BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF045H10

Length=775
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KHN42891.1|  Cyclin-H1-1                                             141   2e-37   Glycine soja [wild soybean]
emb|CDP15498.1|  unnamed protein product                                140   2e-35   Coffea canephora [robusta coffee]
ref|XP_010320161.1|  PREDICTED: cyclin-H1-1-like isoform X2             130   3e-32   Solanum lycopersicum
ref|XP_009620424.1|  PREDICTED: cyclin-H1-1 isoform X6                  130   3e-32   
ref|XP_009620422.1|  PREDICTED: cyclin-H1-1 isoform X4                  130   4e-32   Nicotiana tomentosiformis
ref|XP_004237891.1|  PREDICTED: cyclin-H1-1-like isoform X1             130   5e-32   Solanum lycopersicum
ref|XP_009620418.1|  PREDICTED: cyclin-H1-1 isoform X1                  130   6e-32   
ref|XP_010271136.1|  PREDICTED: cyclin-H1-1 isoform X2                  129   9e-32   Nelumbo nucifera [Indian lotus]
ref|XP_010271132.1|  PREDICTED: cyclin-H1-1 isoform X1                  129   1e-31   
ref|XP_010108984.1|  hypothetical protein L484_027180                   129   2e-31   
ref|XP_009799573.1|  PREDICTED: cyclin-H1-1 isoform X4                  127   4e-31   Nicotiana sylvestris
ref|XP_009760267.1|  PREDICTED: cyclin-H1-1-like isoform X2             124   4e-31   Nicotiana sylvestris
ref|XP_009799572.1|  PREDICTED: cyclin-H1-1 isoform X3                  127   4e-31   Nicotiana sylvestris
ref|XP_009799569.1|  PREDICTED: cyclin-H1-1 isoform X1                  127   6e-31   Nicotiana sylvestris
ref|XP_006354003.1|  PREDICTED: cyclin-H1-1-like isoform X1             127   7e-31   Solanum tuberosum [potatoes]
ref|XP_010918004.1|  PREDICTED: cyclin-H1-1 isoform X2                  126   2e-30   Elaeis guineensis
ref|XP_010917999.1|  PREDICTED: cyclin-H1-1 isoform X1                  126   2e-30   Elaeis guineensis
ref|XP_007030955.1|  Cyclin H,1 isoform 3                               125   3e-30   
ref|XP_007030954.1|  Cyclin H,1 isoform 2                               125   4e-30   
ref|XP_007030953.1|  Cyclin-H1-1 isoform 1                              125   1e-29   
gb|EYU42757.1|  hypothetical protein MIMGU_mgv1a009980mg                124   2e-29   Erythranthe guttata [common monkey flower]
ref|XP_002284178.1|  PREDICTED: cyclin-H1-1                             124   2e-29   Vitis vinifera
ref|XP_011076677.1|  PREDICTED: cyclin-H1-1                             123   2e-29   Sesamum indicum [beniseed]
ref|XP_008246397.1|  PREDICTED: cyclin-H1-1                             123   3e-29   Prunus mume [ume]
ref|XP_009376695.1|  PREDICTED: LOW QUALITY PROTEIN: cyclin-H1-1        122   4e-29   
ref|XP_007205500.1|  hypothetical protein PRUPE_ppa008262mg             122   5e-29   
ref|XP_008359865.1|  PREDICTED: cyclin-H1-1-like                        122   5e-29   Malus domestica [apple tree]
ref|XP_006344638.1|  PREDICTED: cyclin-H1-1-like isoform X2             122   7e-29   Solanum tuberosum [potatoes]
gb|KJB45248.1|  hypothetical protein B456_007G298500                    120   8e-29   Gossypium raimondii
gb|KHN20228.1|  Cyclin-H1-1                                             118   1e-28   Glycine soja [wild soybean]
gb|KDP23501.1|  hypothetical protein JCGZ_23334                         121   1e-28   Jatropha curcas
gb|KJB45252.1|  hypothetical protein B456_007G298500                    120   1e-28   Gossypium raimondii
gb|KJB45249.1|  hypothetical protein B456_007G298500                    119   3e-28   Gossypium raimondii
gb|KJB45251.1|  hypothetical protein B456_007G298500                    120   3e-28   Gossypium raimondii
gb|KJB45246.1|  hypothetical protein B456_007G298500                    120   3e-28   Gossypium raimondii
gb|KJB45247.1|  hypothetical protein B456_007G298500                    120   3e-28   Gossypium raimondii
gb|KHN09714.1|  Cyclin-H1-1                                             120   4e-28   Glycine soja [wild soybean]
gb|KHG11498.1|  Cyclin-H1-1 -like protein                               120   5e-28   Gossypium arboreum [tree cotton]
ref|XP_003526926.1|  PREDICTED: cyclin-H1-1 isoformX1                   119   1e-27   Glycine max [soybeans]
ref|XP_008811991.1|  PREDICTED: cyclin-H1-1 isoform X2                  118   2e-27   Phoenix dactylifera
ref|XP_009620420.1|  PREDICTED: cyclin-H1-1 isoform X2                  117   2e-27   Nicotiana tomentosiformis
ref|XP_008811990.1|  PREDICTED: cyclin-H1-1 isoform X1                  118   2e-27   Phoenix dactylifera
gb|EPS69696.1|  hypothetical protein M569_05066                         117   2e-27   Genlisea aurea
ref|XP_006433378.1|  hypothetical protein CICLE_v10001764mg             117   3e-27   Citrus clementina [clementine]
ref|XP_002512403.1|  cyclin h, putative                                 117   3e-27   
gb|ACU23520.1|  unknown                                                 117   4e-27   Glycine max [soybeans]
ref|XP_009799571.1|  PREDICTED: cyclin-H1-1 isoform X2                  116   5e-27   Nicotiana sylvestris
gb|KJB45250.1|  hypothetical protein B456_007G298500                    117   6e-27   Gossypium raimondii
ref|XP_009620423.1|  PREDICTED: cyclin-H1-1 isoform X5                  115   6e-27   Nicotiana tomentosiformis
ref|XP_003550146.1|  PREDICTED: cyclin-H1-1-like isoformX1              116   7e-27   Glycine max [soybeans]
ref|XP_009760266.1|  PREDICTED: cyclin-H1-1-like isoform X1             114   7e-27   Nicotiana sylvestris
ref|XP_004141934.1|  PREDICTED: cyclin-H1-1-like                        116   8e-27   Cucumis sativus [cucumbers]
ref|XP_004230215.1|  PREDICTED: cyclin-H1-1                             116   8e-27   Solanum lycopersicum
ref|XP_008440228.1|  PREDICTED: cyclin-H1-1 isoform X3                  115   9e-27   
ref|XP_006394954.1|  hypothetical protein EUTSA_v10004554mg             116   9e-27   Eutrema salsugineum [saltwater cress]
ref|XP_009620421.1|  PREDICTED: cyclin-H1-1 isoform X3                  115   1e-26   Nicotiana tomentosiformis
ref|XP_008440227.1|  PREDICTED: cyclin-H1-1 isoform X2                  115   1e-26   Cucumis melo [Oriental melon]
ref|XP_009111750.1|  PREDICTED: cyclin-H1-1-like                        115   2e-26   Brassica rapa
ref|XP_008440225.1|  PREDICTED: cyclin-H1-1 isoform X1                  115   3e-26   Cucumis melo [Oriental melon]
ref|XP_009418143.1|  PREDICTED: cyclin-H1-1 isoform X3                  110   4e-26   
ref|XP_010455108.1|  PREDICTED: cyclin-H1-1-like                        114   6e-26   Camelina sativa [gold-of-pleasure]
ref|NP_198114.2|  cyclin H;1                                            114   8e-26   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002874361.1|  CYCH_1                                             114   8e-26   Arabidopsis lyrata subsp. lyrata
emb|CDY19728.1|  BnaA09g03810D                                          113   9e-26   Brassica napus [oilseed rape]
ref|XP_010546708.1|  PREDICTED: cyclin-H1-1-like isoform X1             113   1e-25   Tarenaya hassleriana [spider flower]
ref|XP_010546709.1|  PREDICTED: cyclin-H1-1-like isoform X2             113   1e-25   Tarenaya hassleriana [spider flower]
ref|XP_009418142.1|  PREDICTED: cyclin-H1-1 isoform X2                  112   1e-25   
ref|XP_010674708.1|  PREDICTED: cyclin-H1-1 isoform X2                  113   1e-25   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010674706.1|  PREDICTED: cyclin-H1-1 isoform X1                  113   1e-25   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010674709.1|  PREDICTED: cyclin-H1-1 isoform X3                  113   1e-25   Beta vulgaris subsp. vulgaris [field beet]
emb|CDX99977.1|  BnaC09g03240D                                          112   2e-25   
gb|KJB45253.1|  hypothetical protein B456_007G298500                    112   2e-25   Gossypium raimondii
ref|XP_006344637.1|  PREDICTED: cyclin-H1-1-like isoform X1             112   2e-25   Solanum tuberosum [potatoes]
ref|XP_010421593.1|  PREDICTED: cyclin-H1-1-like                        112   2e-25   Camelina sativa [gold-of-pleasure]
ref|XP_009151194.1|  PREDICTED: cyclin-H1-1-like                        112   2e-25   Brassica rapa
ref|XP_006288154.1|  hypothetical protein CARUB_v10001393mg             112   2e-25   
gb|AFK42904.1|  unknown                                                 109   3e-25   Lotus japonicus
ref|XP_006581842.1|  PREDICTED: cyclin-H1-1 isoform X2                  112   3e-25   Glycine max [soybeans]
gb|AAD02871.1|  CAK associated cyclinH homolog                          111   5e-25   Populus tremula x Populus tremuloides
ref|XP_009418139.1|  PREDICTED: cyclin-H1-1 isoform X1                  111   5e-25   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006433379.1|  hypothetical protein CICLE_v10001764mg             111   7e-25   Citrus clementina [clementine]
ref|XP_010674710.1|  PREDICTED: cyclin-H1-1 isoform X4                  110   7e-25   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006382505.1|  hypothetical protein POPTR_0005s02780g             110   7e-25   
emb|CDY05569.1|  BnaA02g31220D                                          110   1e-24   
gb|ABK96417.1|  unknown                                                 110   1e-24   Populus trichocarpa x Populus deltoides
gb|KDO56276.1|  hypothetical protein CISIN_1g038028mg                   110   1e-24   Citrus sinensis [apfelsine]
ref|XP_011036827.1|  PREDICTED: cyclin-H1-1 isoform X1                  110   1e-24   Populus euphratica
ref|XP_011036828.1|  PREDICTED: cyclin-H1-1 isoform X2                  110   2e-24   Populus euphratica
ref|XP_010043075.1|  PREDICTED: cyclin-H1-1-like isoform X2             109   3e-24   Eucalyptus grandis [rose gum]
ref|XP_010043073.1|  PREDICTED: cyclin-H1-1-like isoform X1             109   3e-24   Eucalyptus grandis [rose gum]
ref|XP_006842697.1|  hypothetical protein AMTR_s00147p00079450          108   6e-24   
ref|XP_010042910.1|  PREDICTED: cyclin-H1-1-like isoform X2             107   8e-24   Eucalyptus grandis [rose gum]
ref|XP_010042901.1|  PREDICTED: cyclin-H1-1-like isoform X1             107   8e-24   Eucalyptus grandis [rose gum]
ref|XP_004302415.1|  PREDICTED: cyclin-H1-1                             107   9e-24   Fragaria vesca subsp. vesca
emb|CDX86148.1|  BnaA06g28650D                                          107   1e-23   
ref|XP_006606942.1|  PREDICTED: cyclin-H1-1-like                        103   1e-23   
ref|XP_009129870.1|  PREDICTED: cyclin-H1-1                             107   2e-23   Brassica rapa
emb|CDY25030.1|  BnaC02g39780D                                          110   2e-23   Brassica napus [oilseed rape]
ref|XP_007144723.1|  hypothetical protein PHAVU_007G1793000g            103   2e-22   Phaseolus vulgaris [French bean]
ref|XP_009760268.1|  PREDICTED: cyclin-H1-1-like isoform X3           99.0    2e-21   Nicotiana sylvestris
ref|XP_004981844.1|  PREDICTED: cyclin-H1-1-like isoform X1             100   2e-21   Setaria italica
ref|XP_010546710.1|  PREDICTED: cyclin-H1-1-like isoform X3           99.4    8e-21   Tarenaya hassleriana [spider flower]
gb|KCW58355.1|  hypothetical protein EUGRSUZ_H01039                   97.1    8e-21   Eucalyptus grandis [rose gum]
gb|KJB45254.1|  hypothetical protein B456_007G298500                  97.8    1e-20   Gossypium raimondii
gb|AAS13366.1|  cyclin H                                              95.5    2e-20   Glycine max [soybeans]
gb|ACF88227.1|  unknown                                               95.5    2e-20   Zea mays [maize]
gb|AES61374.2|  cyclin H, putative                                    97.8    3e-20   Medicago truncatula
ref|XP_010069853.1|  PREDICTED: uncharacterized protein LOC104456...  97.4    3e-20   
ref|XP_010550979.1|  PREDICTED: cyclin-H1-1-like                      96.7    7e-20   Tarenaya hassleriana [spider flower]
ref|XP_003591123.1|  Cyclin-H1-1                                      98.2    8e-20   
ref|XP_004507893.1|  PREDICTED: cyclin-H1-1-like                      96.7    8e-20   
ref|NP_001149855.1|  LOC100283483                                     96.3    9e-20   Zea mays [maize]
gb|ACN31885.1|  unknown                                               96.3    9e-20   Zea mays [maize]
ref|XP_006651796.1|  PREDICTED: cyclin-H1-1-like                      95.9    1e-19   Oryza brachyantha
ref|XP_004496023.1|  PREDICTED: cyclin-H1-1-like                      97.8    1e-19   
emb|CDI66532.1|  Cyclin-H1-1                                          95.5    2e-19   Saccharum hybrid cultivar R570
emb|CDI66493.1|  Cyclin-H1-1                                          95.5    2e-19   Saccharum hybrid cultivar R570
emb|CDI66557.1|  Cyclin-H1-1                                          95.5    2e-19   Saccharum hybrid cultivar R570
emb|CDI66513.1|  Cyclin-H1-1                                          95.5    2e-19   Saccharum hybrid cultivar R570
gb|KCW60766.1|  hypothetical protein EUGRSUZ_H03488                   92.8    3e-19   Eucalyptus grandis [rose gum]
ref|XP_002466497.1|  hypothetical protein SORBIDRAFT_01g008760        94.4    4e-19   
gb|AAR07076.1|  cyclin H-1                                            93.2    1e-18   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001051203.1|  Os03g0737600                                     93.2    1e-18   
emb|CDI66519.1|  Cyclin-H1-1                                          92.0    3e-18   Saccharum hybrid cultivar R570
ref|XP_010026956.1|  PREDICTED: uncharacterized protein LOC104417359  92.0    3e-18   
gb|AAP03415.1|  cyclin H-1                                            87.4    1e-16   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003560004.1|  PREDICTED: cyclin-H1-1 isoform X2                87.0    1e-16   
ref|XP_010230296.1|  PREDICTED: cyclin-H1-1 isoform X1                86.7    2e-16   
ref|XP_007219466.1|  hypothetical protein PRUPE_ppa021360mg           82.8    4e-16   
emb|CBB36490.1|  Oryza sativa protein similar to cyclin H-1 AAP03415  84.7    5e-16   Saccharum hybrid cultivar R570
emb|CBB36468.1|  Oryza sativa protein similar to cyclin H-1 AAP03415  84.3    6e-16   Saccharum hybrid cultivar R570
emb|CDI66546.1|  Cyclin-H1-1                                          84.3    7e-16   Saccharum hybrid cultivar R570
ref|XP_002984036.1|  hypothetical protein SELMODRAFT_445744           84.3    1e-15   Selaginella moellendorffii
ref|XP_010024316.1|  PREDICTED: uncharacterized protein LOC104414...  85.1    1e-15   
ref|XP_010024315.1|  PREDICTED: uncharacterized protein LOC104414...  84.7    3e-15   
ref|XP_010024314.1|  PREDICTED: uncharacterized protein LOC104414...  84.3    4e-15   
ref|XP_008235971.1|  PREDICTED: cyclin-H1-1-like                      80.9    9e-15   Prunus mume [ume]
ref|XP_001779669.1|  predicted protein                                80.5    2e-14   
gb|EMT30492.1|  hypothetical protein F775_06942                       79.3    4e-14   
ref|XP_002960101.1|  hypothetical protein SELMODRAFT_163567           79.0    5e-14   
gb|AAU93531.1|  cyclin H-1                                            78.6    2e-13   Zea mays [maize]
ref|XP_001762420.1|  predicted protein                                74.3    1e-12   
emb|CDX80636.1|  BnaC07g28080D                                        72.0    3e-11   
ref|XP_003078137.1|  Cyclin H (IC)                                    66.2    2e-09   Ostreococcus tauri
ref|XP_009605486.1|  PREDICTED: cyclin-H1-1-like isoform X1           64.7    3e-09   
gb|KCW59459.1|  hypothetical protein EUGRSUZ_H02201                   57.4    2e-07   Eucalyptus grandis [rose gum]
ref|XP_009605487.1|  PREDICTED: cyclin-H1-1-like isoform X2           57.8    7e-07   
ref|XP_001416639.1|  predicted protein                                53.5    5e-05   Ostreococcus lucimarinus CCE9901
ref|XP_005651240.1|  cyclin-like protein                              51.6    3e-04   Coccomyxa subellipsoidea C-169
ref|XP_001692753.1|  predicted protein                                49.3    4e-04   Chlamydomonas reinhardtii
ref|XP_006266776.1|  PREDICTED: cyclin-H                              50.4    8e-04   



>gb|KHN42891.1| Cyclin-H1-1 [Glycine soja]
Length=187

 Score =   141 bits (356),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 77/173 (45%), Positives = 100/173 (58%), Gaps = 29/173 (17%)
 Frame = +2

Query  248  MADFTTSTHRAKWIFSPQDLKEKFKAVNQRAKQALEKYGTTRMEVDVDGSFSYVEPPAGA  427
            MADF TSTHRAKWIFSPQ L  +F  +          Y   R                  
Sbjct  1    MADFQTSTHRAKWIFSPQQLSLEFDLI---------VYAPYR------------------  33

Query  428  KETVEGFVNDIEEFRGAEGEQLDTLKKLLESAKIEADRTMLTDATLLFPPGQLALTALRR  607
              +VEGF+ND+EEF  A  +QL+ LK L E+A+ E D+ MLTDA LLFPPGQLAL AL  
Sbjct  34   --SVEGFINDVEEFCNAGDDQLEMLKTLQETARFEVDKMMLTDAPLLFPPGQLALAALSN  91

Query  608  ANEKLRVFEFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVK  766
            +N   RV +F+ YL  I + +   H++S+LS  L  I+S + K +SPS K++K
Sbjct  92   SNALHRVIDFDSYLRGIFSHENSMHTMSELSESLNAIDSWVRKYKSPSEKELK  144



>emb|CDP15498.1| unnamed protein product [Coffea canephora]
Length=328

 Score =   140 bits (352),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 66/111 (59%), Positives = 86/111 (77%), Gaps = 0/111 (0%)
 Frame = +2

Query  434  TVEGFVNDIEEFRGAEGEQLDTLKKLLESAKIEADRTMLTDATLLFPPGQLALTALRRAN  613
             ++GF+ND+EEF GA+ EQL  L  L ESAK+E D+ M TDA LLFPPGQLAL ALRR+N
Sbjct  182  ALDGFLNDVEEFCGAKEEQLAMLGSLHESAKVEVDKIMRTDAPLLFPPGQLALAALRRSN  241

Query  614  EKLRVFEFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVK  766
            E   +F+FERYL+ +L+RQ PT S SDL+  L  ++S +NKLE+P++KDVK
Sbjct  242  EACGIFDFERYLKSVLSRQHPTLSNSDLAVFLNAVDSSVNKLETPTSKDVK  292


 Score =   111 bits (278),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 49/63 (78%), Positives = 56/63 (89%), Gaps = 0/63 (0%)
 Frame = +2

Query  248  MADFTTSTHRAKWIFSPQDLKEKFKAVNQRAKQALEKYGTTRMEVDVDGSFSYVEPPAGA  427
            MADF TSTHRAKWIF+PQDLKEK+KA NQRAKQALEKYG+TR++V++DGSFSY E P  A
Sbjct  1    MADFMTSTHRAKWIFTPQDLKEKYKAANQRAKQALEKYGSTRVDVNIDGSFSYAEHPNDA  60

Query  428  KET  436
            KE 
Sbjct  61   KEN  63



>ref|XP_010320161.1| PREDICTED: cyclin-H1-1-like isoform X2 [Solanum lycopersicum]
Length=285

 Score =   130 bits (327),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 64/112 (57%), Positives = 86/112 (77%), Gaps = 1/112 (1%)
 Frame = +2

Query  434  TVEGFVNDIEEFRGAEGE-QLDTLKKLLESAKIEADRTMLTDATLLFPPGQLALTALRRA  610
             +EGF++D+EEF GA+ E QL  LK  L++A+IEAD+ M +D  LLFPPGQLALTAL RA
Sbjct  138  ALEGFISDLEEFCGAKDEDQLVALKGSLDTARIEADKIMRSDGPLLFPPGQLALTALHRA  197

Query  611  NEKLRVFEFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVK  766
            N    +F+FERYL  +L+R QP H+IS+L+G +  I+SLI KL +P++KDVK
Sbjct  198  NAVHSIFDFERYLRSVLSRYQPAHAISELTGSIDAIDSLIGKLLTPTSKDVK  249



>ref|XP_009620424.1| PREDICTED: cyclin-H1-1 isoform X6 [Nicotiana tomentosiformis]
Length=267

 Score =   130 bits (326),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 68/113 (60%), Positives = 90/113 (80%), Gaps = 2/113 (2%)
 Frame = +2

Query  434  TVEGFVNDIEEFRGA-EGEQLDTLKKLLESAKIEADRTMLTDATLLFPPGQLALTALRRA  610
             +EGFV+D+EEFRGA + +Q +TLK++LE+A++EAD+ M T+A LLFPPGQLAL ALRRA
Sbjct  119  ALEGFVSDMEEFRGANDDDQHETLKRMLEAARMEADKIMRTEAPLLFPPGQLALAALRRA  178

Query  611  NEKLRVFEFERYLERILARQQPTHSISDLSGLLKPIESLINKLES-PSAKDVK  766
            N    + +FERYL  IL+RQQ T +IS+LS  L  I+SLI KLE+ P++KDVK
Sbjct  179  NVVHDILDFERYLRSILSRQQSTQAISELSVSLNTIDSLICKLEAPPTSKDVK  231



>ref|XP_009620422.1| PREDICTED: cyclin-H1-1 isoform X4 [Nicotiana tomentosiformis]
Length=286

 Score =   130 bits (326),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 68/113 (60%), Positives = 90/113 (80%), Gaps = 2/113 (2%)
 Frame = +2

Query  434  TVEGFVNDIEEFRGA-EGEQLDTLKKLLESAKIEADRTMLTDATLLFPPGQLALTALRRA  610
             +EGFV+D+EEFRGA + +Q +TLK++LE+A++EAD+ M T+A LLFPPGQLAL ALRRA
Sbjct  138  ALEGFVSDMEEFRGANDDDQHETLKRMLEAARMEADKIMRTEAPLLFPPGQLALAALRRA  197

Query  611  NEKLRVFEFERYLERILARQQPTHSISDLSGLLKPIESLINKLES-PSAKDVK  766
            N    + +FERYL  IL+RQQ T +IS+LS  L  I+SLI KLE+ P++KDVK
Sbjct  198  NVVHDILDFERYLRSILSRQQSTQAISELSVSLNTIDSLICKLEAPPTSKDVK  250



>ref|XP_004237891.1| PREDICTED: cyclin-H1-1-like isoform X1 [Solanum lycopersicum]
 ref|XP_010320159.1| PREDICTED: cyclin-H1-1-like isoform X1 [Solanum lycopersicum]
 ref|XP_010320160.1| PREDICTED: cyclin-H1-1-like isoform X1 [Solanum lycopersicum]
Length=327

 Score =   130 bits (328),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 64/111 (58%), Positives = 86/111 (77%), Gaps = 1/111 (1%)
 Frame = +2

Query  437  VEGFVNDIEEFRGAEGE-QLDTLKKLLESAKIEADRTMLTDATLLFPPGQLALTALRRAN  613
            +EGF++D+EEF GA+ E QL  LK  L++A+IEAD+ M +D  LLFPPGQLALTAL RAN
Sbjct  181  LEGFISDLEEFCGAKDEDQLVALKGSLDTARIEADKIMRSDGPLLFPPGQLALTALHRAN  240

Query  614  EKLRVFEFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVK  766
                +F+FERYL  +L+R QP H+IS+L+G +  I+SLI KL +P++KDVK
Sbjct  241  AVHSIFDFERYLRSVLSRYQPAHAISELTGSIDAIDSLIGKLLTPTSKDVK  291


 Score =   107 bits (267),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 47/65 (72%), Positives = 52/65 (80%), Gaps = 0/65 (0%)
 Frame = +2

Query  248  MADFTTSTHRAKWIFSPQDLKEKFKAVNQRAKQALEKYGTTRMEVDVDGSFSYVEPPAGA  427
            MADF TSTHR KWIF+PQD+K K+K  N RAKQALEKYGTTRMEVD+DGSFSY E    A
Sbjct  1    MADFVTSTHRTKWIFTPQDIKHKYKVANHRAKQALEKYGTTRMEVDIDGSFSYAESQNDA  60

Query  428  KETVE  442
            K+  E
Sbjct  61   KDNAE  65



>ref|XP_009620418.1| PREDICTED: cyclin-H1-1 isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009620419.1| PREDICTED: cyclin-H1-1 isoform X1 [Nicotiana tomentosiformis]
Length=328

 Score =   130 bits (327),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 68/112 (61%), Positives = 90/112 (80%), Gaps = 2/112 (2%)
 Frame = +2

Query  437  VEGFVNDIEEFRGA-EGEQLDTLKKLLESAKIEADRTMLTDATLLFPPGQLALTALRRAN  613
            +EGFV+D+EEFRGA + +Q +TLK++LE+A++EAD+ M T+A LLFPPGQLAL ALRRAN
Sbjct  181  LEGFVSDMEEFRGANDDDQHETLKRMLEAARMEADKIMRTEAPLLFPPGQLALAALRRAN  240

Query  614  EKLRVFEFERYLERILARQQPTHSISDLSGLLKPIESLINKLES-PSAKDVK  766
                + +FERYL  IL+RQQ T +IS+LS  L  I+SLI KLE+ P++KDVK
Sbjct  241  VVHDILDFERYLRSILSRQQSTQAISELSVSLNTIDSLICKLEAPPTSKDVK  292


 Score =   115 bits (289),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 50/65 (77%), Positives = 59/65 (91%), Gaps = 0/65 (0%)
 Frame = +2

Query  248  MADFTTSTHRAKWIFSPQDLKEKFKAVNQRAKQALEKYGTTRMEVDVDGSFSYVEPPAGA  427
            MADFTTSTHRAKWIF+PQ+L++K+KA NQRAKQALEKYG TRMEVD+DGSFSY EP + A
Sbjct  1    MADFTTSTHRAKWIFTPQELRDKYKAANQRAKQALEKYGATRMEVDIDGSFSYAEPQSDA  60

Query  428  KETVE  442
            K++ E
Sbjct  61   KDSAE  65



>ref|XP_010271136.1| PREDICTED: cyclin-H1-1 isoform X2 [Nelumbo nucifera]
Length=304

 Score =   129 bits (325),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 62/111 (56%), Positives = 83/111 (75%), Gaps = 0/111 (0%)
 Frame = +2

Query  434  TVEGFVNDIEEFRGAEGEQLDTLKKLLESAKIEADRTMLTDATLLFPPGQLALTALRRAN  613
            ++EGF++D+EEF  A+  QL  LK L E++K+E D+TMLTDA LLFPPGQLAL ALRR+N
Sbjct  149  SIEGFIDDMEEFCQAKNGQLQMLKDLRETSKLEVDKTMLTDAPLLFPPGQLALAALRRSN  208

Query  614  EKLRVFEFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVK  766
            E  RV +FERYLE I++RQ   HSI +L+  L  I+S + KL  P+ KD++
Sbjct  209  EVHRVLDFERYLENIISRQHSAHSILELTESLDDIDSWVRKLNIPTTKDMR  259



>ref|XP_010271132.1| PREDICTED: cyclin-H1-1 isoform X1 [Nelumbo nucifera]
 ref|XP_010271133.1| PREDICTED: cyclin-H1-1 isoform X1 [Nelumbo nucifera]
 ref|XP_010271134.1| PREDICTED: cyclin-H1-1 isoform X1 [Nelumbo nucifera]
Length=337

 Score =   129 bits (325),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 62/111 (56%), Positives = 83/111 (75%), Gaps = 0/111 (0%)
 Frame = +2

Query  434  TVEGFVNDIEEFRGAEGEQLDTLKKLLESAKIEADRTMLTDATLLFPPGQLALTALRRAN  613
            ++EGF++D+EEF  A+  QL  LK L E++K+E D+TMLTDA LLFPPGQLAL ALRR+N
Sbjct  182  SIEGFIDDMEEFCQAKNGQLQMLKDLRETSKLEVDKTMLTDAPLLFPPGQLALAALRRSN  241

Query  614  EKLRVFEFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVK  766
            E  RV +FERYLE I++RQ   HSI +L+  L  I+S + KL  P+ KD++
Sbjct  242  EVHRVLDFERYLENIISRQHSAHSILELTESLDDIDSWVRKLNIPTTKDMR  292


 Score = 94.0 bits (232),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 49/65 (75%), Gaps = 0/65 (0%)
 Frame = +2

Query  248  MADFTTSTHRAKWIFSPQDLKEKFKAVNQRAKQALEKYGTTRMEVDVDGSFSYVEPPAGA  427
            MADF TSTHRAKWIF+P DL EK++A NQRA + LE++G TR+EVDVDGS SY EP    
Sbjct  1    MADFQTSTHRAKWIFTPHDLMEKYQATNQRAIKTLEQFGATRIEVDVDGSLSYPEPQLDG  60

Query  428  KETVE  442
            K   E
Sbjct  61   KNHAE  65



>ref|XP_010108984.1| hypothetical protein L484_027180 [Morus notabilis]
 gb|EXC20624.1| hypothetical protein L484_027180 [Morus notabilis]
Length=332

 Score =   129 bits (324),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 61/111 (55%), Positives = 83/111 (75%), Gaps = 0/111 (0%)
 Frame = +2

Query  434  TVEGFVNDIEEFRGAEGEQLDTLKKLLESAKIEADRTMLTDATLLFPPGQLALTALRRAN  613
            +VEGF++D+EEF G++ +QL  LK L E+A++E D+ MLTDA LLFPPGQLAL ALR +N
Sbjct  179  SVEGFIDDMEEFCGSKDDQLQALKNLHETARMEVDKIMLTDAPLLFPPGQLALAALRSSN  238

Query  614  EKLRVFEFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVK  766
            E  RV +FERYL+RIL RQ   H++S+L   L  I+S + + + PS KD+K
Sbjct  239  EVHRVIDFERYLKRILTRQNSAHTMSELIESLNAIDSWVKRYKFPSEKDLK  289


 Score = 92.8 bits (229),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 49/65 (75%), Gaps = 0/65 (0%)
 Frame = +2

Query  248  MADFTTSTHRAKWIFSPQDLKEKFKAVNQRAKQALEKYGTTRMEVDVDGSFSYVEPPAGA  427
            MADF TSTHRAKWIF+PQ+L +K+KA  QRA Q LEKYG T MEVD DG+ SY E  A A
Sbjct  1    MADFQTSTHRAKWIFTPQELVDKYKAAQQRAIQTLEKYGATLMEVDADGTLSYPELQANA  60

Query  428  KETVE  442
            KE  +
Sbjct  61   KENAD  65



>ref|XP_009799573.1| PREDICTED: cyclin-H1-1 isoform X4 [Nicotiana sylvestris]
Length=267

 Score =   127 bits (318),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 66/112 (59%), Positives = 89/112 (79%), Gaps = 2/112 (2%)
 Frame = +2

Query  437  VEGFVNDIEEFRGA-EGEQLDTLKKLLESAKIEADRTMLTDATLLFPPGQLALTALRRAN  613
            +EGFV+D+EEFRGA + +Q + LK++LE+A++EAD+ M T+A LLFPPGQLAL ALRRAN
Sbjct  120  LEGFVSDMEEFRGANDDDQYEMLKRMLEAARMEADKIMRTEAPLLFPPGQLALAALRRAN  179

Query  614  EKLRVFEFERYLERILARQQPTHSISDLSGLLKPIESLINKLES-PSAKDVK  766
                + +FERYL  IL+RQQ T +IS+L+  L  I+SLI KLE+ P++KDVK
Sbjct  180  VVHGILDFERYLRSILSRQQSTQTISELTVSLNTIDSLICKLEAPPTSKDVK  231



>ref|XP_009760267.1| PREDICTED: cyclin-H1-1-like isoform X2 [Nicotiana sylvestris]
Length=183

 Score =   124 bits (312),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 58/113 (51%), Positives = 84/113 (74%), Gaps = 1/113 (1%)
 Frame = +2

Query  431  ETVEGFVNDIEEFRGA-EGEQLDTLKKLLESAKIEADRTMLTDATLLFPPGQLALTALRR  607
             T++GF++D+EEF GA + +Q+  LK  LE+A++EAD+ M T+  LLFPPGQLAL AL R
Sbjct  65   HTLDGFISDLEEFCGAKDDDQIVALKASLETARMEADKIMRTNGPLLFPPGQLALAALHR  124

Query  608  ANEKLRVFEFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVK  766
            AN +  +F+FERYL  +L+R  P H+IS+L+  +  I+SLI KL +P++KDV 
Sbjct  125  ANTEHGIFDFERYLRSVLSRHHPAHTISELTASINAIDSLIGKLVTPTSKDVN  177



>ref|XP_009799572.1| PREDICTED: cyclin-H1-1 isoform X3 [Nicotiana sylvestris]
Length=286

 Score =   127 bits (319),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 66/113 (58%), Positives = 89/113 (79%), Gaps = 2/113 (2%)
 Frame = +2

Query  434  TVEGFVNDIEEFRGA-EGEQLDTLKKLLESAKIEADRTMLTDATLLFPPGQLALTALRRA  610
             +EGFV+D+EEFRGA + +Q + LK++LE+A++EAD+ M T+A LLFPPGQLAL ALRRA
Sbjct  138  ALEGFVSDMEEFRGANDDDQYEMLKRMLEAARMEADKIMRTEAPLLFPPGQLALAALRRA  197

Query  611  NEKLRVFEFERYLERILARQQPTHSISDLSGLLKPIESLINKLES-PSAKDVK  766
            N    + +FERYL  IL+RQQ T +IS+L+  L  I+SLI KLE+ P++KDVK
Sbjct  198  NVVHGILDFERYLRSILSRQQSTQTISELTVSLNTIDSLICKLEAPPTSKDVK  250



>ref|XP_009799569.1| PREDICTED: cyclin-H1-1 isoform X1 [Nicotiana sylvestris]
 ref|XP_009799570.1| PREDICTED: cyclin-H1-1 isoform X1 [Nicotiana sylvestris]
Length=328

 Score =   127 bits (320),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 66/112 (59%), Positives = 89/112 (79%), Gaps = 2/112 (2%)
 Frame = +2

Query  437  VEGFVNDIEEFRGA-EGEQLDTLKKLLESAKIEADRTMLTDATLLFPPGQLALTALRRAN  613
            +EGFV+D+EEFRGA + +Q + LK++LE+A++EAD+ M T+A LLFPPGQLAL ALRRAN
Sbjct  181  LEGFVSDMEEFRGANDDDQYEMLKRMLEAARMEADKIMRTEAPLLFPPGQLALAALRRAN  240

Query  614  EKLRVFEFERYLERILARQQPTHSISDLSGLLKPIESLINKLES-PSAKDVK  766
                + +FERYL  IL+RQQ T +IS+L+  L  I+SLI KLE+ P++KDVK
Sbjct  241  VVHGILDFERYLRSILSRQQSTQTISELTVSLNTIDSLICKLEAPPTSKDVK  292


 Score =   116 bits (291),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 51/65 (78%), Positives = 59/65 (91%), Gaps = 0/65 (0%)
 Frame = +2

Query  248  MADFTTSTHRAKWIFSPQDLKEKFKAVNQRAKQALEKYGTTRMEVDVDGSFSYVEPPAGA  427
            MADFTTSTHRAKWIF+PQ+LK+K+KA NQRAKQALEKYG TRMEVD+DGSFSY EP + A
Sbjct  1    MADFTTSTHRAKWIFTPQELKDKYKAANQRAKQALEKYGATRMEVDIDGSFSYAEPQSDA  60

Query  428  KETVE  442
            K++ E
Sbjct  61   KDSAE  65



>ref|XP_006354003.1| PREDICTED: cyclin-H1-1-like isoform X1 [Solanum tuberosum]
 ref|XP_006354004.1| PREDICTED: cyclin-H1-1-like isoform X2 [Solanum tuberosum]
 ref|XP_006354005.1| PREDICTED: cyclin-H1-1-like isoform X3 [Solanum tuberosum]
 ref|XP_006354006.1| PREDICTED: cyclin-H1-1-like isoform X4 [Solanum tuberosum]
Length=327

 Score =   127 bits (319),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 61/111 (55%), Positives = 85/111 (77%), Gaps = 1/111 (1%)
 Frame = +2

Query  437  VEGFVNDIEEFRGAEGE-QLDTLKKLLESAKIEADRTMLTDATLLFPPGQLALTALRRAN  613
            +EGF++D+EEF GA+ E QL  LK  L++A+IEAD+ M +D  LLFPPGQLALTAL RAN
Sbjct  181  LEGFISDLEEFCGAKDEDQLVALKGSLDTARIEADKIMRSDGPLLFPPGQLALTALHRAN  240

Query  614  EKLRVFEFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVK  766
                +F+FERYL  +L+  +P H+IS+L+G +  I+SL+ KL +P++KDVK
Sbjct  241  AAHSIFDFERYLRSVLSHYEPAHAISELAGSINAIDSLVGKLLTPTSKDVK  291


 Score =   107 bits (268),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 47/65 (72%), Positives = 53/65 (82%), Gaps = 0/65 (0%)
 Frame = +2

Query  248  MADFTTSTHRAKWIFSPQDLKEKFKAVNQRAKQALEKYGTTRMEVDVDGSFSYVEPPAGA  427
            MADF TSTHR KWIF+PQD+K K+K  N RAKQALEKYGTTRMEVD+DGSFSY E    A
Sbjct  1    MADFVTSTHRTKWIFTPQDIKHKYKVANHRAKQALEKYGTTRMEVDIDGSFSYAESQNDA  60

Query  428  KETVE  442
            K++ E
Sbjct  61   KDSAE  65



>ref|XP_010918004.1| PREDICTED: cyclin-H1-1 isoform X2 [Elaeis guineensis]
Length=341

 Score =   126 bits (317),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 60/111 (54%), Positives = 83/111 (75%), Gaps = 0/111 (0%)
 Frame = +2

Query  434  TVEGFVNDIEEFRGAEGEQLDTLKKLLESAKIEADRTMLTDATLLFPPGQLALTALRRAN  613
            ++EGFV D+EEF  A  E+ +  + L E+AK+E D+ MLTDA LL+PPGQLAL ALRR+N
Sbjct  181  SIEGFVEDMEEFGQARNEEQEKFQDLRETAKLEVDKIMLTDAPLLYPPGQLALAALRRSN  240

Query  614  EKLRVFEFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVK  766
            E  RV +FERYLE I +RQ+ +HSIS L+  +K I+ ++ KL+ PS KD++
Sbjct  241  EAHRVLDFERYLESIFSRQRSSHSISQLNESMKTIDFMLGKLKIPSTKDMR  291


 Score = 92.0 bits (227),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 49/65 (75%), Gaps = 0/65 (0%)
 Frame = +2

Query  248  MADFTTSTHRAKWIFSPQDLKEKFKAVNQRAKQALEKYGTTRMEVDVDGSFSYVEPPAGA  427
            MADF TSTHRAKWIF PQ+L EK +A NQRA + LE+YG TR+EVDVDGS SY EP    
Sbjct  1    MADFQTSTHRAKWIFIPQELLEKHEAANQRAIKMLEQYGITRLEVDVDGSLSYPEPVLDQ  60

Query  428  KETVE  442
            K+  E
Sbjct  61   KDNAE  65



>ref|XP_010917999.1| PREDICTED: cyclin-H1-1 isoform X1 [Elaeis guineensis]
 ref|XP_010918000.1| PREDICTED: cyclin-H1-1 isoform X1 [Elaeis guineensis]
 ref|XP_010918001.1| PREDICTED: cyclin-H1-1 isoform X1 [Elaeis guineensis]
 ref|XP_010918002.1| PREDICTED: cyclin-H1-1 isoform X1 [Elaeis guineensis]
Length=351

 Score =   126 bits (317),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 60/111 (54%), Positives = 83/111 (75%), Gaps = 0/111 (0%)
 Frame = +2

Query  434  TVEGFVNDIEEFRGAEGEQLDTLKKLLESAKIEADRTMLTDATLLFPPGQLALTALRRAN  613
            ++EGFV D+EEF  A  E+ +  + L E+AK+E D+ MLTDA LL+PPGQLAL ALRR+N
Sbjct  191  SIEGFVEDMEEFGQARNEEQEKFQDLRETAKLEVDKIMLTDAPLLYPPGQLALAALRRSN  250

Query  614  EKLRVFEFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVK  766
            E  RV +FERYLE I +RQ+ +HSIS L+  +K I+ ++ KL+ PS KD++
Sbjct  251  EAHRVLDFERYLESIFSRQRSSHSISQLNESMKTIDFMLGKLKIPSTKDMR  301


 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 43/75 (57%), Positives = 49/75 (65%), Gaps = 10/75 (13%)
 Frame = +2

Query  248  MADFTTSTHRAKWIFSPQDLKEKFKAVNQRAKQALE----------KYGTTRMEVDVDGS  397
            MADF TSTHRAKWIF PQ+L EK +A NQRA + LE          +YG TR+EVDVDGS
Sbjct  1    MADFQTSTHRAKWIFIPQELLEKHEAANQRAIKMLEQRAVGCHCLFQYGITRLEVDVDGS  60

Query  398  FSYVEPPAGAKETVE  442
             SY EP    K+  E
Sbjct  61   LSYPEPVLDQKDNAE  75



>ref|XP_007030955.1| Cyclin H,1 isoform 3 [Theobroma cacao]
 gb|EOY11457.1| Cyclin H,1 isoform 3 [Theobroma cacao]
Length=332

 Score =   125 bits (315),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 63/111 (57%), Positives = 78/111 (70%), Gaps = 0/111 (0%)
 Frame = +2

Query  434  TVEGFVNDIEEFRGAEGEQLDTLKKLLESAKIEADRTMLTDATLLFPPGQLALTALRRAN  613
            +VEGFVND+EEF GA+ EQ   LK L E+A+IE D+ MLTDA  LFPPGQLAL ALR AN
Sbjct  180  SVEGFVNDMEEFCGAKDEQNQILKDLQETARIEVDKIMLTDAPHLFPPGQLALAALRSAN  239

Query  614  EKLRVFEFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVK  766
            E  +V +FERYL  IL RQ   H+IS L   L  I++ + K + P+ KD+K
Sbjct  240  EMHKVLDFERYLRSILTRQNSEHTISQLIESLNAIDTWVRKYKFPTEKDMK  290


 Score = 96.3 bits (238),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 44/58 (76%), Positives = 48/58 (83%), Gaps = 0/58 (0%)
 Frame = +2

Query  248  MADFTTSTHRAKWIFSPQDLKEKFKAVNQRAKQALEKYGTTRMEVDVDGSFSYVEPPA  421
            MADF TSTHRAKWIF+PQ L EK++A NQRA Q LEKYGTT+MEVD DGS SY EP A
Sbjct  1    MADFQTSTHRAKWIFTPQGLVEKYRAANQRAIQTLEKYGTTQMEVDADGSLSYPEPIA  58



>ref|XP_007030954.1| Cyclin H,1 isoform 2 [Theobroma cacao]
 gb|EOY11456.1| Cyclin H,1 isoform 2 [Theobroma cacao]
Length=331

 Score =   125 bits (314),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 63/111 (57%), Positives = 78/111 (70%), Gaps = 0/111 (0%)
 Frame = +2

Query  434  TVEGFVNDIEEFRGAEGEQLDTLKKLLESAKIEADRTMLTDATLLFPPGQLALTALRRAN  613
            +VEGFVND+EEF GA+ EQ   LK L E+A+IE D+ MLTDA  LFPPGQLAL ALR AN
Sbjct  180  SVEGFVNDMEEFCGAKDEQNQILKDLQETARIEVDKIMLTDAPHLFPPGQLALAALRSAN  239

Query  614  EKLRVFEFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVK  766
            E  +V +FERYL  IL RQ   H+IS L   L  I++ + K + P+ KD+K
Sbjct  240  EMHKVLDFERYLRSILTRQNSEHTISQLIESLNAIDTWVRKYKFPTEKDMK  290


 Score = 96.3 bits (238),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 44/58 (76%), Positives = 48/58 (83%), Gaps = 0/58 (0%)
 Frame = +2

Query  248  MADFTTSTHRAKWIFSPQDLKEKFKAVNQRAKQALEKYGTTRMEVDVDGSFSYVEPPA  421
            MADF TSTHRAKWIF+PQ L EK++A NQRA Q LEKYGTT+MEVD DGS SY EP A
Sbjct  1    MADFQTSTHRAKWIFTPQGLVEKYRAANQRAIQTLEKYGTTQMEVDADGSLSYPEPIA  58



>ref|XP_007030953.1| Cyclin-H1-1 isoform 1 [Theobroma cacao]
 gb|EOY11455.1| Cyclin-H1-1 isoform 1 [Theobroma cacao]
Length=426

 Score =   125 bits (314),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 63/111 (57%), Positives = 78/111 (70%), Gaps = 0/111 (0%)
 Frame = +2

Query  434  TVEGFVNDIEEFRGAEGEQLDTLKKLLESAKIEADRTMLTDATLLFPPGQLALTALRRAN  613
            +VEGFVND+EEF GA+ EQ   LK L E+A+IE D+ MLTDA  LFPPGQLAL ALR AN
Sbjct  180  SVEGFVNDMEEFCGAKDEQNQILKDLQETARIEVDKIMLTDAPHLFPPGQLALAALRSAN  239

Query  614  EKLRVFEFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVK  766
            E  +V +FERYL  IL RQ   H+IS L   L  I++ + K + P+ KD+K
Sbjct  240  EMHKVLDFERYLRSILTRQNSEHTISQLIESLNAIDTWVRKYKFPTEKDMK  290


 Score = 95.9 bits (237),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/58 (76%), Positives = 48/58 (83%), Gaps = 0/58 (0%)
 Frame = +2

Query  248  MADFTTSTHRAKWIFSPQDLKEKFKAVNQRAKQALEKYGTTRMEVDVDGSFSYVEPPA  421
            MADF TSTHRAKWIF+PQ L EK++A NQRA Q LEKYGTT+MEVD DGS SY EP A
Sbjct  1    MADFQTSTHRAKWIFTPQGLVEKYRAANQRAIQTLEKYGTTQMEVDADGSLSYPEPIA  58



>gb|EYU42757.1| hypothetical protein MIMGU_mgv1a009980mg [Erythranthe guttata]
 gb|EYU42758.1| hypothetical protein MIMGU_mgv1a009980mg [Erythranthe guttata]
Length=325

 Score =   124 bits (310),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 61/111 (55%), Positives = 83/111 (75%), Gaps = 1/111 (1%)
 Frame = +2

Query  437  VEGFVNDIEEFRGAE-GEQLDTLKKLLESAKIEADRTMLTDATLLFPPGQLALTALRRAN  613
            ++GF+ D+EE  GA+   Q + +K L ESAK+E D+ MLT+A LLFPPGQLAL ALRR+ 
Sbjct  183  LQGFIGDMEEIYGAKMAGQTEIIKNLHESAKLEVDKIMLTEAPLLFPPGQLALAALRRSC  242

Query  614  EKLRVFEFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVK  766
            E  +V +FERY++ +L+RQ P H +SDL   L  I+ LINKLE+P++KDVK
Sbjct  243  EVHKVNDFERYIKSMLSRQHPAHGLSDLHLPLNAIDILINKLETPTSKDVK  293


 Score =   105 bits (261),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 46/65 (71%), Positives = 52/65 (80%), Gaps = 0/65 (0%)
 Frame = +2

Query  248  MADFTTSTHRAKWIFSPQDLKEKFKAVNQRAKQALEKYGTTRMEVDVDGSFSYVEPPAGA  427
            MADFTTSTHR+KWIF+P DLKEK+K  N+RAKQALE YG TRMEVD+DGSF Y EP    
Sbjct  1    MADFTTSTHRSKWIFTPHDLKEKYKDANKRAKQALEMYGATRMEVDIDGSFIYAEPQNDV  60

Query  428  KETVE  442
            K+  E
Sbjct  61   KDNAE  65



>ref|XP_002284178.1| PREDICTED: cyclin-H1-1 [Vitis vinifera]
 emb|CBI39478.3| unnamed protein product [Vitis vinifera]
Length=335

 Score =   124 bits (310),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 60/111 (54%), Positives = 84/111 (76%), Gaps = 0/111 (0%)
 Frame = +2

Query  434  TVEGFVNDIEEFRGAEGEQLDTLKKLLESAKIEADRTMLTDATLLFPPGQLALTALRRAN  613
            +VEGFV+D+EEF  A+ ++L  LK L ++AK+E D+TMLTDA LLFPPGQLAL ALRR+N
Sbjct  182  SVEGFVDDMEEFCQAKNDRLQMLKDLHKTAKMEVDKTMLTDAPLLFPPGQLALAALRRSN  241

Query  614  EKLRVFEFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVK  766
            E  +V +FERYL  IL+RQ  +H+ S+L+  L  I+S + K + P+ +D+K
Sbjct  242  EVHQVLDFERYLSSILSRQDFSHAFSELTESLNAIDSWVMKHQVPTTEDMK  292


 Score =   102 bits (255),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 46/65 (71%), Positives = 51/65 (78%), Gaps = 0/65 (0%)
 Frame = +2

Query  248  MADFTTSTHRAKWIFSPQDLKEKFKAVNQRAKQALEKYGTTRMEVDVDGSFSYVEPPAGA  427
            MADF TSTHR+KWIF+PQDL EK+KA NQRAKQ LEKYG TR+EVD DGS  Y EP   A
Sbjct  1    MADFQTSTHRSKWIFTPQDLIEKYKAANQRAKQTLEKYGVTRIEVDADGSLQYPEPQISA  60

Query  428  KETVE  442
            K+  E
Sbjct  61   KDNAE  65



>ref|XP_011076677.1| PREDICTED: cyclin-H1-1 [Sesamum indicum]
 ref|XP_011076678.1| PREDICTED: cyclin-H1-1 [Sesamum indicum]
Length=328

 Score =   123 bits (309),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 61/110 (55%), Positives = 82/110 (75%), Gaps = 0/110 (0%)
 Frame = +2

Query  437  VEGFVNDIEEFRGAEGEQLDTLKKLLESAKIEADRTMLTDATLLFPPGQLALTALRRANE  616
            +EGFV+D+EE   A+  Q +T+K L ESAK E D+ M TDA LL+PPGQLAL ALRRA E
Sbjct  183  LEGFVSDLEESYDAKLGQSETIKSLHESAKAEVDKIMRTDAPLLYPPGQLALAALRRACE  242

Query  617  KLRVFEFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVK  766
              ++ +FERYL+ + +RQ P H+ S+L+  L  I+ LINKLE+P++KDVK
Sbjct  243  VHKLIDFERYLQNMFSRQHPAHATSELNLALNVIDMLINKLETPTSKDVK  292


 Score =   112 bits (279),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 49/65 (75%), Positives = 55/65 (85%), Gaps = 0/65 (0%)
 Frame = +2

Query  248  MADFTTSTHRAKWIFSPQDLKEKFKAVNQRAKQALEKYGTTRMEVDVDGSFSYVEPPAGA  427
            MADFTTSTHRA WIF+PQDLKEK+K  N+RAKQALEKYG TRMEVD+DGSFSY EP   A
Sbjct  1    MADFTTSTHRANWIFTPQDLKEKYKDANKRAKQALEKYGATRMEVDIDGSFSYAEPQNDA  60

Query  428  KETVE  442
            K+  +
Sbjct  61   KDNAD  65



>ref|XP_008246397.1| PREDICTED: cyclin-H1-1 [Prunus mume]
Length=337

 Score =   123 bits (309),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 59/111 (53%), Positives = 79/111 (71%), Gaps = 0/111 (0%)
 Frame = +2

Query  434  TVEGFVNDIEEFRGAEGEQLDTLKKLLESAKIEADRTMLTDATLLFPPGQLALTALRRAN  613
            ++EGF++D+EEF G   +QL  L+ LL +AK+E D+ MLTDA LLFPPGQLAL ALR AN
Sbjct  182  SIEGFIDDMEEFCGINDDQLQILQNLLHAAKMEVDKIMLTDAPLLFPPGQLALAALRGAN  241

Query  614  EKLRVFEFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVK  766
            +  +V +FERYL  IL+RQ   H++S+L   L  I+S   K + PS KD+K
Sbjct  242  QVHKVVDFERYLRSILSRQSSEHTVSELIEFLNAIDSWARKYKFPSDKDLK  292


 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/65 (68%), Positives = 50/65 (77%), Gaps = 0/65 (0%)
 Frame = +2

Query  248  MADFTTSTHRAKWIFSPQDLKEKFKAVNQRAKQALEKYGTTRMEVDVDGSFSYVEPPAGA  427
            MADF TSTHRAKWIF+P+DL  K+KA NQRA Q LEKYG T MEVDVDG+ SY EP   A
Sbjct  1    MADFQTSTHRAKWIFTPEDLVGKYKAANQRAIQTLEKYGATLMEVDVDGTISYPEPQVIA  60

Query  428  KETVE  442
            K+  +
Sbjct  61   KDNAD  65



>ref|XP_009376695.1| PREDICTED: LOW QUALITY PROTEIN: cyclin-H1-1, partial [Pyrus x 
bretschneideri]
Length=313

 Score =   122 bits (306),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 60/111 (54%), Positives = 77/111 (69%), Gaps = 0/111 (0%)
 Frame = +2

Query  434  TVEGFVNDIEEFRGAEGEQLDTLKKLLESAKIEADRTMLTDATLLFPPGQLALTALRRAN  613
            ++EGFV D+EEF G E  QL  LK ++ +AK E D+ MLTDA LLFPPGQLAL ALR AN
Sbjct  169  SIEGFVYDMEEFCGLEDNQLQYLKVIVGAAKTEVDKIMLTDAPLLFPPGQLALAALRSAN  228

Query  614  EKLRVFEFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVK  766
            +  RV +FER+L  IL+RQ   H+IS+L   L  I+S   + + PS KD+K
Sbjct  229  QVCRVADFERFLSSILSRQSSAHTISELVEFLNAIDSWAKRYKFPSDKDIK  279


 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/53 (60%), Positives = 39/53 (74%), Gaps = 0/53 (0%)
 Frame = +2

Query  269  THRAKWIFSPQDLKEKFKAVNQRAKQALEKYGTTRMEVDVDGSFSYVEPPAGA  427
            THRA+WIF+P +L  K+KA NQ A Q LEKYG T MEV+VDG+ SY +P   A
Sbjct  1    THRARWIFTPGELAGKYKAANQGAMQTLEKYGATLMEVNVDGTLSYPKPQVNA  53



>ref|XP_007205500.1| hypothetical protein PRUPE_ppa008262mg [Prunus persica]
 gb|EMJ06699.1| hypothetical protein PRUPE_ppa008262mg [Prunus persica]
Length=339

 Score =   122 bits (307),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 58/111 (52%), Positives = 79/111 (71%), Gaps = 0/111 (0%)
 Frame = +2

Query  434  TVEGFVNDIEEFRGAEGEQLDTLKKLLESAKIEADRTMLTDATLLFPPGQLALTALRRAN  613
            ++EGF++D+EEF G   ++L  L+ LL +AK+E D+ MLTDA LLFPPGQLAL ALR AN
Sbjct  179  SIEGFIDDMEEFCGINDDRLQILQNLLHAAKMEVDKIMLTDAPLLFPPGQLALAALRSAN  238

Query  614  EKLRVFEFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVK  766
            +  +V +FERYL  IL+RQ   H++S+L   L  I+S   K + PS KD+K
Sbjct  239  QVHKVVDFERYLRSILSRQSSEHTVSELVEFLNAIDSWARKYKFPSDKDLK  289


 Score = 93.6 bits (231),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 50/65 (77%), Gaps = 0/65 (0%)
 Frame = +2

Query  248  MADFTTSTHRAKWIFSPQDLKEKFKAVNQRAKQALEKYGTTRMEVDVDGSFSYVEPPAGA  427
            MADF TSTHRAKWIF+P++L  K+KA NQRA Q LEKYG T MEVDVDG+ SY EP   A
Sbjct  1    MADFQTSTHRAKWIFTPEELVGKYKAANQRAIQTLEKYGATLMEVDVDGTISYPEPQVIA  60

Query  428  KETVE  442
            K+  +
Sbjct  61   KDNAD  65



>ref|XP_008359865.1| PREDICTED: cyclin-H1-1-like [Malus domestica]
Length=328

 Score =   122 bits (307),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 62/111 (56%), Positives = 77/111 (69%), Gaps = 3/111 (3%)
 Frame = +2

Query  434  TVEGFVNDIEEFRGAEGEQLDTLKKLLESAKIEADRTMLTDATLLFPPGQLALTALRRAN  613
            ++EGFVND+EEF G E  QL  LK   ++AK+E D+ MLTDA LLFPPGQLAL ALR AN
Sbjct  176  SIEGFVNDMEEFCGLEDNQLQHLK---DAAKMEVDKIMLTDAPLLFPPGQLALAALRSAN  232

Query  614  EKLRVFEFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVK  766
               RV +FERYL  IL+RQ   H+IS+L   L  I+S   + + PS KD+K
Sbjct  233  HVCRVADFERYLSSILSRQSSAHTISELVEFLNAIDSWAKRYKFPSDKDLK  283


 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 52/129 (40%), Positives = 69/129 (53%), Gaps = 8/129 (6%)
 Frame = +2

Query  248  MADFTTSTHRAKWIFSPQDLKEKFKAVNQRAKQALEKYGTTRMEVDVDGSFSYVEPPAGA  427
            MADF +STHRA+WIF+P++L  K+KA NQRA Q LEKYG T MEVDVDG+ SY +P   A
Sbjct  1    MADFQSSTHRARWIFTPEELVGKYKAANQRAVQTLEKYGATLMEVDVDGTLSYPKPQVNA  60

Query  428  KETVEGFVNDIEEFRGAEGE--------QLDTLKKLLESAKIEADRTMLTDATLLFPPGQ  583
                +    + E+F     E              K+  +A I   R  L  + +L  P  
Sbjct  61   DSRPKPINIEEEQFMRVFYENKLQEVCTNFHFPHKVQATALIYFKRFYLHWSVMLHHPKN  120

Query  584  LALTALRRA  610
            + LT +  A
Sbjct  121  IMLTCIYAA  129



>ref|XP_006344638.1| PREDICTED: cyclin-H1-1-like isoform X2 [Solanum tuberosum]
Length=328

 Score =   122 bits (305),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 61/112 (54%), Positives = 84/112 (75%), Gaps = 2/112 (2%)
 Frame = +2

Query  437  VEGFVNDIEEFRGAEGE-QLDTLKKLLESAKIEADRTMLTDATLLFPPGQLALTALRRAN  613
            +EGF++D+EEF GA+ + QL  LK  L++A+IEAD+ M +D  LLFPPGQLAL AL RAN
Sbjct  181  LEGFISDLEEFCGAQDDDQLVALKGALDTARIEADKIMRSDGPLLFPPGQLALAALHRAN  240

Query  614  EKLRVFEFERYLERILARQ-QPTHSISDLSGLLKPIESLINKLESPSAKDVK  766
                +F+FERYL  +L+   QP H+IS+L+G +  I+SLI KL +P++KDVK
Sbjct  241  AAHGIFDFERYLRSVLSHHDQPGHAISELTGSINAIDSLIGKLLTPTSKDVK  292


 Score =   100 bits (250),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 52/65 (80%), Gaps = 0/65 (0%)
 Frame = +2

Query  248  MADFTTSTHRAKWIFSPQDLKEKFKAVNQRAKQALEKYGTTRMEVDVDGSFSYVEPPAGA  427
            MADF TSTH+ KWI++PQD+K K+K  NQRAKQALE +GTTRMEVD+DG+FSY E    A
Sbjct  1    MADFMTSTHKTKWIYTPQDIKHKYKVANQRAKQALEMFGTTRMEVDIDGTFSYAESQNDA  60

Query  428  KETVE  442
            K+  E
Sbjct  61   KDNAE  65



>gb|KJB45248.1| hypothetical protein B456_007G298500 [Gossypium raimondii]
Length=243

 Score =   120 bits (300),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 60/111 (54%), Positives = 77/111 (69%), Gaps = 0/111 (0%)
 Frame = +2

Query  434  TVEGFVNDIEEFRGAEGEQLDTLKKLLESAKIEADRTMLTDATLLFPPGQLALTALRRAN  613
            +VEGFVND+EEF G + ++   LK L E+A++E D+ MLTDA  LFPPGQLAL ALR AN
Sbjct  92   SVEGFVNDMEEFCGVKDDENQMLKDLQETARLEVDKIMLTDAPHLFPPGQLALAALRNAN  151

Query  614  EKLRVFEFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVK  766
            E  RV +FE YL RILARQ   H+I  L   L  I++ + K + P+ KD+K
Sbjct  152  EMHRVLDFEGYLRRILARQNSKHTILQLIESLDAIDAWVRKFKFPTEKDMK  202



>gb|KHN20228.1| Cyclin-H1-1 [Glycine soja]
Length=174

 Score =   118 bits (295),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 58/111 (52%), Positives = 78/111 (70%), Gaps = 0/111 (0%)
 Frame = +2

Query  434  TVEGFVNDIEEFRGAEGEQLDTLKKLLESAKIEADRTMLTDATLLFPPGQLALTALRRAN  613
            +VEGF+ND+EEF  A   QL+ LK L E+A+ E D+ MLTDA LLFPPGQLAL ALR +N
Sbjct  21   SVEGFINDMEEFFNAGDNQLEMLKTLQETARFEVDKMMLTDAPLLFPPGQLALAALRNSN  80

Query  614  EKLRVFEFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVK  766
               RV +F+ YL  I +R+   H++S+LS  L  I+S + K +SPS K++K
Sbjct  81   ALHRVIDFDSYLRGIFSRENSMHTMSELSESLDAIDSWVRKYKSPSEKELK  131



>gb|KDP23501.1| hypothetical protein JCGZ_23334 [Jatropha curcas]
Length=350

 Score =   121 bits (304),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 61/111 (55%), Positives = 76/111 (68%), Gaps = 0/111 (0%)
 Frame = +2

Query  434  TVEGFVNDIEEFRGAEGEQLDTLKKLLESAKIEADRTMLTDATLLFPPGQLALTALRRAN  613
            +VEGF+ND+EEF  A  +Q+  LK+L  SA  E D+ M TDA LLFPPGQLAL ALR AN
Sbjct  197  SVEGFINDMEEFCHATDDQIQMLKELQSSAVAEVDKIMFTDAPLLFPPGQLALAALRSAN  256

Query  614  EKLRVFEFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVK  766
            E  +V +FERYL  ILARQ   H++SDL   L  I S + K + P+ KD+K
Sbjct  257  EMHQVLDFERYLGDILARQNSIHTMSDLFESLDAINSWVKKYKFPTEKDMK  307


 Score =   103 bits (257),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 60/118 (51%), Positives = 68/118 (58%), Gaps = 16/118 (14%)
 Frame = +2

Query  248  MADFTTSTHRAKWIFSPQDLKEKFKAVNQRAKQALEKYGTTRMEVDVDGSFSYVEPPAGA  427
            MADF TSTHRAKWIF+PQ L EK KA NQRAKQ LEKYGTTRMEVDVDGS SY EP    
Sbjct  1    MADFQTSTHRAKWIFTPQQLVEKHKATNQRAKQMLEKYGTTRMEVDVDGSLSYPEPQVNT  60

Query  428  KETV-------------EGFVNDIEEFRGAEGEQLDTLKKL-LESAKIEAD--RTMLT  553
             E               E F+    E++  E   L   K+  L+ + +E D    MLT
Sbjct  61   AENAYKHSRPKPLSVEEEQFMRVYYEYKLREATALIYFKRFYLQWSVMEHDPKNIMLT  118



>gb|KJB45252.1| hypothetical protein B456_007G298500 [Gossypium raimondii]
Length=272

 Score =   120 bits (300),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 60/111 (54%), Positives = 77/111 (69%), Gaps = 0/111 (0%)
 Frame = +2

Query  434  TVEGFVNDIEEFRGAEGEQLDTLKKLLESAKIEADRTMLTDATLLFPPGQLALTALRRAN  613
            +VEGFVND+EEF G + ++   LK L E+A++E D+ MLTDA  LFPPGQLAL ALR AN
Sbjct  121  SVEGFVNDMEEFCGVKDDENQMLKDLQETARLEVDKIMLTDAPHLFPPGQLALAALRNAN  180

Query  614  EKLRVFEFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVK  766
            E  RV +FE YL RILARQ   H+I  L   L  I++ + K + P+ KD+K
Sbjct  181  EMHRVLDFEGYLRRILARQNSKHTILQLIESLDAIDAWVRKFKFPTEKDMK  231



>gb|KJB45249.1| hypothetical protein B456_007G298500 [Gossypium raimondii]
Length=289

 Score =   119 bits (299),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 60/111 (54%), Positives = 77/111 (69%), Gaps = 0/111 (0%)
 Frame = +2

Query  434  TVEGFVNDIEEFRGAEGEQLDTLKKLLESAKIEADRTMLTDATLLFPPGQLALTALRRAN  613
            +VEGFVND+EEF G + ++   LK L E+A++E D+ MLTDA  LFPPGQLAL ALR AN
Sbjct  138  SVEGFVNDMEEFCGVKDDENQMLKDLQETARLEVDKIMLTDAPHLFPPGQLALAALRNAN  197

Query  614  EKLRVFEFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVK  766
            E  RV +FE YL RILARQ   H+I  L   L  I++ + K + P+ KD+K
Sbjct  198  EMHRVLDFEGYLRRILARQNSKHTILQLIESLDAIDAWVRKFKFPTEKDMK  248



>gb|KJB45251.1| hypothetical protein B456_007G298500 [Gossypium raimondii]
Length=332

 Score =   120 bits (301),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 60/111 (54%), Positives = 77/111 (69%), Gaps = 0/111 (0%)
 Frame = +2

Query  434  TVEGFVNDIEEFRGAEGEQLDTLKKLLESAKIEADRTMLTDATLLFPPGQLALTALRRAN  613
            +VEGFVND+EEF G + ++   LK L E+A++E D+ MLTDA  LFPPGQLAL ALR AN
Sbjct  180  SVEGFVNDMEEFCGVKDDENQMLKDLQETARLEVDKIMLTDAPHLFPPGQLALAALRNAN  239

Query  614  EKLRVFEFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVK  766
            E  RV +FE YL RILARQ   H+I  L   L  I++ + K + P+ KD+K
Sbjct  240  EMHRVLDFEGYLRRILARQNSKHTILQLIESLDAIDAWVRKFKFPTEKDMK  290


 Score = 97.4 bits (241),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 45/58 (78%), Positives = 48/58 (83%), Gaps = 0/58 (0%)
 Frame = +2

Query  248  MADFTTSTHRAKWIFSPQDLKEKFKAVNQRAKQALEKYGTTRMEVDVDGSFSYVEPPA  421
            MADF TSTHRA WIFSPQ+L EK+KA NQRA Q LEKYGTT+MEVD DGS SY EP A
Sbjct  1    MADFHTSTHRANWIFSPQELVEKYKAANQRAIQTLEKYGTTQMEVDADGSLSYPEPIA  58



>gb|KJB45246.1| hypothetical protein B456_007G298500 [Gossypium raimondii]
Length=332

 Score =   120 bits (301),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 60/111 (54%), Positives = 77/111 (69%), Gaps = 0/111 (0%)
 Frame = +2

Query  434  TVEGFVNDIEEFRGAEGEQLDTLKKLLESAKIEADRTMLTDATLLFPPGQLALTALRRAN  613
            +VEGFVND+EEF G + ++   LK L E+A++E D+ MLTDA  LFPPGQLAL ALR AN
Sbjct  180  SVEGFVNDMEEFCGVKDDENQMLKDLQETARLEVDKIMLTDAPHLFPPGQLALAALRNAN  239

Query  614  EKLRVFEFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVK  766
            E  RV +FE YL RILARQ   H+I  L   L  I++ + K + P+ KD+K
Sbjct  240  EMHRVLDFEGYLRRILARQNSKHTILQLIESLDAIDAWVRKFKFPTEKDMK  290


 Score = 97.8 bits (242),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 45/58 (78%), Positives = 48/58 (83%), Gaps = 0/58 (0%)
 Frame = +2

Query  248  MADFTTSTHRAKWIFSPQDLKEKFKAVNQRAKQALEKYGTTRMEVDVDGSFSYVEPPA  421
            MADF TSTHRA WIFSPQ+L EK+KA NQRA Q LEKYGTT+MEVD DGS SY EP A
Sbjct  1    MADFHTSTHRANWIFSPQELVEKYKAANQRAIQTLEKYGTTQMEVDADGSLSYPEPIA  58



>gb|KJB45247.1| hypothetical protein B456_007G298500 [Gossypium raimondii]
Length=331

 Score =   120 bits (301),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 60/111 (54%), Positives = 77/111 (69%), Gaps = 0/111 (0%)
 Frame = +2

Query  434  TVEGFVNDIEEFRGAEGEQLDTLKKLLESAKIEADRTMLTDATLLFPPGQLALTALRRAN  613
            +VEGFVND+EEF G + ++   LK L E+A++E D+ MLTDA  LFPPGQLAL ALR AN
Sbjct  180  SVEGFVNDMEEFCGVKDDENQMLKDLQETARLEVDKIMLTDAPHLFPPGQLALAALRNAN  239

Query  614  EKLRVFEFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVK  766
            E  RV +FE YL RILARQ   H+I  L   L  I++ + K + P+ KD+K
Sbjct  240  EMHRVLDFEGYLRRILARQNSKHTILQLIESLDAIDAWVRKFKFPTEKDMK  290


 Score = 97.4 bits (241),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 45/58 (78%), Positives = 48/58 (83%), Gaps = 0/58 (0%)
 Frame = +2

Query  248  MADFTTSTHRAKWIFSPQDLKEKFKAVNQRAKQALEKYGTTRMEVDVDGSFSYVEPPA  421
            MADF TSTHRA WIFSPQ+L EK+KA NQRA Q LEKYGTT+MEVD DGS SY EP A
Sbjct  1    MADFHTSTHRANWIFSPQELVEKYKAANQRAIQTLEKYGTTQMEVDADGSLSYPEPIA  58



>gb|KHN09714.1| Cyclin-H1-1 [Glycine soja]
Length=332

 Score =   120 bits (300),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 59/111 (53%), Positives = 78/111 (70%), Gaps = 0/111 (0%)
 Frame = +2

Query  434  TVEGFVNDIEEFRGAEGEQLDTLKKLLESAKIEADRTMLTDATLLFPPGQLALTALRRAN  613
            +VEGF+ND+EEF  A   QL+ LK L E+A+ E DR MLTDA LLFPPGQLAL ALR +N
Sbjct  179  SVEGFINDMEEFFNAGDNQLEMLKTLQETARFEVDRMMLTDAPLLFPPGQLALAALRNSN  238

Query  614  EKLRVFEFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVK  766
               RV +F+ YL  I +R+   H++S+LS  L  I+S + K +SPS K++K
Sbjct  239  ALHRVIDFDSYLRGIFSRENSMHTMSELSESLDAIDSWVRKYKSPSEKELK  289


 Score =   100 bits (248),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 47/65 (72%), Positives = 51/65 (78%), Gaps = 0/65 (0%)
 Frame = +2

Query  248  MADFTTSTHRAKWIFSPQDLKEKFKAVNQRAKQALEKYGTTRMEVDVDGSFSYVEPPAGA  427
            MADF TSTHRAKWIFSPQ L EK++A NQRAKQ LEK G T MEVDVDGS SY EP   A
Sbjct  1    MADFQTSTHRAKWIFSPQQLVEKYRAANQRAKQILEKCGATLMEVDVDGSLSYPEPQMTA  60

Query  428  KETVE  442
            K++ E
Sbjct  61   KDSAE  65



>gb|KHG11498.1| Cyclin-H1-1 -like protein [Gossypium arboreum]
Length=332

 Score =   120 bits (300),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 60/111 (54%), Positives = 77/111 (69%), Gaps = 0/111 (0%)
 Frame = +2

Query  434  TVEGFVNDIEEFRGAEGEQLDTLKKLLESAKIEADRTMLTDATLLFPPGQLALTALRRAN  613
            +VEGFVND+EEF G + ++   LK L E+A++E D+ MLTDA  LFPPGQLAL ALR AN
Sbjct  180  SVEGFVNDMEEFCGVKDDENQMLKDLQETARLEVDKIMLTDAPHLFPPGQLALAALRNAN  239

Query  614  EKLRVFEFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVK  766
            E  RV +FE YL RILARQ   H+I  L   L  I++ + K + P+ KD+K
Sbjct  240  EMHRVLDFEGYLRRILARQNSEHTILQLIESLDAIDAWVRKFKFPTEKDMK  290


 Score = 97.4 bits (241),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 45/58 (78%), Positives = 48/58 (83%), Gaps = 0/58 (0%)
 Frame = +2

Query  248  MADFTTSTHRAKWIFSPQDLKEKFKAVNQRAKQALEKYGTTRMEVDVDGSFSYVEPPA  421
            MADF TSTHRA WIFSPQ+L EK+KA NQRA Q LEKYGTT+MEVD DGS SY EP A
Sbjct  1    MADFHTSTHRANWIFSPQELVEKYKAANQRAIQTLEKYGTTQMEVDADGSLSYPEPIA  58



>ref|XP_003526926.1| PREDICTED: cyclin-H1-1 isoformX1 [Glycine max]
Length=335

 Score =   119 bits (297),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 58/111 (52%), Positives = 78/111 (70%), Gaps = 0/111 (0%)
 Frame = +2

Query  434  TVEGFVNDIEEFRGAEGEQLDTLKKLLESAKIEADRTMLTDATLLFPPGQLALTALRRAN  613
            +VEGF+ND+EEF  A   QL+ LK L E+A+ E D+ MLTDA LLFPPGQLAL ALR +N
Sbjct  182  SVEGFINDMEEFFNAGDNQLEMLKTLQETARFEVDKMMLTDAPLLFPPGQLALAALRNSN  241

Query  614  EKLRVFEFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVK  766
               RV +F+ YL  I +R+   H++S+LS  L  I+S + K +SPS K++K
Sbjct  242  AFHRVIDFDSYLRGIFSRENSMHTMSELSESLDAIDSWVRKYKSPSEKELK  292


 Score =   100 bits (248),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 47/65 (72%), Positives = 51/65 (78%), Gaps = 0/65 (0%)
 Frame = +2

Query  248  MADFTTSTHRAKWIFSPQDLKEKFKAVNQRAKQALEKYGTTRMEVDVDGSFSYVEPPAGA  427
            MADF TSTHRAKWIFSPQ L EK++A NQRAKQ LEK G T MEVDVDGS SY EP   A
Sbjct  1    MADFQTSTHRAKWIFSPQQLVEKYRAANQRAKQILEKCGATLMEVDVDGSLSYPEPQMTA  60

Query  428  KETVE  442
            K++ E
Sbjct  61   KDSAE  65



>ref|XP_008811991.1| PREDICTED: cyclin-H1-1 isoform X2 [Phoenix dactylifera]
Length=320

 Score =   118 bits (295),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 58/111 (52%), Positives = 79/111 (71%), Gaps = 0/111 (0%)
 Frame = +2

Query  434  TVEGFVNDIEEFRGAEGEQLDTLKKLLESAKIEADRTMLTDATLLFPPGQLALTALRRAN  613
            +VEGFV D+EEF     E+ +  + L  +AK+E D+ MLTDA LL+ PGQLAL ALRR+N
Sbjct  160  SVEGFVEDMEEFCQVRNEEQEKFQDLRGTAKLEVDKIMLTDAPLLYAPGQLALAALRRSN  219

Query  614  EKLRVFEFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVK  766
            E  RV +FERYLE I +RQ+ +HSIS L   +K I+ ++ KL+ PS KD++
Sbjct  220  EVHRVLDFERYLESIFSRQRSSHSISQLIESMKTIDFMLGKLKIPSTKDMR  270


 Score = 90.5 bits (223),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 52/118 (44%), Positives = 68/118 (58%), Gaps = 8/118 (7%)
 Frame = +2

Query  248  MADFTTSTHRAKWIFSPQDLKEKFKAVNQRAKQALEKYGTTRMEVDVDGSFSYVEPPAGA  427
            MADF TSTHRAKWI +PQ+L EK +A NQRA + LE+YG TR+EVDVDGS SY EP    
Sbjct  1    MADFQTSTHRAKWISTPQELLEKHQAANQRAIKMLEQYGITRLEVDVDGSLSYPEPVLDQ  60

Query  428  KETVEGFVNDIEEFRGAEGEQLDTLKKLLESAKIEADRTMLTDATLLFPPGQLALTAL  601
            K+  E     + +    + EQL     +  +A I   R  L  + +   P  + LT +
Sbjct  61   KDNAE---RSVPKPLNCDEEQL-----MQATAIIYFKRFYLQWSVMEHHPKHIMLTCI  110



>ref|XP_009620420.1| PREDICTED: cyclin-H1-1 isoform X2 [Nicotiana tomentosiformis]
Length=305

 Score =   117 bits (294),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 62/105 (59%), Positives = 83/105 (79%), Gaps = 2/105 (2%)
 Frame = +2

Query  458  IEEFRGA-EGEQLDTLKKLLESAKIEADRTMLTDATLLFPPGQLALTALRRANEKLRVFE  634
            ++EFRGA + +Q +TLK++LE+A++EAD+ M T+A LLFPPGQLAL ALRRAN    + +
Sbjct  165  LQEFRGANDDDQHETLKRMLEAARMEADKIMRTEAPLLFPPGQLALAALRRANVVHDILD  224

Query  635  FERYLERILARQQPTHSISDLSGLLKPIESLINKLES-PSAKDVK  766
            FERYL  IL+RQQ T +IS+LS  L  I+SLI KLE+ P++KDVK
Sbjct  225  FERYLRSILSRQQSTQAISELSVSLNTIDSLICKLEAPPTSKDVK  269


 Score =   115 bits (289),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 50/65 (77%), Positives = 59/65 (91%), Gaps = 0/65 (0%)
 Frame = +2

Query  248  MADFTTSTHRAKWIFSPQDLKEKFKAVNQRAKQALEKYGTTRMEVDVDGSFSYVEPPAGA  427
            MADFTTSTHRAKWIF+PQ+L++K+KA NQRAKQALEKYG TRMEVD+DGSFSY EP + A
Sbjct  1    MADFTTSTHRAKWIFTPQELRDKYKAANQRAKQALEKYGATRMEVDIDGSFSYAEPQSDA  60

Query  428  KETVE  442
            K++ E
Sbjct  61   KDSAE  65



>ref|XP_008811990.1| PREDICTED: cyclin-H1-1 isoform X1 [Phoenix dactylifera]
Length=341

 Score =   118 bits (295),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 58/111 (52%), Positives = 79/111 (71%), Gaps = 0/111 (0%)
 Frame = +2

Query  434  TVEGFVNDIEEFRGAEGEQLDTLKKLLESAKIEADRTMLTDATLLFPPGQLALTALRRAN  613
            +VEGFV D+EEF     E+ +  + L  +AK+E D+ MLTDA LL+ PGQLAL ALRR+N
Sbjct  181  SVEGFVEDMEEFCQVRNEEQEKFQDLRGTAKLEVDKIMLTDAPLLYAPGQLALAALRRSN  240

Query  614  EKLRVFEFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVK  766
            E  RV +FERYLE I +RQ+ +HSIS L   +K I+ ++ KL+ PS KD++
Sbjct  241  EVHRVLDFERYLESIFSRQRSSHSISQLIESMKTIDFMLGKLKIPSTKDMR  291


 Score = 90.1 bits (222),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 49/65 (75%), Gaps = 0/65 (0%)
 Frame = +2

Query  248  MADFTTSTHRAKWIFSPQDLKEKFKAVNQRAKQALEKYGTTRMEVDVDGSFSYVEPPAGA  427
            MADF TSTHRAKWI +PQ+L EK +A NQRA + LE+YG TR+EVDVDGS SY EP    
Sbjct  1    MADFQTSTHRAKWISTPQELLEKHQAANQRAIKMLEQYGITRLEVDVDGSLSYPEPVLDQ  60

Query  428  KETVE  442
            K+  E
Sbjct  61   KDNAE  65



>gb|EPS69696.1| hypothetical protein M569_05066, partial [Genlisea aurea]
Length=321

 Score =   117 bits (294),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 62/112 (55%), Positives = 80/112 (71%), Gaps = 3/112 (3%)
 Frame = +2

Query  434  TVEGFVNDIEEFR-GAEGEQLDTLKKLLESAKIEADRTMLTDATLLFPPGQLALTALRRA  610
             +EGFVNDIE  R   E  QLD LK + ESAK+E D+ M TDA LLFPPGQLAL ALRR+
Sbjct  185  ALEGFVNDIEATRESQEVYQLDKLKNVHESAKLEVDKIMRTDAPLLFPPGQLALAALRRS  244

Query  611  NEKLRVFEFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVK  766
             E  +  EFERYL  IL+RQ+P   + +++  L  I+ L+N+LE+P++KDVK
Sbjct  245  VEAHKFMEFERYLGSILSRQKPV--VPEMNASLNAIDLLVNRLETPTSKDVK  294


 Score = 98.6 bits (244),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 44/60 (73%), Positives = 48/60 (80%), Gaps = 0/60 (0%)
 Frame = +2

Query  248  MADFTTSTHRAKWIFSPQDLKEKFKAVNQRAKQALEKYGTTRMEVDVDGSFSYVEPPAGA  427
            MADF TSTHR KWIFSPQDL EK+K  N+RAK ALEKYG TRM+VDV G+FSY EP   A
Sbjct  3    MADFATSTHRVKWIFSPQDLIEKYKEANKRAKHALEKYGATRMQVDVYGAFSYAEPQTDA  62



>ref|XP_006433378.1| hypothetical protein CICLE_v10001764mg [Citrus clementina]
 ref|XP_006472056.1| PREDICTED: cyclin-H1-1-like isoform X3 [Citrus sinensis]
 gb|ESR46618.1| hypothetical protein CICLE_v10001764mg [Citrus clementina]
Length=331

 Score =   117 bits (294),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 61/120 (51%), Positives = 80/120 (67%), Gaps = 3/120 (3%)
 Frame = +2

Query  407  VEPPAGAKETVEGFVNDIEEFRGAEGEQLDTLKKLLESAKIEADRTMLTDATLLFPPGQL  586
            V PP      +EGF+ND+E+F   +  +L  LK L E+AK+E D+ MLTDA LLFPPGQL
Sbjct  176  VYPPY---RPLEGFINDMEDFCQVKNGELQMLKDLHETAKLEVDKIMLTDAPLLFPPGQL  232

Query  587  ALTALRRANEKLRVFEFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVK  766
            AL ALR +N+  RV ++E YL  IL+RQ   H ISDL+  L  I+S + K + PS KD+K
Sbjct  233  ALAALRNSNKVQRVVDYESYLSSILSRQNSGHIISDLTENLDTIDSWVMKYKFPSEKDMK  292


 Score =   102 bits (253),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 47/65 (72%), Positives = 53/65 (82%), Gaps = 0/65 (0%)
 Frame = +2

Query  248  MADFTTSTHRAKWIFSPQDLKEKFKAVNQRAKQALEKYGTTRMEVDVDGSFSYVEPPAGA  427
            MADF TSTHRA WIF+PQ+L EK+KA N+RA Q LEKYGTT+MEVDVDGSFSY EP   A
Sbjct  1    MADFQTSTHRANWIFTPQELIEKYKASNRRAIQTLEKYGTTQMEVDVDGSFSYPEPQNNA  60

Query  428  KETVE  442
            K+  E
Sbjct  61   KDNSE  65



>ref|XP_002512403.1| cyclin h, putative [Ricinus communis]
 gb|EEF49855.1| cyclin h, putative [Ricinus communis]
Length=312

 Score =   117 bits (293),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 59/111 (53%), Positives = 75/111 (68%), Gaps = 0/111 (0%)
 Frame = +2

Query  434  TVEGFVNDIEEFRGAEGEQLDTLKKLLESAKIEADRTMLTDATLLFPPGQLALTALRRAN  613
            +VEGF+ND+E+F  A  +Q   LK L  SA  E D+ M TDA LLFPPGQLAL ALR AN
Sbjct  161  SVEGFINDMEDFCHATDDQTQMLKDLQVSAVAEVDKIMFTDAPLLFPPGQLALAALRSAN  220

Query  614  EKLRVFEFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVK  766
               RV +FERYL  IL+RQ   H+IS+L+  L  I+S + K + P+ KD+K
Sbjct  221  GMHRVLDFERYLRDILSRQNLVHTISNLTESLDAIDSWVKKYKFPTEKDMK  271


 Score =   100 bits (248),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 46/56 (82%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = +2

Query  248  MADFTTSTHRAKWIFSPQDLKEKFKAVNQRAKQALEKYGTTRMEVDVDGSFSYVEP  415
            MADF TSTHR KWIF+PQ L EK KA NQRAKQ LEKYGTTRMEVDVDGS SY EP
Sbjct  1    MADFQTSTHRVKWIFTPQQLVEKHKATNQRAKQMLEKYGTTRMEVDVDGSISYPEP  56



>gb|ACU23520.1| unknown [Glycine max]
Length=335

 Score =   117 bits (293),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 57/111 (51%), Positives = 77/111 (69%), Gaps = 0/111 (0%)
 Frame = +2

Query  434  TVEGFVNDIEEFRGAEGEQLDTLKKLLESAKIEADRTMLTDATLLFPPGQLALTALRRAN  613
            +VEGF+ND+EEF  A   QL+ LK L E+A+ E D+ MLTDA LLFPPGQLAL ALR +N
Sbjct  182  SVEGFINDMEEFFNAGDNQLEMLKTLQETARFEVDKMMLTDAPLLFPPGQLALAALRNSN  241

Query  614  EKLRVFEFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVK  766
               RV +F+ Y   I +R+   H++S+LS  L  I+S + K +SPS K++K
Sbjct  242  AFHRVIDFDSYFRGIFSRENSMHTMSELSESLDAIDSWVRKYKSPSEKELK  292


 Score =   100 bits (248),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 47/65 (72%), Positives = 51/65 (78%), Gaps = 0/65 (0%)
 Frame = +2

Query  248  MADFTTSTHRAKWIFSPQDLKEKFKAVNQRAKQALEKYGTTRMEVDVDGSFSYVEPPAGA  427
            MADF TSTHRAKWIFSPQ L EK++A NQRAKQ LEK G T MEVDVDGS SY EP   A
Sbjct  1    MADFQTSTHRAKWIFSPQQLVEKYRAANQRAKQILEKCGATLMEVDVDGSLSYPEPQMTA  60

Query  428  KETVE  442
            K++ E
Sbjct  61   KDSAE  65



>ref|XP_009799571.1| PREDICTED: cyclin-H1-1 isoform X2 [Nicotiana sylvestris]
Length=305

 Score =   116 bits (291),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 51/65 (78%), Positives = 59/65 (91%), Gaps = 0/65 (0%)
 Frame = +2

Query  248  MADFTTSTHRAKWIFSPQDLKEKFKAVNQRAKQALEKYGTTRMEVDVDGSFSYVEPPAGA  427
            MADFTTSTHRAKWIF+PQ+LK+K+KA NQRAKQALEKYG TRMEVD+DGSFSY EP + A
Sbjct  1    MADFTTSTHRAKWIFTPQELKDKYKAANQRAKQALEKYGATRMEVDIDGSFSYAEPQSDA  60

Query  428  KETVE  442
            K++ E
Sbjct  61   KDSAE  65


 Score =   114 bits (286),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 60/105 (57%), Positives = 82/105 (78%), Gaps = 2/105 (2%)
 Frame = +2

Query  458  IEEFRGA-EGEQLDTLKKLLESAKIEADRTMLTDATLLFPPGQLALTALRRANEKLRVFE  634
            ++EFRGA + +Q + LK++LE+A++EAD+ M T+A LLFPPGQLAL ALRRAN    + +
Sbjct  165  LQEFRGANDDDQYEMLKRMLEAARMEADKIMRTEAPLLFPPGQLALAALRRANVVHGILD  224

Query  635  FERYLERILARQQPTHSISDLSGLLKPIESLINKLES-PSAKDVK  766
            FERYL  IL+RQQ T +IS+L+  L  I+SLI KLE+ P++KDVK
Sbjct  225  FERYLRSILSRQQSTQTISELTVSLNTIDSLICKLEAPPTSKDVK  269



>gb|KJB45250.1| hypothetical protein B456_007G298500 [Gossypium raimondii]
Length=339

 Score =   117 bits (292),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 61/118 (52%), Positives = 78/118 (66%), Gaps = 7/118 (6%)
 Frame = +2

Query  434  TVEGFVNDIEEFRGAEGEQLDTLKKLLESAKIEADRTMLTDATLLFPPGQLALTALRRAN  613
            +VEGFVND+EEF G + ++   LK L E+A++E D+ MLTDA  LFPPGQLAL ALR AN
Sbjct  180  SVEGFVNDMEEFCGVKDDENQMLKDLQETARLEVDKIMLTDAPHLFPPGQLALAALRNAN  239

Query  614  EKLRVFEFE-------RYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVK  766
            E  RV +FE       RYL RILARQ   H+I  L   L  I++ + K + P+ KD+K
Sbjct  240  EMHRVLDFEGLCCVLCRYLRRILARQNSKHTILQLIESLDAIDAWVRKFKFPTEKDMK  297


 Score = 97.8 bits (242),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 45/58 (78%), Positives = 48/58 (83%), Gaps = 0/58 (0%)
 Frame = +2

Query  248  MADFTTSTHRAKWIFSPQDLKEKFKAVNQRAKQALEKYGTTRMEVDVDGSFSYVEPPA  421
            MADF TSTHRA WIFSPQ+L EK+KA NQRA Q LEKYGTT+MEVD DGS SY EP A
Sbjct  1    MADFHTSTHRANWIFSPQELVEKYKAANQRAIQTLEKYGTTQMEVDADGSLSYPEPIA  58



>ref|XP_009620423.1| PREDICTED: cyclin-H1-1 isoform X5 [Nicotiana tomentosiformis]
Length=279

 Score =   115 bits (289),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 50/65 (77%), Positives = 59/65 (91%), Gaps = 0/65 (0%)
 Frame = +2

Query  248  MADFTTSTHRAKWIFSPQDLKEKFKAVNQRAKQALEKYGTTRMEVDVDGSFSYVEPPAGA  427
            MADFTTSTHRAKWIF+PQ+L++K+KA NQRAKQALEKYG TRMEVD+DGSFSY EP + A
Sbjct  1    MADFTTSTHRAKWIFTPQELRDKYKAANQRAKQALEKYGATRMEVDIDGSFSYAEPQSDA  60

Query  428  KETVE  442
            K++ E
Sbjct  61   KDSAE  65


 Score = 68.2 bits (165),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 46/105 (44%), Positives = 60/105 (57%), Gaps = 28/105 (27%)
 Frame = +2

Query  458  IEEFRGA-EGEQLDTLKKLLESAKIEADRTMLTDATLLFPPGQLALTALRRANEKLRVFE  634
            ++EFRGA + +Q +TLK                          LAL ALRRAN    + +
Sbjct  165  LQEFRGANDDDQHETLK--------------------------LALAALRRANVVHDILD  198

Query  635  FERYLERILARQQPTHSISDLSGLLKPIESLINKLES-PSAKDVK  766
            FERYL  IL+RQQ T +IS+LS  L  I+SLI KLE+ P++KDVK
Sbjct  199  FERYLRSILSRQQSTQAISELSVSLNTIDSLICKLEAPPTSKDVK  243



>ref|XP_003550146.1| PREDICTED: cyclin-H1-1-like isoformX1 [Glycine max]
Length=335

 Score =   116 bits (291),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 56/111 (50%), Positives = 77/111 (69%), Gaps = 0/111 (0%)
 Frame = +2

Query  434  TVEGFVNDIEEFRGAEGEQLDTLKKLLESAKIEADRTMLTDATLLFPPGQLALTALRRAN  613
            +VEGF+ND+EEF  A  +QL+ LK L E+A+ E D+ MLTDA LLFPPGQLAL AL  +N
Sbjct  182  SVEGFINDVEEFCNAGDDQLEMLKTLQETARFEVDKMMLTDAPLLFPPGQLALAALSNSN  241

Query  614  EKLRVFEFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVK  766
               RV +F+ YL  I + +   H++S+LS  L  I+S + K +SPS K++K
Sbjct  242  ALHRVIDFDSYLRGIFSHENSMHTMSELSESLNAIDSWVRKYKSPSEKELK  292


 Score = 98.6 bits (244),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 46/65 (71%), Positives = 51/65 (78%), Gaps = 0/65 (0%)
 Frame = +2

Query  248  MADFTTSTHRAKWIFSPQDLKEKFKAVNQRAKQALEKYGTTRMEVDVDGSFSYVEPPAGA  427
            MADF TSTHRAKWIFSPQ L EK++A NQRAKQ LEK G T MEVDV+GS SY EP   A
Sbjct  1    MADFQTSTHRAKWIFSPQQLVEKYRAANQRAKQILEKCGATLMEVDVNGSLSYPEPHMTA  60

Query  428  KETVE  442
            K++ E
Sbjct  61   KDSAE  65



>ref|XP_009760266.1| PREDICTED: cyclin-H1-1-like isoform X1 [Nicotiana sylvestris]
Length=200

 Score =   114 bits (284),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 58/130 (45%), Positives = 84/130 (65%), Gaps = 18/130 (14%)
 Frame = +2

Query  431  ETVEGFVNDIEEFRGA-EGEQLDTLK-----------------KLLESAKIEADRTMLTD  556
             T++GF++D+EEF GA + +Q+  LK                   LE+A++EAD+ M T+
Sbjct  65   HTLDGFISDLEEFCGAKDDDQIVALKISLLPLLLFLMVPQKIKASLETARMEADKIMRTN  124

Query  557  ATLLFPPGQLALTALRRANEKLRVFEFERYLERILARQQPTHSISDLSGLLKPIESLINK  736
              LLFPPGQLAL AL RAN +  +F+FERYL  +L+R  P H+IS+L+  +  I+SLI K
Sbjct  125  GPLLFPPGQLALAALHRANTEHGIFDFERYLRSVLSRHHPAHTISELTASINAIDSLIGK  184

Query  737  LESPSAKDVK  766
            L +P++KDV 
Sbjct  185  LVTPTSKDVN  194



>ref|XP_004141934.1| PREDICTED: cyclin-H1-1-like [Cucumis sativus]
 ref|XP_004169380.1| PREDICTED: cyclin-H1-1-like [Cucumis sativus]
 gb|KGN48487.1| hypothetical protein Csa_6G490020 [Cucumis sativus]
Length=332

 Score =   116 bits (291),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 60/111 (54%), Positives = 75/111 (68%), Gaps = 3/111 (3%)
 Frame = +2

Query  434  TVEGFVNDIEEFRGAEGEQLDTLKKLLESAKIEADRTMLTDATLLFPPGQLALTALRRAN  613
            +VEG+VNDIEE      E L  LK    +A +E D+ MLTDA LLFPPGQLAL ALRR+N
Sbjct  182  SVEGYVNDIEELFNENAEMLQMLKV---TASLEVDKIMLTDAPLLFPPGQLALAALRRSN  238

Query  614  EKLRVFEFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVK  766
            E   V +F  YL+ IL+RQ  TH+IS+L   +  IESL+N+   PS KD+K
Sbjct  239  EVHGVIDFNSYLDSILSRQNSTHTISELYEGINAIESLVNRYAFPSEKDLK  289


 Score = 82.4 bits (202),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = +2

Query  248  MADFTTSTHRAKWIFSPQDLKEKFKAVNQRAKQALEKYGTTRMEVDVDGSFSYVEPPAGA  427
            MADF TST RAKWI SPQ+L  ++ A NQRA +ALEK+G   MEVD DGS SY +P   +
Sbjct  1    MADFQTSTQRAKWILSPQELGGRYNAANQRAIEALEKFGAALMEVDADGSLSYPDPQINS  60

Query  428  KE  433
            K+
Sbjct  61   KD  62



>ref|XP_004230215.1| PREDICTED: cyclin-H1-1 [Solanum lycopersicum]
Length=328

 Score =   116 bits (290),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 58/112 (52%), Positives = 84/112 (75%), Gaps = 2/112 (2%)
 Frame = +2

Query  437  VEGFVNDIEEFRGAE-GEQLDTLKKLLESAKIEADRTMLTDATLLFPPGQLALTALRRAN  613
            +EGF++++EEF GA+  +QL  LK  L++A+IEAD+ M +D  LLFPPGQLALTAL RA+
Sbjct  181  LEGFISNLEEFCGAQDNDQLLALKGALDTARIEADKIMRSDGPLLFPPGQLALTALHRAD  240

Query  614  EKLRVFEFERYLERILARQ-QPTHSISDLSGLLKPIESLINKLESPSAKDVK  766
                +F+FERYL  +L+   QP H+IS+L+  +  I+SL+ KL +P++KDVK
Sbjct  241  AAHGIFDFERYLRSVLSHHDQPGHAISELTDSINVIDSLVGKLLTPTSKDVK  292


 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 50/65 (77%), Gaps = 0/65 (0%)
 Frame = +2

Query  248  MADFTTSTHRAKWIFSPQDLKEKFKAVNQRAKQALEKYGTTRMEVDVDGSFSYVEPPAGA  427
            MADF TSTH+ KWI++ QD+K K+K  NQRAKQALE +GTTRMEVD+DG+FSY E     
Sbjct  1    MADFMTSTHKTKWIYTLQDIKHKYKVANQRAKQALEMFGTTRMEVDIDGTFSYAESQNDT  60

Query  428  KETVE  442
            K+  E
Sbjct  61   KDNAE  65



>ref|XP_008440228.1| PREDICTED: cyclin-H1-1 isoform X3 [Cucumis melo]
Length=275

 Score =   115 bits (288),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 59/111 (53%), Positives = 75/111 (68%), Gaps = 3/111 (3%)
 Frame = +2

Query  434  TVEGFVNDIEEFRGAEGEQLDTLKKLLESAKIEADRTMLTDATLLFPPGQLALTALRRAN  613
            +VEG+VNDIEE      E L  LK    +A ++ D+ MLTDA LLFPPGQLAL ALRR+N
Sbjct  125  SVEGYVNDIEELFHENAEMLQMLKA---TASLDVDKIMLTDAPLLFPPGQLALAALRRSN  181

Query  614  EKLRVFEFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVK  766
            E   V +F  YL+ IL+RQ  TH+IS+L   +  IESL+N+   PS KD+K
Sbjct  182  EVHGVIDFNSYLDSILSRQNSTHTISELYEGINAIESLVNRYAFPSEKDLK  232



>ref|XP_006394954.1| hypothetical protein EUTSA_v10004554mg [Eutrema salsugineum]
 gb|ESQ32240.1| hypothetical protein EUTSA_v10004554mg [Eutrema salsugineum]
Length=334

 Score =   116 bits (290),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 56/110 (51%), Positives = 81/110 (74%), Gaps = 0/110 (0%)
 Frame = +2

Query  437  VEGFVNDIEEFRGAEGEQLDTLKKLLESAKIEADRTMLTDATLLFPPGQLALTALRRANE  616
            +EGFV+++E+F  A+ +++  L+ LL++A  EAD+ MLTDA LLFPPGQLAL ALR AN 
Sbjct  181  IEGFVSNMEDFLQAQDDEIQKLENLLKAATAEADKVMLTDAPLLFPPGQLALAALRIANR  240

Query  617  KLRVFEFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVK  766
             L V +++RYLE I+++    H+ S+L+ LL  IESL+   +SPS KD+K
Sbjct  241  ILGVVDYDRYLENIVSQPNSEHTTSELTKLLDDIESLVKNYKSPSEKDMK  290


 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = +2

Query  248  MADFTTSTHRAKWIFSPQDLKEKFKAVNQRAKQALEKYGTTRMEVDVDGSFSY  406
            MADF TST RAKWIF+PQ L E++KA NQRA Q LEK GTT++EVD  GS +Y
Sbjct  1    MADFQTSTQRAKWIFTPQKLAERYKAANQRAVQMLEKCGTTQVEVDASGSLTY  53



>ref|XP_009620421.1| PREDICTED: cyclin-H1-1 isoform X3 [Nicotiana tomentosiformis]
Length=302

 Score =   115 bits (289),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 50/65 (77%), Positives = 59/65 (91%), Gaps = 0/65 (0%)
 Frame = +2

Query  248  MADFTTSTHRAKWIFSPQDLKEKFKAVNQRAKQALEKYGTTRMEVDVDGSFSYVEPPAGA  427
            MADFTTSTHRAKWIF+PQ+L++K+KA NQRAKQALEKYG TRMEVD+DGSFSY EP + A
Sbjct  1    MADFTTSTHRAKWIFTPQELRDKYKAANQRAKQALEKYGATRMEVDIDGSFSYAEPQSDA  60

Query  428  KETVE  442
            K++ E
Sbjct  61   KDSAE  65


 Score = 80.9 bits (198),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 52/112 (46%), Positives = 67/112 (60%), Gaps = 28/112 (25%)
 Frame = +2

Query  437  VEGFVNDIEEFRGA-EGEQLDTLKKLLESAKIEADRTMLTDATLLFPPGQLALTALRRAN  613
            +EGFV+D+EEFRGA + +Q +TLK                          LAL ALRRAN
Sbjct  181  LEGFVSDMEEFRGANDDDQHETLK--------------------------LALAALRRAN  214

Query  614  EKLRVFEFERYLERILARQQPTHSISDLSGLLKPIESLINKLES-PSAKDVK  766
                + +FERYL  IL+RQQ T +IS+LS  L  I+SLI KLE+ P++KDVK
Sbjct  215  VVHDILDFERYLRSILSRQQSTQAISELSVSLNTIDSLICKLEAPPTSKDVK  266



>ref|XP_008440227.1| PREDICTED: cyclin-H1-1 isoform X2 [Cucumis melo]
Length=290

 Score =   115 bits (288),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 59/111 (53%), Positives = 75/111 (68%), Gaps = 3/111 (3%)
 Frame = +2

Query  434  TVEGFVNDIEEFRGAEGEQLDTLKKLLESAKIEADRTMLTDATLLFPPGQLALTALRRAN  613
            +VEG+VNDIEE      E L  LK    +A ++ D+ MLTDA LLFPPGQLAL ALRR+N
Sbjct  140  SVEGYVNDIEELFHENAEMLQMLKA---TASLDVDKIMLTDAPLLFPPGQLALAALRRSN  196

Query  614  EKLRVFEFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVK  766
            E   V +F  YL+ IL+RQ  TH+IS+L   +  IESL+N+   PS KD+K
Sbjct  197  EVHGVIDFNSYLDSILSRQNSTHTISELYEGINAIESLVNRYAFPSEKDLK  247



>ref|XP_009111750.1| PREDICTED: cyclin-H1-1-like [Brassica rapa]
Length=334

 Score =   115 bits (288),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 59/110 (54%), Positives = 78/110 (71%), Gaps = 0/110 (0%)
 Frame = +2

Query  437  VEGFVNDIEEFRGAEGEQLDTLKKLLESAKIEADRTMLTDATLLFPPGQLALTALRRANE  616
            +EGFV ++EEF  A  +++  L+ LL++A  EAD+ MLTDA LLFPPGQLAL ALR AN 
Sbjct  181  MEGFVANMEEFLQARDDEIQKLQSLLKAATAEADKVMLTDAPLLFPPGQLALAALRIANG  240

Query  617  KLRVFEFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVK  766
             L V +F+RYLE I+++    H+ SDLS LL  IESL+   + PS KD+K
Sbjct  241  ILGVVDFDRYLENIVSQPNSEHTASDLSKLLDGIESLVKNYKYPSEKDMK  290


 Score = 77.4 bits (189),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 34/53 (64%), Positives = 41/53 (77%), Gaps = 0/53 (0%)
 Frame = +2

Query  248  MADFTTSTHRAKWIFSPQDLKEKFKAVNQRAKQALEKYGTTRMEVDVDGSFSY  406
            MADF TST RAKW+F+PQ L E++KA N RA Q LEK GTT++EVD  GS +Y
Sbjct  1    MADFQTSTQRAKWVFTPQKLAERYKAANHRAVQFLEKCGTTQVEVDASGSLTY  53



>ref|XP_008440225.1| PREDICTED: cyclin-H1-1 isoform X1 [Cucumis melo]
 ref|XP_008440226.1| PREDICTED: cyclin-H1-1 isoform X1 [Cucumis melo]
Length=332

 Score =   115 bits (287),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 59/111 (53%), Positives = 75/111 (68%), Gaps = 3/111 (3%)
 Frame = +2

Query  434  TVEGFVNDIEEFRGAEGEQLDTLKKLLESAKIEADRTMLTDATLLFPPGQLALTALRRAN  613
            +VEG+VNDIEE      E L  LK    +A ++ D+ MLTDA LLFPPGQLAL ALRR+N
Sbjct  182  SVEGYVNDIEELFHENAEMLQMLKA---TASLDVDKIMLTDAPLLFPPGQLALAALRRSN  238

Query  614  EKLRVFEFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVK  766
            E   V +F  YL+ IL+RQ  TH+IS+L   +  IESL+N+   PS KD+K
Sbjct  239  EVHGVIDFNSYLDSILSRQNSTHTISELYEGINAIESLVNRYAFPSEKDLK  289


 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = +2

Query  248  MADFTTSTHRAKWIFSPQDLKEKFKAVNQRAKQALEKYGTTRMEVDVDGSFSYVEPPAGA  427
            MADF TST RAKWI SPQ+L  ++KA NQRA +ALEK+G + MEVD DGS SY +P    
Sbjct  1    MADFQTSTQRAKWILSPQELGCRYKAANQRAIEALEKFGASLMEVDADGSLSYPDPQINL  60

Query  428  KE  433
            K+
Sbjct  61   KD  62



>ref|XP_009418143.1| PREDICTED: cyclin-H1-1 isoform X3 [Musa acuminata subsp. malaccensis]
 ref|XP_009418144.1| PREDICTED: cyclin-H1-1 isoform X3 [Musa acuminata subsp. malaccensis]
Length=170

 Score =   110 bits (276),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 55/111 (50%), Positives = 75/111 (68%), Gaps = 0/111 (0%)
 Frame = +2

Query  434  TVEGFVNDIEEFRGAEGEQLDTLKKLLESAKIEADRTMLTDATLLFPPGQLALTALRRAN  613
            +VEGF  D++EF  A  E+ +  K  L++A  E DR MLTDA LL+PPGQL+L +L RAN
Sbjct  19   SVEGFNEDMQEFCHARDEEQEKFKNFLQTANAEVDRIMLTDAPLLYPPGQLSLASLHRAN  78

Query  614  EKLRVFEFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVK  766
            E   V +FERYL  +L+RQ   +S S L   LK I++L+ KL  P+AKD++
Sbjct  79   EVHGVLDFERYLNILLSRQHSAYSTSQLFESLKSIDTLVGKLNIPTAKDMR  129



>ref|XP_010455108.1| PREDICTED: cyclin-H1-1-like [Camelina sativa]
Length=335

 Score =   114 bits (285),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 55/110 (50%), Positives = 76/110 (69%), Gaps = 0/110 (0%)
 Frame = +2

Query  437  VEGFVNDIEEFRGAEGEQLDTLKKLLESAKIEADRTMLTDATLLFPPGQLALTALRRANE  616
            +EGFVN++EEF     +++  LK LLE+A   AD+ +LTDA LLFPPGQLAL +LR AN 
Sbjct  181  IEGFVNNMEEFLQVRDDEIQKLKSLLEAATAVADKVILTDAPLLFPPGQLALASLRIANG  240

Query  617  KLRVFEFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVK  766
             LRV +F+RYLE I+++    H+ S+L+ LL  IE L+     P+ KD+K
Sbjct  241  ALRVIDFDRYLENIVSQPNSEHTTSELTKLLDDIEYLVKNYNCPTDKDMK  290


 Score = 80.1 bits (196),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = +2

Query  248  MADFTTSTHRAKWIFSPQDLKEKFKAVNQRAKQALEKYGTTRMEVDVDGSFSY  406
            MADF TST RAKWIF+PQ L E+++A NQRA Q L+K GTTR+EVD  GS +Y
Sbjct  1    MADFQTSTQRAKWIFTPQKLAERYQAANQRAVQMLDKCGTTRVEVDASGSLTY  53



>ref|NP_198114.2| cyclin H;1 [Arabidopsis thaliana]
 sp|Q8W5S1.1|CCH11_ARATH RecName: Full=Cyclin-H1-1; Short=CycH1;1 [Arabidopsis thaliana]
 dbj|BAB72144.1| cyclin H [Arabidopsis thaliana]
 dbj|BAC43301.1| putative cyclin H AtCycH1 [Arabidopsis thaliana]
 gb|AED93707.1| cyclin H;1 [Arabidopsis thaliana]
Length=336

 Score =   114 bits (284),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 56/110 (51%), Positives = 77/110 (70%), Gaps = 0/110 (0%)
 Frame = +2

Query  437  VEGFVNDIEEFRGAEGEQLDTLKKLLESAKIEADRTMLTDATLLFPPGQLALTALRRANE  616
            +EGFVN++EEF  A  +++  L+ LL+ A  EAD+ MLTDA LLFPPGQLAL +LR AN 
Sbjct  181  IEGFVNNMEEFLQARDDEIQKLESLLKGATAEADKVMLTDAPLLFPPGQLALASLRIANG  240

Query  617  KLRVFEFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVK  766
             L V +F+RYLE I+++    H+ S+L+ LL  IE L+   + PS KD+K
Sbjct  241  VLGVIDFDRYLENIVSQPNSEHTTSELTKLLDNIEYLVKNYKCPSEKDMK  290


 Score = 81.3 bits (199),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 45/60 (75%), Gaps = 0/60 (0%)
 Frame = +2

Query  248  MADFTTSTHRAKWIFSPQDLKEKFKAVNQRAKQALEKYGTTRMEVDVDGSFSYVEPPAGA  427
            MADF TST RAKWIF+PQ L E++KA NQRA Q LEK GTT++EVD  GS +Y +   G+
Sbjct  1    MADFQTSTQRAKWIFTPQKLAERYKAANQRAVQMLEKCGTTQVEVDASGSLTYPKDKVGS  60



>ref|XP_002874361.1| CYCH_1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50620.1| CYCH_1 [Arabidopsis lyrata subsp. lyrata]
Length=334

 Score =   114 bits (284),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 56/110 (51%), Positives = 77/110 (70%), Gaps = 0/110 (0%)
 Frame = +2

Query  437  VEGFVNDIEEFRGAEGEQLDTLKKLLESAKIEADRTMLTDATLLFPPGQLALTALRRANE  616
            +EGFVN++EEF  A  +Q+  L+ LL++A  EAD+ MLTDA LLFPPGQLAL +LR AN 
Sbjct  181  IEGFVNNMEEFLQARDDQIQKLESLLKAATAEADKVMLTDAPLLFPPGQLALASLRIANG  240

Query  617  KLRVFEFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVK  766
             L V +F+RYLE I+++    H+ S+L+  L  IE L+   + PS KD+K
Sbjct  241  VLGVIDFDRYLENIVSQPNSEHTTSELTKFLDDIEFLVKNYKKPSEKDMK  290


 Score = 78.6 bits (192),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = +2

Query  248  MADFTTSTHRAKWIFSPQDLKEKFKAVNQRAKQALEKYGTTRMEVDVDGSFSY  406
            MADF TST RAKWIF+PQ L +K+KA N+RA Q LEK GTT++EVD  GS +Y
Sbjct  1    MADFQTSTQRAKWIFTPQKLADKYKAANKRAVQMLEKCGTTQVEVDASGSLTY  53



>emb|CDY19728.1| BnaA09g03810D [Brassica napus]
Length=331

 Score =   113 bits (283),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 58/110 (53%), Positives = 78/110 (71%), Gaps = 0/110 (0%)
 Frame = +2

Query  437  VEGFVNDIEEFRGAEGEQLDTLKKLLESAKIEADRTMLTDATLLFPPGQLALTALRRANE  616
            +EGFV+++EEF  A  +++  L+ LL++A  EAD+ MLTDA LLFPPGQLAL ALR AN 
Sbjct  178  MEGFVSNMEEFLQARDDEIQKLQSLLKAATAEADKVMLTDAPLLFPPGQLALAALRIANG  237

Query  617  KLRVFEFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVK  766
             L V +F+RYLE I+++    H+ SDL  LL  IESL+   + PS KD+K
Sbjct  238  ILGVVDFDRYLENIVSQPNSEHTASDLLKLLDGIESLVKNYKYPSEKDMK  287


 Score = 77.4 bits (189),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 34/53 (64%), Positives = 41/53 (77%), Gaps = 0/53 (0%)
 Frame = +2

Query  248  MADFTTSTHRAKWIFSPQDLKEKFKAVNQRAKQALEKYGTTRMEVDVDGSFSY  406
            MADF TST RAKW+F+PQ L E++KA N RA Q LEK GTT++EVD  GS +Y
Sbjct  1    MADFQTSTQRAKWVFTPQKLAERYKAANHRAVQFLEKCGTTQVEVDASGSLTY  53



>ref|XP_010546708.1| PREDICTED: cyclin-H1-1-like isoform X1 [Tarenaya hassleriana]
Length=333

 Score =   113 bits (283),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 56/110 (51%), Positives = 76/110 (69%), Gaps = 0/110 (0%)
 Frame = +2

Query  437  VEGFVNDIEEFRGAEGEQLDTLKKLLESAKIEADRTMLTDATLLFPPGQLALTALRRANE  616
            +EGFV+D+E F  A  +++  LK +L++A  E D+ MLTDA LLFPPGQLAL ALR AN 
Sbjct  181  IEGFVDDMEAFFQARDDEVQKLKDVLKAATAETDKIMLTDAPLLFPPGQLALAALRMANG  240

Query  617  KLRVFEFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVK  766
             +    F+RYLE I+AR    H++S+L+ LL  IESL+   + PS KD+K
Sbjct  241  IVGAVYFDRYLENIVARPNSGHTVSELTNLLDAIESLVKNYKFPSEKDMK  290


 Score = 85.1 bits (209),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 38/53 (72%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = +2

Query  248  MADFTTSTHRAKWIFSPQDLKEKFKAVNQRAKQALEKYGTTRMEVDVDGSFSY  406
            MADF TSTHRAKWI +PQ L EK+K+VNQRA Q LEKYGTT++EVD  G+ SY
Sbjct  1    MADFQTSTHRAKWILTPQTLAEKYKSVNQRAVQMLEKYGTTQVEVDPSGTLSY  53



>ref|XP_010546709.1| PREDICTED: cyclin-H1-1-like isoform X2 [Tarenaya hassleriana]
Length=327

 Score =   113 bits (283),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 56/110 (51%), Positives = 76/110 (69%), Gaps = 0/110 (0%)
 Frame = +2

Query  437  VEGFVNDIEEFRGAEGEQLDTLKKLLESAKIEADRTMLTDATLLFPPGQLALTALRRANE  616
            +EGFV+D+E F  A  +++  LK +L++A  E D+ MLTDA LLFPPGQLAL ALR AN 
Sbjct  175  IEGFVDDMEAFFQARDDEVQKLKDVLKAATAETDKIMLTDAPLLFPPGQLALAALRMANG  234

Query  617  KLRVFEFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVK  766
             +    F+RYLE I+AR    H++S+L+ LL  IESL+   + PS KD+K
Sbjct  235  IVGAVYFDRYLENIVARPNSGHTVSELTNLLDAIESLVKNYKFPSEKDMK  284


 Score = 85.9 bits (211),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 53/129 (41%), Positives = 72/129 (56%), Gaps = 10/129 (8%)
 Frame = +2

Query  248  MADFTTSTHRAKWIFSPQDLKEKFKAVNQRAKQALEKYGTTRMEVDVDGSFSYVEPPAGA  427
            MADF TSTHRAKWI +PQ L EK+K+VNQRA Q LEKYGTT++EVD  G+ SY  P   A
Sbjct  1    MADFQTSTHRAKWILTPQTLAEKYKSVNQRAVQMLEKYGTTQVEVDPSGTLSY--PTHKA  58

Query  428  KETVEGFVNDIEEFRGA--EGEQLDTLKKLLESAKIEA------DRTMLTDATLLFPPGQ  583
             + ++    + E+F  A  E +  +         KI+A       R  L  + +   P +
Sbjct  59   DKKLKPLSVEEEQFMRAFYEAKLQEVCSAFCFPHKIQATALQYFKRFYLQWSVMQHHPKE  118

Query  584  LALTALRRA  610
            + LT +  A
Sbjct  119  IMLTCVYAA  127



>ref|XP_009418142.1| PREDICTED: cyclin-H1-1 isoform X2 [Musa acuminata subsp. malaccensis]
Length=253

 Score =   112 bits (279),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 55/111 (50%), Positives = 75/111 (68%), Gaps = 0/111 (0%)
 Frame = +2

Query  434  TVEGFVNDIEEFRGAEGEQLDTLKKLLESAKIEADRTMLTDATLLFPPGQLALTALRRAN  613
            +VEGF  D++EF  A  E+ +  K  L++A  E DR MLTDA LL+PPGQL+L +L RAN
Sbjct  102  SVEGFNEDMQEFCHARDEEQEKFKNFLQTANAEVDRIMLTDAPLLYPPGQLSLASLHRAN  161

Query  614  EKLRVFEFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVK  766
            E   V +FERYL  +L+RQ   +S S L   LK I++L+ KL  P+AKD++
Sbjct  162  EVHGVLDFERYLNILLSRQHSAYSTSQLFESLKSIDTLVGKLNIPTAKDMR  212



>ref|XP_010674708.1| PREDICTED: cyclin-H1-1 isoform X2 [Beta vulgaris subsp. vulgaris]
Length=334

 Score =   113 bits (282),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 54/111 (49%), Positives = 80/111 (72%), Gaps = 0/111 (0%)
 Frame = +2

Query  434  TVEGFVNDIEEFRGAEGEQLDTLKKLLESAKIEADRTMLTDATLLFPPGQLALTALRRAN  613
            +++GF+ND+E+F  A   Q+D L++L + A  EAD+ MLTDA LLFPPGQLAL  LR+AN
Sbjct  180  SIDGFINDMEDFCYATNGQVDMLQELHQRAIFEADKAMLTDAPLLFPPGQLALAVLRKAN  239

Query  614  EKLRVFEFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVK  766
            ++L V +FERYLE IL+R    HSI +L+  L  I+ LI +++  + +++K
Sbjct  240  DELLVLDFERYLESILSRHHSAHSILELNQGLNAIDLLIKRIKISNDEEMK  290


 Score = 87.8 bits (216),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 38/52 (73%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = +2

Query  248  MADFTTSTHRAKWIFSPQDLKEKFKAVNQRAKQALEKYGTTRMEVDVDGSFS  403
            MADF TSTHRAKWIF+ Q+L EK+KA NQRA Q+LEKYGTT +++D DGSFS
Sbjct  1    MADFQTSTHRAKWIFTQQELNEKYKAANQRAIQSLEKYGTTCLQIDADGSFS  52



>ref|XP_010674706.1| PREDICTED: cyclin-H1-1 isoform X1 [Beta vulgaris subsp. vulgaris]
 ref|XP_010674707.1| PREDICTED: cyclin-H1-1 isoform X1 [Beta vulgaris subsp. vulgaris]
Length=335

 Score =   113 bits (282),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 54/111 (49%), Positives = 80/111 (72%), Gaps = 0/111 (0%)
 Frame = +2

Query  434  TVEGFVNDIEEFRGAEGEQLDTLKKLLESAKIEADRTMLTDATLLFPPGQLALTALRRAN  613
            +++GF+ND+E+F  A   Q+D L++L + A  EAD+ MLTDA LLFPPGQLAL  LR+AN
Sbjct  180  SIDGFINDMEDFCYATNGQVDMLQELHQRAIFEADKAMLTDAPLLFPPGQLALAVLRKAN  239

Query  614  EKLRVFEFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVK  766
            ++L V +FERYLE IL+R    HSI +L+  L  I+ LI +++  + +++K
Sbjct  240  DELLVLDFERYLESILSRHHSAHSILELNQGLNAIDLLIKRIKISNDEEMK  290


 Score = 87.8 bits (216),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 38/52 (73%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = +2

Query  248  MADFTTSTHRAKWIFSPQDLKEKFKAVNQRAKQALEKYGTTRMEVDVDGSFS  403
            MADF TSTHRAKWIF+ Q+L EK+KA NQRA Q+LEKYGTT +++D DGSFS
Sbjct  1    MADFQTSTHRAKWIFTQQELNEKYKAANQRAIQSLEKYGTTCLQIDADGSFS  52



>ref|XP_010674709.1| PREDICTED: cyclin-H1-1 isoform X3 [Beta vulgaris subsp. vulgaris]
Length=328

 Score =   113 bits (282),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 54/111 (49%), Positives = 80/111 (72%), Gaps = 0/111 (0%)
 Frame = +2

Query  434  TVEGFVNDIEEFRGAEGEQLDTLKKLLESAKIEADRTMLTDATLLFPPGQLALTALRRAN  613
            +++GF+ND+E+F  A   Q+D L++L + A  EAD+ MLTDA LLFPPGQLAL  LR+AN
Sbjct  173  SIDGFINDMEDFCYATNGQVDMLQELHQRAIFEADKAMLTDAPLLFPPGQLALAVLRKAN  232

Query  614  EKLRVFEFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVK  766
            ++L V +FERYLE IL+R    HSI +L+  L  I+ LI +++  + +++K
Sbjct  233  DELLVLDFERYLESILSRHHSAHSILELNQGLNAIDLLIKRIKISNDEEMK  283


 Score = 70.9 bits (172),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 34/52 (65%), Positives = 39/52 (75%), Gaps = 7/52 (13%)
 Frame = +2

Query  248  MADFTTSTHRAKWIFSPQDLKEKFKAVNQRAKQALEKYGTTRMEVDVDGSFS  403
            MADF TSTHRAKWIF+ Q+L EK+KA NQRA Q+LEK       +D DGSFS
Sbjct  1    MADFQTSTHRAKWIFTQQELNEKYKAANQRAIQSLEK-------IDADGSFS  45



>emb|CDX99977.1| BnaC09g03240D [Brassica napus]
Length=331

 Score =   112 bits (281),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 58/110 (53%), Positives = 78/110 (71%), Gaps = 0/110 (0%)
 Frame = +2

Query  437  VEGFVNDIEEFRGAEGEQLDTLKKLLESAKIEADRTMLTDATLLFPPGQLALTALRRANE  616
            +EGFV+++EEF  A  +++  L+ LL++A  EAD+ MLTDA LLF PGQLAL ALR AN 
Sbjct  178  MEGFVSNMEEFLQARDDEIQKLQSLLKAATAEADKVMLTDAPLLFSPGQLALAALRIANG  237

Query  617  KLRVFEFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVK  766
             L V +F+RYLE IL++    H+ S+LS LL  IESL+   + PS KD+K
Sbjct  238  VLGVIDFDRYLENILSQPNSEHTTSELSKLLDGIESLVKNYKYPSEKDMK  287


 Score = 79.3 bits (194),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = +2

Query  248  MADFTTSTHRAKWIFSPQDLKEKFKAVNQRAKQALEKYGTTRMEVDVDGSFSY  406
            MADF TST RAKW+F+PQ L E++KA NQRA Q LEK GTT++EVD  GS +Y
Sbjct  1    MADFQTSTQRAKWVFTPQKLAERYKAANQRAVQFLEKCGTTQVEVDASGSLTY  53



>gb|KJB45253.1| hypothetical protein B456_007G298500 [Gossypium raimondii]
Length=331

 Score =   112 bits (281),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 59/111 (53%), Positives = 76/111 (68%), Gaps = 1/111 (1%)
 Frame = +2

Query  434  TVEGFVNDIEEFRGAEGEQLDTLKKLLESAKIEADRTMLTDATLLFPPGQLALTALRRAN  613
            +VEGFVND+EEF G + ++   LK L E+A++E D+ MLTDA  LFPPGQLAL ALR AN
Sbjct  180  SVEGFVNDMEEFCGVKDDENQMLKDLQETARLEVDKIMLTDAPHLFPPGQLALAALRNAN  239

Query  614  EKLRVFEFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVK  766
            E  RV +FE Y E ILARQ   H+I  L   L  I++ + K + P+ KD+K
Sbjct  240  EMHRVLDFEGY-ELILARQNSKHTILQLIESLDAIDAWVRKFKFPTEKDMK  289


 Score = 97.8 bits (242),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 45/58 (78%), Positives = 48/58 (83%), Gaps = 0/58 (0%)
 Frame = +2

Query  248  MADFTTSTHRAKWIFSPQDLKEKFKAVNQRAKQALEKYGTTRMEVDVDGSFSYVEPPA  421
            MADF TSTHRA WIFSPQ+L EK+KA NQRA Q LEKYGTT+MEVD DGS SY EP A
Sbjct  1    MADFHTSTHRANWIFSPQELVEKYKAANQRAIQTLEKYGTTQMEVDADGSLSYPEPIA  58



>ref|XP_006344637.1| PREDICTED: cyclin-H1-1-like isoform X1 [Solanum tuberosum]
Length=342

 Score =   112 bits (281),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 61/126 (48%), Positives = 84/126 (67%), Gaps = 16/126 (13%)
 Frame = +2

Query  437  VEGFVNDIEEFRGAEGE-QLDTLKKLLESAKIEADRTMLTDATLLFPPGQLALTALRRAN  613
            +EGF++D+EEF GA+ + QL  LK  L++A+IEAD+ M +D  LLFPPGQLAL AL RAN
Sbjct  181  LEGFISDLEEFCGAQDDDQLVALKGALDTARIEADKIMRSDGPLLFPPGQLALAALHRAN  240

Query  614  EKLRVFEFE--------------RYLERILARQ-QPTHSISDLSGLLKPIESLINKLESP  748
                +F+FE              RYL  +L+   QP H+IS+L+G +  I+SLI KL +P
Sbjct  241  AAHGIFDFERSQSLSHLDRSTIIRYLRSVLSHHDQPGHAISELTGSINAIDSLIGKLLTP  300

Query  749  SAKDVK  766
            ++KDVK
Sbjct  301  TSKDVK  306


 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 52/65 (80%), Gaps = 0/65 (0%)
 Frame = +2

Query  248  MADFTTSTHRAKWIFSPQDLKEKFKAVNQRAKQALEKYGTTRMEVDVDGSFSYVEPPAGA  427
            MADF TSTH+ KWI++PQD+K K+K  NQRAKQALE +GTTRMEVD+DG+FSY E    A
Sbjct  1    MADFMTSTHKTKWIYTPQDIKHKYKVANQRAKQALEMFGTTRMEVDIDGTFSYAESQNDA  60

Query  428  KETVE  442
            K+  E
Sbjct  61   KDNAE  65



>ref|XP_010421593.1| PREDICTED: cyclin-H1-1-like [Camelina sativa]
 ref|XP_010421594.1| PREDICTED: cyclin-H1-1-like [Camelina sativa]
Length=335

 Score =   112 bits (280),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 54/110 (49%), Positives = 76/110 (69%), Gaps = 0/110 (0%)
 Frame = +2

Query  437  VEGFVNDIEEFRGAEGEQLDTLKKLLESAKIEADRTMLTDATLLFPPGQLALTALRRANE  616
            +EGFVN++EEF     +++  LK LLE+A   AD+ +LTDA LLFPPGQLAL +L  AN 
Sbjct  181  IEGFVNNMEEFLQVRDDEIQKLKSLLEAATAVADKVILTDAPLLFPPGQLALASLSIANG  240

Query  617  KLRVFEFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVK  766
             LRV +F+RYLE I++++   H+ S+L+ LL  IE L+     P+ KD+K
Sbjct  241  ALRVIDFDRYLENIVSQRNSEHTTSELTKLLDDIEYLVKNYNCPTDKDMK  290


 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = +2

Query  248  MADFTTSTHRAKWIFSPQDLKEKFKAVNQRAKQALEKYGTTRMEVDVDGSFSY  406
            MADF TST RAKWIF+PQ L E++KA NQRA Q L+K GTTR+EVD  GS +Y
Sbjct  1    MADFQTSTQRAKWIFTPQKLAERYKAANQRAVQMLDKCGTTRVEVDASGSLTY  53



>ref|XP_009151194.1| PREDICTED: cyclin-H1-1-like [Brassica rapa]
Length=336

 Score =   112 bits (280),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 57/110 (52%), Positives = 79/110 (72%), Gaps = 0/110 (0%)
 Frame = +2

Query  437  VEGFVNDIEEFRGAEGEQLDTLKKLLESAKIEADRTMLTDATLLFPPGQLALTALRRANE  616
            +EGF+ ++EEF  A  +++  L+ LL++A  EAD+ MLTDA LLFPPGQLAL ALR AN 
Sbjct  183  IEGFIGNMEEFLQARDDEIQKLEILLKAATGEADKVMLTDAPLLFPPGQLALAALRIANG  242

Query  617  KLRVFEFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVK  766
             L V +F+RYLE I+++    H+ S+L+ LL  IESL+ K + PS KD+K
Sbjct  243  VLGVVDFDRYLENIVSQPNSEHTTSELTRLLDDIESLVKKYKYPSEKDMK  292


 Score = 76.6 bits (187),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 34/53 (64%), Positives = 41/53 (77%), Gaps = 0/53 (0%)
 Frame = +2

Query  248  MADFTTSTHRAKWIFSPQDLKEKFKAVNQRAKQALEKYGTTRMEVDVDGSFSY  406
            MADF TST R+KWIF+PQ L E++KA NQRA Q LEK GTT++EVD  G  +Y
Sbjct  1    MADFQTSTQRSKWIFTPQKLAERYKAANQRAVQLLEKCGTTQVEVDASGLLTY  53



>ref|XP_006288154.1| hypothetical protein CARUB_v10001393mg [Capsella rubella]
 gb|EOA21052.1| hypothetical protein CARUB_v10001393mg [Capsella rubella]
Length=334

 Score =   112 bits (280),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 56/110 (51%), Positives = 77/110 (70%), Gaps = 0/110 (0%)
 Frame = +2

Query  437  VEGFVNDIEEFRGAEGEQLDTLKKLLESAKIEADRTMLTDATLLFPPGQLALTALRRANE  616
            +EGFVN++EEF     +++  L+ LL++A  EAD  MLTDA LLFPPGQLAL  LR AN 
Sbjct  181  IEGFVNNMEEFLQVRDDEMLKLENLLKAATAEADIVMLTDAPLLFPPGQLALACLRIANG  240

Query  617  KLRVFEFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVK  766
             L V +F+RYLE+I+++    H+IS+L+ LL  IE +I   + PS KD+K
Sbjct  241  ALGVIDFDRYLEKIVSQPNSEHTISELTELLDNIEYMIKNYKKPSEKDMK  290


 Score = 82.8 bits (203),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = +2

Query  248  MADFTTSTHRAKWIFSPQDLKEKFKAVNQRAKQALEKYGTTRMEVDVDGSFSY  406
            MADF TST RAKWIF+PQ L E++KA NQRA Q LEK GTTR+EVD  GS +Y
Sbjct  1    MADFQTSTQRAKWIFTPQKLAERYKAANQRAVQILEKCGTTRVEVDASGSLTY  53



>gb|AFK42904.1| unknown [Lotus japonicus]
Length=178

 Score =   109 bits (272),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 54/111 (49%), Positives = 74/111 (67%), Gaps = 0/111 (0%)
 Frame = +2

Query  434  TVEGFVNDIEEFRGAEGEQLDTLKKLLESAKIEADRTMLTDATLLFPPGQLALTALRRAN  613
            +VEGF+ND+EEF  A   QL  LK L ++AK+E  + MLTDA LLFPPGQLAL ALR +N
Sbjct  25   SVEGFMNDMEEFCNAGDAQLQMLKTLQDTAKLEVVKMMLTDAPLLFPPGQLALAALRNSN  84

Query  614  EKLRVFEFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVK  766
               +V +F+ YL  I  RQ   H++S+L      I+S + K ++PS K++K
Sbjct  85   ALHKVVDFDSYLRSIFPRQNSMHTMSELIESFNAIDSWVRKYKTPSEKELK  135



>ref|XP_006581842.1| PREDICTED: cyclin-H1-1 isoform X2 [Glycine max]
Length=343

 Score =   112 bits (280),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 58/119 (49%), Positives = 79/119 (66%), Gaps = 8/119 (7%)
 Frame = +2

Query  434  TVEGFVNDIEEFRGAEGEQLDTLKKLL--------ESAKIEADRTMLTDATLLFPPGQLA  589
            +VEGF+ND+EEF  A   QL+ LK L+        E+A+ E D+ MLTDA LLFPPGQLA
Sbjct  182  SVEGFINDMEEFFNAGDNQLEMLKVLVILLFNTLQETARFEVDKMMLTDAPLLFPPGQLA  241

Query  590  LTALRRANEKLRVFEFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVK  766
            L ALR +N   RV +F+ YL  I +R+   H++S+LS  L  I+S + K +SPS K++K
Sbjct  242  LAALRNSNAFHRVIDFDSYLRGIFSRENSMHTMSELSESLDAIDSWVRKYKSPSEKELK  300


 Score =   100 bits (249),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 47/65 (72%), Positives = 51/65 (78%), Gaps = 0/65 (0%)
 Frame = +2

Query  248  MADFTTSTHRAKWIFSPQDLKEKFKAVNQRAKQALEKYGTTRMEVDVDGSFSYVEPPAGA  427
            MADF TSTHRAKWIFSPQ L EK++A NQRAKQ LEK G T MEVDVDGS SY EP   A
Sbjct  1    MADFQTSTHRAKWIFSPQQLVEKYRAANQRAKQILEKCGATLMEVDVDGSLSYPEPQMTA  60

Query  428  KETVE  442
            K++ E
Sbjct  61   KDSAE  65



>gb|AAD02871.1| CAK associated cyclinH homolog [Populus tremula x Populus tremuloides]
Length=332

 Score =   111 bits (278),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 56/111 (50%), Positives = 74/111 (67%), Gaps = 3/111 (3%)
 Frame = +2

Query  434  TVEGFVNDIEEFRGAEGEQLDTLKKLLESAKIEADRTMLTDATLLFPPGQLALTALRRAN  613
            +VEGFV DIEEF     E ++ LK++   A  E D+ MLTDA ++FPPGQLAL AL+ AN
Sbjct  182  SVEGFVADIEEFCHPTDENIEKLKEI---AVAEVDKIMLTDAPVMFPPGQLALAALQSAN  238

Query  614  EKLRVFEFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVK  766
            E  RV +FERYLE +L+RQ   H IS++S  L  +E  + K   P+ KD+K
Sbjct  239  EMHRVLDFERYLESVLSRQNSAHMISEISESLHAVEKWVRKYSFPTDKDMK  289


 Score = 97.1 bits (240),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 49/65 (75%), Gaps = 0/65 (0%)
 Frame = +2

Query  248  MADFTTSTHRAKWIFSPQDLKEKFKAVNQRAKQALEKYGTTRMEVDVDGSFSYVEPPAGA  427
            MADF +S+H+AKWIF+PQ L EK+KA N RAKQ LEKYGTTRM VDVDGS SY EP    
Sbjct  1    MADFQSSSHKAKWIFTPQQLAEKYKATNNRAKQMLEKYGTTRMRVDVDGSLSYPEPQVNM  60

Query  428  KETVE  442
             E  +
Sbjct  61   TENAD  65



>ref|XP_009418139.1| PREDICTED: cyclin-H1-1 isoform X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009418140.1| PREDICTED: cyclin-H1-1 isoform X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009418141.1| PREDICTED: cyclin-H1-1 isoform X1 [Musa acuminata subsp. malaccensis]
Length=332

 Score =   111 bits (277),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 55/111 (50%), Positives = 75/111 (68%), Gaps = 0/111 (0%)
 Frame = +2

Query  434  TVEGFVNDIEEFRGAEGEQLDTLKKLLESAKIEADRTMLTDATLLFPPGQLALTALRRAN  613
            +VEGF  D++EF  A  E+ +  K  L++A  E DR MLTDA LL+PPGQL+L +L RAN
Sbjct  181  SVEGFNEDMQEFCHARDEEQEKFKNFLQTANAEVDRIMLTDAPLLYPPGQLSLASLHRAN  240

Query  614  EKLRVFEFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVK  766
            E   V +FERYL  +L+RQ   +S S L   LK I++L+ KL  P+AKD++
Sbjct  241  EVHGVLDFERYLNILLSRQHSAYSTSQLFESLKSIDTLVGKLNIPTAKDMR  291


 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/65 (62%), Positives = 51/65 (78%), Gaps = 0/65 (0%)
 Frame = +2

Query  248  MADFTTSTHRAKWIFSPQDLKEKFKAVNQRAKQALEKYGTTRMEVDVDGSFSYVEPPAGA  427
            MADF TSTHR++WIFSPQ+L EK +A NQRA ++LE++G TR+EV +DGS SYVEP    
Sbjct  1    MADFQTSTHRSRWIFSPQELLEKREAANQRAAKSLEQFGVTRLEVHLDGSVSYVEPILDQ  60

Query  428  KETVE  442
            K+  E
Sbjct  61   KDNAE  65



>ref|XP_006433379.1| hypothetical protein CICLE_v10001764mg [Citrus clementina]
 ref|XP_006433380.1| hypothetical protein CICLE_v10001764mg [Citrus clementina]
 ref|XP_006472054.1| PREDICTED: cyclin-H1-1-like isoform X1 [Citrus sinensis]
 ref|XP_006472055.1| PREDICTED: cyclin-H1-1-like isoform X2 [Citrus sinensis]
 gb|ESR46619.1| hypothetical protein CICLE_v10001764mg [Citrus clementina]
 gb|ESR46620.1| hypothetical protein CICLE_v10001764mg [Citrus clementina]
Length=337

 Score =   111 bits (277),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 61/126 (48%), Positives = 80/126 (63%), Gaps = 9/126 (7%)
 Frame = +2

Query  407  VEPPAGAKETVEGFVNDIEEFRGAEGEQLDTLKKLLESAKIEADRTMLTDATLLFPPG--  580
            V PP      +EGF+ND+E+F   +  +L  LK L E+AK+E D+ MLTDA LLFPPG  
Sbjct  176  VYPPY---RPLEGFINDMEDFCQVKNGELQMLKDLHETAKLEVDKIMLTDAPLLFPPGQV  232

Query  581  ----QLALTALRRANEKLRVFEFERYLERILARQQPTHSISDLSGLLKPIESLINKLESP  748
                QLAL ALR +N+  RV ++E YL  IL+RQ   H ISDL+  L  I+S + K + P
Sbjct  233  LSVIQLALAALRNSNKVQRVVDYESYLSSILSRQNSGHIISDLTENLDTIDSWVMKYKFP  292

Query  749  SAKDVK  766
            S KD+K
Sbjct  293  SEKDMK  298


 Score =   102 bits (253),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 47/65 (72%), Positives = 53/65 (82%), Gaps = 0/65 (0%)
 Frame = +2

Query  248  MADFTTSTHRAKWIFSPQDLKEKFKAVNQRAKQALEKYGTTRMEVDVDGSFSYVEPPAGA  427
            MADF TSTHRA WIF+PQ+L EK+KA N+RA Q LEKYGTT+MEVDVDGSFSY EP   A
Sbjct  1    MADFQTSTHRANWIFTPQELIEKYKASNRRAIQTLEKYGTTQMEVDVDGSFSYPEPQNNA  60

Query  428  KETVE  442
            K+  E
Sbjct  61   KDNSE  65



>ref|XP_010674710.1| PREDICTED: cyclin-H1-1 isoform X4 [Beta vulgaris subsp. vulgaris]
Length=318

 Score =   110 bits (276),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 53/101 (52%), Positives = 73/101 (72%), Gaps = 0/101 (0%)
 Frame = +2

Query  434  TVEGFVNDIEEFRGAEGEQLDTLKKLLESAKIEADRTMLTDATLLFPPGQLALTALRRAN  613
            +++GF+ND+E+F  A   Q+D L++L + A  EAD+ MLTDA LLFPPGQLAL  LR+AN
Sbjct  180  SIDGFINDMEDFCYATNGQVDMLQELHQRAIFEADKAMLTDAPLLFPPGQLALAVLRKAN  239

Query  614  EKLRVFEFERYLERILARQQPTHSISDLSGLLKPIESLINK  736
            ++L V +FERYLE IL+R    HSI +L+  L  I+ L+ K
Sbjct  240  DELLVLDFERYLESILSRHHSAHSILELNQGLNAIDLLLEK  280


 Score = 87.4 bits (215),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 38/52 (73%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = +2

Query  248  MADFTTSTHRAKWIFSPQDLKEKFKAVNQRAKQALEKYGTTRMEVDVDGSFS  403
            MADF TSTHRAKWIF+ Q+L EK+KA NQRA Q+LEKYGTT +++D DGSFS
Sbjct  1    MADFQTSTHRAKWIFTQQELNEKYKAANQRAIQSLEKYGTTCLQIDADGSFS  52



>ref|XP_006382505.1| hypothetical protein POPTR_0005s02780g [Populus trichocarpa]
 gb|ERP60302.1| hypothetical protein POPTR_0005s02780g [Populus trichocarpa]
Length=334

 Score =   110 bits (276),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 56/111 (50%), Positives = 74/111 (67%), Gaps = 3/111 (3%)
 Frame = +2

Query  434  TVEGFVNDIEEFRGAEGEQLDTLKKLLESAKIEADRTMLTDATLLFPPGQLALTALRRAN  613
            +VEGFV DIEEF     E ++ LK++   A  E D+ MLTDA ++FPPGQLAL AL+ AN
Sbjct  184  SVEGFVADIEEFCHPTDENIEKLKEI---AVAEIDKIMLTDAPVMFPPGQLALAALQSAN  240

Query  614  EKLRVFEFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVK  766
            E  RV +FERYLE +L+RQ   H IS++S  L  +E  + K   P+ KD+K
Sbjct  241  EVHRVLDFERYLESVLSRQNSAHMISEISESLHAVEKWVRKYSFPTDKDMK  291


 Score = 97.1 bits (240),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 49/65 (75%), Gaps = 0/65 (0%)
 Frame = +2

Query  248  MADFTTSTHRAKWIFSPQDLKEKFKAVNQRAKQALEKYGTTRMEVDVDGSFSYVEPPAGA  427
            MADF +S+H+AKWIF+PQ L EK+KA N RAKQ LEKYGTTRM VDVDGS SY EP    
Sbjct  1    MADFQSSSHKAKWIFTPQQLAEKYKATNNRAKQMLEKYGTTRMRVDVDGSLSYPEPQVNM  60

Query  428  KETVE  442
             E  +
Sbjct  61   TENAD  65



>emb|CDY05569.1| BnaA02g31220D [Brassica napus]
Length=331

 Score =   110 bits (275),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 63/137 (46%), Positives = 85/137 (62%), Gaps = 8/137 (6%)
 Frame = +2

Query  356  KYGTTRMEVDVDGSFSYVEPPAGAKETVEGFVNDIEEFRGAEGEQLDTLKKLLESAKIEA  535
            KY    +E D+      V  P  A   +EGFV ++EEF  A  +++  L+ LL++A  EA
Sbjct  159  KYEMASLEFDL-----IVYAPYRA---IEGFVTNMEEFLQARDDEIQKLESLLKAATAEA  210

Query  536  DRTMLTDATLLFPPGQLALTALRRANEKLRVFEFERYLERILARQQPTHSISDLSGLLKP  715
            D+ MLTDA LLFPPGQLAL ALR AN  L V +F+RYLE I+++    H+ S+L  LL  
Sbjct  211  DKVMLTDAPLLFPPGQLALAALRIANGVLGVVDFDRYLENIVSQPNSEHTTSELLKLLDE  270

Query  716  IESLINKLESPSAKDVK  766
            IE L+   + PS KD+K
Sbjct  271  IEYLVKNYKYPSEKDMK  287


 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/53 (58%), Positives = 38/53 (72%), Gaps = 1/53 (2%)
 Frame = +2

Query  248  MADFTTSTHRAKWIFSPQDLKEKFKAVNQRAKQALEKYGTTRMEVDVDGSFSY  406
            MADF TST RAKWIF+P  L++  K +N RA   LEK GTT++EVD  GS +Y
Sbjct  1    MADFQTSTQRAKWIFTPHKLRD-IKLLNHRAVHLLEKCGTTQVEVDASGSLTY  52



>gb|ABK96417.1| unknown [Populus trichocarpa x Populus deltoides]
Length=363

 Score =   110 bits (276),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 56/111 (50%), Positives = 74/111 (67%), Gaps = 3/111 (3%)
 Frame = +2

Query  434  TVEGFVNDIEEFRGAEGEQLDTLKKLLESAKIEADRTMLTDATLLFPPGQLALTALRRAN  613
            +VEGFV DIEEF     E ++ LK++   A  E D+ MLTDA ++FPPGQLAL AL+ AN
Sbjct  182  SVEGFVADIEEFCHPTDEDIEKLKEI---AVAEIDKIMLTDAPVMFPPGQLALAALQSAN  238

Query  614  EKLRVFEFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVK  766
            E  RV +FERYLE +L+RQ   H IS++S  L  +E  + K   P+ KD+K
Sbjct  239  EVHRVLDFERYLESVLSRQNSAHMISEISESLHAVEKWVKKYSFPTDKDMK  289


 Score = 96.7 bits (239),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 49/65 (75%), Gaps = 0/65 (0%)
 Frame = +2

Query  248  MADFTTSTHRAKWIFSPQDLKEKFKAVNQRAKQALEKYGTTRMEVDVDGSFSYVEPPAGA  427
            MADF +S+H+AKWIF+PQ L EK+KA N RAKQ LEKYGTTRM VDVDGS SY EP    
Sbjct  1    MADFQSSSHKAKWIFTPQQLAEKYKATNNRAKQMLEKYGTTRMRVDVDGSLSYPEPQVNM  60

Query  428  KETVE  442
             E  +
Sbjct  61   TENAD  65



>gb|KDO56276.1| hypothetical protein CISIN_1g038028mg [Citrus sinensis]
Length=337

 Score =   110 bits (275),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 61/126 (48%), Positives = 79/126 (63%), Gaps = 9/126 (7%)
 Frame = +2

Query  407  VEPPAGAKETVEGFVNDIEEFRGAEGEQLDTLKKLLESAKIEADRTMLTDATLLFPPG--  580
            V PP      +EGF+ND+E+F   +  +L  LK L E+AK+E D+ MLTDA LLFPPG  
Sbjct  176  VYPPY---RPLEGFINDMEDFCQVKNGELQMLKDLHETAKLEVDKIMLTDAPLLFPPGQV  232

Query  581  ----QLALTALRRANEKLRVFEFERYLERILARQQPTHSISDLSGLLKPIESLINKLESP  748
                QLAL ALR +N+  RV  +E YL  IL+RQ   H ISDL+  L  I+S + K + P
Sbjct  233  LSVIQLALAALRNSNKVQRVVNYESYLSSILSRQNSGHIISDLTENLDTIDSWVMKYKFP  292

Query  749  SAKDVK  766
            S KD+K
Sbjct  293  SEKDMK  298


 Score =   102 bits (254),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 47/65 (72%), Positives = 53/65 (82%), Gaps = 0/65 (0%)
 Frame = +2

Query  248  MADFTTSTHRAKWIFSPQDLKEKFKAVNQRAKQALEKYGTTRMEVDVDGSFSYVEPPAGA  427
            MADF TSTHRA WIF+PQ+L EK+KA N+RA Q LEKYGTT+MEVDVDGSFSY EP   A
Sbjct  1    MADFQTSTHRANWIFTPQELIEKYKASNRRAIQTLEKYGTTQMEVDVDGSFSYPEPQNNA  60

Query  428  KETVE  442
            K+  E
Sbjct  61   KDNSE  65



>ref|XP_011036827.1| PREDICTED: cyclin-H1-1 isoform X1 [Populus euphratica]
Length=335

 Score =   110 bits (274),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 56/111 (50%), Positives = 73/111 (66%), Gaps = 3/111 (3%)
 Frame = +2

Query  434  TVEGFVNDIEEFRGAEGEQLDTLKKLLESAKIEADRTMLTDATLLFPPGQLALTALRRAN  613
            ++EGFV DIEEF     E ++ LK   E A  E D+ MLTDA +LFPPGQLAL AL+ AN
Sbjct  182  SIEGFVADIEEFCHPTDENIEKLK---EIAVAEVDKIMLTDAPVLFPPGQLALAALQSAN  238

Query  614  EKLRVFEFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVK  766
            E  RV +FERYLE +L+RQ   H IS++S  L  ++  + K   P+ KD+K
Sbjct  239  EVHRVLDFERYLESVLSRQNSAHMISEISESLHAVKKWVRKYSFPTDKDMK  289


 Score = 97.1 bits (240),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 49/65 (75%), Gaps = 0/65 (0%)
 Frame = +2

Query  248  MADFTTSTHRAKWIFSPQDLKEKFKAVNQRAKQALEKYGTTRMEVDVDGSFSYVEPPAGA  427
            MADF +S+H+AKWIF+PQ L EK+KA N RAKQ LEKYGTTRM VDVDGS SY EP    
Sbjct  1    MADFQSSSHKAKWIFTPQQLAEKYKATNNRAKQMLEKYGTTRMRVDVDGSLSYPEPQVNM  60

Query  428  KETVE  442
             E  +
Sbjct  61   TENAD  65



>ref|XP_011036828.1| PREDICTED: cyclin-H1-1 isoform X2 [Populus euphratica]
 ref|XP_011036829.1| PREDICTED: cyclin-H1-1 isoform X2 [Populus euphratica]
Length=332

 Score =   110 bits (274),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 55/111 (50%), Positives = 74/111 (67%), Gaps = 3/111 (3%)
 Frame = +2

Query  434  TVEGFVNDIEEFRGAEGEQLDTLKKLLESAKIEADRTMLTDATLLFPPGQLALTALRRAN  613
            ++EGFV DIEEF     E ++ LK++   A  E D+ MLTDA +LFPPGQLAL AL+ AN
Sbjct  182  SIEGFVADIEEFCHPTDENIEKLKEI---AVAEVDKIMLTDAPVLFPPGQLALAALQSAN  238

Query  614  EKLRVFEFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVK  766
            E  RV +FERYLE +L+RQ   H IS++S  L  ++  + K   P+ KD+K
Sbjct  239  EVHRVLDFERYLESVLSRQNSAHMISEISESLHAVKKWVRKYSFPTDKDMK  289


 Score = 97.4 bits (241),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 49/65 (75%), Gaps = 0/65 (0%)
 Frame = +2

Query  248  MADFTTSTHRAKWIFSPQDLKEKFKAVNQRAKQALEKYGTTRMEVDVDGSFSYVEPPAGA  427
            MADF +S+H+AKWIF+PQ L EK+KA N RAKQ LEKYGTTRM VDVDGS SY EP    
Sbjct  1    MADFQSSSHKAKWIFTPQQLAEKYKATNNRAKQMLEKYGTTRMRVDVDGSLSYPEPQVNM  60

Query  428  KETVE  442
             E  +
Sbjct  61   TENAD  65



>ref|XP_010043075.1| PREDICTED: cyclin-H1-1-like isoform X2 [Eucalyptus grandis]
 gb|KCW85106.1| hypothetical protein EUGRSUZ_B01941 [Eucalyptus grandis]
Length=320

 Score =   109 bits (272),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 58/111 (52%), Positives = 75/111 (68%), Gaps = 3/111 (3%)
 Frame = +2

Query  434  TVEGFVNDIEEFRGAEGEQLDTLKKLLESAKIEADRTMLTDATLLFPPGQLALTALRRAN  613
            ++EGF +DI +F  AE +QL  LK   E+AK E D++MLTDA LLFPPGQLAL ALRRAN
Sbjct  179  SIEGFTDDIGDFCHAEDDQLQLLK---ETAKEEVDKSMLTDAPLLFPPGQLALAALRRAN  235

Query  614  EKLRVFEFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVK  766
            E   V ++E YLE +L RQ   HS ++L   L  I+S +   + PS KD+K
Sbjct  236  EVHGVLDYESYLENMLVRQNSIHSSTELIQHLNAIDSSVRTYKFPSEKDMK  286


 Score = 91.3 bits (225),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = +2

Query  248  MADFTTSTHRAKWIFSPQDLKEKFKAVNQRAKQALEKYGTTRMEVDVDGSFSYVEPPAGA  427
            MADF +STHRAKWIF+P  L EK+KA NQRA Q LEKYG TRMEVDVDGS  Y E    +
Sbjct  1    MADFQSSTHRAKWIFTPHGLAEKYKAANQRAIQTLEKYGATRMEVDVDGSLLYREAQVNS  60

Query  428  KE  433
             +
Sbjct  61   ND  62



>ref|XP_010043073.1| PREDICTED: cyclin-H1-1-like isoform X1 [Eucalyptus grandis]
 ref|XP_010043074.1| PREDICTED: cyclin-H1-1-like isoform X1 [Eucalyptus grandis]
Length=321

 Score =   109 bits (272),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 58/111 (52%), Positives = 75/111 (68%), Gaps = 3/111 (3%)
 Frame = +2

Query  434  TVEGFVNDIEEFRGAEGEQLDTLKKLLESAKIEADRTMLTDATLLFPPGQLALTALRRAN  613
            ++EGF +DI +F  AE +QL  LK   E+AK E D++MLTDA LLFPPGQLAL ALRRAN
Sbjct  180  SIEGFTDDIGDFCHAEDDQLQLLK---ETAKEEVDKSMLTDAPLLFPPGQLALAALRRAN  236

Query  614  EKLRVFEFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVK  766
            E   V ++E YLE +L RQ   HS ++L   L  I+S +   + PS KD+K
Sbjct  237  EVHGVLDYESYLENMLVRQNSIHSSTELIQHLNAIDSSVRTYKFPSEKDMK  287


 Score = 90.5 bits (223),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 41/55 (75%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = +2

Query  248  MADFTTSTHRAKWIFSPQDLKEKFKAVNQRAKQALEKYGTTRMEVDVDGSFSYVE  412
            MADF +STHRAKWIF+P  L EK+KA NQRA Q LEKYG TRMEVDVDGS  Y E
Sbjct  1    MADFQSSTHRAKWIFTPHGLAEKYKAANQRAIQTLEKYGATRMEVDVDGSLLYRE  55



>ref|XP_006842697.1| hypothetical protein AMTR_s00147p00079450 [Amborella trichopoda]
 gb|ERN04372.1| hypothetical protein AMTR_s00147p00079450 [Amborella trichopoda]
Length=396

 Score =   108 bits (271),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 54/111 (49%), Positives = 80/111 (72%), Gaps = 2/111 (2%)
 Frame = +2

Query  434  TVEGFVNDIEEFRGAEGEQLDTLKKLLESAKIEADRTMLTDATLLFPPGQLALTALRRAN  613
            +V+GF+ND+E+F  A  +    LK L E+ K+E D+TMLTDA LLFPPGQLAL ALRR+N
Sbjct  244  SVDGFLNDMEDFSHALDD--GKLKALGEATKLEVDKTMLTDAPLLFPPGQLALAALRRSN  301

Query  614  EKLRVFEFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVK  766
            E  +V +F+RYLE + ++Q   H+  +L+  L  I+S+++ L+ P AKD++
Sbjct  302  EVHKVLDFKRYLESLCSQQNGAHTSHELTKCLSAIDSVVSTLKIPEAKDMR  352


 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/73 (55%), Positives = 52/73 (71%), Gaps = 0/73 (0%)
 Frame = +2

Query  227  GLTEQTTMADFTTSTHRAKWIFSPQDLKEKFKAVNQRAKQALEKYGTTRMEVDVDGSFSY  406
             L+    MADF +STHR +W+F+PQ L EK  A NQRA + LEKYG+TR+EVD+DGS SY
Sbjct  55   SLSLSIVMADFQSSTHRERWMFTPQALIEKCHAANQRALRTLEKYGSTRLEVDIDGSLSY  114

Query  407  VEPPAGAKETVEG  445
             +P   A+E  +G
Sbjct  115  PKPQTNARENGDG  127



>ref|XP_010042910.1| PREDICTED: cyclin-H1-1-like isoform X2 [Eucalyptus grandis]
 gb|KCW85019.1| hypothetical protein EUGRSUZ_B01853 [Eucalyptus grandis]
Length=320

 Score =   107 bits (268),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 57/111 (51%), Positives = 75/111 (68%), Gaps = 3/111 (3%)
 Frame = +2

Query  434  TVEGFVNDIEEFRGAEGEQLDTLKKLLESAKIEADRTMLTDATLLFPPGQLALTALRRAN  613
            ++EGF +D+ +F  AE +QL  LK   E+AK E D++MLTDA LLFPPGQLAL ALRRAN
Sbjct  179  SIEGFTDDLGDFCHAEDDQLQLLK---ETAKEEVDKSMLTDAPLLFPPGQLALAALRRAN  235

Query  614  EKLRVFEFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVK  766
            E   V ++E YLE +L RQ   HS ++L   L  I+S +   + PS KD+K
Sbjct  236  EVHGVLDYESYLENMLVRQNSIHSSTELIQHLNAIDSSVRTYKFPSEKDMK  286


 Score = 91.3 bits (225),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = +2

Query  248  MADFTTSTHRAKWIFSPQDLKEKFKAVNQRAKQALEKYGTTRMEVDVDGSFSYVEPPAGA  427
            MADF +STHRAKWIF+P  L EK+KA NQRA Q LEKYG TRMEVDVDGS  Y E    +
Sbjct  1    MADFQSSTHRAKWIFTPHGLAEKYKAANQRAIQTLEKYGATRMEVDVDGSLLYREAQVNS  60

Query  428  KE  433
             +
Sbjct  61   ND  62



>ref|XP_010042901.1| PREDICTED: cyclin-H1-1-like isoform X1 [Eucalyptus grandis]
Length=321

 Score =   107 bits (268),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 57/111 (51%), Positives = 75/111 (68%), Gaps = 3/111 (3%)
 Frame = +2

Query  434  TVEGFVNDIEEFRGAEGEQLDTLKKLLESAKIEADRTMLTDATLLFPPGQLALTALRRAN  613
            ++EGF +D+ +F  AE +QL  LK   E+AK E D++MLTDA LLFPPGQLAL ALRRAN
Sbjct  180  SIEGFTDDLGDFCHAEDDQLQLLK---ETAKEEVDKSMLTDAPLLFPPGQLALAALRRAN  236

Query  614  EKLRVFEFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVK  766
            E   V ++E YLE +L RQ   HS ++L   L  I+S +   + PS KD+K
Sbjct  237  EVHGVLDYESYLENMLVRQNSIHSSTELIQHLNAIDSSVRTYKFPSEKDMK  287


 Score = 90.5 bits (223),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 41/55 (75%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = +2

Query  248  MADFTTSTHRAKWIFSPQDLKEKFKAVNQRAKQALEKYGTTRMEVDVDGSFSYVE  412
            MADF +STHRAKWIF+P  L EK+KA NQRA Q LEKYG TRMEVDVDGS  Y E
Sbjct  1    MADFQSSTHRAKWIFTPHGLAEKYKAANQRAIQTLEKYGATRMEVDVDGSLLYRE  55



>ref|XP_004302415.1| PREDICTED: cyclin-H1-1 [Fragaria vesca subsp. vesca]
Length=332

 Score =   107 bits (268),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 49/110 (45%), Positives = 78/110 (71%), Gaps = 0/110 (0%)
 Frame = +2

Query  434  TVEGFVNDIEEFRGAEGEQLDTLKKLLESAKIEADRTMLTDATLLFPPGQLALTALRRAN  613
            ++EGF+ D+E+F G + EQL  L+ L ++AK++ D+ MLTD  L+FPPGQLAL ALR AN
Sbjct  179  SIEGFIQDMEDFCGLKDEQLPMLQNLRDAAKMDVDKIMLTDTPLMFPPGQLALAALRSAN  238

Query  614  EKLRVFEFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDV  763
            +  RV +F+RYL  +++R+   H+IS+L   L  I+  +++ + PS K++
Sbjct  239  QVHRVVDFDRYLGSMVSRKSSAHTISELVESLNAIDFWVSRYKFPSDKEI  288


 Score = 78.6 bits (192),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/65 (58%), Positives = 47/65 (72%), Gaps = 3/65 (5%)
 Frame = +2

Query  248  MADFTTSTHRAKWIFSPQDLKEKFKAVNQRAKQALEKYGTTRMEVDVDGSFSYVEPPAGA  427
            MADF TSTHR+KWIF+P+ L EK+KA NQ+A +ALEKYG    +V+ DGS SY   P  A
Sbjct  1    MADFQTSTHRSKWIFTPEQLVEKYKAANQQAIEALEKYGVALAKVNDDGSLSY---PEIA  57

Query  428  KETVE  442
            KE  +
Sbjct  58   KENAD  62



>emb|CDX86148.1| BnaA06g28650D [Brassica napus]
Length=326

 Score =   107 bits (268),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 57/111 (51%), Positives = 79/111 (71%), Gaps = 1/111 (1%)
 Frame = +2

Query  437  VEGFVNDIEEFRGAEGEQLDTLKKLLESAKIEADRTMLTDATLLFPPGQLALTALRRANE  616
            +EGF+ ++EEF  A  +++  L+ LL++A  EAD+ MLTDA LLFPPGQLAL ALR AN 
Sbjct  172  IEGFIGNMEEFLQARDDEIQKLEILLKAATGEADKVMLTDAPLLFPPGQLALAALRIANG  231

Query  617  KLRVFEFER-YLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVK  766
             L V +F+R YLE I+++    H+ S+L+ LL  IESL+ K + PS KD+K
Sbjct  232  VLGVVDFDRLYLENIVSQPNSEHTTSELTRLLDDIESLVKKYKYPSEKDMK  282


 Score = 76.3 bits (186),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 34/53 (64%), Positives = 41/53 (77%), Gaps = 0/53 (0%)
 Frame = +2

Query  248  MADFTTSTHRAKWIFSPQDLKEKFKAVNQRAKQALEKYGTTRMEVDVDGSFSY  406
            MADF TST R+KWIF+PQ L E++KA NQRA Q LEK GTT++EVD  G  +Y
Sbjct  1    MADFQTSTQRSKWIFTPQKLAERYKAANQRAVQLLEKCGTTQVEVDASGLLTY  53



>ref|XP_006606942.1| PREDICTED: cyclin-H1-1-like [Glycine max]
Length=159

 Score =   103 bits (258),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 51/99 (52%), Positives = 68/99 (69%), Gaps = 0/99 (0%)
 Frame = +2

Query  434  TVEGFVNDIEEFRGAEGEQLDTLKKLLESAKIEADRTMLTDATLLFPPGQLALTALRRAN  613
            +VEGF+ND+EEF  A   QL+ LK L E+A+ E D+ MLTDA LLFPPGQLAL AL  +N
Sbjct  21   SVEGFINDMEEFFNAGDNQLEMLKTLQETARFEVDKMMLTDAPLLFPPGQLALAALGNSN  80

Query  614  EKLRVFEFERYLERILARQQPTHSISDLSGLLKPIESLI  730
               RV +F+ YL  I +R+   H++S+LS  L  I+S +
Sbjct  81   ALHRVIDFDSYLRGIFSRENSMHTMSELSESLDAIDSWV  119



>ref|XP_009129870.1| PREDICTED: cyclin-H1-1 [Brassica rapa]
Length=335

 Score =   107 bits (266),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 55/110 (50%), Positives = 76/110 (69%), Gaps = 0/110 (0%)
 Frame = +2

Query  437  VEGFVNDIEEFRGAEGEQLDTLKKLLESAKIEADRTMLTDATLLFPPGQLALTALRRANE  616
            +EGFV+++EEF  A  +++  L+ LL++A  EAD+ MLTDA LLFPPGQLAL ALR AN 
Sbjct  182  IEGFVSNMEEFLQARDDEIQKLESLLKAATAEADKFMLTDAPLLFPPGQLALAALRIANG  241

Query  617  KLRVFEFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVK  766
             L V +F+RYLE I+++    H+ S+L  LL  IE  +   + PS KD+K
Sbjct  242  VLGVVDFDRYLENIVSQPNSEHTTSELLKLLDEIEYRVKNYKYPSEKDMK  291


 Score = 77.0 bits (188),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 34/53 (64%), Positives = 41/53 (77%), Gaps = 0/53 (0%)
 Frame = +2

Query  248  MADFTTSTHRAKWIFSPQDLKEKFKAVNQRAKQALEKYGTTRMEVDVDGSFSY  406
            MADF TST RAKWIF+PQ L E++KA NQ+A   LEK GTT++EVD  GS +Y
Sbjct  1    MADFQTSTQRAKWIFTPQKLAERYKAANQKAVHLLEKCGTTQVEVDASGSLTY  53



>emb|CDY25030.1| BnaC02g39780D [Brassica napus]
Length=1285

 Score =   110 bits (276),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 56/110 (51%), Positives = 77/110 (70%), Gaps = 0/110 (0%)
 Frame = +2

Query  437   VEGFVNDIEEFRGAEGEQLDTLKKLLESAKIEADRTMLTDATLLFPPGQLALTALRRANE  616
             +EGFV+++EEF  A  +++  L+ LL++A  EAD+ MLTDA LLFPPGQLAL ALR AN 
Sbjct  1132  IEGFVSNMEEFLQARDDEIQKLESLLKAATAEADKVMLTDAPLLFPPGQLALAALRIANG  1191

Query  617   KLRVFEFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVK  766
              L V +F+RYLE I+++    H+ S+L  LL  IE L+   + PS KD+K
Sbjct  1192  VLEVVDFDRYLENIVSQPNSEHTTSELIKLLDEIEYLVKNYKYPSEKDMK  1241


 Score = 81.3 bits (199),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = +2

Query  245   TMADFTTSTHRAKWIFSPQDLKEKFKAVNQRAKQALEKYGTTRMEVDVDGSFSY  406
              MADF TST RAKWIF+PQ L+E++KA NQRA Q LEK GTT++EVD  GS +Y
Sbjct  953   VMADFQTSTQRAKWIFTPQKLEERYKAANQRAVQLLEKCGTTQVEVDASGSLTY  1006



>ref|XP_007144723.1| hypothetical protein PHAVU_007G1793000g, partial [Phaseolus vulgaris]
 gb|ESW16717.1| hypothetical protein PHAVU_007G1793000g, partial [Phaseolus vulgaris]
Length=250

 Score =   103 bits (256),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 49/65 (75%), Positives = 51/65 (78%), Gaps = 0/65 (0%)
 Frame = +2

Query  248  MADFTTSTHRAKWIFSPQDLKEKFKAVNQRAKQALEKYGTTRMEVDVDGSFSYVEPPAGA  427
            MADF TSTHR KWIFSPQ L EK+KA NQRAKQ LEKYG T MEVDVDGS SY EP   A
Sbjct  1    MADFMTSTHRVKWIFSPQQLVEKYKAANQRAKQILEKYGATLMEVDVDGSLSYPEPQMTA  60

Query  428  KETVE  442
            K+T E
Sbjct  61   KDTGE  65


 Score = 82.8 bits (203),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/69 (57%), Positives = 51/69 (74%), Gaps = 0/69 (0%)
 Frame = +2

Query  434  TVEGFVNDIEEFRGAEGEQLDTLKKLLESAKIEADRTMLTDATLLFPPGQLALTALRRAN  613
            +VEGF+ND+EEF  A  +QL  LK L E+A++E D+ MLTDA LLFPPGQLAL AL  +N
Sbjct  182  SVEGFINDMEEFCNAGDDQLQMLKTLQETARLEVDKMMLTDAPLLFPPGQLALAALGNSN  241

Query  614  EKLRVFEFE  640
               +V +F+
Sbjct  242  ALHKVVDFD  250



>ref|XP_009760268.1| PREDICTED: cyclin-H1-1-like isoform X3 [Nicotiana sylvestris]
Length=182

 Score = 99.0 bits (245),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 51/117 (44%), Positives = 74/117 (63%), Gaps = 18/117 (15%)
 Frame = +2

Query  431  ETVEGFVNDIEEFRGA-EGEQLDTLK-----------------KLLESAKIEADRTMLTD  556
             T++GF++D+EEF GA + +Q+  LK                   LE+A++EAD+ M T+
Sbjct  65   HTLDGFISDLEEFCGAKDDDQIVALKISLLPLLLFLMVPQKIKASLETARMEADKIMRTN  124

Query  557  ATLLFPPGQLALTALRRANEKLRVFEFERYLERILARQQPTHSISDLSGLLKPIESL  727
              LLFPPGQLAL AL RAN +  +F+FERYL  +L+R  P H+IS+L+  +  I+SL
Sbjct  125  GPLLFPPGQLALAALHRANTEHGIFDFERYLRSVLSRHHPAHTISELTASINAIDSL  181



>ref|XP_004981844.1| PREDICTED: cyclin-H1-1-like isoform X1 [Setaria italica]
Length=324

 Score =   100 bits (250),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 47/111 (42%), Positives = 73/111 (66%), Gaps = 0/111 (0%)
 Frame = +2

Query  434  TVEGFVNDIEEFRGAEGEQLDTLKKLLESAKIEADRTMLTDATLLFPPGQLALTALRRAN  613
            ++EGF++D+E F       +  LK+L ++A   AD+ MLTDA LL+ PGQLAL AL ++N
Sbjct  176  SIEGFIDDLEGFCRVGNGAVQHLKELHQTAMSHADKMMLTDAPLLYTPGQLALAALHKSN  235

Query  614  EKLRVFEFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVK  766
            + LRVF+FERYLE I +RQ    ++      +  I  L+++L+ P+ KD++
Sbjct  236  DILRVFDFERYLETIFSRQHSDCTVEQFVQSINAIHYLVDQLKIPTVKDMR  286


 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 36/67 (54%), Positives = 46/67 (69%), Gaps = 8/67 (12%)
 Frame = +2

Query  248  MADFTTSTHRAKWIFSPQDLKEKFKAVNQRAKQALEKYGTTRMEVD-VDGSFSYVEPPAG  424
            M+DF TST R +WIF P DL E++ A NQRA + L +YGTTRM+VD +DGS   V+ P  
Sbjct  1    MSDFRTSTQRERWIFQPHDLMERWAAANQRAAETLAQYGTTRMKVDQLDGS---VDSP--  55

Query  425  AKETVEG  445
              + VEG
Sbjct  56   --DRVEG  60



>ref|XP_010546710.1| PREDICTED: cyclin-H1-1-like isoform X3 [Tarenaya hassleriana]
Length=319

 Score = 99.4 bits (246),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 52/110 (47%), Positives = 70/110 (64%), Gaps = 14/110 (13%)
 Frame = +2

Query  437  VEGFVNDIEEFRGAEGEQLDTLKKLLESAKIEADRTMLTDATLLFPPGQLALTALRRANE  616
            +EGFV+D+E+              +L++A  E D+ MLTDA LLFPPGQLAL ALR AN 
Sbjct  181  IEGFVDDMED--------------VLKAATAETDKIMLTDAPLLFPPGQLALAALRMANG  226

Query  617  KLRVFEFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVK  766
             +    F+RYLE I+AR    H++S+L+ LL  IESL+   + PS KD+K
Sbjct  227  IVGAVYFDRYLENIVARPNSGHTVSELTNLLDAIESLVKNYKFPSEKDMK  276


 Score = 85.5 bits (210),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 38/53 (72%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = +2

Query  248  MADFTTSTHRAKWIFSPQDLKEKFKAVNQRAKQALEKYGTTRMEVDVDGSFSY  406
            MADF TSTHRAKWI +PQ L EK+K+VNQRA Q LEKYGTT++EVD  G+ SY
Sbjct  1    MADFQTSTHRAKWILTPQTLAEKYKSVNQRAVQMLEKYGTTQVEVDPSGTLSY  53



>gb|KCW58355.1| hypothetical protein EUGRSUZ_H01039 [Eucalyptus grandis]
Length=181

 Score = 97.1 bits (240),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 49/85 (58%), Positives = 61/85 (72%), Gaps = 0/85 (0%)
 Frame = +2

Query  512  LESAKIEADRTMLTDATLLFPPGQLALTALRRANEKLRVFEFERYLERILARQQPTHSIS  691
            LE+AK E D+ M+TDA LLFPPGQLALTALR ANE  RV ++ERYLE +L RQ   HS +
Sbjct  63   LETAKEEVDKIMVTDAPLLFPPGQLALTALRHANEVHRVLDYERYLENMLLRQNSIHSST  122

Query  692  DLSGLLKPIESLINKLESPSAKDVK  766
            +L   L  I+SL+   + PS KD+K
Sbjct  123  ELIQHLNAIDSLVRTYKFPSEKDMK  147



>gb|KJB45254.1| hypothetical protein B456_007G298500 [Gossypium raimondii]
Length=256

 Score = 97.8 bits (242),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 45/58 (78%), Positives = 48/58 (83%), Gaps = 0/58 (0%)
 Frame = +2

Query  248  MADFTTSTHRAKWIFSPQDLKEKFKAVNQRAKQALEKYGTTRMEVDVDGSFSYVEPPA  421
            MADF TSTHRA WIFSPQ+L EK+KA NQRA Q LEKYGTT+MEVD DGS SY EP A
Sbjct  1    MADFHTSTHRANWIFSPQELVEKYKAANQRAIQTLEKYGTTQMEVDADGSLSYPEPIA  58


 Score = 90.1 bits (222),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 43/71 (61%), Positives = 53/71 (75%), Gaps = 0/71 (0%)
 Frame = +2

Query  434  TVEGFVNDIEEFRGAEGEQLDTLKKLLESAKIEADRTMLTDATLLFPPGQLALTALRRAN  613
            +VEGFVND+EEF G + ++   LK L E+A++E D+ MLTDA  LFPPGQLAL ALR AN
Sbjct  180  SVEGFVNDMEEFCGVKDDENQMLKDLQETARLEVDKIMLTDAPHLFPPGQLALAALRNAN  239

Query  614  EKLRVFEFERY  646
            E  RV +FE Y
Sbjct  240  EMHRVLDFEGY  250



>gb|AAS13366.1| cyclin H [Glycine max]
Length=150

 Score = 95.5 bits (236),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 45/65 (69%), Positives = 49/65 (75%), Gaps = 0/65 (0%)
 Frame = +2

Query  248  MADFTTSTHRAKWIFSPQDLKEKFKAVNQRAKQALEKYGTTRMEVDVDGSFSYVEPPAGA  427
            MADF  S HRAKWIFSPQ L EK++A NQRAKQ LEK G T MEVDVDGS SY EP   A
Sbjct  1    MADFQDSYHRAKWIFSPQQLVEKYRAANQRAKQILEKCGATLMEVDVDGSLSYPEPQMTA  60

Query  428  KETVE  442
            K++ E
Sbjct  61   KDSAE  65



>gb|ACF88227.1| unknown [Zea mays]
 tpg|DAA51219.1| TPA: cyclin-H isoform 1 [Zea mays]
 tpg|DAA51220.1| TPA: cyclin-H isoform 2 [Zea mays]
 tpg|DAA51221.1| TPA: cyclin-H isoform 3, partial [Zea mays]
Length=168

 Score = 95.5 bits (236),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 47/111 (42%), Positives = 70/111 (63%), Gaps = 0/111 (0%)
 Frame = +2

Query  434  TVEGFVNDIEEFRGAEGEQLDTLKKLLESAKIEADRTMLTDATLLFPPGQLALTALRRAN  613
            ++EGF++D+E+F  A       LK+L ++A    D+ MLTDA LL+ PGQLAL AL ++N
Sbjct  19   SIEGFIDDLEDFCRAGNGPFQRLKELRQAAISHVDKMMLTDAPLLYTPGQLALAALHKSN  78

Query  614  EKLRVFEFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVK  766
            + LRV +FERYLE I +RQ     I      +  I  L+++L  P+ KD++
Sbjct  79   DLLRVVDFERYLEIIFSRQHSDCPIEQFVQSINEINYLVDQLNIPTVKDMR  129



>gb|AES61374.2| cyclin H, putative [Medicago truncatula]
Length=331

 Score = 97.8 bits (242),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 48/111 (43%), Positives = 73/111 (66%), Gaps = 0/111 (0%)
 Frame = +2

Query  434  TVEGFVNDIEEFRGAEGEQLDTLKKLLESAKIEADRTMLTDATLLFPPGQLALTALRRAN  613
            +VEGF + +EE   +  ++L   K L  +A++E D+ MLTD+ LLFPPGQLAL ALR +N
Sbjct  182  SVEGFTDSMEELCISGEDELQKFKALQNTARLEVDKMMLTDSPLLFPPGQLALAALRTSN  241

Query  614  EKLRVFEFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVK  766
                V +F+ +L RI + Q  TH++++L   L  I+S + K +SPS K++K
Sbjct  242  ALHTVVDFDSFLSRIFSHQNSTHTMTELLESLDAIDSWVRKYKSPSEKELK  292


 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 48/65 (74%), Gaps = 0/65 (0%)
 Frame = +2

Query  248  MADFTTSTHRAKWIFSPQDLKEKFKAVNQRAKQALEKYGTTRMEVDVDGSFSYVEPPAGA  427
            MADF TSTHR+KWIFSPQ L EK+KA N+RAKQ L+  G T MEVDVDGS +Y +P   A
Sbjct  1    MADFQTSTHRSKWIFSPQKLIEKYKAANKRAKQTLDTCGATLMEVDVDGSLTYPQPHPNA  60

Query  428  KETVE  442
             +  E
Sbjct  61   NDNGE  65



>ref|XP_010069853.1| PREDICTED: uncharacterized protein LOC104456698 isoform X1 [Eucalyptus 
grandis]
Length=288

 Score = 97.4 bits (241),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 49/85 (58%), Positives = 61/85 (72%), Gaps = 0/85 (0%)
 Frame = +2

Query  512  LESAKIEADRTMLTDATLLFPPGQLALTALRRANEKLRVFEFERYLERILARQQPTHSIS  691
            LE+AK E D+ M+TDA LLFPPGQLALTALR ANE  RV ++ERYLE +L RQ   HS +
Sbjct  118  LETAKEEVDKIMVTDAPLLFPPGQLALTALRHANEVHRVLDYERYLENMLLRQNSIHSST  177

Query  692  DLSGLLKPIESLINKLESPSAKDVK  766
            +L   L  I+SL+   + PS KD+K
Sbjct  178  ELIQHLNAIDSLVRTYKFPSEKDMK  202



>ref|XP_010550979.1| PREDICTED: cyclin-H1-1-like [Tarenaya hassleriana]
Length=331

 Score = 96.7 bits (239),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 51/111 (46%), Positives = 73/111 (66%), Gaps = 1/111 (1%)
 Frame = +2

Query  437  VEGFVNDIEEFRGAEGEQLDTLKKLLESAKIEADRTMLTDATLLFP-PGQLALTALRRAN  613
            +EGFVND+E F     +++  LK +L++A  E D+ MLTDA  L P PG LAL ALR AN
Sbjct  181  IEGFVNDMEAFFQVRDDKVQKLKDVLKAATAETDKIMLTDAPPLSPWPGNLALAALRMAN  240

Query  614  EKLRVFEFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVK  766
              +   +F+RYLE I+++ +  H+IS+L+ +L  IESL    + PS KD+K
Sbjct  241  GIVGAVDFDRYLENIVSQPKSGHAISELTNVLNAIESLAKSYKFPSEKDMK  291


 Score = 75.5 bits (184),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/53 (64%), Positives = 40/53 (75%), Gaps = 0/53 (0%)
 Frame = +2

Query  248  MADFTTSTHRAKWIFSPQDLKEKFKAVNQRAKQALEKYGTTRMEVDVDGSFSY  406
            MADF +STHR KWIF+P  L EK+KA N+RA Q LEK GTT++EVD  GS  Y
Sbjct  1    MADFQSSTHRGKWIFTPHSLAEKYKASNRRAVQMLEKCGTTQVEVDPSGSLLY  53



>ref|XP_003591123.1| Cyclin-H1-1 [Medicago truncatula]
Length=501

 Score = 98.2 bits (243),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 48/111 (43%), Positives = 73/111 (66%), Gaps = 0/111 (0%)
 Frame = +2

Query  434  TVEGFVNDIEEFRGAEGEQLDTLKKLLESAKIEADRTMLTDATLLFPPGQLALTALRRAN  613
            +VEGF + +EE   +  ++L   K L  +A++E D+ MLTD+ LLFPPGQLAL ALR +N
Sbjct  193  SVEGFTDSMEELCISGEDELQKFKALQNTARLEVDKMMLTDSPLLFPPGQLALAALRTSN  252

Query  614  EKLRVFEFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVK  766
                V +F+ +L RI + Q  TH++++L   L  I+S + K +SPS K++K
Sbjct  253  ALHTVVDFDSFLSRIFSHQNSTHTMTELLESLDAIDSWVRKYKSPSEKELK  303


 Score = 89.4 bits (220),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 48/65 (74%), Gaps = 0/65 (0%)
 Frame = +2

Query  248  MADFTTSTHRAKWIFSPQDLKEKFKAVNQRAKQALEKYGTTRMEVDVDGSFSYVEPPAGA  427
            MADF TSTHR+KWIFSPQ L EK+KA N+RAKQ L+  G T MEVDVDGS +Y +P   A
Sbjct  1    MADFQTSTHRSKWIFSPQKLIEKYKAANKRAKQTLDTCGATLMEVDVDGSLTYPQPHPNA  60

Query  428  KETVE  442
             +  E
Sbjct  61   NDNGE  65



>ref|XP_004507893.1| PREDICTED: cyclin-H1-1-like [Cicer arietinum]
Length=354

 Score = 96.7 bits (239),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 46/65 (71%), Positives = 48/65 (74%), Gaps = 0/65 (0%)
 Frame = +2

Query  248  MADFTTSTHRAKWIFSPQDLKEKFKAVNQRAKQALEKYGTTRMEVDVDGSFSYVEPPAGA  427
            MADF TSTHRAKWIFSPQ L EK+ A NQRAKQ LEK G T MEVDVDGS SY EP   A
Sbjct  42   MADFLTSTHRAKWIFSPQQLVEKYTAANQRAKQILEKGGVTLMEVDVDGSLSYPEPQTTA  101

Query  428  KETVE  442
             +  E
Sbjct  102  SDNAE  106


 Score = 93.2 bits (230),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 53/132 (40%), Positives = 80/132 (61%), Gaps = 4/132 (3%)
 Frame = +2

Query  371  RMEVDVDGSFSYVEPPAGAKETVEGFVNDIEEFRGAEGEQLDTLKKLLESAKIEADRTML  550
            R ++D+   F  +        +VEGF N +EE   A GE    +  L  +A++E D+ ML
Sbjct  215  RYQIDLSLEFELI--VYTPYRSVEGF-NYMEELCNA-GEDKRQVLALQNTARLEVDKMML  270

Query  551  TDATLLFPPGQLALTALRRANEKLRVFEFERYLERILARQQPTHSISDLSGLLKPIESLI  730
            TDA LLFPPGQLAL ALR +N   +V +F+ +L R+ + Q  TH++++L   L  I+SL+
Sbjct  271  TDAPLLFPPGQLALAALRNSNALHQVVDFDSFLSRVFSHQNSTHTMAELLESLDAIDSLV  330

Query  731  NKLESPSAKDVK  766
             K  SPS K+++
Sbjct  331  RKYRSPSEKELE  342



>ref|NP_001149855.1| LOC100283483 [Zea mays]
 gb|ACG37017.1| cyclin-H [Zea mays]
Length=329

 Score = 96.3 bits (238),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 47/111 (42%), Positives = 70/111 (63%), Gaps = 0/111 (0%)
 Frame = +2

Query  434  TVEGFVNDIEEFRGAEGEQLDTLKKLLESAKIEADRTMLTDATLLFPPGQLALTALRRAN  613
            ++EGF++D+E+F  A       LK+L ++A    D+ MLTDA LL+ PGQLAL AL ++N
Sbjct  180  SIEGFIDDLEDFCRAGNGPFQRLKELRQAAISHVDKMMLTDAPLLYTPGQLALAALHKSN  239

Query  614  EKLRVFEFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVK  766
            + LRV +FERYLE I +RQ     I      +  I  L+++L  P+ KD++
Sbjct  240  DLLRVVDFERYLEIIFSRQHSDCPIEQFVQSINEINYLVDQLNIPTVKDMR  290


 Score = 73.9 bits (180),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 44/67 (66%), Gaps = 4/67 (6%)
 Frame = +2

Query  248  MADFTTSTHRAKWIFSPQDLKEKFKAVNQRAKQALEKYGTTRMEVD-VDGSFSYVEPPAG  424
            MADF TST R +WIF   DL E++ A NQRA Q L +YGTTR+ VD +DGS SY   P  
Sbjct  1    MADFRTSTQRERWIFQSHDLMERWAAANQRAAQTLAQYGTTRLNVDLLDGSVSY---PES  57

Query  425  AKETVEG  445
              + VEG
Sbjct  58   MPDHVEG  64



>gb|ACN31885.1| unknown [Zea mays]
Length=329

 Score = 96.3 bits (238),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 47/111 (42%), Positives = 70/111 (63%), Gaps = 0/111 (0%)
 Frame = +2

Query  434  TVEGFVNDIEEFRGAEGEQLDTLKKLLESAKIEADRTMLTDATLLFPPGQLALTALRRAN  613
            ++EGF++D+E+F  A       LK+L ++A    D+ MLTDA LL+ PGQLAL AL ++N
Sbjct  180  SIEGFIDDLEDFCRAGNGPFQRLKELRQAAISHVDKMMLTDAPLLYTPGQLALAALHKSN  239

Query  614  EKLRVFEFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVK  766
            + LRV +FERYLE I +RQ     I      +  I  L+++L  P+ KD++
Sbjct  240  DLLRVVDFERYLEIIFSRQHSDCPIEQFVQSINEINYLVDQLNIPTVKDMR  290


 Score = 73.9 bits (180),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 44/67 (66%), Gaps = 4/67 (6%)
 Frame = +2

Query  248  MADFTTSTHRAKWIFSPQDLKEKFKAVNQRAKQALEKYGTTRMEVD-VDGSFSYVEPPAG  424
            MADF TST R +WIF   DL E++ A NQRA Q L +YGTTR+ VD +DGS SY   P  
Sbjct  1    MADFRTSTQRERWIFQSHDLMERWAAANQRAAQTLAQYGTTRLNVDLLDGSVSY---PES  57

Query  425  AKETVEG  445
              + VEG
Sbjct  58   MPDHVEG  64



>ref|XP_006651796.1| PREDICTED: cyclin-H1-1-like [Oryza brachyantha]
Length=328

 Score = 95.9 bits (237),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 46/112 (41%), Positives = 73/112 (65%), Gaps = 2/112 (2%)
 Frame = +2

Query  434  TVEGFVNDIEEF-RGAEGEQLDTLKKLLESAKIEADRTMLTDATLLFPPGQLALTALRRA  610
            ++EGF++D+E+F R   GE    LK+L ++A  + D+ MLTDA LL+ PGQLAL AL ++
Sbjct  178  SIEGFIDDMEDFCRAGNGEH-QRLKELRQTAISQVDKMMLTDAPLLYTPGQLALAALHKS  236

Query  611  NEKLRVFEFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVK  766
            N+  R+  FERYLE + +RQ     +    G +  I  L+++L+ P+ KD++
Sbjct  237  NDMHRILSFERYLESVFSRQHSDCPVEQFVGSINMINYLVDQLKIPTPKDMR  288


 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/59 (58%), Positives = 42/59 (71%), Gaps = 1/59 (2%)
 Frame = +2

Query  248  MADFTTSTHRAKWIFSPQDLKEKFKAVNQRAKQALEKYGTTRMEVD-VDGSFSYVEPPA  421
            MADF TSTHR +WIF   DL +++ A NQRA + L  YGTT ++VD VDGS SY E P+
Sbjct  1    MADFRTSTHRERWIFQTNDLMDRWGAANQRATETLAHYGTTLLKVDPVDGSLSYPEAPS  59



>ref|XP_004496023.1| PREDICTED: cyclin-H1-1-like [Cicer arietinum]
Length=511

 Score = 97.8 bits (242),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 48/111 (43%), Positives = 71/111 (64%), Gaps = 0/111 (0%)
 Frame = +2

Query  434  TVEGFVNDIEEFRGAEGEQLDTLKKLLESAKIEADRTMLTDATLLFPPGQLALTALRRAN  613
            +V GF + ++EF  A  ++L TLK L  +A +E D+ MLTD  LLFPPGQ+AL  LR +N
Sbjct  193  SVVGFTDYMKEFCNAGEDELQTLKALQNTATLEIDKMMLTDGPLLFPPGQMALAGLRTSN  252

Query  614  EKLRVFEFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVK  766
                V +F+ +L RIL+ Q   H++++L   L  I+S + K  SPS K++K
Sbjct  253  ALHNVVDFDSFLSRILSHQNSMHTMAELQESLDAIDSWVRKYRSPSEKELK  303


 Score = 97.4 bits (241),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/65 (69%), Positives = 50/65 (77%), Gaps = 0/65 (0%)
 Frame = +2

Query  248  MADFTTSTHRAKWIFSPQDLKEKFKAVNQRAKQALEKYGTTRMEVDVDGSFSYVEPPAGA  427
            MADF TSTHRAKWIFSPQ L EK++A NQRA+Q LEK G T MEVDVDGS SY EP   A
Sbjct  1    MADFMTSTHRAKWIFSPQKLVEKYEAANQRARQTLEKCGATLMEVDVDGSLSYPEPQTTA  60

Query  428  KETVE  442
             ++ E
Sbjct  61   NDSAE  65



>emb|CDI66532.1| Cyclin-H1-1 [Saccharum hybrid cultivar R570]
Length=330

 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 46/111 (41%), Positives = 69/111 (62%), Gaps = 0/111 (0%)
 Frame = +2

Query  434  TVEGFVNDIEEFRGAEGEQLDTLKKLLESAKIEADRTMLTDATLLFPPGQLALTALRRAN  613
            ++EGF++D+E+F  A       LK+L ++A    D+ MLTDA LL+ PGQLAL AL ++N
Sbjct  180  SIEGFIDDLEDFCRAGNGPFQRLKELRQAAISRVDKMMLTDAPLLYTPGQLALAALHKSN  239

Query  614  EKLRVFEFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVK  766
            + LRV  FERYLE I +RQ     +      +  I  L+++L  P+ KD++
Sbjct  240  DLLRVVNFERYLETIFSRQHSDCPVEQFVQSINTINYLVDQLNIPTVKDMR  290


 Score = 76.6 bits (187),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 39/67 (58%), Positives = 46/67 (69%), Gaps = 4/67 (6%)
 Frame = +2

Query  248  MADFTTSTHRAKWIFSPQDLKEKFKAVNQRAKQALEKYGTTRMEVD-VDGSFSYVEPPAG  424
            MADF TST R +WIF   DL E++ A NQRA Q L +YGTTR+ VD +DGS SY EP   
Sbjct  1    MADFRTSTQRERWIFQSHDLMERWAAANQRAAQTLAQYGTTRLSVDLLDGSVSYPEP---  57

Query  425  AKETVEG  445
            A + VEG
Sbjct  58   APDHVEG  64



>emb|CDI66493.1| Cyclin-H1-1 [Saccharum hybrid cultivar R570]
 emb|CDI66498.1| Cyclin-H1-1 [Saccharum hybrid cultivar R570]
 emb|CDI66571.1| Cyclin-H1-1 [Saccharum hybrid cultivar R570]
Length=330

 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 46/111 (41%), Positives = 69/111 (62%), Gaps = 0/111 (0%)
 Frame = +2

Query  434  TVEGFVNDIEEFRGAEGEQLDTLKKLLESAKIEADRTMLTDATLLFPPGQLALTALRRAN  613
            ++EGF++D+E+F  A       LK+L ++A    D+ MLTDA LL+ PGQLAL AL ++N
Sbjct  180  SIEGFIDDLEDFCRAGNGPFQRLKELRQAAISRVDKMMLTDAPLLYTPGQLALAALHKSN  239

Query  614  EKLRVFEFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVK  766
            + LRV  FERYLE I +RQ     +      +  I  L+++L  P+ KD++
Sbjct  240  DLLRVVNFERYLETIFSRQHSDCPVEQFVQSINTINYLVDQLNIPTVKDMR  290


 Score = 76.6 bits (187),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 39/67 (58%), Positives = 46/67 (69%), Gaps = 4/67 (6%)
 Frame = +2

Query  248  MADFTTSTHRAKWIFSPQDLKEKFKAVNQRAKQALEKYGTTRMEVD-VDGSFSYVEPPAG  424
            MADF TST R +WIF   DL E++ A NQRA Q L +YGTTR+ VD +DGS SY EP   
Sbjct  1    MADFRTSTQRERWIFQSHDLMERWAAANQRAAQTLAQYGTTRLSVDLLDGSVSYPEP---  57

Query  425  AKETVEG  445
            A + VEG
Sbjct  58   APDHVEG  64



>emb|CDI66557.1| Cyclin-H1-1 [Saccharum hybrid cultivar R570]
Length=330

 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 46/111 (41%), Positives = 69/111 (62%), Gaps = 0/111 (0%)
 Frame = +2

Query  434  TVEGFVNDIEEFRGAEGEQLDTLKKLLESAKIEADRTMLTDATLLFPPGQLALTALRRAN  613
            ++EGF++D+E+F  A       LK+L ++A    D+ MLTDA LL+ PGQLAL AL ++N
Sbjct  180  SIEGFIDDLEDFCRAGNGPFQRLKELRQAAISRVDKMMLTDAPLLYTPGQLALAALHKSN  239

Query  614  EKLRVFEFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVK  766
            + LRV  FERYLE I +RQ     +      +  I  L+++L  P+ KD++
Sbjct  240  DLLRVVNFERYLETIFSRQHSDCPVEQFVQSINTINYLVDQLNIPTVKDMR  290


 Score = 76.6 bits (187),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 39/67 (58%), Positives = 46/67 (69%), Gaps = 4/67 (6%)
 Frame = +2

Query  248  MADFTTSTHRAKWIFSPQDLKEKFKAVNQRAKQALEKYGTTRMEVD-VDGSFSYVEPPAG  424
            MADF TST R +WIF   DL E++ A NQRA Q L +YGTTR+ VD +DGS SY EP   
Sbjct  1    MADFRTSTQRERWIFQSHDLMERWAAANQRAAQTLAQYGTTRLSVDLLDGSVSYPEP---  57

Query  425  AKETVEG  445
            A + VEG
Sbjct  58   APDHVEG  64



>emb|CDI66513.1| Cyclin-H1-1 [Saccharum hybrid cultivar R570]
 emb|CDI66593.1| Cyclin-H1-1 [Saccharum hybrid cultivar R570]
Length=330

 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 46/111 (41%), Positives = 69/111 (62%), Gaps = 0/111 (0%)
 Frame = +2

Query  434  TVEGFVNDIEEFRGAEGEQLDTLKKLLESAKIEADRTMLTDATLLFPPGQLALTALRRAN  613
            ++EGF++D+E+F  A       LK+L ++A    D+ MLTDA LL+ PGQLAL AL ++N
Sbjct  180  SIEGFIDDLEDFCRAGNGPFQRLKELRQAAISRVDKMMLTDAPLLYTPGQLALAALHKSN  239

Query  614  EKLRVFEFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVK  766
            + LRV  FERYLE I +RQ     +      +  I  L+++L  P+ KD++
Sbjct  240  DLLRVVNFERYLETIFSRQHSDCPVEQFVQSINTINYLVDQLNIPTVKDMR  290


 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 38/67 (57%), Positives = 46/67 (69%), Gaps = 4/67 (6%)
 Frame = +2

Query  248  MADFTTSTHRAKWIFSPQDLKEKFKAVNQRAKQALEKYGTTRMEVD-VDGSFSYVEPPAG  424
            MADF TST R +WIF   DL E++ A N+RA Q L +YGTTR+ VD +DGS SY EP   
Sbjct  1    MADFRTSTQRERWIFQSHDLMERWAAANKRAAQTLAQYGTTRLSVDLLDGSVSYPEP---  57

Query  425  AKETVEG  445
            A + VEG
Sbjct  58   APDHVEG  64



>gb|KCW60766.1| hypothetical protein EUGRSUZ_H03488 [Eucalyptus grandis]
Length=181

 Score = 92.8 bits (229),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 47/85 (55%), Positives = 59/85 (69%), Gaps = 0/85 (0%)
 Frame = +2

Query  512  LESAKIEADRTMLTDATLLFPPGQLALTALRRANEKLRVFEFERYLERILARQQPTHSIS  691
            LE+AK E D+ M+TDA LLFPPGQLAL ALR ANE  RV ++ERYLE +L RQ   HS +
Sbjct  63   LETAKEEVDKIMVTDAPLLFPPGQLALAALRHANEVHRVLDYERYLENMLIRQNSIHSST  122

Query  692  DLSGLLKPIESLINKLESPSAKDVK  766
            +L   L  I+S +   + PS KD+K
Sbjct  123  ELIQHLNAIDSSVRTYKFPSEKDMK  147



>ref|XP_002466497.1| hypothetical protein SORBIDRAFT_01g008760 [Sorghum bicolor]
 gb|EER93495.1| hypothetical protein SORBIDRAFT_01g008760 [Sorghum bicolor]
Length=318

 Score = 94.4 bits (233),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 45/111 (41%), Positives = 68/111 (61%), Gaps = 0/111 (0%)
 Frame = +2

Query  434  TVEGFVNDIEEFRGAEGEQLDTLKKLLESAKIEADRTMLTDATLLFPPGQLALTALRRAN  613
            ++EGF++D+E+F          LK+L ++A    D+ MLTDA LL+ PGQLAL AL ++N
Sbjct  180  SIEGFIDDLEDFCRVGNGPFQRLKELRQAAVSHVDKMMLTDAPLLYTPGQLALAALHKSN  239

Query  614  EKLRVFEFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVK  766
            + LRV  FERYLE I +RQ     +      +  I  L+++L  P+ KD++
Sbjct  240  DLLRVVNFERYLETIFSRQHSDCPVEQFVQSINTINYLVDQLNIPTVKDLR  290


 Score = 79.7 bits (195),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 40/67 (60%), Positives = 47/67 (70%), Gaps = 4/67 (6%)
 Frame = +2

Query  248  MADFTTSTHRAKWIFSPQDLKEKFKAVNQRAKQALEKYGTTRMEVD-VDGSFSYVEPPAG  424
            MADF TST R +WIF P DL E++ A NQRA Q L +YGTTR+ VD +DGS SY EP   
Sbjct  1    MADFRTSTQRERWIFQPHDLMERWAAANQRAVQTLAQYGTTRLSVDLLDGSVSYPEP---  57

Query  425  AKETVEG  445
            A + VEG
Sbjct  58   APDHVEG  64



>gb|AAR07076.1| cyclin H-1 [Oryza sativa Japonica Group]
Length=328

 Score = 93.2 bits (230),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 46/112 (41%), Positives = 71/112 (63%), Gaps = 2/112 (2%)
 Frame = +2

Query  434  TVEGFVNDIEEF-RGAEGEQLDTLKKLLESAKIEADRTMLTDATLLFPPGQLALTALRRA  610
            ++EGFV+D+E+F R   GE    L+ L ++A  + D+ MLTDA LL+ PGQLAL AL ++
Sbjct  180  SIEGFVDDMEDFCRAGNGEH-QRLQDLRQTAISQVDKMMLTDAPLLYTPGQLALAALHKS  238

Query  611  NEKLRVFEFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVK  766
            N+  ++  FERYLE + +RQ     I    G +  I  L+ +L+ P+ KD++
Sbjct  239  NDMHKILNFERYLESVFSRQHSDCPIEQFVGSINMINYLVEQLKIPTPKDMR  290


 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/57 (61%), Positives = 43/57 (75%), Gaps = 1/57 (2%)
 Frame = +2

Query  248  MADFTTSTHRAKWIFSPQDLKEKFKAVNQRAKQALEKYGTTRMEVD-VDGSFSYVEP  415
            MADF TSTHR +WIF   DL +++ A NQRA + L +YGTTR++VD VDGS SY EP
Sbjct  1    MADFRTSTHRERWIFQTNDLMDRWGAANQRATETLVQYGTTRLKVDPVDGSLSYPEP  57



>ref|NP_001051203.1| Os03g0737600 [Oryza sativa Japonica Group]
 sp|Q10D80.1|CCH11_ORYSJ RecName: Full=Cyclin-H1-1; Short=CycH1;1; AltName: Full=Cyclin-H-1; 
Short=CycH-1 [Oryza sativa Japonica Group]
 dbj|BAB11694.1| cyclin H-1 [Oryza sativa]
 gb|ABF98764.1| Cyclin, N-terminal domain containing protein, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF13117.1| Os03g0737600 [Oryza sativa Japonica Group]
 dbj|BAG95259.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97262.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC76145.1| hypothetical protein OsI_13435 [Oryza sativa Indica Group]
 gb|EEE59890.1| hypothetical protein OsJ_12494 [Oryza sativa Japonica Group]
Length=330

 Score = 93.2 bits (230),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 46/112 (41%), Positives = 71/112 (63%), Gaps = 2/112 (2%)
 Frame = +2

Query  434  TVEGFVNDIEEF-RGAEGEQLDTLKKLLESAKIEADRTMLTDATLLFPPGQLALTALRRA  610
            ++EGFV+D+E+F R   GE    L+ L ++A  + D+ MLTDA LL+ PGQLAL AL ++
Sbjct  180  SIEGFVDDMEDFCRAGNGEH-QRLQDLRQTAISQVDKMMLTDAPLLYTPGQLALAALHKS  238

Query  611  NEKLRVFEFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVK  766
            N+  ++  FERYLE + +RQ     I    G +  I  L+ +L+ P+ KD++
Sbjct  239  NDMHKILNFERYLESVFSRQHSDCPIEQFVGSINMINYLVEQLKIPTPKDMR  290


 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/57 (61%), Positives = 43/57 (75%), Gaps = 1/57 (2%)
 Frame = +2

Query  248  MADFTTSTHRAKWIFSPQDLKEKFKAVNQRAKQALEKYGTTRMEVD-VDGSFSYVEP  415
            MADF TSTHR +WIF   DL +++ A NQRA + L +YGTTR++VD VDGS SY EP
Sbjct  1    MADFRTSTHRERWIFQTNDLMDRWGAANQRATETLVQYGTTRLKVDPVDGSLSYPEP  57



>emb|CDI66519.1| Cyclin-H1-1 [Saccharum hybrid cultivar R570]
 emb|CDI66576.1| Cyclin-H1-1 [Saccharum hybrid cultivar R570]
 emb|CDI66612.1| Cyclin-H1-1 [Saccharum hybrid cultivar R570]
Length=330

 Score = 92.0 bits (227),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 45/111 (41%), Positives = 68/111 (61%), Gaps = 0/111 (0%)
 Frame = +2

Query  434  TVEGFVNDIEEFRGAEGEQLDTLKKLLESAKIEADRTMLTDATLLFPPGQLALTALRRAN  613
            ++EGF++D+E+F  A       LK+L ++A    D+ MLTDA LL+ PGQLAL AL ++N
Sbjct  180  SIEGFIDDLEDFCRAGNGPFQRLKELRQAAISRVDKMMLTDAPLLYTPGQLALAALHKSN  239

Query  614  EKLRVFEFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVK  766
            + LRV  FE YLE I +RQ     +      +  I  L+++L  P+ KD++
Sbjct  240  DLLRVVNFEGYLETIFSRQHSDCPVEQFVQSINTINYLVDQLNIPTVKDMR  290


 Score = 76.6 bits (187),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 39/67 (58%), Positives = 46/67 (69%), Gaps = 4/67 (6%)
 Frame = +2

Query  248  MADFTTSTHRAKWIFSPQDLKEKFKAVNQRAKQALEKYGTTRMEVD-VDGSFSYVEPPAG  424
            MADF TST R +WIF   DL E++ A NQRA Q L +YGTTR+ VD +DGS SY EP   
Sbjct  1    MADFRTSTQRERWIFQSHDLMERWAAANQRAAQTLAQYGTTRLSVDLLDGSVSYPEP---  57

Query  425  AKETVEG  445
            A + VEG
Sbjct  58   APDHVEG  64



>ref|XP_010026956.1| PREDICTED: uncharacterized protein LOC104417359 [Eucalyptus grandis]
Length=371

 Score = 92.0 bits (227),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 47/85 (55%), Positives = 59/85 (69%), Gaps = 0/85 (0%)
 Frame = +2

Query  512  LESAKIEADRTMLTDATLLFPPGQLALTALRRANEKLRVFEFERYLERILARQQPTHSIS  691
            LE+AK E D+ M+TDA LLFPPGQLAL ALR ANE  RV ++ERYLE +L RQ   HS +
Sbjct  225  LETAKEEVDKIMVTDAPLLFPPGQLALAALRHANEVHRVLDYERYLENMLIRQNSIHSST  284

Query  692  DLSGLLKPIESLINKLESPSAKDVK  766
            +L   L  I+S +   + PS KD+K
Sbjct  285  ELIQHLNAIDSSVRTYKFPSEKDMK  309



>gb|AAP03415.1| cyclin H-1 [Oryza sativa Japonica Group]
Length=328

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 46/112 (41%), Positives = 70/112 (63%), Gaps = 4/112 (4%)
 Frame = +2

Query  434  TVEGFVNDIEEF-RGAEGEQLDTLKKLLESAKIEADRTMLTDATLLFPPGQLALTALRRA  610
            ++EGFV+D+E+F R   GE    L+ L ++A  + D+ MLTDA LL+ PGQLAL AL ++
Sbjct  180  SIEGFVDDMEDFCRAGNGEH-QRLQDLRQTAISQVDKMMLTDAPLLYTPGQLALAALHKS  238

Query  611  NEKLRVFEFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVK  766
            N+  ++  FERYLE + +RQ     I    G +  I  L  +L+ P+ KD++
Sbjct  239  NDMHKILNFERYLESVFSRQHSDCPIEQFVGSINMINYL--QLKIPTPKDMR  288


 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/57 (61%), Positives = 43/57 (75%), Gaps = 1/57 (2%)
 Frame = +2

Query  248  MADFTTSTHRAKWIFSPQDLKEKFKAVNQRAKQALEKYGTTRMEVD-VDGSFSYVEP  415
            MADF TSTHR +WIF   DL +++ A NQRA + L +YGTTR++VD VDGS SY EP
Sbjct  1    MADFRTSTHRERWIFQTNDLMDRWGAANQRATETLVQYGTTRLKVDPVDGSLSYPEP  57



>ref|XP_003560004.1| PREDICTED: cyclin-H1-1 isoform X2 [Brachypodium distachyon]
Length=328

 Score = 87.0 bits (214),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/110 (37%), Positives = 67/110 (61%), Gaps = 0/110 (0%)
 Frame = +2

Query  437  VEGFVNDIEEFRGAEGEQLDTLKKLLESAKIEADRTMLTDATLLFPPGQLALTALRRANE  616
            +EGF++D++ F  A       LK+L ++A    D+ MLTDA LL+ PGQLAL AL ++N+
Sbjct  181  IEGFIDDMDGFCKAGNGAHQRLKELHQTANSHVDKMMLTDAPLLYSPGQLALAALSKSND  240

Query  617  KLRVFEFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVK  766
              +V  FERYL  + +RQ+    +      +  I  L+++L+ P+ KD++
Sbjct  241  MHQVLNFERYLGSVFSRQKSNCPVEQFVQTINAINYLVDQLQIPTLKDMR  290


 Score = 79.7 bits (195),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 35/57 (61%), Positives = 44/57 (77%), Gaps = 1/57 (2%)
 Frame = +2

Query  248  MADFTTSTHRAKWIFSPQDLKEKFKAVNQRAKQALEKYGTTRMEVD-VDGSFSYVEP  415
            M+DF TSTHR +WIF P DL +K+ A NQR+ + L +YGTTR++VD VDGS SY EP
Sbjct  1    MSDFQTSTHRERWIFQPHDLMDKWAAANQRSAETLAQYGTTRLKVDPVDGSISYPEP  57



>ref|XP_010230296.1| PREDICTED: cyclin-H1-1 isoform X1 [Brachypodium distachyon]
Length=335

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/110 (37%), Positives = 67/110 (61%), Gaps = 0/110 (0%)
 Frame = +2

Query  437  VEGFVNDIEEFRGAEGEQLDTLKKLLESAKIEADRTMLTDATLLFPPGQLALTALRRANE  616
            +EGF++D++ F  A       LK+L ++A    D+ MLTDA LL+ PGQLAL AL ++N+
Sbjct  185  IEGFIDDMDGFCKAGNGAHQRLKELHQTANSHVDKMMLTDAPLLYSPGQLALAALSKSND  244

Query  617  KLRVFEFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVK  766
              +V  FERYL  + +RQ+    +      +  I  L+++L+ P+ KD++
Sbjct  245  MHQVLNFERYLGSVFSRQKSNCPVEQFVQTINAINYLVDQLQIPTLKDMR  294


 Score = 79.7 bits (195),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 35/57 (61%), Positives = 44/57 (77%), Gaps = 1/57 (2%)
 Frame = +2

Query  248  MADFTTSTHRAKWIFSPQDLKEKFKAVNQRAKQALEKYGTTRMEVD-VDGSFSYVEP  415
            M+DF TSTHR +WIF P DL +K+ A NQR+ + L +YGTTR++VD VDGS SY EP
Sbjct  1    MSDFQTSTHRERWIFQPHDLMDKWAAANQRSAETLAQYGTTRLKVDPVDGSISYPEP  57



>ref|XP_007219466.1| hypothetical protein PRUPE_ppa021360mg [Prunus persica]
 gb|EMJ20665.1| hypothetical protein PRUPE_ppa021360mg [Prunus persica]
Length=128

 Score = 82.8 bits (203),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 42/80 (53%), Positives = 54/80 (68%), Gaps = 0/80 (0%)
 Frame = +2

Query  527  IEADRTMLTDATLLFPPGQLALTALRRANEKLRVFEFERYLERILARQQPTHSISDLSGL  706
            +E D+ MLTDA LLFPP QLAL ALR AN+  +V +FERYL    +RQ   H++S+L  L
Sbjct  1    MEVDKIMLTDAPLLFPPEQLALAALRSANQVHKVVDFERYLRSTPSRQSSEHTVSELVEL  60

Query  707  LKPIESLINKLESPSAKDVK  766
            L  I+S   K + PS KD+K
Sbjct  61   LNAIDSWARKYKFPSDKDLK  80



>emb|CBB36490.1| Oryza sativa protein similar to cyclin H-1 AAP03415 [Saccharum 
hybrid cultivar R570]
Length=258

 Score = 84.7 bits (208),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 43/95 (45%), Positives = 60/95 (63%), Gaps = 3/95 (3%)
 Frame = +2

Query  434  TVEGFVNDIEEFRGAEGEQLDTLKKLLESAKIEADRTMLTDATLLFPPGQLALTALRRAN  613
            ++EGF++D+E+F  A       LK+L ++A    D+ MLTDA LL+ PGQLAL AL ++N
Sbjct  158  SIEGFIDDLEDFCRAGNGPFQRLKELRQAAISRVDKMMLTDAPLLYTPGQLALAALHKSN  217

Query  614  EKLRVFEFERYLERILARQQ---PTHSISDLSGLL  709
            + LRV  FERYLE I +RQ    P      L+ L+
Sbjct  218  DLLRVINFERYLETIFSRQHSDCPVEQFVQLTSLI  252


 Score = 76.3 bits (186),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 39/67 (58%), Positives = 46/67 (69%), Gaps = 4/67 (6%)
 Frame = +2

Query  248  MADFTTSTHRAKWIFSPQDLKEKFKAVNQRAKQALEKYGTTRMEVD-VDGSFSYVEPPAG  424
            MADF TST R +WIF   DL E++ A NQRA Q L +YGTTR+ VD +DGS SY EP   
Sbjct  1    MADFRTSTQRERWIFQSHDLMERWAAANQRAAQTLAQYGTTRLSVDLLDGSVSYPEP---  57

Query  425  AKETVEG  445
            A + VEG
Sbjct  58   APDHVEG  64



>emb|CBB36468.1| Oryza sativa protein similar to cyclin H-1 AAP03415 [Saccharum 
hybrid cultivar R570]
Length=258

 Score = 84.3 bits (207),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 43/95 (45%), Positives = 60/95 (63%), Gaps = 3/95 (3%)
 Frame = +2

Query  434  TVEGFVNDIEEFRGAEGEQLDTLKKLLESAKIEADRTMLTDATLLFPPGQLALTALRRAN  613
            ++EGF++D+E+F  A       LK+L ++A    D+ MLTDA LL+ PGQLAL AL ++N
Sbjct  158  SIEGFIDDLEDFCRAGNGPFQRLKELRQAAISRVDKMMLTDAPLLYTPGQLALAALHKSN  217

Query  614  EKLRVFEFERYLERILARQQ---PTHSISDLSGLL  709
            + LRV  FERYLE I +RQ    P      L+ L+
Sbjct  218  DLLRVVNFERYLETIFSRQHSDCPVEQFVQLTSLI  252


 Score = 76.3 bits (186),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 39/67 (58%), Positives = 46/67 (69%), Gaps = 4/67 (6%)
 Frame = +2

Query  248  MADFTTSTHRAKWIFSPQDLKEKFKAVNQRAKQALEKYGTTRMEVD-VDGSFSYVEPPAG  424
            MADF TST R +WIF   DL E++ A NQRA Q L +YGTTR+ VD +DGS SY EP   
Sbjct  1    MADFRTSTQRERWIFQSHDLMERWAAANQRAAQTLAQYGTTRLSVDLLDGSVSYPEP---  57

Query  425  AKETVEG  445
            A + VEG
Sbjct  58   APDHVEG  64



>emb|CDI66546.1| Cyclin-H1-1, partial [Saccharum hybrid cultivar R570]
Length=277

 Score = 84.3 bits (207),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 46/102 (45%), Positives = 65/102 (64%), Gaps = 4/102 (4%)
 Frame = +2

Query  434  TVEGFVNDIEEFRGAEGEQLDTLKKLLESAKIEADRTMLTDATLLFPPGQLALTALRRAN  613
            ++EGF++D+E+F  A       LK+L ++A    D+ MLTDA LL+ PGQLAL AL ++N
Sbjct  180  SIEGFIDDLEDFCRAGNGPFQRLKELRQAAISRVDKMMLTDAPLLYTPGQLALAALHKSN  239

Query  614  EKLRVFEFERYLERILARQQPTHSISDLSGLLKPIESLINKL  739
            + LRV  FERYLE I +RQ   HS   +   ++ I + IN L
Sbjct  240  DLLRVVNFERYLETIFSRQ---HSDCPVEQFVQSINT-INYL  277


 Score = 76.3 bits (186),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/67 (58%), Positives = 46/67 (69%), Gaps = 4/67 (6%)
 Frame = +2

Query  248  MADFTTSTHRAKWIFSPQDLKEKFKAVNQRAKQALEKYGTTRMEVD-VDGSFSYVEPPAG  424
            MADF TST R +WIF   DL E++ A NQRA Q L +YGTTR+ VD +DGS SY EP   
Sbjct  1    MADFRTSTQRERWIFQSHDLMERWAAANQRAAQTLAQYGTTRLSVDLLDGSVSYPEP---  57

Query  425  AKETVEG  445
            A + VEG
Sbjct  58   APDHVEG  64



>ref|XP_002984036.1| hypothetical protein SELMODRAFT_445744 [Selaginella moellendorffii]
 gb|EFJ15048.1| hypothetical protein SELMODRAFT_445744 [Selaginella moellendorffii]
Length=331

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 47/113 (42%), Positives = 72/113 (64%), Gaps = 2/113 (2%)
 Frame = +2

Query  434  TVEGFVNDIEEFRGAEGEQLDTLKKL-LESAKI-EADRTMLTDATLLFPPGQLALTALRR  607
            +++GFV DI+++  A  ++  + K L L+S  I + D  +LTD  LLFPPGQLAL ALR 
Sbjct  177  SLDGFVLDIQKWADAAKDENVSQKILDLQSEAIRKVDAMLLTDCPLLFPPGQLALAALRS  236

Query  608  ANEKLRVFEFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVK  766
            AN + R  + E+YL  +  RQQ  HS S+L G+L  I +L++   +P  ++V+
Sbjct  237  ANVQERAIDMEKYLRGVCERQQQKHSYSELVGMLNQIAALVDAARTPIEEEVR  289


 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 42/60 (70%), Gaps = 0/60 (0%)
 Frame = +2

Query  248  MADFTTSTHRAKWIFSPQDLKEKFKAVNQRAKQALEKYGTTRMEVDVDGSFSYVEPPAGA  427
            MADF TSTHR +WIF+ QDL EK  A N RA QAL+++G TR+E+  DGS +Y     GA
Sbjct  1    MADFLTSTHRDRWIFTVQDLVEKASAANARAVQALQQHGATRVEIQPDGSLAYPGSENGA  60



>ref|XP_010024316.1| PREDICTED: uncharacterized protein LOC104414824 isoform X3 [Eucalyptus 
grandis]
Length=395

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 42/71 (59%), Positives = 51/71 (72%), Gaps = 0/71 (0%)
 Frame = +2

Query  512  LESAKIEADRTMLTDATLLFPPGQLALTALRRANEKLRVFEFERYLERILARQQPTHSIS  691
            LE+AK E D+ M+TDA LLFPPGQLAL ALR ANE  RV ++ERYLE +L RQ   HS +
Sbjct  127  LETAKEEVDKIMVTDAPLLFPPGQLALAALRHANEVHRVLDYERYLENMLIRQNSIHSST  186

Query  692  DLSGLLKPIES  724
            +L   L  I+S
Sbjct  187  ELIQHLNAIDS  197



>ref|XP_010024315.1| PREDICTED: uncharacterized protein LOC104414824 isoform X2 [Eucalyptus 
grandis]
Length=482

 Score = 84.7 bits (208),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 42/71 (59%), Positives = 51/71 (72%), Gaps = 0/71 (0%)
 Frame = +2

Query  512  LESAKIEADRTMLTDATLLFPPGQLALTALRRANEKLRVFEFERYLERILARQQPTHSIS  691
            LE+AK E D+ M+TDA LLFPPGQLAL ALR ANE  RV ++ERYLE +L RQ   HS +
Sbjct  225  LETAKEEVDKIMVTDAPLLFPPGQLALAALRHANEVHRVLDYERYLENMLIRQNSIHSST  284

Query  692  DLSGLLKPIES  724
            +L   L  I+S
Sbjct  285  ELIQHLNAIDS  295



>ref|XP_010024314.1| PREDICTED: uncharacterized protein LOC104414824 isoform X1 [Eucalyptus 
grandis]
Length=493

 Score = 84.3 bits (207),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 42/71 (59%), Positives = 51/71 (72%), Gaps = 0/71 (0%)
 Frame = +2

Query  512  LESAKIEADRTMLTDATLLFPPGQLALTALRRANEKLRVFEFERYLERILARQQPTHSIS  691
            LE+AK E D+ M+TDA LLFPPGQLAL ALR ANE  RV ++ERYLE +L RQ   HS +
Sbjct  225  LETAKEEVDKIMVTDAPLLFPPGQLALAALRHANEVHRVLDYERYLENMLIRQNSIHSST  284

Query  692  DLSGLLKPIES  724
            +L   L  I+S
Sbjct  285  ELIQHLNAIDS  295



>ref|XP_008235971.1| PREDICTED: cyclin-H1-1-like [Prunus mume]
Length=255

 Score = 80.9 bits (198),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 49/68 (72%), Gaps = 0/68 (0%)
 Frame = +2

Query  434  TVEGFVNDIEEFRGAEGEQLDTLKKLLESAKIEADRTMLTDATLLFPPGQLALTALRRAN  613
            ++EGF++D+ EF     ++L  L+KLL  AK+E D+ MLTDA LLFPPGQLAL ALR AN
Sbjct  178  SIEGFIDDMGEFCAINDDRLQILQKLLHGAKMEVDKIMLTDAPLLFPPGQLALAALRSAN  237

Query  614  EKLRVFEF  637
            +  +V E 
Sbjct  238  QVHKVVEI  245


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +2

Query  314  KFKAVNQRAKQALEKYGTTRMEVDVDGSFSYVEPPAGAKETVE  442
            K+KA NQRA Q LEKYG T MEVDVDG+ SY EP   AK+  +
Sbjct  19   KYKAANQRAIQTLEKYGATLMEVDVDGTISYPEPQVIAKDNAD  61



>ref|XP_001779669.1| predicted protein [Physcomitrella patens]
 gb|EDQ55465.1| predicted protein [Physcomitrella patens]
Length=308

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/56 (63%), Positives = 41/56 (73%), Gaps = 0/56 (0%)
 Frame = +2

Query  248  MADFTTSTHRAKWIFSPQDLKEKFKAVNQRAKQALEKYGTTRMEVDVDGSFSYVEP  415
            MADFTTSTHR +WI +P DL  K++A NQRA  AL KYG TR+EV  DGS +Y  P
Sbjct  1    MADFTTSTHRKRWILNPHDLTRKYQAANQRAVDALHKYGATRVEVQPDGSLTYPGP  56


 Score = 56.2 bits (134),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 38/112 (34%), Positives = 63/112 (56%), Gaps = 2/112 (2%)
 Frame = +2

Query  434  TVEGFVNDIE-EFRGAEGEQLDTLKKLLESAKIEADRTMLTDATLLFPPGQLALTALRRA  610
            ++EGF+ D+E      +  +L + ++L   A    D  MLTDA LL+PPGQLAL ALR A
Sbjct  170  SMEGFIYDMEVRCFVWKTYRLHSEQELRAVAGRVVDNMMLTDAPLLYPPGQLALAALRIA  229

Query  611  NEKLRVFEFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVK  766
            N++ +V + + YL+ +   +    S ++L   L  I+ L+   + P   +V+
Sbjct  230  NQEPKV-DLDGYLQALPEHKSLQQSYAELIAKLDAIQFLVKGTKQPVEAEVR  280



>gb|EMT30492.1| hypothetical protein F775_06942 [Aegilops tauschii]
Length=269

 Score = 79.3 bits (194),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 60/100 (60%), Gaps = 1/100 (1%)
 Frame = +2

Query  467  FRGAEGEQLDTLKKLLESAKIEADRTMLTDATLLFPPGQLALTALRRANEKLRVFEFERY  646
            +R  EG  +D +  L ++A  E D  MLTDA LL+ PGQLAL AL ++N  L V +FERY
Sbjct  100  YRSIEGF-IDDMDDLHQTANSEVDTMMLTDAPLLYTPGQLALAALYKSNSALSVLDFERY  158

Query  647  LERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVK  766
            LE + +RQ     +     ++  I  L+++L+ P  K+++
Sbjct  159  LESVFSRQHFDCPVEQFIQIISSINHLVSQLQLPGTKEMR  198



>ref|XP_002960101.1| hypothetical protein SELMODRAFT_163567 [Selaginella moellendorffii]
 gb|EFJ37640.1| hypothetical protein SELMODRAFT_163567 [Selaginella moellendorffii]
Length=293

 Score = 79.0 bits (193),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 45/100 (45%), Positives = 64/100 (64%), Gaps = 2/100 (2%)
 Frame = +2

Query  434  TVEGFVNDIEEFRGAEGEQLDTLKKL-LESAKI-EADRTMLTDATLLFPPGQLALTALRR  607
            +++GFV DI+++  A  ++  + K L L+S  I + D  +LTD  LLFPPGQLAL ALR 
Sbjct  177  SLDGFVLDIQKWADAAKDENVSQKILDLQSEAIRKVDTMLLTDCPLLFPPGQLALAALRS  236

Query  608  ANEKLRVFEFERYLERILARQQPTHSISDLSGLLKPIESL  727
            AN + R  + E+YL  +  RQQ  HS S+L G+L  I +L
Sbjct  237  ANVQERAIDMEKYLRGVCERQQQKHSYSELVGMLNQIAAL  276


 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 42/60 (70%), Gaps = 0/60 (0%)
 Frame = +2

Query  248  MADFTTSTHRAKWIFSPQDLKEKFKAVNQRAKQALEKYGTTRMEVDVDGSFSYVEPPAGA  427
            MADF TSTHR +WIF+ QDL EK  A N RA QAL+++G TR+E+  DGS +Y     GA
Sbjct  1    MADFLTSTHRDRWIFTVQDLVEKASAANARAVQALQQHGATRVEIQPDGSLAYPGSENGA  60



>gb|AAU93531.1| cyclin H-1 [Zea mays]
Length=340

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/87 (44%), Positives = 55/87 (63%), Gaps = 0/87 (0%)
 Frame = +2

Query  506  KLLESAKIEADRTMLTDATLLFPPGQLALTALRRANEKLRVFEFERYLERILARQQPTHS  685
            +L ++A    D+ MLTDA LL+ PGQLAL AL ++N+ LRV +FERYLE I +RQ     
Sbjct  237  ELRQAAISHVDKMMLTDAPLLYTPGQLALAALHKSNDLLRVVDFERYLEIIFSRQHSDCP  296

Query  686  ISDLSGLLKPIESLINKLESPSAKDVK  766
            I      +  I  L+++L  P+ KD++
Sbjct  297  IEQFVQSINEINYLVDQLNIPTVKDMR  323



>ref|XP_001762420.1| predicted protein [Physcomitrella patens]
 gb|EDQ72887.1| predicted protein [Physcomitrella patens]
Length=245

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 40/55 (73%), Gaps = 0/55 (0%)
 Frame = +2

Query  248  MADFTTSTHRAKWIFSPQDLKEKFKAVNQRAKQALEKYGTTRMEVDVDGSFSYVE  412
            MADFTTS+HR +WI +P DL  K++A NQRA  AL+K G TR+E+  DGS  Y E
Sbjct  1    MADFTTSSHRKRWILNPHDLVSKYEAANQRAVDALQKCGATRVEIQSDGSLIYPE  55


 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 49/82 (60%), Gaps = 4/82 (5%)
 Frame = +2

Query  407  VEPPAGAKETVEGFVNDIEEF-RGAEGEQLDTLKKLLESAKIEADRTMLTDATLLFPPGQ  583
            V PP     ++EGF+ D+E F +G     L  L++L  +A    +  MLTDA LL+PPGQ
Sbjct  164  VYPP---YRSMEGFIYDLETFVQGMGSTGLKALQELRVAAGSVVNNMMLTDAPLLYPPGQ  220

Query  584  LALTALRRANEKLRVFEFERYL  649
            LAL ALR AN+     +F+ Y+
Sbjct  221  LALAALRIANQNQSKVDFDWYI  242



>emb|CDX80636.1| BnaC07g28080D [Brassica napus]
Length=337

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 56/138 (41%), Positives = 79/138 (57%), Gaps = 12/138 (9%)
 Frame = +2

Query  356  KYGTTRMEVDVDGSFSYVEPPAGAKETVEGFVNDIEEFRGAEGEQLDTLKKLLESAKIEA  535
            KY    +E D+      V  P  A   +EGF+ ++EEF  A  +++  L+ LL++A  EA
Sbjct  168  KYEMASLEFDL-----IVYAPYRA---IEGFIGNMEEFLQARDDEIQKLESLLKAATGEA  219

Query  536  DRTMLTDATLLFPPGQLALTALRRANEKLRVFEFER-YLERILARQQPTHSISDLSGLLK  712
            D+ MLTDA L       AL ALR AN  L V +F+R YLE I+++    H+ S+L+ LL 
Sbjct  220  DKVMLTDAPLA---FFFALAALRIANGVLGVVDFDRLYLESIVSQPNSEHTTSELTRLLD  276

Query  713  PIESLINKLESPSAKDVK  766
             IESL+     PS KD+K
Sbjct  277  DIESLVKSYRYPSEKDMK  294


 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/53 (55%), Positives = 36/53 (68%), Gaps = 3/53 (6%)
 Frame = +2

Query  257  FTTSTHRA---KWIFSPQDLKEKFKAVNQRAKQALEKYGTTRMEVDVDGSFSY  406
            F  S H+    KWIF+PQ L E++KA NQRA Q LEK GTT++EVD  G  +Y
Sbjct  10   FCLSQHQHNGPKWIFTPQKLAERYKAANQRAVQLLEKCGTTQVEVDASGLLTY  62



>ref|XP_003078137.1| Cyclin H (IC) [Ostreococcus tauri]
 gb|AAV68602.1| cyclin H [Ostreococcus tauri]
 emb|CAL52877.1| Cyclin C [Ostreococcus tauri]
Length=322

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 48/121 (40%), Positives = 68/121 (56%), Gaps = 12/121 (10%)
 Frame = +2

Query  422  GAKETVEGFVNDIEE--FRGAEGEQL-DTLKKLLESAKIEADRTMLTDATLLFPPGQLAL  592
            GA   ++GF+ D+E+   +GA  +QL +  KK L+      DR MLTDA L+ PPGQ+AL
Sbjct  157  GATRPLDGFLMDVEDGGCKGATSKQLIECRKKALDIV----DRLMLTDAPLIRPPGQIAL  212

Query  593  TALRRANEKLRVFEFERYLERILAR---QQPTHSISDLSGLLKPIESLINKLESPSAKDV  763
             ALRRA  +    E E+Y E + AR   + P    + L  +L  IES +++   P A  V
Sbjct  213  CALRRAARECGASELEKYCEDVGARGTTKAPRG--AKLKEILDDIESHVDEGVEPDAAVV  270

Query  764  K  766
            K
Sbjct  271  K  271



>ref|XP_009605486.1| PREDICTED: cyclin-H1-1-like isoform X1 [Nicotiana tomentosiformis]
Length=219

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 49/79 (62%), Gaps = 18/79 (23%)
 Frame = +2

Query  431  ETVEGFVNDIEEFRGA-EGEQL-----------------DTLKKLLESAKIEADRTMLTD  556
              ++GF++D+EEF GA + +Q+                  T+K  LE+A++EAD+ M T+
Sbjct  126  HALDGFISDLEEFCGAKDDDQIVALKISLLPLLLFLMVPQTIKASLETARMEADKIMRTN  185

Query  557  ATLLFPPGQLALTALRRAN  613
              LLFPPGQLAL ALRRAN
Sbjct  186  GPLLFPPGQLALAALRRAN  204



>gb|KCW59459.1| hypothetical protein EUGRSUZ_H02201, partial [Eucalyptus grandis]
Length=78

 Score = 57.4 bits (137),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 30/61 (49%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +2

Query  584  LALTALRRANEKLRVFEFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDV  763
            LAL ALR ANE  RV ++ERYLE +L RQ   HS ++L   L  I+S +   + PS KD+
Sbjct  1    LALAALRHANEVHRVVDYERYLENMLIRQNSIHSSTELIQHLNAIDSSVRTYKFPSEKDM  60

Query  764  K  766
            K
Sbjct  61   K  61



>ref|XP_009605487.1| PREDICTED: cyclin-H1-1-like isoform X2 [Nicotiana tomentosiformis]
Length=188

 Score = 57.8 bits (138),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 27/59 (46%), Positives = 41/59 (69%), Gaps = 1/59 (2%)
 Frame = +2

Query  431  ETVEGFVNDIEEFRGA-EGEQLDTLKKLLESAKIEADRTMLTDATLLFPPGQLALTALR  604
              ++GF++D+EEF GA + +Q+  LK  LE+A++EAD+ M T+  LLFPPGQ+    L 
Sbjct  126  HALDGFISDLEEFCGAKDDDQIVALKASLETARMEADKIMRTNGPLLFPPGQVLFYQLH  184



>ref|XP_001416639.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
 gb|ABO94932.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
Length=256

 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 43/122 (35%), Positives = 61/122 (50%), Gaps = 13/122 (11%)
 Frame = +2

Query  422  GAKETVEGFVNDIEEFRGAE--GEQLDTLKKLLESAKIEADRTMLTDATLLFPPGQLALT  595
            GA   ++GF+ D+E+  G +  G QL   +K   SA    D  MLTD  L+ PPGQ+AL 
Sbjct  106  GAARPLDGFLRDVED-GGCKVTGAQLVACRK---SALETIDALMLTDVPLVRPPGQIALC  161

Query  596  ALRRANEKLRVFEFERYLERILAR-----QQPTHSISDLSGLLKPIESLINKLESPSAKD  760
            ALRRA  +    +   Y E + AR     + P  ++  L G+L  IE+ +     P    
Sbjct  162  ALRRAARQAEATDLVEYCEAVGARATGIVKAPKGAL--LKGILDEIETHVEDGTEPDEAV  219

Query  761  VK  766
            VK
Sbjct  220  VK  221



>ref|XP_005651240.1| cyclin-like protein [Coccomyxa subellipsoidea C-169]
 gb|EIE26696.1| cyclin-like protein [Coccomyxa subellipsoidea C-169]
Length=376

 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 42/125 (34%), Positives = 61/125 (49%), Gaps = 15/125 (12%)
 Frame = +2

Query  434  TVEGFVNDIEEFRGAEGEQLD---------TLKKLLESAKIEADRTMLTDATLLFPPGQL  586
            ++ G+  D+E+ +  EG  +D         TL +   +A+   D  MLTDA LLFPPGQL
Sbjct  177  SLSGYFADLEDCQ-KEGSVIDPPLQELGGDTLAQARAAARAAVDALMLTDAPLLFPPGQL  235

Query  587  ALTALRRANEKLRVFEFERYLERILARQQ----PTHSISDLSGLLKPIESLINKLESPSA  754
            AL A+R    K++V     +L R+  R Q       S  D+   LK     I+   S  +
Sbjct  236  ALAAMRSGCNKVKV-PLGSFLSRVAGRAQEEARAGCSTEDIVQELKSAFGRIDSFGSEGS  294

Query  755  KDVKA  769
            + VKA
Sbjct  295  QQVKA  299



>ref|XP_001692753.1| predicted protein [Chlamydomonas reinhardtii]
 gb|EDP03772.1| predicted protein [Chlamydomonas reinhardtii]
Length=144

 Score = 49.3 bits (116),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 41/128 (32%), Positives = 60/128 (47%), Gaps = 17/128 (13%)
 Frame = +2

Query  254  DFTTSTHRAKWIFSPQDLKEKFKAVNQRAKQALEKYGTTRMEVDVDGSFSYVEPPAGAKE  433
            DF TS+HR +W+++   L E+      R +Q +E+Y T     D+  SF   E     +E
Sbjct  2    DFATSSHRQRWLYTRTGLTEE----RHRLQQRVEEYYTR--AADIARSFDVTEDLVVKQE  55

Query  434  T--VEGFVNDI---EEFRGAEG-EQLDTLKKLLESAKIEA-----DRTMLTDATLLFPPG  580
               +EG   D+     +R  +G  QL  +      A   A     D  ML+DA LL+ P 
Sbjct  56   VALLEGLNFDLVVHSPYRALQGLMQLSRMPATCLDAAARASFGALDALMLSDAPLLYGPA  115

Query  581  QLALTALR  604
            Q+A  ALR
Sbjct  116  QMAAAALR  123



>ref|XP_006266776.1| PREDICTED: cyclin-H [Alligator mississippiensis]
Length=349

 Score = 50.4 bits (119),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 39/110 (35%), Positives = 59/110 (54%), Gaps = 5/110 (5%)
 Frame = +2

Query  440  EGFVNDIEEFRGAEGEQLDTLKKLLESAKIEADRTMLTDATLLFPPGQLALTALRRANEK  619
            EGF+ D++  R    E  + L+K   +A    +R  LTDA LLF P Q+ALTA+  +  +
Sbjct  196  EGFLIDLKT-RYPVLENPEVLRK---TADDFLNRVALTDAYLLFTPSQIALTAILSSASR  251

Query  620  LRVFEFERYLERILARQQPTHSISDLSGLLKPIESLINKLESPSAKDVKA  769
              +   E YL   L  ++   S+S L   +K +++LI K E P  +DV A
Sbjct  252  AXI-NMESYLSESLMLKENRSSLSKLLDGMKCMKNLIKKYEPPKPEDVAA  300



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1494411655520