BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF045G21

Length=719
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009802381.1|  PREDICTED: phosphatidylinositol 3-kinase, ro...    282   2e-85   Nicotiana sylvestris
ref|XP_009605436.1|  PREDICTED: phosphatidylinositol 3-kinase, ro...    281   5e-85   
gb|AAW80628.1|  phosphoinositide 3-kinase                               278   4e-84   Nicotiana tabacum [American tobacco]
emb|CDP13176.1|  unnamed protein product                                270   4e-81   Coffea canephora [robusta coffee]
gb|EPS60252.1|  phosphoinositide 3-kinase                               254   6e-81   Genlisea aurea
ref|XP_011100557.1|  PREDICTED: phosphatidylinositol 3-kinase, ro...    267   7e-80   Sesamum indicum [beniseed]
gb|EYU42801.1|  hypothetical protein MIMGU_mgv1a001464mg                267   9e-80   Erythranthe guttata [common monkey flower]
ref|XP_002525363.1|  phosphatidylinositol 3-kinase class, putative      254   3e-75   Ricinus communis
ref|XP_006350224.1|  PREDICTED: phosphatidylinositol 3-kinase, ro...    254   3e-75   Solanum tuberosum [potatoes]
ref|XP_004236633.1|  PREDICTED: phosphatidylinositol 3-kinase, ro...    254   4e-75   Solanum lycopersicum
ref|XP_002267769.2|  PREDICTED: phosphatidylinositol 3-kinase, ro...    253   9e-75   Vitis vinifera
ref|XP_008389664.1|  PREDICTED: phosphatidylinositol 3-kinase, ro...    251   7e-74   Malus domestica [apple tree]
ref|XP_007044677.1|  Vacuolar protein sorting 34 isoform 2              247   3e-73   
ref|XP_010651488.1|  PREDICTED: phosphatidylinositol 3-kinase, ro...    249   3e-73   Vitis vinifera
ref|XP_008221836.1|  PREDICTED: phosphatidylinositol 3-kinase, ro...    249   5e-73   Prunus mume [ume]
ref|XP_010023534.1|  PREDICTED: phosphatidylinositol 3-kinase, ro...    248   9e-73   Eucalyptus grandis [rose gum]
ref|XP_004297475.1|  PREDICTED: phosphatidylinositol 3-kinase, ro...    248   1e-72   Fragaria vesca subsp. vesca
gb|KDP26603.1|  hypothetical protein JCGZ_17761                         247   2e-72   Jatropha curcas
ref|XP_007044676.1|  Vacuolar protein sorting 34 isoform 1              246   4e-72   
ref|XP_010269374.1|  PREDICTED: phosphatidylinositol 3-kinase, ro...    246   7e-72   Nelumbo nucifera [Indian lotus]
ref|XP_010269375.1|  PREDICTED: phosphatidylinositol 3-kinase, ro...    245   8e-72   Nelumbo nucifera [Indian lotus]
gb|KDO82392.1|  hypothetical protein CISIN_1g003462mg                   243   8e-72   Citrus sinensis [apfelsine]
ref|XP_008340052.1|  PREDICTED: phosphatidylinositol 3-kinase, ro...    244   1e-71   
ref|XP_010269370.1|  PREDICTED: phosphatidylinositol 3-kinase, ro...    245   1e-71   Nelumbo nucifera [Indian lotus]
ref|XP_006438360.1|  hypothetical protein CICLE_v10030717mg             244   1e-71   
ref|XP_006483879.1|  PREDICTED: phosphatidylinositol 3-kinase, no...    244   3e-71   
ref|XP_006438361.1|  hypothetical protein CICLE_v10030717mg             244   3e-71   Citrus clementina [clementine]
ref|XP_006438362.1|  hypothetical protein CICLE_v10030717mg             243   4e-71   
gb|KDO82390.1|  hypothetical protein CISIN_1g003462mg                   243   4e-71   Citrus sinensis [apfelsine]
gb|KDO82391.1|  hypothetical protein CISIN_1g003462mg                   242   9e-71   Citrus sinensis [apfelsine]
gb|KDO82389.1|  hypothetical protein CISIN_1g003462mg                   242   9e-71   Citrus sinensis [apfelsine]
gb|KJB15579.1|  hypothetical protein B456_002G185300                    240   6e-70   Gossypium raimondii
ref|XP_010533950.1|  PREDICTED: phosphatidylinositol 3-kinase VPS...    239   1e-69   Tarenaya hassleriana [spider flower]
ref|XP_010533951.1|  PREDICTED: phosphatidylinositol 3-kinase VPS...    239   1e-69   Tarenaya hassleriana [spider flower]
ref|XP_006301054.1|  hypothetical protein CARUB_v10021447mg             238   4e-69   Capsella rubella
ref|XP_002886614.1|  ATVPS34                                            238   4e-69   
ref|XP_008444332.1|  PREDICTED: phosphatidylinositol 3-kinase, ro...    238   4e-69   
ref|NP_176251.1|  phosphatidylinositol 3-kinase VPS34                   238   5e-69   Arabidopsis thaliana [mouse-ear cress]
gb|AAA83427.1|  phosphatidylinositol 3-kinase                           236   2e-68   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011042652.1|  PREDICTED: phosphatidylinositol 3-kinase, ro...    236   2e-68   Populus euphratica
gb|ABA03136.1|  phosphatidylinositol 3-kinase 1                         235   4e-68   Phaseolus vulgaris [French bean]
gb|ABA03135.1|  phosphatidylinositol 3-kinase 1                         235   4e-68   Phaseolus vulgaris [French bean]
ref|XP_007157437.1|  hypothetical protein PHAVU_002G070100g             235   4e-68   Phaseolus vulgaris [French bean]
ref|XP_002318628.1|  phosphatidylinositol 3-kinase family protein       235   4e-68   
gb|AAN62481.1|  phosphatidylinositol 3-kinase                           234   7e-68   Brassica napus [oilseed rape]
ref|XP_010417982.1|  PREDICTED: phosphatidylinositol 3-kinase VPS...    234   9e-68   Camelina sativa [gold-of-pleasure]
ref|XP_009113205.1|  PREDICTED: phosphatidylinositol 3-kinase VPS...    234   1e-67   
ref|XP_004142979.1|  PREDICTED: phosphatidylinositol 3-kinase, ro...    233   2e-67   Cucumis sativus [cucumbers]
ref|XP_004161067.1|  PREDICTED: LOW QUALITY PROTEIN: phosphatidyl...    233   2e-67   
gb|KFK40782.1|  hypothetical protein AALP_AA2G040200                    233   2e-67   Arabis alpina [alpine rockcress]
ref|XP_007227349.1|  hypothetical protein PRUPE_ppa001353mg             233   2e-67   
emb|CDY53049.1|  BnaA09g14140D                                          233   4e-67   Brassica napus [oilseed rape]
ref|XP_010100445.1|  Phosphatidylinositol 3-kinase, root isoform        232   4e-67   
ref|XP_010682534.1|  PREDICTED: phosphatidylinositol 3-kinase, ro...    232   4e-67   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010940071.1|  PREDICTED: phosphatidylinositol 3-kinase, ro...    231   8e-67   Elaeis guineensis
ref|XP_010936707.1|  PREDICTED: phosphatidylinositol 3-kinase, ro...    231   1e-66   Elaeis guineensis
ref|XP_010510944.1|  PREDICTED: phosphatidylinositol 3-kinase VPS...    231   1e-66   Camelina sativa [gold-of-pleasure]
ref|XP_010474549.1|  PREDICTED: phosphatidylinositol 3-kinase VPS...    232   1e-66   
ref|XP_010936705.1|  PREDICTED: phosphatidylinositol 3-kinase, ro...    231   1e-66   Elaeis guineensis
ref|XP_006577876.1|  PREDICTED: phosphatidylinositol 3-kinase, ro...    229   1e-66   
ref|XP_009113204.1|  PREDICTED: phosphatidylinositol 3-kinase VPS...    231   1e-66   Brassica rapa
ref|XP_006580980.1|  PREDICTED: phosphatidylinositol 3-kinase, no...    230   3e-66   
ref|XP_010553608.1|  PREDICTED: phosphatidylinositol 3-kinase VPS34     230   3e-66   Tarenaya hassleriana [spider flower]
ref|NP_001242315.1|  phosphatidylinositol 3-kinase, nodule isoform      230   4e-66   Glycine max [soybeans]
gb|KHN08268.1|  Phosphatidylinositol 3-kinase, root isoform             229   5e-66   Glycine soja [wild soybean]
ref|XP_006392160.1|  hypothetical protein EUTSA_v10023282mg             229   5e-66   Eutrema salsugineum [saltwater cress]
ref|XP_009113206.1|  PREDICTED: phosphatidylinositol 3-kinase VPS...    229   6e-66   Brassica rapa
ref|XP_010682535.1|  PREDICTED: phosphatidylinositol 3-kinase, ro...    229   6e-66   Beta vulgaris subsp. vulgaris [field beet]
gb|KCW84845.1|  hypothetical protein EUGRSUZ_B01668                     229   6e-66   Eucalyptus grandis [rose gum]
ref|XP_008795927.1|  PREDICTED: phosphatidylinositol 3-kinase, ro...    229   6e-66   
ref|XP_004489830.1|  PREDICTED: phosphatidylinositol 3-kinase, ro...    229   6e-66   Cicer arietinum [garbanzo]
ref|XP_008782486.1|  PREDICTED: phosphatidylinositol 3-kinase, ro...    228   8e-66   Phoenix dactylifera
ref|XP_006580982.1|  PREDICTED: phosphatidylinositol 3-kinase, no...    229   9e-66   
ref|XP_008795925.1|  PREDICTED: phosphatidylinositol 3-kinase, ro...    229   9e-66   Phoenix dactylifera
ref|XP_003613218.1|  Phosphatidylinositol 3-kinase                      228   2e-65   Medicago truncatula
ref|XP_008782484.1|  PREDICTED: phosphatidylinositol 3-kinase, ro...    228   2e-65   Phoenix dactylifera
emb|CDY47220.1|  BnaC09g14690D                                          228   2e-65   Brassica napus [oilseed rape]
ref|NP_001236955.1|  phosphatidylinositol 3-kinase, root isoform        227   5e-65   Glycine max [soybeans]
ref|XP_009409808.1|  PREDICTED: phosphatidylinositol 3-kinase, ro...    218   5e-62   
ref|XP_003566732.1|  PREDICTED: phosphatidylinositol 3-kinase, ro...    206   1e-57   Brachypodium distachyon [annual false brome]
ref|XP_010040892.1|  PREDICTED: phosphatidylinositol 3-kinase VPS...    190   3e-57   
ref|XP_008678534.1|  PREDICTED: phosphatidylinositol 3-kinase, ro...    203   1e-56   Zea mays [maize]
dbj|BAJ91813.1|  predicted protein                                      201   5e-56   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004973056.1|  PREDICTED: phosphatidylinositol 3-kinase, ro...    199   3e-55   
ref|XP_004973055.1|  PREDICTED: phosphatidylinositol 3-kinase, ro...    199   4e-55   Setaria italica
emb|CCD74511.1|  phosphatidylinositol 3-kinase                          199   4e-55   Arabidopsis halleri subsp. halleri
ref|NP_001054810.1|  Os05g0180600                                       196   3e-54   
ref|XP_001762959.1|  predicted protein                                  196   5e-54   
gb|EMS55477.1|  Phosphatidylinositol 3-kinase, root isoform             177   2e-47   Triticum urartu
ref|XP_010234573.1|  PREDICTED: phosphatidylinositol 3-kinase, ro...    174   2e-46   Brachypodium distachyon [annual false brome]
ref|XP_003571627.2|  PREDICTED: phosphatidylinositol 3-kinase, ro...    174   3e-46   Brachypodium distachyon [annual false brome]
ref|XP_002972489.1|  hypothetical protein SELMODRAFT_97360              171   4e-45   
ref|XP_006654111.1|  PREDICTED: phosphatidylinositol 3-kinase, ro...    169   4e-45   
ref|XP_006654110.1|  PREDICTED: phosphatidylinositol 3-kinase, ro...    169   7e-45   
ref|XP_006654109.1|  PREDICTED: phosphatidylinositol 3-kinase, ro...    169   1e-44   
ref|NP_001061506.1|  Os08g0307400                                       167   1e-43   
ref|XP_002984319.1|  hypothetical protein SELMODRAFT_268853             166   1e-43   
gb|EEE68452.1|  hypothetical protein OsJ_26836                          166   4e-43   Oryza sativa Japonica Group [Japonica rice]
gb|EEC83339.1|  hypothetical protein OsI_28732                          165   1e-42   Oryza sativa Indica Group [Indian rice]
emb|CAN76735.1|  hypothetical protein VITISV_012040                     152   2e-42   Vitis vinifera
ref|XP_006849085.1|  hypothetical protein AMTR_s00028p00234070          162   7e-42   
gb|EMT32616.1|  Phosphatidylinositol 3-kinase, root isoform             160   3e-41   
gb|KCW84840.1|  hypothetical protein EUGRSUZ_B016665                    142   3e-39   Eucalyptus grandis [rose gum]
ref|XP_002983829.1|  hypothetical protein SELMODRAFT_118849             152   1e-38   
ref|XP_002989110.1|  hypothetical protein SELMODRAFT_129115             152   3e-38   
ref|XP_010940073.1|  PREDICTED: phosphatidylinositol 3-kinase, ro...    149   3e-37   
gb|KDO82393.1|  hypothetical protein CISIN_1g003462mg                   147   8e-37   Citrus sinensis [apfelsine]
ref|XP_010269376.1|  PREDICTED: phosphatidylinositol 3-kinase, ro...    144   5e-36   Nelumbo nucifera [Indian lotus]
emb|CDY44613.1|  BnaCnng11620D                                          132   3e-33   Brassica napus [oilseed rape]
emb|CDY66849.1|  BnaUnng01690D                                          130   8e-33   Brassica napus [oilseed rape]
ref|XP_010417983.1|  PREDICTED: phosphatidylinositol 3-kinase VPS...    128   5e-30   Camelina sativa [gold-of-pleasure]
ref|XP_007765963.1|  atypical PIKK PI3K protein kinase                  117   6e-26   Coniophora puteana RWD-64-598 SS2
emb|CCA75314.1|  related to phosphatidylinositol 3-kinase               116   1e-25   Serendipita indica DSM 11827
ref|XP_006459287.1|  hypothetical protein AGABI2DRAFT_218336            115   2e-25   Agaricus bisporus var. bisporus H97
ref|XP_007304199.1|  atypical/PIKK/PI3K protein kinase                  115   2e-25   Stereum hirsutum FP-91666 SS1
ref|XP_007330402.1|  hypothetical protein AGABI1DRAFT_75039             115   2e-25   Agaricus bisporus var. burnettii JB137-S8
ref|XP_001836217.2|  atypical/PIKK/PI3K protein kinase                  115   2e-25   Coprinopsis cinerea okayama7#130
gb|KIJ11996.1|  phosphatidylinositol 3-kinase                           114   4e-25   Paxillus involutus ATCC 200175
gb|KDQ24549.1|  hypothetical protein PLEOSDRAFT_1067370                 114   5e-25   Pleurotus ostreatus PC15
gb|EPS97255.1|  hypothetical protein FOMPIDRAFT_1166642                 114   6e-25   Fomitopsis pinicola FP-58527 SS1
emb|CCL98382.1|  predicted protein                                      114   7e-25   Fibroporia radiculosa
ref|XP_007868983.1|  phosphatidylinositol 3-kinase                      114   7e-25   Gloeophyllum trabeum ATCC 11539
ref|XP_007342219.1|  phosphatidylinositol 3-kinase                      113   1e-24   
gb|KII89648.1|  hypothetical protein PLICRDRAFT_158734                  113   1e-24   Plicaturopsis crispa FD-325 SS-3
gb|KIO18071.1|  hypothetical protein M407DRAFT_226452                   112   2e-24   Tulasnella calospora MUT 4182
gb|KIK62587.1|  hypothetical protein GYMLUDRAFT_42049                   112   2e-24   Gymnopus luxurians FD-317 M1
ref|XP_003032302.1|  hypothetical protein SCHCODRAFT_15876              112   2e-24   Schizophyllum commune H4-8
ref|XP_007387736.1|  atypical/PIKK/PI3K protein kinase                  112   2e-24   Punctularia strigosozonata HHB-11173 SS5
gb|KIK92419.1|  hypothetical protein PAXRUDRAFT_829978                  112   2e-24   Paxillus rubicundulus Ve08.2h10
gb|KIL59571.1|  hypothetical protein M378DRAFT_1000569                  111   4e-24   Amanita muscaria Koide BX008
ref|XP_005852294.1|  hypothetical protein CHLNCDRAFT_135070             108   4e-24   Chlorella variabilis
gb|KDR78928.1|  hypothetical protein GALMADRAFT_1365700                 111   4e-24   Galerina marginata CBS 339.88
gb|KIK40099.1|  hypothetical protein CY34DRAFT_807526                   110   8e-24   Suillus luteus UH-Slu-Lm8-n1
gb|KIP11047.1|  hypothetical protein PHLGIDRAFT_100348                  110   9e-24   Phlebiopsis gigantea 11061_1 CR5-6
ref|XP_007393187.1|  hypothetical protein PHACADRAFT_192977             110   9e-24   Phanerochaete carnosa HHB-10118-sp
gb|EMD33468.1|  class 3 phosphatylinositol 3-kinase                     110   1e-23   Gelatoporia subvermispora B
gb|KJA19491.1|  hypothetical protein HYPSUDRAFT_168207                  110   1e-23   Hypholoma sublateritium FD-334 SS-4
gb|KIM40591.1|  hypothetical protein M413DRAFT_412586                   110   1e-23   Hebeloma cylindrosporum h7
ref|XP_008039358.1|  atypical/PIKK/PI3K protein kinase                  109   2e-23   Trametes versicolor FP-101664 SS1
emb|CDO77014.1|  hypothetical protein BN946_scf184298.g41               109   2e-23   Trametes cinnabarina
gb|KIK10246.1|  hypothetical protein K443DRAFT_212                      109   2e-23   Laccaria amethystina LaAM-08-1
gb|KIJ66818.1|  hypothetical protein HYDPIDRAFT_26239                   109   2e-23   Hydnomerulius pinastri MD-312
ref|XP_001880950.1|  predicted protein                                  109   3e-23   Laccaria bicolor S238N-H82
gb|KIM33617.1|  hypothetical protein M408DRAFT_157762                   109   3e-23   Serendipita vermifera MAFF 305830
emb|CEG82209.1|  hypothetical protein RMATCC62417_16317                 104   3e-23   Rhizopus microsporus
gb|EJU04865.1|  atypical/PIKK/PI3K protein kinase                       108   4e-23   Dacryopinax primogenitus
gb|KIY42834.1|  phosphatidylinositol 3-kinase                           108   5e-23   Fistulina hepatica ATCC 64428
ref|XP_007362280.1|  atypical/PIKK/PI3K protein kinase                  108   6e-23   Dichomitus squalens LYAD-421 SS1
ref|XP_007848328.1|  atypical pikk pi3k protein kinase                  108   7e-23   
ref|XP_009549484.1|  hypothetical protein HETIRDRAFT_387555             108   7e-23   Heterobasidion irregulare TC 32-1
ref|XP_007262933.1|  phosphatidylinositol 3-kinase                      108   7e-23   Fomitiporia mediterranea MF3/22
ref|XP_007318645.1|  putative atypical/PIKK/PI3K protein kinase         107   2e-22   Serpula lacrymans var. lacrymans S7.9
gb|EGN99051.1|  hypothetical protein SERLA73DRAFT_54158                 107   2e-22   Serpula lacrymans var. lacrymans S7.3
emb|CEL55526.1|  phosphatidylinositol 3-kinase                          106   2e-22   Rhizoctonia solani AG-1 IB
gb|KIM84797.1|  hypothetical protein PILCRDRAFT_5847                    106   2e-22   Piloderma croceum F 1598
gb|KIK28919.1|  hypothetical protein PISMIDRAFT_90499                   106   2e-22   Pisolithus microcarpus 441
gb|KIJ52635.1|  hypothetical protein M422DRAFT_243420                   106   3e-22   Sphaerobolus stellatus SS14
gb|KIY68853.1|  atypical PIKK PI3K protein kinase                       106   3e-22   Cylindrobasidium torrendii FP15055 ss-10
gb|KEP52200.1|  atypical/PIKK/PI3K kinase                               105   4e-22   Rhizoctonia solani 123E
gb|EUC54542.1|  atypical/PIKK/PI3K kinase                               105   5e-22   Rhizoctonia solani AG-3 Rhs1AP
ref|XP_007881950.1|  hypothetical protein PFL1_06221                    105   7e-22   Anthracocystis flocculosa PF-1
gb|ESA02209.1|  hypothetical protein GLOINDRAFT_6733                    105   8e-22   
gb|KIM64269.1|  hypothetical protein SCLCIDRAFT_1213365                 105   8e-22   Scleroderma citrinum Foug A
gb|ELU40724.1|  atypical/PIKK/PI3K protein kinase                       105   9e-22   Rhizoctonia solani AG-1 IA
gb|ELU04838.1|  hypothetical protein CAPTEDRAFT_155274                  104   1e-21   Capitella teleta
ref|XP_007121301.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  99.4    1e-21   
ref|XP_004319034.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  99.0    1e-21   
ref|XP_008509161.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  99.0    1e-21   Equus przewalskii [Przewalski horse]
gb|KDN44187.1|  hypothetical protein RSAG8_05660                        104   2e-21   Rhizoctonia solani AG-8 WAC10335
dbj|GAK62210.1|  phosphatidylinositol 3-kinase                          104   2e-21   Moesziomyces antarcticus
emb|CDH58858.1|  atypical pikk pi3k protein kinase                      103   3e-21   Lichtheimia corymbifera JMRC:FSU:9682
emb|CEG70098.1|  hypothetical protein RMATCC62417_06049                 103   3e-21   Rhizopus microsporus
emb|CEJ04469.1|  hypothetical protein RMCBS344292_18430                 103   4e-21   Rhizopus microsporus
ref|XP_005646177.1|  phosphatidylinositol 3-kinase                      102   5e-21   Coccomyxa subellipsoidea C-169
gb|KIO15059.1|  hypothetical protein M404DRAFT_198741                   102   6e-21   Pisolithus tinctorius Marx 270
ref|XP_008580698.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  98.2    7e-21   Galeopterus variegatus [Malayan flying lemur]
ref|XP_003376635.1|  phosphatidylinositol 3-kinase catalytic subu...    102   1e-20   Trichinella spiralis
ref|XP_008299910.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  98.6    2e-20   Stegastes partitus
gb|EDK97023.1|  phosphoinositide-3-kinase, class 3, isoform CRA_c     99.8    2e-20   Mus musculus [mouse]
ref|XP_008321701.1|  PREDICTED: phosphatidylinositol 3-kinase cat...    100   2e-20   Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_008321707.1|  PREDICTED: phosphatidylinositol 3-kinase cat...    100   2e-20   
emb|CDI51380.1|  related to phosphatidylinositol 3-kinase               100   3e-20   Melanopsichium pennsylvanicum 4
emb|CAN72914.1|  hypothetical protein VITISV_034007                     100   3e-20   Vitis vinifera
gb|KDQ06726.1|  hypothetical protein BOTBODRAFT_167791                  100   3e-20   Botryobasidium botryosum FD-172 SS1
ref|XP_011359594.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  99.8    4e-20   
gb|ELW69376.1|  Phosphatidylinositol 3-kinase catalytic subunit t...  99.8    4e-20   Tupaia chinensis
ref|XP_004579747.1|  PREDICTED: phosphatidylinositol 3-kinase cat...    100   4e-20   
ref|XP_006144458.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  99.8    5e-20   Tupaia chinensis
ref|XP_011359580.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  99.8    5e-20   Pteropus vampyrus
gb|ETS63702.1|  hypothetical protein PaG_02008                        99.8    5e-20   Moesziomyces aphidis DSM 70725
ref|XP_008071342.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  99.8    5e-20   Carlito syrichta
ref|XP_006144457.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  99.8    5e-20   
dbj|GAC73688.1|  phosphatidylinositol 3-kinase VPS34                  99.8    5e-20   Moesziomyces antarcticus T-34
gb|AAH24675.1|  Pik3c3 protein                                        99.4    6e-20   Mus musculus [mouse]
ref|XP_009946528.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  95.5    6e-20   Leptosomus discolor
ref|XP_008259471.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  99.4    6e-20   Oryctolagus cuniculus [domestic rabbit]
ref|NP_852079.2|  phosphatidylinositol 3-kinase catalytic subunit...  99.4    6e-20   Mus musculus [mouse]
gb|EPB83231.1|  hypothetical protein HMPREF1544_10027                 99.4    7e-20   Mucor circinelloides f. circinelloides 1006PhL
gb|EDK97022.1|  phosphoinositide-3-kinase, class 3, isoform CRA_b     99.4    7e-20   Mus musculus [mouse]
ref|XP_004855306.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  99.4    8e-20   Heterocephalus glaber [naked mole rat]
ref|XP_008830714.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  98.6    1e-19   
emb|CBQ67863.1|  related to phosphatidylinositol 3-kinase             99.0    1e-19   Sporisorium reilianum SRZ2
ref|XP_002757241.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  98.6    1e-19   Callithrix jacchus [common marmoset]
ref|XP_006889295.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  98.6    1e-19   Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_006730096.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  98.6    1e-19   Leptonychotes weddellii
ref|XP_001082892.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  98.6    1e-19   
gb|EPY73351.1|  phosphatidylinositol 3-kinase catalytic subunit t...  98.2    1e-19   Camelus ferus
dbj|GAN11171.1|  phosphatidylinositol 3-kinase                        98.2    1e-19   Mucor ambiguus
ref|XP_004415358.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  98.2    1e-19   Odobenus rosmarus divergens
ref|XP_006205318.1|  PREDICTED: LOW QUALITY PROTEIN: phosphatidyl...  98.2    1e-19   
ref|XP_003975987.1|  PREDICTED: LOW QUALITY PROTEIN: phosphatidyl...  98.2    1e-19   
ref|XP_007172845.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  98.2    2e-19   Balaenoptera acutorostrata scammoni
ref|XP_009905528.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  95.1    2e-19   Picoides pubescens
ref|XP_010885974.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  98.2    2e-19   
ref|XP_003784780.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  98.2    2e-19   Otolemur garnettii
ref|XP_008830711.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  98.2    2e-19   Nannospalax galili
ref|XP_010885975.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  98.2    2e-19   
ref|XP_001497818.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  98.2    2e-19   Equus caballus [domestic horse]
ref|XP_005325661.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  98.2    2e-19   
ref|XP_005612913.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  98.2    2e-19   Equus caballus [domestic horse]
ref|XP_004683924.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  98.2    2e-19   Condylura cristata
ref|XP_007081865.1|  PREDICTED: LOW QUALITY PROTEIN: phosphatidyl...  98.2    2e-19   Panthera tigris altaica
gb|EPQ15843.1|  Phosphatidylinositol 3-kinase catalytic subunit t...  98.2    2e-19   Myotis brandtii
ref|XP_007563698.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  98.2    2e-19   Poecilia formosa
emb|CDQ69823.1|  unnamed protein product                              98.2    2e-19   Oncorhynchus mykiss
ref|XP_010636318.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  97.8    2e-19   Fukomys damarensis [Damara mole rat]
ref|NP_001012974.1|  phosphatidylinositol 3-kinase catalytic subu...  98.2    2e-19   Sus scrofa [pigs]
ref|XP_007972369.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  98.2    2e-19   Chlorocebus sabaeus
ref|XP_010357092.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  97.8    2e-19   Rhinopithecus roxellana
emb|CEP14473.1|  hypothetical protein                                 97.8    2e-19   Parasitella parasitica
ref|XP_003267603.1|  PREDICTED: LOW QUALITY PROTEIN: phosphatidyl...  97.8    2e-19   
ref|XP_004623771.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  98.2    2e-19   
ref|NP_002638.2|  phosphatidylinositol 3-kinase catalytic subunit...  97.8    2e-19   Homo sapiens [man]
ref|XP_002828227.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  97.8    2e-19   Pongo abelii [orang utan]
ref|XP_005372904.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  97.8    2e-19   Chinchilla lanigera
ref|XP_010844759.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  97.8    2e-19   Bison bison bison
ref|NP_001274089.1|  phosphatidylinositol 3-kinase catalytic subu...  97.8    2e-19   Canis lupus familiaris [dogs]
ref|XP_006938926.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  97.8    2e-19   
ref|XP_010636317.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  97.8    2e-19   Fukomys damarensis [Damara mole rat]
ref|XP_007464231.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  97.8    2e-19   Lipotes vexillifer [baiji]
ref|XP_005355906.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  97.8    2e-19   Microtus ochrogaster [prairie voles]
ref|XP_004752293.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  97.8    2e-19   Mustela putorius furo [black ferret]
ref|XP_005896412.1|  PREDICTED: LOW QUALITY PROTEIN: phosphatidyl...  97.8    2e-19   Bos mutus
ref|XP_005586880.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  97.8    2e-19   Macaca fascicularis [crab eating macaque]
ref|XP_004283586.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  97.8    2e-19   Orcinus orca [Orca]
ref|XP_003995198.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  97.8    2e-19   Felis catus [cat]
ref|XP_009190905.1|  PREDICTED: LOW QUALITY PROTEIN: phosphatidyl...  97.8    2e-19   
gb|KDQ59030.1|  hypothetical protein JAAARDRAFT_33751                 97.8    2e-19   Jaapia argillacea MUCL 33604
ref|XP_004059400.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  97.8    2e-19   
ref|XP_004422540.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  97.8    2e-19   Ceratotherium simum simum [southern square-lipped rhinoceros]
gb|AAX43278.1|  phosphoinositide-3-kinase class 3                     97.8    2e-19   synthetic construct
gb|EHH29275.1|  hypothetical protein EGK_09648                        97.8    2e-19   Macaca mulatta [rhesus macaque]
ref|XP_010636316.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  97.8    2e-19   Fukomys damarensis [Damara mole rat]
ref|XP_007646590.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  97.8    2e-19   Cricetulus griseus [Chinese hamsters]
ref|XP_004752292.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  97.8    2e-19   
ref|XP_006194592.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  97.8    2e-19   Camelus ferus
ref|XP_005065271.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  97.8    2e-19   
gb|ERE83733.1|  phosphatidylinositol 3-kinase catalytic subunit t...  97.8    2e-19   Cricetulus griseus [Chinese hamsters]
ref|XP_009694679.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  91.7    2e-19   Cariama cristata
ref|XP_010585413.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  97.8    2e-19   
ref|XP_011230331.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  97.8    2e-19   
ref|XP_006805593.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  97.8    2e-19   Neolamprologus brichardi [lyretail cichlid]
ref|XP_007535112.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  97.8    2e-19   
ref|XP_009974146.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  91.7    2e-19   Tyto alba [Schleiereule]
ref|XP_003474048.2|  PREDICTED: phosphatidylinositol 3-kinase cat...  97.8    2e-19   Cavia porcellus [guinea pig]
ref|NP_001092537.1|  phosphatidylinositol 3-kinase catalytic subu...  97.8    2e-19   Bos taurus [bovine]
ref|XP_010816989.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  97.4    2e-19   Bos taurus [bovine]
ref|XP_005879397.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  97.8    3e-19   Myotis brandtii
dbj|GAC95422.1|  hypothetical protein PHSY_002998                     97.8    3e-19   Pseudozyma hubeiensis SY62
ref|XP_006085211.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  97.4    3e-19   Myotis lucifugus
ref|XP_005807287.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  97.4    3e-19   Xiphophorus maculatus
tpg|DAA15981.1|  TPA: phosphatidylinositol 3-kinase catalytic sub...  97.4    3e-19   Bos taurus [bovine]
ref|XP_006971484.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  97.4    3e-19   
gb|ERE83732.1|  phosphatidylinositol 3-kinase catalytic subunit t...  97.4    3e-19   Cricetulus griseus [Chinese hamsters]
gb|ERE83734.1|  phosphatidylinositol 3-kinase catalytic subunit t...  97.4    3e-19   Cricetulus griseus [Chinese hamsters]
ref|XP_005750513.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  97.4    3e-19   Pundamilia nyererei
ref|XP_009075171.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  91.3    3e-19   Acanthisitta chloris
ref|XP_003447586.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  97.4    3e-19   Oreochromis niloticus
ref|XP_005750512.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  97.4    3e-19   Pundamilia nyererei
gb|KFO27382.1|  Phosphatidylinositol 3-kinase catalytic subunit t...  97.4    3e-19   
ref|XP_007944630.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  97.4    3e-19   
ref|XP_004020459.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  97.4    3e-19   
ref|XP_004574230.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  97.4    3e-19   
ref|XP_005976634.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  97.4    3e-19   
ref|XP_008159075.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  97.8    3e-19   
ref|XP_010746556.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  97.4    3e-19   
ref|XP_010746558.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  97.4    3e-19   
ref|XP_008426187.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  97.4    3e-19   
ref|XP_006835201.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  97.4    3e-19   
emb|CAG12813.1|  unnamed protein product                              97.4    3e-19   
ref|XP_008426188.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  97.1    4e-19   
gb|KFM82429.1|  Phosphatidylinositol 3-kinase catalytic subunit t...  95.9    4e-19   
ref|XP_005296240.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  97.1    4e-19   
ref|XP_005151879.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  97.1    4e-19   
ref|XP_010311329.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  91.3    5e-19   
ref|XP_796381.3|  PREDICTED: phosphatidylinositol 3-kinase cataly...  93.6    5e-19   
ref|XP_010160318.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  91.3    5e-19   
ref|NP_075247.1|  phosphatidylinositol 3-kinase catalytic subunit...  96.7    5e-19   
ref|XP_009937266.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  91.7    5e-19   
ref|XP_011399049.1|  Phosphatidylinositol 3-kinase, root isoform      96.3    6e-19   
ref|XP_011386318.1|  hypothetical protein UMAG_00453                  96.7    6e-19   
ref|XP_006254550.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  96.7    6e-19   
ref|XP_007233849.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  96.3    7e-19   
ref|XP_007233847.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  96.3    7e-19   
ref|NP_001086836.1|  phosphatidylinositol 3-kinase catalytic subu...  96.3    8e-19   
ref|XP_010167004.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  90.9    8e-19   
ref|XP_005172338.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  96.3    8e-19   
ref|XP_007233850.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  96.3    8e-19   
ref|XP_003759608.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  95.9    8e-19   
gb|EGU11319.1|  Atypical/PIKK/PI3K protein kinase                     95.9    9e-19   
emb|CAA87094.1|  phosphatidylinositol 3-kinase                        95.9    1e-18   
ref|XP_006273967.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  95.9    1e-18   
ref|XP_006022548.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  95.9    1e-18   
ref|XP_007486788.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  95.5    1e-18   
ref|NP_001017550.2|  phosphatidylinositol 3-kinase catalytic subu...  95.5    1e-18   
ref|XP_004703146.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  95.5    1e-18   
ref|XP_010084630.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  91.3    2e-18   
ref|XP_010784212.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  95.1    2e-18   
ref|XP_005238082.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  95.1    2e-18   
ref|XP_010784211.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  95.1    2e-18   
gb|EST10063.1|  Phosphatidylinositide 3-kinase                        94.7    2e-18   
ref|XP_002609836.1|  hypothetical protein BRAFLDRAFT_280369           94.7    2e-18   
ref|XP_004949109.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  94.4    2e-18   
ref|XP_004949108.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  94.4    3e-18   
ref|XP_001637610.1|  predicted protein                                94.7    3e-18   
ref|XP_010564389.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  94.4    3e-18   
ref|XP_010564388.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  94.4    3e-18   
gb|KFD55083.1|  hypothetical protein M513_04001                       94.4    3e-18   
ref|XP_009044003.1|  hypothetical protein LOTGIDRAFT_181298           94.4    3e-18   
ref|XP_003642950.2|  PREDICTED: phosphatidylinositol 3-kinase cat...  94.4    3e-18   
ref|XP_002186929.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  94.4    3e-18   
ref|XP_004949107.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  94.4    3e-18   
ref|XP_002110551.1|  hypothetical protein TRIADDRAFT_22684            94.4    3e-18   
ref|XP_005528154.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  94.4    4e-18   
ref|XP_004949106.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  94.4    4e-18   
ref|XP_010564385.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  94.4    4e-18   
ref|XP_010295781.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  91.3    4e-18   
ref|XP_004663659.1|  PREDICTED: zinc finger protein 665-like          93.2    4e-18   
ref|XP_010564382.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  94.4    4e-18   
ref|XP_005489732.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  94.0    4e-18   
ref|XP_010564387.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  94.0    4e-18   
ref|XP_005446977.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  94.4    4e-18   
ref|XP_010564383.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  94.0    4e-18   
ref|XP_010564384.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  94.0    4e-18   
gb|KFU95226.1|  Phosphatidylinositol 3-kinase catalytic subunit t...  94.0    4e-18   
ref|XP_005489733.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  94.0    4e-18   
ref|XP_011485883.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  94.0    5e-18   
ref|XP_004348988.2|  phosphoinositide-3-kinase                        94.0    5e-18   
ref|XP_008101879.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  93.6    6e-18   
ref|XP_008101872.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  93.6    6e-18   
emb|CDW59814.1|  phosphatidylinositol 3 kinase catalytic subunit      93.2    7e-18   
emb|CCF54202.1|  related to phosphatidylinositol 3-kinase             93.6    7e-18   
gb|EMS21211.1|  phosphoinositide 3-kinase                             92.8    1e-17   
ref|XP_007435964.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  92.4    1e-17   
gb|KFV41978.1|  Phosphatidylinositol 3-kinase catalytic subunit t...  90.9    1e-17   
ref|XP_009808239.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  90.9    2e-17   
gb|KFP89208.1|  Phosphatidylinositol 3-kinase catalytic subunit t...  91.7    2e-17   
ref|XP_009868172.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  91.7    2e-17   
ref|XP_006823983.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  92.0    2e-17   
ref|XP_011409710.1|  PREDICTED: uncharacterized protein LOC100636775  92.0    2e-17   
ref|XP_004878608.1|  PREDICTED: LOW QUALITY PROTEIN: phosphatidyl...  91.7    3e-17   
ref|XP_006629633.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  91.7    3e-17   
gb|KFQ38262.1|  Phosphatidylinositol 3-kinase catalytic subunit t...  90.9    3e-17   
ref|XP_002409976.1|  phosphatidylinositol 3-kinase class, putative    91.3    3e-17   
ref|XP_007658182.1|  PREDICTED: LOW QUALITY PROTEIN: phosphatidyl...  91.3    3e-17   
gb|KFQ43086.1|  Phosphatidylinositol 3-kinase catalytic subunit t...  90.9    3e-17   
ref|XP_010186138.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  90.9    4e-17   
ref|XP_010016368.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  90.9    4e-17   
ref|XP_010723487.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  90.9    4e-17   
ref|XP_008830712.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  91.3    4e-17   
gb|KFQ87634.1|  Phosphatidylinositol 3-kinase catalytic subunit t...  90.9    4e-17   
ref|XP_010130645.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  90.9    4e-17   
gb|KFW75363.1|  Phosphatidylinositol 3-kinase catalytic subunit t...  90.9    4e-17   
ref|XP_005060392.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  90.9    4e-17   
gb|KFO87396.1|  Phosphatidylinositol 3-kinase catalytic subunit t...  90.9    4e-17   
ref|XP_005425042.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  90.9    4e-17   
ref|XP_009093617.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  90.9    4e-17   
ref|XP_009502769.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  90.5    4e-17   
ref|XP_009093618.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  90.9    4e-17   
ref|XP_006136852.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  90.9    4e-17   
ref|XP_008926902.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  90.9    5e-17   
ref|XP_008936594.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  90.9    5e-17   
ref|XP_006136850.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  90.9    5e-17   
ref|XP_007060508.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  90.9    5e-17   
ref|XP_009664447.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  90.9    5e-17   
gb|KFQ51054.1|  Phosphatidylinositol 3-kinase catalytic subunit t...  90.9    5e-17   
gb|KFM08803.1|  Phosphatidylinositol 3-kinase catalytic subunit t...  90.9    5e-17   
gb|KFV89524.1|  Phosphatidylinositol 3-kinase catalytic subunit t...  90.5    5e-17   
ref|XP_010195965.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  90.9    5e-17   
gb|KGL98543.1|  Phosphatidylinositol 3-kinase catalytic subunit t...  90.9    5e-17   
gb|KFZ61077.1|  Phosphatidylinositol 3-kinase catalytic subunit t...  90.9    5e-17   
gb|KFW72418.1|  Phosphatidylinositol 3-kinase catalytic subunit t...  90.9    5e-17   
ref|XP_009479984.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  90.5    5e-17   
gb|KFP30013.1|  Phosphatidylinositol 3-kinase catalytic subunit t...  90.5    5e-17   
gb|KFV76459.1|  Phosphatidylinositol 3-kinase catalytic subunit t...  90.5    5e-17   
gb|EMP35159.1|  Phosphatidylinositol 3-kinase catalytic subunit t...  90.5    5e-17   
ref|XP_005500462.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  90.9    5e-17   
gb|KFW84915.1|  Phosphatidylinositol 3-kinase catalytic subunit t...  90.5    5e-17   
gb|EGW01396.1|  Phosphatidylinositol 3-kinase catalytic subunit t...  90.5    5e-17   
ref|XP_009585648.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  90.5    5e-17   
ref|XP_009329812.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  90.5    5e-17   
gb|KFP23315.1|  Phosphatidylinositol 3-kinase catalytic subunit t...  90.5    5e-17   
gb|EFB24692.1|  hypothetical protein PANDA_014485                     90.5    5e-17   
ref|XP_010564386.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  90.5    5e-17   
ref|XP_009279455.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  90.5    5e-17   
gb|KFO66137.1|  Phosphatidylinositol 3-kinase catalytic subunit t...  90.5    5e-17   
ref|XP_010003342.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  90.9    5e-17   
ref|XP_008641243.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  90.5    5e-17   
ref|XP_010224059.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  90.5    6e-17   
ref|XP_009646019.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  90.5    6e-17   
ref|XP_008641242.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  90.5    6e-17   
ref|XP_008496454.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  90.5    6e-17   
gb|KGL84868.1|  Phosphatidylinositol 3-kinase catalytic subunit t...  90.5    6e-17   
gb|KFO70688.1|  Phosphatidylinositol 3-kinase catalytic subunit t...  90.5    6e-17   
gb|KFP04292.1|  Phosphatidylinositol 3-kinase catalytic subunit t...  90.5    6e-17   
ref|XP_009889909.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  90.5    6e-17   
ref|XP_010406569.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  90.5    6e-17   
ref|XP_009568552.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  90.5    7e-17   
ref|XP_007895390.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  90.1    7e-17   
ref|XP_004473834.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  90.1    8e-17   
ref|XP_010510945.1|  PREDICTED: phosphatidylinositol 3-kinase VPS...  89.4    1e-16   
ref|XP_008689623.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  89.7    1e-16   
ref|XP_010973791.1|  PREDICTED: LOW QUALITY PROTEIN: phosphatidyl...  89.4    1e-16   
ref|XP_006136851.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  89.0    2e-16   
ref|XP_568889.1|  phosphatidylinositol 3-kinase                       89.0    2e-16   
gb|EFX81394.1|  hypothetical protein DAPPUDRAFT_188071                89.0    2e-16   
gb|KFH73635.1|  hypothetical protein MVEG_00850                       89.0    2e-16   
ref|XP_002935097.2|  PREDICTED: phosphatidylinositol 3-kinase cat...  89.0    2e-16   
ref|XP_011112310.1|  hypothetical protein H072_6520                   87.4    8e-16   
ref|XP_007607016.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  87.0    9e-16   
dbj|GAA95268.1|  hypothetical protein E5Q_01924                       86.7    1e-15   
emb|CDM29302.1|  Phosphatidylinositol 3-kinase vps34                  86.3    2e-15   
ref|XP_010042211.1|  PREDICTED: phosphatidylinositol 3-kinase VPS...  79.3    2e-15   
ref|XP_010041883.1|  PREDICTED: phosphatidylinositol 3-kinase VPS...  79.3    2e-15   
ref|XP_010041150.1|  PREDICTED: phosphatidylinositol 3-kinase VPS...  79.3    2e-15   
ref|XP_007674194.1|  hypothetical protein BAUCODRAFT_104191           85.9    2e-15   
gb|AAA85726.1|  phosphatidylinositol 3-kinase                         85.5    3e-15   
ref|XP_005011756.1|  PREDICTED: LOW QUALITY PROTEIN: phosphatidyl...  85.5    3e-15   
ref|XP_011121964.1|  hypothetical protein AOL_s00078g399              85.5    3e-15   
gb|AFR93322.2|  phosphatidylinositol 3-kinase                         85.1    3e-15   
ref|XP_002836750.1|  hypothetical protein                             85.1    3e-15   
gb|EOB07063.1|  Phosphatidylinositol 3-kinase catalytic subunit t...  85.1    3e-15   
emb|CCX16633.1|  Similar to Phosphatidylinositol 3-kinase vps34; ...  84.7    4e-15   
gb|KFP93890.1|  Phosphatidylinositol 3-kinase catalytic subunit t...  84.7    4e-15   
ref|XP_009914708.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  84.7    4e-15   
ref|XP_011436592.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  84.7    4e-15   
gb|KGO68857.1|  C2 calcium/lipid-binding domain, CaLB                 84.7    5e-15   
gb|EKC20235.1|  Phosphatidylinositol 3-kinase catalytic subunit t...  84.7    5e-15   
ref|XP_003335193.2|  hypothetical protein PGTG_16800                  84.7    5e-15   
ref|XP_636122.1|  phosphatidylinositol 3-kinase                       84.3    7e-15   
ref|XP_003741971.1|  PREDICTED: phosphatidylinositol 3-kinase cat...  83.6    1e-14   
ref|XP_006682457.1|  hypothetical protein BATDEDRAFT_36168            83.2    1e-14   
ref|XP_009021048.1|  hypothetical protein HELRODRAFT_113006           83.2    1e-14   
ref|XP_003291233.1|  phosphatidylinositol 3-kinase                    83.2    1e-14   
ref|XP_006766174.1|  PREDICTED: LOW QUALITY PROTEIN: phosphatidyl...  83.2    2e-14   
gb|KDN52489.1|  phosphatidylinositol 3-kinase                         83.2    2e-14   
ref|XP_002567133.1|  Pc21g00590                                       82.8    2e-14   
ref|XP_007005951.1|  hypothetical protein TREMEDRAFT_74295            82.8    2e-14   
gb|EFX81285.1|  hypothetical protein DAPPUDRAFT_26990                 77.8    2e-14   
ref|XP_003191368.1|  phosphatidylinositol 3-kinase                    82.4    2e-14   
gb|KGO38881.1|  C2 calcium/lipid-binding domain, CaLB                 82.4    3e-14   
ref|XP_002170067.2|  PREDICTED: phosphatidylinositol 3-kinase cat...  82.0    3e-14   
gb|KIR54333.1|  phosphatidylinositol 3-kinase                         82.0    3e-14   
gb|KIR32710.1|  phosphatidylinositol 3-kinase                         82.0    3e-14   
gb|KJE00969.1|  phosphatidylinositol 3-kinase                         82.0    3e-14   
gb|KIR79874.1|  phosphatidylinositol 3-kinase                         82.0    3e-14   
gb|KIR46490.1|  phosphatidylinositol 3-kinase                         82.0    3e-14   
ref|XP_001361090.1|  GA18829                                          82.0    4e-14   
emb|CCJ29853.1|  unnamed protein product                              82.0    4e-14   
ref|XP_002147483.1|  phosphoinositide 3-kinase, putative              81.6    4e-14   
ref|XP_002074858.1|  GK23281                                          81.6    4e-14   
dbj|GAM23254.1|  hypothetical protein SAMD00019534_064290             81.6    4e-14   
gb|EEH33007.2|  phosphatidylinositol 3-kinase vps34                   81.6    5e-14   
ref|XP_010762682.1|  hypothetical protein PADG_07335                  81.6    5e-14   
gb|KGY15264.1|  hypothetical protein PABG_11848                       81.6    5e-14   
gb|KIR25433.1|  phosphatidylinositol 3-kinase                         81.3    6e-14   
gb|KIY34224.1|  phosphatidylinositol 3-kinase                         81.3    6e-14   
gb|KIR71039.1|  phosphatidylinositol 3-kinase                         81.3    6e-14   
gb|KGO44307.1|  C2 calcium/lipid-binding domain, CaLB                 81.3    7e-14   
gb|EER41354.1|  phosphoinositide 3-kinase                             81.3    7e-14   
ref|XP_001986173.1|  GH21209                                          80.9    8e-14   
gb|EGC47238.1|  phosphoinositide 3-kinase                             80.9    8e-14   
gb|KDR23478.1|  Phosphatidylinositol 3-kinase catalytic subunit t...  80.9    9e-14   
ref|XP_011493159.1|  AAEL017118-PA                                    79.3    1e-13   
ref|XP_002050795.1|  GJ22348                                          80.5    1e-13   
gb|EKV12782.1|  Vps34p                                                80.5    1e-13   
ref|XP_008896150.1|  hypothetical protein PPTG_04077                  80.5    1e-13   
gb|KIR85613.1|  phosphatidylinositol 3-kinase                         80.5    1e-13   
dbj|GAM88869.1|  hypothetical protein ANO11243_069030                 80.5    1e-13   
gb|EPS34839.1|  hypothetical protein PDE_09803                        80.1    1e-13   
ref|XP_002082811.1|  GD11777                                          80.1    2e-13   
gb|EEH02833.1|  conserved hypothetical protein                        80.1    2e-13   
ref|XP_662313.1|  hypothetical protein AN4709.2                       80.1    2e-13   
gb|EGE81644.1|  phosphoinositide 3-kinase                             79.7    2e-13   
gb|EQL33006.1|  phosphatidylinositol 3-kinase                         79.7    2e-13   
ref|NP_477133.1|  phosphotidylinositol 3 kinase 59F                   79.3    2e-13   
ref|XP_002040110.1|  GM16028                                          79.3    2e-13   
ref|XP_010956662.1|  PREDICTED: LOW QUALITY PROTEIN: phosphatidyl...  79.3    3e-13   
emb|CAA68185.1|  1-phosphatidylinositol 3-kinase                      79.3    3e-13   
dbj|GAM36497.1|  phosphatidylinositol 3-kinase                        79.3    3e-13   



>ref|XP_009802381.1| PREDICTED: phosphatidylinositol 3-kinase, root isoform [Nicotiana 
sylvestris]
Length=815

 Score =   282 bits (721),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 157/179 (88%), Positives = 166/179 (93%), Gaps = 3/179 (2%)
 Frame = +3

Query  183  MSGNEFRFFLSCDINLPVTFRIERLEgklpppklpgSDGVDTMMNAIDDRKPELYVESTL  362
            MSGNEFRFFLSCDINLPVTFRIE+LEGKL  PKL  SD VD+     +++KPELYVESTL
Sbjct  1    MSGNEFRFFLSCDINLPVTFRIEKLEGKLLSPKLSDSDNVDS---TTEEKKPELYVESTL  57

Query  363  YIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIG  542
            YIDGAPFGL MRTRLESRGPS+CWNELIT+STKYRDLTANSQLA TVWDVSCGK EG+IG
Sbjct  58   YIDGAPFGLSMRTRLESRGPSFCWNELITMSTKYRDLTANSQLAFTVWDVSCGKGEGLIG  117

Query  543  GATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKVPkeergelerleklVNKYE  719
            GATIHLFNMKKQLKTGKHKLRLWSGKEADGSI+TTTPGKVPKEERGELERLEKLVNKYE
Sbjct  118  GATIHLFNMKKQLKTGKHKLRLWSGKEADGSINTTTPGKVPKEERGELERLEKLVNKYE  176



>ref|XP_009605436.1| PREDICTED: phosphatidylinositol 3-kinase, root isoform [Nicotiana 
tomentosiformis]
Length=815

 Score =   281 bits (718),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 156/179 (87%), Positives = 164/179 (92%), Gaps = 3/179 (2%)
 Frame = +3

Query  183  MSGNEFRFFLSCDINLPVTFRIERLEgklpppklpgSDGVDTMMNAIDDRKPELYVESTL  362
            MSGNEFRFFLSCDINLPVTFRIE+LEGKL  PK   SD VD+     +++KPELYVESTL
Sbjct  1    MSGNEFRFFLSCDINLPVTFRIEKLEGKLLTPKHSDSDNVDS---TAEEKKPELYVESTL  57

Query  363  YIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIG  542
            YIDGAPFGL MRTRLESRGPS+CWNELITLSTKYRDLTANSQLA TVWDVSCGK EG+IG
Sbjct  58   YIDGAPFGLSMRTRLESRGPSFCWNELITLSTKYRDLTANSQLAFTVWDVSCGKGEGLIG  117

Query  543  GATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKVPkeergelerleklVNKYE  719
            GATIHLFNMKKQLKTGKHKLRLW GKEADGSI+TTTPGKVPKEERGELERLEKLVNKYE
Sbjct  118  GATIHLFNMKKQLKTGKHKLRLWPGKEADGSINTTTPGKVPKEERGELERLEKLVNKYE  176



>gb|AAW80628.1| phosphoinositide 3-kinase [Nicotiana tabacum]
Length=814

 Score =   278 bits (712),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 155/179 (87%), Positives = 165/179 (92%), Gaps = 3/179 (2%)
 Frame = +3

Query  183  MSGNEFRFFLSCDINLPVTFRIERLEgklpppklpgSDGVDTMMNAIDDRKPELYVESTL  362
            MSGNEFRFFLSCDINLPVTFRIE+LEGKL  PKL  SD VD+     +++KPELYVESTL
Sbjct  1    MSGNEFRFFLSCDINLPVTFRIEKLEGKLLTPKLSDSDNVDS---TAEEKKPELYVESTL  57

Query  363  YIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIG  542
            +IDGAPFGL MR+RLESRGPS+CWNELITLSTKYRDLTANSQLA TVWDVSCGK EG+IG
Sbjct  58   FIDGAPFGLSMRSRLESRGPSFCWNELITLSTKYRDLTANSQLAFTVWDVSCGKGEGLIG  117

Query  543  GATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKVPkeergelerleklVNKYE  719
            GATIHLFNMKKQLKTGKHKLRLW GKEADGSI+TTTPGKVPKEERGELERLEKLVNKYE
Sbjct  118  GATIHLFNMKKQLKTGKHKLRLWPGKEADGSINTTTPGKVPKEERGELERLEKLVNKYE  176



>emb|CDP13176.1| unnamed protein product [Coffea canephora]
Length=815

 Score =   270 bits (691),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 151/179 (84%), Positives = 163/179 (91%), Gaps = 3/179 (2%)
 Frame = +3

Query  183  MSGNEFRFFLSCDINLPVTFRIERLEgklpppklpgSDGVDTMMNAIDDRKPELYVESTL  362
            MSGNEFRFFLSCDINLPVTFRIERLEGKLP  + P S  VD+    +++ +PELYVE TL
Sbjct  1    MSGNEFRFFLSCDINLPVTFRIERLEGKLPSSRNPDSADVDS---TLEEGRPELYVECTL  57

Query  363  YIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIG  542
            Y+DGAPFGLPMRTRLE++GPSYCWNELITLSTKYRDLTANSQLA TVWDVS GKSEGVIG
Sbjct  58   YLDGAPFGLPMRTRLETKGPSYCWNELITLSTKYRDLTANSQLAFTVWDVSRGKSEGVIG  117

Query  543  GATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKVPkeergelerleklVNKYE  719
            GATI LFNMKKQLKTGKHKLRLW G+EADGS+HT+TPGKVPKEERGELERLEKLVNKYE
Sbjct  118  GATIQLFNMKKQLKTGKHKLRLWLGREADGSVHTSTPGKVPKEERGELERLEKLVNKYE  176



>gb|EPS60252.1| phosphoinositide 3-kinase, partial [Genlisea aurea]
Length=226

 Score =   254 bits (648),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 144/179 (80%), Positives = 159/179 (89%), Gaps = 3/179 (2%)
 Frame = +3

Query  183  MSGNEFRFFLSCDINLPVTFRIERLEgklpppklpgSDGVDTMMNAIDDRKPELYVESTL  362
            M+GNEFRFFLSCDINLPVTF+IERLEGKL P +    D VD     I++R PELYVE+ L
Sbjct  1    MTGNEFRFFLSCDINLPVTFKIERLEGKLLPRRP--PDSVDGDY-TIEERNPELYVETLL  57

Query  363  YIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIG  542
            YIDG PFGLPMRTRLES GPSYCWNELITLSTKYRDLTANSQLA+TV+DVS G +  V+G
Sbjct  58   YIDGEPFGLPMRTRLESVGPSYCWNELITLSTKYRDLTANSQLAVTVFDVSNGNNGEVVG  117

Query  543  GATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKVPkeergelerleklVNKYE  719
            GA+IHLFNMKKQLKTGKHKLRLW+GKEADGSI+TTTPGKVPK+ERGELER+EKLVNKYE
Sbjct  118  GASIHLFNMKKQLKTGKHKLRLWAGKEADGSINTTTPGKVPKQERGELERIEKLVNKYE  176



>ref|XP_011100557.1| PREDICTED: phosphatidylinositol 3-kinase, root isoform [Sesamum 
indicum]
Length=815

 Score =   267 bits (682),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 152/179 (85%), Positives = 165/179 (92%), Gaps = 3/179 (2%)
 Frame = +3

Query  183  MSGNEFRFFLSCDINLPVTFRIERLEgklpppklpgSDGVDTMMNAIDDRKPELYVESTL  362
            MSGNEFRFFLSCDINLPVTF+IERL+GKL PPK P S   D +   I+DRKPELYVE +L
Sbjct  1    MSGNEFRFFLSCDINLPVTFKIERLDGKLSPPKPPDSADGDGI---IEDRKPELYVECSL  57

Query  363  YIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIG  542
            +IDGAPFGLPMRTRLES GPSYCWNELITLSTKYRDLTANSQLALTV+DVSCGK+E V+G
Sbjct  58   FIDGAPFGLPMRTRLESVGPSYCWNELITLSTKYRDLTANSQLALTVYDVSCGKNEEVVG  117

Query  543  GATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKVPkeergelerleklVNKYE  719
            GATI LFNMKKQLKTGKHKLRLW+GKEADGSI+TTTPG+VP+EERGELERLEKLVNKYE
Sbjct  118  GATIRLFNMKKQLKTGKHKLRLWAGKEADGSINTTTPGRVPREERGELERLEKLVNKYE  176



>gb|EYU42801.1| hypothetical protein MIMGU_mgv1a001464mg [Erythranthe guttata]
Length=815

 Score =   267 bits (682),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 149/179 (83%), Positives = 162/179 (91%), Gaps = 3/179 (2%)
 Frame = +3

Query  183  MSGNEFRFFLSCDINLPVTFRIERLEgklpppklpgSDGVDTMMNAIDDRKPELYVESTL  362
            MSGNEFRFFLSCDINLP TF+IERLEGKL P + P S   D     +++RKPELYVE  L
Sbjct  1    MSGNEFRFFLSCDINLPATFKIERLEGKLSPLQPPDSADGDC---TVEERKPELYVECLL  57

Query  363  YIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIG  542
            YIDGAPFGLPMRTRLES GPSYCWNELITLSTKYRDLTANS+LALTV+DVSCGK+E V+G
Sbjct  58   YIDGAPFGLPMRTRLESVGPSYCWNELITLSTKYRDLTANSRLALTVYDVSCGKNEEVVG  117

Query  543  GATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKVPkeergelerleklVNKYE  719
            GATIHLFNMKKQLK+GKHKLRLW+GKEADGSI+TTTPGKVPK+ERGELERLEKLVNKYE
Sbjct  118  GATIHLFNMKKQLKSGKHKLRLWAGKEADGSINTTTPGKVPKDERGELERLEKLVNKYE  176



>ref|XP_002525363.1| phosphatidylinositol 3-kinase class, putative [Ricinus communis]
 gb|EEF37001.1| phosphatidylinositol 3-kinase class, putative [Ricinus communis]
Length=813

 Score =   254 bits (650),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 144/179 (80%), Positives = 151/179 (84%), Gaps = 4/179 (2%)
 Frame = +3

Query  183  MSGNEFRFFLSCDINLPVTFRIERLEgklpppklpgSDGVDTMMNAIDDRKPELYVESTL  362
            MSGNEFRFFLSCDINLPVTFR+ERLEG LP  K   S    T     ++RK ELYVE  L
Sbjct  1    MSGNEFRFFLSCDINLPVTFRVERLEGSLPSAKSADSGTYSTA----EERKAELYVECAL  56

Query  363  YIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIG  542
            YIDGAPFGLPMRTRLES GPSYCWNELITLSTKYRDLTA+SQLA+TVWDVSCGK EG+IG
Sbjct  57   YIDGAPFGLPMRTRLESTGPSYCWNELITLSTKYRDLTAHSQLAVTVWDVSCGKDEGLIG  116

Query  543  GATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKVPkeergelerleklVNKYE  719
            GATI LFN K QLKTGK KLRLW GKEADGS  TTTPGKVP+ ERGELERLEKLVNKYE
Sbjct  117  GATILLFNSKMQLKTGKQKLRLWLGKEADGSFPTTTPGKVPRHERGELERLEKLVNKYE  175



>ref|XP_006350224.1| PREDICTED: phosphatidylinositol 3-kinase, root isoform-like [Solanum 
tuberosum]
Length=815

 Score =   254 bits (650),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 152/179 (85%), Positives = 163/179 (91%), Gaps = 3/179 (2%)
 Frame = +3

Query  183  MSGNEFRFFLSCDINLPVTFRIERLEgklpppklpgSDGVDTMMNAIDDRKPELYVESTL  362
            MSGNEFRFFLSCDINLPVT+RIE+LEGKL PPKL  SD VD+     ++RK ELYVESTL
Sbjct  1    MSGNEFRFFLSCDINLPVTYRIEKLEGKLLPPKLSDSDNVDS---TTEERKAELYVESTL  57

Query  363  YIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIG  542
            YIDGAPFGLPMRTRLE+  PS+CWNELITLSTKYRDLTANSQL+ TVWDVSCGK  G+IG
Sbjct  58   YIDGAPFGLPMRTRLETGAPSFCWNELITLSTKYRDLTANSQLSFTVWDVSCGKGGGLIG  117

Query  543  GATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKVPkeergelerleklVNKYE  719
            GATIHLFNMKKQLKTGKHKLRLW GKEADGSI+TTTPGKVP+EERGELERLEKLVNKYE
Sbjct  118  GATIHLFNMKKQLKTGKHKLRLWPGKEADGSINTTTPGKVPREERGELERLEKLVNKYE  176



>ref|XP_004236633.1| PREDICTED: phosphatidylinositol 3-kinase, root isoform [Solanum 
lycopersicum]
Length=815

 Score =   254 bits (649),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 151/179 (84%), Positives = 163/179 (91%), Gaps = 3/179 (2%)
 Frame = +3

Query  183  MSGNEFRFFLSCDINLPVTFRIERLEgklpppklpgSDGVDTMMNAIDDRKPELYVESTL  362
            MSGNEFRFFLSCDINLPVT+RIE+LEGKL PPKL  SD VD+     ++RK ELYVESTL
Sbjct  1    MSGNEFRFFLSCDINLPVTYRIEKLEGKLLPPKLADSDNVDS---TTEERKAELYVESTL  57

Query  363  YIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIG  542
            Y+DGAPFGLPMRTRLE+  PS+CWNELITLSTKYRDLTANSQL+ TVWDVSCGK  G+IG
Sbjct  58   YVDGAPFGLPMRTRLETGAPSFCWNELITLSTKYRDLTANSQLSFTVWDVSCGKGGGLIG  117

Query  543  GATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKVPkeergelerleklVNKYE  719
            GATIHLFNMKKQLKTGKHKLRLW GKEADGSI+TTTPGKVP+EERGELERLEKLVNKYE
Sbjct  118  GATIHLFNMKKQLKTGKHKLRLWPGKEADGSINTTTPGKVPREERGELERLEKLVNKYE  176



>ref|XP_002267769.2| PREDICTED: phosphatidylinositol 3-kinase, root isoform isoform 
X1 [Vitis vinifera]
 ref|XP_010651480.1| PREDICTED: phosphatidylinositol 3-kinase, root isoform isoform 
X1 [Vitis vinifera]
Length=818

 Score =   253 bits (647),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 144/182 (79%), Positives = 154/182 (85%), Gaps = 4/182 (2%)
 Frame = +3

Query  174  MKTMSGNEFRFFLSCDINLPVTFRIERLEgklpppklpgSDGVDTMMNAIDDRKPELYVE  353
            MK MSGNEFRFFLSCDINLPVTFRIERLEG LP  K   S+   T     ++R+ ELYVE
Sbjct  1    MKEMSGNEFRFFLSCDINLPVTFRIERLEGNLPSVKSSISEFDYT----TEERRAELYVE  56

Query  354  STLYIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEG  533
              L+IDGAPFGLP RTRLES GPSYCWNELITLSTKYRDLTA+SQLALTVWDVSCGK EG
Sbjct  57   CALFIDGAPFGLPTRTRLESTGPSYCWNELITLSTKYRDLTAHSQLALTVWDVSCGKDEG  116

Query  534  VIGGATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKVPkeergelerleklVNK  713
            +IGGATI LF+ KKQLKTGK KLRLW GKEADGS  TTTPGKVP+ ERGELERLEKL+NK
Sbjct  117  LIGGATILLFSSKKQLKTGKQKLRLWPGKEADGSFPTTTPGKVPRHERGELERLEKLMNK  176

Query  714  YE  719
            YE
Sbjct  177  YE  178



>ref|XP_008389664.1| PREDICTED: phosphatidylinositol 3-kinase, root isoform [Malus 
domestica]
Length=816

 Score =   251 bits (640),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 144/179 (80%), Positives = 155/179 (87%), Gaps = 2/179 (1%)
 Frame = +3

Query  183  MSGNEFRFFLSCDINLPVTFRIERLEgklpppklpgSDGVDTMMNAIDDRKPELYVESTL  362
            MSGNEFRFFLSCDINLPVTFRIERLEG LPPPK P SD   T  +A ++R+PELYVE  L
Sbjct  1    MSGNEFRFFLSCDINLPVTFRIERLEGALPPPKSPSSDVDPT--SATEERRPELYVECAL  58

Query  363  YIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIG  542
            YIDGAPFGLP RTRLES GP +CWNELITLSTKYRDLT +SQLALTVWDVSCGK EG++G
Sbjct  59   YIDGAPFGLPTRTRLESSGPLFCWNELITLSTKYRDLTGHSQLALTVWDVSCGKDEGLVG  118

Query  543  GATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKVPkeergelerleklVNKYE  719
            GATI LFN KKQLKTGK KLRLW GK ADGS  T+TPGKVP+ ERGELERLEKLVN+YE
Sbjct  119  GATILLFNSKKQLKTGKQKLRLWKGKVADGSFPTSTPGKVPRHERGELERLEKLVNRYE  177



>ref|XP_007044677.1| Vacuolar protein sorting 34 isoform 2 [Theobroma cacao]
 gb|EOY00509.1| Vacuolar protein sorting 34 isoform 2 [Theobroma cacao]
Length=672

 Score =   247 bits (630),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 138/179 (77%), Positives = 151/179 (84%), Gaps = 4/179 (2%)
 Frame = +3

Query  183  MSGNEFRFFLSCDINLPVTFRIERLEgklpppklpgSDGVDTMMNAIDDRKPELYVESTL  362
            MSGNEFRFFLSCDINLPVTFR++RLEG LP  K   S G+D+     ++RK ELYVE  L
Sbjct  1    MSGNEFRFFLSCDINLPVTFRVDRLEGTLPSTKSANS-GIDS---TTEERKAELYVECAL  56

Query  363  YIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIG  542
            YIDGAPFGLP +TRLES GP YCWNELITLSTKYRDLTA+SQLALTVWDVSCGK +G+IG
Sbjct  57   YIDGAPFGLPTKTRLESTGPLYCWNELITLSTKYRDLTAHSQLALTVWDVSCGKDDGLIG  116

Query  543  GATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKVPkeergelerleklVNKYE  719
            GATI LFN K QLKTGK KLRLW GK+ADGS  TTTPGKVP++E GELERLEKL NKYE
Sbjct  117  GATILLFNSKAQLKTGKQKLRLWLGKQADGSFPTTTPGKVPRQECGELERLEKLANKYE  175



>ref|XP_010651488.1| PREDICTED: phosphatidylinositol 3-kinase, root isoform isoform 
X2 [Vitis vinifera]
 emb|CBI28550.3| unnamed protein product [Vitis vinifera]
Length=815

 Score =   249 bits (636),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 142/179 (79%), Positives = 152/179 (85%), Gaps = 4/179 (2%)
 Frame = +3

Query  183  MSGNEFRFFLSCDINLPVTFRIERLEgklpppklpgSDGVDTMMNAIDDRKPELYVESTL  362
            MSGNEFRFFLSCDINLPVTFRIERLEG LP  K   S+   T     ++R+ ELYVE  L
Sbjct  1    MSGNEFRFFLSCDINLPVTFRIERLEGNLPSVKSSISEFDYT----TEERRAELYVECAL  56

Query  363  YIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIG  542
            +IDGAPFGLP RTRLES GPSYCWNELITLSTKYRDLTA+SQLALTVWDVSCGK EG+IG
Sbjct  57   FIDGAPFGLPTRTRLESTGPSYCWNELITLSTKYRDLTAHSQLALTVWDVSCGKDEGLIG  116

Query  543  GATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKVPkeergelerleklVNKYE  719
            GATI LF+ KKQLKTGK KLRLW GKEADGS  TTTPGKVP+ ERGELERLEKL+NKYE
Sbjct  117  GATILLFSSKKQLKTGKQKLRLWPGKEADGSFPTTTPGKVPRHERGELERLEKLMNKYE  175



>ref|XP_008221836.1| PREDICTED: phosphatidylinositol 3-kinase, root isoform [Prunus 
mume]
Length=816

 Score =   249 bits (635),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 140/179 (78%), Positives = 150/179 (84%), Gaps = 2/179 (1%)
 Frame = +3

Query  183  MSGNEFRFFLSCDINLPVTFRIERLEgklpppklpgSDGVDTMMNAIDDRKPELYVESTL  362
            MSGNEFRFFLSCDINLPVTFRIERLEG L   K P SD   T  +  ++R+ ELYVE  L
Sbjct  1    MSGNEFRFFLSCDINLPVTFRIERLEGTLRAAKSPSSDVDPT--STTEERRAELYVECAL  58

Query  363  YIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIG  542
            YIDGAPFGLP RTRLES GP YCWNELITLSTKYRDLT +SQLALTVWDVSCGK EG++G
Sbjct  59   YIDGAPFGLPTRTRLESSGPLYCWNELITLSTKYRDLTGHSQLALTVWDVSCGKDEGLVG  118

Query  543  GATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKVPkeergelerleklVNKYE  719
            GATI LFN KKQLKTGK KLRLW GK ADGS  T+TPGKVP+ ERGELERLEKLVN+YE
Sbjct  119  GATILLFNSKKQLKTGKQKLRLWQGKVADGSFPTSTPGKVPRHERGELERLEKLVNRYE  177



>ref|XP_010023534.1| PREDICTED: phosphatidylinositol 3-kinase, root isoform [Eucalyptus 
grandis]
 gb|KCW59826.1| hypothetical protein EUGRSUZ_H02571 [Eucalyptus grandis]
Length=817

 Score =   248 bits (633),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 140/182 (77%), Positives = 150/182 (82%), Gaps = 3/182 (2%)
 Frame = +3

Query  174  MKTMSGNEFRFFLSCDINLPVTFRIERLEgklpppklpgSDGVDTMMNAIDDRKPELYVE  353
            M    GNEFRFFLSCDINLPVTFR+E LEG LP    P S  +D   +  D+R+ ELYVE
Sbjct  1    MSVSGGNEFRFFLSCDINLPVTFRVENLEGALPAKHSPNSAEID---HTADERQSELYVE  57

Query  354  STLYIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEG  533
             +LYIDGAPFGLP RTRLES GP YCWNELITLSTKYRDLT +SQLALTVWDVSCGK EG
Sbjct  58   CSLYIDGAPFGLPTRTRLESAGPPYCWNELITLSTKYRDLTTHSQLALTVWDVSCGKEEG  117

Query  534  VIGGATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKVPkeergelerleklVNK  713
            +IGGATI LF+ KKQLKTGK KLRLW GKEADGS  TTTPGKVPK ERGELERLEKL+NK
Sbjct  118  LIGGATILLFSSKKQLKTGKQKLRLWQGKEADGSFPTTTPGKVPKHERGELERLEKLLNK  177

Query  714  YE  719
            YE
Sbjct  178  YE  179



>ref|XP_004297475.1| PREDICTED: phosphatidylinositol 3-kinase, root isoform [Fragaria 
vesca subsp. vesca]
Length=816

 Score =   248 bits (632),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 140/179 (78%), Positives = 151/179 (84%), Gaps = 2/179 (1%)
 Frame = +3

Query  183  MSGNEFRFFLSCDINLPVTFRIERLEgklpppklpgSDGVDTMMNAIDDRKPELYVESTL  362
            MSGNEFRFFLSCDINLP+TFRIERLEG L  PK   +D   T   A ++++ ELYVE  L
Sbjct  1    MSGNEFRFFLSCDINLPLTFRIERLEGTLTRPKSATADVDPT--PATEEKRSELYVECAL  58

Query  363  YIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIG  542
            YIDGAPFGLP RTRLES GPSYCWNELITLSTKYRDLT +SQLALTVWDVSCGK EG+IG
Sbjct  59   YIDGAPFGLPTRTRLESSGPSYCWNELITLSTKYRDLTGHSQLALTVWDVSCGKDEGLIG  118

Query  543  GATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKVPkeergelerleklVNKYE  719
            GATI LFN KKQLKTGK KLRLW GK ADGS  T+TPGKVP+ ERGELERLEKL+NKYE
Sbjct  119  GATILLFNNKKQLKTGKQKLRLWQGKLADGSFPTSTPGKVPRNERGELERLEKLMNKYE  177



>gb|KDP26603.1| hypothetical protein JCGZ_17761 [Jatropha curcas]
Length=809

 Score =   247 bits (630),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 141/179 (79%), Positives = 151/179 (84%), Gaps = 9/179 (5%)
 Frame = +3

Query  183  MSGNEFRFFLSCDINLPVTFRIERLEgklpppklpgSDGVDTMMNAIDDRKPELYVESTL  362
            MSGNEFRFFLSCDINLPVTFR+ERLEG LP  K P         N+ ++R+ EL+VE  L
Sbjct  1    MSGNEFRFFLSCDINLPVTFRVERLEGSLPSTKSP---------NSAEERRAELFVECAL  51

Query  363  YIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIG  542
            YIDGAPFGLPMRTRLES GPSYCWNELITLSTKYRDLTA+SQLA+TVWDVS GK EG+IG
Sbjct  52   YIDGAPFGLPMRTRLESTGPSYCWNELITLSTKYRDLTAHSQLAVTVWDVSRGKDEGLIG  111

Query  543  GATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKVPkeergelerleklVNKYE  719
            GATI LFN K QLKTGK KLRLW GKEADGS  TTTPGKVP+ ERGELERLEKLVNKYE
Sbjct  112  GATILLFNSKMQLKTGKQKLRLWPGKEADGSFPTTTPGKVPRHERGELERLEKLVNKYE  170



>ref|XP_007044676.1| Vacuolar protein sorting 34 isoform 1 [Theobroma cacao]
 gb|EOY00508.1| Vacuolar protein sorting 34 isoform 1 [Theobroma cacao]
Length=814

 Score =   246 bits (628),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 138/179 (77%), Positives = 151/179 (84%), Gaps = 4/179 (2%)
 Frame = +3

Query  183  MSGNEFRFFLSCDINLPVTFRIERLEgklpppklpgSDGVDTMMNAIDDRKPELYVESTL  362
            MSGNEFRFFLSCDINLPVTFR++RLEG LP  K   S G+D+     ++RK ELYVE  L
Sbjct  1    MSGNEFRFFLSCDINLPVTFRVDRLEGTLPSTKSANS-GIDS---TTEERKAELYVECAL  56

Query  363  YIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIG  542
            YIDGAPFGLP +TRLES GP YCWNELITLSTKYRDLTA+SQLALTVWDVSCGK +G+IG
Sbjct  57   YIDGAPFGLPTKTRLESTGPLYCWNELITLSTKYRDLTAHSQLALTVWDVSCGKDDGLIG  116

Query  543  GATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKVPkeergelerleklVNKYE  719
            GATI LFN K QLKTGK KLRLW GK+ADGS  TTTPGKVP++E GELERLEKL NKYE
Sbjct  117  GATILLFNSKAQLKTGKQKLRLWLGKQADGSFPTTTPGKVPRQECGELERLEKLANKYE  175



>ref|XP_010269374.1| PREDICTED: phosphatidylinositol 3-kinase, root isoform isoform 
X2 [Nelumbo nucifera]
Length=855

 Score =   246 bits (628),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 141/179 (79%), Positives = 147/179 (82%), Gaps = 5/179 (3%)
 Frame = +3

Query  183  MSGNEFRFFLSCDINLPVTFRIERLEgklpppklpgSDGVDTMMNAIDDRKPELYVESTL  362
            MSGNEFRFFLSCDINLPVTFR+ERLEG LP  K   S    T     +DR+ ELYVE  L
Sbjct  1    MSGNEFRFFLSCDINLPVTFRVERLEGNLPATKSSESLSCTT-----EDRRAELYVECVL  55

Query  363  YIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIG  542
            YIDGAPFGLP RTRLES G  YCW ELITLSTKYRDLTA+SQL LTVWDVSCGK EG+IG
Sbjct  56   YIDGAPFGLPTRTRLESTGQPYCWTELITLSTKYRDLTAHSQLTLTVWDVSCGKDEGLIG  115

Query  543  GATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKVPkeergelerleklVNKYE  719
            GATI LFN KKQLKTGK KLRLW GKEADGS  TTTPGKVP+ ERGELERLEKLVNKYE
Sbjct  116  GATILLFNSKKQLKTGKQKLRLWLGKEADGSFPTTTPGKVPRHERGELERLEKLVNKYE  174



>ref|XP_010269375.1| PREDICTED: phosphatidylinositol 3-kinase, root isoform isoform 
X3 [Nelumbo nucifera]
Length=814

 Score =   245 bits (626),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 140/179 (78%), Positives = 147/179 (82%), Gaps = 4/179 (2%)
 Frame = +3

Query  183  MSGNEFRFFLSCDINLPVTFRIERLEgklpppklpgSDGVDTMMNAIDDRKPELYVESTL  362
            MSGNEFRFFLSCDINLPVTFR+ERLEG LP  K   S     +    +DR+ ELYVE  L
Sbjct  1    MSGNEFRFFLSCDINLPVTFRVERLEGNLPATKSSESQ----VSCTTEDRRAELYVECVL  56

Query  363  YIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIG  542
            YIDGAPFGLP RTRLES G  YCW ELITLSTKYRDLTA+SQL LTVWDVSCGK EG+IG
Sbjct  57   YIDGAPFGLPTRTRLESTGQPYCWTELITLSTKYRDLTAHSQLTLTVWDVSCGKDEGLIG  116

Query  543  GATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKVPkeergelerleklVNKYE  719
            GATI LFN KKQLKTGK KLRLW GKEADGS  TTTPGKVP+ ERGELERLEKLVNKYE
Sbjct  117  GATILLFNSKKQLKTGKQKLRLWLGKEADGSFPTTTPGKVPRHERGELERLEKLVNKYE  175



>gb|KDO82392.1| hypothetical protein CISIN_1g003462mg [Citrus sinensis]
Length=676

 Score =   243 bits (620),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 137/180 (76%), Positives = 151/180 (84%), Gaps = 1/180 (1%)
 Frame = +3

Query  183  MSGNEFRFFLSCDINLPVTFRIERLEgklpppklpgS-DGVDTMMNAIDDRKPELYVEST  359
            MSGNEFRFFLSCDINLPV FR++RLEG LP  K P S +    + +  ++R+PELYVE  
Sbjct  1    MSGNEFRFFLSCDINLPVKFRVDRLEGTLPSIKSPNSVNDRSGISSTTEERRPELYVECA  60

Query  360  LYIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVI  539
            LYIDGAPFGLPMRTRLES GP YCWNE ITLSTKYRDLTA+SQLALTVWDVSCGK E ++
Sbjct  61   LYIDGAPFGLPMRTRLESMGPMYCWNEPITLSTKYRDLTAHSQLALTVWDVSCGKDERLV  120

Query  540  GGATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKVPkeergelerleklVNKYE  719
            GG TI LFN K QLKTGK KLRLW GKEADGS+ T+TPGKVPK ERGELERLEKL+NKYE
Sbjct  121  GGTTILLFNSKMQLKTGKQKLRLWPGKEADGSLPTSTPGKVPKNERGELERLEKLINKYE  180



>ref|XP_008340052.1| PREDICTED: phosphatidylinositol 3-kinase, root isoform-like [Malus 
domestica]
Length=816

 Score =   244 bits (624),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 142/179 (79%), Positives = 151/179 (84%), Gaps = 2/179 (1%)
 Frame = +3

Query  183  MSGNEFRFFLSCDINLPVTFRIERLEgklpppklpgSDGVDTMMNAIDDRKPELYVESTL  362
            MSGNEFRFFLSCDINLPVTFRIE LEG LPP K P SD VD    A ++R  ELYVE  L
Sbjct  1    MSGNEFRFFLSCDINLPVTFRIELLEGALPPSKSPSSD-VDPAF-ATEERNSELYVECAL  58

Query  363  YIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIG  542
            YIDGAPFGLP RTRLES GP YCWNEL+TLSTKYRDLT +SQLALTVWDVSCGK EG++G
Sbjct  59   YIDGAPFGLPTRTRLESSGPLYCWNELVTLSTKYRDLTGHSQLALTVWDVSCGKDEGLVG  118

Query  543  GATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKVPkeergelerleklVNKYE  719
            GATI LFN KKQLKTGK KLRLW GK ADGS  T+TPGKVP+ ERGELERLEKLVN+YE
Sbjct  119  GATILLFNSKKQLKTGKQKLRLWKGKVADGSFPTSTPGKVPRHERGELERLEKLVNRYE  177



>ref|XP_010269370.1| PREDICTED: phosphatidylinositol 3-kinase, root isoform isoform 
X1 [Nelumbo nucifera]
 ref|XP_010269372.1| PREDICTED: phosphatidylinositol 3-kinase, root isoform isoform 
X1 [Nelumbo nucifera]
 ref|XP_010269373.1| PREDICTED: phosphatidylinositol 3-kinase, root isoform isoform 
X1 [Nelumbo nucifera]
Length=856

 Score =   245 bits (626),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 141/179 (79%), Positives = 147/179 (82%), Gaps = 4/179 (2%)
 Frame = +3

Query  183  MSGNEFRFFLSCDINLPVTFRIERLEgklpppklpgSDGVDTMMNAIDDRKPELYVESTL  362
            MSGNEFRFFLSCDINLPVTFR+ERLEG LP  K   S    T     +DR+ ELYVE  L
Sbjct  1    MSGNEFRFFLSCDINLPVTFRVERLEGNLPATKSSESQVSCTT----EDRRAELYVECVL  56

Query  363  YIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIG  542
            YIDGAPFGLP RTRLES G  YCW ELITLSTKYRDLTA+SQL LTVWDVSCGK EG+IG
Sbjct  57   YIDGAPFGLPTRTRLESTGQPYCWTELITLSTKYRDLTAHSQLTLTVWDVSCGKDEGLIG  116

Query  543  GATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKVPkeergelerleklVNKYE  719
            GATI LFN KKQLKTGK KLRLW GKEADGS  TTTPGKVP+ ERGELERLEKLVNKYE
Sbjct  117  GATILLFNSKKQLKTGKQKLRLWLGKEADGSFPTTTPGKVPRHERGELERLEKLVNKYE  175



>ref|XP_006438360.1| hypothetical protein CICLE_v10030717mg [Citrus clementina]
 gb|ESR51600.1| hypothetical protein CICLE_v10030717mg [Citrus clementina]
Length=770

 Score =   244 bits (622),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 138/180 (77%), Positives = 152/180 (84%), Gaps = 1/180 (1%)
 Frame = +3

Query  183  MSGNEFRFFLSCDINLPVTFRIERLEgklpppklpgSDGVDTMMNAI-DDRKPELYVEST  359
            MSGNEFRFFLSCDINLPV FR++RLEG LP  K P S    + +N+  ++R+PELYVE  
Sbjct  1    MSGNEFRFFLSCDINLPVKFRVDRLEGTLPSIKSPNSVNDRSGINSTTEERRPELYVECA  60

Query  360  LYIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVI  539
            LYIDGAPFGLPMRTRLES GP YCWNE ITLSTKYRDLTA+SQLALTVWDVSCGK E ++
Sbjct  61   LYIDGAPFGLPMRTRLESMGPMYCWNEPITLSTKYRDLTAHSQLALTVWDVSCGKDERLV  120

Query  540  GGATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKVPkeergelerleklVNKYE  719
            GG TI LFN K QLKTGK KLRLW GKEADGS+ T+TPGKVPK ERGELERLEKL+NKYE
Sbjct  121  GGTTILLFNSKMQLKTGKQKLRLWPGKEADGSLPTSTPGKVPKNERGELERLEKLINKYE  180



>ref|XP_006483879.1| PREDICTED: phosphatidylinositol 3-kinase, nodule isoform-like 
isoform X1 [Citrus sinensis]
 ref|XP_006483880.1| PREDICTED: phosphatidylinositol 3-kinase, nodule isoform-like 
isoform X2 [Citrus sinensis]
Length=818

 Score =   244 bits (622),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 138/180 (77%), Positives = 152/180 (84%), Gaps = 1/180 (1%)
 Frame = +3

Query  183  MSGNEFRFFLSCDINLPVTFRIERLEgklpppklpgSDGVDTMMNAI-DDRKPELYVEST  359
            MSGNEFRFFLSCDINLPV FR++RLEG LP  K P S    + +N+  ++R+PELYVE  
Sbjct  1    MSGNEFRFFLSCDINLPVKFRVDRLEGTLPSIKSPNSVNDRSGINSTTEERRPELYVECA  60

Query  360  LYIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVI  539
            LYIDGAPFGLPMRTRLES GP YCWNE ITLSTKYRDLTA+SQLALTVWDVSCGK E ++
Sbjct  61   LYIDGAPFGLPMRTRLESMGPMYCWNEPITLSTKYRDLTAHSQLALTVWDVSCGKDERLV  120

Query  540  GGATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKVPkeergelerleklVNKYE  719
            GG TI LFN K QLKTGK KLRLW GKEADGS+ T+TPGKVPK ERGELERLEKL+NKYE
Sbjct  121  GGTTILLFNSKMQLKTGKQKLRLWPGKEADGSLPTSTPGKVPKNERGELERLEKLINKYE  180



>ref|XP_006438361.1| hypothetical protein CICLE_v10030717mg [Citrus clementina]
 ref|XP_006438363.1| hypothetical protein CICLE_v10030717mg [Citrus clementina]
 gb|ESR51601.1| hypothetical protein CICLE_v10030717mg [Citrus clementina]
 gb|ESR51603.1| hypothetical protein CICLE_v10030717mg [Citrus clementina]
Length=818

 Score =   244 bits (622),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 138/180 (77%), Positives = 152/180 (84%), Gaps = 1/180 (1%)
 Frame = +3

Query  183  MSGNEFRFFLSCDINLPVTFRIERLEgklpppklpgSDGVDTMMNAI-DDRKPELYVEST  359
            MSGNEFRFFLSCDINLPV FR++RLEG LP  K P S    + +N+  ++R+PELYVE  
Sbjct  1    MSGNEFRFFLSCDINLPVKFRVDRLEGTLPSIKSPNSVNDRSGINSTTEERRPELYVECA  60

Query  360  LYIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVI  539
            LYIDGAPFGLPMRTRLES GP YCWNE ITLSTKYRDLTA+SQLALTVWDVSCGK E ++
Sbjct  61   LYIDGAPFGLPMRTRLESMGPMYCWNEPITLSTKYRDLTAHSQLALTVWDVSCGKDERLV  120

Query  540  GGATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKVPkeergelerleklVNKYE  719
            GG TI LFN K QLKTGK KLRLW GKEADGS+ T+TPGKVPK ERGELERLEKL+NKYE
Sbjct  121  GGTTILLFNSKMQLKTGKQKLRLWPGKEADGSLPTSTPGKVPKNERGELERLEKLINKYE  180



>ref|XP_006438362.1| hypothetical protein CICLE_v10030717mg [Citrus clementina]
 gb|ESR51602.1| hypothetical protein CICLE_v10030717mg [Citrus clementina]
Length=813

 Score =   243 bits (621),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 138/180 (77%), Positives = 152/180 (84%), Gaps = 1/180 (1%)
 Frame = +3

Query  183  MSGNEFRFFLSCDINLPVTFRIERLEgklpppklpgSDGVDTMMNAI-DDRKPELYVEST  359
            MSGNEFRFFLSCDINLPV FR++RLEG LP  K P S    + +N+  ++R+PELYVE  
Sbjct  1    MSGNEFRFFLSCDINLPVKFRVDRLEGTLPSIKSPNSVNDRSGINSTTEERRPELYVECA  60

Query  360  LYIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVI  539
            LYIDGAPFGLPMRTRLES GP YCWNE ITLSTKYRDLTA+SQLALTVWDVSCGK E ++
Sbjct  61   LYIDGAPFGLPMRTRLESMGPMYCWNEPITLSTKYRDLTAHSQLALTVWDVSCGKDERLV  120

Query  540  GGATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKVPkeergelerleklVNKYE  719
            GG TI LFN K QLKTGK KLRLW GKEADGS+ T+TPGKVPK ERGELERLEKL+NKYE
Sbjct  121  GGTTILLFNSKMQLKTGKQKLRLWPGKEADGSLPTSTPGKVPKNERGELERLEKLINKYE  180



>gb|KDO82390.1| hypothetical protein CISIN_1g003462mg [Citrus sinensis]
Length=770

 Score =   243 bits (619),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 137/180 (76%), Positives = 151/180 (84%), Gaps = 1/180 (1%)
 Frame = +3

Query  183  MSGNEFRFFLSCDINLPVTFRIERLEgklpppklpgS-DGVDTMMNAIDDRKPELYVEST  359
            MSGNEFRFFLSCDINLPV FR++RLEG LP  K P S +    + +  ++R+PELYVE  
Sbjct  1    MSGNEFRFFLSCDINLPVKFRVDRLEGTLPSIKSPNSVNDRSGISSTTEERRPELYVECA  60

Query  360  LYIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVI  539
            LYIDGAPFGLPMRTRLES GP YCWNE ITLSTKYRDLTA+SQLALTVWDVSCGK E ++
Sbjct  61   LYIDGAPFGLPMRTRLESMGPMYCWNEPITLSTKYRDLTAHSQLALTVWDVSCGKDERLV  120

Query  540  GGATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKVPkeergelerleklVNKYE  719
            GG TI LFN K QLKTGK KLRLW GKEADGS+ T+TPGKVPK ERGELERLEKL+NKYE
Sbjct  121  GGTTILLFNSKMQLKTGKQKLRLWPGKEADGSLPTSTPGKVPKNERGELERLEKLINKYE  180



>gb|KDO82391.1| hypothetical protein CISIN_1g003462mg [Citrus sinensis]
Length=805

 Score =   242 bits (618),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 137/180 (76%), Positives = 151/180 (84%), Gaps = 1/180 (1%)
 Frame = +3

Query  183  MSGNEFRFFLSCDINLPVTFRIERLEgklpppklpgS-DGVDTMMNAIDDRKPELYVEST  359
            MSGNEFRFFLSCDINLPV FR++RLEG LP  K P S +    + +  ++R+PELYVE  
Sbjct  1    MSGNEFRFFLSCDINLPVKFRVDRLEGTLPSIKSPNSVNDRSGISSTTEERRPELYVECA  60

Query  360  LYIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVI  539
            LYIDGAPFGLPMRTRLES GP YCWNE ITLSTKYRDLTA+SQLALTVWDVSCGK E ++
Sbjct  61   LYIDGAPFGLPMRTRLESMGPMYCWNEPITLSTKYRDLTAHSQLALTVWDVSCGKDERLV  120

Query  540  GGATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKVPkeergelerleklVNKYE  719
            GG TI LFN K QLKTGK KLRLW GKEADGS+ T+TPGKVPK ERGELERLEKL+NKYE
Sbjct  121  GGTTILLFNSKMQLKTGKQKLRLWPGKEADGSLPTSTPGKVPKNERGELERLEKLINKYE  180



>gb|KDO82389.1| hypothetical protein CISIN_1g003462mg [Citrus sinensis]
Length=818

 Score =   242 bits (618),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 137/180 (76%), Positives = 151/180 (84%), Gaps = 1/180 (1%)
 Frame = +3

Query  183  MSGNEFRFFLSCDINLPVTFRIERLEgklpppklpgS-DGVDTMMNAIDDRKPELYVEST  359
            MSGNEFRFFLSCDINLPV FR++RLEG LP  K P S +    + +  ++R+PELYVE  
Sbjct  1    MSGNEFRFFLSCDINLPVKFRVDRLEGTLPSIKSPNSVNDRSGISSTTEERRPELYVECA  60

Query  360  LYIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVI  539
            LYIDGAPFGLPMRTRLES GP YCWNE ITLSTKYRDLTA+SQLALTVWDVSCGK E ++
Sbjct  61   LYIDGAPFGLPMRTRLESMGPMYCWNEPITLSTKYRDLTAHSQLALTVWDVSCGKDERLV  120

Query  540  GGATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKVPkeergelerleklVNKYE  719
            GG TI LFN K QLKTGK KLRLW GKEADGS+ T+TPGKVPK ERGELERLEKL+NKYE
Sbjct  121  GGTTILLFNSKMQLKTGKQKLRLWPGKEADGSLPTSTPGKVPKNERGELERLEKLINKYE  180



>gb|KJB15579.1| hypothetical protein B456_002G185300 [Gossypium raimondii]
 gb|KJB15580.1| hypothetical protein B456_002G185300 [Gossypium raimondii]
 gb|KJB15581.1| hypothetical protein B456_002G185300 [Gossypium raimondii]
Length=814

 Score =   240 bits (613),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 138/179 (77%), Positives = 152/179 (85%), Gaps = 4/179 (2%)
 Frame = +3

Query  183  MSGNEFRFFLSCDINLPVTFRIERLEgklpppklpgSDGVDTMMNAIDDRKPELYVESTL  362
            MSGNEFRFFLSCDINLPVTFR++RLEG LP P  P S G D+     ++RK ELYVE  L
Sbjct  1    MSGNEFRFFLSCDINLPVTFRVDRLEGTLPSPNSPNS-GTDS---TTEERKGELYVECAL  56

Query  363  YIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIG  542
            YIDGAPFGLP +TRLES GP YCWNELITLSTKYRDLTA+SQLALTVWD+SCGK +G+IG
Sbjct  57   YIDGAPFGLPTKTRLESAGPLYCWNELITLSTKYRDLTAHSQLALTVWDLSCGKDDGLIG  116

Query  543  GATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKVPkeergelerleklVNKYE  719
            GATI LFN K QLKTGK KLRLW GK+ADGS  T+TPGKVP++ERGELERLEKL NKYE
Sbjct  117  GATILLFNNKMQLKTGKQKLRLWLGKQADGSFPTSTPGKVPRQERGELERLEKLANKYE  175



>ref|XP_010533950.1| PREDICTED: phosphatidylinositol 3-kinase VPS34 isoform X1 [Tarenaya 
hassleriana]
Length=813

 Score =   239 bits (611),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 133/179 (74%), Positives = 154/179 (86%), Gaps = 4/179 (2%)
 Frame = +3

Query  183  MSGNEFRFFLSCDINLPVTFRIERLEgklpppklpgSDGVDTMMNAIDDRKPELYVESTL  362
            M  NEFRFFLSCDINLPVTFR+ERLEG LP  K  G+ GV   ++ +DD+KPEL+VE  L
Sbjct  1    MGANEFRFFLSCDINLPVTFRVERLEGTLPEKKPSGT-GV---VSGVDDQKPELFVECAL  56

Query  363  YIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIG  542
            +IDGAPFGLPMR+RL++ GP YCWNELITLS KYRDLTA+SQLA+TVWDVS GK+EG+IG
Sbjct  57   HIDGAPFGLPMRSRLQTSGPPYCWNELITLSAKYRDLTAHSQLAITVWDVSRGKAEGLIG  116

Query  543  GATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKVPkeergelerleklVNKYE  719
            GAT+ LFN K QLKTGK KLRLW GKEADGS  T+TPGKVP++ERGE+ERLEKL+NKYE
Sbjct  117  GATVLLFNSKMQLKTGKQKLRLWQGKEADGSFPTSTPGKVPRQERGEIERLEKLMNKYE  175



>ref|XP_010533951.1| PREDICTED: phosphatidylinositol 3-kinase VPS34 isoform X2 [Tarenaya 
hassleriana]
Length=811

 Score =   239 bits (610),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 132/179 (74%), Positives = 152/179 (85%), Gaps = 6/179 (3%)
 Frame = +3

Query  183  MSGNEFRFFLSCDINLPVTFRIERLEgklpppklpgSDGVDTMMNAIDDRKPELYVESTL  362
            M  NEFRFFLSCDINLPVTFR+ERLEG LP  K     GV   ++ +DD+KPEL+VE  L
Sbjct  1    MGANEFRFFLSCDINLPVTFRVERLEGTLPEKK---PSGV---VSGVDDQKPELFVECAL  54

Query  363  YIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIG  542
            +IDGAPFGLPMR+RL++ GP YCWNELITLS KYRDLTA+SQLA+TVWDVS GK+EG+IG
Sbjct  55   HIDGAPFGLPMRSRLQTSGPPYCWNELITLSAKYRDLTAHSQLAITVWDVSRGKAEGLIG  114

Query  543  GATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKVPkeergelerleklVNKYE  719
            GAT+ LFN K QLKTGK KLRLW GKEADGS  T+TPGKVP++ERGE+ERLEKL+NKYE
Sbjct  115  GATVLLFNSKMQLKTGKQKLRLWQGKEADGSFPTSTPGKVPRQERGEIERLEKLMNKYE  173



>ref|XP_006301054.1| hypothetical protein CARUB_v10021447mg [Capsella rubella]
 gb|EOA33952.1| hypothetical protein CARUB_v10021447mg [Capsella rubella]
Length=813

 Score =   238 bits (607),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 130/179 (73%), Positives = 151/179 (84%), Gaps = 4/179 (2%)
 Frame = +3

Query  183  MSGNEFRFFLSCDINLPVTFRIERLEgklpppklpgSDGVDTMMNAIDDRKPELYVESTL  362
            M  NEFRFFLSCDIN PVTFRIE+L+G LP  K   S+ V    +  +++KPELY+E  L
Sbjct  1    MGANEFRFFLSCDINSPVTFRIEKLDGNLPVKKSTDSEFV----SIAEEKKPELYIECAL  56

Query  363  YIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIG  542
            YIDGAPFGLPMRTRL++ GP YCWNELITLS+KYRDLTA+SQLA+TVWDVSCGK+EG+IG
Sbjct  57   YIDGAPFGLPMRTRLKTTGPPYCWNELITLSSKYRDLTAHSQLAITVWDVSCGKTEGLIG  116

Query  543  GATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKVPkeergelerleklVNKYE  719
            GAT+ LFN K Q+K+GK KLRLW GKEADGS  T+TPGKVP+ ERGELERLEKL+NKYE
Sbjct  117  GATVLLFNSKGQMKSGKQKLRLWQGKEADGSYPTSTPGKVPRHERGELERLEKLMNKYE  175



>ref|XP_002886614.1| ATVPS34 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH62873.1| ATVPS34 [Arabidopsis lyrata subsp. lyrata]
Length=813

 Score =   238 bits (607),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 131/179 (73%), Positives = 152/179 (85%), Gaps = 4/179 (2%)
 Frame = +3

Query  183  MSGNEFRFFLSCDINLPVTFRIERLEgklpppklpgSDGVDTMMNAIDDRKPELYVESTL  362
            M  NEFRFFLSCDIN PVTFRIE+L+G LP  K   S GV   ++  +++KPELY+E  L
Sbjct  1    MGANEFRFFLSCDINSPVTFRIEKLDGNLPVKKSSDS-GV---VSVAEEKKPELYIECAL  56

Query  363  YIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIG  542
            YIDGAPFGLPMRTRL++ GP YCWNELITLS+KYRDLTA+SQLA+TVWDVSCGK+EG+IG
Sbjct  57   YIDGAPFGLPMRTRLKTTGPPYCWNELITLSSKYRDLTAHSQLAITVWDVSCGKTEGLIG  116

Query  543  GATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKVPkeergelerleklVNKYE  719
            GAT+ LFN K Q+K+GK KLRLW GKEADGS  T+TPGKVP+ ERGELERLEKL+NKYE
Sbjct  117  GATVLLFNSKMQMKSGKQKLRLWQGKEADGSFPTSTPGKVPRHERGELERLEKLMNKYE  175



>ref|XP_008444332.1| PREDICTED: phosphatidylinositol 3-kinase, root isoform [Cucumis 
melo]
Length=867

 Score =   238 bits (608),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 145/198 (73%), Positives = 158/198 (80%), Gaps = 10/198 (5%)
 Frame = +3

Query  126  NHENLSF*SLNPNQIVMKTMSGNEFRFFLSCDINLPVTFRIERLEgklpppklpgSDGVD  305
            +HE L F      Q  +  MSGNEFRFFLSCDINLPVTFR+ERLEG LPP K   S    
Sbjct  41   DHEKLYF------QSRLAEMSGNEFRFFLSCDINLPVTFRVERLEGNLPPAKSSDS----  90

Query  306  TMMNAIDDRKPELYVESTLYIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANS  485
             + +A D+R+ EL+VE  LYIDGAPFGLP RTRLES GPSY W+ELITLSTKYRDLTA+S
Sbjct  91   DIDSASDERRAELFVECALYIDGAPFGLPTRTRLESSGPSYSWSELITLSTKYRDLTAHS  150

Query  486  QLALTVWDVSCGKSEGVIGGATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKVP  665
            QLALTVWDVS GK E +IGGATI LFN KKQLKTGK KLRLW GKEADGS  TTTPGKVP
Sbjct  151  QLALTVWDVSRGKEEELIGGATILLFNRKKQLKTGKQKLRLWLGKEADGSFPTTTPGKVP  210

Query  666  keergelerleklVNKYE  719
            + ERGELERLEK+VNKYE
Sbjct  211  RHERGELERLEKVVNKYE  228



>ref|NP_176251.1| phosphatidylinositol 3-kinase VPS34 [Arabidopsis thaliana]
 sp|P42339.2|PI3K_ARATH RecName: Full=Phosphatidylinositol 3-kinase VPS34; AltName: Full=PI3-kinase 
VPS34; Short=AtVPS34; Short=PI3K VPS34; AltName: 
Full=PtdIns-3-kinase VSP34 [Arabidopsis thaliana]
 gb|AAB71971.1| Phosphatidylinositol 3-kinase [Arabidopsis thaliana]
 gb|AAN41278.1| putative phosphatidylinositol 3-kinase [Arabidopsis thaliana]
 gb|AEE33693.1| phosphatidylinositol 3-kinase VPS34 [Arabidopsis thaliana]
Length=814

 Score =   238 bits (606),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 131/179 (73%), Positives = 152/179 (85%), Gaps = 4/179 (2%)
 Frame = +3

Query  183  MSGNEFRFFLSCDINLPVTFRIERLEgklpppklpgSDGVDTMMNAIDDRKPELYVESTL  362
            M  NEFRFFLSCDIN PVTFRIE+L+G LP  K   S GV   ++  +++KPELY+E  L
Sbjct  1    MGANEFRFFLSCDINSPVTFRIEKLDGNLPVKKSSDS-GV---VSIAEEKKPELYIECAL  56

Query  363  YIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIG  542
            YIDGAPFGLPMRTRL++ GP YCWNELITLS+KYRDLTA+SQLA+TVWDVSCGK+EG+IG
Sbjct  57   YIDGAPFGLPMRTRLKTTGPPYCWNELITLSSKYRDLTAHSQLAITVWDVSCGKTEGLIG  116

Query  543  GATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKVPkeergelerleklVNKYE  719
            GAT+ LFN K Q+K+GK KLRLW GKEADGS  T+TPGKVP+ ERGELERLEKL+NKYE
Sbjct  117  GATVLLFNSKMQMKSGKQKLRLWQGKEADGSFPTSTPGKVPRHERGELERLEKLMNKYE  175



>gb|AAA83427.1| phosphatidylinositol 3-kinase [Arabidopsis thaliana]
Length=814

 Score =   236 bits (602),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 130/179 (73%), Positives = 152/179 (85%), Gaps = 4/179 (2%)
 Frame = +3

Query  183  MSGNEFRFFLSCDINLPVTFRIERLEgklpppklpgSDGVDTMMNAIDDRKPELYVESTL  362
            M  NEFRFFLSCDIN PVTFRIE+L+G LP  K   + GV   ++  +++KPELY+E  L
Sbjct  1    MGANEFRFFLSCDINSPVTFRIEKLDGNLPVKKSSDA-GV---VSIAEEKKPELYIECAL  56

Query  363  YIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIG  542
            YIDGAPFGLPMRTRL++ GP YCWNELITLS+KYRDLTA+SQLA+TVWDVSCGK+EG+IG
Sbjct  57   YIDGAPFGLPMRTRLKTTGPPYCWNELITLSSKYRDLTAHSQLAITVWDVSCGKTEGLIG  116

Query  543  GATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKVPkeergelerleklVNKYE  719
            GAT+ LFN K Q+K+GK KLRLW GKEADGS  T+TPGKVP+ ERGELERLEKL+NKYE
Sbjct  117  GATVLLFNSKMQMKSGKQKLRLWQGKEADGSFPTSTPGKVPRHERGELERLEKLMNKYE  175



>ref|XP_011042652.1| PREDICTED: phosphatidylinositol 3-kinase, root isoform [Populus 
euphratica]
 ref|XP_011042653.1| PREDICTED: phosphatidylinositol 3-kinase, root isoform [Populus 
euphratica]
Length=810

 Score =   236 bits (601),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 136/179 (76%), Positives = 145/179 (81%), Gaps = 8/179 (4%)
 Frame = +3

Query  183  MSGNEFRFFLSCDINLPVTFRIERLEgklpppklpgSDGVDTMMNAIDDRKPELYVESTL  362
            MSG EFRFFLSCDINLPVTFR+ERL G LP       +  +  +NA      ELYVE  L
Sbjct  1    MSGREFRFFLSCDINLPVTFRVERLHGPLPSSPTKSPNSEE--INA------ELYVECAL  52

Query  363  YIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIG  542
            YIDGAPFGLP+RTRLES G SYCWNELIT+STKYRDLTA+SQLA TVWDVSCGK EG+IG
Sbjct  53   YIDGAPFGLPIRTRLESGGASYCWNELITMSTKYRDLTAHSQLAFTVWDVSCGKDEGLIG  112

Query  543  GATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKVPkeergelerleklVNKYE  719
            GATI LFN K QLKTGK KLRLW GKEADGS  TTTPGKVPK ERGE+ERLEKLVNKYE
Sbjct  113  GATILLFNNKMQLKTGKQKLRLWPGKEADGSFPTTTPGKVPKHERGEVERLEKLVNKYE  171



>gb|ABA03136.1| phosphatidylinositol 3-kinase 1 [Phaseolus vulgaris]
Length=811

 Score =   235 bits (600),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 135/179 (75%), Positives = 145/179 (81%), Gaps = 6/179 (3%)
 Frame = +3

Query  183  MSGNEFRFFLSCDINLPVTFRIERLEgklpppklpgSDGVDTMMNAIDDRKPELYVESTL  362
            M+GNEFRFFLSCDINLPVTFR+ERLEG     K P S+  D   N I    PELYVE  L
Sbjct  1    MTGNEFRFFLSCDINLPVTFRVERLEGSFSLSKFPDSENDDPTENII----PELYVECAL  56

Query  363  YIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIG  542
            YIDGAPFGLP RTRLES GP +CWNELITL+TKYRDLTA SQL  TVWDVS G  EG+IG
Sbjct  57   YIDGAPFGLPTRTRLESTGPPFCWNELITLTTKYRDLTAQSQLTFTVWDVSHG--EGLIG  114

Query  543  GATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKVPkeergelerleklVNKYE  719
            GATI LFN KKQLKTGK KLRLW+GKEADG+  T+TPGKVP+ ERGELERLEKLVNKYE
Sbjct  115  GATILLFNNKKQLKTGKQKLRLWTGKEADGTYPTSTPGKVPRHERGELERLEKLVNKYE  173



>gb|ABA03135.1| phosphatidylinositol 3-kinase 1 [Phaseolus vulgaris]
Length=811

 Score =   235 bits (600),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 135/179 (75%), Positives = 145/179 (81%), Gaps = 6/179 (3%)
 Frame = +3

Query  183  MSGNEFRFFLSCDINLPVTFRIERLEgklpppklpgSDGVDTMMNAIDDRKPELYVESTL  362
            M+GNEFRFFLSCDINLPVTFR+ERLEG     K P S+  D   N I    PELYVE  L
Sbjct  1    MTGNEFRFFLSCDINLPVTFRVERLEGSFSLSKFPDSENDDPTENII----PELYVECAL  56

Query  363  YIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIG  542
            YIDGAPFGLP RTRLES GP +CWNELITL+TKYRDLTA SQL  TVWDVS G  EG+IG
Sbjct  57   YIDGAPFGLPTRTRLESTGPPFCWNELITLTTKYRDLTAQSQLTFTVWDVSHG--EGLIG  114

Query  543  GATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKVPkeergelerleklVNKYE  719
            GATI LFN KKQLKTGK KLRLW+GKEADG+  T+TPGKVP+ ERGELERLEKLVNKYE
Sbjct  115  GATILLFNNKKQLKTGKQKLRLWTGKEADGTYPTSTPGKVPRHERGELERLEKLVNKYE  173



>ref|XP_007157437.1| hypothetical protein PHAVU_002G070100g [Phaseolus vulgaris]
 gb|ESW29431.1| hypothetical protein PHAVU_002G070100g [Phaseolus vulgaris]
Length=811

 Score =   235 bits (600),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 135/179 (75%), Positives = 145/179 (81%), Gaps = 6/179 (3%)
 Frame = +3

Query  183  MSGNEFRFFLSCDINLPVTFRIERLEgklpppklpgSDGVDTMMNAIDDRKPELYVESTL  362
            M+GNEFRFFLSCDINLPVTFR+ERLEG     K P S+  D   N I    PELYVE  L
Sbjct  1    MTGNEFRFFLSCDINLPVTFRVERLEGSFSLSKFPDSENDDPTENII----PELYVECAL  56

Query  363  YIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIG  542
            YIDGAPFGLP RTRLES GP +CWNELITL+TKYRDLTA SQL  TVWDVS G  EG+IG
Sbjct  57   YIDGAPFGLPTRTRLESTGPPFCWNELITLTTKYRDLTAQSQLTFTVWDVSHG--EGLIG  114

Query  543  GATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKVPkeergelerleklVNKYE  719
            GATI LFN KKQLKTGK KLRLW+GKEADG+  T+TPGKVP+ ERGELERLEKLVNKYE
Sbjct  115  GATILLFNNKKQLKTGKQKLRLWTGKEADGTYPTSTPGKVPRHERGELERLEKLVNKYE  173



>ref|XP_002318628.1| phosphatidylinositol 3-kinase family protein [Populus trichocarpa]
 gb|EEE96848.1| phosphatidylinositol 3-kinase family protein [Populus trichocarpa]
Length=810

 Score =   235 bits (599),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 136/179 (76%), Positives = 145/179 (81%), Gaps = 8/179 (4%)
 Frame = +3

Query  183  MSGNEFRFFLSCDINLPVTFRIERLEgklpppklpgSDGVDTMMNAIDDRKPELYVESTL  362
            MSG EFRFFLSCDINLPVTFR+ERL G LP       +  +  +NA      ELYVE  L
Sbjct  1    MSGKEFRFFLSCDINLPVTFRVERLLGPLPSSPTKSPNSEE--INA------ELYVECAL  52

Query  363  YIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIG  542
            YIDGAPFGLP+RTRLES G SYCWNELIT+STKYRDLTA+SQLA TVWDVSCGK EG+IG
Sbjct  53   YIDGAPFGLPIRTRLESGGASYCWNELITMSTKYRDLTAHSQLAFTVWDVSCGKDEGLIG  112

Query  543  GATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKVPkeergelerleklVNKYE  719
            GATI LFN K QLKTGK KLRLW GKEADGS  TTTPGKVPK ERGE+ERLEKLVNKYE
Sbjct  113  GATILLFNNKMQLKTGKQKLRLWPGKEADGSFPTTTPGKVPKHERGEVERLEKLVNKYE  171



>gb|AAN62481.1| phosphatidylinositol 3-kinase [Brassica napus]
Length=813

 Score =   234 bits (598),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 130/179 (73%), Positives = 149/179 (83%), Gaps = 4/179 (2%)
 Frame = +3

Query  183  MSGNEFRFFLSCDINLPVTFRIERLEgklpppklpgSDGVDTMMNAIDDRKPELYVESTL  362
            M  NEFRFFLSCD+N PVTFRIE+L+G LP  K   S GV   ++  +D++PELYVE  L
Sbjct  1    MGANEFRFFLSCDLNSPVTFRIEKLDGTLPVEKSTDS-GV---ISGAEDKRPELYVECAL  56

Query  363  YIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIG  542
            YIDGAPFGLPMRTRL + GP YCWNELITLS+KYRDLTA+SQLA+TVWDVSCGK EG+IG
Sbjct  57   YIDGAPFGLPMRTRLNTTGPPYCWNELITLSSKYRDLTAHSQLAITVWDVSCGKGEGLIG  116

Query  543  GATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKVPkeergelerleklVNKYE  719
            GATI LFN K Q+K+GK KLRLW GKEADGS  T+TPGK P+ ERGELERLEKL+NK+E
Sbjct  117  GATILLFNSKMQMKSGKQKLRLWKGKEADGSFPTSTPGKAPRHERGELERLEKLMNKFE  175



>ref|XP_010417982.1| PREDICTED: phosphatidylinositol 3-kinase VPS34 isoform X1 [Camelina 
sativa]
Length=813

 Score =   234 bits (597),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 129/179 (72%), Positives = 152/179 (85%), Gaps = 4/179 (2%)
 Frame = +3

Query  183  MSGNEFRFFLSCDINLPVTFRIERLEgklpppklpgSDGVDTMMNAIDDRKPELYVESTL  362
            M  +EFRFFLSCDIN PVTFRIE+L+G LP  K   S GV   ++  +++KPELY+E  L
Sbjct  1    MGASEFRFFLSCDINSPVTFRIEKLDGNLPVNKSTDS-GV---VSVAEEKKPELYIECAL  56

Query  363  YIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIG  542
            YIDGAPFGLPMRTRL++ GP YCWNEL+TLS+KYRDLTA+SQLA+TVWDVSCGK+EG+IG
Sbjct  57   YIDGAPFGLPMRTRLKTTGPPYCWNELMTLSSKYRDLTAHSQLAITVWDVSCGKTEGLIG  116

Query  543  GATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKVPkeergelerleklVNKYE  719
            GAT+ LFN K Q+K+GK KLRLW GKEADGS  T+TPGKVP+ ERGELERLEKL+NKYE
Sbjct  117  GATVLLFNSKGQMKSGKQKLRLWQGKEADGSFPTSTPGKVPRHERGELERLEKLMNKYE  175



>ref|XP_009113205.1| PREDICTED: phosphatidylinositol 3-kinase VPS34 isoform X2 [Brassica 
rapa]
Length=812

 Score =   234 bits (596),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 125/179 (70%), Positives = 148/179 (83%), Gaps = 5/179 (3%)
 Frame = +3

Query  183  MSGNEFRFFLSCDINLPVTFRIERLEgklpppklpgSDGVDTMMNAIDDRKPELYVESTL  362
            M  +EFRFFLSCD+N P TFRIE+L+G LP          D++++  +D++PELYVE  L
Sbjct  1    MGASEFRFFLSCDLNSPFTFRIEKLDGTLPV-----EKSTDSVVSGAEDKRPELYVECAL  55

Query  363  YIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIG  542
            YIDGAPFGLPMRTRL + GP YCWNELITLS+KYRDLTA+SQLA+TVWDVSCGK EG+IG
Sbjct  56   YIDGAPFGLPMRTRLNTTGPPYCWNELITLSSKYRDLTAHSQLAITVWDVSCGKGEGLIG  115

Query  543  GATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKVPkeergelerleklVNKYE  719
            GATI LFN K Q+K+GK KLR+W GKEADGS  T+TPGKVP+ ERGELERLEKL+NK+E
Sbjct  116  GATILLFNSKMQMKSGKQKLRIWKGKEADGSFPTSTPGKVPRHERGELERLEKLMNKFE  174



>ref|XP_004142979.1| PREDICTED: phosphatidylinositol 3-kinase, root isoform-like [Cucumis 
sativus]
 gb|KGN62291.1| hypothetical protein Csa_2G348290 [Cucumis sativus]
Length=814

 Score =   233 bits (595),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 139/179 (78%), Positives = 151/179 (84%), Gaps = 4/179 (2%)
 Frame = +3

Query  183  MSGNEFRFFLSCDINLPVTFRIERLEgklpppklpgSDGVDTMMNAIDDRKPELYVESTL  362
            MSGNEFRFFLSCDINLPVTFR+ERLEG LPP K   S     + +A D+R+ EL+VE  L
Sbjct  1    MSGNEFRFFLSCDINLPVTFRVERLEGNLPPAKSSDS----DIDSASDERRAELFVECAL  56

Query  363  YIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIG  542
            YIDGAPFGLP RTRLES GPSY W+ELITLSTKYRDLTA+SQLALTVWDVS GK E +IG
Sbjct  57   YIDGAPFGLPTRTRLESSGPSYTWSELITLSTKYRDLTAHSQLALTVWDVSRGKEEELIG  116

Query  543  GATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKVPkeergelerleklVNKYE  719
            GATI LFN KKQLKTGK KLRLW G+EADGS  TTTPGKVP+ ERGELERLEK+VNKYE
Sbjct  117  GATILLFNRKKQLKTGKQKLRLWLGREADGSFPTTTPGKVPRLERGELERLEKVVNKYE  175



>ref|XP_004161067.1| PREDICTED: LOW QUALITY PROTEIN: phosphatidylinositol 3-kinase, 
root isoform-like [Cucumis sativus]
Length=813

 Score =   233 bits (595),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 139/179 (78%), Positives = 151/179 (84%), Gaps = 4/179 (2%)
 Frame = +3

Query  183  MSGNEFRFFLSCDINLPVTFRIERLEgklpppklpgSDGVDTMMNAIDDRKPELYVESTL  362
            MSGNEFRFFLSCDINLPVTFR+ERLEG LPP K   S     + +A D+R+ EL+VE  L
Sbjct  1    MSGNEFRFFLSCDINLPVTFRVERLEGNLPPAKSSDS----DIDSASDERRAELFVECAL  56

Query  363  YIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIG  542
            YIDGAPFGLP RTRLES GPSY W+ELITLSTKYRDLTA+SQLALTVWDVS GK E +IG
Sbjct  57   YIDGAPFGLPTRTRLESSGPSYTWSELITLSTKYRDLTAHSQLALTVWDVSRGKEEELIG  116

Query  543  GATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKVPkeergelerleklVNKYE  719
            GATI LFN KKQLKTGK KLRLW G+EADGS  TTTPGKVP+ ERGELERLEK+VNKYE
Sbjct  117  GATILLFNRKKQLKTGKQKLRLWLGREADGSFPTTTPGKVPRLERGELERLEKVVNKYE  175



>gb|KFK40782.1| hypothetical protein AALP_AA2G040200 [Arabis alpina]
Length=813

 Score =   233 bits (594),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 129/179 (72%), Positives = 149/179 (83%), Gaps = 4/179 (2%)
 Frame = +3

Query  183  MSGNEFRFFLSCDINLPVTFRIERLEgklpppklpgSDGVDTMMNAIDDRKPELYVESTL  362
            M  +EFRFFLSCDIN PVTFRIE+L+G LP  K   S  V    +  ++ KPELY+E  L
Sbjct  1    MGASEFRFFLSCDINSPVTFRIEKLDGALPVKKSTDSGDV----SMAEETKPELYIECAL  56

Query  363  YIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIG  542
            YIDGAPFGLPMRTRL++ GP YCWNE ITLS+KYRDLTA+SQLA+TVWDVSCGK+EG+IG
Sbjct  57   YIDGAPFGLPMRTRLKTTGPPYCWNEPITLSSKYRDLTAHSQLAITVWDVSCGKAEGLIG  116

Query  543  GATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKVPkeergelerleklVNKYE  719
            GATI LFN K Q+K+GK KLRLW GKEADGS  T+TPGKVP++ERGELERLEKL+NKYE
Sbjct  117  GATILLFNSKMQMKSGKQKLRLWQGKEADGSFPTSTPGKVPRQERGELERLEKLMNKYE  175



>ref|XP_007227349.1| hypothetical protein PRUPE_ppa001353mg [Prunus persica]
 gb|EMJ28548.1| hypothetical protein PRUPE_ppa001353mg [Prunus persica]
Length=846

 Score =   233 bits (595),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 135/208 (65%), Positives = 146/208 (70%), Gaps = 30/208 (14%)
 Frame = +3

Query  183  MSGNEFRFFLSCDINLPVTFRIERLE-----------------------------gklpp  275
            MSGNEFRFFLSCDINLPVTFRIERLE                                  
Sbjct  1    MSGNEFRFFLSCDINLPVTFRIERLEGTLRPPKSPSSGTFYLNFPFGSRETVSFNHYSSI  60

Query  276  pklpgSDGVDTMMNAIDDRKPELYVESTLYIDGAPFGLPMRTRLESRGPSYCWNELITLS  455
                 +  VD   +  ++R+ ELYVE  LYIDGAPFGLP RTRLES GP YCWNELITLS
Sbjct  61   QFSFCTADVDPT-STTEERRAELYVECALYIDGAPFGLPTRTRLESSGPLYCWNELITLS  119

Query  456  TKYRDLTANSQLALTVWDVSCGKSEGVIGGATIHLFNMKKQLKTGKHKLRLWSGKEADGS  635
            TKYRDLT +SQLALTVWDVSCGK EG++GGATI LFN KKQLKTGK KLRLW GK ADGS
Sbjct  120  TKYRDLTGHSQLALTVWDVSCGKDEGLVGGATILLFNSKKQLKTGKQKLRLWQGKVADGS  179

Query  636  IHTTTPGKVPkeergelerleklVNKYE  719
              T+TPGKVP+ ERGELERLEKLVN+YE
Sbjct  180  FPTSTPGKVPRHERGELERLEKLVNRYE  207



>emb|CDY53049.1| BnaA09g14140D [Brassica napus]
Length=813

 Score =   233 bits (593),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 129/179 (72%), Positives = 149/179 (83%), Gaps = 4/179 (2%)
 Frame = +3

Query  183  MSGNEFRFFLSCDINLPVTFRIERLEgklpppklpgSDGVDTMMNAIDDRKPELYVESTL  362
            M  +EFRFFLSCD+N PVTFRIE+L+G LP  K   S GV   ++  +D++PELYVE  L
Sbjct  1    MGASEFRFFLSCDLNSPVTFRIEKLDGTLPVEKSTDS-GV---ISGAEDKRPELYVECAL  56

Query  363  YIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIG  542
            YIDGAPFGLPMRTRL + GP YCWNELITLS+KYRDLTA+SQLA+TVWDVSCGK EG+IG
Sbjct  57   YIDGAPFGLPMRTRLNTTGPPYCWNELITLSSKYRDLTAHSQLAITVWDVSCGKGEGLIG  116

Query  543  GATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKVPkeergelerleklVNKYE  719
            GATI LFN K Q+K+GK KLRLW GKEADGS  T+TPGK P+ ERGELERLEKL+NK+E
Sbjct  117  GATILLFNSKMQMKSGKQKLRLWKGKEADGSFPTSTPGKAPRHERGELERLEKLMNKFE  175



>ref|XP_010100445.1| Phosphatidylinositol 3-kinase, root isoform [Morus notabilis]
 gb|EXB82579.1| Phosphatidylinositol 3-kinase, root isoform [Morus notabilis]
Length=810

 Score =   232 bits (592),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 137/179 (77%), Positives = 149/179 (83%), Gaps = 4/179 (2%)
 Frame = +3

Query  183  MSGNEFRFFLSCDINLPVTFRIERLEgklpppklpgSDGVDTMMNAIDDRKPELYVESTL  362
            M+GNEFRFFLSCDINLP+TFRI+RLEG LPP K P S+ VD+     ++R  ELYVE  L
Sbjct  1    MTGNEFRFFLSCDINLPLTFRIDRLEGTLPPAKSPNSE-VDS---TTEERIAELYVECAL  56

Query  363  YIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIG  542
            YIDGAPFGLP RTRLES GP+YCWNELITLSTKYRDLT +SQLA TVWDVS GK E +IG
Sbjct  57   YIDGAPFGLPTRTRLESEGPTYCWNELITLSTKYRDLTGHSQLAFTVWDVSRGKDERLIG  116

Query  543  GATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKVPkeergelerleklVNKYE  719
            GATI LFN K+QLKTGK KLRLW GK ADGS  T TPGKVPK ERGELERLEKL+NKYE
Sbjct  117  GATILLFNSKRQLKTGKQKLRLWQGKVADGSFTTATPGKVPKHERGELERLEKLLNKYE  175



>ref|XP_010682534.1| PREDICTED: phosphatidylinositol 3-kinase, root isoform isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=815

 Score =   232 bits (592),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 133/179 (74%), Positives = 152/179 (85%), Gaps = 2/179 (1%)
 Frame = +3

Query  183  MSGNEFRFFLSCDINLPVTFRIERLEgklpppklpgSDGVDTMMNAIDDRKPELYVESTL  362
            MSGNEFRFFLSCDINLP+TFRI+RLEG LP  K P S G D    A ++R+ ELYVE  L
Sbjct  1    MSGNEFRFFLSCDINLPLTFRIDRLEGILPSLKSPISAGADAGYAA-EERRGELYVECAL  59

Query  363  YIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIG  542
            +++GAPFGLPMRTRLES G S+CW+ELITLSTKYRDLTA+SQL+ TVWDVSC K EG+IG
Sbjct  60   FVNGAPFGLPMRTRLES-GQSFCWSELITLSTKYRDLTAHSQLSFTVWDVSCCKGEGLIG  118

Query  543  GATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKVPkeergelerleklVNKYE  719
            GATI LFN KKQL+TGK KLRLW GKEADG+  ++TPGKVP+ ERGELERLEKL+NKYE
Sbjct  119  GATILLFNSKKQLRTGKQKLRLWLGKEADGACPSSTPGKVPRHERGELERLEKLMNKYE  177



>ref|XP_010940071.1| PREDICTED: phosphatidylinositol 3-kinase, root isoform isoform 
X1 [Elaeis guineensis]
Length=813

 Score =   231 bits (590),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 128/179 (72%), Positives = 147/179 (82%), Gaps = 5/179 (3%)
 Frame = +3

Query  183  MSGNEFRFFLSCDINLPVTFRIERLEgklpppklpgSDGVDTMMNAIDDRKPELYVESTL  362
            M+GNEFRFFLSCDINLPVTFRIERLEG LP      S  +DT   + ++R  ELYVE  L
Sbjct  1    MTGNEFRFFLSCDINLPVTFRIERLEGNLPQSPA--SSELDT---STENRNAELYVECAL  55

Query  363  YIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIG  542
            YIDGAPFGL  +TRLES G  YCWNELITLSTKYRDLT+ +QLA TVWDVSCG ++G++G
Sbjct  56   YIDGAPFGLSTKTRLESSGYPYCWNELITLSTKYRDLTSQAQLAFTVWDVSCGNNDGLVG  115

Query  543  GATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKVPkeergelerleklVNKYE  719
            GAT+ LFN KKQLK G+ KLRLW GKEADG+I +TTPGKVPK E+GE+ERLE+LVNKYE
Sbjct  116  GATVFLFNSKKQLKAGRKKLRLWPGKEADGTIPSTTPGKVPKCEQGEIERLERLVNKYE  174



>ref|XP_010936707.1| PREDICTED: phosphatidylinositol 3-kinase, root isoform-like isoform 
X2 [Elaeis guineensis]
Length=811

 Score =   231 bits (590),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 129/179 (72%), Positives = 147/179 (82%), Gaps = 5/179 (3%)
 Frame = +3

Query  183  MSGNEFRFFLSCDINLPVTFRIERLEgklpppklpgSDGVDTMMNAIDDRKPELYVESTL  362
            M+GNEFRFFLSCDINLPVTFRIERLEG LP      S  +DT   + ++R  EL+VE TL
Sbjct  1    MTGNEFRFFLSCDINLPVTFRIERLEGNLPQSPA--SSELDT---STENRNAELHVECTL  55

Query  363  YIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIG  542
            YIDGAPFGL  +TRLES G  YCWNELITLS+KYRDLT+ +QLA TVWDVSCG  +G++G
Sbjct  56   YIDGAPFGLSTKTRLESSGYPYCWNELITLSSKYRDLTSQAQLAFTVWDVSCGNGDGLVG  115

Query  543  GATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKVPkeergelerleklVNKYE  719
            GAT+ LFN KKQLK G+ KLRLW GKEADG+I TTTPGKVPK ERGE+ERLE+LVNKYE
Sbjct  116  GATVFLFNSKKQLKAGRQKLRLWPGKEADGTIPTTTPGKVPKHERGEIERLERLVNKYE  174



>ref|XP_010510944.1| PREDICTED: phosphatidylinositol 3-kinase VPS34-like isoform X1 
[Camelina sativa]
Length=813

 Score =   231 bits (590),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 128/179 (72%), Positives = 151/179 (84%), Gaps = 4/179 (2%)
 Frame = +3

Query  183  MSGNEFRFFLSCDINLPVTFRIERLEgklpppklpgSDGVDTMMNAIDDRKPELYVESTL  362
            M  +EFRFFLSCDIN PVTFRIE+L+G LP  K   S GV   ++  +++KPELY+E  L
Sbjct  1    MGASEFRFFLSCDINSPVTFRIEKLDGNLPVNKSTDS-GV---VSVAEEKKPELYIECAL  56

Query  363  YIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIG  542
            YIDGAPFGLPM TRL++ GP YCWNELITLS+KYRDLTA+SQLA+TVWD+SCGK+EG+IG
Sbjct  57   YIDGAPFGLPMSTRLKTTGPPYCWNELITLSSKYRDLTAHSQLAITVWDMSCGKTEGLIG  116

Query  543  GATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKVPkeergelerleklVNKYE  719
            GAT+ LFN K Q+K+GK KLRLW GKEADGS  T+TPGKVP+ ERGELERLEKL+NKYE
Sbjct  117  GATVLLFNSKGQMKSGKQKLRLWQGKEADGSFPTSTPGKVPRHERGELERLEKLMNKYE  175



>ref|XP_010474549.1| PREDICTED: phosphatidylinositol 3-kinase VPS34-like [Camelina 
sativa]
Length=922

 Score =   232 bits (592),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 130/179 (73%), Positives = 151/179 (84%), Gaps = 4/179 (2%)
 Frame = +3

Query  183  MSGNEFRFFLSCDINLPVTFRIERLEgklpppklpgSDGVDTMMNAIDDRKPELYVESTL  362
            M  +EFRFFLSCDIN PVTFRIE+L+G LP  K   S GV T+    +++KPELY+E  L
Sbjct  1    MGASEFRFFLSCDINSPVTFRIEKLDGNLPVNKSTDS-GVVTVA---EEKKPELYIECAL  56

Query  363  YIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIG  542
             IDGAPFGLPMRTRL++ GP YCWNELITLS+KYRDLTA+SQLA+TVWDVSCGK+EG+IG
Sbjct  57   SIDGAPFGLPMRTRLKTTGPPYCWNELITLSSKYRDLTAHSQLAITVWDVSCGKTEGLIG  116

Query  543  GATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKVPkeergelerleklVNKYE  719
            GAT+ LFN K Q+K+GK KLRLW GKEADGS  T+TPGKVP+ ERGELERLEKL+NKYE
Sbjct  117  GATVLLFNSKGQMKSGKQKLRLWQGKEADGSFPTSTPGKVPRHERGELERLEKLMNKYE  175



>ref|XP_010936705.1| PREDICTED: phosphatidylinositol 3-kinase, root isoform-like isoform 
X1 [Elaeis guineensis]
 ref|XP_010936706.1| PREDICTED: phosphatidylinositol 3-kinase, root isoform-like isoform 
X1 [Elaeis guineensis]
Length=813

 Score =   231 bits (589),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 129/179 (72%), Positives = 147/179 (82%), Gaps = 5/179 (3%)
 Frame = +3

Query  183  MSGNEFRFFLSCDINLPVTFRIERLEgklpppklpgSDGVDTMMNAIDDRKPELYVESTL  362
            M+GNEFRFFLSCDINLPVTFRIERLEG LP      S  +DT   + ++R  EL+VE TL
Sbjct  1    MTGNEFRFFLSCDINLPVTFRIERLEGNLPQSPA--SSELDT---STENRNAELHVECTL  55

Query  363  YIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIG  542
            YIDGAPFGL  +TRLES G  YCWNELITLS+KYRDLT+ +QLA TVWDVSCG  +G++G
Sbjct  56   YIDGAPFGLSTKTRLESSGYPYCWNELITLSSKYRDLTSQAQLAFTVWDVSCGNGDGLVG  115

Query  543  GATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKVPkeergelerleklVNKYE  719
            GAT+ LFN KKQLK G+ KLRLW GKEADG+I TTTPGKVPK ERGE+ERLE+LVNKYE
Sbjct  116  GATVFLFNSKKQLKAGRQKLRLWPGKEADGTIPTTTPGKVPKHERGEIERLERLVNKYE  174



>ref|XP_006577876.1| PREDICTED: phosphatidylinositol 3-kinase, root isoform isoform 
X1 [Glycine max]
Length=696

 Score =   229 bits (585),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 135/180 (75%), Positives = 151/180 (84%), Gaps = 6/180 (3%)
 Frame = +3

Query  183  MSGNEFRFFLSCDINLPVTFRIERLEgklpppklpgSDGVDTMMNA-IDDRKPELYVEST  359
            M+GNEFRFFLSCDI++PVTFR+ERLEG LP P     D ++T  NA  ++R  EL+VE  
Sbjct  1    MTGNEFRFFLSCDISVPVTFRVERLEGNLPLPNPKSPD-LET--NAPTENRTKELFVECA  57

Query  360  LYIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVI  539
            LYIDGAPFGLPMRTRLES GPSYCWNELITL+TKYRDLTA SQL  TVWD+S G  EG+I
Sbjct  58   LYIDGAPFGLPMRTRLESSGPSYCWNELITLTTKYRDLTAQSQLTFTVWDLSHG--EGLI  115

Query  540  GGATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKVPkeergelerleklVNKYE  719
            GGATI LFN KKQLKTGK KLRLW+GKEADG+  T+TPGKVP+ ERGELERLEKLVNKYE
Sbjct  116  GGATILLFNNKKQLKTGKQKLRLWAGKEADGTFPTSTPGKVPRHERGELERLEKLVNKYE  175



>ref|XP_009113204.1| PREDICTED: phosphatidylinositol 3-kinase VPS34 isoform X1 [Brassica 
rapa]
Length=813

 Score =   231 bits (589),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 128/179 (72%), Positives = 149/179 (83%), Gaps = 4/179 (2%)
 Frame = +3

Query  183  MSGNEFRFFLSCDINLPVTFRIERLEgklpppklpgSDGVDTMMNAIDDRKPELYVESTL  362
            M  +EFRFFLSCD+N P TFRIE+L+G LP  K   S GV   ++  +D++PELYVE  L
Sbjct  1    MGASEFRFFLSCDLNSPFTFRIEKLDGTLPVEKSTDS-GV---VSGAEDKRPELYVECAL  56

Query  363  YIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIG  542
            YIDGAPFGLPMRTRL + GP YCWNELITLS+KYRDLTA+SQLA+TVWDVSCGK EG+IG
Sbjct  57   YIDGAPFGLPMRTRLNTTGPPYCWNELITLSSKYRDLTAHSQLAITVWDVSCGKGEGLIG  116

Query  543  GATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKVPkeergelerleklVNKYE  719
            GATI LFN K Q+K+GK KLR+W GKEADGS  T+TPGKVP+ ERGELERLEKL+NK+E
Sbjct  117  GATILLFNSKMQMKSGKQKLRIWKGKEADGSFPTSTPGKVPRHERGELERLEKLMNKFE  175



>ref|XP_006580980.1| PREDICTED: phosphatidylinositol 3-kinase, nodule isoform isoform 
X1 [Glycine max]
 ref|XP_006580981.1| PREDICTED: phosphatidylinositol 3-kinase, nodule isoform isoform 
X2 [Glycine max]
 gb|KHN08996.1| Phosphatidylinositol 3-kinase, nodule isoform [Glycine soja]
Length=812

 Score =   230 bits (586),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 134/180 (74%), Positives = 147/180 (82%), Gaps = 8/180 (4%)
 Frame = +3

Query  183  MSGNEFRFFLSCDINLPVTFRIERLEgklpppklpgSDGVDTMMNA-IDDRKPELYVEST  359
            M+GNEFRFFLSCDI++PVTFR+ERLEG LP          D   NA  D+R  EL+VE  
Sbjct  1    MTGNEFRFFLSCDISVPVTFRVERLEGNLPL-----PKSPDLENNAPTDNRTTELFVECA  55

Query  360  LYIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVI  539
            LYIDGAPFGLPMRTRLES GPSYCWNELITL+TKYRDLTA SQL  TVWD+S G  EG+I
Sbjct  56   LYIDGAPFGLPMRTRLESLGPSYCWNELITLTTKYRDLTAQSQLTFTVWDLSHG--EGLI  113

Query  540  GGATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKVPkeergelerleklVNKYE  719
            GGATI LFN KKQLKTGK KLRLW+GKEADG+  T+TPGKVP+ ERGELERLEKLVNKYE
Sbjct  114  GGATILLFNNKKQLKTGKQKLRLWAGKEADGTFPTSTPGKVPRHERGELERLEKLVNKYE  173



>ref|XP_010553608.1| PREDICTED: phosphatidylinositol 3-kinase VPS34 [Tarenaya hassleriana]
Length=810

 Score =   230 bits (586),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 128/179 (72%), Positives = 143/179 (80%), Gaps = 7/179 (4%)
 Frame = +3

Query  183  MSGNEFRFFLSCDINLPVTFRIERLEgklpppklpgSDGVDTMMNAIDDRKPELYVESTL  362
            M  NEFRFFLSCDIN PVTFR+E+L+G L        D   T     +D KPELYVE  L
Sbjct  1    MGANEFRFFLSCDINSPVTFRVEKLDGALL-------DKQPTDPVGAEDNKPELYVECAL  53

Query  363  YIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIG  542
            YIDGAPFGLPMRTRL++ GP YCWNELI+LS KYRDLT +SQLA+TVWDVS GK+EG+IG
Sbjct  54   YIDGAPFGLPMRTRLKTTGPPYCWNELISLSAKYRDLTTHSQLAITVWDVSRGKAEGLIG  113

Query  543  GATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKVPkeergelerleklVNKYE  719
            GAT+ LFN K QLKTGK KLRLW GKEADGS  T+TPGKVP+ ERGELERLEKL+NKYE
Sbjct  114  GATVLLFNSKMQLKTGKQKLRLWHGKEADGSFPTSTPGKVPRHERGELERLEKLMNKYE  172



>ref|NP_001242315.1| phosphatidylinositol 3-kinase, nodule isoform [Glycine max]
 sp|P42348.1|PI3K2_SOYBN RecName: Full=Phosphatidylinositol 3-kinase, nodule isoform; 
Short=PI3-kinase; Short=PI3K; Short=PtdIns-3-kinase; AltName: 
Full=SPI3K-1 [Glycine max]
 gb|AAA64468.1| phosphatidylinositol 3-kinase [Glycine max]
Length=812

 Score =   230 bits (586),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 134/180 (74%), Positives = 147/180 (82%), Gaps = 8/180 (4%)
 Frame = +3

Query  183  MSGNEFRFFLSCDINLPVTFRIERLEgklpppklpgSDGVDTMMNA-IDDRKPELYVEST  359
            M+GNEFRFFLSCDI++PVTFR+ERLEG LP          D   NA  D+R  EL+VE  
Sbjct  1    MTGNEFRFFLSCDISVPVTFRVERLEGNLPL-----PKSPDLENNAPTDNRTTELFVECA  55

Query  360  LYIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVI  539
            LYIDGAPFGLPMRTRLES GPSYCWNELITL+TKYRDLTA SQL  TVWD+S G  EG+I
Sbjct  56   LYIDGAPFGLPMRTRLESLGPSYCWNELITLTTKYRDLTAQSQLTFTVWDLSHG--EGLI  113

Query  540  GGATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKVPkeergelerleklVNKYE  719
            GGATI LFN KKQLKTGK KLRLW+GKEADG+  T+TPGKVP+ ERGELERLEKLVNKYE
Sbjct  114  GGATILLFNNKKQLKTGKQKLRLWAGKEADGTFPTSTPGKVPRHERGELERLEKLVNKYE  173



>gb|KHN08268.1| Phosphatidylinositol 3-kinase, root isoform [Glycine soja]
Length=814

 Score =   229 bits (585),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 135/180 (75%), Positives = 151/180 (84%), Gaps = 6/180 (3%)
 Frame = +3

Query  183  MSGNEFRFFLSCDINLPVTFRIERLEgklpppklpgSDGVDTMMNA-IDDRKPELYVEST  359
            M+GNEFRFFLSCDI++PVTFR+ERLEG LP P     D ++T  NA  ++R  EL+VE  
Sbjct  1    MTGNEFRFFLSCDISVPVTFRVERLEGNLPLPNPKSPD-LET--NAPTENRTKELFVECA  57

Query  360  LYIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVI  539
            LYIDGAPFGLPMRTRLES GPSYCWNELITL+TKYRDLTA SQL  TVWD+S G  EG+I
Sbjct  58   LYIDGAPFGLPMRTRLESSGPSYCWNELITLTTKYRDLTAQSQLTFTVWDLSHG--EGLI  115

Query  540  GGATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKVPkeergelerleklVNKYE  719
            GGATI LFN KKQLKTGK KLRLW+GKEADG+  T+TPGKVP+ ERGELERLEKLVNKYE
Sbjct  116  GGATILLFNNKKQLKTGKQKLRLWAGKEADGTFPTSTPGKVPRHERGELERLEKLVNKYE  175



>ref|XP_006392160.1| hypothetical protein EUTSA_v10023282mg [Eutrema salsugineum]
 gb|ESQ29446.1| hypothetical protein EUTSA_v10023282mg [Eutrema salsugineum]
Length=813

 Score =   229 bits (584),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 127/179 (71%), Positives = 150/179 (84%), Gaps = 4/179 (2%)
 Frame = +3

Query  183  MSGNEFRFFLSCDINLPVTFRIERLEgklpppklpgSDGVDTMMNAIDDRKPELYVESTL  362
            M  +EFRFFLSCDIN PVTFRIE+L+G LP  K   S GV   ++  +++ PELY+E  L
Sbjct  1    MGASEFRFFLSCDINSPVTFRIEKLDGILPVKKSTDS-GV---ISVAEEKIPELYIECAL  56

Query  363  YIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIG  542
            YIDGAPFGLPMRTRL + GP +CWNELITLS+KYRDLTA+SQLA+TVWDVSCGK++G+IG
Sbjct  57   YIDGAPFGLPMRTRLNTTGPPFCWNELITLSSKYRDLTAHSQLAITVWDVSCGKADGLIG  116

Query  543  GATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKVPkeergelerleklVNKYE  719
            GATI LFN K Q+K+GK KLRLW GKEADGS  T+TPGKVP+ ERGELERLEKL+NK+E
Sbjct  117  GATILLFNSKMQMKSGKQKLRLWQGKEADGSFPTSTPGKVPRHERGELERLEKLMNKFE  175



>ref|XP_009113206.1| PREDICTED: phosphatidylinositol 3-kinase VPS34 isoform X3 [Brassica 
rapa]
Length=807

 Score =   229 bits (584),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 124/181 (69%), Positives = 143/181 (79%), Gaps = 14/181 (8%)
 Frame = +3

Query  183  MSGNEFRFFLSCDINLPVTFRIERLEgklpppklpgSDGVDTMMNAID--DRKPELYVES  356
            M  +EFRFFLSCD+N P TFRIE+L            DG   +  + D  D++PELYVE 
Sbjct  1    MGASEFRFFLSCDLNSPFTFRIEKL------------DGTLPVEKSTDSEDKRPELYVEC  48

Query  357  TLYIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGV  536
             LYIDGAPFGLPMRTRL + GP YCWNELITLS+KYRDLTA+SQLA+TVWDVSCGK EG+
Sbjct  49   ALYIDGAPFGLPMRTRLNTTGPPYCWNELITLSSKYRDLTAHSQLAITVWDVSCGKGEGL  108

Query  537  IGGATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKVPkeergelerleklVNKY  716
            IGGATI LFN K Q+K+GK KLR+W GKEADGS  T+TPGKVP+ ERGELERLEKL+NK+
Sbjct  109  IGGATILLFNSKMQMKSGKQKLRIWKGKEADGSFPTSTPGKVPRHERGELERLEKLMNKF  168

Query  717  E  719
            E
Sbjct  169  E  169



>ref|XP_010682535.1| PREDICTED: phosphatidylinositol 3-kinase, root isoform isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=812

 Score =   229 bits (584),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 132/179 (74%), Positives = 151/179 (84%), Gaps = 5/179 (3%)
 Frame = +3

Query  183  MSGNEFRFFLSCDINLPVTFRIERLEgklpppklpgSDGVDTMMNAIDDRKPELYVESTL  362
            MSGNEFRFFLSCDINLP+TFRI+RLEG LP  K P SD       A ++R+ ELYVE  L
Sbjct  1    MSGNEFRFFLSCDINLPLTFRIDRLEGILPSLKSPISDA----GYAAEERRGELYVECAL  56

Query  363  YIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIG  542
            +++GAPFGLPMRTRLES G S+CW+ELITLSTKYRDLTA+SQL+ TVWDVSC K EG+IG
Sbjct  57   FVNGAPFGLPMRTRLES-GQSFCWSELITLSTKYRDLTAHSQLSFTVWDVSCCKGEGLIG  115

Query  543  GATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKVPkeergelerleklVNKYE  719
            GATI LFN KKQL+TGK KLRLW GKEADG+  ++TPGKVP+ ERGELERLEKL+NKYE
Sbjct  116  GATILLFNSKKQLRTGKQKLRLWLGKEADGACPSSTPGKVPRHERGELERLEKLMNKYE  174



>gb|KCW84845.1| hypothetical protein EUGRSUZ_B01668 [Eucalyptus grandis]
 gb|KCW84846.1| hypothetical protein EUGRSUZ_B01668 [Eucalyptus grandis]
Length=801

 Score =   229 bits (584),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 135/177 (76%), Positives = 148/177 (84%), Gaps = 4/177 (2%)
 Frame = +3

Query  189  GNEFRFFLSCDINLPVTFRIERLEgklpppklpgSDGVDTMMNAIDDRKPELYVESTLYI  368
            GNEFRFFLS DI LPVTFR++ LE  LPP + P  + +D   +A ++RK ELYVE +LYI
Sbjct  4    GNEFRFFLSRDIKLPVTFRVKNLEDALPPKRSPNPE-ID---HAAEERKAELYVECSLYI  59

Query  369  DGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIGGA  548
            DGAPFGLP RTRLES GP Y WNELITLSTKYRDLTA+SQLALTVWDVSCGK EG+IGGA
Sbjct  60   DGAPFGLPTRTRLESAGPPYFWNELITLSTKYRDLTAHSQLALTVWDVSCGKEEGLIGGA  119

Query  549  TIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKVPkeergelerleklVNKYE  719
            TI LF+ KKQLKTGK KLRLW GKEADGS  T TPGKVPK ERGELERLEKL+NKYE
Sbjct  120  TILLFSSKKQLKTGKQKLRLWQGKEADGSFPTNTPGKVPKHERGELERLEKLMNKYE  176



>ref|XP_008795927.1| PREDICTED: phosphatidylinositol 3-kinase, root isoform-like isoform 
X2 [Phoenix dactylifera]
Length=767

 Score =   229 bits (583),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 127/179 (71%), Positives = 146/179 (82%), Gaps = 5/179 (3%)
 Frame = +3

Query  183  MSGNEFRFFLSCDINLPVTFRIERLEgklpppklpgSDGVDTMMNAIDDRKPELYVESTL  362
            M+GNEFRFFLSCDINLPVTFRIERLEG LP      S  +DT   + ++R  ELYVE  L
Sbjct  1    MTGNEFRFFLSCDINLPVTFRIERLEGNLPQSSA--SSELDT---STENRTAELYVEYAL  55

Query  363  YIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIG  542
            YIDGAPFGL  +TRLES G  YCWNELITLSTKY+DLT+ +QLA TVWDVSC  ++G++G
Sbjct  56   YIDGAPFGLSTKTRLESSGYPYCWNELITLSTKYQDLTSQAQLAFTVWDVSCSNNDGLVG  115

Query  543  GATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKVPkeergelerleklVNKYE  719
            GAT+ LFN KKQLK G+ KLRLW GKEADG+I TTTPGKVPK E+GE+ERLE+LVNKYE
Sbjct  116  GATVFLFNSKKQLKAGRKKLRLWPGKEADGTIPTTTPGKVPKCEQGEIERLERLVNKYE  174



>ref|XP_004489830.1| PREDICTED: phosphatidylinositol 3-kinase, root isoform-like isoform 
X1 [Cicer arietinum]
 ref|XP_004489831.1| PREDICTED: phosphatidylinositol 3-kinase, root isoform-like isoform 
X2 [Cicer arietinum]
Length=812

 Score =   229 bits (584),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 135/179 (75%), Positives = 147/179 (82%), Gaps = 6/179 (3%)
 Frame = +3

Query  183  MSGNEFRFFLSCDINLPVTFRIERLEgklpppklpgSDGVDTMMNAIDDRKPELYVESTL  362
            M+GNEFRFFLSCDINLPVTFRIERLEG LP P+ P S+       + +D   ELYVE  L
Sbjct  1    MTGNEFRFFLSCDINLPVTFRIERLEGNLPLPESPRSEN----NGSTEDGTGELYVECAL  56

Query  363  YIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIG  542
            YIDGAPFGLP RTRLES GPSYCWNELITL+ KYRDLTA SQL  TVWD+S G  EG+IG
Sbjct  57   YIDGAPFGLPTRTRLESSGPSYCWNELITLTAKYRDLTAQSQLTFTVWDLSHG--EGLIG  114

Query  543  GATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKVPkeergelerleklVNKYE  719
            GATI LFN KKQLKTGK KLRLW+GKEADG+  T+TPGKVP+ ERGELERLEKLVNKYE
Sbjct  115  GATIVLFNNKKQLKTGKQKLRLWAGKEADGTFPTSTPGKVPRHERGELERLEKLVNKYE  173



>ref|XP_008782486.1| PREDICTED: phosphatidylinositol 3-kinase, root isoform isoform 
X2 [Phoenix dactylifera]
Length=721

 Score =   228 bits (580),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 127/179 (71%), Positives = 142/179 (79%), Gaps = 5/179 (3%)
 Frame = +3

Query  183  MSGNEFRFFLSCDINLPVTFRIERLEgklpppklpgSDGVDTMMNAIDDRKPELYVESTL  362
            M+GNEFRFFLSCDINLPVTFRIERLEG LP        G+     A  +R  ELYVE TL
Sbjct  1    MTGNEFRFFLSCDINLPVTFRIERLEGNLPQSPASSELGM-----ATGNRNAELYVECTL  55

Query  363  YIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIG  542
            YIDGA FGL  +TRLES G  YCWNELITLS+KYRDLT+ +QLA TVWDVSCG   G++G
Sbjct  56   YIDGALFGLSTKTRLESSGYPYCWNELITLSSKYRDLTSQAQLAFTVWDVSCGNGVGLVG  115

Query  543  GATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKVPkeergelerleklVNKYE  719
            GAT+ LFN KKQLK G+ KLRLW GKEADG+I TTTPGKVPK ERGE+ER+E+LVNKYE
Sbjct  116  GATVFLFNSKKQLKAGRQKLRLWPGKEADGTIPTTTPGKVPKHERGEIERVERLVNKYE  174



>ref|XP_006580982.1| PREDICTED: phosphatidylinositol 3-kinase, nodule isoform isoform 
X3 [Glycine max]
Length=806

 Score =   229 bits (583),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 134/179 (75%), Positives = 148/179 (83%), Gaps = 12/179 (7%)
 Frame = +3

Query  183  MSGNEFRFFLSCDINLPVTFRIERLEgklpppklpgSDGVDTMMNAIDDRKPELYVESTL  362
            M+GNEFRFFLSCDI++PVTFR+ERLEG LP PK P           +D+R  EL+VE  L
Sbjct  1    MTGNEFRFFLSCDISVPVTFRVERLEGNLPLPKSPD----------LDNRTTELFVECAL  50

Query  363  YIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIG  542
            YIDGAPFGLPMRTRLES GPSYCWNELITL+TKYRDLTA SQL  TVWD+S G  EG+IG
Sbjct  51   YIDGAPFGLPMRTRLESLGPSYCWNELITLTTKYRDLTAQSQLTFTVWDLSHG--EGLIG  108

Query  543  GATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKVPkeergelerleklVNKYE  719
            GATI LFN KKQLKTGK KLRLW+GKEADG+  T+TPGKVP+ ERGELERLEKLVNKYE
Sbjct  109  GATILLFNNKKQLKTGKQKLRLWAGKEADGTFPTSTPGKVPRHERGELERLEKLVNKYE  167



>ref|XP_008795925.1| PREDICTED: phosphatidylinositol 3-kinase, root isoform-like isoform 
X1 [Phoenix dactylifera]
 ref|XP_008795926.1| PREDICTED: phosphatidylinositol 3-kinase, root isoform-like isoform 
X1 [Phoenix dactylifera]
Length=813

 Score =   229 bits (583),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 127/179 (71%), Positives = 146/179 (82%), Gaps = 5/179 (3%)
 Frame = +3

Query  183  MSGNEFRFFLSCDINLPVTFRIERLEgklpppklpgSDGVDTMMNAIDDRKPELYVESTL  362
            M+GNEFRFFLSCDINLPVTFRIERLEG LP      S  +DT   + ++R  ELYVE  L
Sbjct  1    MTGNEFRFFLSCDINLPVTFRIERLEGNLPQSSA--SSELDT---STENRTAELYVEYAL  55

Query  363  YIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIG  542
            YIDGAPFGL  +TRLES G  YCWNELITLSTKY+DLT+ +QLA TVWDVSC  ++G++G
Sbjct  56   YIDGAPFGLSTKTRLESSGYPYCWNELITLSTKYQDLTSQAQLAFTVWDVSCSNNDGLVG  115

Query  543  GATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKVPkeergelerleklVNKYE  719
            GAT+ LFN KKQLK G+ KLRLW GKEADG+I TTTPGKVPK E+GE+ERLE+LVNKYE
Sbjct  116  GATVFLFNSKKQLKAGRKKLRLWPGKEADGTIPTTTPGKVPKCEQGEIERLERLVNKYE  174



>ref|XP_003613218.1| Phosphatidylinositol 3-kinase [Medicago truncatula]
 emb|CAD56881.1| phosphatidylinositol 3-kinase [Medicago truncatula]
 gb|AES96176.1| phosphatidylinositol 3-kinase [Medicago truncatula]
Length=808

 Score =   228 bits (580),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 133/179 (74%), Positives = 144/179 (80%), Gaps = 10/179 (6%)
 Frame = +3

Query  183  MSGNEFRFFLSCDINLPVTFRIERLEgklpppklpgSDGVDTMMNAIDDRKPELYVESTL  362
            M+GNEFRFFLSCDINLPVTFRIERLEG LP P    S+         DD   ELYVE  L
Sbjct  1    MTGNEFRFFLSCDINLPVTFRIERLEGNLPFPNSLNSEN--------DDGTAELYVECAL  52

Query  363  YIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIG  542
            +IDGAPFGLP RTRLES GPSYCWNELITL+ KYRDLTA SQL  TVWD+S G  EG+IG
Sbjct  53   HIDGAPFGLPTRTRLESTGPSYCWNELITLTAKYRDLTAQSQLTFTVWDLSHG--EGLIG  110

Query  543  GATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKVPkeergelerleklVNKYE  719
            GATI LFN KKQLKTGK KLRLW+GKEADG+  T+TPGKVP+ ERGELERLEKL+NKYE
Sbjct  111  GATILLFNNKKQLKTGKQKLRLWAGKEADGTFPTSTPGKVPRHERGELERLEKLLNKYE  169



>ref|XP_008782484.1| PREDICTED: phosphatidylinositol 3-kinase, root isoform isoform 
X1 [Phoenix dactylifera]
 ref|XP_008782485.1| PREDICTED: phosphatidylinositol 3-kinase, root isoform isoform 
X1 [Phoenix dactylifera]
Length=813

 Score =   228 bits (580),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 127/179 (71%), Positives = 142/179 (79%), Gaps = 5/179 (3%)
 Frame = +3

Query  183  MSGNEFRFFLSCDINLPVTFRIERLEgklpppklpgSDGVDTMMNAIDDRKPELYVESTL  362
            M+GNEFRFFLSCDINLPVTFRIERLEG LP        G+     A  +R  ELYVE TL
Sbjct  1    MTGNEFRFFLSCDINLPVTFRIERLEGNLPQSPASSELGM-----ATGNRNAELYVECTL  55

Query  363  YIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIG  542
            YIDGA FGL  +TRLES G  YCWNELITLS+KYRDLT+ +QLA TVWDVSCG   G++G
Sbjct  56   YIDGALFGLSTKTRLESSGYPYCWNELITLSSKYRDLTSQAQLAFTVWDVSCGNGVGLVG  115

Query  543  GATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKVPkeergelerleklVNKYE  719
            GAT+ LFN KKQLK G+ KLRLW GKEADG+I TTTPGKVPK ERGE+ER+E+LVNKYE
Sbjct  116  GATVFLFNSKKQLKAGRQKLRLWPGKEADGTIPTTTPGKVPKHERGEIERVERLVNKYE  174



>emb|CDY47220.1| BnaC09g14690D [Brassica napus]
Length=813

 Score =   228 bits (580),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 127/179 (71%), Positives = 147/179 (82%), Gaps = 4/179 (2%)
 Frame = +3

Query  183  MSGNEFRFFLSCDINLPVTFRIERLEgklpppklpgSDGVDTMMNAIDDRKPELYVESTL  362
            M  +EFRFFLSCD+N PVTFRIE+L+G LP      S GV   +   +D++PELYVE  L
Sbjct  1    MGASEFRFFLSCDLNSPVTFRIEKLDGTLPVENSTDS-GV---VFGAEDKRPELYVECAL  56

Query  363  YIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIG  542
            YIDGAPFGLPMRTRL + GP Y WNELITLS+KYRDLTA+SQLA+TVWDVSCGK +G+IG
Sbjct  57   YIDGAPFGLPMRTRLNTTGPPYSWNELITLSSKYRDLTAHSQLAITVWDVSCGKGQGLIG  116

Query  543  GATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKVPkeergelerleklVNKYE  719
            GATI LFN K Q+K+GK KLRLW GKEADGS  T+TPGKVP+ ERGELERLEKL+NK+E
Sbjct  117  GATILLFNSKMQMKSGKQKLRLWQGKEADGSFPTSTPGKVPRHERGELERLEKLMNKFE  175



>ref|NP_001236955.1| phosphatidylinositol 3-kinase, root isoform [Glycine max]
 sp|P42347.1|PI3K1_SOYBN RecName: Full=Phosphatidylinositol 3-kinase, root isoform; Short=PI3-kinase; 
Short=PI3K; Short=PtdIns-3-kinase; AltName: 
Full=SPI3K-5 [Glycine max]
 gb|AAA83995.1| phosphatidylinositol 3-kinase [Glycine max]
Length=814

 Score =   227 bits (578),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 134/180 (74%), Positives = 150/180 (83%), Gaps = 6/180 (3%)
 Frame = +3

Query  183  MSGNEFRFFLSCDINLPVTFRIERLEgklpppklpgSDGVDTMMNA-IDDRKPELYVEST  359
            M+GNEFRFFLSCDI++PVTFR+ERLEG LP P     D ++T  NA  ++R  EL+VE  
Sbjct  1    MTGNEFRFFLSCDISVPVTFRVERLEGNLPLPNPKSPD-LET--NAPTENRTKELFVECA  57

Query  360  LYIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVI  539
            LYIDGAPFGLP RTRLES GPSYCWNELITL+TKYRDLTA SQL  TVWD+S G  EG+I
Sbjct  58   LYIDGAPFGLPTRTRLESSGPSYCWNELITLTTKYRDLTAQSQLTFTVWDLSHG--EGLI  115

Query  540  GGATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKVPkeergelerleklVNKYE  719
            GGATI LFN KKQLKTGK KLRLW+GKEADG+  T+TPGKVP+ ERGELERLEKLVNKYE
Sbjct  116  GGATILLFNNKKQLKTGKQKLRLWAGKEADGTFPTSTPGKVPRHERGELERLEKLVNKYE  175



>ref|XP_009409808.1| PREDICTED: phosphatidylinositol 3-kinase, root isoform [Musa 
acuminata subsp. malaccensis]
Length=811

 Score =   218 bits (556),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 121/179 (68%), Positives = 140/179 (78%), Gaps = 7/179 (4%)
 Frame = +3

Query  183  MSGNEFRFFLSCDINLPVTFRIERLEgklpppklpgSDGVDTMMNAIDDRKPELYVESTL  362
            M GNEFRFFLSCDINLPVTFRIERLEG L        +    + +   +R  E++VE TL
Sbjct  1    MGGNEFRFFLSCDINLPVTFRIERLEGCL-------PNPPAEIDSPTGNRNAEIFVECTL  53

Query  363  YIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIG  542
            +IDGAPFGL  +TRLE+ G  YCWNELITL+ KYRDLT+ +QLA TVWDVSCG   G++G
Sbjct  54   HIDGAPFGLSTKTRLEASGCPYCWNELITLTAKYRDLTSRAQLAFTVWDVSCGNDNGLVG  113

Query  543  GATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKVPkeergelerleklVNKYE  719
            GAT+ LFN KKQLKTG+ KLRLW GKEADG+I TTTPGKV K ERGE+ERLE+LVNKYE
Sbjct  114  GATVFLFNRKKQLKTGRQKLRLWPGKEADGAIPTTTPGKVSKHERGEIERLERLVNKYE  172



>ref|XP_003566732.1| PREDICTED: phosphatidylinositol 3-kinase, root isoform-like [Brachypodium 
distachyon]
Length=821

 Score =   206 bits (525),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 117/177 (66%), Positives = 135/177 (76%), Gaps = 9/177 (5%)
 Frame = +3

Query  189  GNEFRFFLSCDINLPVTFRIERLEgklpppklpgSDGVDTMMNAIDDRKPELYVESTLYI  368
             NEFRFFLSCDI+LP+TFR+  ++  +PPP     DG       +D + PEL+VE  L+I
Sbjct  16   NNEFRFFLSCDISLPLTFRV--IQAPIPPPTTTTQDG-------LDKKVPELFVECKLFI  66

Query  369  DGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIGGA  548
            DG  FGLP+ TRLES GP YCWNELITL TKYRDLT+ +QLA TVWDVS G    V+GGA
Sbjct  67   DGIQFGLPVNTRLESSGPPYCWNELITLCTKYRDLTSLAQLAFTVWDVSSGDGRNVVGGA  126

Query  549  TIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKVPkeergelerleklVNKYE  719
            TI LFN KKQLKTG+ KLRLW  KEADG + TTTPGKVPK ERGE+ERLE+LVNKYE
Sbjct  127  TIFLFNNKKQLKTGRQKLRLWPQKEADGGVPTTTPGKVPKNERGEIERLERLVNKYE  183



>ref|XP_010040892.1| PREDICTED: phosphatidylinositol 3-kinase VPS34-like [Eucalyptus 
grandis]
Length=139

 Score =   190 bits (483),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 101/140 (72%), Positives = 116/140 (83%), Gaps = 4/140 (3%)
 Frame = +3

Query  189  GNEFRFFLSCDINLPVTFRIERLEgklpppklpgSDGVDTMMNAIDDRKPELYVESTLYI  368
            GNEFRFFLS DINLPVTFR++ LEG LPP + P  +    + +A ++RK ELYV+ +LYI
Sbjct  4    GNEFRFFLSRDINLPVTFRVKNLEGALPPKRSPNPE----IDHATEERKAELYVDCSLYI  59

Query  369  DGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIGGA  548
            DG PFGLP RTRLES GP Y WNEL+TLSTKY+DLTA+SQLALTVWDVSCGK EG+IGGA
Sbjct  60   DGTPFGLPTRTRLESAGPPYFWNELVTLSTKYQDLTAHSQLALTVWDVSCGKEEGLIGGA  119

Query  549  TIHLFNMKKQLKTGKHKLRL  608
            TI LF+ KKQLKTGK KLRL
Sbjct  120  TILLFSSKKQLKTGKQKLRL  139



>ref|XP_008678534.1| PREDICTED: phosphatidylinositol 3-kinase, root isoform [Zea mays]
 ref|XP_008678535.1| PREDICTED: phosphatidylinositol 3-kinase, root isoform [Zea mays]
 gb|AFW62054.1| hypothetical protein ZEAMMB73_811721 [Zea mays]
Length=803

 Score =   203 bits (517),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 112/177 (63%), Positives = 130/177 (73%), Gaps = 16/177 (9%)
 Frame = +3

Query  189  GNEFRFFLSCDINLPVTFRIERLEgklpppklpgSDGVDTMMNAIDDRKPELYVESTLYI  368
            GNEFRFFLSCDI+ P+ FR+   E                 +   D + PEL+VE  LYI
Sbjct  5    GNEFRFFLSCDISHPLAFRVLHAEH----------------ILLTDQKVPELFVECKLYI  48

Query  369  DGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIGGA  548
            DG  FGLP++TRLE  GP YCWNELITLSTKYRDLT+ SQLA TVWDVS G++  V+GGA
Sbjct  49   DGIQFGLPVKTRLEPSGPKYCWNELITLSTKYRDLTSLSQLAFTVWDVSSGENPEVVGGA  108

Query  549  TIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKVPkeergelerleklVNKYE  719
            TI LFN K+QLKTG+ KLRLW  KEADG + TTTPGKVP+ ERGE+ERLE+LVNKYE
Sbjct  109  TIFLFNSKRQLKTGRQKLRLWPTKEADGGVPTTTPGKVPRNERGEIERLERLVNKYE  165



>dbj|BAJ91813.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=826

 Score =   201 bits (512),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 115/179 (64%), Positives = 135/179 (75%), Gaps = 12/179 (7%)
 Frame = +3

Query  183  MSGNEFRFFLSCDINLPVTFRIERLEgklpppklpgSDGVDTMMNAIDDRKPELYVESTL  362
            ++ +EFRFFLSCDI+LP+TFR+        P   P  DG+D  ++       EL+VE  L
Sbjct  22   INSSEFRFFLSCDISLPLTFRV-----LQAPIPPPAQDGLDKKVS-------ELFVECKL  69

Query  363  YIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIG  542
            YIDG  FGLP+ TRLES GP YCWNELITL TKYRDLT+ +QLA TVWDVS G+ + V+G
Sbjct  70   YIDGIQFGLPVNTRLESSGPPYCWNELITLCTKYRDLTSLAQLAFTVWDVSSGEGKSVVG  129

Query  543  GATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKVPkeergelerleklVNKYE  719
            GATI LFN KKQLKTGK KL+LW  KEADG + TTTPGKVPK ERGE+ERLE+LVNKYE
Sbjct  130  GATIFLFNSKKQLKTGKQKLQLWPQKEADGRVPTTTPGKVPKNERGEIERLERLVNKYE  188



>ref|XP_004973056.1| PREDICTED: phosphatidylinositol 3-kinase, root isoform-like isoform 
X2 [Setaria italica]
Length=805

 Score =   199 bits (507),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 111/177 (63%), Positives = 129/177 (73%), Gaps = 14/177 (8%)
 Frame = +3

Query  189  GNEFRFFLSCDINLPVTFRIERLEgklpppklpgSDGVDTMMNAIDDRKPELYVESTLYI  368
            GNEFRFFLSCDI+LP+ FR+                 V   +     + PEL+VE  LYI
Sbjct  5    GNEFRFFLSCDISLPLAFRVLH--------------AVPEHILLTQQKVPELFVECKLYI  50

Query  369  DGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIGGA  548
            DG  FGLP++TRLE  GP+Y WNELITLSTKYRDLT+ SQLA TVWDVS G+   ++GGA
Sbjct  51   DGILFGLPVKTRLEPSGPTYFWNELITLSTKYRDLTSLSQLAFTVWDVSSGEDPEIVGGA  110

Query  549  TIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKVPkeergelerleklVNKYE  719
            TI LFN K+QLKTG+ KLRLW  KEADG + TTTPGKVPK ERGE+ERLE+LVNKYE
Sbjct  111  TIFLFNSKRQLKTGRQKLRLWPKKEADGGVPTTTPGKVPKNERGEIERLERLVNKYE  167



>ref|XP_004973055.1| PREDICTED: phosphatidylinositol 3-kinase, root isoform-like isoform 
X1 [Setaria italica]
Length=803

 Score =   199 bits (505),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 111/177 (63%), Positives = 129/177 (73%), Gaps = 16/177 (9%)
 Frame = +3

Query  189  GNEFRFFLSCDINLPVTFRIERLEgklpppklpgSDGVDTMMNAIDDRKPELYVESTLYI  368
            GNEFRFFLSCDI+LP+ FR+   E                 +     + PEL+VE  LYI
Sbjct  5    GNEFRFFLSCDISLPLAFRVLHAEH----------------ILLTQQKVPELFVECKLYI  48

Query  369  DGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIGGA  548
            DG  FGLP++TRLE  GP+Y WNELITLSTKYRDLT+ SQLA TVWDVS G+   ++GGA
Sbjct  49   DGILFGLPVKTRLEPSGPTYFWNELITLSTKYRDLTSLSQLAFTVWDVSSGEDPEIVGGA  108

Query  549  TIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKVPkeergelerleklVNKYE  719
            TI LFN K+QLKTG+ KLRLW  KEADG + TTTPGKVPK ERGE+ERLE+LVNKYE
Sbjct  109  TIFLFNSKRQLKTGRQKLRLWPKKEADGGVPTTTPGKVPKNERGEIERLERLVNKYE  165



>emb|CCD74511.1| phosphatidylinositol 3-kinase, partial [Arabidopsis halleri subsp. 
halleri]
Length=775

 Score =   199 bits (505),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 102/137 (74%), Positives = 123/137 (90%), Gaps = 0/137 (0%)
 Frame = +3

Query  309  MMNAIDDRKPELYVESTLYIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQ  488
            +++  +++KPELY+E  LYIDGAPFGLPMRTRL++ GP YCWNELITLS+KYRDLTA+SQ
Sbjct  1    LVSVAEEKKPELYIECALYIDGAPFGLPMRTRLKTTGPPYCWNELITLSSKYRDLTAHSQ  60

Query  489  LALTVWDVSCGKSEGVIGGATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKVPk  668
            LA+TV+DVSCGK+EG+IGGAT+ LFN K Q+K+GK KLRLW GKEADGS  T+TPGKVP+
Sbjct  61   LAITVYDVSCGKTEGLIGGATVLLFNSKMQMKSGKQKLRLWQGKEADGSFPTSTPGKVPR  120

Query  669  eergelerleklVNKYE  719
             ERGELERLEKL+NKYE
Sbjct  121  HERGELERLEKLMNKYE  137



>ref|NP_001054810.1| Os05g0180600 [Oryza sativa Japonica Group]
 gb|AAW57810.1| putative phosphatidylinositol 3-kinase [Oryza sativa Japonica 
Group]
 dbj|BAF16724.1| Os05g0180600 [Oryza sativa Japonica Group]
 gb|EEE62546.1| hypothetical protein OsJ_17344 [Oryza sativa Japonica Group]
Length=814

 Score =   196 bits (498),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 110/178 (62%), Positives = 133/178 (75%), Gaps = 2/178 (1%)
 Frame = +3

Query  186  SGNEFRFFLSCDINLPVTFRIERLEgklpppklpgSDGVDTMMNAIDDRKPELYVESTLY  365
            +G EFRFFLSCDI+LP+ FR++RL     P +        T+  A + + PEL VE  LY
Sbjct  3    NGGEFRFFLSCDISLPLAFRVDRLLHYPTPTQPSPPQDCTTL--ATNKKVPELVVECKLY  60

Query  366  IDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIGG  545
            IDG  FGLP+ TRLES GP Y WNE++TL+ KYRDLT+ SQLA TVWD+S G+   ++GG
Sbjct  61   IDGIQFGLPVSTRLESSGPPYFWNEVMTLTAKYRDLTSLSQLAFTVWDMSSGEDGNIVGG  120

Query  546  ATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKVPkeergelerleklVNKYE  719
            ATI LFN KKQLKTG+ KLRLW  KEADG + TTTPGKVPK ERGE+ERLE+LVNK+E
Sbjct  121  ATIFLFNNKKQLKTGRQKLRLWPQKEADGRVPTTTPGKVPKNERGEIERLERLVNKHE  178



>ref|XP_001762959.1| predicted protein [Physcomitrella patens]
 gb|EDQ72164.1| predicted protein [Physcomitrella patens]
Length=813

 Score =   196 bits (497),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 114/179 (64%), Positives = 137/179 (77%), Gaps = 6/179 (3%)
 Frame = +3

Query  183  MSGNEFRFFLSCDINLPVTFRIERLEgklpppklpgSDGVDTMMNAIDDRKPELYVESTL  362
            M+GNEFRFFLSCDINLPVTFR+E L+G  P      +  +D ++ A     PEL+VE  L
Sbjct  1    MNGNEFRFFLSCDINLPVTFRVEALDGDPPA-----APPLDGLIGA-GGSTPELFVECAL  54

Query  363  YIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIG  542
            YIDG  FGLP RTRL S    + WNEL+TLS KYRDL++N+QLALTVWDVS  + E V+G
Sbjct  55   YIDGVLFGLPTRTRLSSIEKPWRWNELVTLSAKYRDLSSNAQLALTVWDVSSPRQEVVVG  114

Query  543  GATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKVPkeergelerleklVNKYE  719
            GAT+ LF+ KKQLKTGK KLRLW  ++ADG + T+TPGKVPK ERGELERLEKL+NK+E
Sbjct  115  GATLSLFSSKKQLKTGKQKLRLWRARQADGHVPTSTPGKVPKHERGELERLEKLMNKFE  173



>gb|EMS55477.1| Phosphatidylinositol 3-kinase, root isoform [Triticum urartu]
Length=838

 Score =   177 bits (450),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 96/135 (71%), Positives = 110/135 (81%), Gaps = 0/135 (0%)
 Frame = +3

Query  315  NAIDDRKPELYVESTLYIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLA  494
            + +D +  EL+VE  LYIDG  FGLP+ TRLES GP YCWNELITL TKYRDLT+ +QLA
Sbjct  66   HGLDKKVSELFVECKLYIDGIQFGLPVNTRLESSGPPYCWNELITLCTKYRDLTSLAQLA  125

Query  495  LTVWDVSCGKSEGVIGGATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKVPkee  674
             TVWDVS G+ + V+GGATI LFN KKQLKTGK KL+LW  KEADG + TTTPGKVPK E
Sbjct  126  FTVWDVSSGEGKSVVGGATIFLFNSKKQLKTGKQKLQLWPQKEADGRVPTTTPGKVPKNE  185

Query  675  rgelerleklVNKYE  719
            RGE+ERLE+LVNKYE
Sbjct  186  RGEIERLERLVNKYE  200



>ref|XP_010234573.1| PREDICTED: phosphatidylinositol 3-kinase, root isoform-like isoform 
X2 [Brachypodium distachyon]
Length=762

 Score =   174 bits (441),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 97/173 (56%), Positives = 122/173 (71%), Gaps = 15/173 (9%)
 Frame = +3

Query  201  RFFLSCDINLPVTFRIERLEgklpppklpgSDGVDTMMNAIDDRKPELYVESTLYIDGAP  380
            RFFLS DI LP+ FR++RL            D    + +++     EL+VE  LYIDG  
Sbjct  21   RFFLSHDIGLPIAFRVDRL----------IPDHTLLIESSL-----ELFVECALYIDGIQ  65

Query  381  FGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIGGATIHL  560
            FGL + TRLES GP YCWNEL+TLS KYRDLT  SQLA TVW+VS G+   ++GGAT+ L
Sbjct  66   FGLTVDTRLESSGPIYCWNELMTLSIKYRDLTPLSQLAFTVWNVSAGEDRMIVGGATVSL  125

Query  561  FNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKVPkeergelerleklVNKYE  719
            FN KKQLKTG+H+LR+W  K ADGS+ T+TPGKV K +R E+ERLE++ NKY+
Sbjct  126  FNSKKQLKTGRHRLRIWPKKMADGSLPTSTPGKVSKTKRDEMERLERVANKYK  178



>ref|XP_003571627.2| PREDICTED: phosphatidylinositol 3-kinase, root isoform-like isoform 
X1 [Brachypodium distachyon]
Length=819

 Score =   174 bits (441),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 97/173 (56%), Positives = 122/173 (71%), Gaps = 15/173 (9%)
 Frame = +3

Query  201  RFFLSCDINLPVTFRIERLEgklpppklpgSDGVDTMMNAIDDRKPELYVESTLYIDGAP  380
            RFFLS DI LP+ FR++RL            D    + +++     EL+VE  LYIDG  
Sbjct  21   RFFLSHDIGLPIAFRVDRL----------IPDHTLLIESSL-----ELFVECALYIDGIQ  65

Query  381  FGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIGGATIHL  560
            FGL + TRLES GP YCWNEL+TLS KYRDLT  SQLA TVW+VS G+   ++GGAT+ L
Sbjct  66   FGLTVDTRLESSGPIYCWNELMTLSIKYRDLTPLSQLAFTVWNVSAGEDRMIVGGATVSL  125

Query  561  FNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKVPkeergelerleklVNKYE  719
            FN KKQLKTG+H+LR+W  K ADGS+ T+TPGKV K +R E+ERLE++ NKY+
Sbjct  126  FNSKKQLKTGRHRLRIWPKKMADGSLPTSTPGKVSKTKRDEMERLERVANKYK  178



>ref|XP_002972489.1| hypothetical protein SELMODRAFT_97360 [Selaginella moellendorffii]
 gb|EFJ26575.1| hypothetical protein SELMODRAFT_97360 [Selaginella moellendorffii]
Length=803

 Score =   171 bits (433),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 102/180 (57%), Positives = 123/180 (68%), Gaps = 1/180 (1%)
 Frame = +3

Query  183  MSG-NEFRFFLSCDINLPVTFRIERLEgklpppklpgSDGVDTMMNAIDDRKPELYVEST  359
            M+G N  RFFLS DINLPVT R+E LEG L                A     P+L+VE +
Sbjct  1    MAGSNGERFFLSSDINLPVTLRVESLEGDLQRYTEATLKNATDFALAEHSPVPDLFVECS  60

Query  360  LYIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVI  539
            LYIDG  FGLP +TRL      Y WNE+ITLS KYRDLTA +QL  TVWDVS  + E  +
Sbjct  61   LYIDGVLFGLPTKTRLAPIEKPYKWNEMITLSAKYRDLTATTQLTFTVWDVSYPRQEVAV  120

Query  540  GGATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKVPkeergelerleklVNKYE  719
            GGA+  +F+ KK+LKTGK KLRLW G+ ADG++ ++TPGKVPK ERGELERL+K +NKYE
Sbjct  121  GGASFRIFSKKKELKTGKQKLRLWRGRIADGAVVSSTPGKVPKHERGELERLDKALNKYE  180



>ref|XP_006654111.1| PREDICTED: phosphatidylinositol 3-kinase, root isoform-like isoform 
X3 [Oryza brachyantha]
Length=629

 Score =   169 bits (429),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 92/128 (72%), Positives = 105/128 (82%), Gaps = 0/128 (0%)
 Frame = +3

Query  336  PELYVESTLYIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVS  515
            PEL+VE  LYIDG PFGLP+ TRLES GP Y WNE++TL+ KYRDLT+ SQLA TVWD+S
Sbjct  7    PELFVECKLYIDGIPFGLPVSTRLESSGPPYFWNEVMTLTAKYRDLTSLSQLAFTVWDMS  66

Query  516  CGKSEGVIGGATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKVPkeergelerl  695
             G+   ++GGATI LFN KKQLKTG+ KLRLW  K ADG I TTTPGKVPK ERGE+ERL
Sbjct  67   SGEDGHIVGGATIFLFNNKKQLKTGRQKLRLWPQKVADGRIPTTTPGKVPKNERGEIERL  126

Query  696  eklVNKYE  719
            E+LVNKYE
Sbjct  127  ERLVNKYE  134



>ref|XP_006654110.1| PREDICTED: phosphatidylinositol 3-kinase, root isoform-like isoform 
X2 [Oryza brachyantha]
Length=647

 Score =   169 bits (428),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 92/128 (72%), Positives = 105/128 (82%), Gaps = 0/128 (0%)
 Frame = +3

Query  336  PELYVESTLYIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVS  515
            PEL+VE  LYIDG PFGLP+ TRLES GP Y WNE++TL+ KYRDLT+ SQLA TVWD+S
Sbjct  7    PELFVECKLYIDGIPFGLPVSTRLESSGPPYFWNEVMTLTAKYRDLTSLSQLAFTVWDMS  66

Query  516  CGKSEGVIGGATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKVPkeergelerl  695
             G+   ++GGATI LFN KKQLKTG+ KLRLW  K ADG I TTTPGKVPK ERGE+ERL
Sbjct  67   SGEDGHIVGGATIFLFNNKKQLKTGRQKLRLWPQKVADGRIPTTTPGKVPKNERGEIERL  126

Query  696  eklVNKYE  719
            E+LVNKYE
Sbjct  127  ERLVNKYE  134



>ref|XP_006654109.1| PREDICTED: phosphatidylinositol 3-kinase, root isoform-like isoform 
X1 [Oryza brachyantha]
Length=770

 Score =   169 bits (428),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 92/128 (72%), Positives = 105/128 (82%), Gaps = 0/128 (0%)
 Frame = +3

Query  336  PELYVESTLYIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVS  515
            PEL+VE  LYIDG PFGLP+ TRLES GP Y WNE++TL+ KYRDLT+ SQLA TVWD+S
Sbjct  7    PELFVECKLYIDGIPFGLPVSTRLESSGPPYFWNEVMTLTAKYRDLTSLSQLAFTVWDMS  66

Query  516  CGKSEGVIGGATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKVPkeergelerl  695
             G+   ++GGATI LFN KKQLKTG+ KLRLW  K ADG I TTTPGKVPK ERGE+ERL
Sbjct  67   SGEDGHIVGGATIFLFNNKKQLKTGRQKLRLWPQKVADGRIPTTTPGKVPKNERGEIERL  126

Query  696  eklVNKYE  719
            E+LVNKYE
Sbjct  127  ERLVNKYE  134



>ref|NP_001061506.1| Os08g0307400 [Oryza sativa Japonica Group]
 gb|AAQ56420.1| putative kinase [Oryza sativa Japonica Group]
 dbj|BAF23420.1| Os08g0307400 [Oryza sativa Japonica Group]
Length=827

 Score =   167 bits (423),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 96/177 (54%), Positives = 117/177 (66%), Gaps = 15/177 (8%)
 Frame = +3

Query  189  GNEFRFFLSCDINLPVTFRIERLEgklpppklpgSDGVDTMMNAIDDRKPELYVESTLYI  368
            G EFRF LS DI+LP++FR+ R               V      I+   P L+VE TLYI
Sbjct  25   GKEFRFILSQDISLPLSFRVNRF--------------VPDRTLLIERSAPVLFVECTLYI  70

Query  369  DGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSE-GVIGG  545
            DG  FGL   TRL+S G  YCWNEL+TLS KYRDLT  S LA TVWD+S G+    ++GG
Sbjct  71   DGVQFGLSTNTRLKSLGSPYCWNELVTLSAKYRDLTPFSHLAFTVWDMSSGEDNIYIVGG  130

Query  546  ATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKVPkeergelerleklVNKY  716
             TI LFN K QLKTG+ +LR+W  K ADGS+ T+TPGKVPK +R E+ERLE++ NKY
Sbjct  131  TTISLFNSKNQLKTGRLRLRVWPNKMADGSLSTSTPGKVPKTKREEIERLERVANKY  187



>ref|XP_002984319.1| hypothetical protein SELMODRAFT_268853 [Selaginella moellendorffii]
 gb|EFJ14829.1| hypothetical protein SELMODRAFT_268853 [Selaginella moellendorffii]
Length=785

 Score =   166 bits (421),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 99/180 (55%), Positives = 121/180 (67%), Gaps = 19/180 (11%)
 Frame = +3

Query  183  MSG-NEFRFFLSCDINLPVTFRIERLEgklpppklpgSDGVDTMMNAIDDRKPELYVEST  359
            M+G N  RFFLS DINLPVT R+E LE                    +    P+L+VE +
Sbjct  1    MAGSNGERFFLSSDINLPVTLRVESLE------------------GDLQRPVPDLFVECS  42

Query  360  LYIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVI  539
            LYIDG  FGLP +TRL      Y WNE+ITLS KYRDLTA +QL  TVWDVS  + E  +
Sbjct  43   LYIDGVLFGLPTKTRLAPIEKPYKWNEMITLSAKYRDLTATTQLTFTVWDVSYPRQEVAV  102

Query  540  GGATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKVPkeergelerleklVNKYE  719
            GGA+  +F+ KK+LKTGK KLRLW G+ ADG++ ++TPGKVPK ERGELERL+K +NKYE
Sbjct  103  GGASFRIFSKKKELKTGKQKLRLWRGRIADGAVVSSTPGKVPKHERGELERLDKALNKYE  162



>gb|EEE68452.1| hypothetical protein OsJ_26836 [Oryza sativa Japonica Group]
Length=951

 Score =   166 bits (421),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 96/177 (54%), Positives = 117/177 (66%), Gaps = 15/177 (8%)
 Frame = +3

Query  189  GNEFRFFLSCDINLPVTFRIERLEgklpppklpgSDGVDTMMNAIDDRKPELYVESTLYI  368
            G EFRF LS DI+LP++FR+ R               V      I+   P L+VE TLYI
Sbjct  25   GKEFRFILSQDISLPLSFRVNRF--------------VPDRTLLIERSAPVLFVECTLYI  70

Query  369  DGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSE-GVIGG  545
            DG  FGL   TRL+S G  YCWNEL+TLS KYRDLT  S LA TVWD+S G+    ++GG
Sbjct  71   DGVQFGLSTNTRLKSLGSPYCWNELVTLSAKYRDLTPFSHLAFTVWDMSSGEDNIYIVGG  130

Query  546  ATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKVPkeergelerleklVNKY  716
             TI LFN K QLKTG+ +LR+W  K ADGS+ T+TPGKVPK +R E+ERLE++ NKY
Sbjct  131  TTISLFNSKNQLKTGRLRLRVWPNKMADGSLSTSTPGKVPKTKREEIERLERVANKY  187



>gb|EEC83339.1| hypothetical protein OsI_28732 [Oryza sativa Indica Group]
Length=1050

 Score =   165 bits (418),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 95/177 (54%), Positives = 117/177 (66%), Gaps = 15/177 (8%)
 Frame = +3

Query  189  GNEFRFFLSCDINLPVTFRIERLEgklpppklpgSDGVDTMMNAIDDRKPELYVESTLYI  368
            G EFRF LS DI+LP++FR+ R               V      I+   P L+VE TLYI
Sbjct  25   GKEFRFILSQDISLPLSFRVNRF--------------VPDRTLLIERSAPVLFVECTLYI  70

Query  369  DGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSE-GVIGG  545
            DG  FGL   TRL+S G  YCWNEL+TLS KYRDLT  S LA TVWD+S G+    ++GG
Sbjct  71   DGVQFGLSTNTRLKSLGSPYCWNELVTLSAKYRDLTPFSHLAFTVWDMSSGEDNIYIVGG  130

Query  546  ATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKVPkeergelerleklVNKY  716
             TI LFN K QLKTG+ +LR+W  K ADGS+ T+TPGKVPK +R E+ERLE++ N+Y
Sbjct  131  TTISLFNSKNQLKTGRLRLRVWPNKMADGSLSTSTPGKVPKTKREEIERLERVANQY  187



>emb|CAN76735.1| hypothetical protein VITISV_012040 [Vitis vinifera]
Length=125

 Score =   152 bits (383),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 81/106 (76%), Positives = 87/106 (82%), Gaps = 4/106 (4%)
 Frame = +3

Query  183  MSGNEFRFFLSCDINLPVTFRIERLEgklpppklpgSDGVDTMMNAIDDRKPELYVESTL  362
            MSGNEFRFFLSCDINLPVTFRIERLEG LP  K   S+   T     ++R+ ELYVE  L
Sbjct  1    MSGNEFRFFLSCDINLPVTFRIERLEGNLPSVKSSISEFDYT----TEERRAELYVECAL  56

Query  363  YIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALT  500
            +IDGAPFGLP RTRLES GPSYCWNELITLSTKYRDLTA+SQLALT
Sbjct  57   FIDGAPFGLPTRTRLESTGPSYCWNELITLSTKYRDLTAHSQLALT  102



>ref|XP_006849085.1| hypothetical protein AMTR_s00028p00234070 [Amborella trichopoda]
 gb|ERN10666.1| hypothetical protein AMTR_s00028p00234070 [Amborella trichopoda]
Length=833

 Score =   162 bits (410),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 94/132 (71%), Positives = 103/132 (78%), Gaps = 1/132 (1%)
 Frame = +3

Query  324  DDRKPELYVESTLYIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTV  503
            + R  ELYVE  LYIDGAPFGLPM+TRLES    Y WNE ITLS KYRDLT ++QL LTV
Sbjct  64   EKRSAELYVECILYIDGAPFGLPMQTRLESGAQPYYWNEHITLSAKYRDLTVHAQLGLTV  123

Query  504  WDVSCGKSEGVIGGATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKVPkeerge  683
            WDV C + E  +GG TI LF+ KKQLKTGK  LRLW GKEADGS  T TPGKVPK ERGE
Sbjct  124  WDV-CKQDEEPVGGTTILLFSGKKQLKTGKQMLRLWRGKEADGSFPTKTPGKVPKHERGE  182

Query  684  lerleklVNKYE  719
            +ERLEKL+NKYE
Sbjct  183  MERLEKLLNKYE  194



>gb|EMT32616.1| Phosphatidylinositol 3-kinase, root isoform [Aegilops tauschii]
Length=838

 Score =   160 bits (405),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 104/191 (54%), Positives = 128/191 (67%), Gaps = 19/191 (10%)
 Frame = +3

Query  180  TMSGNEFRFFLSCDINLPVTFRIERLEgklpppklpgSDGVDTMMNAIDDRKPELYVEST  359
            + + +EFRFFLSCDI+LP+TFR+ +     PP +   S  +   ++      P++   S 
Sbjct  18   STNSSEFRFFLSCDISLPLTFRVLQ-APIPPPAQGAHSHSLPCPLSP----HPQI---SL  69

Query  360  LYIDGAPFGLPMR-----------TRLESRGPSYCWNELITLSTKYRDLTANSQLALTVW  506
            ++       LP R            RLES GP YCWNELITL TKYRDLT+ +QLA TVW
Sbjct  70   VFTSDLSSLLPGRWSRQEDVGIKNIRLESSGPPYCWNELITLCTKYRDLTSLAQLAFTVW  129

Query  507  DVSCGKSEGVIGGATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKVPkeergel  686
            DVS G+ + V+GGATI LFN KKQLKTGK KL+LW  KEADG + TTTPGKVPK ERGE+
Sbjct  130  DVSSGEGKSVVGGATIFLFNSKKQLKTGKQKLQLWPQKEADGRVPTTTPGKVPKNERGEI  189

Query  687  erleklVNKYE  719
            ERLE+LVNKYE
Sbjct  190  ERLERLVNKYE  200



>gb|KCW84840.1| hypothetical protein EUGRSUZ_B016665, partial [Eucalyptus grandis]
 gb|KCW84841.1| hypothetical protein EUGRSUZ_B016665, partial [Eucalyptus grandis]
Length=84

 Score =   142 bits (358),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 70/84 (83%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = +3

Query  405  LESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIGGATIHLFNMKKQLK  584
            LES GP Y WNELITLSTKYRDLTA+SQLALTVWDVSCGK EG+IGGATI LF+ KKQLK
Sbjct  1    LESAGPPYFWNELITLSTKYRDLTAHSQLALTVWDVSCGKEEGLIGGATILLFSSKKQLK  60

Query  585  TGKHKLRLWSGKEADGSIHTTTPG  656
            TGK KLRLW GKEADGS  T TPG
Sbjct  61   TGKQKLRLWQGKEADGSFPTNTPG  84



>ref|XP_002983829.1| hypothetical protein SELMODRAFT_118849 [Selaginella moellendorffii]
 gb|EFJ15325.1| hypothetical protein SELMODRAFT_118849 [Selaginella moellendorffii]
Length=790

 Score =   152 bits (385),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 94/173 (54%), Positives = 117/173 (68%), Gaps = 12/173 (7%)
 Frame = +3

Query  201  RFFLSCDINLPVTFRIERLEgklpppklpgSDGVDTMMNAIDDRKPELYVESTLYIDGAP  380
            + FLS DIN PVT  +E L+             + +  ++ +D  P LYVE  LYIDG+P
Sbjct  3    QVFLSSDINFPVTALVESLQ-----------GDLRSPPSSQEDLSPALYVECALYIDGSP  51

Query  381  FGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIGGATIHL  560
            FGL  RT L    P Y WNE ITL+ KYRDL+ N+QLA TVWDVS    E  +GG+T+ L
Sbjct  52   FGLVTRTGLAIEKP-YKWNEAITLTGKYRDLSLNAQLAFTVWDVSNPLQEIAVGGSTLKL  110

Query  561  FNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKVPkeergelerleklVNKYE  719
            FN K QLKTGK +LRLW G+ ADGS  +TTPGKVP+ ERGE+ERL+KL++KYE
Sbjct  111  FNSKGQLKTGKQRLRLWRGRVADGSAVSTTPGKVPEGERGEVERLDKLLSKYE  163



>ref|XP_002989110.1| hypothetical protein SELMODRAFT_129115 [Selaginella moellendorffii]
 gb|EFJ09904.1| hypothetical protein SELMODRAFT_129115 [Selaginella moellendorffii]
Length=806

 Score =   152 bits (383),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 96/178 (54%), Positives = 118/178 (66%), Gaps = 6/178 (3%)
 Frame = +3

Query  201  RFFLSCDINLPVTFRIERLEgklpppklpgSDGVDTMM-----NAIDDRKPELYVESTLY  365
            + FLS DIN PVT  +E L+G L           + ++     +  +D  P LYVE  LY
Sbjct  3    QVFLSSDINFPVTALVESLQGDLRSRPSSQGTRENFIVYILFSSTAEDLSPALYVECALY  62

Query  366  IDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIGG  545
            IDG+PFGL  RT L    P Y WNE ITL+ KYRDL+ N+QLA TVWDVS    E  +GG
Sbjct  63   IDGSPFGLVTRTGLAIEKP-YKWNEAITLTGKYRDLSLNAQLAFTVWDVSNPLQEIAVGG  121

Query  546  ATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKVPkeergelerleklVNKYE  719
            +T+ LFN K QLKTGK +LRLW G+ ADGS  +TTPGKVP+ ERGE ERL+KL++KYE
Sbjct  122  STLRLFNSKGQLKTGKQRLRLWRGRVADGSAVSTTPGKVPEGERGEGERLDKLLSKYE  179



>ref|XP_010940073.1| PREDICTED: phosphatidylinositol 3-kinase, root isoform isoform 
X2 [Elaeis guineensis]
Length=756

 Score =   149 bits (375),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 79/105 (75%), Positives = 92/105 (88%), Gaps = 0/105 (0%)
 Frame = +3

Query  405  LESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIGGATIHLFNMKKQLK  584
            LES G  YCWNELITLSTKYRDLT+ +QLA TVWDVSCG ++G++GGAT+ LFN KKQLK
Sbjct  13   LESSGYPYCWNELITLSTKYRDLTSQAQLAFTVWDVSCGNNDGLVGGATVFLFNSKKQLK  72

Query  585  TGKHKLRLWSGKEADGSIHTTTPGKVPkeergelerleklVNKYE  719
             G+ KLRLW GKEADG+I +TTPGKVPK E+GE+ERLE+LVNKYE
Sbjct  73   AGRKKLRLWPGKEADGTIPSTTPGKVPKCEQGEIERLERLVNKYE  117



>gb|KDO82393.1| hypothetical protein CISIN_1g003462mg [Citrus sinensis]
Length=740

 Score =   147 bits (371),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 83/101 (82%), Positives = 89/101 (88%), Gaps = 0/101 (0%)
 Frame = +3

Query  417  GPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIGGATIHLFNMKKQLKTGKH  596
            GP YCWNE ITLSTKYRDLTA+SQLALTVWDVSCGK E ++GG TI LFN K QLKTGK 
Sbjct  2    GPMYCWNEPITLSTKYRDLTAHSQLALTVWDVSCGKDERLVGGTTILLFNSKMQLKTGKQ  61

Query  597  KLRLWSGKEADGSIHTTTPGKVPkeergelerleklVNKYE  719
            KLRLW GKEADGS+ T+TPGKVPK ERGELERLEKL+NKYE
Sbjct  62   KLRLWPGKEADGSLPTSTPGKVPKNERGELERLEKLINKYE  102



>ref|XP_010269376.1| PREDICTED: phosphatidylinositol 3-kinase, root isoform isoform 
X4 [Nelumbo nucifera]
Length=691

 Score =   144 bits (364),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 78/106 (74%), Positives = 82/106 (77%), Gaps = 4/106 (4%)
 Frame = +3

Query  183  MSGNEFRFFLSCDINLPVTFRIERLEgklpppklpgSDGVDTMMNAIDDRKPELYVESTL  362
            MSGNEFRFFLSCDINLPVTFR+ERLEG LP  K   S    T     +DR+ ELYVE  L
Sbjct  1    MSGNEFRFFLSCDINLPVTFRVERLEGNLPATKSSESQVSCT----TEDRRAELYVECVL  56

Query  363  YIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALT  500
            YIDGAPFGLP RTRLES G  YCW ELITLSTKYRDLTA+SQL LT
Sbjct  57   YIDGAPFGLPTRTRLESTGQPYCWTELITLSTKYRDLTAHSQLTLT  102



>emb|CDY44613.1| BnaCnng11620D [Brassica napus]
Length=277

 Score =   132 bits (332),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 95/193 (49%), Positives = 118/193 (61%), Gaps = 40/193 (21%)
 Frame = +3

Query  183  MSGNEFRFFLSCDINLPVTFRIERLEgklpppklpgSDGVDT--------------MMNA  320
            M  +EFRFFLSCDIN PVTFRI++L+G  PP + P    ++               +++ 
Sbjct  1    MGASEFRFFLSCDINSPVTFRIDKLDGIPPPSRNPLIRVLNKIRLYMFIAQWNPPRLVSV  60

Query  321  IDDRKPELYVESTLYIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALT  500
             +++K ELY+E  LYI+GAPFGLPMRT   S  P                L A     L 
Sbjct  61   AEEKKQELYIECALYINGAPFGLPMRT---SESP----------------LVAGMGFFLR  101

Query  501  VWDVSCGKSEGVIGGATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKVPkeerg  680
                   K+EG+IGGATI LFN K Q+K+GK KLRLW GKEADGS  T+TPGKVP+ E G
Sbjct  102  -------KTEGLIGGATILLFNSKMQMKSGKQKLRLWQGKEADGSFPTSTPGKVPRHECG  154

Query  681  elerleklVNKYE  719
            ELERLEKL+NK+E
Sbjct  155  ELERLEKLMNKFE  167



>emb|CDY66849.1| BnaUnng01690D [Brassica napus]
Length=265

 Score =   130 bits (328),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 95/193 (49%), Positives = 117/193 (61%), Gaps = 40/193 (21%)
 Frame = +3

Query  183  MSGNEFRFFLSCDINLPVTFRIERLEgklpppklpgSDGVDT--------------MMNA  320
            M  +EFRFFLSCDIN PVTFRI++L+G  PP + P    ++               +++ 
Sbjct  1    MGASEFRFFLSCDINSPVTFRIDKLDGIPPPSRNPLIRVLNKIRLYMFIAQWNPPRLVSV  60

Query  321  IDDRKPELYVESTLYIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALT  500
             +++K ELY+E  LYI+GAPFGLPMRT   S  P                L A     L 
Sbjct  61   AEEKKQELYIECALYINGAPFGLPMRT---SESP----------------LVAGMGCFLR  101

Query  501  VWDVSCGKSEGVIGGATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKVPkeerg  680
                   K+EG+IGGATI LFN K Q+K+GK KLRLW GKEADGS  T+TPGKVP  E G
Sbjct  102  -------KTEGLIGGATILLFNSKMQMKSGKQKLRLWQGKEADGSFPTSTPGKVPWHECG  154

Query  681  elerleklVNKYE  719
            ELERLEKL+NK+E
Sbjct  155  ELERLEKLMNKFE  167



>ref|XP_010417983.1| PREDICTED: phosphatidylinositol 3-kinase VPS34 isoform X2 [Camelina 
sativa]
Length=730

 Score =   128 bits (321),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 72/92 (78%), Positives = 84/92 (91%), Gaps = 0/92 (0%)
 Frame = +3

Query  444  ITLSTKYRDLTANSQLALTVWDVSCGKSEGVIGGATIHLFNMKKQLKTGKHKLRLWSGKE  623
            +TLS+KYRDLTA+SQLA+TVWDVSCGK+EG+IGGAT+ LFN K Q+K+GK KLRLW GKE
Sbjct  1    MTLSSKYRDLTAHSQLAITVWDVSCGKTEGLIGGATVLLFNSKGQMKSGKQKLRLWQGKE  60

Query  624  ADGSIHTTTPGKVPkeergelerleklVNKYE  719
            ADGS  T+TPGKVP+ ERGELERLEKL+NKYE
Sbjct  61   ADGSFPTSTPGKVPRHERGELERLEKLMNKYE  92



>ref|XP_007765963.1| atypical PIKK PI3K protein kinase [Coniophora puteana RWD-64-598 
SS2]
 gb|EIW84194.1| atypical PIKK PI3K protein kinase [Coniophora puteana RWD-64-598 
SS2]
Length=849

 Score =   117 bits (292),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 64/165 (39%), Positives = 89/165 (54%), Gaps = 14/165 (8%)
 Frame = +3

Query  192  NEFRFFLSCDINLPVTFRIERLEgklpppklpgSDGVDTMMNAIDDR--------KPELY  347
            ++F F    ++ LPVTFRI +LE           + +  ++   + R          +LY
Sbjct  7    DDFTFAKLSNLKLPVTFRISQLE------GTRQPNSITQLLEKPELRFHGVQLPTLSDLY  60

Query  348  VESTLYIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKS  527
            V   L  D  P  +P RT  ++   SY WNE IT   +Y DL  NSQ+  TVWD+   +S
Sbjct  61   VTCQLVADNKPLTIPFRTSFKAFKNSYTWNEWITFPVRYCDLPLNSQITFTVWDIGGPRS  120

Query  528  EGVIGGATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKV  662
               +GG+T  +F  K  L+ GKH+L LW+GKEADGS+ TTTP KV
Sbjct  121  AIPVGGSTFRMFGKKWTLRRGKHRLLLWAGKEADGSVETTTPSKV  165



>emb|CCA75314.1| related to phosphatidylinositol 3-kinase [Piriformospora indica 
DSM 11827]
Length=849

 Score =   116 bits (290),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 69/175 (39%), Positives = 91/175 (52%), Gaps = 24/175 (14%)
 Frame = +3

Query  177  KTMSGNEFRFFLSCDINLPVTFRIERLEgklpppklpgSDGVDTMMNAIDDRKPEL----  344
            K  +G EF F    D+ +PVTFRI +LEG   P          +    +D  KPEL    
Sbjct  3    KDSNGREFHFAKLSDLKVPVTFRISQLEGTRKPL---------SFTELLD--KPELKHSG  51

Query  345  ---------YVESTLYIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLAL  497
                     YV   L  D  P  +P RT  ++   SY WNE ITL   Y DL   +Q+  
Sbjct  52   LQLPTLSDLYVTCQLVADNKPLTIPFRTSFKAFNTSYIWNEWITLPINYCDLPLGAQITF  111

Query  498  TVWDVSCGKSEGVIGGATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKV  662
            TVWD++  ++   +GG+T  LF  K  L+ GKH+L LW G+EADGSI++ TP KV
Sbjct  112  TVWDIAGPRTPMPVGGSTFRLFGKKMTLRRGKHRLLLWKGQEADGSINSQTPSKV  166



>ref|XP_006459287.1| hypothetical protein AGABI2DRAFT_218336 [Agaricus bisporus var. 
bisporus H97]
 gb|EKV49210.1| hypothetical protein AGABI2DRAFT_218336 [Agaricus bisporus var. 
bisporus H97]
Length=834

 Score =   115 bits (289),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 65/159 (41%), Positives = 84/159 (53%), Gaps = 2/159 (1%)
 Frame = +3

Query  192  NEFRFFLSCDINLPVTFRIERLE--gklpppklpgSDGVDTMMNAIDDRKPELYVESTLY  365
            ++F F   CDI LPVTFRI +LE   K         D       A      +LYV   L 
Sbjct  7    DDFTFAKLCDIKLPVTFRISQLEGVRKPRSFTEVLDDPGLKFHGAQSASLSDLYVTCQLV  66

Query  366  IDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIGG  545
             D  P  +P RT  ++   SY WNE I L  +Y DL  +SQ+  TVWD    ++   +GG
Sbjct  67   ADNKPLTIPFRTSFKAFKNSYSWNEWIVLPIRYCDLPLSSQITFTVWDTGGPRTAVAVGG  126

Query  546  ATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKV  662
            +T  LF  K  L+ GKH+L LW G EADGS+ +TTP K+
Sbjct  127  STFRLFGKKWTLRRGKHRLLLWPGIEADGSVDSTTPSKM  165



>ref|XP_007304199.1| atypical/PIKK/PI3K protein kinase [Stereum hirsutum FP-91666 
SS1]
 gb|EIM86502.1| atypical/PIKK/PI3K protein kinase [Stereum hirsutum FP-91666 
SS1]
Length=849

 Score =   115 bits (289),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 61/165 (37%), Positives = 92/165 (56%), Gaps = 2/165 (1%)
 Frame = +3

Query  174  MKTMSGNEFRFFLSCDINLPVTFRIERLE-gklpppklpgSDGVDTMMNAIDDRK-PELY  347
            M   + ++F F   CD+ LPVTFRI +LE  + P       D  +   + +  +   +LY
Sbjct  1    MNKDNKDDFTFARLCDLKLPVTFRIAQLEGTRHPRSFTEIIDDPELRFHGLQSQGLSDLY  60

Query  348  VESTLYIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKS  527
            V   L  D  P  +P RT  ++   +Y WNE I+   +Y DL  +SQ+  TVWD++  ++
Sbjct  61   VTCQLVADNKPLTIPFRTSFKAFKSNYTWNEWISFPIRYCDLPLSSQIIFTVWDIAGPRA  120

Query  528  EGVIGGATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKV  662
               +GG T  LF  K  L+ GKH++ LW G+EADGS+ +TTP K+
Sbjct  121  ATPVGGTTFRLFGKKWTLRRGKHRMLLWPGREADGSVESTTPSKM  165



>ref|XP_007330402.1| hypothetical protein AGABI1DRAFT_75039 [Agaricus bisporus var. 
burnettii JB137-S8]
 gb|EKM78657.1| hypothetical protein AGABI1DRAFT_75039 [Agaricus bisporus var. 
burnettii JB137-S8]
Length=848

 Score =   115 bits (289),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 65/159 (41%), Positives = 84/159 (53%), Gaps = 2/159 (1%)
 Frame = +3

Query  192  NEFRFFLSCDINLPVTFRIERLE--gklpppklpgSDGVDTMMNAIDDRKPELYVESTLY  365
            ++F F   CDI LPVTFRI +LE   K         D       A      +LYV   L 
Sbjct  7    DDFTFAKLCDIKLPVTFRISQLEGVRKPRSFTEVLDDPGLKFHGAQSASLSDLYVTCQLV  66

Query  366  IDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIGG  545
             D  P  +P RT  ++   SY WNE I L  +Y DL  +SQ+  TVWD    ++   +GG
Sbjct  67   ADNKPLTIPFRTSFKAFKNSYSWNEWIVLPIRYCDLPLSSQITFTVWDTGGPRTAVAVGG  126

Query  546  ATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKV  662
            +T  LF  K  L+ GKH+L LW G EADGS+ +TTP K+
Sbjct  127  STFRLFGKKWTLRRGKHRLLLWPGIEADGSVDSTTPSKM  165



>ref|XP_001836217.2| atypical/PIKK/PI3K protein kinase [Coprinopsis cinerea okayama7#130]
 gb|EAU85589.2| atypical/PIKK/PI3K protein kinase [Coprinopsis cinerea okayama7#130]
Length=852

 Score =   115 bits (288),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 64/159 (40%), Positives = 88/159 (55%), Gaps = 2/159 (1%)
 Frame = +3

Query  192  NEFRFFLSCDINLPVTFRIERLE-gklpppklpgSDGVDTMMNAIDDRK-PELYVESTLY  365
            ++F F    D+ LPVTFRI +LE  + P       +  D   + +      +LYV   L 
Sbjct  7    DDFTFARLSDLKLPVTFRISQLEGIRKPKSFTEVLENPDLRFHGVQQATLSDLYVTCQLI  66

Query  366  IDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIGG  545
             D  P  +P RT  ++   SY WNE IT   +Y DL A+SQ+  TVWD+   ++   +GG
Sbjct  67   ADNKPLTIPYRTPFKAFKNSYTWNEWITFPVRYCDLPASSQITFTVWDIGGPRTAVPVGG  126

Query  546  ATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKV  662
            +T  LF  K  L+ GKH+L LW G EADGS+ TTTP K+
Sbjct  127  STFRLFGKKWTLRRGKHRLLLWPGVEADGSVETTTPSKL  165



>gb|KIJ11996.1| phosphatidylinositol 3-kinase [Paxillus involutus ATCC 200175]
Length=847

 Score =   114 bits (286),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 65/161 (40%), Positives = 91/161 (57%), Gaps = 6/161 (4%)
 Frame = +3

Query  192  NEFRFFLSCDINLPVTFRIERLEgklpppklpgSDGVDT----MMNAIDDRKPELYVEST  359
            ++F F    D+ LPVTFRI +LEG  P   +  S+ +D        A      +LYV   
Sbjct  7    DDFTFAKLSDLKLPVTFRISQLEGTRPHKSV--SEVLDNPELKFHGAQSSTLSDLYVTCQ  64

Query  360  LYIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVI  539
            L  D  P  +P RT  ++   +Y WNE +TL  +Y DL  NSQ+  TVWD+   ++   +
Sbjct  65   LVADNKPLTIPFRTSFKTFKTNYIWNEWVTLPIRYCDLPLNSQITFTVWDIGGPRTAVPV  124

Query  540  GGATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKV  662
            GG+T  LF  K  L+ GKH+L LW+G+EADGS+ T TP K+
Sbjct  125  GGSTFRLFGKKWTLRRGKHRLLLWAGQEADGSMDTKTPSKL  165



>gb|KDQ24549.1| hypothetical protein PLEOSDRAFT_1067370 [Pleurotus ostreatus 
PC15]
Length=846

 Score =   114 bits (285),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 62/165 (38%), Positives = 91/165 (55%), Gaps = 2/165 (1%)
 Frame = +3

Query  174  MKTMSGNEFRFFLSCDINLPVTFRIERLE-gklpppklpgSDGVDTMMNAID-DRKPELY  347
            M   S ++F F    D+N+PVT RI +LE  + P       D  +   + +      +LY
Sbjct  1    MDKDSRDDFTFAKLSDLNMPVTLRISQLEGMRKPKSFREILDNPELRFHGVQLPTLSDLY  60

Query  348  VESTLYIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKS  527
            V   L  D  P  +P RT  ++   +Y WNE IT   +Y DL  NSQ+  TVWD++  ++
Sbjct  61   VTCQLVADNKPLTIPFRTSFKAFKSNYIWNEWITFPVRYCDLPLNSQVTFTVWDIAGPRT  120

Query  528  EGVIGGATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKV  662
               +GG+T  LF+ K  L+ GKH+L LW G EADGS+ ++TP K+
Sbjct  121  AAPVGGSTFRLFSKKWTLRRGKHRLWLWQGVEADGSVESSTPSKL  165



>gb|EPS97255.1| hypothetical protein FOMPIDRAFT_1166642 [Fomitopsis pinicola 
FP-58527 SS1]
Length=847

 Score =   114 bits (285),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 65/161 (40%), Positives = 90/161 (56%), Gaps = 5/161 (3%)
 Frame = +3

Query  192  NEFRFFLSCDINLPVTFRIERLE-gklpppklpgSDGVDTMMNAIDDRKPEL---YVEST  359
            ++F F    D+ LPVTFRI +LE  + P       +  +   + +  + PEL   YV   
Sbjct  7    DDFTFAKLSDLKLPVTFRISQLEGTRKPHSFTELLENPELRFHGVQ-QSPELSDLYVTCQ  65

Query  360  LYIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVI  539
            L  D  P  +P RT  ++    Y WNE +TL  +Y DL  +SQ+  TVWD+S  +S   +
Sbjct  66   LIADNKPLTIPFRTSYKAFRKDYTWNEWVTLPIRYCDLPLSSQITFTVWDISGPRSAIPV  125

Query  540  GGATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKV  662
            GG+T  LF  K  L+ GKH+L LW  +EADGSI TTTP K+
Sbjct  126  GGSTFRLFGKKLSLRRGKHRLLLWPDREADGSIETTTPSKM  166



>emb|CCL98382.1| predicted protein [Fibroporia radiculosa]
Length=1009

 Score =   114 bits (285),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 67/172 (39%), Positives = 91/172 (53%), Gaps = 5/172 (3%)
 Frame = +3

Query  156  NPNQIVMKTMSGNEFRFFLSCDINLPVTFRIERLEgklpppklpgSDGVDTMMNAIDDRK  335
            +PN   +   S ++F F    D+ LPVTFRI +LEG               +      + 
Sbjct  160  DPNNFSL--YSRDDFTFARLSDLKLPVTFRISQLEGTRKSRPYTELLEKPELRFHGVQQS  217

Query  336  PEL---YVESTLYIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVW  506
            PEL   YV   L  D  P  +P RT  ++    Y WNE ITL  +Y DL  ++Q+  TVW
Sbjct  218  PELSDLYVTCQLVADNKPLTIPFRTSHKAFKKDYTWNEWITLPIRYCDLPLSAQVTFTVW  277

Query  507  DVSCGKSEGVIGGATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKV  662
            D++  +S   +GG+T  LF  K  L+ GKH+L LW  +EADG+I TTTP KV
Sbjct  278  DIAGPRSAVPVGGSTFRLFGKKWSLRRGKHRLLLWPDREADGAIETTTPSKV  329



>ref|XP_007868983.1| phosphatidylinositol 3-kinase [Gloeophyllum trabeum ATCC 11539]
 gb|EPQ52717.1| phosphatidylinositol 3-kinase [Gloeophyllum trabeum ATCC 11539]
Length=838

 Score =   114 bits (284),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 63/159 (40%), Positives = 85/159 (53%), Gaps = 2/159 (1%)
 Frame = +3

Query  192  NEFRFFLSCDINLPVTFRIERLE-gklpppklpgSDGVDTMMNAIDDRK-PELYVESTLY  365
            ++F F    D+  PVTFRI +LE            +  D   + +      +LYV   L 
Sbjct  7    DDFTFAKLSDLKQPVTFRISQLEGTIPKKSFTELLENPDLRFHGVQQSTLADLYVTCQLV  66

Query  366  IDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIGG  545
             D  P  +P RT  ++   SY WNE ITL  +Y DL  +SQ+  TVWD++  +S   IGG
Sbjct  67   ADNKPLTIPFRTSFKAFKNSYTWNEWITLPIRYCDLPLSSQITFTVWDIAGPRSAVPIGG  126

Query  546  ATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKV  662
             T  LF  K  L+ GKH+L LW  +EADGS+ TTTP K+
Sbjct  127  TTFRLFGKKWTLRRGKHRLLLWPDREADGSVETTTPSKL  165



>ref|XP_007342219.1| phosphatidylinositol 3-kinase [Auricularia delicata TFB-10046 
SS5]
 gb|EJD49671.1| phosphatidylinositol 3-kinase [Auricularia delicata TFB-10046 
SS5]
Length=854

 Score =   113 bits (283),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 67/168 (40%), Positives = 87/168 (52%), Gaps = 10/168 (6%)
 Frame = +3

Query  177  KTMSGNEFRFFLSCDINLPVTFRIERLE------gklpppklpgSDGVDTMMNAIDDRKP  338
            K  +  +F F    D+ LPVTFRI +LE            + P        +  + D   
Sbjct  3    KDNNSKDFTFAKLSDLKLPVTFRISQLEGTRKPRSYTELLEHPELKFAGVQLPTLSD---  59

Query  339  ELYVESTLYIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSC  518
             LYV   L  D  P  +P RT  ++   SY WNE ITL  KY DL  NSQLA+TVWD+  
Sbjct  60   -LYVTVQLVADNKPLTIPYRTAFKAFKNSYTWNEWITLPIKYCDLPLNSQLAITVWDIQG  118

Query  519  GKSEGVIGGATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKV  662
             ++   +GG T  LF  K  L+ GKH+L LW  +EADGS+ T TP K+
Sbjct  119  PRTAVPVGGTTFRLFGKKWTLRRGKHRLLLWEDQEADGSVDTKTPSKL  166



>gb|KII89648.1| hypothetical protein PLICRDRAFT_158734 [Plicaturopsis crispa 
FD-325 SS-3]
Length=847

 Score =   113 bits (283),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 62/159 (39%), Positives = 90/159 (57%), Gaps = 2/159 (1%)
 Frame = +3

Query  192  NEFRFFLSCDINLPVTFRIERLE-gklpppklpgSDGVDTMMNAIDDRK-PELYVESTLY  365
            ++  F    D+ LPVTFRI +LE  + P P     D  +   + +      ++YV   L 
Sbjct  7    DDITFATLSDLKLPVTFRISQLEGIRHPRPFTELLDQPELRFHGVQSSTLSDIYVTCQLI  66

Query  366  IDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIGG  545
             D  P  +P RT  ++   +Y WNE ITL  +Y DL  +SQ+  TVWD++  ++   +GG
Sbjct  67   ADNKPLTIPFRTSFKAFKTNYTWNEWITLPIRYCDLPLSSQITFTVWDIAGPRAAAPVGG  126

Query  546  ATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKV  662
            +T  +F  K  L+ GKH+L LW G+EADGSI TTTP K+
Sbjct  127  STFRIFGKKWTLRRGKHRLLLWPGREADGSIETTTPSKL  165



>gb|KIO18071.1| hypothetical protein M407DRAFT_226452 [Tulasnella calospora MUT 
4182]
Length=882

 Score =   112 bits (281),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 64/161 (40%), Positives = 87/161 (54%), Gaps = 2/161 (1%)
 Frame = +3

Query  186  SGNEFRFFLSCDINLPVTFRIERLE-gklpppklpgSDGVDTMMNAIDDRK-PELYVEST  359
            +  +F F    D+NLPVTFRI +LE  + P       +  D     +      +LYV   
Sbjct  9    NNKDFTFAKLSDLNLPVTFRISQLEGIRKPRSYADILENPDLRFAGVQSEGLSDLYVTCQ  68

Query  360  LYIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVI  539
            L  D  P  +  RT  ++   SY WNE IT   KY DL  NSQ+  TVWD++  ++   +
Sbjct  69   LIADNKPLTIQYRTGFKAFKNSYTWNEWITFPVKYCDLPLNSQITFTVWDIANPRTAVPV  128

Query  540  GGATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKV  662
            GG+T  LF  K  L+ GKH+L LW G+EADGS+ T TP K+
Sbjct  129  GGSTFKLFGKKWTLRRGKHRLLLWPGQEADGSMDTRTPSKI  169



>gb|KIK62587.1| hypothetical protein GYMLUDRAFT_42049 [Gymnopus luxurians FD-317 
M1]
Length=859

 Score =   112 bits (281),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 63/160 (39%), Positives = 88/160 (55%), Gaps = 2/160 (1%)
 Frame = +3

Query  192  NEFRFFLSCDINLPVTFRIERLEgklpppklpgS-DGVDTMMNAIDDRK-PELYVESTLY  365
            ++F F    D+ LPVTFRI +LEG   P       +  +   + +      +LYV   L 
Sbjct  7    DDFTFARLSDLKLPVTFRISQLEGVRKPRSFTEVLESPELKFHGVQSSTLSDLYVICQLV  66

Query  366  IDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIGG  545
             D  P  +P RT  ++   +Y WNE ITL  +Y DL  +SQ+  TVWD++  +S   +GG
Sbjct  67   ADNKPLTIPYRTSFKAFKNAYIWNEWITLPIRYCDLPLSSQITFTVWDIAGPRSAVPVGG  126

Query  546  ATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKVP  665
             T  LF  K  L+ GKH+L LW G E DGS+ +TTP K+P
Sbjct  127  TTFRLFGKKWTLRRGKHRLLLWPGIEGDGSVDSTTPSKIP  166



>ref|XP_003032302.1| hypothetical protein SCHCODRAFT_15876 [Schizophyllum commune 
H4-8]
 gb|EFI97399.1| hypothetical protein SCHCODRAFT_15876 [Schizophyllum commune 
H4-8]
Length=858

 Score =   112 bits (281),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 63/166 (38%), Positives = 90/166 (54%), Gaps = 2/166 (1%)
 Frame = +3

Query  174  MKTMSGNEFRFFLSCDINLPVTFRIERLE-gklpppklpgSDGVDTMMNAIDDRK-PELY  347
            M   + ++F F    D+NL VTFRI  LE  + P       +  D   + +  +   +LY
Sbjct  1    MDKEAKDDFTFAKLSDLNLHVTFRISNLEGIRRPHSLTEILENPDLRFHGVQSQTLSDLY  60

Query  348  VESTLYIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKS  527
            V   L  +  P  +P RT  ++   SY WNE ITL  +Y DL  N+Q+  TVWD++  ++
Sbjct  61   VTCQLVANNKPLTIPFRTSFKAFKNSYTWNEWITLPIRYCDLPLNAQITFTVWDIAGLRA  120

Query  528  EGVIGGATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKVP  665
               +GG T  LF  K  L+ GKH+L LW   EADGS+ +TTP K+P
Sbjct  121  AMPVGGTTFRLFGKKCTLRRGKHRLLLWPNIEADGSVESTTPSKLP  166



>ref|XP_007387736.1| atypical/PIKK/PI3K protein kinase [Punctularia strigosozonata 
HHB-11173 SS5]
 gb|EIN04813.1| atypical/PIKK/PI3K protein kinase [Punctularia strigosozonata 
HHB-11173 SS5]
Length=846

 Score =   112 bits (280),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 61/165 (37%), Positives = 89/165 (54%), Gaps = 2/165 (1%)
 Frame = +3

Query  174  MKTMSGNEFRFFLSCDINLPVTFRIERLE-gklpppklpgSDGVDTMMNAIDDRK-PELY  347
            M   + ++F F    D+   VTFRI +LE  +         +  D   + +      +LY
Sbjct  1    MDKDTRDDFSFAKLSDLKELVTFRISQLEGRRQQHSFTELLENPDLKFHGVQSSSLSDLY  60

Query  348  VESTLYIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKS  527
            V   L  D  P  +P RT  ++   SY WNE ITL  +Y DL  ++QL  T+WD++  ++
Sbjct  61   VTCQLVADNKPLTIPFRTSFKAFKQSYIWNEWITLPIRYCDLPLSAQLTFTIWDIAGPRA  120

Query  528  EGVIGGATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKV  662
               +GG+T  LF  K  L+ GKH+L LW GKEADGS+ +TTP K+
Sbjct  121  TAPVGGSTFRLFGKKWTLRRGKHRLLLWPGKEADGSVESTTPSKL  165



>gb|KIK92419.1| hypothetical protein PAXRUDRAFT_829978 [Paxillus rubicundulus 
Ve08.2h10]
Length=847

 Score =   112 bits (280),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 62/159 (39%), Positives = 85/159 (53%), Gaps = 2/159 (1%)
 Frame = +3

Query  192  NEFRFFLSCDINLPVTFRIERLEgk--lpppklpgSDGVDTMMNAIDDRKPELYVESTLY  365
            ++F F    D+ LPVTFRI +LEG            +       A      +LYV   L 
Sbjct  7    DDFTFAKLSDLKLPVTFRISQLEGTRPQKSVSEVLENPELRFHGAQSSTLSDLYVTCQLV  66

Query  366  IDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIGG  545
             D  P  +P RT  ++   +Y WNE +TL  +Y DL  NSQ+  TVWD+   +    +GG
Sbjct  67   ADNKPLTIPFRTSFKTFKTNYIWNEWVTLPIRYCDLPLNSQVTFTVWDIGGPRIAVPVGG  126

Query  546  ATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKV  662
            +T  LF  K  L+ GKH+L LW+G+EADGS+ T TP K+
Sbjct  127  STFRLFGKKWMLRRGKHRLLLWAGQEADGSMDTKTPSKL  165



>gb|KIL59571.1| hypothetical protein M378DRAFT_1000569 [Amanita muscaria Koide 
BX008]
Length=846

 Score =   111 bits (278),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 62/165 (38%), Positives = 88/165 (53%), Gaps = 14/165 (8%)
 Frame = +3

Query  192  NEFRFFLSCDINLPVTFRIERLE--------gklpppklpgSDGVDTMMNAIDDRKPELY  347
            ++F F    D+ LPVTFR+ +LE         +L         GV +   +      +LY
Sbjct  7    DDFTFAKLSDLKLPVTFRVSQLEGIRKPPTYTELLENPGLRHHGVQSSTLS------DLY  60

Query  348  VESTLYIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKS  527
            V   L  D  P  +P RT  ++   +Y WNE IT   +Y DL  +SQ+  TVWD++  ++
Sbjct  61   VTCQLVADNKPLTIPFRTSFKAFKSNYSWNEWITFPMQYCDLPLSSQITFTVWDIAGPRN  120

Query  528  EGVIGGATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKV  662
               +GG T  LF  K  L+ GKH+L LW G+EADGS+ T+TP KV
Sbjct  121  AVPVGGTTFRLFGKKMTLRRGKHRLLLWPGREADGSVETSTPSKV  165



>ref|XP_005852294.1| hypothetical protein CHLNCDRAFT_135070, partial [Chlorella variabilis]
 gb|EFN50586.1| hypothetical protein CHLNCDRAFT_135070 [Chlorella variabilis]
Length=370

 Score =   108 bits (270),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 62/158 (39%), Positives = 88/158 (56%), Gaps = 3/158 (2%)
 Frame = +3

Query  195  EFRFFLSCDINLPVTFRIERLEgklpppklpgSDGVDTMMNAIDDRKPELYVESTLYIDG  374
            EF F+ SCD+N+ V  R++RL G LP  +   + G     +    R   L VE  +   G
Sbjct  13   EFEFYASCDLNIQVQVRVDRLLGCLPAYREAAAGGEGD--SGCAPRPSALCVEGRVCSYG  70

Query  375  APFGLPMRTRLESRGPS-YCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIGGAT  551
             P G+P RT     GP+   W+  ++   KYRDL  ++QLALTVW+   G     +GG T
Sbjct  71   EPLGIPARTPWAEAGPAGASWDAWLSFPIKYRDLGHDAQLALTVWEAREGVPRRALGGTT  130

Query  552  IHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKVP  665
            + LF+ K +LK+G  +L+LW G+ AD    + TPGKVP
Sbjct  131  LRLFSKKGRLKSGVQELQLWLGRGADAGWPSATPGKVP  168



>gb|KDR78928.1| hypothetical protein GALMADRAFT_1365700 [Galerina marginata CBS 
339.88]
Length=848

 Score =   111 bits (278),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 62/159 (39%), Positives = 88/159 (55%), Gaps = 2/159 (1%)
 Frame = +3

Query  192  NEFRFFLSCDINLPVTFRIERLE-gklpppklpgSDGVDTMMNAIDDRK-PELYVESTLY  365
            ++F F    D+ LPVTFRI +LE  + P       +  +   + +      +LYV   L 
Sbjct  7    DDFTFAKLSDLKLPVTFRISQLEGVRKPRSFTELLEHPELRFHGVQSSTLSDLYVTCQLV  66

Query  366  IDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIGG  545
             D  P  +P RT  ++   +Y WNE ITL  +Y DL  +SQ+  TVWD+   ++   +GG
Sbjct  67   ADNKPLTIPFRTSFKAFKNAYTWNEWITLPIRYCDLPLSSQITFTVWDIGGPRAAIPVGG  126

Query  546  ATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKV  662
            +T  LF  K  L+ GKH+L LW G EADGS+ TTTP K+
Sbjct  127  STFRLFGKKWTLRRGKHRLLLWPGVEADGSVETTTPSKL  165



>gb|KIK40099.1| hypothetical protein CY34DRAFT_807526 [Suillus luteus UH-Slu-Lm8-n1]
Length=876

 Score =   110 bits (276),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 61/159 (38%), Positives = 86/159 (54%), Gaps = 2/159 (1%)
 Frame = +3

Query  192  NEFRFFLSCDINLPVTFRIERLEgk--lpppklpgSDGVDTMMNAIDDRKPELYVESTLY  365
            ++F F    D+ LPVTFRI +LEG    P       +       A      +LYV   L 
Sbjct  36   DDFTFAKLSDLKLPVTFRISQLEGSIPQPSVSELLENPELRFHGAQSSALSDLYVSCQLL  95

Query  366  IDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIGG  545
             D  P  +P RT  ++   +Y WNE ITL  +Y DL  +SQ+  TVWD+   ++   +G 
Sbjct  96   ADNKPLTIPFRTSFKAFKNNYTWNEWITLPIRYCDLPLSSQITFTVWDIGAPRTAVPVGS  155

Query  546  ATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKV  662
            +T  +F  K  L+ GKH+L LW+G+EADGS+ T TP K+
Sbjct  156  STFRMFGKKWTLRRGKHRLLLWAGQEADGSMQTKTPSKL  194



>gb|KIP11047.1| hypothetical protein PHLGIDRAFT_100348 [Phlebiopsis gigantea 
11061_1 CR5-6]
Length=846

 Score =   110 bits (276),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 62/165 (38%), Positives = 87/165 (53%), Gaps = 3/165 (2%)
 Frame = +3

Query  174  MKTMSGNEFRFFLSCDINLPVTFRIERLE-gklpppklpgSDGVDTMMNAIDDRKP--EL  344
            M   S ++F F    D+ LPVTFRI +LE  + P       +  +   + +       +L
Sbjct  1    MDKDSRDDFTFAKLSDLKLPVTFRISQLEGLRHPHAFTELLEKPELRFHGVQQSPALSDL  60

Query  345  YVESTLYIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGK  524
            YV   L  D  P  +P RT  ++    Y WNE IT   +Y DL   SQ+  TVWD++  +
Sbjct  61   YVTCQLVADNKPLTIPFRTSFKAFTKDYTWNEWITFPIRYCDLPLTSQITFTVWDIAGPR  120

Query  525  SEGVIGGATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGK  659
            +   +GG+T  LF  K  L+ GKH+L LW G+EADGS  T+TP K
Sbjct  121  AASPVGGSTFRLFGKKWSLRRGKHRLYLWPGREADGSNETSTPSK  165



>ref|XP_007393187.1| hypothetical protein PHACADRAFT_192977 [Phanerochaete carnosa 
HHB-10118-sp]
 gb|EKM57844.1| hypothetical protein PHACADRAFT_192977 [Phanerochaete carnosa 
HHB-10118-sp]
Length=848

 Score =   110 bits (275),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 61/166 (37%), Positives = 88/166 (53%), Gaps = 3/166 (2%)
 Frame = +3

Query  174  MKTMSGNEFRFFLSCDINLPVTFRIERLE-gklpppklpgSDGVDTMMNAIDDRKP--EL  344
            M   S ++F F    D+ LPVTFRI +LE  + P       +  +   + +       +L
Sbjct  3    MDKDSRDDFTFAKLSDLKLPVTFRISQLEGFRRPHAFTELLEKPELRFHGVQQSPALSDL  62

Query  345  YVESTLYIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGK  524
            YV   L  D  P  +P RT  ++    Y WNE IT   +Y DL  NSQ+  TVWD++  +
Sbjct  63   YVTCQLVADNKPLTIPFRTSFKAFTKDYTWNEWITFPIRYCDLPLNSQITFTVWDIAGPR  122

Query  525  SEGVIGGATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKV  662
            +   +GG+T  LF  K  L+ GKH+L LW G EADG+  ++TP K+
Sbjct  123  AAAPVGGSTFRLFGKKWSLRRGKHRLYLWPGHEADGANESSTPSKM  168



>gb|EMD33468.1| class 3 phosphatylinositol 3-kinase [Ceriporiopsis subvermispora 
B]
Length=848

 Score =   110 bits (275),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 64/160 (40%), Positives = 85/160 (53%), Gaps = 3/160 (2%)
 Frame = +3

Query  192  NEFRFFLSCDINLPVTFRIERLEgklpppklpgSDGVDTMMNAIDDRKPE---LYVESTL  362
            ++F F    D+ LPVTFRI +LEG   P           +      + PE   LYV   L
Sbjct  7    DDFTFAKLSDLKLPVTFRISQLEGTRKPHSFSEVLEKPELRFHGVQQSPEFSDLYVTCQL  66

Query  363  YIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIG  542
              D  P  +P RT  ++    Y WNE ITL  +Y DL  +SQ+  TVWD++  +S   +G
Sbjct  67   IADNKPLTIPFRTSFKAFKKDYTWNEWITLPIRYCDLPLDSQITFTVWDIAGPRSAIPVG  126

Query  543  GATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKV  662
            G T  LF  K  L+ GKH+L LW  +EADGS  T+TP K+
Sbjct  127  GTTFRLFGKKWTLRRGKHRLLLWPDREADGSNETSTPSKI  166



>gb|KJA19491.1| hypothetical protein HYPSUDRAFT_168207 [Hypholoma sublateritium 
FD-334 SS-4]
Length=865

 Score =   110 bits (275),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 62/159 (39%), Positives = 86/159 (54%), Gaps = 2/159 (1%)
 Frame = +3

Query  192  NEFRFFLSCDINLPVTFRIERLE-gklpppklpgSDGVDTMMNAIDDRK-PELYVESTLY  365
            ++F F    DI LPVTFRI +LE  + P       D  D   + +      +LYV   L 
Sbjct  7    DDFTFAKLSDIKLPVTFRISQLEGVRKPNTFTELLDNPDLRFHGVQSTTLSDLYVTCQLI  66

Query  366  IDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIGG  545
             D  P  +P RT  ++   SY WNE I    +Y DL  ++Q+  TVWD++  ++   +GG
Sbjct  67   ADNKPLTIPFRTSFKAFRNSYTWNEWIVFPIRYCDLPLSAQVTFTVWDIAGPRAAVPVGG  126

Query  546  ATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKV  662
            +T  LF  K  L+ GKH+L LW   EADGS+ TTTP K+
Sbjct  127  STFRLFGKKWTLRRGKHRLLLWPRVEADGSLETTTPSKL  165



>gb|KIM40591.1| hypothetical protein M413DRAFT_412586 [Hebeloma cylindrosporum 
h7]
Length=846

 Score =   110 bits (274),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 61/159 (38%), Positives = 87/159 (55%), Gaps = 2/159 (1%)
 Frame = +3

Query  192  NEFRFFLSCDINLPVTFRIERLE-gklpppklpgSDGVDTMMNAIDDRK-PELYVESTLY  365
            ++F F    D+ LPVTFRI +LE  + P       +  +   + +      +LYV   L 
Sbjct  7    DDFTFAKLSDLKLPVTFRISQLEGIRKPRSFTELLENPELRFHGVQSSTLSDLYVTCQLI  66

Query  366  IDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIGG  545
             D  P  +P RT  ++   +Y WNE ITL  +Y DL  +SQ+  TVWD+   +    +GG
Sbjct  67   ADNKPLTIPFRTSFKAFKNTYTWNEWITLPIRYCDLPLSSQITFTVWDIGGPREAIPVGG  126

Query  546  ATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKV  662
            +T  LF  K  L+ GKH+L LW G EADGS+ T+TP K+
Sbjct  127  STFRLFGKKWTLRRGKHRLLLWPGVEADGSVETSTPSKM  165



>ref|XP_008039358.1| atypical/PIKK/PI3K protein kinase [Trametes versicolor FP-101664 
SS1]
 gb|EIW57772.1| atypical/PIKK/PI3K protein kinase [Trametes versicolor FP-101664 
SS1]
Length=843

 Score =   109 bits (273),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 63/165 (38%), Positives = 84/165 (51%), Gaps = 13/165 (8%)
 Frame = +3

Query  192  NEFRFFLSCDINLPVTFRIERLE--------gklpppklpgSDGVDTMMNAIDDRKPELY  347
            ++F F    D+ +PVTFRI +LE         ++         GV    N  D     LY
Sbjct  7    DDFTFAKLSDLKMPVTFRISQLEGTRKPHPFTEVLEKPELRFHGVQQSPNFSD-----LY  61

Query  348  VESTLYIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKS  527
            V   L  D  P  +P RT  ++    Y WNE ITL  +Y DL  NSQ+  TVWD+S  +S
Sbjct  62   VTCQLVADNKPLTIPFRTSFKAFKKDYTWNEWITLPIRYCDLPLNSQITFTVWDISGPRS  121

Query  528  EGVIGGATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKV  662
               +GG T  LF  K  L+ GKH++ LW  +EADG+   TTP K+
Sbjct  122  AIPVGGTTFRLFGKKWTLRRGKHRMVLWPDREADGANEPTTPSKI  166



>emb|CDO77014.1| hypothetical protein BN946_scf184298.g41 [Trametes cinnabarina]
Length=841

 Score =   109 bits (273),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 64/171 (37%), Positives = 86/171 (50%), Gaps = 13/171 (8%)
 Frame = +3

Query  174  MKTMSGNEFRFFLSCDINLPVTFRIERLE--------gklpppklpgSDGVDTMMNAIDD  329
            M   S ++F F    D+ +PVT RI +LE         ++         GV    N  D 
Sbjct  1    MDKDSRDDFTFAKLSDLKMPVTLRISQLEGTRKPHPFTEVLEKPELRFHGVQQSPNLSD-  59

Query  330  RKPELYVESTLYIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWD  509
                LYV   L  D  P  +P RT  ++    Y WNE ITL  +Y DL  NSQ+  TVWD
Sbjct  60   ----LYVTCQLVADNKPLTIPFRTAFKAFKKEYTWNEWITLPIRYCDLPLNSQITFTVWD  115

Query  510  VSCGKSEGVIGGATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKV  662
            ++  +S   +GG T  LF  K  L+ GKH++ LW  +EADG+  TTTP K+
Sbjct  116  IAGPRSATPVGGTTFRLFGKKWTLRRGKHRMILWLDREADGANETTTPSKI  166



>gb|KIK10246.1| hypothetical protein K443DRAFT_212 [Laccaria amethystina LaAM-08-1]
Length=894

 Score =   109 bits (273),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 62/159 (39%), Positives = 83/159 (52%), Gaps = 2/159 (1%)
 Frame = +3

Query  192  NEFRFFLSCDINLPVTFRIERLE--gklpppklpgSDGVDTMMNAIDDRKPELYVESTLY  365
            ++F F    DI  PVTFRI +LE   +         D              +LYV   L 
Sbjct  37   DDFTFAKLSDIKHPVTFRISQLEGVRRPKSVTELLQDPELRFHGIQSPTLSDLYVTCQLI  96

Query  366  IDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIGG  545
             D  P  +P RT  +S   +Y WNE ITL  +Y DL  +SQ+  TVWD+   ++   +GG
Sbjct  97   ADNKPLTIPFRTSFKSFKNAYTWNEWITLPIRYCDLPLSSQITFTVWDIGGPRTAVPVGG  156

Query  546  ATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKV  662
            +T  LF  K  L+ GKH+L LW G EADGS+ +TTP K+
Sbjct  157  STFRLFGKKWTLRRGKHRLLLWPGLEADGSVESTTPSKM  195



>gb|KIJ66818.1| hypothetical protein HYDPIDRAFT_26239 [Hydnomerulius pinastri 
MD-312]
Length=847

 Score =   109 bits (272),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 60/159 (38%), Positives = 90/159 (57%), Gaps = 2/159 (1%)
 Frame = +3

Query  192  NEFRFFLSCDINLPVTFRIERLEgklpppklpgS-DGVDTMMNAIDDRK-PELYVESTLY  365
            ++F F    D+ LPVTFRI +LEG  P   +    +  +   + +      +LYV   L 
Sbjct  7    DDFTFAKLSDLKLPVTFRISQLEGTRPQKSVSEVLENPELRFHGVQSSTLSDLYVTCQLV  66

Query  366  IDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIGG  545
             D  P  +P RT  ++   ++ WNE ITL  +Y DL  +SQ+  TVWD+   ++   +GG
Sbjct  67   ADNKPLTIPFRTSFKAFKANHTWNEWITLPIRYCDLPLSSQITFTVWDIGGPRTAVPVGG  126

Query  546  ATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKV  662
            +T  LF  K  L+ GKH+L LW+G+EADGS+ + TP K+
Sbjct  127  STFRLFGKKWTLRRGKHRLLLWAGQEADGSMESKTPSKL  165



>ref|XP_001880950.1| predicted protein [Laccaria bicolor S238N-H82]
 gb|EDR08725.1| predicted protein [Laccaria bicolor S238N-H82]
Length=844

 Score =   109 bits (272),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 63/165 (38%), Positives = 87/165 (53%), Gaps = 14/165 (8%)
 Frame = +3

Query  192  NEFRFFLSCDINLPVTFRIERLEgklpppklpgSDGVDTMMNAIDDR--------KPELY  347
            ++F F    DI  PVTFRI +LE       +     V  ++   + R          +LY
Sbjct  7    DDFTFAKLSDIKHPVTFRISQLE------GVRRPKSVTELLQHPELRFHGIQSPTLSDLY  60

Query  348  VESTLYIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKS  527
            V   L  D  P  +P RT  +S   +Y WNE ITL  +Y DL  +SQ+  TVWD+   ++
Sbjct  61   VTCQLVADNKPLTIPFRTSFKSFKNAYTWNEWITLPIRYCDLPLSSQITFTVWDIGGPRT  120

Query  528  EGVIGGATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKV  662
               +GG+T  LF  K  L+ GKH+L LW G EADGS+ +TTP K+
Sbjct  121  AVPVGGSTFRLFGKKWTLRRGKHRLLLWPGLEADGSVESTTPSKM  165



>gb|KIM33617.1| hypothetical protein M408DRAFT_157762 [Serendipita vermifera 
MAFF 305830]
Length=846

 Score =   109 bits (272),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 66/172 (38%), Positives = 88/172 (51%), Gaps = 24/172 (14%)
 Frame = +3

Query  186  SGNEFRFFLSCDINLPVTFRIERLEgklpppklpgSDGVDTMMNAIDDRKPEL-------  344
            +G EF F    D+ +PVTFRI +LEGK  P          ++   +D  KPEL       
Sbjct  6    NGKEFYFAKLSDLKVPVTFRISQLEGKRKPL---------SLTELLD--KPELKFSGLQL  54

Query  345  ------YVESTLYIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVW  506
                  YV   L  D  P   P RT  ++    Y WNE +T    Y D+  +SQ+  TVW
Sbjct  55   PTLSDLYVTCQLVADNKPLTAPYRTSFKAFKNGYTWNEWVTFPINYCDVPLSSQITFTVW  114

Query  507  DVSCGKSEGVIGGATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKV  662
            D++  +S   +GG+T  LF  K  L+ GKH+L LW  +EADGS+ T TP KV
Sbjct  115  DIAGPRSATPVGGSTFRLFGKKMTLRRGKHRLLLWRDREADGSVETQTPSKV  166



>emb|CEG82209.1| hypothetical protein RMATCC62417_16317 [Rhizopus microsporus]
Length=222

 Score =   104 bits (259),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 56/156 (36%), Positives = 81/156 (52%), Gaps = 12/156 (8%)
 Frame = +3

Query  195  EFRFFLSCDINLPVTFRIERLEgklpppklpgSDGVDTMMNAIDDRKPELYVESTLYIDG  374
            +F + L+ D+ LPV+ RI  LE            G        D   P+LYV   L+ D 
Sbjct  2    DFSYCLTKDVQLPVSIRISTLE------------GRSDTWRIKDKPLPDLYVTVQLFGDN  49

Query  375  APFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIGGATI  554
             P  +P+RT  ++    + WNE +TL  KY DL A++Q A+TVW  +  +    +GG T+
Sbjct  50   KPLTVPVRTSYKAFKNHWSWNEWLTLPIKYCDLPASAQFAITVWKANGPRKVQPVGGTTV  109

Query  555  HLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKV  662
             +F     L+ GK KL LW  +EADG   T+TP K+
Sbjct  110  RVFGKHFTLRKGKQKLHLWPDREADGKQDTSTPSKI  145



>gb|EJU04865.1| atypical/PIKK/PI3K protein kinase [Dacryopinax sp. DJM-731 SS1]
Length=844

 Score =   108 bits (271),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 62/165 (38%), Positives = 90/165 (55%), Gaps = 2/165 (1%)
 Frame = +3

Query  174  MKTMSGNEFRFFLSCDINLPVTFRIERLE-gklpppklpgSDGVDTMMNAIDDRK-PELY  347
            M   +  +F F    D+ LPVTFRI +LE  + P P     +  +   + +   +  +LY
Sbjct  1    MDPNNSKDFTFAKLSDLKLPVTFRISQLEGTRKPRPFSELLEHPEYRFSGVQSSELSDLY  60

Query  348  VESTLYIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKS  527
            V   L+ D  P  +P RT  +S    Y WNE ITL  +Y DL  NSQL++TVWD+     
Sbjct  61   VTCQLFADNKPLTIPYRTSYKSFKKDYIWNEWITLPYRYCDLPLNSQLSVTVWDIEGPDR  120

Query  528  EGVIGGATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKV  662
               +GG+T  +F  K  L+ G+H+L LW  +EADG+  T+TP K+
Sbjct  121  PVPVGGSTFRMFGKKLTLRRGQHRLVLWRDREADGAHETSTPSKI  165



>gb|KIY42834.1| phosphatidylinositol 3-kinase [Fistulina hepatica ATCC 64428]
Length=846

 Score =   108 bits (270),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 62/164 (38%), Positives = 87/164 (53%), Gaps = 2/164 (1%)
 Frame = +3

Query  174  MKTMSGNEFRFFLSCDINLPVTFRIERLE--gklpppklpgSDGVDTMMNAIDDRKPELY  347
            M   S ++F F    D+ +PVTFRI +LE   K  P     ++       A      ++Y
Sbjct  1    MDKDSRDDFTFARLSDLAVPVTFRISQLEGIRKPRPLTEVLANPELRFHGAQLSTLSDIY  60

Query  348  VESTLYIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKS  527
            V   +  D  P  +P RT  +S   SY WN+ IT    YRDL  ++Q+  TVWD++  ++
Sbjct  61   VTCQIVADNKPLTIPFRTSFKSFKNSYTWNKWITFPICYRDLPLSAQITFTVWDIAGTRT  120

Query  528  EGVIGGATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGK  659
               +GG T  +F  K  L+ GKH+L LW G EADGS+ TTTP K
Sbjct  121  ASPVGGTTFRMFGKKCCLRRGKHRLFLWPGVEADGSVETTTPSK  164



>ref|XP_007362280.1| atypical/PIKK/PI3K protein kinase [Dichomitus squalens LYAD-421 
SS1]
 gb|EJF64484.1| atypical/PIKK/PI3K protein kinase [Dichomitus squalens LYAD-421 
SS1]
Length=845

 Score =   108 bits (269),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 60/160 (38%), Positives = 86/160 (54%), Gaps = 3/160 (2%)
 Frame = +3

Query  192  NEFRFFLSCDINLPVTFRIERLE-gklpppklpgSDGVDTMMNAIDDRK--PELYVESTL  362
            ++F F    D+ +PVTFR+ +LE  + P       +  +   + I       +LYV   L
Sbjct  7    DDFTFAKLSDLKMPVTFRVSQLEGVRKPHSFTEVLEKPELRFHGIQQAPDYSDLYVTCQL  66

Query  363  YIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIG  542
              D  P  +P RT  ++    Y WNE ITL  +Y DL  NSQ+  TVWD++  +S   +G
Sbjct  67   IADNKPLTIPFRTAFKAFRNGYTWNEWITLPIRYCDLPLNSQITFTVWDIAGPRSAVPVG  126

Query  543  GATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKV  662
            G T  LF  K  L+ GKH++ LW  +EADG+  TTTP K+
Sbjct  127  GTTFRLFGKKWTLRRGKHRMILWPDREADGANETTTPSKI  166



>ref|XP_007848328.1| atypical pikk pi3k protein kinase [Moniliophthora roreri MCA 
2997]
 gb|ESK92357.1| atypical pikk pi3k protein kinase [Moniliophthora roreri MCA 
2997]
Length=845

 Score =   108 bits (269),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 60/159 (38%), Positives = 87/159 (55%), Gaps = 2/159 (1%)
 Frame = +3

Query  192  NEFRFFLSCDINLPVTFRIERLE-gklpppklpgSDGVDTMMNAIDDRK-PELYVESTLY  365
            ++F F    D+ LPVTFRI +LE  + P       +  +   + +      +LYV   L 
Sbjct  7    DDFTFAKLTDLKLPVTFRISQLEGIRQPRSFTELLEHPELKFHGVQSPNLSDLYVTCQLV  66

Query  366  IDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIGG  545
             D  P  +P RT  ++   +Y WNE IT   +Y DL  ++Q+  TVWD++  ++   IGG
Sbjct  67   ADNKPLTIPFRTSFKAFKNAYFWNEWITFPIRYCDLPLSAQITFTVWDIAGPRAAIPIGG  126

Query  546  ATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKV  662
             T  LF  K  L+ GKH+L LW G EADGS+ +TTP K+
Sbjct  127  TTFRLFGKKWTLRRGKHRLLLWPGIEADGSVESTTPSKL  165



>ref|XP_009549484.1| hypothetical protein HETIRDRAFT_387555 [Heterobasidion irregulare 
TC 32-1]
 gb|ETW79232.1| hypothetical protein HETIRDRAFT_387555 [Heterobasidion irregulare 
TC 32-1]
Length=830

 Score =   108 bits (269),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 62/165 (38%), Positives = 88/165 (53%), Gaps = 2/165 (1%)
 Frame = +3

Query  174  MKTMSGNEFRFFLSCDINLPVTFRIERLE-gklpppklpgSDGVDTMMNAIDDRK-PELY  347
            M   + ++F F    D+ LPVTFRI +LE  + P       +  +     +      +LY
Sbjct  1    MNKENKDDFTFARLSDLKLPVTFRISQLEGIRHPKSFTEVIENPELRFRGVQSSSLSDLY  60

Query  348  VESTLYIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKS  527
            V   L  D  P  +P RT  ++   +Y WNE I+   +Y DL  +SQ+  TVWD S  ++
Sbjct  61   VTCQLVADNKPLTIPFRTSYKAFKNNYTWNEWISFPIRYCDLPLSSQITFTVWDTSGPRA  120

Query  528  EGVIGGATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKV  662
               +GG+T  LF  K  L+ GKH+L L  GKEADGSI +TTP K+
Sbjct  121  SEPVGGSTFRLFGKKWTLRRGKHRLLLCLGKEADGSIESTTPSKI  165



>ref|XP_007262933.1| phosphatidylinositol 3-kinase [Fomitiporia mediterranea MF3/22]
 gb|EJD06669.1| phosphatidylinositol 3-kinase [Fomitiporia mediterranea MF3/22]
Length=845

 Score =   108 bits (269),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 63/157 (40%), Positives = 81/157 (52%), Gaps = 2/157 (1%)
 Frame = +3

Query  195  EFRFFLSCDINLPVTFRIERLE-gklpppklpgSDGVDTMMNAIDDRK-PELYVESTLYI  368
            +F F  S  + LPVTFRI + E  + P P     D  D     +      +LYV   L  
Sbjct  7    DFTFAKSSSLKLPVTFRISQFEGNRQPRPFTDVIDNPDLQFAGVQSPTFSDLYVTCQLVA  66

Query  369  DGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIGGA  548
            D  P  +  RT  ++   SY WNE ITL  +Y DL  +SQ+  TVWD+   +S   +GG 
Sbjct  67   DNKPLTIAYRTAFKAFKNSYTWNEWITLPIRYCDLPLSSQITFTVWDIEGPRSAAPVGGT  126

Query  549  TIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGK  659
            T  LF  K  L+ GKH+L LW G EADGS+   TP K
Sbjct  127  TFRLFGKKGTLRRGKHRLFLWPGVEADGSVDAKTPSK  163



>ref|XP_007318645.1| putative atypical/PIKK/PI3K protein kinase [Serpula lacrymans 
var. lacrymans S7.9]
 gb|EGO24626.1| putative atypical/PIKK/PI3K protein kinase [Serpula lacrymans 
var. lacrymans S7.9]
Length=835

 Score =   107 bits (266),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 60/159 (38%), Positives = 89/159 (56%), Gaps = 2/159 (1%)
 Frame = +3

Query  192  NEFRFFLSCDINLPVTFRIERLE-gklpppklpgSDGVDTMMNAIDDRK-PELYVESTLY  365
            ++F F    D+ LPVTFRI  LE  + P P     +  +   + +      +LYV   L 
Sbjct  7    DDFTFAKLSDLKLPVTFRISSLEGTRRPRPISELLEKPELRFHGVQSSSLSDLYVTCQLV  66

Query  366  IDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIGG  545
             D  P  +P RT  ++   S+ WNE ITL  +Y DL  +SQ+  TVWD+   ++   +GG
Sbjct  67   ADNKPLTIPFRTSFKAFKTSFIWNEWITLPVRYCDLPLSSQVTFTVWDIGGPRAAVPVGG  126

Query  546  ATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKV  662
            +T  LF  K  L+ GKH+L LW+ +EADGS+ ++TP K+
Sbjct  127  STFRLFGKKWTLRRGKHRLLLWTDQEADGSMDSSTPSKL  165



>gb|EGN99051.1| hypothetical protein SERLA73DRAFT_54158 [Serpula lacrymans var. 
lacrymans S7.3]
Length=849

 Score =   107 bits (266),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 60/159 (38%), Positives = 89/159 (56%), Gaps = 2/159 (1%)
 Frame = +3

Query  192  NEFRFFLSCDINLPVTFRIERLE-gklpppklpgSDGVDTMMNAIDDRK-PELYVESTLY  365
            ++F F    D+ LPVTFRI  LE  + P P     +  +   + +      +LYV   L 
Sbjct  7    DDFTFAKLSDLKLPVTFRISSLEGTRRPRPISELLEKPELRFHGVQSSSLSDLYVTCQLV  66

Query  366  IDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIGG  545
             D  P  +P RT  ++   S+ WNE ITL  +Y DL  +SQ+  TVWD+   ++   +GG
Sbjct  67   ADNKPLTIPFRTSFKAFKTSFIWNEWITLPVRYCDLPLSSQVTFTVWDIGGPRAAVPVGG  126

Query  546  ATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKV  662
            +T  LF  K  L+ GKH+L LW+ +EADGS+ ++TP K+
Sbjct  127  STFRLFGKKWTLRRGKHRLLLWTDQEADGSMDSSTPSKL  165



>emb|CEL55526.1| phosphatidylinositol 3-kinase [Rhizoctonia solani AG-1 IB]
Length=764

 Score =   106 bits (265),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 62/167 (37%), Positives = 84/167 (50%), Gaps = 14/167 (8%)
 Frame = +3

Query  186  SGNEFRFFLSCDINLPVTFRIERLE--------gklpppklpgSDGVDTMMNAIDDRKPE  341
            +  +F F    D++  VT RI +LE         +L         GV    N + D    
Sbjct  4    AARDFSFAKLSDLDKSVTVRISQLEGTRTPRPFSELLERPELRFAGV--QQNTLSD----  57

Query  342  LYVESTLYIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCG  521
            L+V   +  D  P  +P RT  ++   SY WNE IT   KYRDL  N+QL  TVWD+   
Sbjct  58   LFVTCQIVADNKPLTVPHRTSFKAFKNSYTWNEWITFPLKYRDLPLNAQLTFTVWDIEGP  117

Query  522  KSEGVIGGATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKV  662
            ++   +GG T  +F  K  L+ GKH+L LW G+EADGS  + TP KV
Sbjct  118  RTSAPVGGTTFRMFGKKSTLRRGKHRLLLWVGQEADGSAESRTPSKV  164



>gb|KIM84797.1| hypothetical protein PILCRDRAFT_5847 [Piloderma croceum F 1598]
Length=845

 Score =   106 bits (265),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 60/165 (36%), Positives = 89/165 (54%), Gaps = 2/165 (1%)
 Frame = +3

Query  174  MKTMSGNEFRFFLSCDINLPVTFRIERLE-gklpppklpgSDGVDTMMNAIDDRK-PELY  347
            M   + ++F F    D+ L VTFRI +LE  + P       D  +     +      +LY
Sbjct  1    MDKDNKDDFTFAKLSDLKLLVTFRISQLEGTRHPRSLTELLDKPELRFQGVQSSTLSDLY  60

Query  348  VESTLYIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKS  527
            +   L  D  P  +P RT  ++   +Y WNE ITL  +Y DL  +SQ+  TVWD++  ++
Sbjct  61   ITCQLVADNKPLTIPFRTAFKAFKNNYTWNEWITLPMRYCDLPLSSQITFTVWDIAGPRA  120

Query  528  EGVIGGATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKV  662
               +GG+T  LF  K  L+ GKH+L LW G+EADGS+ + TP K+
Sbjct  121  AIPVGGSTFRLFGKKWTLRRGKHRLLLWPGQEADGSMESATPSKL  165



>gb|KIK28919.1| hypothetical protein PISMIDRAFT_90499 [Pisolithus microcarpus 
441]
Length=847

 Score =   106 bits (265),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 56/159 (35%), Positives = 84/159 (53%), Gaps = 2/159 (1%)
 Frame = +3

Query  192  NEFRFFLSCDINLPVTFRIERLE--gklpppklpgSDGVDTMMNAIDDRKPELYVESTLY  365
            ++F F    D+ LPVTFR+ +LE   +         +       A      +LYV   L 
Sbjct  7    DDFTFAKLSDLKLPVTFRVSQLEGTRQRKSVVEVLEEPELRYYGAQSSTLSDLYVTCQLV  66

Query  366  IDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIGG  545
             +  P  +P RT  ++   +Y WNE IT  T+Y DL  +SQ+  TVWD+   ++   +GG
Sbjct  67   AENKPLTIPFRTSFKAFKQNYIWNEWITFPTRYCDLPLSSQITFTVWDIGSPRTAIPVGG  126

Query  546  ATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKV  662
            +T  +F  K  L+ GKH+L LW  +EADGS+ + TP K+
Sbjct  127  STFRMFGKKGTLRRGKHRLLLWPDQEADGSMESKTPSKL  165



>gb|KIJ52635.1| hypothetical protein M422DRAFT_243420 [Sphaerobolus stellatus 
SS14]
Length=845

 Score =   106 bits (264),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 64/163 (39%), Positives = 83/163 (51%), Gaps = 14/163 (9%)
 Frame = +3

Query  195  EFRFFLSCDINLPVTFRIERLE--------gklpppklpgSDGVDTMMNAIDDRKPELYV  350
            +F F    D+ L VTFRI +LE         +L         GV +   +      +LYV
Sbjct  8    DFTFAKLSDLKLNVTFRISQLEGTRHPKPFTELLEHPELRFAGVQSPTLS------DLYV  61

Query  351  ESTLYIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSE  530
               L+ D  P  +P RT  ++   SY WNE ITL  KY DL  NSQ+  TVWD+   +  
Sbjct  62   TCQLFADNKPLTIPFRTSFKAFKNSYIWNEWITLPIKYCDLPLNSQITFTVWDIQGPRQA  121

Query  531  GVIGGATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGK  659
              +GG+T  LF  K  L+ GKH+L LW  +EADGS  T TP K
Sbjct  122  MPVGGSTFRLFGKKCTLRRGKHRLLLWRDQEADGSADTRTPSK  164



>gb|KIY68853.1| atypical PIKK PI3K protein kinase, partial [Cylindrobasidium 
torrendii FP15055 ss-10]
Length=845

 Score =   106 bits (264),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 60/161 (37%), Positives = 90/161 (56%), Gaps = 6/161 (4%)
 Frame = +3

Query  192  NEFRFFLSCDINLPVTFRIERLE-gklpppklpgSDGVDTMMNAIDDRKP---ELYVEST  359
            ++F F    ++ +PVTFRI +LE  + P       D  D   + +  ++P   +LYV   
Sbjct  7    DDFSFATLSNLKVPVTFRINQLEGLRRPYSLTELLDQPDLRFHGV--QQPTLSDLYVTCQ  64

Query  360  LYIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVI  539
            L  D  P  +P RT  ++   SY WNE ITL  +Y DL  N+Q+  TVWD++  ++   +
Sbjct  65   LVADNKPLTIPFRTSFKAFKSSYTWNEWITLPIRYCDLPMNAQITFTVWDIAGPRNAVPV  124

Query  540  GGATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKV  662
            GG+T  +F  K  L+ GKH+L L  G EADG+  T+TP K+
Sbjct  125  GGSTFRMFGKKWTLRRGKHRLLLSPGVEADGAAETSTPSKL  165



>gb|KEP52200.1| atypical/PIKK/PI3K kinase [Rhizoctonia solani 123E]
Length=846

 Score =   105 bits (263),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 60/167 (36%), Positives = 86/167 (51%), Gaps = 14/167 (8%)
 Frame = +3

Query  186  SGNEFRFFLSCDINLPVTFRIERLE--------gklpppklpgSDGVDTMMNAIDDRKPE  341
            +  +F F    D++  VT RI +LE         +L         GV    +A+ D    
Sbjct  4    TARDFSFAKLSDLDKAVTVRISQLEGTRTPRPFSELLERPELRFAGV--QQSALSD----  57

Query  342  LYVESTLYIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCG  521
            L+V   +  D  P  +P RT  ++   +Y WNE IT   KYRDL  N+Q+  TVWD+   
Sbjct  58   LFVTCQIVADNKPLTVPHRTSFKAFKNTYTWNEWITFPLKYRDLPLNAQITFTVWDIEGP  117

Query  522  KSEGVIGGATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKV  662
            ++   +GG T  +F  K  L+ GKH+L LW+G+EADGS  + TP KV
Sbjct  118  RTSAPVGGTTFRMFGKKSTLRRGKHRLLLWAGQEADGSTESRTPSKV  164



>gb|EUC54542.1| atypical/PIKK/PI3K kinase, partial [Rhizoctonia solani AG-3 Rhs1AP]
Length=846

 Score =   105 bits (262),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 60/167 (36%), Positives = 86/167 (51%), Gaps = 14/167 (8%)
 Frame = +3

Query  186  SGNEFRFFLSCDINLPVTFRIERLE--------gklpppklpgSDGVDTMMNAIDDRKPE  341
            +  +F F    D++  VT RI +LE         +L         GV    +A+ D    
Sbjct  4    TARDFSFAKLSDLDKAVTVRISQLEGTRTPRPFSELLERPELRFAGV--QQSALSD----  57

Query  342  LYVESTLYIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCG  521
            L+V   +  D  P  +P RT  ++   +Y WNE IT   KYRDL  N+Q+  TVWD+   
Sbjct  58   LFVTCQIVADNKPLTVPHRTSFKAFKNTYTWNEWITFPLKYRDLPLNAQITFTVWDIEGP  117

Query  522  KSEGVIGGATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKV  662
            ++   +GG T  +F  K  L+ GKH+L LW+G+EADGS  + TP KV
Sbjct  118  RTSAPVGGTTFRMFGKKSTLRRGKHRLLLWTGQEADGSTESRTPSKV  164



>ref|XP_007881950.1| hypothetical protein PFL1_06221 [Pseudozyma flocculosa PF-1]
 gb|EPQ26286.1| hypothetical protein PFL1_06221 [Pseudozyma flocculosa PF-1]
Length=986

 Score =   105 bits (261),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 65/162 (40%), Positives = 85/162 (52%), Gaps = 2/162 (1%)
 Frame = +3

Query  183  MSGNEFRFFLSCDINLPVTFRIERLEgklpppklpgSDGVDTMMNAIDDRK--PELYVES  356
            M  + + F    D+NL +TFRI  L+G LP              N    R   P+LYVE 
Sbjct  1    MDRDFYSFARITDLNLNLTFRISSLQGSLPRLSRLEQLHRPHARNWGVHRADYPDLYVEC  60

Query  357  TLYIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGV  536
             LY D  P  LP++T       ++ W+E ITL  K  DL  N+QLA TV+DV+   +  V
Sbjct  61   RLYSDNKPLSLPVKTAYRHFRNNHVWSEWITLPYKLSDLPLNAQLAFTVYDVAASATTRV  120

Query  537  IGGATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKV  662
            +GG T  LF+ K  LK  + +L LW G E DGS  T+TP KV
Sbjct  121  VGGTTFRLFSKKGTLKKAQQRLYLWQGAEGDGSAETSTPSKV  162



>gb|ESA02209.1| hypothetical protein GLOINDRAFT_6733 [Rhizophagus irregularis 
DAOM 181602]
 gb|EXX72175.1| phosphatidylinositol 3-kinase VPS34 [Rhizophagus irregularis 
DAOM 197198w]
Length=836

 Score =   105 bits (261),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 59/157 (38%), Positives = 80/157 (51%), Gaps = 2/157 (1%)
 Frame = +3

Query  198  FRFFLSCDINLPVTFRIERLE--gklpppklpgSDGVDTMMNAIDDRKPELYVESTLYID  371
            + F L+ D+N P+T RI  LE   +  P      D          +   +LYV   LY D
Sbjct  13   YSFCLTKDLNTPLTVRISVLEGIREKKPFTTLLDDPTLKFTGVQTNDFSDLYVTCQLYAD  72

Query  372  GAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIGGAT  551
              P  +P+RT  +S    + WNE +T+  K+ DL   +QL  TVWD+   +    +GG T
Sbjct  73   NKPLTIPIRTSYKSFKNHWLWNEWLTIPIKFCDLPITAQLVFTVWDIYGPRKAVPVGGTT  132

Query  552  IHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKV  662
              LF    +L+ GKHKL LW   EADG  HTTTP K+
Sbjct  133  FRLFGKHNKLRKGKHKLYLWPDVEADGRDHTTTPSKI  169



>gb|KIM64269.1| hypothetical protein SCLCIDRAFT_1213365 [Scleroderma citrinum 
Foug A]
Length=846

 Score =   105 bits (261),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 60/164 (37%), Positives = 89/164 (54%), Gaps = 12/164 (7%)
 Frame = +3

Query  192  NEFRFFLSCDINLPVTFRIERLEgklpppklpgSDGVDTMMN-------AIDDRKPELYV  350
            ++F F    ++ LPVTFR+ +LEG  P   +     ++ + N       A      +LYV
Sbjct  7    DDFTFAKLSELKLPVTFRVSQLEGTRPRKSV-----LEVLENPELRYHGAQSSTLSDLYV  61

Query  351  ESTLYIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSE  530
               L  D  P  +P RT  ++   SY WNE ITL  +Y DL  +SQ+  TVWD+   ++ 
Sbjct  62   TCQLVADNKPLTIPFRTSFKTFKNSYIWNEWITLPIQYCDLPLSSQITFTVWDIGNPRAA  121

Query  531  GVIGGATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKV  662
              +GG+T  +F  K  L+ GKH+L LW  +EADGS+ + TP K+
Sbjct  122  VPVGGSTFRMFGKKGTLRRGKHRLLLWLDQEADGSMESKTPSKL  165



>gb|ELU40724.1| atypical/PIKK/PI3K protein kinase [Rhizoctonia solani AG-1 IA]
Length=1039

 Score =   105 bits (261),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 47/108 (44%), Positives = 65/108 (60%), Gaps = 0/108 (0%)
 Frame = +3

Query  339  ELYVESTLYIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSC  518
            +L+V   +  D  P  +P RT  ++   SY WNE IT   KYRDL  ++QL  TVWD+  
Sbjct  264  DLFVTCQIVADNKPLTVPHRTSFKAFKNSYTWNEWITFPLKYRDLPLHAQLTFTVWDIEG  323

Query  519  GKSEGVIGGATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKV  662
             ++   +GG T  +F  K  L+ GKH+L LW+G+EADGS  + TP KV
Sbjct  324  PRTSAPVGGTTFRMFGKKSTLRRGKHRLLLWAGQEADGSAESRTPSKV  371



>gb|ELU04838.1| hypothetical protein CAPTEDRAFT_155274 [Capitella teleta]
Length=888

 Score =   104 bits (260),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 64/161 (40%), Positives = 85/161 (53%), Gaps = 6/161 (4%)
 Frame = +3

Query  192  NEFRFFLSCDINLPVTFRIERLEgklpp--pklpgSDGVDTMMNAIDDRKPELYVESTLY  365
            ++F +  SCD+   V  +I  LEG       K    D +     A  +   +LYV S +Y
Sbjct  5    DKFHYVYSCDLEANVQIKIGTLEGHRERPGYKELIDDPLLRFSGACQEGCSDLYVTSQVY  64

Query  366  IDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDV--SCGKSEGVI  539
             +G P  LP+RT  ++    + WNE ITL  K+ DL  +SQL LTVWD+   CG     +
Sbjct  65   AEGRPLALPIRTSYKAFTTRWNWNEWITLPVKFCDLPRSSQLVLTVWDIYGPCGVKP--V  122

Query  540  GGATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKV  662
            GG TI LF     L+ G H LR+W   E DGS+ TTTPGK 
Sbjct  123  GGTTISLFGKHGVLRQGMHDLRVWKDVEGDGSVVTTTPGKA  163



>ref|XP_007121301.1| PREDICTED: phosphatidylinositol 3-kinase catalytic subunit type 
3-like [Physeter catodon]
Length=190

 Score = 99.4 bits (246),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 53/159 (33%), Positives = 80/159 (50%), Gaps = 2/159 (1%)
 Frame = +3

Query  189  GNEFRFFLSCDINLPVTFRIERLE--gklpppklpgSDGVDTMMNAIDDRKPELYVESTL  362
              +F +  SCD+++ V  +I  LE   +    K    D +        +   +LYV   +
Sbjct  4    AEKFHYIYSCDLDINVQLKIGSLEGKREQKSYKAVLEDPMLKFSGLYQETCSDLYVTCQV  63

Query  363  YIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIG  542
            + +G P  LP+RT  ++    + WNE + L  KY DL  N+Q+ALT+WDV        +G
Sbjct  64   FAEGKPLALPVRTSYKAFSTRWNWNEWLKLPVKYPDLPRNAQVALTIWDVYGPGKAVPVG  123

Query  543  GATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGK  659
            G T+ LF      + G H L++W   EADGS  T TPG+
Sbjct  124  GTTVSLFGKYGMFRQGMHDLKVWPNVEADGSEPTKTPGR  162



>ref|XP_004319034.1| PREDICTED: phosphatidylinositol 3-kinase catalytic subunit type 
3-like [Tursiops truncatus]
Length=190

 Score = 99.0 bits (245),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 53/159 (33%), Positives = 80/159 (50%), Gaps = 2/159 (1%)
 Frame = +3

Query  189  GNEFRFFLSCDINLPVTFRIERLE--gklpppklpgSDGVDTMMNAIDDRKPELYVESTL  362
              +F +  SCD+++ V  +I  LE   +    K    D +        +   +LYV   +
Sbjct  4    AEKFHYIYSCDLDINVQLKIGSLEGKREQKSYKAVLEDPMLKFSGLYQETCSDLYVTCQV  63

Query  363  YIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIG  542
            + +G P  LP+RT  ++    + WNE + L  KY DL  N+Q+ALT+WDV        +G
Sbjct  64   FAEGKPLALPVRTSYKAFSTRWNWNEWLKLPVKYPDLPRNAQVALTIWDVYGPGKAVPVG  123

Query  543  GATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGK  659
            G T+ LF      + G H L++W   EADGS  T TPG+
Sbjct  124  GTTVSLFGKYGMFRQGMHDLKVWPNVEADGSEPTKTPGR  162



>ref|XP_008509161.1| PREDICTED: phosphatidylinositol 3-kinase catalytic subunit type 
3-like [Equus przewalskii]
Length=190

 Score = 99.0 bits (245),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 53/159 (33%), Positives = 80/159 (50%), Gaps = 2/159 (1%)
 Frame = +3

Query  189  GNEFRFFLSCDINLPVTFRIERLE--gklpppklpgSDGVDTMMNAIDDRKPELYVESTL  362
              +F +  SCD+++ V  +I  LE   +    K    D +        +   +LYV   +
Sbjct  4    AEKFHYIYSCDLDINVQLKIGSLEGKREQKSYKAVLEDPMLKFSGLYQETCSDLYVTCQV  63

Query  363  YIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIG  542
            + +G P  LP+RT  ++    + WNE + L  KY DL  N+Q+ALT+WDV        +G
Sbjct  64   FAEGKPLALPVRTSYKAFSTRWNWNEWLKLPVKYPDLPRNAQVALTIWDVYGPGKAVPVG  123

Query  543  GATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGK  659
            G T+ LF      + G H L++W   EADGS  T TPG+
Sbjct  124  GTTVSLFGKYGMFRQGMHDLKVWPNVEADGSEPTKTPGR  162



>gb|KDN44187.1| hypothetical protein RSAG8_05660, partial [Rhizoctonia solani 
AG-8 WAC10335]
Length=1035

 Score =   104 bits (259),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 45/108 (42%), Positives = 64/108 (59%), Gaps = 0/108 (0%)
 Frame = +3

Query  339  ELYVESTLYIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSC  518
            +L+V   +  D  P  +P RT  ++   +Y WNE IT   KYRDL  N+Q+  T WD+  
Sbjct  31   DLFVTCQIVADNKPLTIPHRTSFKAFKNTYTWNEWITFPIKYRDLPLNAQITFTAWDIEG  90

Query  519  GKSEGVIGGATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKV  662
             ++   +GG T  +F  K  L+ GKH+L LW+G+EADGS  + TP KV
Sbjct  91   PRTSAPVGGTTFRMFGKKSTLRRGKHRLLLWAGQEADGSTESRTPSKV  138



>dbj|GAK62210.1| phosphatidylinositol 3-kinase [Pseudozyma antarctica]
Length=2400

 Score =   104 bits (259),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 62/167 (37%), Positives = 87/167 (52%), Gaps = 2/167 (1%)
 Frame = +3

Query  168   IVMKTMSGNEFRFFLSCDINLPVTFRIERLEgk--lpppklpgSDGVDTMMNAIDDRKPE  341
             ++  TM  + + F    D+NL VTFRI  L+GK                   A     P+
Sbjct  1427  LISSTMDRDFYSFVRLSDLNLNVTFRISSLQGKLDRISRTQLLRQPEARQWGAQQSDYPD  1486

Query  342   LYVESTLYIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCG  521
             L VE  L+ D  P  +P++T       ++ WNE ITL  K  DL   +QLA T++DV+  
Sbjct  1487  LLVECCLFSDNKPLSVPVKTAYRPFRNNHQWNEWITLPYKLCDLPLGAQLAFTIYDVASS  1546

Query  522   KSEGVIGGATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKV  662
             ++  VIGG T  LF+ K  LK+ +H+L +W G  ADGS+ T TP KV
Sbjct  1547  RAARVIGGTTFPLFSKKGTLKSAQHRLFVWKGAGADGSVETATPSKV  1593



>emb|CDH58858.1| atypical pikk pi3k protein kinase [Lichtheimia corymbifera JMRC:FSU:9682]
Length=847

 Score =   103 bits (257),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 57/156 (37%), Positives = 85/156 (54%), Gaps = 3/156 (2%)
 Frame = +3

Query  195  EFRFFLSCDINLPVTFRIERLEgklpppklpgSDGVDTMMNAIDDRKPELYVESTLYIDG  374
            +F + L+ DI LPV+ RI  LEG     +   +D    +    D+   + YV   L+ D 
Sbjct  2    DFSYCLTKDIELPVSIRIASLEGTRDRRQWIKNDSRPHIH---DEEHTDFYVTVQLFGDN  58

Query  375  APFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIGGATI  554
             P  +P+RT  ++      WNE +TL  KY +L  ++Q A+TVWD +  +    +GG T+
Sbjct  59   KPLTVPVRTCYKAFKSHCSWNEWLTLPIKYCELPPSAQCAITVWDTTGPRQAIPVGGTTL  118

Query  555  HLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKV  662
             LF     L+ GKHKL LW G E+DG +++ TP KV
Sbjct  119  QLFGKYYTLRKGKHKLHLWPGVESDGRVNSKTPSKV  154



>emb|CEG70098.1| hypothetical protein RMATCC62417_06049 [Rhizopus microsporus]
Length=827

 Score =   103 bits (256),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 56/156 (36%), Positives = 81/156 (52%), Gaps = 12/156 (8%)
 Frame = +3

Query  195  EFRFFLSCDINLPVTFRIERLEgklpppklpgSDGVDTMMNAIDDRKPELYVESTLYIDG  374
            +F + L+ D+ LPV+ RI  LE            G        D   P+LYV   L+ D 
Sbjct  2    DFSYCLTKDVQLPVSIRISTLE------------GQSGSWRIKDKPLPDLYVTVQLFGDN  49

Query  375  APFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIGGATI  554
             P  +P+RT  ++    + WNE +TL  KY DL A++Q A+TVW  +  +    +GG T+
Sbjct  50   KPLTVPVRTSYKAFKNHWSWNEWLTLPIKYCDLPASAQFAITVWKANGPRKVQPVGGTTV  109

Query  555  HLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKV  662
             +F     L+ GK KL LW  +EADG   T+TP K+
Sbjct  110  RVFGKHFTLRKGKQKLHLWPDREADGKQDTSTPSKI  145



>emb|CEJ04469.1| hypothetical protein RMCBS344292_18430 [Rhizopus microsporus]
Length=821

 Score =   103 bits (256),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 56/156 (36%), Positives = 81/156 (52%), Gaps = 12/156 (8%)
 Frame = +3

Query  195  EFRFFLSCDINLPVTFRIERLEgklpppklpgSDGVDTMMNAIDDRKPELYVESTLYIDG  374
            +F + L+ D+ LPV+ RI  LE            G        D   P+LYV   L+ D 
Sbjct  2    DFSYCLTKDVQLPVSIRISTLE------------GQSGSWRIKDKPLPDLYVTVQLFGDN  49

Query  375  APFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIGGATI  554
             P  +P+RT  ++    + WNE +TL  KY DL A++Q A+TVW  +  +    +GG T+
Sbjct  50   KPLTVPVRTSYKAFKNHWSWNEWLTLPIKYCDLPASAQFAITVWKANGPRKVQPVGGTTV  109

Query  555  HLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKV  662
             +F     L+ GK KL LW  +EADG   T+TP K+
Sbjct  110  RVFGKHFTLRKGKQKLHLWPDREADGKQDTSTPSKI  145



>ref|XP_005646177.1| phosphatidylinositol 3-kinase [Coccomyxa subellipsoidea C-169]
 gb|EIE21633.1| phosphatidylinositol 3-kinase [Coccomyxa subellipsoidea C-169]
Length=822

 Score =   102 bits (255),  Expect = 5e-21, Method: Composition-based stats.
 Identities = 58/167 (35%), Positives = 89/167 (53%), Gaps = 1/167 (1%)
 Frame = +3

Query  168  IVMKTMSGNEFRFFLSCDINLPVTFRIERLEgklpppklpgSDGVDTMMNAIDDRKPELY  347
            +V     G  F F+LSCDI+  V  R++ L G+L               +  +   P  Y
Sbjct  1    MVQDRAKGEAFVFYLSCDISSQVHVRVDHLVGQLRDKGKHNIGQGGGGGSLDEGVAPAFY  60

Query  348  VESTLYIDGAPFGLPMRTRL-ESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGK  524
            V   L   G   GLP R  + ++R     W  +++   KY DL  ++QLALTVW +  G+
Sbjct  61   VVGQLCAFGEVLGLPARAPIAQARSDGCSWGSILSFPLKYCDLAQDAQLALTVWQIQEGQ  120

Query  525  SEGVIGGATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKVP  665
             +  +GGAT+ LF+ K +LK+G+ +L LW+G+EAD +  + TP K+P
Sbjct  121  PQTPLGGATLRLFSKKGRLKSGQQELCLWAGREADMAWPSATPAKLP  167



>gb|KIO15059.1| hypothetical protein M404DRAFT_198741 [Pisolithus tinctorius 
Marx 270]
Length=847

 Score =   102 bits (254),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 54/159 (34%), Positives = 83/159 (52%), Gaps = 2/159 (1%)
 Frame = +3

Query  192  NEFRFFLSCDINLPVTFRIERLE--gklpppklpgSDGVDTMMNAIDDRKPELYVESTLY  365
            ++F F    D+ LPVTFR+ +LE   +         +       A      +LYV   L 
Sbjct  7    DDFTFAKLSDLKLPVTFRVSQLEGTRQRKSVLEVLEEPELRHYGAQSSTLSDLYVTCQLV  66

Query  366  IDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIGG  545
             +  P  +P RT  ++   ++ WNE IT   +Y DL  +SQ+  TVWD+   ++   +GG
Sbjct  67   AENKPLTIPFRTSFKAFKHNHTWNEWITFPIRYCDLPLSSQITFTVWDIGSPRTAVPVGG  126

Query  546  ATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKV  662
            +T  +F  K  L+ GKH+L LW  +EADGS+ + TP K+
Sbjct  127  STFRMFGKKGTLRRGKHRLLLWPDQEADGSMESKTPSKL  165



>ref|XP_008580698.1| PREDICTED: phosphatidylinositol 3-kinase catalytic subunit type 
3-like, partial [Galeopterus variegatus]
Length=246

 Score = 98.2 bits (243),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 54/158 (34%), Positives = 80/158 (51%), Gaps = 2/158 (1%)
 Frame = +3

Query  192  NEFRFFLSCDINLPVTFRIERLEgklpppklpg--SDGVDTMMNAIDDRKPELYVESTLY  365
             +F +  SCD+++ V  +I  LEGK           D +        +   +LYV   ++
Sbjct  74   EKFYYIYSCDLDINVQLKIGSLEGKREQKSYKAVLEDPMLKFSGLYQETCSDLYVTCQVF  133

Query  366  IDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIGG  545
             +G P  LP+RT  ++    + WNE + L  KY DL  N+Q+ALT+WDV        +GG
Sbjct  134  AEGKPLALPVRTSYKAFSTRWNWNEWLKLPVKYPDLPRNAQVALTIWDVYGPGKAVPVGG  193

Query  546  ATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGK  659
             T+ LF      + G H L++W   EADGS  T TPG+
Sbjct  194  TTVSLFGKYGMFRQGMHDLKVWPNVEADGSEPTKTPGR  231



>ref|XP_003376635.1| phosphatidylinositol 3-kinase catalytic subunit type 3 [Trichinella 
spiralis]
 gb|EFV58120.1| phosphatidylinositol 3-kinase catalytic subunit type 3 [Trichinella 
spiralis]
Length=1486

 Score =   102 bits (253),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 58/165 (35%), Positives = 89/165 (54%), Gaps = 5/165 (3%)
 Frame = +3

Query  180  TMSGNEFRFFLSCDINLPVTFRIERLE----gklpppklpgSDGVDTMMNAIDDRKPELY  347
            TM+ +   +  SCD++ PV F+I  LE           L   + VD +    ++ +P +Y
Sbjct  559  TMTNDRVNYVYSCDVHKPVKFKIGCLEGLLPRFSLNDILRDPNAVDCLA-LQEECQPNIY  617

Query  348  VESTLYIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKS  527
            VE  LY  G P GLP+ T  +     YCW+E ITL  KY +L+ ++QLA T+ DV     
Sbjct  618  VECQLYCLGRPVGLPIVTSSKYFTTFYCWDEWITLPIKYSELSRDAQLAFTIVDVHSNMK  677

Query  528  EGVIGGATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKV  662
              VIGG +I LF+ +  L+  ++ L++W  +  DG+    TPGK+
Sbjct  678  RHVIGGTSITLFSKRGILRCRQYDLKVWPFQSGDGTPANRTPGKM  722



>ref|XP_008299910.1| PREDICTED: phosphatidylinositol 3-kinase catalytic subunit type 
3-like, partial [Stegastes partitus]
Length=398

 Score = 98.6 bits (244),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 53/161 (33%), Positives = 82/161 (51%), Gaps = 2/161 (1%)
 Frame = +3

Query  183  MSGNEFRFFLSCDINLPVTFRIERLE--gklpppklpgSDGVDTMMNAIDDRKPELYVES  356
            M  ++F +  SCD+++ V  +I  LE   +    K    D +        +   +LYV  
Sbjct  1    MDTDKFNYVYSCDLDINVQLKIGSLEGKREQKSYKALLEDPMLRFSGLYQENCSDLYVTC  60

Query  357  TLYIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGV  536
             ++ +G P  LP+RT  ++    + WNE + L  KY DL  ++Q+ALTVWD+        
Sbjct  61   QVFAEGKPLALPVRTSYKAFSTRWNWNEWLRLPVKYPDLPQSAQVALTVWDIYGPGRAVP  120

Query  537  IGGATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGK  659
            +GG T+ LF      + G H L++W G E DG   TTTPG+
Sbjct  121  VGGTTVTLFGKYGMFRQGMHDLKVWPGVEGDGGEPTTTPGR  161



>gb|EDK97023.1| phosphoinositide-3-kinase, class 3, isoform CRA_c [Mus musculus]
Length=521

 Score = 99.8 bits (247),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 54/159 (34%), Positives = 81/159 (51%), Gaps = 2/159 (1%)
 Frame = +3

Query  189  GNEFRFFLSCDINLPVTFRIERLE--gklpppklpgSDGVDTMMNAIDDRKPELYVESTL  362
              +F +  SCD+++ V  +I  LE   +    K    D +        +   +LYV   +
Sbjct  12   AEKFHYIYSCDLDINVQLKIGSLEGKREQKSYKAVLEDPMLKFSGLYQETCSDLYVTCQV  71

Query  363  YIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIG  542
            + +G P  LP+RT  ++    + WNE + L  KY DL  N+Q+ALT+WDV    S   +G
Sbjct  72   FAEGKPLALPVRTSYKAFSTRWNWNEWLKLPVKYPDLPRNAQVALTIWDVYGPGSAVPVG  131

Query  543  GATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGK  659
            G T+ LF      + G H L++W   EADGS  T TPG+
Sbjct  132  GTTVSLFGKYGMFRQGMHDLKVWPNVEADGSEPTRTPGR  170



>ref|XP_008321701.1| PREDICTED: phosphatidylinositol 3-kinase catalytic subunit type 
3 isoform X1 [Cynoglossus semilaevis]
Length=875

 Score =   100 bits (249),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 54/161 (34%), Positives = 83/161 (52%), Gaps = 2/161 (1%)
 Frame = +3

Query  183  MSGNEFRFFLSCDINLPVTFRIERLE--gklpppklpgSDGVDTMMNAIDDRKPELYVES  356
            M  ++F +  SCD+++ V  +I  LE   +    K    D +        +   +LYV  
Sbjct  1    MDTDKFNYVYSCDLDINVQLKIGSLEGKREQKSYKALLEDPMLRFSGLYQENCSDLYVTC  60

Query  357  TLYIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGV  536
             ++ DG P  LP+RT  ++    + WNE + L  KY DL  ++Q+ALTVWD+    +   
Sbjct  61   QVFADGKPLALPVRTSYKAFSTRWNWNEWLRLPVKYPDLPQSAQVALTVWDIYGPGTAVP  120

Query  537  IGGATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGK  659
            +GG T+ LF      + G H L++W G E DG   TTTPG+
Sbjct  121  VGGTTVSLFGKYGMFRQGMHDLKVWPGVEGDGGDPTTTPGR  161



>ref|XP_008321707.1| PREDICTED: phosphatidylinositol 3-kinase catalytic subunit type 
3 isoform X2 [Cynoglossus semilaevis]
Length=874

 Score =   100 bits (249),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 54/161 (34%), Positives = 83/161 (52%), Gaps = 2/161 (1%)
 Frame = +3

Query  183  MSGNEFRFFLSCDINLPVTFRIERLE--gklpppklpgSDGVDTMMNAIDDRKPELYVES  356
            M  ++F +  SCD+++ V  +I  LE   +    K    D +        +   +LYV  
Sbjct  1    MDTDKFNYVYSCDLDINVQLKIGSLEGKREQKSYKALLEDPMLRFSGLYQENCSDLYVTC  60

Query  357  TLYIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGV  536
             ++ DG P  LP+RT  ++    + WNE + L  KY DL  ++Q+ALTVWD+    +   
Sbjct  61   QVFADGKPLALPVRTSYKAFSTRWNWNEWLRLPVKYPDLPQSAQVALTVWDIYGPGTAVP  120

Query  537  IGGATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGK  659
            +GG T+ LF      + G H L++W G E DG   TTTPG+
Sbjct  121  VGGTTVSLFGKYGMFRQGMHDLKVWPGVEGDGGDPTTTPGR  161



>emb|CDI51380.1| related to phosphatidylinositol 3-kinase [Melanopsichium pennsylvanicum 
4]
Length=972

 Score =   100 bits (250),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 60/162 (37%), Positives = 89/162 (55%), Gaps = 2/162 (1%)
 Frame = +3

Query  183  MSGNEFRFFLSCDINLPVTFRIERLEgklpppk--lpgSDGVDTMMNAIDDRKPELYVES  356
            M  + + F    D+NL +TFRI  L+GKL                  A + + P+L VE 
Sbjct  1    MDRDFYSFVRLSDLNLNLTFRISFLQGKLDRLACTKLLEHPESRHWGAQESQYPDLVVEC  60

Query  357  TLYIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGV  536
             L+ +  P  +P++T  +S   ++ WNE ITL  K  DL   +QL  T++DV+   +  +
Sbjct  61   RLFSENKPLSMPVKTAYKSFRNNHQWNEWITLPYKLCDLPLGAQLTFTIYDVASSTTSRI  120

Query  537  IGGATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKV  662
            IGG T+ LF+ K  LK+ +H+L LW G +ADGS+ T TP KV
Sbjct  121  IGGTTLSLFSKKGTLKSAQHRLFLWKGVKADGSVETATPSKV  162



>emb|CAN72914.1| hypothetical protein VITISV_034007 [Vitis vinifera]
Length=1586

 Score =   100 bits (250),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 61/73 (84%), Positives = 65/73 (89%), Gaps = 0/73 (0%)
 Frame = +3

Query  501  VWDVSCGKSEGVIGGATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKVPkeerg  680
            VWDVSCGK EG+IGGATI LF+ KKQLKTGK KLRLW GKEADGS  TTTPGKVP+ ERG
Sbjct  738  VWDVSCGKDEGLIGGATILLFSSKKQLKTGKQKLRLWPGKEADGSFPTTTPGKVPRHERG  797

Query  681  elerleklVNKYE  719
            ELERLEKL+NKYE
Sbjct  798  ELERLEKLMNKYE  810



>gb|KDQ06726.1| hypothetical protein BOTBODRAFT_167791 [Botryobasidium botryosum 
FD-172 SS1]
Length=849

 Score =   100 bits (249),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 47/108 (44%), Positives = 65/108 (60%), Gaps = 0/108 (0%)
 Frame = +3

Query  339  ELYVESTLYIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSC  518
            +LYV   +  D  P  +P RT  ++   +Y WNE IT   KY DL  NSQ+  TVWD++ 
Sbjct  60   DLYVTCQILADNKPLTIPYRTCFKAFKNNYTWNEWITFPIKYCDLPLNSQITFTVWDIAG  119

Query  519  GKSEGVIGGATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKV  662
             +S   +GG+T  +F  K  L+ GKH+L LW  +EADGS+ + TP KV
Sbjct  120  PRSAVPVGGSTFKMFGKKWTLRRGKHRLLLWPEQEADGSVESRTPSKV  167



>ref|XP_011359594.1| PREDICTED: phosphatidylinositol 3-kinase catalytic subunit type 
3 isoform X3 [Pteropus vampyrus]
Length=784

 Score = 99.8 bits (247),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 54/159 (34%), Positives = 80/159 (50%), Gaps = 2/159 (1%)
 Frame = +3

Query  189  GNEFRFFLSCDINLPVTFRIERLE--gklpppklpgSDGVDTMMNAIDDRKPELYVESTL  362
              +F +  SCD+++ V  +I  LE   +    K    D +        D   +LYV   +
Sbjct  4    AEKFHYIYSCDLDINVQLKIGSLEGKREQKSYKAVLEDPMLKFSGLYQDTCSDLYVTCQV  63

Query  363  YIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIG  542
            + +G P  LP+RT  ++    + WNE + L  KY DL  N+Q+ALT+WDV        +G
Sbjct  64   FAEGKPLALPVRTSYKAFSTRWNWNEWLKLPVKYPDLPRNAQVALTIWDVYGPGKAVPVG  123

Query  543  GATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGK  659
            G T+ LF      + G H L++W   EADGS  T TPG+
Sbjct  124  GTTVSLFGKYGMFRQGMHDLKVWPNVEADGSEPTKTPGR  162



>gb|ELW69376.1| Phosphatidylinositol 3-kinase catalytic subunit type 3 [Tupaia 
chinensis]
Length=782

 Score = 99.8 bits (247),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 54/159 (34%), Positives = 80/159 (50%), Gaps = 2/159 (1%)
 Frame = +3

Query  189  GNEFRFFLSCDINLPVTFRIERLE--gklpppklpgSDGVDTMMNAIDDRKPELYVESTL  362
              +F +  SCD+++ V  +I  LE   +    K    D +        D   +LYV   +
Sbjct  4    AEKFHYIYSCDLDINVQLKIGSLEGKREQKSYKAVLEDPMLKFSGLYQDTCSDLYVTCQV  63

Query  363  YIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIG  542
            + +G P  LP+RT  ++    + WNE + L  KY DL  N+Q+ALT+WDV        +G
Sbjct  64   FAEGKPLALPVRTSYKAFSTRWNWNEWLKLPVKYPDLPRNAQVALTIWDVYGPGKAVPVG  123

Query  543  GATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGK  659
            G T+ LF      + G H L++W   EADGS  T TPG+
Sbjct  124  GTTVSLFGKYGMFRQGMHDLKVWPNVEADGSEPTKTPGR  162



>ref|XP_004579747.1| PREDICTED: phosphatidylinositol 3-kinase catalytic subunit type 
3 [Ochotona princeps]
Length=927

 Score =   100 bits (248),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 55/159 (35%), Positives = 80/159 (50%), Gaps = 2/159 (1%)
 Frame = +3

Query  189  GNEFRFFLSCDINLPVTFRIERLE--gklpppklpgSDGVDTMMNAIDDRKPELYVESTL  362
              +F +  SCD+++ V  +I  LE   +    K    D +        D   +LYV   +
Sbjct  4    AEKFHYIYSCDLDINVQLKIGSLEGKREQKSYKAVLEDPMLKFSGLYQDTCSDLYVTCQV  63

Query  363  YIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIG  542
            + +G P  LP+RT  ++    + WNE + L  KY DL  N+Q+ALTVWDV        +G
Sbjct  64   FAEGKPLALPVRTSYKAFSTRWNWNEWLRLPVKYPDLPRNAQVALTVWDVYGPGKAVPVG  123

Query  543  GATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGK  659
            G T+ LF      + G H L++W   EADGS  T TPG+
Sbjct  124  GTTVSLFGKYGMFRQGMHDLKVWPNVEADGSEPTKTPGR  162



>ref|XP_006144458.1| PREDICTED: phosphatidylinositol 3-kinase catalytic subunit type 
3-like isoform X2 [Tupaia chinensis]
Length=887

 Score = 99.8 bits (247),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 54/159 (34%), Positives = 80/159 (50%), Gaps = 2/159 (1%)
 Frame = +3

Query  189  GNEFRFFLSCDINLPVTFRIERLE--gklpppklpgSDGVDTMMNAIDDRKPELYVESTL  362
              +F +  SCD+++ V  +I  LE   +    K    D +        D   +LYV   +
Sbjct  4    AEKFHYIYSCDLDINVQLKIGSLEGKREQKSYKAVLEDPMLKFSGLYQDTCSDLYVTCQV  63

Query  363  YIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIG  542
            + +G P  LP+RT  ++    + WNE + L  KY DL  N+Q+ALT+WDV        +G
Sbjct  64   FAEGKPLALPVRTSYKAFSTRWNWNEWLKLPVKYPDLPRNAQVALTIWDVYGPGKAVPVG  123

Query  543  GATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGK  659
            G T+ LF      + G H L++W   EADGS  T TPG+
Sbjct  124  GTTVSLFGKYGMFRQGMHDLKVWPNVEADGSEPTKTPGR  162



>ref|XP_011359580.1| PREDICTED: phosphatidylinositol 3-kinase catalytic subunit type 
3 isoform X1 [Pteropus vampyrus]
Length=887

 Score = 99.8 bits (247),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 54/159 (34%), Positives = 80/159 (50%), Gaps = 2/159 (1%)
 Frame = +3

Query  189  GNEFRFFLSCDINLPVTFRIERLE--gklpppklpgSDGVDTMMNAIDDRKPELYVESTL  362
              +F +  SCD+++ V  +I  LE   +    K    D +        D   +LYV   +
Sbjct  4    AEKFHYIYSCDLDINVQLKIGSLEGKREQKSYKAVLEDPMLKFSGLYQDTCSDLYVTCQV  63

Query  363  YIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIG  542
            + +G P  LP+RT  ++    + WNE + L  KY DL  N+Q+ALT+WDV        +G
Sbjct  64   FAEGKPLALPVRTSYKAFSTRWNWNEWLKLPVKYPDLPRNAQVALTIWDVYGPGKAVPVG  123

Query  543  GATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGK  659
            G T+ LF      + G H L++W   EADGS  T TPG+
Sbjct  124  GTTVSLFGKYGMFRQGMHDLKVWPNVEADGSEPTKTPGR  162



>gb|ETS63702.1| hypothetical protein PaG_02008 [Pseudozyma aphidis DSM 70725]
Length=969

 Score = 99.8 bits (247),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 59/162 (36%), Positives = 81/162 (50%), Gaps = 2/162 (1%)
 Frame = +3

Query  183  MSGNEFRFFLSCDINLPVTFRIERLE--gklpppklpgSDGVDTMMNAIDDRKPELYVES  356
            M  + + F    D+NL VTFRI  L+                     A     P+L VE 
Sbjct  1    MDRDFYSFVRLSDLNLNVTFRISSLQGKLDRISRTQLLRQPEARQWGAQQSDYPDLLVEC  60

Query  357  TLYIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGV  536
             L+ D  P  + ++T       ++ WNE ITL  K  DL   +QLA T++DV+  +S  V
Sbjct  61   CLFADNKPLSVLVKTAYRPFRNNHQWNEWITLPYKLCDLPLGAQLAFTIYDVASSRSARV  120

Query  537  IGGATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKV  662
            IGG T  LF+ K  LK+ +H+L +W G  ADGS+ T TP KV
Sbjct  121  IGGTTFPLFSKKGTLKSAQHRLFVWKGARADGSVETATPSKV  162



>ref|XP_008071342.1| PREDICTED: phosphatidylinositol 3-kinase catalytic subunit type 
3 isoform X1 [Tarsius syrichta]
Length=887

 Score = 99.8 bits (247),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 54/159 (34%), Positives = 80/159 (50%), Gaps = 2/159 (1%)
 Frame = +3

Query  189  GNEFRFFLSCDINLPVTFRIERLE--gklpppklpgSDGVDTMMNAIDDRKPELYVESTL  362
              +F +  SCD+++ V  +I  LE   +    K    D +        D   +LYV   +
Sbjct  4    AEKFHYIYSCDLDINVQLKIGSLEGKREQKSYKAVLEDPMLKFSGLYQDTCSDLYVTCQV  63

Query  363  YIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIG  542
            + +G P  LP+RT  ++    + WNE + L  KY DL  N+Q+ALT+WDV        +G
Sbjct  64   FAEGKPLALPVRTSYKAFSTRWNWNEWLKLPVKYPDLPRNAQVALTIWDVYGPGKAVPVG  123

Query  543  GATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGK  659
            G T+ LF      + G H L++W   EADGS  T TPG+
Sbjct  124  GTTVSLFGKYGMFRQGMHDLKVWPNVEADGSEPTKTPGR  162



>ref|XP_006144457.1| PREDICTED: phosphatidylinositol 3-kinase catalytic subunit type 
3-like isoform X1 [Tupaia chinensis]
Length=894

 Score = 99.8 bits (247),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 54/159 (34%), Positives = 80/159 (50%), Gaps = 2/159 (1%)
 Frame = +3

Query  189  GNEFRFFLSCDINLPVTFRIERLE--gklpppklpgSDGVDTMMNAIDDRKPELYVESTL  362
              +F +  SCD+++ V  +I  LE   +    K    D +        D   +LYV   +
Sbjct  4    AEKFHYIYSCDLDINVQLKIGSLEGKREQKSYKAVLEDPMLKFSGLYQDTCSDLYVTCQV  63

Query  363  YIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIG  542
            + +G P  LP+RT  ++    + WNE + L  KY DL  N+Q+ALT+WDV        +G
Sbjct  64   FAEGKPLALPVRTSYKAFSTRWNWNEWLKLPVKYPDLPRNAQVALTIWDVYGPGKAVPVG  123

Query  543  GATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGK  659
            G T+ LF      + G H L++W   EADGS  T TPG+
Sbjct  124  GTTVSLFGKYGMFRQGMHDLKVWPNVEADGSEPTKTPGR  162



>dbj|GAC73688.1| phosphatidylinositol 3-kinase VPS34 [Pseudozyma antarctica T-34]
Length=969

 Score = 99.8 bits (247),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 59/162 (36%), Positives = 81/162 (50%), Gaps = 2/162 (1%)
 Frame = +3

Query  183  MSGNEFRFFLSCDINLPVTFRIERLE--gklpppklpgSDGVDTMMNAIDDRKPELYVES  356
            M  + + F    D+NL VTFRI  L+                     A     P+L VE 
Sbjct  1    MDRDFYSFVRLSDLNLNVTFRISSLQGKLDRISRTQLLRQPEARQWGAQQSDYPDLLVEC  60

Query  357  TLYIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGV  536
             L+ D  P  + ++T       ++ WNE ITL  K  DL   +QLA T++DV+  +S  V
Sbjct  61   CLFADNKPLSVLVKTAYRPFRNNHQWNEWITLPYKLCDLPLGAQLAFTIYDVASSRSARV  120

Query  537  IGGATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKV  662
            IGG T  LF+ K  LK+ +H+L +W G  ADGS+ T TP KV
Sbjct  121  IGGTTFPLFSKKGTLKSAQHRLFVWKGARADGSVETATPSKV  162



>gb|AAH24675.1| Pik3c3 protein [Mus musculus]
Length=847

 Score = 99.4 bits (246),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 54/159 (34%), Positives = 81/159 (51%), Gaps = 2/159 (1%)
 Frame = +3

Query  189  GNEFRFFLSCDINLPVTFRIERLE--gklpppklpgSDGVDTMMNAIDDRKPELYVESTL  362
              +F +  SCD+++ V  +I  LE   +    K    D +        +   +LYV   +
Sbjct  4    AEKFHYIYSCDLDINVQLKIGSLEGKREQKSYKAVLEDPMLKFSGLYQETCSDLYVTCQV  63

Query  363  YIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIG  542
            + +G P  LP+RT  ++    + WNE + L  KY DL  N+Q+ALT+WDV    S   +G
Sbjct  64   FAEGKPLALPVRTSYKAFSTRWNWNEWLKLPVKYPDLPRNAQVALTIWDVYGPGSAVPVG  123

Query  543  GATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGK  659
            G T+ LF      + G H L++W   EADGS  T TPG+
Sbjct  124  GTTVSLFGKYGMFRQGMHDLKVWPNVEADGSEPTRTPGR  162



>ref|XP_009946528.1| PREDICTED: phosphatidylinositol 3-kinase catalytic subunit type 
3-like [Leptosomus discolor]
Length=254

 Score = 95.5 bits (236),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 53/154 (34%), Positives = 78/154 (51%), Gaps = 2/154 (1%)
 Frame = +3

Query  204  FFLSCDINLPVTFRIERLEgklpppklpg--SDGVDTMMNAIDDRKPELYVESTLYIDGA  377
            +  SCD+++ V  +I  LEGK           D +        +   +LYV   ++ +G 
Sbjct  83   YVYSCDLDINVQLKIGSLEGKREQKSYKALLEDPMLKFSGLYQETCSDLYVTCQVFAEGK  142

Query  378  PFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIGGATIH  557
            P  LP+RT  ++    + WNE + L  KY DL  N+Q+ALT+WDV        +GG T+ 
Sbjct  143  PLALPVRTSYKAFSTRWNWNEWLKLPVKYPDLPRNAQVALTIWDVYGPGKAVPVGGTTVS  202

Query  558  LFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGK  659
            LF      + G H L++W   EADGS  T TPG+
Sbjct  203  LFGKYGMFRQGMHDLKVWPNVEADGSEPTRTPGR  236



>ref|XP_008259471.1| PREDICTED: phosphatidylinositol 3-kinase catalytic subunit type 
3 [Oryctolagus cuniculus]
Length=887

 Score = 99.4 bits (246),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 54/159 (34%), Positives = 80/159 (50%), Gaps = 2/159 (1%)
 Frame = +3

Query  189  GNEFRFFLSCDINLPVTFRIERLE--gklpppklpgSDGVDTMMNAIDDRKPELYVESTL  362
              +F +  SCD+++ V  +I  LE   +    K    D +        D   +LYV   +
Sbjct  4    AEKFHYIYSCDLDINVQLKIGSLEGKREQKSYKAVLEDPMLKFSGLYQDTCSDLYVTCQV  63

Query  363  YIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIG  542
            + +G P  LP+RT  ++    + WNE + L  KY DL  N+Q+ALT+WDV        +G
Sbjct  64   FAEGKPLALPVRTSYKAFSTRWNWNEWLRLPVKYPDLPRNAQVALTIWDVYGPGKAVPVG  123

Query  543  GATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGK  659
            G T+ LF      + G H L++W   EADGS  T TPG+
Sbjct  124  GTTVSLFGKYGMFRQGMHDLKVWPNVEADGSEPTKTPGR  162



>ref|NP_852079.2| phosphatidylinositol 3-kinase catalytic subunit type 3 [Mus musculus]
 sp|Q6PF93.1|PK3C3_MOUSE RecName: Full=Phosphatidylinositol 3-kinase catalytic subunit 
type 3; Short=PI3-kinase type 3; Short=PI3K type 3; Short=PtdIns-3-kinase 
type 3; AltName: Full=Phosphoinositide-3-kinase 
class 3 [Mus musculus]
 gb|AAH57678.1| Phosphoinositide-3-kinase, class 3 [Mus musculus]
 gb|EDK97021.1| phosphoinositide-3-kinase, class 3, isoform CRA_a [Mus musculus]
Length=887

 Score = 99.4 bits (246),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 54/159 (34%), Positives = 81/159 (51%), Gaps = 2/159 (1%)
 Frame = +3

Query  189  GNEFRFFLSCDINLPVTFRIERLE--gklpppklpgSDGVDTMMNAIDDRKPELYVESTL  362
              +F +  SCD+++ V  +I  LE   +    K    D +        +   +LYV   +
Sbjct  4    AEKFHYIYSCDLDINVQLKIGSLEGKREQKSYKAVLEDPMLKFSGLYQETCSDLYVTCQV  63

Query  363  YIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIG  542
            + +G P  LP+RT  ++    + WNE + L  KY DL  N+Q+ALT+WDV    S   +G
Sbjct  64   FAEGKPLALPVRTSYKAFSTRWNWNEWLKLPVKYPDLPRNAQVALTIWDVYGPGSAVPVG  123

Query  543  GATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGK  659
            G T+ LF      + G H L++W   EADGS  T TPG+
Sbjct  124  GTTVSLFGKYGMFRQGMHDLKVWPNVEADGSEPTRTPGR  162



>gb|EPB83231.1| hypothetical protein HMPREF1544_10027 [Mucor circinelloides f. 
circinelloides 1006PhL]
Length=839

 Score = 99.4 bits (246),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 55/156 (35%), Positives = 87/156 (56%), Gaps = 13/156 (8%)
 Frame = +3

Query  195  EFRFFLSCDINLPVTFRIERLEgklpppklpgSDGVDTMMNAIDDRKPELYVESTLYIDG  374
            +F + L+ D+ LPV+ RI  LEGK            DT+     D  P+LY+   L+ D 
Sbjct  2    DFSYCLTKDVKLPVSIRIATLEGKR-----------DTLQQQ--DSLPDLYITVQLFGDN  48

Query  375  APFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIGGATI  554
             P  +P++T  ++    + WNE +TL  KY DL +++Q A+T+W+    +    +GG T+
Sbjct  49   KPLTVPVKTSYKAFRNHWSWNEWLTLPIKYCDLPSSAQFAITIWETIGPRKVKPVGGTTL  108

Query  555  HLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKV  662
             LF  +  L+ GK KL +W+  EADG+  T+TP K+
Sbjct  109  RLFGKQFTLRKGKQKLHIWTNCEADGNHDTSTPSKL  144



>gb|EDK97022.1| phosphoinositide-3-kinase, class 3, isoform CRA_b [Mus musculus]
Length=872

 Score = 99.4 bits (246),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 54/159 (34%), Positives = 81/159 (51%), Gaps = 2/159 (1%)
 Frame = +3

Query  189  GNEFRFFLSCDINLPVTFRIERLE--gklpppklpgSDGVDTMMNAIDDRKPELYVESTL  362
              +F +  SCD+++ V  +I  LE   +    K    D +        +   +LYV   +
Sbjct  28   AEKFHYIYSCDLDINVQLKIGSLEGKREQKSYKAVLEDPMLKFSGLYQETCSDLYVTCQV  87

Query  363  YIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIG  542
            + +G P  LP+RT  ++    + WNE + L  KY DL  N+Q+ALT+WDV    S   +G
Sbjct  88   FAEGKPLALPVRTSYKAFSTRWNWNEWLKLPVKYPDLPRNAQVALTIWDVYGPGSAVPVG  147

Query  543  GATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGK  659
            G T+ LF      + G H L++W   EADGS  T TPG+
Sbjct  148  GTTVSLFGKYGMFRQGMHDLKVWPNVEADGSEPTRTPGR  186



>ref|XP_004855306.1| PREDICTED: phosphatidylinositol 3-kinase catalytic subunit type 
3-like isoform X1 [Heterocephalus glaber]
Length=887

 Score = 99.4 bits (246),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 54/157 (34%), Positives = 80/157 (51%), Gaps = 2/157 (1%)
 Frame = +3

Query  195  EFRFFLSCDINLPVTFRIERLE--gklpppklpgSDGVDTMMNAIDDRKPELYVESTLYI  368
            +F +  SCD+++ V  +I  LE   +    K    D +        D   +LYV   ++ 
Sbjct  6    KFHYIYSCDLDINVQLKIGSLEGKREQKSYKAVLEDPMLKFSGLYQDTCSDLYVTCQVFA  65

Query  369  DGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIGGA  548
            +G P  LP+RT  ++    + WNE + L  KY DL  N+Q+ALT+WDV        +GG 
Sbjct  66   EGKPLALPVRTSYKAFSTRWNWNEWLKLPVKYPDLPRNAQVALTIWDVYGPGRAVPVGGT  125

Query  549  TIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGK  659
            T+ LF      + G H L++W   EADGS  T TPG+
Sbjct  126  TVSLFGKYGMFRQGMHDLKVWPNVEADGSEPTKTPGR  162



>ref|XP_008830714.1| PREDICTED: phosphatidylinositol 3-kinase catalytic subunit type 
3 isoform X4 [Nannospalax galili]
Length=768

 Score = 98.6 bits (244),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 53/159 (33%), Positives = 80/159 (50%), Gaps = 2/159 (1%)
 Frame = +3

Query  189  GNEFRFFLSCDINLPVTFRIERLE--gklpppklpgSDGVDTMMNAIDDRKPELYVESTL  362
              +F +  SCD+++ V  +I  LE   +    K    D +        +   +LYV   +
Sbjct  4    AEKFHYIYSCDLDINVQLKIGSLEGKREQKSYKAVLEDPMLKFSGLYQETCSDLYVTCQV  63

Query  363  YIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIG  542
            + +G P  LP+RT  ++    + WNE + L  KY DL  N+Q+ALT+WDV        +G
Sbjct  64   FAEGKPLALPVRTSYKAFSTRWNWNEWLKLPVKYPDLPRNAQVALTIWDVYGPGKAVPVG  123

Query  543  GATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGK  659
            G T+ LF      + G H L++W   EADGS  T TPG+
Sbjct  124  GTTVSLFGKYGMFRQGMHDLKVWPNMEADGSEPTKTPGR  162



>emb|CBQ67863.1| related to phosphatidylinositol 3-kinase [Sporisorium reilianum 
SRZ2]
Length=972

 Score = 99.0 bits (245),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 57/162 (35%), Positives = 83/162 (51%), Gaps = 2/162 (1%)
 Frame = +3

Query  183  MSGNEFRFFLSCDINLPVTFRIERLE--gklpppklpgSDGVDTMMNAIDDRKPELYVES  356
            M  + + F    D+NL +TFRI  L+                     A     P+L VE 
Sbjct  1    MDRDFYSFVRLSDLNLNLTFRISSLQGKLDRLTRTQLLEQPESRHWGAQQSPYPDLNVEC  60

Query  357  TLYIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGV  536
             LY D  P  +P++T  +    ++ WNE ITL  K  DL   +QL  T++DV+   +  +
Sbjct  61   RLYSDNKPLSVPVKTAYKPFRNNHQWNEWITLPYKLCDLPLGAQLTFTIYDVASSNASRI  120

Query  537  IGGATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKV  662
            IGG T+ LF+ K  LK+ +H+L +W G +ADG I +TTP KV
Sbjct  121  IGGMTLPLFSKKGTLKSAQHRLFVWKGVKADGGIESTTPSKV  162



>ref|XP_002757241.1| PREDICTED: phosphatidylinositol 3-kinase catalytic subunit type 
3 [Callithrix jacchus]
 ref|XP_003924759.1| PREDICTED: phosphatidylinositol 3-kinase catalytic subunit type 
3 [Saimiri boliviensis boliviensis]
Length=887

 Score = 98.6 bits (244),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 53/159 (33%), Positives = 81/159 (51%), Gaps = 2/159 (1%)
 Frame = +3

Query  189  GNEFRFFLSCDINLPVTFRIERLE--gklpppklpgSDGVDTMMNAIDDRKPELYVESTL  362
             ++F +  SCD+++ V  +I  LE   +    K    D +        +   +LYV   +
Sbjct  4    ADKFHYIYSCDLDINVQLKIGSLEGKREQKSYKAVLEDPMLKFSGLYQETCSDLYVTCQV  63

Query  363  YIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIG  542
            + +G P  LP+RT  ++    + WNE + L  KY DL  N+Q+ALT+WDV        +G
Sbjct  64   FAEGKPLALPVRTSYKAFSTRWNWNEWLKLPVKYPDLPRNAQVALTIWDVYGPGKAVPVG  123

Query  543  GATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGK  659
            G T+ LF      + G H L++W   EADGS  T TPG+
Sbjct  124  GTTVSLFGKYGMFRQGMHDLKVWPNVEADGSEPTKTPGR  162



>ref|XP_006889295.1| PREDICTED: phosphatidylinositol 3-kinase catalytic subunit type 
3-like [Elephantulus edwardii]
Length=911

 Score = 98.6 bits (244),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 53/157 (34%), Positives = 80/157 (51%), Gaps = 2/157 (1%)
 Frame = +3

Query  195  EFRFFLSCDINLPVTFRIERLE--gklpppklpgSDGVDTMMNAIDDRKPELYVESTLYI  368
            +F +  SCD+++ V  +I  LE   +    +    D +        D   +LYV   ++ 
Sbjct  6    KFHYVYSCDLDINVQLKIGSLEGKREQKNYRAVLEDPMLKFSGLYQDTCSDLYVTCQVFT  65

Query  369  DGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIGGA  548
            +G P  LP+RT  ++    + WNE + L  KY DL  N+Q+ALT+WDV        +GG 
Sbjct  66   EGKPLALPVRTSYKAFSTRWNWNEWLKLPVKYPDLPRNAQVALTIWDVYGPGKAVPVGGT  125

Query  549  TIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGK  659
            T+ LF      + G H L++W   EADGS  T TPG+
Sbjct  126  TVSLFGKYGMFRQGMHDLKVWPNVEADGSEPTKTPGR  162



>ref|XP_006730096.1| PREDICTED: phosphatidylinositol 3-kinase catalytic subunit type 
3-like [Leptonychotes weddellii]
Length=811

 Score = 98.6 bits (244),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 54/159 (34%), Positives = 80/159 (50%), Gaps = 2/159 (1%)
 Frame = +3

Query  189  GNEFRFFLSCDINLPVTFRIERLE--gklpppklpgSDGVDTMMNAIDDRKPELYVESTL  362
              +F +  SCD+++ V  +I  LE   +    K    D +        +   +LYV   +
Sbjct  4    AEKFHYIYSCDLDINVQLKIGSLEGKREQKSYKAVLEDPMLKFSGLYQETCSDLYVTCQV  63

Query  363  YIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIG  542
            + +G P  LP+RT  ++    + WNE + L  KY DL  N+Q+ALTVWDV        +G
Sbjct  64   FAEGKPLALPVRTSYKAFSTRWNWNEWLKLPVKYPDLPRNAQVALTVWDVYGPGKAVPVG  123

Query  543  GATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGK  659
            G T+ LF      + G H L++W   EADGS  T TPG+
Sbjct  124  GTTVSLFGKYGMFRQGMHDLKVWPNVEADGSEPTKTPGR  162



>ref|XP_001082892.1| PREDICTED: phosphatidylinositol 3-kinase catalytic subunit type 
3 isoform 1 [Macaca mulatta]
Length=887

 Score = 98.6 bits (244),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 54/159 (34%), Positives = 80/159 (50%), Gaps = 2/159 (1%)
 Frame = +3

Query  189  GNEFRFFLSCDINLPVTFRIERLE--gklpppklpgSDGVDTMMNAIDDRKPELYVESTL  362
              +F +  SCD+++ V  +I  LE   +    K    D +        +   +LYV   +
Sbjct  4    AEKFHYLYSCDLDINVQLKIGSLEGKREQKSYKAVLEDPMLKFSGLYQETCSDLYVTCQV  63

Query  363  YIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIG  542
            + +G P  LP+RT  ++    + WNE + L  KY DL  N+Q+ALTVWDV        +G
Sbjct  64   FAEGKPLALPVRTSYKAFSTRWNWNEWLKLPVKYPDLPRNAQVALTVWDVYGPGKAVPVG  123

Query  543  GATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGK  659
            G T+ LF      + G H L++W   EADGS  T TPG+
Sbjct  124  GTTVSLFGKYGMFRQGMHDLKVWPNVEADGSEPTKTPGR  162



>gb|EPY73351.1| phosphatidylinositol 3-kinase catalytic subunit type 3 [Camelus 
ferus]
Length=683

 Score = 98.2 bits (243),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 53/159 (33%), Positives = 80/159 (50%), Gaps = 2/159 (1%)
 Frame = +3

Query  189  GNEFRFFLSCDINLPVTFRIERLE--gklpppklpgSDGVDTMMNAIDDRKPELYVESTL  362
              +F +  SCD+++ V  +I  LE   +    K    D +        +   +LYV   +
Sbjct  4    AEKFHYIYSCDLDINVQLKIGSLEGKREQKSYKAVLEDPMLRFSGLYQETCSDLYVTCQV  63

Query  363  YIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIG  542
            + +G P  LP+RT  ++    + WNE + L  KY DL  N+Q+ALT+WDV        +G
Sbjct  64   FAEGKPLALPVRTSYKAFSTRWNWNEWLKLPVKYPDLPRNAQVALTIWDVYGPGKAVPVG  123

Query  543  GATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGK  659
            G T+ LF      + G H L++W   EADGS  T TPG+
Sbjct  124  GTTVSLFGKYGMFRQGMHDLKVWPNVEADGSEPTKTPGR  162



>dbj|GAN11171.1| phosphatidylinositol 3-kinase [Mucor ambiguus]
Length=838

 Score = 98.2 bits (243),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 55/157 (35%), Positives = 85/157 (54%), Gaps = 15/157 (10%)
 Frame = +3

Query  195  EFRFFLSCDINLPVTFRIERLEgklpppklpgSDGV-DTMMNAIDDRKPELYVESTLYID  371
            +F + L+ D+ LPV+ RI  LE            G+ DT      D  P+LY+   L+ D
Sbjct  2    DFSYCLTKDVKLPVSIRIATLE------------GIRDTFQQQ--DNLPDLYITVQLFGD  47

Query  372  GAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIGGAT  551
              P  +P++T  ++    + WNE +TL  KY DL +++Q A+TVW+    +    +GG T
Sbjct  48   NKPLTVPIKTSYKAFRNHWSWNEWLTLPIKYCDLPSSAQFAITVWETIGPRKVKPVGGTT  107

Query  552  IHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKV  662
            + LF  +  L+ GK KL +W   EADG+  T+TP K+
Sbjct  108  LRLFGKQFTLRKGKQKLHIWRDCEADGNHDTSTPSKL  144



>ref|XP_004415358.1| PREDICTED: phosphatidylinositol 3-kinase catalytic subunit type 
3-like isoform 1 [Odobenus rosmarus divergens]
Length=887

 Score = 98.2 bits (243),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 54/159 (34%), Positives = 80/159 (50%), Gaps = 2/159 (1%)
 Frame = +3

Query  189  GNEFRFFLSCDINLPVTFRIERLE--gklpppklpgSDGVDTMMNAIDDRKPELYVESTL  362
              +F +  SCD+++ V  +I  LE   +    K    D +        +   +LYV   +
Sbjct  4    AEKFHYIYSCDLDINVQLKIGSLEGKREQKSYKAVLEDPMLKFSGLYQETCSDLYVTCQV  63

Query  363  YIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIG  542
            + +G P  LP+RT  ++    + WNE + L  KY DL  N+Q+ALTVWDV        +G
Sbjct  64   FAEGKPLALPVRTSYKAFSTRWNWNEWLKLPVKYPDLPRNAQVALTVWDVYGPGKAVPVG  123

Query  543  GATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGK  659
            G T+ LF      + G H L++W   EADGS  T TPG+
Sbjct  124  GTTVSLFGKYGMFRQGMHDLKVWPNVEADGSEPTKTPGR  162



>ref|XP_006205318.1| PREDICTED: LOW QUALITY PROTEIN: phosphatidylinositol 3-kinase 
catalytic subunit type 3-like [Vicugna pacos]
Length=884

 Score = 98.2 bits (243),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 53/159 (33%), Positives = 80/159 (50%), Gaps = 2/159 (1%)
 Frame = +3

Query  189  GNEFRFFLSCDINLPVTFRIERLE--gklpppklpgSDGVDTMMNAIDDRKPELYVESTL  362
              +F +  SCD+++ V  +I  LE   +    K    D +        +   +LYV   +
Sbjct  4    AEKFHYIYSCDLDINVQLKIGSLEGKREQKSYKAVLEDPMLRFSGLYQETCSDLYVTCQV  63

Query  363  YIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIG  542
            + +G P  LP+RT  ++    + WNE + L  KY DL  N+Q+ALT+WDV        +G
Sbjct  64   FAEGKPLALPVRTSYKAFSTRWNWNEWLKLPVKYPDLPRNAQVALTIWDVYGPGKAVPVG  123

Query  543  GATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGK  659
            G T+ LF      + G H L++W   EADGS  T TPG+
Sbjct  124  GTTVSLFGKYSMFRQGMHDLKVWPNVEADGSEPTKTPGR  162



>ref|XP_003975987.1| PREDICTED: LOW QUALITY PROTEIN: phosphatidylinositol 3-kinase 
catalytic subunit type 3-like [Takifugu rubripes]
Length=877

 Score = 98.2 bits (243),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 53/161 (33%), Positives = 81/161 (50%), Gaps = 2/161 (1%)
 Frame = +3

Query  183  MSGNEFRFFLSCDINLPVTFRIERLE--gklpppklpgSDGVDTMMNAIDDRKPELYVES  356
            M  ++F +  SCD+++ V  +I  LE   +    K    D +        +   +LYV  
Sbjct  1    METDKFNYVYSCDLDINVQLKIGSLEGKREQKSYKALLEDPMLRFSGLYQENCSDLYVTC  60

Query  357  TLYIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGV  536
             ++ +G P  LP+RT  ++    + WNE + L  KY DL  N+Q+ALTVWD+        
Sbjct  61   QVFAEGKPLALPVRTSYKAFSTRWNWNEWLRLPVKYPDLPQNAQVALTVWDIYGPGRAVP  120

Query  537  IGGATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGK  659
            +GG T+ LF      + G H L++W G E DG   T TPG+
Sbjct  121  VGGTTVTLFGKYGMFRQGMHDLKVWPGVEGDGGDPTATPGR  161



>ref|XP_007172845.1| PREDICTED: phosphatidylinositol 3-kinase catalytic subunit type 
3-like isoform X1 [Balaenoptera acutorostrata scammoni]
Length=887

 Score = 98.2 bits (243),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 54/159 (34%), Positives = 80/159 (50%), Gaps = 2/159 (1%)
 Frame = +3

Query  189  GNEFRFFLSCDINLPVTFRIERLE--gklpppklpgSDGVDTMMNAIDDRKPELYVESTL  362
              +F +  SCD+++ V  +I  LE   +    K    D +        +   +LYV   +
Sbjct  4    AEKFHYIYSCDLDINVQLKIGSLEGKREQKSYKAVLEDPMLKFSGLYQETCSDLYVTCQV  63

Query  363  YIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIG  542
            + +G P  LP+RT  ++    + WNE + L  KY DL  N+Q+ALTVWDV        +G
Sbjct  64   FAEGKPLALPVRTSYKAFSTRWNWNEWLKLPVKYPDLPRNAQVALTVWDVYGPGKAVPVG  123

Query  543  GATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGK  659
            G T+ LF      + G H L++W   EADGS  T TPG+
Sbjct  124  GTTVSLFGKYGMFRQGMHDLKVWPNVEADGSEPTKTPGR  162



>ref|XP_009905528.1| PREDICTED: phosphatidylinositol 3-kinase catalytic subunit type 
3-like, partial [Picoides pubescens]
Length=297

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 53/154 (34%), Positives = 78/154 (51%), Gaps = 2/154 (1%)
 Frame = +3

Query  204  FFLSCDINLPVTFRIERLEgklpppklpg--SDGVDTMMNAIDDRKPELYVESTLYIDGA  377
            +  SCD+++ V  +I  LEGK           D +        +   +LYV   ++ +G 
Sbjct  9    YVYSCDLDINVQLKIGSLEGKREQKSYKALLEDPMLKFSGLYQETCSDLYVTCQVFAEGK  68

Query  378  PFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIGGATIH  557
            P  LP+RT  ++    + WNE + L  KY DL  N+Q+ALT+WDV        +GG T+ 
Sbjct  69   PLALPVRTSYKAFSTRWNWNEWLKLPVKYPDLPRNAQVALTIWDVYGPGKAVPVGGTTVS  128

Query  558  LFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGK  659
            LF      + G H L++W   EADGS  T TPG+
Sbjct  129  LFGKYGMFRQGMHDLKVWPNVEADGSEPTKTPGR  162



>ref|XP_010885974.1| PREDICTED: phosphatidylinositol 3-kinase catalytic subunit type 
3 isoform X1 [Esox lucius]
Length=886

 Score = 98.2 bits (243),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 54/161 (34%), Positives = 82/161 (51%), Gaps = 2/161 (1%)
 Frame = +3

Query  183  MSGNEFRFFLSCDINLPVTFRIERLE--gklpppklpgSDGVDTMMNAIDDRKPELYVES  356
            M  ++F +  SCD+++ V  +I  LE   +    K    D +        +   +LYV  
Sbjct  1    MDTDKFNYVYSCDLDINVQLKIGSLEGKREQKSYKALLQDPMLRFSGLYQENCSDLYVTC  60

Query  357  TLYIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGV  536
             ++ +G P  LP+RT  ++    + WNE + L  KY DL  ++Q+ALTVWDV        
Sbjct  61   QVFAEGKPLALPVRTSYKAFSTRWNWNEWLRLPVKYPDLPQSAQVALTVWDVYGPGRAIP  120

Query  537  IGGATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGK  659
            +GG T+ LF      + G H L++W G E DG   TTTPG+
Sbjct  121  VGGTTVTLFGKYGMFRQGMHDLKVWPGVEGDGGEPTTTPGR  161



>ref|XP_003784780.1| PREDICTED: phosphatidylinositol 3-kinase catalytic subunit type 
3 isoform 1 [Otolemur garnettii]
Length=887

 Score = 98.2 bits (243),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 53/159 (33%), Positives = 80/159 (50%), Gaps = 2/159 (1%)
 Frame = +3

Query  189  GNEFRFFLSCDINLPVTFRIERLE--gklpppklpgSDGVDTMMNAIDDRKPELYVESTL  362
              +F +  SCD+++ V  +I  LE   +    K    D +        +   +LYV   +
Sbjct  4    AEKFHYIYSCDLDINVQLKIGSLEGKREQKSYKAVLEDPMLKFSGLYQETCSDLYVTCQV  63

Query  363  YIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIG  542
            + +G P  LP+RT  ++    + WNE + L  KY DL  N+Q+ALT+WDV        +G
Sbjct  64   FAEGKPLALPVRTSYKAFSTRWNWNEWLKLPVKYPDLPRNAQVALTIWDVYGPGKAVPVG  123

Query  543  GATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGK  659
            G T+ LF      + G H L++W   EADGS  T TPG+
Sbjct  124  GTTVSLFGKYGMFRQGMHDLKVWPNVEADGSEPTKTPGR  162



>ref|XP_008830711.1| PREDICTED: phosphatidylinositol 3-kinase catalytic subunit type 
3 isoform X1 [Nannospalax galili]
Length=887

 Score = 98.2 bits (243),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 53/159 (33%), Positives = 80/159 (50%), Gaps = 2/159 (1%)
 Frame = +3

Query  189  GNEFRFFLSCDINLPVTFRIERLE--gklpppklpgSDGVDTMMNAIDDRKPELYVESTL  362
              +F +  SCD+++ V  +I  LE   +    K    D +        +   +LYV   +
Sbjct  4    AEKFHYIYSCDLDINVQLKIGSLEGKREQKSYKAVLEDPMLKFSGLYQETCSDLYVTCQV  63

Query  363  YIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIG  542
            + +G P  LP+RT  ++    + WNE + L  KY DL  N+Q+ALT+WDV        +G
Sbjct  64   FAEGKPLALPVRTSYKAFSTRWNWNEWLKLPVKYPDLPRNAQVALTIWDVYGPGKAVPVG  123

Query  543  GATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGK  659
            G T+ LF      + G H L++W   EADGS  T TPG+
Sbjct  124  GTTVSLFGKYGMFRQGMHDLKVWPNMEADGSEPTKTPGR  162



>ref|XP_010885975.1| PREDICTED: phosphatidylinositol 3-kinase catalytic subunit type 
3 isoform X2 [Esox lucius]
Length=877

 Score = 98.2 bits (243),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 54/161 (34%), Positives = 82/161 (51%), Gaps = 2/161 (1%)
 Frame = +3

Query  183  MSGNEFRFFLSCDINLPVTFRIERLE--gklpppklpgSDGVDTMMNAIDDRKPELYVES  356
            M  ++F +  SCD+++ V  +I  LE   +    K    D +        +   +LYV  
Sbjct  1    MDTDKFNYVYSCDLDINVQLKIGSLEGKREQKSYKALLQDPMLRFSGLYQENCSDLYVTC  60

Query  357  TLYIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGV  536
             ++ +G P  LP+RT  ++    + WNE + L  KY DL  ++Q+ALTVWDV        
Sbjct  61   QVFAEGKPLALPVRTSYKAFSTRWNWNEWLRLPVKYPDLPQSAQVALTVWDVYGPGRAIP  120

Query  537  IGGATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGK  659
            +GG T+ LF      + G H L++W G E DG   TTTPG+
Sbjct  121  VGGTTVTLFGKYGMFRQGMHDLKVWPGVEGDGGEPTTTPGR  161



>ref|XP_001497818.1| PREDICTED: phosphatidylinositol 3-kinase catalytic subunit type 
3 isoformX1 [Equus caballus]
Length=887

 Score = 98.2 bits (243),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 53/159 (33%), Positives = 80/159 (50%), Gaps = 2/159 (1%)
 Frame = +3

Query  189  GNEFRFFLSCDINLPVTFRIERLE--gklpppklpgSDGVDTMMNAIDDRKPELYVESTL  362
              +F +  SCD+++ V  +I  LE   +    K    D +        +   +LYV   +
Sbjct  4    AEKFHYIYSCDLDINVQLKIGSLEGKREQKSYKAVLEDPMLKFSGLYQETCSDLYVTCQV  63

Query  363  YIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIG  542
            + +G P  LP+RT  ++    + WNE + L  KY DL  N+Q+ALT+WDV        +G
Sbjct  64   FAEGKPLALPVRTSYKAFSTRWNWNEWLKLPVKYPDLPRNAQVALTIWDVYGPGKAVPVG  123

Query  543  GATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGK  659
            G T+ LF      + G H L++W   EADGS  T TPG+
Sbjct  124  GTTVSLFGKYGMFRQGMHDLKVWPNVEADGSEPTKTPGR  162



>ref|XP_005325661.1| PREDICTED: phosphatidylinositol 3-kinase catalytic subunit type 
3 [Ictidomys tridecemlineatus]
Length=886

 Score = 98.2 bits (243),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 53/159 (33%), Positives = 80/159 (50%), Gaps = 2/159 (1%)
 Frame = +3

Query  189  GNEFRFFLSCDINLPVTFRIERLE--gklpppklpgSDGVDTMMNAIDDRKPELYVESTL  362
              +F +  SCD+++ V  +I  LE   +    K    D +        +   +LYV   +
Sbjct  4    AEKFHYIYSCDLDINVQLKIGSLEGKREQKSYKAVLEDPMLKFSGLYQETCSDLYVTCQV  63

Query  363  YIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIG  542
            + +G P  LP+RT  ++    + WNE + L  KY DL  N+Q+ALT+WDV        +G
Sbjct  64   FAEGKPLALPVRTSYKAFSTRWNWNEWLKLPVKYPDLPRNAQVALTIWDVYGPGKAVPVG  123

Query  543  GATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGK  659
            G T+ LF      + G H L++W   EADGS  T TPG+
Sbjct  124  GTTVSLFGKYGMFRQGMHDLKVWPNVEADGSEPTKTPGR  162



>ref|XP_005612913.1| PREDICTED: phosphatidylinositol 3-kinase catalytic subunit type 
3 isoform X2 [Equus caballus]
Length=843

 Score = 98.2 bits (243),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 53/159 (33%), Positives = 80/159 (50%), Gaps = 2/159 (1%)
 Frame = +3

Query  189  GNEFRFFLSCDINLPVTFRIERLE--gklpppklpgSDGVDTMMNAIDDRKPELYVESTL  362
              +F +  SCD+++ V  +I  LE   +    K    D +        +   +LYV   +
Sbjct  4    AEKFHYIYSCDLDINVQLKIGSLEGKREQKSYKAVLEDPMLKFSGLYQETCSDLYVTCQV  63

Query  363  YIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIG  542
            + +G P  LP+RT  ++    + WNE + L  KY DL  N+Q+ALT+WDV        +G
Sbjct  64   FAEGKPLALPVRTSYKAFSTRWNWNEWLKLPVKYPDLPRNAQVALTIWDVYGPGKAVPVG  123

Query  543  GATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGK  659
            G T+ LF      + G H L++W   EADGS  T TPG+
Sbjct  124  GTTVSLFGKYGMFRQGMHDLKVWPNVEADGSEPTKTPGR  162



>ref|XP_004683924.1| PREDICTED: phosphatidylinositol 3-kinase catalytic subunit type 
3 isoform X1 [Condylura cristata]
Length=887

 Score = 98.2 bits (243),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 53/159 (33%), Positives = 80/159 (50%), Gaps = 2/159 (1%)
 Frame = +3

Query  189  GNEFRFFLSCDINLPVTFRIERLE--gklpppklpgSDGVDTMMNAIDDRKPELYVESTL  362
              +F +  SCD+++ V  +I  LE   +    K    D +        D   +L+V   +
Sbjct  4    AEKFHYIYSCDLDINVQLKIGSLEGKREQKSYKAVLEDPMLKFSGLYQDTCSDLFVTCQV  63

Query  363  YIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIG  542
            + +G P  LP+RT  ++    + WNE + L  KY DL  N+Q+ALT+WDV        +G
Sbjct  64   FAEGKPLALPVRTSYKAFSTRWNWNEWLKLPVKYPDLPRNAQVALTIWDVYGPGKAVPVG  123

Query  543  GATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGK  659
            G T+ LF      + G H L++W   EADGS  T TPG+
Sbjct  124  GTTVSLFGKYGMFRQGMHDLKVWPNVEADGSEPTKTPGR  162



>ref|XP_007081865.1| PREDICTED: LOW QUALITY PROTEIN: phosphatidylinositol 3-kinase 
catalytic subunit type 3 [Panthera tigris altaica]
Length=887

 Score = 98.2 bits (243),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 53/159 (33%), Positives = 80/159 (50%), Gaps = 2/159 (1%)
 Frame = +3

Query  189  GNEFRFFLSCDINLPVTFRIERLE--gklpppklpgSDGVDTMMNAIDDRKPELYVESTL  362
              +F +  SCD+++ V  +I  LE   +    K    D +        +   +LYV   +
Sbjct  4    AEKFHYIYSCDLDINVQLKIGSLEGKREQKSYKAVLEDPMLKFSGLYQETCSDLYVTCQV  63

Query  363  YIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIG  542
            + +G P  LP+RT  ++    + WNE + L  KY DL  N+Q+ALT+WDV        +G
Sbjct  64   FAEGKPLALPVRTSYKAFSTRWNWNEWLKLPLKYPDLXXNAQVALTIWDVYGPGKAVPVG  123

Query  543  GATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGK  659
            G T+ LF      + G H L++W   EADGS  T TPG+
Sbjct  124  GTTVSLFGKYGMFRQGMHDLKVWPNVEADGSEPTKTPGR  162



>gb|EPQ15843.1| Phosphatidylinositol 3-kinase catalytic subunit type 3 [Myotis 
brandtii]
Length=1031

 Score = 98.2 bits (243),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 53/159 (33%), Positives = 80/159 (50%), Gaps = 2/159 (1%)
 Frame = +3

Query  189  GNEFRFFLSCDINLPVTFRIERLE--gklpppklpgSDGVDTMMNAIDDRKPELYVESTL  362
              +F +  SCD+++ V  +I  LE   +    K    D +        +   +LYV   +
Sbjct  4    AEKFHYIYSCDLDINVRLKIGSLEGKREQKSYKAVLEDPMLKFSGLYQETCSDLYVTCQV  63

Query  363  YIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIG  542
            + +G P  LP+RT  ++    + WNE + L  KY DL  N+Q+ALT+WDV        +G
Sbjct  64   FAEGKPLALPVRTSYKAFSTRWNWNEWLKLPVKYPDLPRNAQVALTIWDVYGPGKAVPVG  123

Query  543  GATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGK  659
            G T+ LF      + G H L++W   EADGS  T TPG+
Sbjct  124  GTTVSLFGKYGMFRQGMHDLKVWPNVEADGSEPTKTPGR  162



>ref|XP_007563698.1| PREDICTED: phosphatidylinositol 3-kinase catalytic subunit type 
3 [Poecilia formosa]
Length=876

 Score = 98.2 bits (243),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 56/162 (35%), Positives = 84/162 (52%), Gaps = 4/162 (2%)
 Frame = +3

Query  183  MSGNEFRFFLSCDINLPVTFRIERLEgklpppklpgSDGVDTMMN---AIDDRKPELYVE  353
            M  ++F +  SCD+++ V  +I  LEGK          G D M+       +   +LYV 
Sbjct  1    MDTDKFNYVYSCDLDINVQLKIGSLEGKREQKSYKALLG-DPMLRFSGLYQENCSDLYVT  59

Query  354  STLYIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEG  533
              ++ +G P  LP+RT  ++    + WNE + L  KY DL  ++Q+ALTVWD+       
Sbjct  60   CQVFAEGKPLALPVRTSYKAFSTRWNWNEWLRLPVKYPDLPQSAQVALTVWDIYGPGRAV  119

Query  534  VIGGATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGK  659
             +GG T+ LF      + G H L++W G E DG   TTTPG+
Sbjct  120  PVGGTTVTLFGKYGMFRQGMHDLKVWPGVEGDGGEPTTTPGR  161



>emb|CDQ69823.1| unnamed protein product [Oncorhynchus mykiss]
Length=878

 Score = 98.2 bits (243),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 53/161 (33%), Positives = 82/161 (51%), Gaps = 2/161 (1%)
 Frame = +3

Query  183  MSGNEFRFFLSCDINLPVTFRIERLE--gklpppklpgSDGVDTMMNAIDDRKPELYVES  356
            M  ++F +  SCD+++ V  +I  LE   +    K    D +        +   +LYV  
Sbjct  1    MDTDKFNYVYSCDLDINVQLKIGSLEGKREQKSYKALLQDPMLRFSGLYQENCSDLYVTC  60

Query  357  TLYIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGV  536
             ++ +G P  LP+RT  ++    + WNE + L  KY DL  ++Q+ALTVWDV        
Sbjct  61   QVFAEGKPLALPVRTSYKAFSTRWNWNEWLKLPVKYPDLPQSAQVALTVWDVYGPGRATP  120

Query  537  IGGATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGK  659
            +GG T+ LF      + G H L++W G E DG   T+TPG+
Sbjct  121  VGGTTVTLFGKYGMFRQGMHDLKVWPGVEGDGGEPTSTPGR  161



>ref|XP_010636318.1| PREDICTED: phosphatidylinositol 3-kinase catalytic subunit type 
3 isoform X3 [Fukomys damarensis]
Length=763

 Score = 97.8 bits (242),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 53/159 (33%), Positives = 80/159 (50%), Gaps = 2/159 (1%)
 Frame = +3

Query  189  GNEFRFFLSCDINLPVTFRIERLE--gklpppklpgSDGVDTMMNAIDDRKPELYVESTL  362
              +F +  SCD+++ V  +I  LE   +    K    D +        +   +LYV   +
Sbjct  4    AEKFHYIYSCDLDINVQLKIGSLEGKREQKSYKAVLEDPMLKFSGLYQETCSDLYVTCQV  63

Query  363  YIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIG  542
            + +G P  LP+RT  ++    + WNE + L  KY DL  N+Q+ALT+WDV        +G
Sbjct  64   FAEGKPLALPVRTSYKAFSTRWNWNEWLKLPVKYPDLPRNAQVALTIWDVYGPGRAVPVG  123

Query  543  GATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGK  659
            G T+ LF      + G H L++W   EADGS  T TPG+
Sbjct  124  GTTVSLFGKYGMFRQGMHDLKVWPNVEADGSEPTKTPGR  162



>ref|NP_001012974.1| phosphatidylinositol 3-kinase catalytic subunit type 3 [Sus scrofa]
 sp|Q5D891.1|PK3C3_PIG RecName: Full=Phosphatidylinositol 3-kinase catalytic subunit 
type 3; Short=PI3-kinase type 3; Short=PI3K type 3; Short=PtdIns-3-kinase 
type 3; AltName: Full=Phosphoinositide-3-kinase 
class 3 [Sus scrofa]
 gb|AAX12416.1| class 3 phosphoinositide-3-kinase [Sus scrofa]
Length=887

 Score = 98.2 bits (243),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 53/159 (33%), Positives = 80/159 (50%), Gaps = 2/159 (1%)
 Frame = +3

Query  189  GNEFRFFLSCDINLPVTFRIERLE--gklpppklpgSDGVDTMMNAIDDRKPELYVESTL  362
              +F +  SCD+++ V  +I  LE   +    K    D +        +   +LYV   +
Sbjct  4    AEKFHYIYSCDLDINVQLKIGSLEGKREQKSYKAVLEDPMLKFSGLYQETCSDLYVTCQV  63

Query  363  YIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIG  542
            + +G P  LP+RT  ++    + WNE + L  KY DL  N+Q+ALT+WDV        +G
Sbjct  64   FAEGKPLALPVRTSYKAFSTRWNWNEWLKLPVKYPDLPRNAQVALTIWDVYGPGKAVPVG  123

Query  543  GATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGK  659
            G T+ LF      + G H L++W   EADGS  T TPG+
Sbjct  124  GTTVSLFGKYGMFRQGMHDLKVWPNVEADGSEPTKTPGR  162



>ref|XP_007972369.1| PREDICTED: phosphatidylinositol 3-kinase catalytic subunit type 
3 isoform X1 [Chlorocebus sabaeus]
Length=948

 Score = 98.2 bits (243),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 53/159 (33%), Positives = 80/159 (50%), Gaps = 2/159 (1%)
 Frame = +3

Query  189  GNEFRFFLSCDINLPVTFRIERLE--gklpppklpgSDGVDTMMNAIDDRKPELYVESTL  362
              +F +  SCD+++ V  +I  LE   +    K    D +        +   +LYV   +
Sbjct  65   AEKFHYIYSCDLDINVQLKIGSLEGKREQKSYKAVLEDPMLKFSGLYQETCSDLYVTCQV  124

Query  363  YIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIG  542
            + +G P  LP+RT  ++    + WNE + L  KY DL  N+Q+ALT+WDV        +G
Sbjct  125  FAEGKPLALPVRTSYKAFSTRWNWNEWLKLPVKYPDLPRNAQVALTIWDVYGPGKAVPVG  184

Query  543  GATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGK  659
            G T+ LF      + G H L++W   EADGS  T TPG+
Sbjct  185  GTTVSLFGKYGMFRQGMHDLKVWPNVEADGSEPTKTPGR  223



>ref|XP_010357092.1| PREDICTED: phosphatidylinositol 3-kinase catalytic subunit type 
3 isoform X1 [Rhinopithecus roxellana]
Length=887

 Score = 97.8 bits (242),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 53/159 (33%), Positives = 80/159 (50%), Gaps = 2/159 (1%)
 Frame = +3

Query  189  GNEFRFFLSCDINLPVTFRIERLE--gklpppklpgSDGVDTMMNAIDDRKPELYVESTL  362
              +F +  SCD+++ V  +I  LE   +    K    D +        +   +LYV   +
Sbjct  4    AEKFHYIYSCDLDINVQLKIGSLEGKREQKSYKAVLEDPMLKFSGLYQETCSDLYVTCQV  63

Query  363  YIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIG  542
            + +G P  LP+RT  ++    + WNE + L  KY DL  N+Q+ALT+WDV        +G
Sbjct  64   FAEGKPLALPVRTSYKAFSTRWNWNEWLKLPVKYPDLPRNAQVALTIWDVYGPGKAVPVG  123

Query  543  GATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGK  659
            G T+ LF      + G H L++W   EADGS  T TPG+
Sbjct  124  GTTVSLFGKYGMFRQGMHDLKVWPNVEADGSEPTKTPGR  162



>emb|CEP14473.1| hypothetical protein [Parasitella parasitica]
Length=836

 Score = 97.8 bits (242),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 55/156 (35%), Positives = 83/156 (53%), Gaps = 13/156 (8%)
 Frame = +3

Query  195  EFRFFLSCDINLPVTFRIERLEgklpppklpgSDGVDTMMNAIDDRKPELYVESTLYIDG  374
            +F + L+ D+ LPV+ RI  LE            G   ++    D  P+LY+   L+ D 
Sbjct  2    DFSYCLTKDVKLPVSIRIATLE------------GKRDILQQ-QDYLPDLYLTVQLFADN  48

Query  375  APFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIGGATI  554
             P  +P++T  ++    + WNE +TL  KY DL +++Q A+TVW     +    IGG T+
Sbjct  49   KPLTVPVKTSYKAFRNHWSWNEWLTLPIKYCDLPSSAQFAITVWKTIGPRKVKPIGGTTL  108

Query  555  HLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKV  662
             LF  +  L+ GK KL LW   EADG+  T+TP K+
Sbjct  109  RLFGKQFTLRKGKQKLHLWPDCEADGNHDTSTPSKL  144



>ref|XP_003267603.1| PREDICTED: LOW QUALITY PROTEIN: phosphatidylinositol 3-kinase 
catalytic subunit type 3 [Nomascus leucogenys]
Length=887

 Score = 97.8 bits (242),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 53/159 (33%), Positives = 80/159 (50%), Gaps = 2/159 (1%)
 Frame = +3

Query  189  GNEFRFFLSCDINLPVTFRIERLE--gklpppklpgSDGVDTMMNAIDDRKPELYVESTL  362
              +F +  SCD+++ V  +I  LE   +    K    D +        +   +LYV   +
Sbjct  4    AEKFHYIYSCDLDINVQLKIGSLEGKREQKSYKAVLEDPMLKFSGLYQETCSDLYVTCQV  63

Query  363  YIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIG  542
            + +G P  LP+RT  ++    + WNE + L  KY DL  N+Q+ALT+WDV        +G
Sbjct  64   FAEGKPLALPVRTSYKAFSTRWNWNEWLKLPVKYPDLPRNAQVALTIWDVYGPGKAVPVG  123

Query  543  GATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGK  659
            G T+ LF      + G H L++W   EADGS  T TPG+
Sbjct  124  GTTVSLFGKYGMFRQGMHDLKVWPNVEADGSEPTKTPGR  162



>ref|XP_004623771.1| PREDICTED: phosphatidylinositol 3-kinase catalytic subunit type 
3 [Octodon degus]
Length=961

 Score = 98.2 bits (243),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 53/159 (33%), Positives = 80/159 (50%), Gaps = 2/159 (1%)
 Frame = +3

Query  189  GNEFRFFLSCDINLPVTFRIERLE--gklpppklpgSDGVDTMMNAIDDRKPELYVESTL  362
              +F +  SCD+++ V  +I  LE   +    K    D +        +   +LYV   +
Sbjct  4    AEKFHYIYSCDLDINVQLKIGSLEGKREQKSYKAVLEDPMLKFSGLYQETCSDLYVTCQV  63

Query  363  YIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIG  542
            + +G P  LP+RT  ++    + WNE + L  KY DL  N+Q+ALT+WDV        +G
Sbjct  64   FAEGKPLALPVRTSYKAFSTRWNWNEWLKLPVKYPDLPRNAQVALTIWDVYGPGKAVPVG  123

Query  543  GATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGK  659
            G T+ LF      + G H L++W   EADGS  T TPG+
Sbjct  124  GTTVSLFGKYGMFRQGMHDLKVWPNVEADGSEPTKTPGR  162



>ref|NP_002638.2| phosphatidylinositol 3-kinase catalytic subunit type 3 [Homo 
sapiens]
 ref|XP_001142812.1| PREDICTED: phosphatidylinositol 3-kinase catalytic subunit type 
3 isoform X1 [Pan troglodytes]
 ref|XP_003830260.1| PREDICTED: phosphatidylinositol 3-kinase catalytic subunit type 
3 isoform X1 [Pan paniscus]
 sp|Q8NEB9.1|PK3C3_HUMAN RecName: Full=Phosphatidylinositol 3-kinase catalytic subunit 
type 3; Short=PI3-kinase type 3; Short=PI3K type 3; Short=PtdIns-3-kinase 
type 3; AltName: Full=Phosphatidylinositol 3-kinase 
p100 subunit; AltName: Full=Phosphoinositide-3-kinase 
class 3; AltName: Full=hVps34 [Homo sapiens]
 gb|AAH33004.1| Phosphoinositide-3-kinase, class 3 [Homo sapiens]
 gb|AAH53651.1| Phosphoinositide-3-kinase, class 3 [Homo sapiens]
 gb|EAX01426.1| phosphoinositide-3-kinase, class 3 [Homo sapiens]
 gb|ABM84638.1| phosphoinositide-3-kinase, class 3 [synthetic construct]
 gb|ABM92169.1| phosphoinositide-3-kinase, class 3 [synthetic construct]
 dbj|BAG72683.1| phosphoinositide-3-kinase, class 3 [synthetic construct]
Length=887

 Score = 97.8 bits (242),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 53/159 (33%), Positives = 80/159 (50%), Gaps = 2/159 (1%)
 Frame = +3

Query  189  GNEFRFFLSCDINLPVTFRIERLE--gklpppklpgSDGVDTMMNAIDDRKPELYVESTL  362
              +F +  SCD+++ V  +I  LE   +    K    D +        +   +LYV   +
Sbjct  4    AEKFHYIYSCDLDINVQLKIGSLEGKREQKSYKAVLEDPMLKFSGLYQETCSDLYVTCQV  63

Query  363  YIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIG  542
            + +G P  LP+RT  ++    + WNE + L  KY DL  N+Q+ALT+WDV        +G
Sbjct  64   FAEGKPLALPVRTSYKAFSTRWNWNEWLKLPVKYPDLPRNAQVALTIWDVYGPGKAVPVG  123

Query  543  GATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGK  659
            G T+ LF      + G H L++W   EADGS  T TPG+
Sbjct  124  GTTVSLFGKYGMFRQGMHDLKVWPNVEADGSEPTKTPGR  162



>ref|XP_002828227.1| PREDICTED: phosphatidylinositol 3-kinase catalytic subunit type 
3 isoform X1 [Pongo abelii]
Length=887

 Score = 97.8 bits (242),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 53/159 (33%), Positives = 80/159 (50%), Gaps = 2/159 (1%)
 Frame = +3

Query  189  GNEFRFFLSCDINLPVTFRIERLE--gklpppklpgSDGVDTMMNAIDDRKPELYVESTL  362
              +F +  SCD+++ V  +I  LE   +    K    D +        +   +LYV   +
Sbjct  4    AEKFHYIYSCDLDINVQLKIGSLEGKREQKSYKAVLEDPMLKFSGLYQETCSDLYVTCQV  63

Query  363  YIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIG  542
            + +G P  LP+RT  ++    + WNE + L  KY DL  N+Q+ALT+WDV        +G
Sbjct  64   FAEGKPLALPVRTSYKAFSTRWNWNEWLKLPVKYPDLPRNAQVALTIWDVYGPGKAVPVG  123

Query  543  GATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGK  659
            G T+ LF      + G H L++W   EADGS  T TPG+
Sbjct  124  GTTVSLFGKYGMFRQGMHDLKVWPNVEADGSEPTKTPGR  162



>ref|XP_005372904.1| PREDICTED: phosphatidylinositol 3-kinase catalytic subunit type 
3 [Chinchilla lanigera]
Length=886

 Score = 97.8 bits (242),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 53/159 (33%), Positives = 80/159 (50%), Gaps = 2/159 (1%)
 Frame = +3

Query  189  GNEFRFFLSCDINLPVTFRIERLE--gklpppklpgSDGVDTMMNAIDDRKPELYVESTL  362
              +F +  SCD+++ V  +I  LE   +    K    D +        +   +LYV   +
Sbjct  4    AEKFHYIYSCDLDINVQLKIGSLEGKREQKSYKAVLEDPMLKFSGLYQETCSDLYVTCQV  63

Query  363  YIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIG  542
            + +G P  LP+RT  ++    + WNE + L  KY DL  N+Q+ALT+WDV        +G
Sbjct  64   FAEGKPLALPVRTSYKAFSTRWNWNEWLKLPVKYPDLPRNAQVALTIWDVYGPGKAVPVG  123

Query  543  GATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGK  659
            G T+ LF      + G H L++W   EADGS  T TPG+
Sbjct  124  GTTVSLFGKYGMFRQGMHDLKVWPNVEADGSEPTKTPGR  162



>ref|XP_010844759.1| PREDICTED: phosphatidylinositol 3-kinase catalytic subunit type 
3 isoform X2 [Bison bison bison]
Length=853

 Score = 97.8 bits (242),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 53/159 (33%), Positives = 80/159 (50%), Gaps = 2/159 (1%)
 Frame = +3

Query  189  GNEFRFFLSCDINLPVTFRIERLE--gklpppklpgSDGVDTMMNAIDDRKPELYVESTL  362
              +F +  SCD+++ V  +I  LE   +    K    D +        +   +LYV   +
Sbjct  4    AEKFHYVYSCDLDINVQLKIGSLEGKREQKSYKAVLEDPMLKFSGLYQETCSDLYVTCQV  63

Query  363  YIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIG  542
            + +G P  LP+RT  ++    + WNE + L  KY DL  N+Q+ALT+WDV        +G
Sbjct  64   FAEGKPLALPVRTSYKAFSTRWNWNEWLKLPVKYPDLPRNAQVALTIWDVYGPGKAVPVG  123

Query  543  GATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGK  659
            G T+ LF      + G H L++W   EADGS  T TPG+
Sbjct  124  GTTVSLFGKYGMFRQGMHDLKVWPNVEADGSEPTKTPGR  162



>ref|NP_001274089.1| phosphatidylinositol 3-kinase catalytic subunit type 3 [Canis 
lupus familiaris]
Length=887

 Score = 97.8 bits (242),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 53/159 (33%), Positives = 80/159 (50%), Gaps = 2/159 (1%)
 Frame = +3

Query  189  GNEFRFFLSCDINLPVTFRIERLE--gklpppklpgSDGVDTMMNAIDDRKPELYVESTL  362
              +F +  SCD+++ V  +I  LE   +    K    D +        +   +LYV   +
Sbjct  4    AEKFHYIYSCDLDINVQLKIGSLEGKREQKSYKAVLEDPMLKFSGLYQETCSDLYVTCQV  63

Query  363  YIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIG  542
            + +G P  LP+RT  ++    + WNE + L  KY DL  N+Q+ALT+WDV        +G
Sbjct  64   FAEGKPLALPVRTSYKAFSTRWNWNEWLKLPVKYPDLPRNAQVALTIWDVYGPGKAVPVG  123

Query  543  GATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGK  659
            G T+ LF      + G H L++W   EADGS  T TPG+
Sbjct  124  GTTVSLFGKYGMFRQGMHDLKVWPNVEADGSEPTKTPGR  162



>ref|XP_006938926.1| PREDICTED: phosphatidylinositol 3-kinase catalytic subunit type 
3 isoform X2 [Felis catus]
Length=825

 Score = 97.8 bits (242),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 53/159 (33%), Positives = 80/159 (50%), Gaps = 2/159 (1%)
 Frame = +3

Query  189  GNEFRFFLSCDINLPVTFRIERLE--gklpppklpgSDGVDTMMNAIDDRKPELYVESTL  362
              +F +  SCD+++ V  +I  LE   +    K    D +        +   +LYV   +
Sbjct  4    AEKFHYIYSCDLDINVQLKIGSLEGKREQKSYKAVLEDPMLKFSGLYQETCSDLYVTCQV  63

Query  363  YIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIG  542
            + +G P  LP+RT  ++    + WNE + L  KY DL  N+Q+ALT+WDV        +G
Sbjct  64   FAEGKPLALPVRTSYKAFSTRWNWNEWLKLPVKYPDLPRNAQVALTIWDVYGPGKAVPVG  123

Query  543  GATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGK  659
            G T+ LF      + G H L++W   EADGS  T TPG+
Sbjct  124  GTTVSLFGKYGMFRQGMHDLKVWPNVEADGSEPTKTPGR  162



>ref|XP_010636317.1| PREDICTED: phosphatidylinositol 3-kinase catalytic subunit type 
3 isoform X2 [Fukomys damarensis]
Length=852

 Score = 97.8 bits (242),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 53/159 (33%), Positives = 80/159 (50%), Gaps = 2/159 (1%)
 Frame = +3

Query  189  GNEFRFFLSCDINLPVTFRIERLE--gklpppklpgSDGVDTMMNAIDDRKPELYVESTL  362
              +F +  SCD+++ V  +I  LE   +    K    D +        +   +LYV   +
Sbjct  4    AEKFHYIYSCDLDINVQLKIGSLEGKREQKSYKAVLEDPMLKFSGLYQETCSDLYVTCQV  63

Query  363  YIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIG  542
            + +G P  LP+RT  ++    + WNE + L  KY DL  N+Q+ALT+WDV        +G
Sbjct  64   FAEGKPLALPVRTSYKAFSTRWNWNEWLKLPVKYPDLPRNAQVALTIWDVYGPGRAVPVG  123

Query  543  GATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGK  659
            G T+ LF      + G H L++W   EADGS  T TPG+
Sbjct  124  GTTVSLFGKYGMFRQGMHDLKVWPNVEADGSEPTKTPGR  162



>ref|XP_007464231.1| PREDICTED: phosphatidylinositol 3-kinase catalytic subunit type 
3-like isoform X1 [Lipotes vexillifer]
Length=887

 Score = 97.8 bits (242),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 53/159 (33%), Positives = 80/159 (50%), Gaps = 2/159 (1%)
 Frame = +3

Query  189  GNEFRFFLSCDINLPVTFRIERLE--gklpppklpgSDGVDTMMNAIDDRKPELYVESTL  362
              +F +  SCD+++ V  +I  LE   +    K    D +        +   +LYV   +
Sbjct  4    AEKFHYIYSCDLDINVQLKIGSLEGKREQKSYKAVLEDPMLKFSGLYQETCSDLYVTCQV  63

Query  363  YIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIG  542
            + +G P  LP+RT  ++    + WNE + L  KY DL  N+Q+ALT+WDV        +G
Sbjct  64   FAEGKPLALPVRTSYKAFSTRWNWNEWLKLPVKYPDLPRNAQVALTIWDVYGPGKAVPVG  123

Query  543  GATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGK  659
            G T+ LF      + G H L++W   EADGS  T TPG+
Sbjct  124  GTTVSLFGKYGMFRQGMHDLKVWPNVEADGSEPTKTPGR  162



>ref|XP_005355906.1| PREDICTED: phosphatidylinositol 3-kinase catalytic subunit type 
3-like [Microtus ochrogaster]
Length=887

 Score = 97.8 bits (242),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 53/159 (33%), Positives = 80/159 (50%), Gaps = 2/159 (1%)
 Frame = +3

Query  189  GNEFRFFLSCDINLPVTFRIERLE--gklpppklpgSDGVDTMMNAIDDRKPELYVESTL  362
              +F +  SCD+++ V  +I  LE   +    K    D +        +   +LYV   +
Sbjct  4    AEKFHYIYSCDLDINVQLKIGSLEGKREQKSYKAVLEDPMLKFSGLYQETCSDLYVTCQV  63

Query  363  YIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIG  542
            + +G P  LP+RT  ++    + WNE + L  KY DL  N+Q+ALT+WDV        +G
Sbjct  64   FAEGKPLALPVRTSYKAFSTRWNWNEWLKLPVKYPDLPRNAQVALTIWDVYGPGKAVPVG  123

Query  543  GATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGK  659
            G T+ LF      + G H L++W   EADGS  T TPG+
Sbjct  124  GTTVSLFGKYGMFRQGMHDLKVWPNVEADGSEPTRTPGR  162



>ref|XP_004752293.1| PREDICTED: phosphatidylinositol 3-kinase catalytic subunit type 
3 isoform X2 [Mustela putorius furo]
 ref|XP_004815333.1| PREDICTED: phosphatidylinositol 3-kinase catalytic subunit type 
3 isoform X2 [Mustela putorius furo]
Length=887

 Score = 97.8 bits (242),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 53/159 (33%), Positives = 80/159 (50%), Gaps = 2/159 (1%)
 Frame = +3

Query  189  GNEFRFFLSCDINLPVTFRIERLE--gklpppklpgSDGVDTMMNAIDDRKPELYVESTL  362
              +F +  SCD+++ V  +I  LE   +    K    D +        +   +LYV   +
Sbjct  4    AEKFHYIYSCDLDINVQLKIGSLEGKREQKSYKAVLEDPMLKFSGLYQETCSDLYVTCQV  63

Query  363  YIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIG  542
            + +G P  LP+RT  ++    + WNE + L  KY DL  N+Q+ALT+WDV        +G
Sbjct  64   FAEGKPLALPVRTSYKAFSTRWNWNEWLKLPVKYPDLPRNAQVALTIWDVYGPGKAVPVG  123

Query  543  GATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGK  659
            G T+ LF      + G H L++W   EADGS  T TPG+
Sbjct  124  GTTVSLFGKYGMFRQGMHDLKVWPNVEADGSEPTKTPGR  162



>ref|XP_005896412.1| PREDICTED: LOW QUALITY PROTEIN: phosphatidylinositol 3-kinase 
catalytic subunit type 3-like [Bos mutus]
Length=887

 Score = 97.8 bits (242),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 53/159 (33%), Positives = 80/159 (50%), Gaps = 2/159 (1%)
 Frame = +3

Query  189  GNEFRFFLSCDINLPVTFRIERLE--gklpppklpgSDGVDTMMNAIDDRKPELYVESTL  362
              +F +  SCD+++ V  +I  LE   +    K    D +        +   +LYV   +
Sbjct  4    AEKFHYVYSCDLDINVQLKIGSLEGKREQKSYKAVLEDPMLKFSGLYQETCSDLYVTCQV  63

Query  363  YIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIG  542
            + +G P  LP+RT  ++    + WNE + L  KY DL  N+Q+ALT+WDV        +G
Sbjct  64   FAEGKPLALPVRTSYKAFSTRWNWNEWLKLPVKYPDLPXNAQVALTIWDVYGPGKAVPVG  123

Query  543  GATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGK  659
            G T+ LF      + G H L++W   EADGS  T TPG+
Sbjct  124  GTTVSLFGKYGMFRQGMHDLKVWPNVEADGSEPTKTPGR  162



>ref|XP_005586880.1| PREDICTED: phosphatidylinositol 3-kinase catalytic subunit type 
3 [Macaca fascicularis]
Length=887

 Score = 97.8 bits (242),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 53/159 (33%), Positives = 80/159 (50%), Gaps = 2/159 (1%)
 Frame = +3

Query  189  GNEFRFFLSCDINLPVTFRIERLE--gklpppklpgSDGVDTMMNAIDDRKPELYVESTL  362
              +F +  SCD+++ V  +I  LE   +    K    D +        +   +LYV   +
Sbjct  4    AEKFHYIYSCDLDINVQLKIGSLEGKREQKSYKAVLEDPMLKFSGLYQETCSDLYVTCQV  63

Query  363  YIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIG  542
            + +G P  LP+RT  ++    + WNE + L  KY DL  N+Q+ALT+WDV        +G
Sbjct  64   FAEGKPLALPVRTSYKAFSTRWNWNEWLKLPVKYPDLPRNAQVALTIWDVYGPGKAVPVG  123

Query  543  GATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGK  659
            G T+ LF      + G H L++W   EADGS  T TPG+
Sbjct  124  GTTVSLFGKYGMFRQGMHDLKVWPNVEADGSEPTKTPGR  162



>ref|XP_004283586.1| PREDICTED: phosphatidylinositol 3-kinase catalytic subunit type 
3-like isoform 1 [Orcinus orca]
Length=887

 Score = 97.8 bits (242),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 53/159 (33%), Positives = 80/159 (50%), Gaps = 2/159 (1%)
 Frame = +3

Query  189  GNEFRFFLSCDINLPVTFRIERLE--gklpppklpgSDGVDTMMNAIDDRKPELYVESTL  362
              +F +  SCD+++ V  +I  LE   +    K    D +        +   +LYV   +
Sbjct  4    AEKFHYIYSCDLDINVQLKIGSLEGKREQKSYKAVLEDPMLKFSGLYQETCSDLYVTCQV  63

Query  363  YIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIG  542
            + +G P  LP+RT  ++    + WNE + L  KY DL  N+Q+ALT+WDV        +G
Sbjct  64   FAEGKPLALPVRTSYKAFSTRWNWNEWLKLPVKYPDLPRNAQVALTIWDVYGPGKAVPVG  123

Query  543  GATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGK  659
            G T+ LF      + G H L++W   EADGS  T TPG+
Sbjct  124  GTTVSLFGKYGMFRQGMHDLKVWPNVEADGSEPTKTPGR  162



>ref|XP_003995198.1| PREDICTED: phosphatidylinositol 3-kinase catalytic subunit type 
3 isoform X1 [Felis catus]
Length=887

 Score = 97.8 bits (242),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 53/159 (33%), Positives = 80/159 (50%), Gaps = 2/159 (1%)
 Frame = +3

Query  189  GNEFRFFLSCDINLPVTFRIERLE--gklpppklpgSDGVDTMMNAIDDRKPELYVESTL  362
              +F +  SCD+++ V  +I  LE   +    K    D +        +   +LYV   +
Sbjct  4    AEKFHYIYSCDLDINVQLKIGSLEGKREQKSYKAVLEDPMLKFSGLYQETCSDLYVTCQV  63

Query  363  YIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIG  542
            + +G P  LP+RT  ++    + WNE + L  KY DL  N+Q+ALT+WDV        +G
Sbjct  64   FAEGKPLALPVRTSYKAFSTRWNWNEWLKLPVKYPDLPRNAQVALTIWDVYGPGKAVPVG  123

Query  543  GATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGK  659
            G T+ LF      + G H L++W   EADGS  T TPG+
Sbjct  124  GTTVSLFGKYGMFRQGMHDLKVWPNVEADGSEPTKTPGR  162



>ref|XP_009190905.1| PREDICTED: LOW QUALITY PROTEIN: phosphatidylinositol 3-kinase 
catalytic subunit type 3 [Papio anubis]
Length=888

 Score = 97.8 bits (242),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 53/159 (33%), Positives = 80/159 (50%), Gaps = 2/159 (1%)
 Frame = +3

Query  189  GNEFRFFLSCDINLPVTFRIERLE--gklpppklpgSDGVDTMMNAIDDRKPELYVESTL  362
              +F +  SCD+++ V  +I  LE   +    K    D +        +   +LYV   +
Sbjct  4    AEKFHYIYSCDLDINVQLKIGSLEGKREQKSYKAVLEDPMLKFSGLYQETCSDLYVTCQV  63

Query  363  YIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIG  542
            + +G P  LP+RT  ++    + WNE + L  KY DL  N+Q+ALT+WDV        +G
Sbjct  64   FAEGKPLALPVRTSYKAFSTRWNWNEWLKLPVKYPDLPRNAQVALTIWDVYGPGKAVPVG  123

Query  543  GATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGK  659
            G T+ LF      + G H L++W   EADGS  T TPG+
Sbjct  124  GTTVSLFGKYGMFRQGMHDLKVWPNVEADGSEPTKTPGR  162



>gb|KDQ59030.1| hypothetical protein JAAARDRAFT_33751 [Jaapia argillacea MUCL 
33604]
Length=871

 Score = 97.8 bits (242),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 65/166 (39%), Positives = 85/166 (51%), Gaps = 16/166 (10%)
 Frame = +3

Query  192  NEFRFFLSCDINLPVTFRIERLE--------gklpppklpgSDGVDTMMNAIDDRKPELY  347
            ++F F    D+ LPVTFRI  L          +L         GV +   A+ D    LY
Sbjct  7    DDFTFAKLSDLKLPVTFRISELSGTRPKKSFTELLAHPELRFHGVQS--QALSD----LY  60

Query  348  VESTLYIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKS  527
            V   L  D  P  +P RT  ++    Y WNE I+L  +Y DL  +SQ+  TV+D S G  
Sbjct  61   VTCQLVADNKPLTIPFRTSFKAFKNGYTWNEYISLPIRYCDLPLSSQITFTVYD-SAGPR  119

Query  528  EGV-IGGATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGKV  662
            E V +GG T  +F  K  L+ GKH+L LW G EAD S+ TTTP K+
Sbjct  120  ETVPVGGTTWRVFGKKWTLRRGKHRLHLWPGVEADPSLDTTTPSKL  165



>ref|XP_004059400.1| PREDICTED: phosphatidylinositol 3-kinase catalytic subunit type 
3, partial [Gorilla gorilla gorilla]
Length=883

 Score = 97.8 bits (242),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 53/159 (33%), Positives = 80/159 (50%), Gaps = 2/159 (1%)
 Frame = +3

Query  189  GNEFRFFLSCDINLPVTFRIERLE--gklpppklpgSDGVDTMMNAIDDRKPELYVESTL  362
              +F +  SCD+++ V  +I  LE   +    K    D +        +   +LYV   +
Sbjct  4    AEKFHYIYSCDLDINVQLKIGSLEGKREQKSYKAVLEDPMLKFSGLYQETCSDLYVTCQV  63

Query  363  YIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIG  542
            + +G P  LP+RT  ++    + WNE + L  KY DL  N+Q+ALT+WDV        +G
Sbjct  64   FAEGKPLALPVRTSYKAFSTRWNWNEWLKLPVKYPDLPRNAQVALTIWDVYGPGKAVPVG  123

Query  543  GATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGK  659
            G T+ LF      + G H L++W   EADGS  T TPG+
Sbjct  124  GTTVSLFGKYGMFRQGMHDLKVWPNVEADGSEPTKTPGR  162



>ref|XP_004422540.1| PREDICTED: phosphatidylinositol 3-kinase catalytic subunit type 
3 isoform 1 [Ceratotherium simum simum]
Length=887

 Score = 97.8 bits (242),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 53/159 (33%), Positives = 80/159 (50%), Gaps = 2/159 (1%)
 Frame = +3

Query  189  GNEFRFFLSCDINLPVTFRIERLE--gklpppklpgSDGVDTMMNAIDDRKPELYVESTL  362
              +F +  SCD+++ V  +I  LE   +    K    D +        +   +LYV   +
Sbjct  4    AEKFHYIYSCDLDINVQLKIGSLEGKREQKSYKAVLEDPMLKFSGLYQETCSDLYVTCQV  63

Query  363  YIDGAPFGLPMRTRLESRGPSYCWNELITLSTKYRDLTANSQLALTVWDVSCGKSEGVIG  542
            + +G P  LP+RT  ++    + WNE + L  KY DL  N+Q+ALT+WDV        +G
Sbjct  64   FAEGKPLALPVRTSYKAFSTRWNWNEWLKLPVKYPDLPRNAQVALTIWDVYGPGKAVPVG  123

Query  543  GATIHLFNMKKQLKTGKHKLRLWSGKEADGSIHTTTPGK  659
            G T+ LF      + G H L++W   EADGS  T TPG+
Sbjct  124  GTTVSLFGKYGMFRQGMHDLKVWPNVEADGSEPTKTPGR  162



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1260188911410