIDND  210



>gb|KHN44770.1| Peroxisome biogenesis protein 5 [Glycine soja]
Length=738

 Score =   194 bits (493),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 121/207 (58%), Positives = 138/207 (67%), Gaps = 7/207 (3%)
 Frame = +1

Query  160  MAMRDLVTGGAACAVPGSSSSNPFGA-LANTLIGSSSKTQERLKEIPTSVST-PSDGNFG  333
            MAMRDLV+G AAC    SSSS    A LAN LIGSSSKT ERLKEIPTS  T P+   + 
Sbjct  1    MAMRDLVSGAAACGDSSSSSSANPLASLANALIGSSSKTPERLKEIPTSTPTDPTSQFYS  60

Query  334  VGFQEPLATLPGSEIDHPF-QPNLQGSEFLEGFRTADQNSFADVWDGIQRPQLPHSNFPL  510
                 P   LPG+E+D P    N Q SEFL  FR        + WD IQR         L
Sbjct  61   TAL--PANQLPGTELDKPLLNANSQASEFLHRFRGT--TGLEETWDEIQRDGAAAQMRQL  116

Query  511  DNSQLQPELNGPPQRVLSNFLHSFVNSSHGGIPFRPASLPVLGLSQGEKQCIRDRSTIMA  690
                 Q  L+G PQRVLS+FLHSF++SS GG+PF PA LP+LGLS G+KQCIRDRS+IMA
Sbjct  117  PPGIQQLPLDGTPQRVLSSFLHSFLDSSRGGVPFHPAPLPMLGLSDGDKQCIRDRSSIMA  176

Query  691  RHFFADKNEDFINAQVNALLCSLDIDA  771
            RH FADK E+FI+AQVNALLCSLDID+
Sbjct  177  RHLFADKGEEFIDAQVNALLCSLDIDS  203



>ref|XP_003523862.1| PREDICTED: peroxisome biogenesis protein 5-like isoform X1 [Glycine 
max]
 ref|XP_006578357.1| PREDICTED: peroxisome biogenesis protein 5-like isoform X2 [Glycine 
max]
 ref|XP_006578358.1| PREDICTED: peroxisome biogenesis protein 5-like isoform X3 [Glycine 
max]
Length=738

 Score =   194 bits (493),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 121/207 (58%), Positives = 138/207 (67%), Gaps = 7/207 (3%)
 Frame = +1

Query  160  MAMRDLVTGGAACAVPGSSSSNPFGA-LANTLIGSSSKTQERLKEIPTSVST-PSDGNFG  333
            MAMRDLV+G AAC    SSSS    A LAN LIGSSSKT ERLKEIPTS  T P+   + 
Sbjct  1    MAMRDLVSGAAACGDSSSSSSANPLASLANALIGSSSKTPERLKEIPTSTPTDPTSQFYS  60

Query  334  VGFQEPLATLPGSEIDHPF-QPNLQGSEFLEGFRTADQNSFADVWDGIQRPQLPHSNFPL  510
                 P   LPG+E+D P    N Q SEFL  FR        + WD IQR         L
Sbjct  61   TAL--PANQLPGTELDKPLLNANSQASEFLHRFRGT--TGLEETWDEIQRDGAAAQMRQL  116

Query  511  DNSQLQPELNGPPQRVLSNFLHSFVNSSHGGIPFRPASLPVLGLSQGEKQCIRDRSTIMA  690
                 Q  L+G PQRVLS+FLHSF++SS GG+PF PA LP+LGLS G+KQCIRDRS+IMA
Sbjct  117  PPGIQQLPLDGTPQRVLSSFLHSFLDSSRGGVPFHPAPLPMLGLSDGDKQCIRDRSSIMA  176

Query  691  RHFFADKNEDFINAQVNALLCSLDIDA  771
            RH FADK E+FI+AQVNALLCSLDID+
Sbjct  177  RHLFADKGEEFIDAQVNALLCSLDIDS  203



>ref|XP_004973819.1| PREDICTED: peroxisome biogenesis protein 5-like isoform X2 [Setaria 
italica]
Length=677

 Score =   175 bits (444),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 102/216 (47%), Positives = 134/216 (62%), Gaps = 21/216 (10%)
 Frame = +1

Query  160  MAMRDLVTGGAACAVPGSSSSNPFGALANTLIGSSSKTQERLKEIPTSVSTPSDGNFGVG  339
            MAMR L+TG  +CA  G+SSSNP  A AN ++G SSKT+  +KE+P SVS PS  +FG  
Sbjct  1    MAMRHLITGQNSCAPDGASSSNPLNAFANAVLGQSSKTRS-IKELPGSVSVPSTSDFGTA  59

Query  340  FQEPLATLPGS--EIDHPFQPNLQGSEFLEG---------FRTADQNSFADVWDGIQRPQ  486
               PL+T+PGS  E     +P  +G++F+ G         FR      F     G+   Q
Sbjct  60   --APLSTIPGSDDEFKQDQRPLARGADFIRGGPANDWIESFRPPGVPEF-----GVTESQ  112

Query  487  LPHSNFPLDNS--QLQPELNGPPQRVLSNFLHSFVNSSHGGIPFRPASLPVLGLSQGEKQ  660
            +   +   +N+   + P L+GPPQRVLS  LHSF+ S   G+PF+P  +P LGLS+ +KQ
Sbjct  113  VAEFDQIYNNTGTTIGPPLDGPPQRVLSGVLHSFLASGRAGVPFQPVPVPALGLSESDKQ  172

Query  661  CIRDRSTIMARHFFADKNEDFINAQVNALLCSLDID  768
            CIRDRS IMARH  AD+ E++I AQVN LL SLDID
Sbjct  173  CIRDRSCIMARHILADQPEEYIQAQVNTLLHSLDID  208



>ref|XP_004973818.1| PREDICTED: peroxisome biogenesis protein 5-like isoform X1 [Setaria 
italica]
Length=734

 Score =   175 bits (444),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 102/216 (47%), Positives = 134/216 (62%), Gaps = 21/216 (10%)
 Frame = +1

Query  160  MAMRDLVTGGAACAVPGSSSSNPFGALANTLIGSSSKTQERLKEIPTSVSTPSDGNFGVG  339
            MAMR L+TG  +CA  G+SSSNP  A AN ++G SSKT+  +KE+P SVS PS  +FG  
Sbjct  1    MAMRHLITGQNSCAPDGASSSNPLNAFANAVLGQSSKTRS-IKELPGSVSVPSTSDFGTA  59

Query  340  FQEPLATLPGS--EIDHPFQPNLQGSEFLEG---------FRTADQNSFADVWDGIQRPQ  486
               PL+T+PGS  E     +P  +G++F+ G         FR      F     G+   Q
Sbjct  60   --APLSTIPGSDDEFKQDQRPLARGADFIRGGPANDWIESFRPPGVPEF-----GVTESQ  112

Query  487  LPHSNFPLDNS--QLQPELNGPPQRVLSNFLHSFVNSSHGGIPFRPASLPVLGLSQGEKQ  660
            +   +   +N+   + P L+GPPQRVLS  LHSF+ S   G+PF+P  +P LGLS+ +KQ
Sbjct  113  VAEFDQIYNNTGTTIGPPLDGPPQRVLSGVLHSFLASGRAGVPFQPVPVPALGLSESDKQ  172

Query  661  CIRDRSTIMARHFFADKNEDFINAQVNALLCSLDID  768
            CIRDRS IMARH  AD+ E++I AQVN LL SLDID
Sbjct  173  CIRDRSCIMARHILADQPEEYIQAQVNTLLHSLDID  208



>ref|XP_002980203.1| hypothetical protein SELMODRAFT_444455 [Selaginella moellendorffii]
 gb|EFJ18463.1| hypothetical protein SELMODRAFT_444455 [Selaginella moellendorffii]
Length=724

 Score =   170 bits (431),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 102/216 (47%), Positives = 127/216 (59%), Gaps = 17/216 (8%)
 Frame = +1

Query  160  MAMRDLVTGGAACAVPG---SSSSNPFGALANTLIGSSSKTQERLKEIPTSVSTPSDGNF  330
            MA+RDLVTG   C VPG   SSSSNP    A++L+GS  K QER++E+PT  +    G  
Sbjct  1    MALRDLVTGAGGCVVPGEGASSSSNPLANFASSLLGSLPKAQERVRELPTIPTFQGPGQQ  60

Query  331  GVGFQEPLATLPGSEIDHPFQPNLQGSEFLEGFRTADQNSFADVW-DGIQRPQ-------  486
                    A+LPG+E    FQ   Q SEF+ GFR A+   +AD W +  QR +       
Sbjct  61   LEYGSSSAASLPGTE----FQNETQHSEFMRGFRDAEPAPYADAWNEATQRGEDLSRFSE  116

Query  487  --LPHSNFPLDNSQLQPELNGPPQRVLSNFLHSFVNSSHGGIPFRPASLPVLGLSQGEKQ  660
                +   P  N Q    ++GPPQ  LS FL SF  SS   +PF    LP LGLS  +KQ
Sbjct  117  FERIYGQKPGGNVQQLHYMDGPPQHALSGFLRSFFASSRTELPFHAVRLPELGLSGFDKQ  176

Query  661  CIRDRSTIMARHFFADKNEDFINAQVNALLCSLDID  768
             IRDRS+IMARHFFADK E+++NAQVNA L SLDI+
Sbjct  177  RIRDRSSIMARHFFADKGEEYVNAQVNAFLESLDIE  212



>ref|XP_003574713.1| PREDICTED: peroxisome biogenesis protein 5 [Brachypodium distachyon]
Length=737

 Score =   169 bits (428),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 103/218 (47%), Positives = 132/218 (61%), Gaps = 24/218 (11%)
 Frame = +1

Query  160  MAMRDLVTGGAACAVPGSSSSNPFGALANTLIGSSSKTQERLKEIP-TSVSTPSDGNFGV  336
            MA R L+TG   CA  G+SSSNPFGALAN L+G SSK Q  +KE+P  SV+ P+  ++  
Sbjct  1    MATRHLITGQNNCAPDGASSSNPFGALANALLGQSSKAQS-IKELPGASVNVPTTSDYST  59

Query  337  GFQEPLATLPGSEID--HPFQPNLQGSEFLEGFRTADQNSFADVWDGIQRPQLPHSNFPL  510
                PL+T+PGSE +     +P   G+EF+ G       S  D  +  + P  P    P 
Sbjct  60   S--APLSTIPGSENEFRQDQRPPGWGTEFIHG------GSANDWVESFRPPGHPVVGGPA  111

Query  511  DN------------SQLQPELNGPPQRVLSNFLHSFVNSSHGGIPFRPASLPVLGLSQGE  654
             N            +   P L+GPPQRVLS  LHSF++S   G+PF+P  +P LGLS+G+
Sbjct  112  PNFAEFDQIYSNAGTTSGPALDGPPQRVLSGVLHSFLSSGRAGVPFQPVPIPALGLSEGD  171

Query  655  KQCIRDRSTIMARHFFADKNEDFINAQVNALLCSLDID  768
            KQCIRDRS IMARH  AD+ E++I AQVN LL SLDID
Sbjct  172  KQCIRDRSCIMARHILADQPEEYIQAQVNTLLHSLDID  209



>ref|XP_006659548.1| PREDICTED: peroxisome biogenesis protein 5-like isoform X2 [Oryza 
brachyantha]
Length=679

 Score =   167 bits (424),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 102/224 (46%), Positives = 137/224 (61%), Gaps = 31/224 (14%)
 Frame = +1

Query  160  MAMRDLVTGGAACAVPGSSSSNPFGALANTLIGSSSKTQERLKEIP-TSVSTPSDGNFGV  336
            MAMR L+TG   CA  G+SSSNPFG LAN ++G SSKTQ  +KE+P +SV+ P+   FG 
Sbjct  1    MAMRHLITGQGNCAPDGASSSNPFGNLANAILGQSSKTQA-IKELPGSSVNVPTTSEFGA  59

Query  337  GFQEPLATLPGSE--IDHPFQPNLQGSEFLEGFRTADQNSFADVW-DGIQRPQLPHSNFP  507
                PL+T+PGSE        P  +G++F+ G  + D       W +  + P LP   F 
Sbjct  60   A--APLSTIPGSENEFKQDQLPLARGADFIRGGPSHD-------WVESFRPPGLPE--FA  108

Query  508  LDNSQLQ---------------PELNGPPQRVLSNFLHSFVNSSHGGIPFRPASLPVLGL  642
              +++ +               P L+GPPQRVLS  L SF++S   G+PF+P  +P LGL
Sbjct  109  GPDAEFKEFEQIFNNTGPTFGPPVLDGPPQRVLSGVLRSFLSSGQAGVPFQPVPVPALGL  168

Query  643  SQGEKQCIRDRSTIMARHFFADKNEDFINAQVNALLCSLDIDAD  774
            S+ +KQCIRDRS IMARH  AD+ E++I AQVN LL SLDID++
Sbjct  169  SESDKQCIRDRSCIMARHILADQPEEYIQAQVNTLLHSLDIDSN  212



>ref|XP_006659547.1| PREDICTED: peroxisome biogenesis protein 5-like isoform X1 [Oryza 
brachyantha]
Length=736

 Score =   167 bits (423),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 102/224 (46%), Positives = 137/224 (61%), Gaps = 31/224 (14%)
 Frame = +1

Query  160  MAMRDLVTGGAACAVPGSSSSNPFGALANTLIGSSSKTQERLKEIP-TSVSTPSDGNFGV  336
            MAMR L+TG   CA  G+SSSNPFG LAN ++G SSKTQ  +KE+P +SV+ P+   FG 
Sbjct  1    MAMRHLITGQGNCAPDGASSSNPFGNLANAILGQSSKTQA-IKELPGSSVNVPTTSEFGA  59

Query  337  GFQEPLATLPGSE--IDHPFQPNLQGSEFLEGFRTADQNSFADVW-DGIQRPQLPHSNFP  507
                PL+T+PGSE        P  +G++F+ G  + D       W +  + P LP   F 
Sbjct  60   A--APLSTIPGSENEFKQDQLPLARGADFIRGGPSHD-------WVESFRPPGLPE--FA  108

Query  508  LDNSQLQ---------------PELNGPPQRVLSNFLHSFVNSSHGGIPFRPASLPVLGL  642
              +++ +               P L+GPPQRVLS  L SF++S   G+PF+P  +P LGL
Sbjct  109  GPDAEFKEFEQIFNNTGPTFGPPVLDGPPQRVLSGVLRSFLSSGQAGVPFQPVPVPALGL  168

Query  643  SQGEKQCIRDRSTIMARHFFADKNEDFINAQVNALLCSLDIDAD  774
            S+ +KQCIRDRS IMARH  AD+ E++I AQVN LL SLDID++
Sbjct  169  SESDKQCIRDRSCIMARHILADQPEEYIQAQVNTLLHSLDIDSN  212



>ref|XP_008679527.1| PREDICTED: peroxisome biogenesis protein 5-like isoform X2 [Zea 
mays]
Length=713

 Score =   166 bits (421),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 106/220 (48%), Positives = 133/220 (60%), Gaps = 28/220 (13%)
 Frame = +1

Query  160  MAMRDLVTGGAACAVPGSSSSNPFGALANTLIGSSSKTQERLKEIPTSVSTPSDGNFGVG  339
            MA+R LVTG   CA  G+SSSNP  ALAN  +G SSK Q  +KE+P SVS PS   F   
Sbjct  1    MALRHLVTGQNNCAPDGASSSNPLNALANAFLGQSSKAQS-IKELPGSVSVPSTSGFSA-  58

Query  340  FQEPLATLPGSE--IDHPFQPNLQGSEFLEGFRTADQNSFADVW-DGIQRPQLPH-----  495
               PL+ +PGSE       +P +QGS+F+ G    D       W    + P +P      
Sbjct  59   -PAPLSNIPGSENEFKQDQRPFVQGSDFIHGGPAND-------WIKSFRPPGVPELGGIE  110

Query  496  SNFPLDNSQL--------QPELNGPPQRVLSNFLHSFVNSSHGGIPFRPASLPV-LGLSQ  648
            ++FP D  Q+        QP L+GPPQRVLS  LHSF+ S   G+PF+P  +P  LGLS+
Sbjct  111  AHFP-DFEQIYNNAGTTFQPPLDGPPQRVLSGVLHSFLTSGPAGVPFQPLPVPAALGLSE  169

Query  649  GEKQCIRDRSTIMARHFFADKNEDFINAQVNALLCSLDID  768
             +KQCIRDRS IMARH F+D+ E++I AQVN LL SLDID
Sbjct  170  SDKQCIRDRSCIMARHIFSDQPEEYIQAQVNTLLHSLDID  209



>ref|XP_008679528.1| PREDICTED: peroxisome biogenesis protein 5-like isoform X3 [Zea 
mays]
Length=678

 Score =   166 bits (420),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 106/220 (48%), Positives = 133/220 (60%), Gaps = 28/220 (13%)
 Frame = +1

Query  160  MAMRDLVTGGAACAVPGSSSSNPFGALANTLIGSSSKTQERLKEIPTSVSTPSDGNFGVG  339
            MA+R LVTG   CA  G+SSSNP  ALAN  +G SSK Q  +KE+P SVS PS   F   
Sbjct  1    MALRHLVTGQNNCAPDGASSSNPLNALANAFLGQSSKAQS-IKELPGSVSVPSTSGFSA-  58

Query  340  FQEPLATLPGSE--IDHPFQPNLQGSEFLEGFRTADQNSFADVW-DGIQRPQLPH-----  495
               PL+ +PGSE       +P +QGS+F+ G    D       W    + P +P      
Sbjct  59   -PAPLSNIPGSENEFKQDQRPFVQGSDFIHGGPAND-------WIKSFRPPGVPELGGIE  110

Query  496  SNFPLDNSQL--------QPELNGPPQRVLSNFLHSFVNSSHGGIPFRPASLPV-LGLSQ  648
            ++FP D  Q+        QP L+GPPQRVLS  LHSF+ S   G+PF+P  +P  LGLS+
Sbjct  111  AHFP-DFEQIYNNAGTTFQPPLDGPPQRVLSGVLHSFLTSGPAGVPFQPLPVPAALGLSE  169

Query  649  GEKQCIRDRSTIMARHFFADKNEDFINAQVNALLCSLDID  768
             +KQCIRDRS IMARH F+D+ E++I AQVN LL SLDID
Sbjct  170  SDKQCIRDRSCIMARHIFSDQPEEYIQAQVNTLLHSLDID  209



>ref|XP_008679526.1| PREDICTED: peroxisome biogenesis protein 5-like isoform X1 [Zea 
mays]
Length=735

 Score =   166 bits (421),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 106/220 (48%), Positives = 133/220 (60%), Gaps = 28/220 (13%)
 Frame = +1

Query  160  MAMRDLVTGGAACAVPGSSSSNPFGALANTLIGSSSKTQERLKEIPTSVSTPSDGNFGVG  339
            MA+R LVTG   CA  G+SSSNP  ALAN  +G SSK Q  +KE+P SVS PS   F   
Sbjct  1    MALRHLVTGQNNCAPDGASSSNPLNALANAFLGQSSKAQS-IKELPGSVSVPSTSGFSA-  58

Query  340  FQEPLATLPGSE--IDHPFQPNLQGSEFLEGFRTADQNSFADVW-DGIQRPQLPH-----  495
               PL+ +PGSE       +P +QGS+F+ G    D       W    + P +P      
Sbjct  59   -PAPLSNIPGSENEFKQDQRPFVQGSDFIHGGPAND-------WIKSFRPPGVPELGGIE  110

Query  496  SNFPLDNSQL--------QPELNGPPQRVLSNFLHSFVNSSHGGIPFRPASLPV-LGLSQ  648
            ++FP D  Q+        QP L+GPPQRVLS  LHSF+ S   G+PF+P  +P  LGLS+
Sbjct  111  AHFP-DFEQIYNNAGTTFQPPLDGPPQRVLSGVLHSFLTSGPAGVPFQPLPVPAALGLSE  169

Query  649  GEKQCIRDRSTIMARHFFADKNEDFINAQVNALLCSLDID  768
             +KQCIRDRS IMARH F+D+ E++I AQVN LL SLDID
Sbjct  170  SDKQCIRDRSCIMARHIFSDQPEEYIQAQVNTLLHSLDID  209



>ref|XP_008666997.1| PREDICTED: uncharacterized protein LOC100191477 isoform X2 [Zea 
mays]
Length=679

 Score =   166 bits (419),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 102/216 (47%), Positives = 135/216 (63%), Gaps = 19/216 (9%)
 Frame = +1

Query  160  MAMRDLVTGGAACAVPGSSSSNPFGALANTLIGSSSKTQERLKEIPTSVSTPSDGNFGVG  339
            MA+R LVTG   C   G+SSSNP  ALAN  +G SSK Q  +KE+P SV+ PS  +F V 
Sbjct  1    MALRHLVTGQNNCVPDGASSSNPLNALANAFLGQSSKAQS-IKELPGSVNVPSTSDFSVS  59

Query  340  FQEPLATLPGSE--IDHPFQPNLQGSEFLEGFRTADQNSFADVWDGIQRPQL-PHSNFP-  507
               PL+ +PGSE       +P  +G++F+ G      N + + +   + PQL   + FP 
Sbjct  60   --APLSNIPGSENEFKQDQRPLARGADFIRG---GPANDWIESFRPPRVPQLGVEAQFPD  114

Query  508  ----LDNS----QLQPELNGPPQRVLSNFLHSFVNSSHGGIPFRPASLPV-LGLSQGEKQ  660
                 +N+    Q QP L+GPPQRVLS  LHSF+ S   G+PF+P  +P  LGLS+ +KQ
Sbjct  115  FEQIYNNAGTTFQFQPPLDGPPQRVLSGVLHSFLTSGPAGVPFQPLPVPAALGLSESDKQ  174

Query  661  CIRDRSTIMARHFFADKNEDFINAQVNALLCSLDID  768
            CIRDRS IMARH F+D+ E++I +QVN LL SLDID
Sbjct  175  CIRDRSCIMARHIFSDQPEEYIQSQVNTLLHSLDID  210



>ref|XP_008666974.1| PREDICTED: uncharacterized protein LOC100191477 isoform X1 [Zea 
mays]
Length=734

 Score =   166 bits (420),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 102/216 (47%), Positives = 135/216 (63%), Gaps = 19/216 (9%)
 Frame = +1

Query  160  MAMRDLVTGGAACAVPGSSSSNPFGALANTLIGSSSKTQERLKEIPTSVSTPSDGNFGVG  339
            MA+R LVTG   C   G+SSSNP  ALAN  +G SSK Q  +KE+P SV+ PS  +F V 
Sbjct  1    MALRHLVTGQNNCVPDGASSSNPLNALANAFLGQSSKAQS-IKELPGSVNVPSTSDFSVS  59

Query  340  FQEPLATLPGSE--IDHPFQPNLQGSEFLEGFRTADQNSFADVWDGIQRPQL-PHSNFP-  507
               PL+ +PGSE       +P  +G++F+ G      N + + +   + PQL   + FP 
Sbjct  60   --APLSNIPGSENEFKQDQRPLARGADFIRG---GPANDWIESFRPPRVPQLGVEAQFPD  114

Query  508  ----LDNS----QLQPELNGPPQRVLSNFLHSFVNSSHGGIPFRPASLPV-LGLSQGEKQ  660
                 +N+    Q QP L+GPPQRVLS  LHSF+ S   G+PF+P  +P  LGLS+ +KQ
Sbjct  115  FEQIYNNAGTTFQFQPPLDGPPQRVLSGVLHSFLTSGPAGVPFQPLPVPAALGLSESDKQ  174

Query  661  CIRDRSTIMARHFFADKNEDFINAQVNALLCSLDID  768
            CIRDRS IMARH F+D+ E++I +QVN LL SLDID
Sbjct  175  CIRDRSCIMARHIFSDQPEEYIQSQVNTLLHSLDID  210



>tpg|DAA47839.1| TPA: hypothetical protein ZEAMMB73_779817 [Zea mays]
Length=736

 Score =   166 bits (420),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 102/216 (47%), Positives = 135/216 (63%), Gaps = 19/216 (9%)
 Frame = +1

Query  160  MAMRDLVTGGAACAVPGSSSSNPFGALANTLIGSSSKTQERLKEIPTSVSTPSDGNFGVG  339
            MA+R LVTG   C   G+SSSNP  ALAN  +G SSK Q  +KE+P SV+ PS  +F V 
Sbjct  1    MALRHLVTGQNNCVPDGASSSNPLNALANAFLGQSSKAQS-IKELPGSVNVPSTSDFSVS  59

Query  340  FQEPLATLPGSE--IDHPFQPNLQGSEFLEGFRTADQNSFADVWDGIQRPQL-PHSNFP-  507
               PL+ +PGSE       +P  +G++F+ G      N + + +   + PQL   + FP 
Sbjct  60   --APLSNIPGSENEFKQDQRPLARGADFIRG---GPANDWIESFRPPRVPQLGVEAQFPD  114

Query  508  ----LDNS----QLQPELNGPPQRVLSNFLHSFVNSSHGGIPFRPASLPV-LGLSQGEKQ  660
                 +N+    Q QP L+GPPQRVLS  LHSF+ S   G+PF+P  +P  LGLS+ +KQ
Sbjct  115  FEQIYNNAGTTFQFQPPLDGPPQRVLSGVLHSFLTSGPAGVPFQPLPVPAALGLSESDKQ  174

Query  661  CIRDRSTIMARHFFADKNEDFINAQVNALLCSLDID  768
            CIRDRS IMARH F+D+ E++I +QVN LL SLDID
Sbjct  175  CIRDRSCIMARHIFSDQPEEYIQSQVNTLLHSLDID  210



>ref|NP_001130381.1| uncharacterized protein LOC100191477 [Zea mays]
 gb|ACF78574.1| unknown [Zea mays]
Length=736

 Score =   166 bits (420),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 102/216 (47%), Positives = 135/216 (63%), Gaps = 19/216 (9%)
 Frame = +1

Query  160  MAMRDLVTGGAACAVPGSSSSNPFGALANTLIGSSSKTQERLKEIPTSVSTPSDGNFGVG  339
            MA+R LVTG   C   G+SSSNP  ALAN  +G SSK Q  +KE+P SV+ PS  +F V 
Sbjct  1    MALRHLVTGQNNCVPDGASSSNPLNALANAFLGQSSKAQS-IKELPGSVNVPSTSDFSVS  59

Query  340  FQEPLATLPGSE--IDHPFQPNLQGSEFLEGFRTADQNSFADVWDGIQRPQL-PHSNFP-  507
               PL+ +PGSE       +P  +G++F+ G      N + + +   + PQL   + FP 
Sbjct  60   --APLSNIPGSENEFKQDQRPLARGADFIRG---GPANDWIESFRPPRVPQLGVEAQFPD  114

Query  508  ----LDNS----QLQPELNGPPQRVLSNFLHSFVNSSHGGIPFRPASLPV-LGLSQGEKQ  660
                 +N+    Q QP L+GPPQRVLS  LHSF+ S   G+PF+P  +P  LGLS+ +KQ
Sbjct  115  FEQIYNNAGTTFQFQPPLDGPPQRVLSGVLHSFLTSGPAGVPFQPLPVPAALGLSESDKQ  174

Query  661  CIRDRSTIMARHFFADKNEDFINAQVNALLCSLDID  768
            CIRDRS IMARH F+D+ E++I +QVN LL SLDID
Sbjct  175  CIRDRSCIMARHIFSDQPEEYIQSQVNTLLHSLDID  210



>dbj|BAD08811.1| putative peroxisomal targeting signal 1 receptor [Oryza sativa 
Japonica Group]
Length=679

 Score =   165 bits (418),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 100/224 (45%), Positives = 135/224 (60%), Gaps = 31/224 (14%)
 Frame = +1

Query  160  MAMRDLVTGGAACAVPGSSSSNPFGALANTLIGSSSKTQERLKEIP-TSVSTPSDGNFGV  336
            MAMR L+TG   CA  G+SSSNPFG LAN + G SSK Q  +KE+P ++V+ P+    G 
Sbjct  1    MAMRHLITGQGNCAPDGASSSNPFGNLANAIFGQSSKAQS-IKELPGSAVNVPTTSELGT  59

Query  337  GFQEPLATLPGSE--IDHPFQPNLQGSEFLEGFRTADQNSFADVW-DGIQRPQLPHSNFP  507
                PL+T+PGSE        P  +G++F+ G  + D       W +  + P LP   F 
Sbjct  60   A--APLSTIPGSENEFKQDQLPLARGADFIRGGPSHD-------WVESFRPPGLPE--FA  108

Query  508  LDNSQLQ---------------PELNGPPQRVLSNFLHSFVNSSHGGIPFRPASLPVLGL  642
            + ++QL+               P ++GPPQRVLS  L SF+ S   G+PF+P  +P LGL
Sbjct  109  VPDAQLKEFEQIFNSTGPTFGPPVMDGPPQRVLSGVLRSFLASGQAGVPFQPVPVPALGL  168

Query  643  SQGEKQCIRDRSTIMARHFFADKNEDFINAQVNALLCSLDIDAD  774
            S+ +KQCIRDRS IMARH  AD+ E++I AQVN LL SLDID++
Sbjct  169  SESDKQCIRDRSCIMARHILADQPEEYIQAQVNTLLHSLDIDSN  212



>ref|XP_002963119.1| hypothetical protein SELMODRAFT_78782 [Selaginella moellendorffii]
 gb|EFJ36582.1| hypothetical protein SELMODRAFT_78782 [Selaginella moellendorffii]
Length=742

 Score =   166 bits (419),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 102/227 (45%), Positives = 128/227 (56%), Gaps = 24/227 (11%)
 Frame = +1

Query  160  MAMRDLVTGGAACAVPG---SSSSNPFGALANTLIGSSSKTQERLKEIPTSVSTPSDGNF  330
            MA+RDLVTG   C VPG   SSSSNP    A++L+GS  K QER++E+PT  +    G  
Sbjct  1    MALRDLVTGAGGCVVPGEGASSSSNPLANFASSLLGSLPKAQERVRELPTIPTFQGPGQQ  60

Query  331  GVGFQEPLATLPGSEIDHPFQPN-----------LQGSEFLEGFRTADQNSFADVW-DGI  474
                    A+LPG+E  +  Q             LQ SEF+ GFR A+   +AD W +  
Sbjct  61   LEYGSSSAASLPGTEFQNETQVENFQSGALLSFQLQHSEFMRGFRDAEPAPYADAWNEAT  120

Query  475  QRPQ---------LPHSNFPLDNSQLQPELNGPPQRVLSNFLHSFVNSSHGGIPFRPASL  627
            QR +           +   P  N Q    ++GPPQ  LS FL SF  SS   +PF    L
Sbjct  121  QRGEDLSRFSEFERIYGQKPGGNVQQLHYMDGPPQHALSGFLRSFFASSRTELPFHAVRL  180

Query  628  PVLGLSQGEKQCIRDRSTIMARHFFADKNEDFINAQVNALLCSLDID  768
            P LGLS  +KQ IRDRS+IMARHFFADK E+++NAQVNA L SLDI+
Sbjct  181  PELGLSGFDKQRIRDRSSIMARHFFADKGEEYVNAQVNAFLESLDIE  227



>gb|EMS62055.1| Peroxisome biogenesis protein 5 [Triticum urartu]
Length=962

 Score =   167 bits (423),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 102/222 (46%), Positives = 133/222 (60%), Gaps = 33/222 (15%)
 Frame = +1

Query  160  MAMRDLVTGGAACAVPGSSSSNPFGALANTLIGSSSKTQERLKEIP-TSVSTPSDGNFGV  336
            M  R L+TG   CA  G+SSSNPFGALANTL+G SSK  E LK +P  SV+ P+  ++  
Sbjct  1    MGTRHLITGQNNCAPDGASSSNPFGALANTLLGQSSKA-ESLKGLPGASVNVPTTSDYST  59

Query  337  GFQEPLATLPGSE--IDHPFQPNLQGSEFLEG---------FRTADQNSFADVWDGIQRP  483
                PL+T+PGSE       +P  +G++F+ G         FR    ++F          
Sbjct  60   A---PLSTVPGSENEFKQDQRPFARGADFMRGGPANDWVESFRPPGHSAFGG--------  108

Query  484  QLPHSNFP-----LDNS--QLQPELNGPPQRVLSNFLHSFVNSSHGGIPFRPASLPVLGL  642
              P +NF       +N+     P L+GPPQRVLS  LHSF++S   G+PF+P  +P LGL
Sbjct  109  --PETNFAEFEQIYNNAGPTFGPALDGPPQRVLSGVLHSFLSSGRAGVPFQPVPVPALGL  166

Query  643  SQGEKQCIRDRSTIMARHFFADKNEDFINAQVNALLCSLDID  768
            S+ +KQCIRDRS IMARH  AD+ E++I AQVN LL SLDID
Sbjct  167  SEADKQCIRDRSCIMARHILADQPEEYIQAQVNTLLHSLDID  208



>gb|EEC83824.1| hypothetical protein OsI_29764 [Oryza sativa Indica Group]
 gb|EEE68947.1| hypothetical protein OsJ_27829 [Oryza sativa Japonica Group]
Length=750

 Score =   165 bits (418),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 100/224 (45%), Positives = 135/224 (60%), Gaps = 31/224 (14%)
 Frame = +1

Query  160  MAMRDLVTGGAACAVPGSSSSNPFGALANTLIGSSSKTQERLKEIP-TSVSTPSDGNFGV  336
            MAMR L+TG   CA  G+SSSNPFG LAN + G SSK Q  +KE+P ++V+ P+    G 
Sbjct  1    MAMRHLITGQGNCAPDGASSSNPFGNLANAIFGQSSKAQS-IKELPGSAVNVPTTSELGT  59

Query  337  GFQEPLATLPGSE--IDHPFQPNLQGSEFLEGFRTADQNSFADVW-DGIQRPQLPHSNFP  507
                PL+T+PGSE        P  +G++F+ G  + D       W +  + P LP   F 
Sbjct  60   A--APLSTIPGSENEFKQDQLPLARGADFIRGGPSHD-------WVESFRPPGLPE--FA  108

Query  508  LDNSQLQ---------------PELNGPPQRVLSNFLHSFVNSSHGGIPFRPASLPVLGL  642
            + ++QL+               P ++GPPQRVLS  L SF+ S   G+PF+P  +P LGL
Sbjct  109  VPDAQLKEFEQIFNSTGPTFGPPVMDGPPQRVLSGVLRSFLASGQAGVPFQPVPVPALGL  168

Query  643  SQGEKQCIRDRSTIMARHFFADKNEDFINAQVNALLCSLDIDAD  774
            S+ +KQCIRDRS IMARH  AD+ E++I AQVN LL SLDID++
Sbjct  169  SESDKQCIRDRSCIMARHILADQPEEYIQAQVNTLLHSLDIDSN  212



>ref|NP_001062153.1| Os08g0500100 [Oryza sativa Japonica Group]
 dbj|BAD08812.1| putative peroxisomal targeting signal 1 receptor [Oryza sativa 
Japonica Group]
 dbj|BAF24067.1| Os08g0500100 [Oryza sativa Japonica Group]
 dbj|BAG89368.1| unnamed protein product [Oryza sativa Japonica Group]
Length=736

 Score =   165 bits (418),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 100/224 (45%), Positives = 135/224 (60%), Gaps = 31/224 (14%)
 Frame = +1

Query  160  MAMRDLVTGGAACAVPGSSSSNPFGALANTLIGSSSKTQERLKEIP-TSVSTPSDGNFGV  336
            MAMR L+TG   CA  G+SSSNPFG LAN + G SSK Q  +KE+P ++V+ P+    G 
Sbjct  1    MAMRHLITGQGNCAPDGASSSNPFGNLANAIFGQSSKAQS-IKELPGSAVNVPTTSELGT  59

Query  337  GFQEPLATLPGSE--IDHPFQPNLQGSEFLEGFRTADQNSFADVW-DGIQRPQLPHSNFP  507
                PL+T+PGSE        P  +G++F+ G  + D       W +  + P LP   F 
Sbjct  60   A--APLSTIPGSENEFKQDQLPLARGADFIRGGPSHD-------WVESFRPPGLPE--FA  108

Query  508  LDNSQLQ---------------PELNGPPQRVLSNFLHSFVNSSHGGIPFRPASLPVLGL  642
            + ++QL+               P ++GPPQRVLS  L SF+ S   G+PF+P  +P LGL
Sbjct  109  VPDAQLKEFEQIFNSTGPTFGPPVMDGPPQRVLSGVLRSFLASGQAGVPFQPVPVPALGL  168

Query  643  SQGEKQCIRDRSTIMARHFFADKNEDFINAQVNALLCSLDIDAD  774
            S+ +KQCIRDRS IMARH  AD+ E++I AQVN LL SLDID++
Sbjct  169  SESDKQCIRDRSCIMARHILADQPEEYIQAQVNTLLHSLDIDSN  212



>gb|AAX11256.1| peroxisomal targeting signal 1 receptor short form [Oryza sativa 
Japonica Group]
Length=679

 Score =   163 bits (412),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 100/224 (45%), Positives = 133/224 (59%), Gaps = 31/224 (14%)
 Frame = +1

Query  160  MAMRDLVTGGAACAVPGSSSSNPFGALANTLIGSSSKTQERLKEIP-TSVSTPSDGNFGV  336
            MAMR L+TG   CA  G+SSSNPFG LAN + G SSK Q  +KE+P ++V+ P+    G 
Sbjct  1    MAMRHLITGQGNCAPDGASSSNPFGNLANAIFGQSSKAQS-IKELPGSAVNVPTTSELGT  59

Query  337  GFQEPLATLPGSE--IDHPFQPNLQGSEFLEGFRTADQNSFADVW-DGIQRPQLPHSNFP  507
                PL+T+PGSE        P   G++F+ G  + D       W +  + P LP   F 
Sbjct  60   A--APLSTIPGSENEFKQDQLPLALGADFIRGGPSHD-------WVESFRPPGLPE--FA  108

Query  508  LDNSQLQ---------------PELNGPPQRVLSNFLHSFVNSSHGGIPFRPASLPVLGL  642
            + ++QL+               P ++GPPQRVLS  L SF+ S   G+PF+P  +P LGL
Sbjct  109  VPDAQLKEFEQIFNSTGPTFGPPVMDGPPQRVLSGVLRSFLASGQAGVPFQPVPVPALGL  168

Query  643  SQGEKQCIRDRSTIMARHFFADKNEDFINAQVNALLCSLDIDAD  774
            S+ +KQCIRDRS IMARH  AD+ E +I AQVN LL SLDID++
Sbjct  169  SESDKQCIRDRSCIMARHILADQPEKYIQAQVNTLLHSLDIDSN  212



>gb|AAX11255.1| peroxisomal targeting signal 1 receptor long form [Oryza sativa 
Japonica Group]
Length=736

 Score =   163 bits (412),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 100/224 (45%), Positives = 133/224 (59%), Gaps = 31/224 (14%)
 Frame = +1

Query  160  MAMRDLVTGGAACAVPGSSSSNPFGALANTLIGSSSKTQERLKEIP-TSVSTPSDGNFGV  336
            MAMR L+TG   CA  G+SSSNPFG LAN + G SSK Q  +KE+P ++V+ P+    G 
Sbjct  1    MAMRHLITGQGNCAPDGASSSNPFGNLANAIFGQSSKAQS-IKELPGSAVNVPTTSELGT  59

Query  337  GFQEPLATLPGSE--IDHPFQPNLQGSEFLEGFRTADQNSFADVW-DGIQRPQLPHSNFP  507
                PL+T+PGSE        P   G++F+ G  + D       W +  + P LP   F 
Sbjct  60   A--APLSTIPGSENEFKQDQLPLALGADFIRGGPSHD-------WVESFRPPGLPE--FA  108

Query  508  LDNSQLQ---------------PELNGPPQRVLSNFLHSFVNSSHGGIPFRPASLPVLGL  642
            + ++QL+               P ++GPPQRVLS  L SF+ S   G+PF+P  +P LGL
Sbjct  109  VPDAQLKEFEQIFNSTGPTFGPPVMDGPPQRVLSGVLRSFLASGQAGVPFQPVPVPALGL  168

Query  643  SQGEKQCIRDRSTIMARHFFADKNEDFINAQVNALLCSLDIDAD  774
            S+ +KQCIRDRS IMARH  AD+ E +I AQVN LL SLDID++
Sbjct  169  SESDKQCIRDRSCIMARHILADQPEKYIQAQVNTLLHSLDIDSN  212



>gb|AFW65172.1| hypothetical protein ZEAMMB73_964933 [Zea mays]
Length=720

 Score =   159 bits (402),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 103/214 (48%), Positives = 128/214 (60%), Gaps = 31/214 (14%)
 Frame = +1

Query  160  MAMRDLVTGGAACAVPGSSSSNPFGALANTLIGSSSKTQERLKEIPTSVSTPSDGNFGVG  339
            MA+R LVTG   CA  G+SSSNP  ALAN  +G SSK Q  +KE+P SVS PS   F   
Sbjct  1    MALRHLVTGQNNCAPDGASSSNPLNALANAFLGQSSKAQS-IKELPGSVSVPSTSGFSA-  58

Query  340  FQEPLATLPGSEIDHPFQPNLQGSEFLEGFRTADQNSFADVWDGIQRPQLP--HSNFPLD  513
               PL+ +PGSE           +EF +     DQ  F   +     P+L    ++FP D
Sbjct  59   -PAPLSNIPGSE-----------NEFKQ-----DQRPFVQSFRPPGVPELGGIEAHFP-D  100

Query  514  NSQL--------QPELNGPPQRVLSNFLHSFVNSSHGGIPFRPASLPV-LGLSQGEKQCI  666
              Q+        QP L+GPPQRVLS  LHSF+ S   G+PF+P  +P  LGLS+ +KQCI
Sbjct  101  FEQIYNNAGTTFQPPLDGPPQRVLSGVLHSFLTSGPAGVPFQPLPVPAALGLSESDKQCI  160

Query  667  RDRSTIMARHFFADKNEDFINAQVNALLCSLDID  768
            RDRS IMARH F+D+ E++I AQVN LL SLDID
Sbjct  161  RDRSCIMARHIFSDQPEEYIQAQVNTLLHSLDID  194



>ref|XP_002445936.1| hypothetical protein SORBIDRAFT_07g028340 [Sorghum bicolor]
 gb|EES15431.1| hypothetical protein SORBIDRAFT_07g028340 [Sorghum bicolor]
Length=734

 Score =   159 bits (402),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 99/214 (46%), Positives = 129/214 (60%), Gaps = 17/214 (8%)
 Frame = +1

Query  160  MAMRDLVTGGAACAVPGSSSSNPFGALANTLIGSSSKTQERLKEIPTSVSTPSDGNFGVG  339
            MA+R LVTG   C   G+SSSNP  ALAN  +G SSK Q  +KE+P SVS PS  +F   
Sbjct  1    MALRHLVTGQNNCTPDGASSSNPLNALANAFLGQSSKAQS-IKELPGSVSVPSTSDFST-  58

Query  340  FQEPLATLPGSE--IDHPFQPNLQGSEFLEGFRTADQNSFADVWDGIQRPQLPHSNFPLD  513
               P++ +PG+E       +P  +G++F+ G      N + + +     PQL       D
Sbjct  59   -PAPISNIPGAENEFKQDQRPLARGADFIRG---GPANDWIESFRPPGVPQLGVEAQFRD  114

Query  514  NSQL--------QPELNGPPQRVLSNFLHSFVNSSHGGIPFRPASLPV-LGLSQGEKQCI  666
              Q+        QP L+GPPQRVLS  LHSF+ S   G+PF+P  +P  LGLS+ +KQCI
Sbjct  115  FEQIYNNTGTTFQPPLDGPPQRVLSGVLHSFLTSGPAGVPFQPLPVPAALGLSESDKQCI  174

Query  667  RDRSTIMARHFFADKNEDFINAQVNALLCSLDID  768
            RDRS IMARH F+D+ E++I AQVN LL SLDID
Sbjct  175  RDRSCIMARHIFSDQPEEYIQAQVNTLLHSLDID  208



>gb|EMS46697.1| hypothetical protein TRIUR3_08788 [Triticum urartu]
Length=568

 Score =   157 bits (397),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 103/222 (46%), Positives = 131/222 (59%), Gaps = 31/222 (14%)
 Frame = +1

Query  160  MAMRDLVTGGAACAVPGSSSSNPFGALANTLIGSSSKTQERLKEIP-TSVSTPSDGNFGV  336
            M  R L+TG   CA  G+SSSNPFGALANTL+G S+K  E L+ +P  SV+ P+  ++  
Sbjct  1    MGTRHLITGQNNCAPDGASSSNPFGALANTLLGQSNKA-ESLRGLPGASVNVPTTSDYSG  59

Query  337  GFQEPLATLPGSEID-----HPFQPNLQGSEFLEGFRTADQNSFADVWDGIQRP------  483
                PL+TLPGSE +      PF   + G++F  G    D       W G  RP      
Sbjct  60   A---PLSTLPGSENEFKQDQRPF-AWVMGADFSRGGPAND-------WVGSFRPPGHSAF  108

Query  484  QLPHSNFP-----LDNS--QLQPELNGPPQRVLSNFLHSFVNSSHGGIPFRPASLPVLGL  642
              P +NF       +N+   L P L+GPPQRVLS  LHSF+ S   G+PF+   +P LGL
Sbjct  109  GGPEANFAEFEQIYNNAGPTLGPALDGPPQRVLSGVLHSFILSGRAGVPFQAVPVPALGL  168

Query  643  SQGEKQCIRDRSTIMARHFFADKNEDFINAQVNALLCSLDID  768
            S+ +KQCIRDRS IMA H  AD+ E++I AQVN LL SLDID
Sbjct  169  SEADKQCIRDRSFIMAHHILADQPEEYIQAQVNTLLHSLDID  210



>gb|EMT18446.1| Peroxisomal targeting signal 1 receptor [Aegilops tauschii]
Length=790

 Score =   150 bits (379),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 97/220 (44%), Positives = 128/220 (58%), Gaps = 28/220 (13%)
 Frame = +1

Query  160  MAMRDLVTGGAACAV-PGSSSSNPFGALANTLIGSSSKTQERLKEIP-TSVSTPSDGNFG  333
            M  R L+TG  +C     SSS+NP  A AN + G S K  E LK +P  SV+ P+  ++ 
Sbjct  1    MGTRHLITGNTSCPTDEASSSNNPLAAFANKVFGQSHKA-ESLKGLPGVSVNVPTTSDYS  59

Query  334  VGFQEPLATLPGSE--IDHPFQPNLQGSEFLEGFRTADQNSFADVWDGIQRP------QL  489
                 PL+T+PGSE       +P  +G++F+ G       S A+ W    RP        
Sbjct  60   T---TPLSTVPGSENEFKQDQRPFARGADFMRG-------SPANDWVESFRPPGHSAFGG  109

Query  490  PHSNFP-----LDNS--QLQPELNGPPQRVLSNFLHSFVNSSHGGIPFRPASLPVLGLSQ  648
            P +NF       +N+   L P L+GPPQRVLS  LHSF++S   G+PF+P  +P LGLS+
Sbjct  110  PGANFAEFEQIYNNAGPTLGPALDGPPQRVLSGVLHSFLSSGRAGVPFQPVPVPALGLSE  169

Query  649  GEKQCIRDRSTIMARHFFADKNEDFINAQVNALLCSLDID  768
             +KQCIRDRS IMARH  AD+ E++I AQVN LL SLDID
Sbjct  170  ADKQCIRDRSCIMARHILADQPEEYIQAQVNTLLHSLDID  209



>ref|XP_006857544.1| hypothetical protein AMTR_s00061p00043210 [Amborella trichopoda]
 gb|ERN19011.1| hypothetical protein AMTR_s00061p00043210 [Amborella trichopoda]
Length=729

 Score =   149 bits (375),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 87/184 (47%), Positives = 113/184 (61%), Gaps = 20/184 (11%)
 Frame = +1

Query  274  QERLKEIP-TSVSTPSDGNFGVGFQEPLATLPGSEIDHPF--QPNLQGSEFLEGFRTADQ  444
            ++RL E+P  +V  P   +  +   +PL++LPG E DH     P+ QGSEFL  F +   
Sbjct  14   RDRLNELPDVAVVGPHAPD--IRGHDPLSSLPG-EYDHEQIQYPDNQGSEFLRKFHSGGH  70

Query  445  NSFADVWDGIQRPQLPHSNFPLDNSQL--------------QPELNGPPQRVLSNFLHSF  582
              F   W+  Q+P +P +    DN  L                   GPPQ +LS FLH F
Sbjct  71   EGFEVAWNEAQQPHMPPNFQQRDNPSLFSTFDQIYDGVNAPVSRWEGPPQNILSGFLHQF  130

Query  583  VNSSHGGIPFRPASLPVLGLSQGEKQCIRDRSTIMARHFFADKNEDFINAQVNALLCSLD  762
            V+S+  GIPF PA+LPV+GLSQ +K CIRDRS+IMARHFFADK++D+INAQVNALL SL+
Sbjct  131  VHSNQAGIPFCPATLPVMGLSQRDKHCIRDRSSIMARHFFADKSDDYINAQVNALLHSLE  190

Query  763  IDAD  774
            ID D
Sbjct  191  IDND  194



>gb|AAC97489.1| peroxisomal targeting signal-1 receptor [Citrullus lanatus subsp. 
vulgaris]
Length=647

 Score =   143 bits (361),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 67/84 (80%), Positives = 75/84 (89%), Gaps = 0/84 (0%)
 Frame = +1

Query  517  SQLQPELNGPPQRVLSNFLHSFVNSSHGGIPFRPASLPVLGLSQGEKQCIRDRSTIMARH  696
            SQ QP L+GPPQRVLS FLHSFV SS GG+PF P  LP+LGLS+G+KQCIRDRS+IMARH
Sbjct  37   SQHQPILDGPPQRVLSTFLHSFVESSRGGVPFHPTPLPLLGLSEGDKQCIRDRSSIMARH  96

Query  697  FFADKNEDFINAQVNALLCSLDID  768
            FFADK+EDFINAQV+ALL SLDID
Sbjct  97   FFADKSEDFINAQVSALLSSLDID  120



>ref|NP_001237339.1| uncharacterized protein LOC100527272 [Glycine max]
 gb|ACU16330.1| unknown [Glycine max]
Length=160

 Score =   127 bits (320),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 84/163 (52%), Positives = 95/163 (58%), Gaps = 6/163 (4%)
 Frame = +1

Query  160  MAMRDLVTGGAACAVPGSSSSNPFGALANTLIGSSSKTQERLKEIPTSVST-PSDGNFGV  336
            MAMRDLV+G AAC    SSSSNP  +LAN LIGSSSKTQERLKEIPTS  T P+   +  
Sbjct  1    MAMRDLVSGAAACGDSSSSSSNPLASLANALIGSSSKTQERLKEIPTSTPTDPASQFYST  60

Query  337  GFQEPLATLPGSEIDHP-FQPNLQGSEFLEGFRTADQNSFADVWDGIQRPQLPHSNFPLD  513
                P   LPGSE D P    N Q SEFL  F  +      + WD IQR         L 
Sbjct  61   AL--PANQLPGSEFDKPLLNLNSQASEFLHRF--SGSTGLEETWDEIQRDGAAAQMRQLP  116

Query  514  NSQLQPELNGPPQRVLSNFLHSFVNSSHGGIPFRPASLPVLGL  642
                QP L+G PQRVLSN LHSF++SS GG+PF   S   +G 
Sbjct  117  PGIQQPPLDGTPQRVLSNILHSFLDSSRGGVPFSSCSTSDVGF  159



>ref|XP_008351197.1| PREDICTED: peroxisome biogenesis protein 5-like [Malus domestica]
Length=149

 Score =   119 bits (298),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 79/143 (55%), Positives = 87/143 (61%), Gaps = 10/143 (7%)
 Frame = +1

Query  160  MAMRDLVTGGAACAVPG-SSSSNPFGALANTLIGSSSKTQERLKEIPTSVSTPSDGNFGV  336
            MAMR+LVTGGAACAVPG SSSSNPFGALAN LIGSSSK QE LKEIP+S  T S+  F  
Sbjct  1    MAMRELVTGGAACAVPGQSSSSNPFGALANALIGSSSK-QEGLKEIPSSTPTASEPQFYP  59

Query  337  GFQEPLATLPGSEIDHPF-QPNLQGSEFLEGFRTADQNSFAD-VWDGIQRPQLPHSNFPL  510
                 L  LPGSE+D PF QP  Q SEF   F + D N   D  WD IQ   L   + P 
Sbjct  60   DGHGHLQQLPGSELDQPFMQPRTQSSEFFXNFNSVDGNRLLDNAWDEIQSSXLEPMHMPX  119

Query  511  DNS------QLQPELNGPPQRVL  561
             +       QLQP L+G    VL
Sbjct  120  HDRIYDMRPQLQPTLDGKFLEVL  142



>ref|XP_008343460.1| PREDICTED: peroxisome biogenesis protein 5-like, partial [Malus 
domestica]
Length=135

 Score =   116 bits (291),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 76/136 (56%), Positives = 84/136 (62%), Gaps = 10/136 (7%)
 Frame = +1

Query  160  MAMRDLVTGGAACAVPG-SSSSNPFGALANTLIGSSSKTQERLKEIPTSVSTPSDGNFGV  336
            MAMR+LVTGGAACAVPG SSSSNPFGALAN LIGSSSK QE LKEIP+S  T S+  F  
Sbjct  1    MAMRELVTGGAACAVPGQSSSSNPFGALANALIGSSSK-QEGLKEIPSSTPTASEPQFYP  59

Query  337  GFQEPLATLPGSEIDHPF-QPNLQGSEFLEGFRTADQNSFAD-VWDGIQRPQLPHSNFPL  510
                 L  LPGSE+D PF QP  Q SEF   F + D N   D  WD IQ   L   + P 
Sbjct  60   DGHGHLQQLPGSELDQPFMQPRTQSSEFFXNFNSVDGNRLLDNAWDEIQSSXLEPMHMPX  119

Query  511  DNS------QLQPELN  540
             +       QLQP L+
Sbjct  120  HDRIYDMRPQLQPTLD  135



>gb|EMT00979.1| Peroxisomal targeting signal 1 receptor [Aegilops tauschii]
Length=527

 Score =   119 bits (298),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 71/158 (45%), Positives = 93/158 (59%), Gaps = 28/158 (18%)
 Frame = +1

Query  349  PLATLPGSE--IDHPFQPNLQGSEFLEG---------FRTADQNSFADVWDGIQRPQLPH  495
            PL+TLPGSE       +P  +G++F+ G         FR    ++F            P 
Sbjct  5    PLSTLPGSENEFKQEQRPFARGADFIRGGPANDWVESFRPPGHSAFGG----------PE  54

Query  496  SNFP-----LDNS--QLQPELNGPPQRVLSNFLHSFVNSSHGGIPFRPASLPVLGLSQGE  654
            +NF       +N+   L P L+GPPQRVLS  LHSF++S   G+PF+P  +P LGLS+ +
Sbjct  55   ANFAEFEQIYNNAGPTLGPALDGPPQRVLSGVLHSFLSSGRAGVPFQPVPVPALGLSEAD  114

Query  655  KQCIRDRSTIMARHFFADKNEDFINAQVNALLCSLDID  768
            KQCIRDRS IMA H  AD+ E++I AQVN LL SLDID
Sbjct  115  KQCIRDRSFIMAHHILADQPEEYIQAQVNTLLHSLDID  152



>gb|AFW65171.1| hypothetical protein ZEAMMB73_964933, partial [Zea mays]
Length=90

 Score = 72.0 bits (175),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 45/91 (49%), Positives = 56/91 (62%), Gaps = 5/91 (5%)
 Frame = +1

Query  160  MAMRDLVTGGAACAVPGSSSSNPFGALANTLIGSSSKTQERLKEIPTSVSTPSDGNFGVG  339
            MA+R LVTG   CA  G+SSSNP  ALAN  +G SSK Q  +KE+P SVS PS   F   
Sbjct  1    MALRHLVTGQNNCAPDGASSSNPLNALANAFLGQSSKAQS-IKELPGSVSVPSTSGFSA-  58

Query  340  FQEPLATLPGS--EIDHPFQPNLQGSEFLEG  426
               PL+ +PGS  E     +P +QGS+F+ G
Sbjct  59   -PAPLSNIPGSENEFKQDQRPFVQGSDFIHG  88



>gb|KIZ06207.1| peroxin-5 [Monoraphidium neglectum]
Length=827

 Score = 71.6 bits (174),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 70/222 (32%), Positives = 103/222 (46%), Gaps = 23/222 (10%)
 Frame = +1

Query  160  MAMRDLVTGGAACAVPGSSS--SNPFGALANTLIGSSSKTQERLKEIPTSVS--------  309
            MA+R LVTG   C+  G  +  SN  GAL N L+G ++KTQE+L+++P   +        
Sbjct  1    MALRTLVTGSDMCSAGGDGAGPSNAVGALVNQLLGGAAKTQEQLRDLPVHHAPPQLHQVP  60

Query  310  -TPSDGNFGVGFQEPLATLPG----SEIDHPFQPNLQGSEFLEGFRTADQNSFADVWDGI  474
             TP               LPG    +         L G+  + G   AD +     ++ +
Sbjct  61   LTPEAAAMAAAAGSRAMVLPGLPQGAVGPGTLDALLGGAPRMAGPPGADVSGMVAEFEQM  120

Query  475  QRP--QLPHSNFPLDNSQLQPELNGPPQRVLSNFLHSFVNSS--HGGIPFRPASLPVLGL  642
            QR   Q+P    P  +    P L   P  V  N L +F +S+    G P   A L    L
Sbjct  121  QRAAGQVPFGPQPPGSG---PMLAAAPPAVAHN-LRAFFSSAGARTGAPQPLAPLAPGAL  176

Query  643  SQGEKQCIRDRSTIMARHFFADKNEDFINAQVNALLCSLDID  768
            S  ++  +RDRSTI+AR  F+++ + F +AQV  LL SL +D
Sbjct  177  SVADQCRVRDRSTILARQLFSEQGQGFADAQVARLLESLSVD  218



>ref|XP_008782941.1| PREDICTED: uncharacterized protein LOC103702335 [Phoenix dactylifera]
Length=125

 Score = 59.7 bits (143),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 41/64 (64%), Gaps = 0/64 (0%)
 Frame = +1

Query  547  PQRVLSNFLHSFVNSSHGGIPFRPASLPVLGLSQGEKQCIRDRSTIMARHFFADKNEDFI  726
            P+RVLS+ +H FV+S H  I F PA L +LG  + +K  IRD    M +H FA+K ++ +
Sbjct  29   PRRVLSSLIHFFVDSGHAVILFHPAKLQLLGFFESDKHGIRDCRCKMEQHIFAEKGDENV  88

Query  727  NAQV  738
            + Q+
Sbjct  89   DIQI  92



>ref|XP_005645163.1| TPR-like protein, partial [Coccomyxa subellipsoidea C-169]
 gb|EIE20619.1| TPR-like protein, partial [Coccomyxa subellipsoidea C-169]
Length=592

 Score = 57.0 bits (136),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 43/66 (65%), Gaps = 0/66 (0%)
 Frame = +1

Query  571  LHSFVNSSHGGIPFRPASLPVLGLSQGEKQCIRDRSTIMARHFFADKNEDFINAQVNALL  750
            + +F+ S+     F+P   P L L+Q ++  IRDRSTIMARH FAD+ + F + QV  LL
Sbjct  9    VQAFLASAKVQGIFQPLLSPPLQLTQLDQCRIRDRSTIMARHLFADRGDVFADEQVGRLL  68

Query  751  CSLDID  768
             SL+ID
Sbjct  69   HSLNID  74



>gb|KDO36345.1| hypothetical protein CISIN_1g026371mg [Citrus sinensis]
Length=239

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/30 (80%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = +1

Query  685  MARHFFADKNEDFINAQVNALLCSLDIDAD  774
            MARHFFAD++EDFINAQVN LL SL+ID+D
Sbjct  1    MARHFFADQSEDFINAQVNTLLSSLEIDSD  30



Lambda      K        H        a         alpha
   0.317    0.133    0.394    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1494411655520