BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF045G10

Length=768
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009599649.1|  PREDICTED: RING finger protein 10                  164   1e-42   Nicotiana tomentosiformis
ref|XP_009800276.1|  PREDICTED: RING finger protein 10                  159   7e-41   Nicotiana sylvestris
ref|XP_006338736.1|  PREDICTED: RING finger protein 10-like             154   3e-39   Solanum tuberosum [potatoes]
emb|CBI21277.3|  unnamed protein product                                150   1e-37   Vitis vinifera
ref|XP_010660682.1|  PREDICTED: RING finger protein 10 isoform X2       150   2e-37   Vitis vinifera
ref|XP_002275712.2|  PREDICTED: RING finger protein 10 isoform X1       150   2e-37   Vitis vinifera
ref|XP_007032024.1|  RING/U-box superfamily protein, putative iso...    147   5e-37   
ref|XP_007032023.1|  RING/U-box superfamily protein, putative iso...    147   5e-37   
ref|XP_010315901.1|  PREDICTED: RING finger protein 10                  148   6e-37   Solanum lycopersicum
ref|XP_007032022.1|  RING/U-box superfamily protein, putative iso...    148   6e-37   Theobroma cacao [chocolate]
gb|KJB70712.1|  hypothetical protein B456_011G088400                    147   1e-36   Gossypium raimondii
gb|KJB70711.1|  hypothetical protein B456_011G088400                    147   2e-36   Gossypium raimondii
ref|XP_010096031.1|  RING finger protein 10                             147   3e-36   
ref|XP_008231028.1|  PREDICTED: RING finger protein 10 isoform X3       144   2e-35   Prunus mume [ume]
ref|XP_008231025.1|  PREDICTED: RING finger protein 10 isoform X1       144   2e-35   Prunus mume [ume]
ref|XP_008231027.1|  PREDICTED: RING finger protein 10 isoform X2       143   4e-35   Prunus mume [ume]
ref|XP_008231029.1|  PREDICTED: RING finger protein 10 isoform X4       143   5e-35   Prunus mume [ume]
ref|XP_011006127.1|  PREDICTED: RING finger protein 10                  140   4e-34   Populus euphratica
ref|XP_002320428.2|  hypothetical protein POPTR_0014s14220g             140   4e-34   Populus trichocarpa [western balsam poplar]
ref|XP_004493075.1|  PREDICTED: RING finger protein 10-like isofo...    140   5e-34   Cicer arietinum [garbanzo]
ref|XP_004493074.1|  PREDICTED: RING finger protein 10-like isofo...    140   6e-34   
ref|XP_002512841.1|  conserved hypothetical protein                     139   9e-34   Ricinus communis
ref|XP_011468214.1|  PREDICTED: RING finger protein 10                  139   9e-34   Fragaria vesca subsp. vesca
ref|XP_003624500.1|  RING finger protein                                137   4e-33   Medicago truncatula
ref|XP_010682974.1|  PREDICTED: RING finger protein 10 isoform X2       137   4e-33   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010682973.1|  PREDICTED: RING finger protein 10 isoform X1       137   4e-33   Beta vulgaris subsp. vulgaris [field beet]
gb|KDP41854.1|  hypothetical protein JCGZ_26872                         137   4e-33   Jatropha curcas
ref|XP_008347984.1|  PREDICTED: RING finger protein 10-like isofo...    137   9e-33   
ref|XP_008347985.1|  PREDICTED: RING finger protein 10-like isofo...    136   1e-32   
emb|CDP16737.1|  unnamed protein product                                133   1e-31   Coffea canephora [robusta coffee]
ref|XP_006468890.1|  PREDICTED: RING finger protein 10-like             133   2e-31   Citrus sinensis [apfelsine]
gb|KCW55769.1|  hypothetical protein EUGRSUZ_I01601                     130   4e-31   Eucalyptus grandis [rose gum]
ref|XP_010028937.1|  PREDICTED: RING finger protein 10                  131   6e-31   Eucalyptus grandis [rose gum]
ref|XP_009378041.1|  PREDICTED: RING finger protein 10 isoform X3       131   8e-31   Pyrus x bretschneideri [bai li]
gb|KDO43572.1|  hypothetical protein CISIN_1g003879mg                   131   1e-30   Citrus sinensis [apfelsine]
ref|XP_006446937.1|  hypothetical protein CICLE_v10014332mg             131   1e-30   Citrus clementina [clementine]
ref|XP_009378043.1|  PREDICTED: RING finger protein 10 isoform X5       130   1e-30   Pyrus x bretschneideri [bai li]
ref|XP_009378040.1|  PREDICTED: RING finger protein 10 isoform X2       130   1e-30   Pyrus x bretschneideri [bai li]
ref|XP_009378042.1|  PREDICTED: RING finger protein 10 isoform X4       130   1e-30   Pyrus x bretschneideri [bai li]
ref|XP_009378039.1|  PREDICTED: RING finger protein 10 isoform X1       130   1e-30   Pyrus x bretschneideri [bai li]
ref|XP_007214973.1|  hypothetical protein PRUPE_ppa001768mg             130   2e-30   Prunus persica
ref|XP_007214972.1|  hypothetical protein PRUPE_ppa001768mg             130   2e-30   Prunus persica
ref|XP_010528130.1|  PREDICTED: RING finger protein 10 isoform X1       129   3e-30   Tarenaya hassleriana [spider flower]
ref|XP_010528131.1|  PREDICTED: RING finger protein 10 isoform X2       129   3e-30   Tarenaya hassleriana [spider flower]
ref|XP_010929676.1|  PREDICTED: RING finger protein 10                  129   3e-30   Elaeis guineensis
ref|XP_008362083.1|  PREDICTED: RING finger protein 10-like isofo...    128   8e-30   
ref|XP_008362084.1|  PREDICTED: RING finger protein 10-like isofo...    128   8e-30   
gb|KDO43574.1|  hypothetical protein CISIN_1g003879mg                   126   9e-30   Citrus sinensis [apfelsine]
gb|KDO43575.1|  hypothetical protein CISIN_1g003879mg                   125   1e-29   Citrus sinensis [apfelsine]
gb|KDO43573.1|  hypothetical protein CISIN_1g003879mg                   127   2e-29   Citrus sinensis [apfelsine]
ref|XP_007161621.1|  hypothetical protein PHAVU_001G084800g             127   2e-29   Phaseolus vulgaris [French bean]
ref|XP_003553982.1|  PREDICTED: RING finger protein 10-like isofo...    126   5e-29   Glycine max [soybeans]
ref|XP_009129487.1|  PREDICTED: RING finger protein 10 isoform X2       125   1e-28   
ref|XP_009129485.1|  PREDICTED: RING finger protein 10 isoform X1       125   1e-28   
gb|KHM99214.1|  RING finger protein 10                                  125   1e-28   Glycine soja [wild soybean]
emb|CDY28532.1|  BnaC02g36280D                                          124   1e-28   Brassica napus [oilseed rape]
ref|XP_010249226.1|  PREDICTED: RING finger protein 10 isoform X2       124   1e-28   Nelumbo nucifera [Indian lotus]
ref|XP_010249224.1|  PREDICTED: RING finger protein 10 isoform X1       124   2e-28   Nelumbo nucifera [Indian lotus]
emb|CDY48977.1|  BnaA02g28190D                                          124   2e-28   Brassica napus [oilseed rape]
ref|XP_006598997.1|  PREDICTED: RING finger protein 10-like             123   3e-28   
emb|CAA66822.1|  hypothetical protein                                   121   3e-28   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006844483.1|  hypothetical protein AMTR_s00016p00109400          123   4e-28   Amborella trichopoda
ref|XP_011097256.1|  PREDICTED: RING finger protein 10                  123   5e-28   Sesamum indicum [beniseed]
ref|XP_006395529.1|  hypothetical protein EUTSA_v10003691mg             123   6e-28   Eutrema salsugineum [saltwater cress]
ref|NP_189307.2|  RING/U-box domain-containing protein                  122   9e-28   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008791034.1|  PREDICTED: RING finger protein 10                  122   9e-28   Phoenix dactylifera
ref|XP_002875336.1|  hypothetical protein ARALYDRAFT_484446             122   1e-27   
gb|KFK33594.1|  hypothetical protein AALP_AA5G034200                    121   2e-27   Arabis alpina [alpine rockcress]
ref|XP_004145702.1|  PREDICTED: RING finger protein 10-like             121   2e-27   Cucumis sativus [cucumbers]
ref|XP_004159146.1|  PREDICTED: RING finger protein 10-like             120   2e-27   
gb|KGN58249.1|  hypothetical protein Csa_3G599440                       120   2e-27   Cucumis sativus [cucumbers]
ref|XP_004952585.1|  PREDICTED: RING finger protein 10-like             120   5e-27   Setaria italica
gb|KHN28587.1|  RING finger protein 10                                  119   7e-27   Glycine soja [wild soybean]
ref|XP_006290605.1|  hypothetical protein CARUB_v10016694mg             118   2e-26   Capsella rubella
ref|XP_002453901.1|  hypothetical protein SORBIDRAFT_04g021110          118   2e-26   Sorghum bicolor [broomcorn]
ref|XP_008450028.1|  PREDICTED: RING finger protein 10 isoform X4       117   2e-26   
ref|XP_008450025.1|  PREDICTED: RING finger protein 10 isoform X2       118   2e-26   Cucumis melo [Oriental melon]
ref|XP_008450024.1|  PREDICTED: RING finger protein 10 isoform X1       118   2e-26   Cucumis melo [Oriental melon]
ref|XP_006290606.1|  hypothetical protein CARUB_v10016694mg             118   3e-26   
ref|XP_008450027.1|  PREDICTED: RING finger protein 10 isoform X3       117   3e-26   
ref|XP_010514334.1|  PREDICTED: RING finger protein 10-like             117   4e-26   Camelina sativa [gold-of-pleasure]
ref|XP_010502612.1|  PREDICTED: RING finger protein 10-like             117   5e-26   Camelina sativa [gold-of-pleasure]
ref|XP_010425391.1|  PREDICTED: RING finger protein 10-like             116   9e-26   Camelina sativa [gold-of-pleasure]
gb|EYU34830.1|  hypothetical protein MIMGU_mgv1a002265mg                115   2e-25   Erythranthe guttata [common monkey flower]
gb|EPS67903.1|  hypothetical protein M569_06871                         113   7e-25   Genlisea aurea
ref|XP_003575036.1|  PREDICTED: RING finger protein 10                  113   1e-24   Brachypodium distachyon [annual false brome]
dbj|BAK00968.1|  predicted protein                                      112   3e-24   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006647257.1|  PREDICTED: RING finger protein 10-like             110   8e-24   
gb|ACN34207.1|  unknown                                                 110   1e-23   Zea mays [maize]
ref|NP_001152489.1|  LOC100286129                                       110   1e-23   
gb|AFW71577.1|  hypothetical protein ZEAMMB73_891715                    110   1e-23   
gb|EEC73269.1|  hypothetical protein OsI_07406                          110   1e-23   Oryza sativa Indica Group [Indian rice]
gb|EMT18774.1|  RING finger protein 10                                  108   2e-23   
ref|NP_001046958.1|  Os02g0516600                                       109   3e-23   
gb|EEE57081.1|  hypothetical protein OsJ_06908                          109   3e-23   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009405452.1|  PREDICTED: RING finger protein 10 isoform X1       105   6e-22   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009405454.1|  PREDICTED: RING finger protein 10 isoform X2       105   7e-22   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002977414.1|  hypothetical protein SELMODRAFT_443565             101   2e-20   
ref|XP_002974997.1|  hypothetical protein SELMODRAFT_442720           97.1    6e-19   
gb|ACN41106.1|  unknown                                               95.1    2e-18   Picea sitchensis
ref|XP_001753592.1|  predicted protein                                88.2    5e-16   
gb|ADN34144.1|  hypothetical protein                                  68.6    9e-11   Cucumis melo subsp. melo
gb|ESA07679.1|  hypothetical protein GLOINDRAFT_349382                69.3    5e-10   
ref|XP_004367839.1|  zinc finger, C3HC4 type (RING finger) domain...  66.6    4e-09   Acanthamoeba castellanii str. Neff
ref|XP_008551291.1|  PREDICTED: RING finger protein 10                65.9    6e-09   Microplitis demolitor
ref|XP_011308976.1|  PREDICTED: RING finger protein 10                65.5    8e-09   Fopius arisanus
ref|XP_005644276.1|  hypothetical protein COCSUDRAFT_44557            64.7    2e-08   Coccomyxa subellipsoidea C-169
ref|XP_780048.3|  PREDICTED: RING finger protein 10-like              62.4    1e-07   
ref|XP_002736630.2|  PREDICTED: RING finger protein 10-like           60.8    4e-07   Saccoglossus kowalevskii
ref|XP_001653450.1|  AAEL008854-PA                                    60.1    6e-07   
gb|KDR09385.1|  RING finger protein 10                                59.7    7e-07   Zootermopsis nevadensis
ref|XP_002427459.1|  RING finger protein, putative                    59.7    7e-07   Pediculus humanus corporis [human body lice]
ref|XP_002504035.1|  predicted protein                                59.3    1e-06   Micromonas commoda
gb|ELU04068.1|  hypothetical protein CAPTEDRAFT_178155                58.9    1e-06   Capitella teleta
ref|XP_011137254.1|  PREDICTED: RING finger protein 10                58.9    2e-06   Harpegnathos saltator
ref|XP_011421757.1|  PREDICTED: RING finger protein 10-like           58.5    2e-06   Crassostrea gigas
ref|XP_005844797.1|  expressed protein                                58.2    2e-06   Chlorella variabilis
ref|XP_001843035.1|  RING finger protein 10                           58.2    2e-06   Culex quinquefasciatus
ref|XP_011168526.1|  PREDICTED: RING finger protein 10 isoform X1     57.8    3e-06   Solenopsis invicta [imported red fire ant]
ref|XP_011168527.1|  PREDICTED: RING finger protein 10 isoform X2     57.8    3e-06   Solenopsis invicta [imported red fire ant]
ref|XP_780309.3|  PREDICTED: RING finger protein 10-like              57.8    3e-06   
gb|EKC17307.1|  RING finger protein 10                                57.4    4e-06   Crassostrea gigas
ref|XP_009017693.1|  hypothetical protein HELRODRAFT_191771           57.4    5e-06   Helobdella robusta
ref|XP_002115739.1|  hypothetical protein TRIADDRAFT_59741            57.0    5e-06   Trichoplax adhaerens
dbj|GAN10619.1|  RING finger domain protein                           57.0    6e-06   Mucor ambiguus
ref|XP_003054911.1|  predicted protein                                57.0    6e-06   Micromonas pusilla CCMP1545
gb|EPB83462.1|  hypothetical protein HMPREF1544_09790                 56.6    7e-06   Mucor circinelloides f. circinelloides 1006PhL
ref|XP_001420844.1|  predicted protein                                56.6    9e-06   Ostreococcus lucimarinus CCE9901
dbj|BAN20910.1|  conserved hypothetical protein                       56.6    9e-06   Riptortus pedestris
ref|XP_003705539.1|  PREDICTED: RING finger protein 10-like           56.2    1e-05   Megachile rotundata
ref|XP_011340136.1|  PREDICTED: RING finger protein 10                55.8    2e-05   Ooceraea biroi
ref|XP_003397460.1|  PREDICTED: RING finger protein 10-like           55.5    2e-05   Bombus terrestris [large earth bumblebee]
gb|EPX71098.1|  ubiquitin-protein ligase E3                           55.5    2e-05   Schizosaccharomyces octosporus yFS286
ref|XP_005834147.1|  hypothetical protein GUITHDRAFT_137758           55.5    2e-05   Guillardia theta CCMP2712
emb|CDS14039.1|  hypothetical protein LRAMOSA06210                    55.1    3e-05   Lichtheimia ramosa
ref|XP_002596691.1|  hypothetical protein BRAFLDRAFT_219134           55.1    3e-05   Branchiostoma floridae
ref|XP_003690653.1|  PREDICTED: RING finger protein 10-like           55.1    3e-05   
ref|XP_006610485.1|  PREDICTED: RING finger protein 10-like           55.1    3e-05   Apis dorsata [rock honeybee]
gb|ETN65851.1|  RING finger protein 10                                54.7    3e-05   Anopheles darlingi [American malaria mosquito]
ref|XP_001639551.1|  predicted protein                                54.7    3e-05   Nematostella vectensis
emb|CEF99945.1|  Zinc finger, RING/FYVE/PHD-type                      54.7    4e-05   Ostreococcus tauri
ref|XP_003485829.1|  PREDICTED: RING finger protein 10-like           54.7    4e-05   Bombus impatiens
emb|CDH55082.1|  alkylbase dna n-glycosylase                          54.3    4e-05   Lichtheimia corymbifera JMRC:FSU:9682
gb|EPY53709.1|  ubiquitin-protein ligase E3                           54.3    5e-05   Schizosaccharomyces cryophilus OY26
ref|XP_006695008.1|  hypothetical protein CTHT_0046290                53.9    6e-05   Chaetomium thermophilum var. thermophilum DSM 1495
ref|XP_317518.4|  AGAP007954-PA                                       53.9    6e-05   Anopheles gambiae str. PEST
ref|XP_392932.3|  PREDICTED: RING finger protein 10-like              53.9    6e-05   Apis mellifera [bee]
ref|XP_003082406.1|  Predicted E3 ubiquitin ligase (ISS)              53.9    6e-05   
gb|KFM75235.1|  hypothetical protein X975_08140                       53.9    7e-05   Stegodyphus mimosarum
gb|KFH62253.1|  hypothetical protein MVEG_11464                       53.9    7e-05   Mortierella verticillata NRRL 6337
gb|EHJ65782.1|  hypothetical protein KGM_06029                        53.1    1e-04   
ref|XP_008209812.1|  PREDICTED: RING finger protein 10                53.1    1e-04   
gb|EFX03950.1|  ring finger domain containing protein                 52.8    1e-04   Grosmannia clavigera kw1407
ref|XP_011395030.1|  RING-15 protein                                  52.8    2e-04   Neurospora crassa OR74A
ref|XP_009854561.1|  hypothetical protein NEUTE1DRAFT_88138           52.8    2e-04   Neurospora tetrasperma FGSC 2508
ref|XP_002609585.1|  hypothetical protein BRAFLDRAFT_115063           52.8    2e-04   Branchiostoma floridae
ref|XP_011395031.1|  RING-15 protein, variant                         52.8    2e-04   Neurospora crassa OR74A
ref|XP_007936486.1|  PREDICTED: RING finger protein 10                52.4    2e-04   Orycteropus afer afer
ref|XP_011060457.1|  PREDICTED: RING finger protein 10 isoform X1     52.4    2e-04   Acromyrmex echinatior
ref|XP_011060466.1|  PREDICTED: RING finger protein 10 isoform X2     52.4    2e-04   Acromyrmex echinatior
ref|XP_011060473.1|  PREDICTED: RING finger protein 10 isoform X3     52.0    2e-04   Acromyrmex echinatior
ref|XP_001971151.1|  GG14590                                          51.6    3e-04   Drosophila erecta
ref|XP_002083234.1|  GD13467                                          51.6    4e-04   Drosophila simulans
ref|NP_647623.1|  CG12099, isoform B                                  51.6    4e-04   Drosophila melanogaster
ref|XP_011184197.1|  PREDICTED: RING finger protein 10                51.6    4e-04   Zeugodacus cucurbitae [melon fruit fly]
ref|XP_011506010.1|  PREDICTED: LOW QUALITY PROTEIN: RING finger ...  51.2    4e-04   Ceratosolen solmsi marchali
ref|XP_007229396.1|  PREDICTED: RING finger protein 10-like           51.2    5e-04   
ref|XP_001985429.1|  GH17054                                          51.2    5e-04   Drosophila grimshawi
ref|NP_596530.1|  hypothetical protein SPBP8B7.23                     51.2    5e-04   Schizosaccharomyces pombe
ref|XP_001518584.2|  PREDICTED: RING finger protein 10                51.2    5e-04   
ref|XP_002034929.1|  GM14204                                          51.2    5e-04   Drosophila sechellia
ref|XP_011112993.1|  hypothetical protein H072_7231                   51.2    6e-04   
ref|XP_002093140.1|  GE20950                                          50.8    6e-04   Drosophila yakuba
ref|XP_006995860.1|  PREDICTED: RING finger protein 10 isoform X2     50.8    6e-04   Peromyscus maniculatus bairdii
ref|XP_006995859.1|  PREDICTED: RING finger protein 10 isoform X1     50.8    7e-04   Peromyscus maniculatus bairdii
emb|CEP17430.1|  hypothetical protein                                 50.8    7e-04   Parasitella parasitica
ref|XP_010366601.1|  PREDICTED: RING finger protein 10 isoform X4     50.8    7e-04   Rhinopithecus roxellana
ref|XP_007525335.1|  PREDICTED: RING finger protein 10                50.8    7e-04   Erinaceus europaeus [common hedgehog]
ref|XP_008003145.1|  PREDICTED: RING finger protein 10 isoform X6     50.8    7e-04   Chlorocebus sabaeus
ref|XP_009180108.1|  PREDICTED: RING finger protein 10 isoform X4     50.8    7e-04   Papio anubis [baboon]
ref|XP_008003147.1|  PREDICTED: RING finger protein 10 isoform X7     50.8    7e-04   Chlorocebus sabaeus
ref|XP_004718107.1|  PREDICTED: LOW QUALITY PROTEIN: ring finger ...  50.8    7e-04   Echinops telfairi [lesser hedgehog tenrec]
ref|XP_006890492.1|  PREDICTED: RING finger protein 10 isoform X1     50.8    8e-04   Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_004464711.1|  PREDICTED: RING finger protein 10 isoform 3      50.4    8e-04   
ref|XP_003790042.1|  PREDICTED: RING finger protein 10                50.8    8e-04   
gb|ERE75902.1|  RING finger protein 10                                50.4    8e-04   Cricetulus griseus [Chinese hamsters]
ref|XP_003974626.1|  PREDICTED: RING finger protein 10-like           50.4    8e-04   
dbj|BAE33735.1|  unnamed protein product                              50.8    8e-04   Mus musculus [mouse]
ref|XP_009424675.1|  PREDICTED: RING finger protein 10 isoform X3     50.4    8e-04   Pan troglodytes
dbj|BAE02122.1|  unnamed protein product                              50.4    8e-04   Macaca fascicularis [crab eating macaque]
ref|XP_005112582.1|  PREDICTED: RING finger protein 10-like isofo...  50.4    8e-04   
ref|XP_005396644.1|  PREDICTED: RING finger protein 10                50.4    9e-04   
ref|XP_006640236.1|  PREDICTED: RING finger protein 10-like           50.4    9e-04   
gb|KIH86793.1|  hypothetical protein SPBR_08174                       50.4    9e-04   Sporothrix brasiliensis 5110
ref|XP_010366598.1|  PREDICTED: RING finger protein 10 isoform X1     50.4    9e-04   Rhinopithecus roxellana
gb|KFO23766.1|  RING finger protein 10                                50.4    9e-04   Fukomys damarensis [Damara mole rat]
ref|XP_010366599.1|  PREDICTED: RING finger protein 10 isoform X2     50.4    9e-04   Rhinopithecus roxellana
ref|XP_005815819.1|  PREDICTED: RING finger protein 10-like           49.7    9e-04   
ref|XP_004843717.1|  PREDICTED: RING finger protein 10                50.4    9e-04   Heterocephalus glaber [naked mole rat]
ref|XP_008505347.1|  PREDICTED: RING finger protein 10 isoform X1     50.4    0.001   Equus przewalskii [Przewalski horse]
ref|XP_001914782.2|  PREDICTED: LOW QUALITY PROTEIN: RING finger ...  50.4    0.001   
ref|XP_005169141.1|  PREDICTED: RING finger protein 10 isoform X1     50.4    0.001   Danio rerio [leopard danio]
ref|XP_008838840.1|  PREDICTED: RING finger protein 10                50.4    0.001   Nannospalax galili
ref|NP_001116727.1|  RING finger protein 10                           50.4    0.001   Danio rerio [leopard danio]
ref|XP_010341111.1|  PREDICTED: RING finger protein 10 isoform X1     50.4    0.001   Saimiri boliviensis boliviensis
ref|XP_008003140.1|  PREDICTED: RING finger protein 10 isoform X1     50.4    0.001   Chlorocebus sabaeus
ref|XP_004464709.1|  PREDICTED: RING finger protein 10 isoform 1      50.4    0.001   
ref|XP_008003143.1|  PREDICTED: RING finger protein 10 isoform X4     50.4    0.001   Chlorocebus sabaeus
ref|XP_006865501.1|  PREDICTED: RING finger protein 10 isoform X1     50.4    0.001   Chrysochloris asiatica
ref|XP_008003141.1|  PREDICTED: RING finger protein 10 isoform X2     50.4    0.001   Chlorocebus sabaeus
gb|EHH66776.1|  hypothetical protein EGM_03829                        50.4    0.001   Macaca fascicularis [crab eating macaque]
ref|NP_001247749.1|  RING finger protein 10                           50.4    0.001   Macaca mulatta [rhesus macaque]
ref|XP_009180106.1|  PREDICTED: RING finger protein 10 isoform X1     50.4    0.001   Papio anubis [baboon]
ref|XP_010597230.1|  PREDICTED: RING finger protein 10                50.4    0.001   Loxodonta africana [African bush elephant]
ref|XP_003907310.1|  PREDICTED: RING finger protein 10 isoform X2     50.4    0.001   Papio anubis [baboon]
ref|XP_001956081.1|  GF25027                                          50.4    0.001   Drosophila ananassae
ref|XP_007607213.1|  PREDICTED: RING finger protein 10 isoform X2     50.4    0.001   
emb|CCG83238.1|  RING finger domain protein                           50.4    0.001   Taphrina deformans PYCC 5710
gb|EHH21249.1|  hypothetical protein EGK_04266                        50.4    0.001   Macaca mulatta [rhesus macaque]
gb|EHB01529.1|  RING finger protein 10                                50.4    0.001   Heterocephalus glaber [naked mole rat]
ref|XP_006151586.1|  PREDICTED: RING finger protein 10                50.4    0.001   
ref|XP_004429964.1|  PREDICTED: RING finger protein 10                50.4    0.001   
gb|KDN49086.1|  hypothetical protein RSAG8_02439                      50.4    0.001   Rhizoctonia solani AG-8 WAC10335
ref|XP_010366600.1|  PREDICTED: RING finger protein 10 isoform X3     50.4    0.001   Rhinopithecus roxellana
ref|XP_004636314.1|  PREDICTED: RING finger protein 10 isoform X2     50.4    0.001   
gb|EGW10590.1|  RING finger protein 10                                50.4    0.001   Cricetulus griseus [Chinese hamsters]
dbj|BAG54301.1|  unnamed protein product                              50.4    0.001   Homo sapiens [man]
ref|XP_008003142.1|  PREDICTED: RING finger protein 10 isoform X3     50.4    0.001   Chlorocebus sabaeus
ref|XP_003478507.1|  PREDICTED: LOW QUALITY PROTEIN: RING finger ...  50.4    0.001   Cavia porcellus [guinea pig]
ref|XP_004664185.1|  PREDICTED: RING finger protein 10 isoform X2     50.4    0.001   Jaculus jaculus
ref|XP_004664184.1|  PREDICTED: RING finger protein 10 isoform X1     50.4    0.001   Jaculus jaculus
ref|XP_010341112.1|  PREDICTED: RING finger protein 10 isoform X2     50.4    0.001   Saimiri boliviensis boliviensis
ref|XP_006719780.1|  PREDICTED: RING finger protein 10 isoform X8     50.4    0.001   
ref|XP_010602478.1|  PREDICTED: RING finger protein 10                50.4    0.001   Fukomys damarensis [Damara mole rat]
dbj|BAE27391.1|  unnamed protein product                              50.4    0.001   Mus musculus [mouse]



>ref|XP_009599649.1| PREDICTED: RING finger protein 10 [Nicotiana tomentosiformis]
Length=783

 Score =   164 bits (415),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 98/153 (64%), Positives = 119/153 (78%), Gaps = 1/153 (1%)
 Frame = +1

Query  313  GSPEKVN-MSVGQNGIKTLTYHSTGQISVDDRRKSPGPGLPATSHNNSGSTRSQGSMPRP  489
            GS +KVN +S  Q+G ++L  H  G+IS+ +  KS G   P++  ++ GS   QG   R 
Sbjct  117  GSSKKVNNLSASQDGFRSLGRHKNGRISLHEPGKSAGTIDPSSRRDHFGSNSPQGIATRS  176

Query  490  TGRRTQMVSGNHLLNFHYDpisrpksrappprrqpkrkpYNKDLFLQANYKFVVFSSGNY  669
              RRTQMVSGNHLLNFHYDPISRP++RAPPPRR  KRKPYNKDLFLQANYKFV+  SGNY
Sbjct  177  APRRTQMVSGNHLLNFHYDPISRPQTRAPPPRRYMKRKPYNKDLFLQANYKFVLLDSGNY  236

Query  670  VPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
             P+SMDPDK+L+WEDI+CV++STPF VQCPICL
Sbjct  237  TPDSMDPDKILQWEDIVCVRYSTPFHVQCPICL  269



>ref|XP_009800276.1| PREDICTED: RING finger protein 10 [Nicotiana sylvestris]
Length=732

 Score =   159 bits (402),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 97/153 (63%), Positives = 117/153 (76%), Gaps = 1/153 (1%)
 Frame = +1

Query  313  GSPEKVN-MSVGQNGIKTLTYHSTGQISVDDRRKSPGPGLPATSHNNSGSTRSQGSMPRP  489
            GS +KVN  S  Q+G ++L     G+IS+ +  KS G   P++  ++ GS   QG   R 
Sbjct  65   GSSKKVNNFSTSQDGFRSLGRPKNGRISLHEPGKSAGTIDPSSRRDHFGSNSPQGIATRS  124

Query  490  TGRRTQMVSGNHLLNFHYDpisrpksrappprrqpkrkpYNKDLFLQANYKFVVFSSGNY  669
              RRTQMVSGNHLLNFHYDPISRP++RAPPPRR  KRKPYNKDLFLQANYKFV+  SGNY
Sbjct  125  APRRTQMVSGNHLLNFHYDPISRPQTRAPPPRRYMKRKPYNKDLFLQANYKFVLLDSGNY  184

Query  670  VPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
             P+SMDPDK+L+WEDI+CV++STPF VQCPICL
Sbjct  185  TPDSMDPDKILQWEDIVCVRYSTPFHVQCPICL  217



>ref|XP_006338736.1| PREDICTED: RING finger protein 10-like [Solanum tuberosum]
Length=715

 Score =   154 bits (389),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 97/161 (60%), Positives = 116/161 (72%), Gaps = 2/161 (1%)
 Frame = +1

Query  286  MGPAALGSCGSPEKVNMSVGQNGIKTLTYHSTGQISVDDRRKSPGPGLPATSHNNSGSTR  465
            M   A  S GS +KVN S      ++  +H++ +IS+  +RKS     P++  +  GS  
Sbjct  44   MATTASTSGGSSKKVNNSGSSR--ESSRHHNSDRISLHGQRKSARTNDPSSGRDQFGSNS  101

Query  466  SQGSMPRPTGRRTQMVSGNHLLNFHYDpisrpksrappprrqpkrkpYNKDLFLQANYKF  645
             QG + R   RRTQMVSGNHLLNF YDPISRP+SR PPPRR  KRKPYNKDLFLQANYKF
Sbjct  102  PQGVVTRSAPRRTQMVSGNHLLNFQYDPISRPQSRLPPPRRYVKRKPYNKDLFLQANYKF  161

Query  646  VVFSSGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
            V+  SGNY P+SMDPDKML WEDI+CV++STPF VQCPICL
Sbjct  162  VLLDSGNYTPDSMDPDKMLHWEDIVCVRYSTPFHVQCPICL  202



>emb|CBI21277.3| unnamed protein product [Vitis vinifera]
Length=685

 Score =   150 bits (378),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 99/172 (58%), Positives = 114/172 (66%), Gaps = 12/172 (7%)
 Frame = +1

Query  286  MGPAALGSCGSPEKVNMSVGQNGIKTLTYHSTG-----------QISVDDRRKSPGPGLP  432
            + PAA  S GS +KV     QN  K+L + +TG             S   R K  GP + 
Sbjct  74   LAPAAADSGGSSKKVTELGVQNSKKSLPHQNTGTRSQSRSVGRGSESTQSRGKLSGPTIS  133

Query  433  ATSHNNSGSTRSQGSMPRPTGRRTQMVSGNHLLNFHYDpisrpksrappprrqpkrkpYN  612
              S   SGS    GS     GR+TQM +GNHLLNFHYDPISRP+ RAPPPRRQ K KPYN
Sbjct  134  PRSQQASGSINFHGSTTHSAGRKTQM-NGNHLLNFHYDPISRPQPRAPPPRRQQKIKPYN  192

Query  613  KDLFLQANYKFVVFSSGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
            KDLFLQANY+FVV  +GN VPE MDPDKML+W+DIICV++STP PVQCPICL
Sbjct  193  KDLFLQANYRFVVLDTGNQVPELMDPDKMLQWDDIICVRYSTPLPVQCPICL  244



>ref|XP_010660682.1| PREDICTED: RING finger protein 10 isoform X2 [Vitis vinifera]
Length=762

 Score =   150 bits (378),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 115/226 (51%), Positives = 137/226 (61%), Gaps = 18/226 (8%)
 Frame = +1

Query  136  NPNSNHGFLY----FPNQHQQEEPSLSISGMGSLRIADsdsasssscsfsetssMGPAAL  303
            NPN +HG L+     P           +  + SL I+  DS SS + S   + S+ PAA 
Sbjct  22   NPNLDHGILFQPHPSPLSRSPPSLPSHVQNLASLHIS--DSESSVASSEDVSGSLAPAAA  79

Query  304  GSCGSPEKVNMSVGQNGIKTLTYHSTG-----------QISVDDRRKSPGPGLPATSHNN  450
             S GS +KV     QN  K+L + +TG             S   R K  GP +   S   
Sbjct  80   DSGGSSKKVTELGVQNSKKSLPHQNTGTRSQSRSVGRGSESTQSRGKLSGPTISPRSQQA  139

Query  451  SGSTRSQGSMPRPTGRRTQMVSGNHLLNFHYDpisrpksrappprrqpkrkpYNKDLFLQ  630
            SGS    GS     GR+TQM +GNHLLNFHYDPISRP+ RAPPPRRQ K KPYNKDLFLQ
Sbjct  140  SGSINFHGSTTHSAGRKTQM-NGNHLLNFHYDPISRPQPRAPPPRRQQKIKPYNKDLFLQ  198

Query  631  ANYKFVVFSSGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
            ANY+FVV  +GN VPE MDPDKML+W+DIICV++STP PVQCPICL
Sbjct  199  ANYRFVVLDTGNQVPELMDPDKMLQWDDIICVRYSTPLPVQCPICL  244



>ref|XP_002275712.2| PREDICTED: RING finger protein 10 isoform X1 [Vitis vinifera]
Length=765

 Score =   150 bits (378),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 115/226 (51%), Positives = 137/226 (61%), Gaps = 18/226 (8%)
 Frame = +1

Query  136  NPNSNHGFLY----FPNQHQQEEPSLSISGMGSLRIADsdsasssscsfsetssMGPAAL  303
            NPN +HG L+     P           +  + SL I+  DS SS + S   + S+ PAA 
Sbjct  22   NPNLDHGILFQPHPSPLSRSPPSLPSHVQNLASLHIS--DSESSVASSEDVSGSLAPAAA  79

Query  304  GSCGSPEKVNMSVGQNGIKTLTYHSTG-----------QISVDDRRKSPGPGLPATSHNN  450
             S GS +KV     QN  K+L + +TG             S   R K  GP +   S   
Sbjct  80   DSGGSSKKVTELGVQNSKKSLPHQNTGTRSQSRSVGRGSESTQSRGKLSGPTISPRSQQA  139

Query  451  SGSTRSQGSMPRPTGRRTQMVSGNHLLNFHYDpisrpksrappprrqpkrkpYNKDLFLQ  630
            SGS    GS     GR+TQM +GNHLLNFHYDPISRP+ RAPPPRRQ K KPYNKDLFLQ
Sbjct  140  SGSINFHGSTTHSAGRKTQM-NGNHLLNFHYDPISRPQPRAPPPRRQQKIKPYNKDLFLQ  198

Query  631  ANYKFVVFSSGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
            ANY+FVV  +GN VPE MDPDKML+W+DIICV++STP PVQCPICL
Sbjct  199  ANYRFVVLDTGNQVPELMDPDKMLQWDDIICVRYSTPLPVQCPICL  244



>ref|XP_007032024.1| RING/U-box superfamily protein, putative isoform 3 [Theobroma 
cacao]
 gb|EOY02950.1| RING/U-box superfamily protein, putative isoform 3 [Theobroma 
cacao]
Length=548

 Score =   147 bits (370),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 111/216 (51%), Positives = 129/216 (60%), Gaps = 22/216 (10%)
 Frame = +1

Query  133  TNPNSNHGFLYFPNQHQQEEPSLSISGMGSLRIADsdsasssscsfsetssMGP--AALG  306
             NP SNHG       HQ   P +S    GSL I+     +         S  GP   A G
Sbjct  22   ANPTSNHG------NHQTSPPPISF---GSLHIS-----NPPPPFPFSNSPPGPLATAQG  67

Query  307  SCGSPEKVNMSVGQNGIKTLTYHSTGQISVDDRRKSPGPGLPATSHNNSGSTRSQGSMPR  486
            S GS ++V+     NG +T  + + G  S    + S    +   S  N   T SQGS   
Sbjct  68   SGGSSKEVSEVETPNGKRTSPHENRGTNSQFRGKMS----VDMVSTRNHQGTGSQGSATH  123

Query  487  PTGRRTQMVSGNHLLNFHYD--pisrpksrappprrqpkrkpYNKDLFLQANYKFVVFSS  660
              GRR QM++GNHLLNFHYD    SRP+ R PPPRRQ K KPYNKDLFLQANYKFVV  +
Sbjct  124  SAGRRAQMMNGNHLLNFHYDPITRSRPQPRGPPPRRQRKIKPYNKDLFLQANYKFVVLDT  183

Query  661  GNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
            G+Y+PESMDPDKML WEDIICV+FSTPFPVQCPICL
Sbjct  184  GSYMPESMDPDKMLLWEDIICVRFSTPFPVQCPICL  219



>ref|XP_007032023.1| RING/U-box superfamily protein, putative isoform 2 [Theobroma 
cacao]
 gb|EOY02949.1| RING/U-box superfamily protein, putative isoform 2 [Theobroma 
cacao]
Length=599

 Score =   147 bits (371),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 111/216 (51%), Positives = 129/216 (60%), Gaps = 22/216 (10%)
 Frame = +1

Query  133  TNPNSNHGFLYFPNQHQQEEPSLSISGMGSLRIADsdsasssscsfsetssMGP--AALG  306
             NP SNHG       HQ   P +S    GSL I+     +         S  GP   A G
Sbjct  22   ANPTSNHG------NHQTSPPPISF---GSLHIS-----NPPPPFPFSNSPPGPLATAQG  67

Query  307  SCGSPEKVNMSVGQNGIKTLTYHSTGQISVDDRRKSPGPGLPATSHNNSGSTRSQGSMPR  486
            S GS ++V+     NG +T  + + G  S    + S    +   S  N   T SQGS   
Sbjct  68   SGGSSKEVSEVETPNGKRTSPHENRGTNSQFRGKMS----VDMVSTRNHQGTGSQGSATH  123

Query  487  PTGRRTQMVSGNHLLNFHYD--pisrpksrappprrqpkrkpYNKDLFLQANYKFVVFSS  660
              GRR QM++GNHLLNFHYD    SRP+ R PPPRRQ K KPYNKDLFLQANYKFVV  +
Sbjct  124  SAGRRAQMMNGNHLLNFHYDPITRSRPQPRGPPPRRQRKIKPYNKDLFLQANYKFVVLDT  183

Query  661  GNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
            G+Y+PESMDPDKML WEDIICV+FSTPFPVQCPICL
Sbjct  184  GSYMPESMDPDKMLLWEDIICVRFSTPFPVQCPICL  219



>ref|XP_010315901.1| PREDICTED: RING finger protein 10 [Solanum lycopersicum]
Length=718

 Score =   148 bits (373),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 95/161 (59%), Positives = 114/161 (71%), Gaps = 2/161 (1%)
 Frame = +1

Query  286  MGPAALGSCGSPEKVNMSVGQNGIKTLTYHSTGQISVDDRRKSPGPGLPATSHNNSGSTR  465
            M  AA  S GS +KVN S      ++  +H++  IS+  + K      P++  +  G   
Sbjct  47   MATAASTSGGSSKKVNNSGSSR--ESSRHHNSDIISLHGQGKPARTNDPSSGRDQFGFNS  104

Query  466  SQGSMPRPTGRRTQMVSGNHLLNFHYDpisrpksrappprrqpkrkpYNKDLFLQANYKF  645
             QG + R   RRTQMVSGNHLLNF YDPISRP+SR PPPRR  KRKPYNKDLFLQANYKF
Sbjct  105  PQGVVTRSASRRTQMVSGNHLLNFQYDPISRPQSRLPPPRRYVKRKPYNKDLFLQANYKF  164

Query  646  VVFSSGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
            V+  SGNY P+SMDPDKML+WEDI+CV++STPF VQCPICL
Sbjct  165  VLLDSGNYTPDSMDPDKMLQWEDIVCVRYSTPFHVQCPICL  205



>ref|XP_007032022.1| RING/U-box superfamily protein, putative isoform 1 [Theobroma 
cacao]
 gb|EOY02948.1| RING/U-box superfamily protein, putative isoform 1 [Theobroma 
cacao]
Length=741

 Score =   148 bits (374),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 111/216 (51%), Positives = 129/216 (60%), Gaps = 22/216 (10%)
 Frame = +1

Query  133  TNPNSNHGFLYFPNQHQQEEPSLSISGMGSLRIADsdsasssscsfsetssMGP--AALG  306
             NP SNHG       HQ   P +S    GSL I+     +         S  GP   A G
Sbjct  22   ANPTSNHG------NHQTSPPPISF---GSLHIS-----NPPPPFPFSNSPPGPLATAQG  67

Query  307  SCGSPEKVNMSVGQNGIKTLTYHSTGQISVDDRRKSPGPGLPATSHNNSGSTRSQGSMPR  486
            S GS ++V+     NG +T  + + G  S    + S    +   S  N   T SQGS   
Sbjct  68   SGGSSKEVSEVETPNGKRTSPHENRGTNSQFRGKMS----VDMVSTRNHQGTGSQGSATH  123

Query  487  PTGRRTQMVSGNHLLNFHYD--pisrpksrappprrqpkrkpYNKDLFLQANYKFVVFSS  660
              GRR QM++GNHLLNFHYD    SRP+ R PPPRRQ K KPYNKDLFLQANYKFVV  +
Sbjct  124  SAGRRAQMMNGNHLLNFHYDPITRSRPQPRGPPPRRQRKIKPYNKDLFLQANYKFVVLDT  183

Query  661  GNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
            G+Y+PESMDPDKML WEDIICV+FSTPFPVQCPICL
Sbjct  184  GSYMPESMDPDKMLLWEDIICVRFSTPFPVQCPICL  219



>gb|KJB70712.1| hypothetical protein B456_011G088400 [Gossypium raimondii]
Length=740

 Score =   147 bits (372),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 108/214 (50%), Positives = 130/214 (61%), Gaps = 21/214 (10%)
 Frame = +1

Query  136  NPNSNHGFLYFPNQHQQEEPSLSISGMGSLRIADsdsasssscsfsetssMGPAALGSCG  315
            NPN NHG L       Q  P +S    GSL ++D    S+S         +   A GS G
Sbjct  22   NPNPNHGNL-------QSSPPISF---GSLHVSDPLPLSASPPGP-----LASDAHGSAG  66

Query  316  SPEKVNMS-VGQNGIKTLTYHSTGQISVDDRRKSPGPGLPATSHNNSGSTRSQGSMPRPT  492
            S ++  +S V    +KT + H     +   RRK     +   +H     T + GS     
Sbjct  67   SSKEDQLSEVDTPNVKTTSLHRNRGKNSHSRRKISEDVVSIRNHQG---TMAHGSAMHSA  123

Query  493  GRRTQMVSGNHLLNFHYD--pisrpksrappprrqpkrkpYNKDLFLQANYKFVVFSSGN  666
            GRRTQM++GNHLLNFHYD    SRP+ R PPPRRQ K KPYNKDLFLQAN+KFVV  +GN
Sbjct  124  GRRTQMMNGNHLLNFHYDPIARSRPQPRGPPPRRQRKIKPYNKDLFLQANFKFVVLDTGN  183

Query  667  YVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
            Y+PESMDPDKML WEDIICV++STPFPVQCPICL
Sbjct  184  YMPESMDPDKMLLWEDIICVRYSTPFPVQCPICL  217



>gb|KJB70711.1| hypothetical protein B456_011G088400 [Gossypium raimondii]
Length=738

 Score =   147 bits (371),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 107/213 (50%), Positives = 130/213 (61%), Gaps = 21/213 (10%)
 Frame = +1

Query  136  NPNSNHGFLYFPNQHQQEEPSLSISGMGSLRIADsdsasssscsfsetssMGPAALGSCG  315
            NPN NHG L       Q  P +S    GSL ++D    S+S         +   A GS G
Sbjct  22   NPNPNHGNL-------QSSPPISF---GSLHVSDPLPLSASPPGP-----LASDAHGSAG  66

Query  316  SPEKVNMSVGQNGIKTLTYHSTGQISVDDRRKSPGPGLPATSHNNSGSTRSQGSMPRPTG  495
            S ++++  V    +KT + H     +   RRK     +   +H     T + GS     G
Sbjct  67   SSKELS-EVDTPNVKTTSLHRNRGKNSHSRRKISEDVVSIRNHQG---TMAHGSAMHSAG  122

Query  496  RRTQMVSGNHLLNFHYD--pisrpksrappprrqpkrkpYNKDLFLQANYKFVVFSSGNY  669
            RRTQM++GNHLLNFHYD    SRP+ R PPPRRQ K KPYNKDLFLQAN+KFVV  +GNY
Sbjct  123  RRTQMMNGNHLLNFHYDPIARSRPQPRGPPPRRQRKIKPYNKDLFLQANFKFVVLDTGNY  182

Query  670  VPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
            +PESMDPDKML WEDIICV++STPFPVQCPICL
Sbjct  183  MPESMDPDKMLLWEDIICVRYSTPFPVQCPICL  215



>ref|XP_010096031.1| RING finger protein 10 [Morus notabilis]
 gb|EXB62837.1| RING finger protein 10 [Morus notabilis]
Length=778

 Score =   147 bits (370),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 87/122 (71%), Positives = 97/122 (80%), Gaps = 0/122 (0%)
 Frame = +1

Query  403  RRKSPGPGLPATSHNNSGSTRSQGSMPRPTGRRTQMVSGNHLLNFHYDpisrpksrappp  582
            R KSPG  +   +  +SGS  S GS     GRR+Q++SGNHLLNFHYDPISRP+ RAPPP
Sbjct  113  RGKSPGSRVSHRNQQSSGSANSHGSSTPSGGRRSQLMSGNHLLNFHYDPISRPQPRAPPP  172

Query  583  rrqpkrkpYNKDLFLQANYKFVVFSSGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPI  762
            RRQ K KPYNKDLFLQANYKFVV  +GNY PESMDPDKML WEDIICV++STP  VQCPI
Sbjct  173  RRQQKLKPYNKDLFLQANYKFVVLDTGNYTPESMDPDKMLRWEDIICVRYSTPSEVQCPI  232

Query  763  CL  768
            CL
Sbjct  233  CL  234



>ref|XP_008231028.1| PREDICTED: RING finger protein 10 isoform X3 [Prunus mume]
Length=768

 Score =   144 bits (364),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 115/232 (50%), Positives = 139/232 (60%), Gaps = 21/232 (9%)
 Frame = +1

Query  133  TNPNSNHGFLYFPNQHQQEEPSLS-------ISGMGSLRIADsdsasssscsfsetssMG  291
             NPNS HG  +     Q E  SLS       +   GSL+I+DS S  S S + S   S+ 
Sbjct  22   ANPNSQHGHRHHLFLSQSESKSLSPPALSRQMLTFGSLQISDSQSPFSISSNTSAGPSV-  80

Query  292  PAALGSCGSPE---KVNMSVGQNGI----KTLTY-HSTGQI----SVDDRRKSPGPGLPA  435
            PAA  S GS +   K+ M  G+  +    +TL+  HS G      S   R KS G     
Sbjct  81   PAAEASAGSSQEVTKLGMPRGKKALPNDNETLSQCHSGGGGQGIGSARSRGKSSGTVGSR  140

Query  436  TSHNNSGSTRSQGSMPRPTGRRTQMVSGNHLLNFHYDpisrpksrappprrqpkrkp-YN  612
            +S    GS  S GS   P GR+ Q+++GNHLLNFHYDPISRP+ R  PP R+  ++  YN
Sbjct  141  SSQQTIGSVGSHGSSTHPVGRKAQLMNGNHLLNFHYDPISRPQPRTAPPPRRHHKRKPYN  200

Query  613  KDLFLQANYKFVVFSSGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
            KDLFLQANYKFVV  SGNY  ESMDPDKML+WEDIICV++STP  VQCPICL
Sbjct  201  KDLFLQANYKFVVLDSGNYSVESMDPDKMLKWEDIICVRYSTPTLVQCPICL  252



>ref|XP_008231025.1| PREDICTED: RING finger protein 10 isoform X1 [Prunus mume]
Length=769

 Score =   144 bits (364),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 115/232 (50%), Positives = 139/232 (60%), Gaps = 21/232 (9%)
 Frame = +1

Query  133  TNPNSNHGFLYFPNQHQQEEPSLS-------ISGMGSLRIADsdsasssscsfsetssMG  291
             NPNS HG  +     Q E  SLS       +   GSL+I+DS S  S S + S   S+ 
Sbjct  22   ANPNSQHGHRHHLFLSQSESKSLSPPALSRQMLTFGSLQISDSQSPFSISSNTSAGPSV-  80

Query  292  PAALGSCGSPEKVN---MSVGQNGI----KTLTY-HSTGQI----SVDDRRKSPGPGLPA  435
            PAA  S GS ++V    M  G+  +    +TL+  HS G      S   R KS G     
Sbjct  81   PAAEASAGSSQEVTKLGMPRGKKALPNDNETLSQCHSGGGGQGIGSARSRGKSSGTVGSR  140

Query  436  TSHNNSGSTRSQGSMPRPTGRRTQMVSGNHLLNFHYDpisrpksrappprrqpkrkp-YN  612
            +S    GS  S GS   P GR+ Q+++GNHLLNFHYDPISRP+ R  PP R+  ++  YN
Sbjct  141  SSQQTIGSVGSHGSSTHPVGRKAQLMNGNHLLNFHYDPISRPQPRTAPPPRRHHKRKPYN  200

Query  613  KDLFLQANYKFVVFSSGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
            KDLFLQANYKFVV  SGNY  ESMDPDKML+WEDIICV++STP  VQCPICL
Sbjct  201  KDLFLQANYKFVVLDSGNYSVESMDPDKMLKWEDIICVRYSTPTLVQCPICL  252



>ref|XP_008231027.1| PREDICTED: RING finger protein 10 isoform X2 [Prunus mume]
Length=768

 Score =   143 bits (361),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 115/232 (50%), Positives = 138/232 (59%), Gaps = 22/232 (9%)
 Frame = +1

Query  133  TNPNSNHGFLYFPNQHQQEEPSLS-------ISGMGSLRIADsdsasssscsfsetssMG  291
             NPNS HG  +     Q E  SLS       +   GSL+I+DS S  S S + S  S   
Sbjct  22   ANPNSQHGHRHHLFLSQSESKSLSPPALSRQMLTFGSLQISDSQSPFSISSNTSGPSV--  79

Query  292  PAALGSCGSPE---KVNMSVGQNGI----KTLTY-HSTGQI----SVDDRRKSPGPGLPA  435
            PAA  S GS +   K+ M  G+  +    +TL+  HS G      S   R KS G     
Sbjct  80   PAAEASAGSSQEVTKLGMPRGKKALPNDNETLSQCHSGGGGQGIGSARSRGKSSGTVGSR  139

Query  436  TSHNNSGSTRSQGSMPRPTGRRTQMVSGNHLLNFHYDpisrpksrappprrqpkrkp-YN  612
            +S    GS  S GS   P GR+ Q+++GNHLLNFHYDPISRP+ R  PP R+  ++  YN
Sbjct  140  SSQQTIGSVGSHGSSTHPVGRKAQLMNGNHLLNFHYDPISRPQPRTAPPPRRHHKRKPYN  199

Query  613  KDLFLQANYKFVVFSSGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
            KDLFLQANYKFVV  SGNY  ESMDPDKML+WEDIICV++STP  VQCPICL
Sbjct  200  KDLFLQANYKFVVLDSGNYSVESMDPDKMLKWEDIICVRYSTPTLVQCPICL  251



>ref|XP_008231029.1| PREDICTED: RING finger protein 10 isoform X4 [Prunus mume]
Length=767

 Score =   143 bits (361),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 115/232 (50%), Positives = 138/232 (59%), Gaps = 22/232 (9%)
 Frame = +1

Query  133  TNPNSNHGFLYFPNQHQQEEPSLS-------ISGMGSLRIADsdsasssscsfsetssMG  291
             NPNS HG  +     Q E  SLS       +   GSL+I+DS S  S S + S  S   
Sbjct  22   ANPNSQHGHRHHLFLSQSESKSLSPPALSRQMLTFGSLQISDSQSPFSISSNTSGPSV--  79

Query  292  PAALGSCGSPEKVN---MSVGQNGI----KTLTY-HSTGQI----SVDDRRKSPGPGLPA  435
            PAA  S GS ++V    M  G+  +    +TL+  HS G      S   R KS G     
Sbjct  80   PAAEASAGSSQEVTKLGMPRGKKALPNDNETLSQCHSGGGGQGIGSARSRGKSSGTVGSR  139

Query  436  TSHNNSGSTRSQGSMPRPTGRRTQMVSGNHLLNFHYDpisrpksrappprrqpkrkp-YN  612
            +S    GS  S GS   P GR+ Q+++GNHLLNFHYDPISRP+ R  PP R+  ++  YN
Sbjct  140  SSQQTIGSVGSHGSSTHPVGRKAQLMNGNHLLNFHYDPISRPQPRTAPPPRRHHKRKPYN  199

Query  613  KDLFLQANYKFVVFSSGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
            KDLFLQANYKFVV  SGNY  ESMDPDKML+WEDIICV++STP  VQCPICL
Sbjct  200  KDLFLQANYKFVVLDSGNYSVESMDPDKMLKWEDIICVRYSTPTLVQCPICL  251



>ref|XP_011006127.1| PREDICTED: RING finger protein 10 [Populus euphratica]
Length=737

 Score =   140 bits (354),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 78/110 (71%), Positives = 89/110 (81%), Gaps = 0/110 (0%)
 Frame = +1

Query  439  SHNNSGSTRSQGSMPRPTGRRTQMVSGNHLLNFHYDpisrpksrappprrqpkrkpYNKD  618
            S  + GS  S+G     +GRR QM + NHLLNFHYDPISRP+ RAPPPRR  K+K YNKD
Sbjct  118  SQRSVGSVNSRGGTTHASGRRAQMTNANHLLNFHYDPISRPQPRAPPPRRPQKKKAYNKD  177

Query  619  LFLQANYKFVVFSSGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
            LFLQANYKFVV  +G+Y PESMDPDKML+WEDIICV++ST FPVQCPICL
Sbjct  178  LFLQANYKFVVLDTGSYAPESMDPDKMLKWEDIICVRYSTTFPVQCPICL  227



>ref|XP_002320428.2| hypothetical protein POPTR_0014s14220g [Populus trichocarpa]
 gb|EEE98743.2| hypothetical protein POPTR_0014s14220g [Populus trichocarpa]
Length=735

 Score =   140 bits (353),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 77/110 (70%), Positives = 89/110 (81%), Gaps = 0/110 (0%)
 Frame = +1

Query  439  SHNNSGSTRSQGSMPRPTGRRTQMVSGNHLLNFHYDpisrpksrappprrqpkrkpYNKD  618
            S  + GS  S+G     +GRR QM + NHLLNFHYDPISRP+ RAPPPRR  K++ YNKD
Sbjct  118  SQQSVGSVNSRGGTTHASGRRAQMTNANHLLNFHYDPISRPQPRAPPPRRPQKKRAYNKD  177

Query  619  LFLQANYKFVVFSSGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
            LFLQANYKFVV  +G+Y PESMDPDKML+WEDIICV++ST FPVQCPICL
Sbjct  178  LFLQANYKFVVLDTGSYAPESMDPDKMLKWEDIICVRYSTTFPVQCPICL  227



>ref|XP_004493075.1| PREDICTED: RING finger protein 10-like isoform X2 [Cicer arietinum]
Length=747

 Score =   140 bits (353),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 104/225 (46%), Positives = 128/225 (57%), Gaps = 31/225 (14%)
 Frame = +1

Query  136  NPNSNHGFLYFPNQHQQEEPSLSISGMGSLRIADsdsasssscsfsetssMGPAALGSCG  315
            NPN  +G    P+      P L+   +GSL+I+D    S+            PAA  + G
Sbjct  22   NPNPQYGI---PDTFSSPSPILN-HALGSLQISDYPGPST------------PAAENTGG  65

Query  316  SPEKVNMSVGQNGIKTLTYHSTGQISVDDRRKSPGPGLPA-------TSHNN---SGSTR  465
            S EKV      +G+K   ++S         R++ G    A       +SH N   +GS  
Sbjct  66   SSEKVTELGSSSGMKAPQHNSRTHSRSQSGRRAFGSPQSAGKTTGTVSSHRNQQTTGSVN  125

Query  466  SQGSMPRPTGRRTQMVSGNHLLNFHYD----pisrpksrappprrqpkrkpYNKDLFLQA  633
            S GS P   GR++QMV+GNHLLNF YD       R     PP RRQ KR+PYNKDLFLQA
Sbjct  126  SHGSTPL-AGRKSQMVNGNHLLNFQYDPISRSQQRGPPPPPPARRQRKRRPYNKDLFLQA  184

Query  634  NYKFVVFSSGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
            N+KF+V  SGNY PESMDPDKML+WEDIICV + TPFPVQCPICL
Sbjct  185  NFKFMVLDSGNYSPESMDPDKMLQWEDIICVTYLTPFPVQCPICL  229



>ref|XP_004493074.1| PREDICTED: RING finger protein 10-like isoform X1 [Cicer arietinum]
Length=772

 Score =   140 bits (353),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 104/225 (46%), Positives = 128/225 (57%), Gaps = 31/225 (14%)
 Frame = +1

Query  136  NPNSNHGFLYFPNQHQQEEPSLSISGMGSLRIADsdsasssscsfsetssMGPAALGSCG  315
            NPN  +G    P+      P L+   +GSL+I+D    S+            PAA  + G
Sbjct  22   NPNPQYGI---PDTFSSPSPILN-HALGSLQISDYPGPST------------PAAENTGG  65

Query  316  SPEKVNMSVGQNGIKTLTYHSTGQISVDDRRKSPGPGLPA-------TSHNN---SGSTR  465
            S EKV      +G+K   ++S         R++ G    A       +SH N   +GS  
Sbjct  66   SSEKVTELGSSSGMKAPQHNSRTHSRSQSGRRAFGSPQSAGKTTGTVSSHRNQQTTGSVN  125

Query  466  SQGSMPRPTGRRTQMVSGNHLLNFHYD----pisrpksrappprrqpkrkpYNKDLFLQA  633
            S GS P   GR++QMV+GNHLLNF YD       R     PP RRQ KR+PYNKDLFLQA
Sbjct  126  SHGSTPL-AGRKSQMVNGNHLLNFQYDPISRSQQRGPPPPPPARRQRKRRPYNKDLFLQA  184

Query  634  NYKFVVFSSGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
            N+KF+V  SGNY PESMDPDKML+WEDIICV + TPFPVQCPICL
Sbjct  185  NFKFMVLDSGNYSPESMDPDKMLQWEDIICVTYLTPFPVQCPICL  229



>ref|XP_002512841.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF49344.1| conserved hypothetical protein [Ricinus communis]
Length=746

 Score =   139 bits (351),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 92/167 (55%), Positives = 110/167 (66%), Gaps = 6/167 (4%)
 Frame = +1

Query  286  MGPAALGSCGSPEKVNMSVGQNGIKTL-----TYHSTGQISVDDRR-KSPGPGLPATSHN  447
              PAA  S GS ++VN S   N  K+L       HS  ++     + K+ G    +    
Sbjct  66   FAPAAEESGGSSKQVNGSRTLNEKKSLPQQNGEKHSQSRLDGQGSKGKTSGTMSSSQGQQ  125

Query  448  NSGSTRSQGSMPRPTGRRTQMVSGNHLLNFHYDpisrpksrappprrqpkrkpYNKDLFL  627
            ++G    QGS    +GRR QM++ NHLLNFHYDPI RPK RAPPPRRQ K KPYNKDLFL
Sbjct  126  SNGPINGQGSSAYSSGRRAQMMNANHLLNFHYDPICRPKPRAPPPRRQQKIKPYNKDLFL  185

Query  628  QANYKFVVFSSGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
            QANYKFV+   GNY P SMDPDKML W+DIICV+++TP PVQCPICL
Sbjct  186  QANYKFVLLDKGNYTPASMDPDKMLIWDDIICVRYATPVPVQCPICL  232



>ref|XP_011468214.1| PREDICTED: RING finger protein 10 [Fragaria vesca subsp. vesca]
Length=749

 Score =   139 bits (351),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 102/219 (47%), Positives = 124/219 (57%), Gaps = 14/219 (6%)
 Frame = +1

Query  133  TNPNSNHGFLYFPNQHQQEEPSLSISGMGSLRIADsdsasssscsfsetssMGPAALGSC  312
             NPNS HG  +  +  Q +  S      GSL I+DS S +S   S        PA   S 
Sbjct  21   ANPNSQHGNHHDRHLFQPQSLSRQNIAFGSLDISDSHSPTSPGPSL-------PAPQDSL  73

Query  313  GSPEKV-NMSVGQNGIK-TLTYHSTGQISVDDRRKSP--GPGLPATSHNNSGSTRSQGSM  480
            GS ++V  + +  N +      HS  +   + R        G  + S  + G+  S GS 
Sbjct  74   GSSQEVTELGLADNNVMPNHERHSQSRSGGNGRGAGSYRSRGKRSGSQQSIGTVASHGSS  133

Query  481  PRPTGRRTQMVSGNHLLNFHYD---pisrpksrappprrqpkrkpYNKDLFLQANYKFVV  651
            P+P GRR+QM++GNHLLNFHYD            PP RRQ KRK YNKDLFLQANYKFVV
Sbjct  134  PQPAGRRSQMMNGNHLLNFHYDPISRPQARGPPPPPARRQHKRKAYNKDLFLQANYKFVV  193

Query  652  FSSGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
              +GNY  ESMDPDKML WEDIICV++STP  VQCPICL
Sbjct  194  LDAGNYSAESMDPDKMLRWEDIICVRYSTPTLVQCPICL  232



>ref|XP_003624500.1| RING finger protein [Medicago truncatula]
 gb|AES80718.1| RING finger protein [Medicago truncatula]
Length=744

 Score =   137 bits (346),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 89/173 (51%), Positives = 105/173 (61%), Gaps = 15/173 (9%)
 Frame = +1

Query  292  PAALGSCGSPEKVNMSVGQNGIKTLTYHSTGQISVDDRRKSPGPGL-------PATSHNN  450
            PAA  S    EKV      +G+KT   +S  Q      R++ G            +SH N
Sbjct  55   PAAENSGVPSEKVTELESSSGMKTPQRNSRTQSRSHSGRRTVGSSQYEGKTTGTVSSHRN  114

Query  451  ---SGSTRSQGSMPRPTGRRTQMVSGNHLLNFHYD----pisrpksrappprrqpkrkpY  609
               +GS  SQGS P   GR++QM + NHLLNF YD       R     PP RRQ K +PY
Sbjct  115  QQTTGSVYSQGSTPL-AGRKSQMANANHLLNFQYDPISRSQQRGPPPPPPARRQRKTRPY  173

Query  610  NKDLFLQANYKFVVFSSGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
            NKDLFLQAN+KF+V  SGNY P+SMDPDKML+WEDIICV +STPFPVQCPICL
Sbjct  174  NKDLFLQANFKFMVLDSGNYSPDSMDPDKMLQWEDIICVTYSTPFPVQCPICL  226



>ref|XP_010682974.1| PREDICTED: RING finger protein 10 isoform X2 [Beta vulgaris subsp. 
vulgaris]
Length=745

 Score =   137 bits (346),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 105/216 (49%), Positives = 131/216 (61%), Gaps = 7/216 (3%)
 Frame = +1

Query  136  NPNSNHGFLYFPNQHQQEEPSLSISGM-----GSLRIADsdsasssscsfsetssMGPAA  300
            NPN NHGF    +Q       +S+S +      SLRI+D  S++S++   +  S +  AA
Sbjct  23   NPNLNHGFSIEEDQLYHHHRHISLSSLQTPPLDSLRISDPQSSASATSDSASGSVVETAA  82

Query  301  LGSCGSPEKVNMSVGQNGIKTLTYHSTGQISVDDRRKSPGPGLPATSHNNSGSTRSQGSM  480
              S GS +KV      NG KT   HS    +  +     G G   +S   SGS  S G  
Sbjct  83   -NSNGSSKKVIGYGSSNGKKTSPNHSINSRNQSNSVAQVGIGSSQSSGEVSGSPPS-GRA  140

Query  481  PRPTGRRTQMVSGNHLLNFHYDpisrpksrappprrqpkrkpYNKDLFLQANYKFVVFSS  660
                 RR Q VSGNHLLNF Y+PISR +SR PP ++  K KPYNKDLFLQANYKFVV  S
Sbjct  141  SGSARRRYQTVSGNHLLNFQYNPISRTQSRGPPLKKPQKNKPYNKDLFLQANYKFVVLDS  200

Query  661  GNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
            G+Y  +SMDPDK+L+WEDIICV++STP P+QCPICL
Sbjct  201  GSYTIDSMDPDKLLQWEDIICVRYSTPQPIQCPICL  236



>ref|XP_010682973.1| PREDICTED: RING finger protein 10 isoform X1 [Beta vulgaris subsp. 
vulgaris]
Length=751

 Score =   137 bits (346),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 105/216 (49%), Positives = 131/216 (61%), Gaps = 7/216 (3%)
 Frame = +1

Query  136  NPNSNHGFLYFPNQHQQEEPSLSISGM-----GSLRIADsdsasssscsfsetssMGPAA  300
            NPN NHGF    +Q       +S+S +      SLRI+D  S++S++   +  S +  AA
Sbjct  23   NPNLNHGFSIEEDQLYHHHRHISLSSLQTPPLDSLRISDPQSSASATSDSASGSVVETAA  82

Query  301  LGSCGSPEKVNMSVGQNGIKTLTYHSTGQISVDDRRKSPGPGLPATSHNNSGSTRSQGSM  480
              S GS +KV      NG KT   HS    +  +     G G   +S   SGS  S G  
Sbjct  83   -NSNGSSKKVIGYGSSNGKKTSPNHSINSRNQSNSVAQVGIGSSQSSGEVSGSPPS-GRA  140

Query  481  PRPTGRRTQMVSGNHLLNFHYDpisrpksrappprrqpkrkpYNKDLFLQANYKFVVFSS  660
                 RR Q VSGNHLLNF Y+PISR +SR PP ++  K KPYNKDLFLQANYKFVV  S
Sbjct  141  SGSARRRYQTVSGNHLLNFQYNPISRTQSRGPPLKKPQKNKPYNKDLFLQANYKFVVLDS  200

Query  661  GNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
            G+Y  +SMDPDK+L+WEDIICV++STP P+QCPICL
Sbjct  201  GSYTIDSMDPDKLLQWEDIICVRYSTPQPIQCPICL  236



>gb|KDP41854.1| hypothetical protein JCGZ_26872 [Jatropha curcas]
Length=747

 Score =   137 bits (346),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 104/239 (44%), Positives = 130/239 (54%), Gaps = 56/239 (23%)
 Frame = +1

Query  133  TNPNSNHGF--------------LYFPNQHQQEEPSLSISGMGSLRIADsdsasssscsf  270
            T+PNSNHG               + F +  Q + P +++SG+ +                
Sbjct  22   TSPNSNHGTSSQSPSSLSRQFQSMQFIDDAQSQSP-IAVSGLSA----------------  64

Query  271  setssMGPAALGSCGSPEKVNMSVGQNGIKTLTYHSTGQISVDDRRKSPGPGLPATSHNN  450
                   PAA  S GS +KVN     NG  +L+    G++ +    +SP  G    S  +
Sbjct  65   -------PAAEYSGGSSKKVNELRASNGESSLS-QQNGEMHL----QSPLDGQGVGSARS  112

Query  451  SGSTRSQGSMP-------------RPTGRRTQMVSGNHLLNFHYDpisrpksrappprrq  591
             G   +    P               TGRR QM++ NHLLNF YDPI+R + RAPPPRRQ
Sbjct  113  KGKISTWNCAPGGNGPISGPGGNAYSTGRRGQMMNANHLLNFQYDPIARSQPRAPPPRRQ  172

Query  592  pkrkpYNKDLFLQANYKFVVFSSGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
             K KPYNKDLFLQANYKFVV  +GNY PE MDPDKML WEDIICV+++TPFPVQCPICL
Sbjct  173  QKIKPYNKDLFLQANYKFVVLDTGNYAPELMDPDKMLRWEDIICVRYATPFPVQCPICL  231



>ref|XP_008347984.1| PREDICTED: RING finger protein 10-like isoform X1 [Malus domestica]
Length=776

 Score =   137 bits (344),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 112/235 (48%), Positives = 136/235 (58%), Gaps = 26/235 (11%)
 Frame = +1

Query  133  TNPNSNHGFLYF--------PNQHQQEEPSLSISGMGSLRIADsdsasssscsfsetssM  288
             NPNS HG  +         P      +PS  I   GSLRI+DS S+SS++   S     
Sbjct  22   VNPNSQHGHRHRHLSLSQSQPQSLSPPDPSRQILAFGSLRISDSQSSSSATGGLSPP---  78

Query  289  GPAALGSCGSPEKVNMSVGQNGIKTL--TYHST-----------GQISVDDRRKSPGPGL  429
             PAA  S GS ++VN      G KTL   +H T           G  S   R K  G   
Sbjct  79   APAAEDSGGSSQQVNELGMPGGNKTLPNNHHETHSQCHSGGGGRGVGSPWSRGKRSGTFG  138

Query  430  PATSHNNSGSTRSQGSMPRPTGRRTQMVSGNHLLNFHYD--pisrpksrappprrqpkrk  603
              ++  + GS  S G+    TGR+ Q+++GNHLLNF+YD     + ++  PPPRRQ KRK
Sbjct  139  SGSTEQSIGSAASHGNSTHQTGRKAQLMNGNHLLNFYYDPIARPQRRAAPPPPRRQHKRK  198

Query  604  pYNKDLFLQANYKFVVFSSGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
            PYNKDLFLQANYKFVV  SGNY  ESMDPDKML+WEDIICV++STP  VQCPICL
Sbjct  199  PYNKDLFLQANYKFVVLDSGNYSAESMDPDKMLQWEDIICVRYSTPTVVQCPICL  253



>ref|XP_008347985.1| PREDICTED: RING finger protein 10-like isoform X2 [Malus domestica]
Length=775

 Score =   136 bits (343),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 112/235 (48%), Positives = 136/235 (58%), Gaps = 26/235 (11%)
 Frame = +1

Query  133  TNPNSNHGFLYF--------PNQHQQEEPSLSISGMGSLRIADsdsasssscsfsetssM  288
             NPNS HG  +         P      +PS  I   GSLRI+DS S+SS++   S     
Sbjct  22   VNPNSQHGHRHRHLSLSQSQPQSLSPPDPSRQILAFGSLRISDSQSSSSATGGLSPP---  78

Query  289  GPAALGSCGSPEKVNMSVGQNGIKTL--TYHST-----------GQISVDDRRKSPGPGL  429
             PAA  S GS ++VN      G KTL   +H T           G  S   R K  G   
Sbjct  79   APAAEDSGGSSQQVNELGMPGGNKTLPNNHHETHSQCHSGGGGRGVGSPWSRGKRSGTFG  138

Query  430  PATSHNNSGSTRSQGSMPRPTGRRTQMVSGNHLLNFHYD--pisrpksrappprrqpkrk  603
              ++  + GS  S G+    TGR+ Q+++GNHLLNF+YD     + ++  PPPRRQ KRK
Sbjct  139  SGSTEQSIGSAASHGNSTHQTGRKAQLMNGNHLLNFYYDPIARPQRRAAPPPPRRQHKRK  198

Query  604  pYNKDLFLQANYKFVVFSSGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
            PYNKDLFLQANYKFVV  SGNY  ESMDPDKML+WEDIICV++STP  VQCPICL
Sbjct  199  PYNKDLFLQANYKFVVLDSGNYSAESMDPDKMLQWEDIICVRYSTPTVVQCPICL  253



>emb|CDP16737.1| unnamed protein product [Coffea canephora]
Length=750

 Score =   133 bits (335),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 91/165 (55%), Positives = 104/165 (63%), Gaps = 13/165 (8%)
 Frame = +1

Query  304  GSCGSPEKVNM----SVGQNGIKTLTYHSTGQISVDDRRKSPGPGLPATSHNNSGSTRSQ  471
            GS G  EKVN       G+N +        G  S+ D+ K         S NN  ST S+
Sbjct  79   GSDGPSEKVNYWEKHGAGKNMVNVADQVGDGLRSIQDQGK---LSQSVASPNNGQSTTSR  135

Query  472  G----SMPRPTGRRTQMVSGNHLLNFHYD--pisrpksrappprrqpkrkpYNKDLFLQA  633
            G    S     GR+T MVSGNHLLNFHYD      P+ RAPPPRR+ +RKPYNKDLF+QA
Sbjct  136  GGPRGSSTTSAGRKTLMVSGNHLLNFHYDPISRQNPRPRAPPPRRKQRRKPYNKDLFIQA  195

Query  634  NYKFVVFSSGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
            NYKFV+  SGNY PESMDPDKML WEDIIC+K+ TPF V CPICL
Sbjct  196  NYKFVILDSGNYEPESMDPDKMLLWEDIICLKYFTPFEVHCPICL  240



>ref|XP_006468890.1| PREDICTED: RING finger protein 10-like [Citrus sinensis]
Length=789

 Score =   133 bits (334),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 89/176 (51%), Positives = 111/176 (63%), Gaps = 19/176 (11%)
 Frame = +1

Query  286  MGPAALGSCGSPEKVNMSVGQNGIKTLTYHST-------------GQISVDDRRKSPGPG  426
            +   A  S GS ++V+ +   NG K+L+  ++             G  S  ++ K  G  
Sbjct  50   LASTAQDSGGSSKEVSEAGTPNGRKSLSRWNSDRQFRNHNHPRGRGAGSAQNKGKMSGDS  109

Query  427  LPATSHNNSGSTRSQGSMPRPTGRRTQMVSGNHLLNFHYDpisrpksrapp--prrqpkr  600
            +   S   +G   SQGS    +GRR Q +SGNHLLNF YDPISRP+ R PP   RRQ K 
Sbjct  110  VSPISQQRAGPVTSQGS----SGRRAQTISGNHLLNFQYDPISRPQYRMPPPPARRQRKI  165

Query  601  kpYNKDLFLQANYKFVVFSSGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
            +PYNKDLFLQANYKFVV  +G+Y PESMDPDKML+WEDIICV++S P  VQCPICL
Sbjct  166  RPYNKDLFLQANYKFVVLDTGDYTPESMDPDKMLQWEDIICVRYSNPLSVQCPICL  221



>gb|KCW55769.1| hypothetical protein EUGRSUZ_I01601 [Eucalyptus grandis]
Length=531

 Score =   130 bits (327),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 84/164 (51%), Positives = 107/164 (65%), Gaps = 13/164 (8%)
 Frame = +1

Query  286  MGPAALGSCGSPEKVNMSVGQNGIKTLTYHSTGQ-ISVDDRRKSPGPGLPATSHNNSGST  462
            +   A  S GS +KV++S   NG K+ +  +  + ++++           A S   +GST
Sbjct  57   LAAVAESSNGSSQKVSVSGSPNGQKSGSSQAKCKALAIN----------AARSQRATGST  106

Query  463  RSQGSMPRPTGRRTQMVSGNHLLNFHYD--pisrpksrappprrqpkrkpYNKDLFLQAN  636
             S GS  +  GRR Q+V+GNHLLNFHYD    S+ +   PPPRRQ K KPYNKDLFLQAN
Sbjct  107  DSLGSPMQSAGRRAQVVNGNHLLNFHYDPISRSQFRQPPPPPRRQQKIKPYNKDLFLQAN  166

Query  637  YKFVVFSSGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
            YKFVV  S +Y P+ M+PDKML WEDIICV++STP  VQCPICL
Sbjct  167  YKFVVLDSADYEPDLMNPDKMLRWEDIICVRYSTPSVVQCPICL  210



>ref|XP_010028937.1| PREDICTED: RING finger protein 10 [Eucalyptus grandis]
 gb|KCW55768.1| hypothetical protein EUGRSUZ_I01601 [Eucalyptus grandis]
Length=670

 Score =   131 bits (329),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 84/164 (51%), Positives = 107/164 (65%), Gaps = 13/164 (8%)
 Frame = +1

Query  286  MGPAALGSCGSPEKVNMSVGQNGIKTLTYHSTGQ-ISVDDRRKSPGPGLPATSHNNSGST  462
            +   A  S GS +KV++S   NG K+ +  +  + ++++           A S   +GST
Sbjct  57   LAAVAESSNGSSQKVSVSGSPNGQKSGSSQAKCKALAIN----------AARSQRATGST  106

Query  463  RSQGSMPRPTGRRTQMVSGNHLLNFHYD--pisrpksrappprrqpkrkpYNKDLFLQAN  636
             S GS  +  GRR Q+V+GNHLLNFHYD    S+ +   PPPRRQ K KPYNKDLFLQAN
Sbjct  107  DSLGSPMQSAGRRAQVVNGNHLLNFHYDPISRSQFRQPPPPPRRQQKIKPYNKDLFLQAN  166

Query  637  YKFVVFSSGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
            YKFVV  S +Y P+ M+PDKML WEDIICV++STP  VQCPICL
Sbjct  167  YKFVVLDSADYEPDLMNPDKMLRWEDIICVRYSTPSVVQCPICL  210



>ref|XP_009378041.1| PREDICTED: RING finger protein 10 isoform X3 [Pyrus x bretschneideri]
Length=783

 Score =   131 bits (330),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 105/208 (50%), Positives = 133/208 (64%), Gaps = 18/208 (9%)
 Frame = +1

Query  190  EPSLSISGMGSLRIADsdsasssscsfsetssMGPAALGSCGSPEKVN---MSVGQNGIK  360
            +PS  I   GSLRI+DS S+SS++   S +    PAA  S GS ++V    M  G   I 
Sbjct  55   DPSRQILQFGSLRISDSQSSSSATAGLSPS---APAAEDSGGSSQQVTELGMPGGNKAIP  111

Query  361  TLTYHSTGQI----------SVDDRRKSPGPGLPATSHNNSGSTRSQGSMPRPTGRRTQM  510
               +H+  Q           +   R K  G    +++ ++ GS  S G+    TGR+TQ+
Sbjct  112  NNLHHTHLQCHSGGGGRGVGTPRSRGKRSGTDGSSSTQHSIGSVASHGNSTHQTGRKTQL  171

Query  511  VSGNHLLNFHYDpisrpksrappp--rrqpkrkpYNKDLFLQANYKFVVFSSGNYVPESM  684
            ++GNHLLNF+YDPIS P+ RA PP  RRQ KRKPYNKDLFLQANYKFVV  SGNY  E+M
Sbjct  172  MNGNHLLNFYYDPISHPQHRAAPPPPRRQHKRKPYNKDLFLQANYKFVVLDSGNYSAETM  231

Query  685  DPDKMLEWEDIICVKFSTPFPVQCPICL  768
            DPDK+L+WEDIICV++STP  VQCPICL
Sbjct  232  DPDKVLQWEDIICVRYSTPTVVQCPICL  259



>gb|KDO43572.1| hypothetical protein CISIN_1g003879mg [Citrus sinensis]
Length=789

 Score =   131 bits (329),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 88/176 (50%), Positives = 111/176 (63%), Gaps = 19/176 (11%)
 Frame = +1

Query  286  MGPAALGSCGSPEKVNMSVGQNGIKTLTYHST-------------GQISVDDRRKSPGPG  426
            +   A  S GS ++V+ +   NG K+L+  ++             G  S  ++ K  G  
Sbjct  50   LASTAQDSGGSSKEVSEAGTPNGRKSLSRWNSDRQFRNHNHPRGRGAGSAQNKGKMSGDS  109

Query  427  LPATSHNNSGSTRSQGSMPRPTGRRTQMVSGNHLLNFHYDpisrpksrapp--prrqpkr  600
            +   S   +G   SQGS    +GRR Q +SGNHLLNF YDPISRP+ R PP   RRQ K 
Sbjct  110  VSPRSQQRAGPVASQGS----SGRRAQTISGNHLLNFQYDPISRPQYRMPPPPARRQRKI  165

Query  601  kpYNKDLFLQANYKFVVFSSGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
            +PYNKDLFLQANYKFVV  +G++ PESMDPDKML+WEDIICV++S P  VQCPICL
Sbjct  166  RPYNKDLFLQANYKFVVLDTGDHAPESMDPDKMLQWEDIICVRYSNPLSVQCPICL  221



>ref|XP_006446937.1| hypothetical protein CICLE_v10014332mg [Citrus clementina]
 gb|ESR60177.1| hypothetical protein CICLE_v10014332mg [Citrus clementina]
Length=789

 Score =   131 bits (329),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 80/131 (61%), Positives = 93/131 (71%), Gaps = 6/131 (5%)
 Frame = +1

Query  382  GQISVDDRRKSPGPGLPATSHNNSGSTRSQGSMPRPTGRRTQMVSGNHLLNFHYDpisrp  561
            G  S  ++ K  G  +   S   +G   SQGS    +GRR Q +SGNHLLNF YDPISRP
Sbjct  95   GAGSAQNKGKMSGDSVSPRSQQRAGPVASQGS----SGRRAQTISGNHLLNFQYDPISRP  150

Query  562  ksrapp--prrqpkrkpYNKDLFLQANYKFVVFSSGNYVPESMDPDKMLEWEDIICVKFS  735
            + R PP   RRQ K +PYNKDLFLQANYKFVV  +G+Y PESMDPDKML+WEDIICV++S
Sbjct  151  QYRMPPPPARRQRKIRPYNKDLFLQANYKFVVLDTGDYAPESMDPDKMLQWEDIICVRYS  210

Query  736  TPFPVQCPICL  768
             P  VQCPICL
Sbjct  211  NPLSVQCPICL  221



>ref|XP_009378043.1| PREDICTED: RING finger protein 10 isoform X5 [Pyrus x bretschneideri]
Length=782

 Score =   130 bits (328),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 105/208 (50%), Positives = 133/208 (64%), Gaps = 17/208 (8%)
 Frame = +1

Query  190  EPSLSISGMGSLRIADsdsasssscsfsetssMGPAALGSCGSPEKVN---MSVGQNGIK  360
            +PS  I   GSLRI+DS S+SS++ +    S   PAA  S GS ++V    M  G   I 
Sbjct  55   DPSRQILQFGSLRISDSQSSSSATSAGLSPS--APAAEDSGGSSQQVTELGMPGGNKAIP  112

Query  361  TLTYHSTGQI----------SVDDRRKSPGPGLPATSHNNSGSTRSQGSMPRPTGRRTQM  510
               +H+  Q           +   R K  G    +++ ++ GS  S G+    TGR+TQ+
Sbjct  113  NNLHHTHLQCHSGGGGRGVGTPRSRGKRSGTDGSSSTQHSIGSVASHGNSTHQTGRKTQL  172

Query  511  VSGNHLLNFHYDpisrpksrappp--rrqpkrkpYNKDLFLQANYKFVVFSSGNYVPESM  684
            ++GNHLLNF+YDPIS P+ RA PP  RRQ KRKPYNKDLFLQANYKFVV  SGNY  E+M
Sbjct  173  MNGNHLLNFYYDPISHPQHRAAPPPPRRQHKRKPYNKDLFLQANYKFVVLDSGNYSAETM  232

Query  685  DPDKMLEWEDIICVKFSTPFPVQCPICL  768
            DPDK+L+WEDIICV++STP  VQCPICL
Sbjct  233  DPDKVLQWEDIICVRYSTPTVVQCPICL  260



>ref|XP_009378040.1| PREDICTED: RING finger protein 10 isoform X2 [Pyrus x bretschneideri]
Length=783

 Score =   130 bits (328),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 105/208 (50%), Positives = 133/208 (64%), Gaps = 17/208 (8%)
 Frame = +1

Query  190  EPSLSISGMGSLRIADsdsasssscsfsetssMGPAALGSCGSPEKVN---MSVGQNGIK  360
            +PS  I   GSLRI+DS S+SS++ +    S   PAA  S GS ++V    M  G   I 
Sbjct  55   DPSRQILQFGSLRISDSQSSSSATSAGLSPS--APAAEDSGGSSQQVTELGMPGGNKAIP  112

Query  361  TLTYHSTGQI----------SVDDRRKSPGPGLPATSHNNSGSTRSQGSMPRPTGRRTQM  510
               +H+  Q           +   R K  G    +++ ++ GS  S G+    TGR+TQ+
Sbjct  113  NNLHHTHLQCHSGGGGRGVGTPRSRGKRSGTDGSSSTQHSIGSVASHGNSTHQTGRKTQL  172

Query  511  VSGNHLLNFHYDpisrpksrappp--rrqpkrkpYNKDLFLQANYKFVVFSSGNYVPESM  684
            ++GNHLLNF+YDPIS P+ RA PP  RRQ KRKPYNKDLFLQANYKFVV  SGNY  E+M
Sbjct  173  MNGNHLLNFYYDPISHPQHRAAPPPPRRQHKRKPYNKDLFLQANYKFVVLDSGNYSAETM  232

Query  685  DPDKMLEWEDIICVKFSTPFPVQCPICL  768
            DPDK+L+WEDIICV++STP  VQCPICL
Sbjct  233  DPDKVLQWEDIICVRYSTPTVVQCPICL  260



>ref|XP_009378042.1| PREDICTED: RING finger protein 10 isoform X4 [Pyrus x bretschneideri]
Length=783

 Score =   130 bits (328),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 105/208 (50%), Positives = 133/208 (64%), Gaps = 18/208 (9%)
 Frame = +1

Query  190  EPSLSISGMGSLRIADsdsasssscsfsetssMGPAALGSCGSPEKVN---MSVGQNGIK  360
            +PS  I   GSLRI+DS S+SS++   S +    PAA  S GS ++V    M  G   I 
Sbjct  55   DPSRQILQFGSLRISDSQSSSSANSGLSPS---APAAEDSGGSSQQVTELGMPGGNKAIP  111

Query  361  TLTYHSTGQI----------SVDDRRKSPGPGLPATSHNNSGSTRSQGSMPRPTGRRTQM  510
               +H+  Q           +   R K  G    +++ ++ GS  S G+    TGR+TQ+
Sbjct  112  NNLHHTHLQCHSGGGGRGVGTPRSRGKRSGTDGSSSTQHSIGSVASHGNSTHQTGRKTQL  171

Query  511  VSGNHLLNFHYDpisrpksrappp--rrqpkrkpYNKDLFLQANYKFVVFSSGNYVPESM  684
            ++GNHLLNF+YDPIS P+ RA PP  RRQ KRKPYNKDLFLQANYKFVV  SGNY  E+M
Sbjct  172  MNGNHLLNFYYDPISHPQHRAAPPPPRRQHKRKPYNKDLFLQANYKFVVLDSGNYSAETM  231

Query  685  DPDKMLEWEDIICVKFSTPFPVQCPICL  768
            DPDK+L+WEDIICV++STP  VQCPICL
Sbjct  232  DPDKVLQWEDIICVRYSTPTVVQCPICL  259



>ref|XP_009378039.1| PREDICTED: RING finger protein 10 isoform X1 [Pyrus x bretschneideri]
Length=784

 Score =   130 bits (328),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 105/208 (50%), Positives = 133/208 (64%), Gaps = 17/208 (8%)
 Frame = +1

Query  190  EPSLSISGMGSLRIADsdsasssscsfsetssMGPAALGSCGSPEKVN---MSVGQNGIK  360
            +PS  I   GSLRI+DS S+SS++ +    S   PAA  S GS ++V    M  G   I 
Sbjct  55   DPSRQILQFGSLRISDSQSSSSATSAGLSPS--APAAEDSGGSSQQVTELGMPGGNKAIP  112

Query  361  TLTYHSTGQI----------SVDDRRKSPGPGLPATSHNNSGSTRSQGSMPRPTGRRTQM  510
               +H+  Q           +   R K  G    +++ ++ GS  S G+    TGR+TQ+
Sbjct  113  NNLHHTHLQCHSGGGGRGVGTPRSRGKRSGTDGSSSTQHSIGSVASHGNSTHQTGRKTQL  172

Query  511  VSGNHLLNFHYDpisrpksrappp--rrqpkrkpYNKDLFLQANYKFVVFSSGNYVPESM  684
            ++GNHLLNF+YDPIS P+ RA PP  RRQ KRKPYNKDLFLQANYKFVV  SGNY  E+M
Sbjct  173  MNGNHLLNFYYDPISHPQHRAAPPPPRRQHKRKPYNKDLFLQANYKFVVLDSGNYSAETM  232

Query  685  DPDKMLEWEDIICVKFSTPFPVQCPICL  768
            DPDK+L+WEDIICV++STP  VQCPICL
Sbjct  233  DPDKVLQWEDIICVRYSTPTVVQCPICL  260



>ref|XP_007214973.1| hypothetical protein PRUPE_ppa001768mg [Prunus persica]
 gb|EMJ16172.1| hypothetical protein PRUPE_ppa001768mg [Prunus persica]
Length=768

 Score =   130 bits (327),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 91/172 (53%), Positives = 109/172 (63%), Gaps = 13/172 (8%)
 Frame = +1

Query  292  PAALGSCGSPE---KVNMSVGQNGI----KTLTY-HSTGQI----SVDDRRKSPGPGLPA  435
            PAA  S GS +   K+ M  G+  +    +TL+  HS G      S     KS G     
Sbjct  80   PAAEASAGSSQEVTKLGMPRGKKALPNDNETLSQCHSGGGGQGIGSARSSGKSSGTVGSR  139

Query  436  TSHNNSGSTRSQGSMPRPTGRRTQMVSGNHLLNFHYDpisrpksrappprrqpkrkp-YN  612
            +S     S  S GS   P GR+ Q+++GNHLLNFHYDPISRP+ R  PP R+  ++  YN
Sbjct  140  SSQQTIESVGSHGSSTHPAGRKAQLMNGNHLLNFHYDPISRPQPRTAPPPRRHHKRKPYN  199

Query  613  KDLFLQANYKFVVFSSGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
            KDLFLQANYKFVV  SGNY  ESMDPDKML+WEDIICV++STP  VQCPICL
Sbjct  200  KDLFLQANYKFVVLDSGNYSVESMDPDKMLKWEDIICVRYSTPTLVQCPICL  251



>ref|XP_007214972.1| hypothetical protein PRUPE_ppa001768mg [Prunus persica]
 gb|EMJ16171.1| hypothetical protein PRUPE_ppa001768mg [Prunus persica]
Length=767

 Score =   130 bits (327),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 91/172 (53%), Positives = 109/172 (63%), Gaps = 13/172 (8%)
 Frame = +1

Query  292  PAALGSCGSPE---KVNMSVGQNGI----KTLTY-HSTGQI----SVDDRRKSPGPGLPA  435
            PAA  S GS +   K+ M  G+  +    +TL+  HS G      S     KS G     
Sbjct  80   PAAEASAGSSQEVTKLGMPRGKKALPNDNETLSQCHSGGGGQGIGSARSSGKSSGTVGSR  139

Query  436  TSHNNSGSTRSQGSMPRPTGRRTQMVSGNHLLNFHYDpisrpksrappprrqpkrkp-YN  612
            +S     S  S GS   P GR+ Q+++GNHLLNFHYDPISRP+ R  PP R+  ++  YN
Sbjct  140  SSQQTIESVGSHGSSTHPAGRKAQLMNGNHLLNFHYDPISRPQPRTAPPPRRHHKRKPYN  199

Query  613  KDLFLQANYKFVVFSSGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
            KDLFLQANYKFVV  SGNY  ESMDPDKML+WEDIICV++STP  VQCPICL
Sbjct  200  KDLFLQANYKFVVLDSGNYSVESMDPDKMLKWEDIICVRYSTPTLVQCPICL  251



>ref|XP_010528130.1| PREDICTED: RING finger protein 10 isoform X1 [Tarenaya hassleriana]
Length=746

 Score =   129 bits (325),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 76/113 (67%), Positives = 90/113 (80%), Gaps = 4/113 (4%)
 Frame = +1

Query  442  HNNSGSTRSQGSMPR--PTGRRTQMVSGNHLLNFHYDpisrpksra--ppprrqpkrkpY  609
             +N+G + S  S  R  PTGRR   +SGNHLLNFHYDPIS P++RA   P RR  KR+PY
Sbjct  121  QHNTGPSNSPTSASRHNPTGRRANTISGNHLLNFHYDPISSPQTRAPPQPQRRPYKRRPY  180

Query  610  NKDLFLQANYKFVVFSSGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
            NKDLFLQANYKFVV  +G++ PESMDPDKML+W+DIICV++STP PVQCPICL
Sbjct  181  NKDLFLQANYKFVVLDTGDHSPESMDPDKMLQWDDIICVRYSTPSPVQCPICL  233



>ref|XP_010528131.1| PREDICTED: RING finger protein 10 isoform X2 [Tarenaya hassleriana]
Length=740

 Score =   129 bits (325),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 76/113 (67%), Positives = 90/113 (80%), Gaps = 4/113 (4%)
 Frame = +1

Query  442  HNNSGSTRSQGSMPR--PTGRRTQMVSGNHLLNFHYDpisrpksra--ppprrqpkrkpY  609
             +N+G + S  S  R  PTGRR   +SGNHLLNFHYDPIS P++RA   P RR  KR+PY
Sbjct  115  QHNTGPSNSPTSASRHNPTGRRANTISGNHLLNFHYDPISSPQTRAPPQPQRRPYKRRPY  174

Query  610  NKDLFLQANYKFVVFSSGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
            NKDLFLQANYKFVV  +G++ PESMDPDKML+W+DIICV++STP PVQCPICL
Sbjct  175  NKDLFLQANYKFVVLDTGDHSPESMDPDKMLQWDDIICVRYSTPSPVQCPICL  227



>ref|XP_010929676.1| PREDICTED: RING finger protein 10 [Elaeis guineensis]
Length=774

 Score =   129 bits (325),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 75/111 (68%), Positives = 85/111 (77%), Gaps = 0/111 (0%)
 Frame = +1

Query  436  TSHNNSGSTRSQGSMPRPTGRRTQMVSGNHLLNFHYDpisrpksrappprrqpkrkpYNK  615
            + H  +G+  +QGS      RR Q+VS NHLLNF+YDPISRP+ R PPPRRQ K KPYNK
Sbjct  139  SDHLAAGTVGTQGSTAHSAARRNQVVSANHLLNFYYDPISRPQPRLPPPRRQQKIKPYNK  198

Query  616  DLFLQANYKFVVFSSGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
            DLFLQANYKFVV  +G Y  E  DPDKML WED+ICV+FSTP PVQCPICL
Sbjct  199  DLFLQANYKFVVLDTGCYEVELTDPDKMLRWEDVICVRFSTPIPVQCPICL  249



>ref|XP_008362083.1| PREDICTED: RING finger protein 10-like isoform X1 [Malus domestica]
Length=777

 Score =   128 bits (322),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 109/234 (47%), Positives = 139/234 (59%), Gaps = 25/234 (11%)
 Frame = +1

Query  136  NPNSNHGFLYFPNQHQQE--------EPSLSISGMGSLRIADsdsasssscsfsetssMG  291
            NPNS HG  +      Q         +PS  I   GSLRI+DS S+SS++ S    S   
Sbjct  23   NPNSQHGHRHHHVSLSQSQSQSLSPPDPSRQILQFGSLRISDSQSSSSATSSGLSPS--A  80

Query  292  PAALGSCGSPEKVN---MSVGQNGIKTLTYHSTGQI----------SVDDRRKSPGPGLP  432
            PAA  S GS ++V    +  G   +    +H+  Q           S   R K  G    
Sbjct  81   PAAEDSGGSSQQVTELGIPWGNQALPNNLHHTHSQCHSGGGGRGVGSPWSRGKRSGTDGS  140

Query  433  ATSHNNSGSTRSQGSMPRPTGRRTQMVSGNHLLNFHYDpisrpksrap--pprrqpkrkp  606
            +++ ++ GS  S G+    TG++TQ+++GNHLLNF+YDPISRP+ RA     RRQ KRKP
Sbjct  141  SSTQHSMGSVASHGNSTHQTGKKTQLMNGNHLLNFYYDPISRPQHRAAPPSSRRQHKRKP  200

Query  607  YNKDLFLQANYKFVVFSSGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
            YNKDLFLQANYKFVV  S NY  E+MDPDK+L+WEDIICV++STP  VQCPICL
Sbjct  201  YNKDLFLQANYKFVVLDSVNYSAEAMDPDKVLQWEDIICVRYSTPTVVQCPICL  254



>ref|XP_008362084.1| PREDICTED: RING finger protein 10-like isoform X2 [Malus domestica]
Length=776

 Score =   128 bits (322),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 109/234 (47%), Positives = 139/234 (59%), Gaps = 25/234 (11%)
 Frame = +1

Query  136  NPNSNHGFLYFPNQHQQE--------EPSLSISGMGSLRIADsdsasssscsfsetssMG  291
            NPNS HG  +      Q         +PS  I   GSLRI+DS S+SS++ S    S   
Sbjct  23   NPNSQHGHRHHHVSLSQSQSQSLSPPDPSRQILQFGSLRISDSQSSSSATSSGLSPS--A  80

Query  292  PAALGSCGSPEKVN---MSVGQNGIKTLTYHSTGQI----------SVDDRRKSPGPGLP  432
            PAA  S GS ++V    +  G   +    +H+  Q           S   R K  G    
Sbjct  81   PAAEDSGGSSQQVTELGIPWGNQALPNNLHHTHSQCHSGGGGRGVGSPWSRGKRSGTDGS  140

Query  433  ATSHNNSGSTRSQGSMPRPTGRRTQMVSGNHLLNFHYDpisrpksrap--pprrqpkrkp  606
            +++ ++ GS  S G+    TG++TQ+++GNHLLNF+YDPISRP+ RA     RRQ KRKP
Sbjct  141  SSTQHSMGSVASHGNSTHQTGKKTQLMNGNHLLNFYYDPISRPQHRAAPPSSRRQHKRKP  200

Query  607  YNKDLFLQANYKFVVFSSGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
            YNKDLFLQANYKFVV  S NY  E+MDPDK+L+WEDIICV++STP  VQCPICL
Sbjct  201  YNKDLFLQANYKFVVLDSVNYSAEAMDPDKVLQWEDIICVRYSTPTVVQCPICL  254



>gb|KDO43574.1| hypothetical protein CISIN_1g003879mg [Citrus sinensis]
Length=549

 Score =   126 bits (317),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 76/119 (64%), Positives = 88/119 (74%), Gaps = 6/119 (5%)
 Frame = +1

Query  418  GPGLPATSHNNSGSTRSQGSMPRPTGRRTQMVSGNHLLNFHYDpisrpksrapp--prrq  591
            G  +   S   +G   SQGS    +GRR Q +SGNHLLNF YDPISRP+ R PP   RRQ
Sbjct  3    GDSVSPRSQQRAGPVASQGS----SGRRAQTISGNHLLNFQYDPISRPQYRMPPPPARRQ  58

Query  592  pkrkpYNKDLFLQANYKFVVFSSGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
             K +PYNKDLFLQANYKFVV  +G++ PESMDPDKML+WEDIICV++S P  VQCPICL
Sbjct  59   RKIRPYNKDLFLQANYKFVVLDTGDHAPESMDPDKMLQWEDIICVRYSNPLSVQCPICL  117



>gb|KDO43575.1| hypothetical protein CISIN_1g003879mg [Citrus sinensis]
Length=527

 Score =   125 bits (315),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 76/119 (64%), Positives = 88/119 (74%), Gaps = 6/119 (5%)
 Frame = +1

Query  418  GPGLPATSHNNSGSTRSQGSMPRPTGRRTQMVSGNHLLNFHYDpisrpksrapp--prrq  591
            G  +   S   +G   SQGS    +GRR Q +SGNHLLNF YDPISRP+ R PP   RRQ
Sbjct  3    GDSVSPRSQQRAGPVASQGS----SGRRAQTISGNHLLNFQYDPISRPQYRMPPPPARRQ  58

Query  592  pkrkpYNKDLFLQANYKFVVFSSGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
             K +PYNKDLFLQANYKFVV  +G++ PESMDPDKML+WEDIICV++S P  VQCPICL
Sbjct  59   RKIRPYNKDLFLQANYKFVVLDTGDHAPESMDPDKMLQWEDIICVRYSNPLSVQCPICL  117



>gb|KDO43573.1| hypothetical protein CISIN_1g003879mg [Citrus sinensis]
Length=685

 Score =   127 bits (318),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 76/119 (64%), Positives = 88/119 (74%), Gaps = 6/119 (5%)
 Frame = +1

Query  418  GPGLPATSHNNSGSTRSQGSMPRPTGRRTQMVSGNHLLNFHYDpisrpksrapp--prrq  591
            G  +   S   +G   SQGS    +GRR Q +SGNHLLNF YDPISRP+ R PP   RRQ
Sbjct  3    GDSVSPRSQQRAGPVASQGS----SGRRAQTISGNHLLNFQYDPISRPQYRMPPPPARRQ  58

Query  592  pkrkpYNKDLFLQANYKFVVFSSGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
             K +PYNKDLFLQANYKFVV  +G++ PESMDPDKML+WEDIICV++S P  VQCPICL
Sbjct  59   RKIRPYNKDLFLQANYKFVVLDTGDHAPESMDPDKMLQWEDIICVRYSNPLSVQCPICL  117



>ref|XP_007161621.1| hypothetical protein PHAVU_001G084800g [Phaseolus vulgaris]
 gb|ESW33615.1| hypothetical protein PHAVU_001G084800g [Phaseolus vulgaris]
Length=741

 Score =   127 bits (318),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 108/222 (49%), Positives = 123/222 (55%), Gaps = 31/222 (14%)
 Frame = +1

Query  136  NPNSNHGF-LYFPNQHQQEEPSLS---ISGMGSLRIADsdsasssscsfsetssMGPAAL  303
            NPN  HG  +  P   QQ  P LS      +GSL+I+D   +S+             AA 
Sbjct  22   NPNPQHGIGIPLP---QQPFPYLSPPLHHALGSLQISDIPGSSTQ------------AAE  66

Query  304  GSCGSPEKVNMSVGQNGIKTLTYHSTGQISVDDRRKSPGPGLPATSHNNS---GSTRSQG  474
             S GS EKV      +G+      S  Q S    R   G      SH N    GS  S G
Sbjct  67   DSGGSSEKVTELGSPSGVMV----SPQQNSRTRSRIPGGRRAGMASHRNQQAPGSVSSHG  122

Query  475  SMPRPTGRRTQMVSGNHLLNFHYDpisrpksrappprrqp----krkpYNKDLFLQANYK  642
            S P   GR+ Q V+GN+LLNF YDPISR + R PPP        KRKPYNKDLFLQANYK
Sbjct  123  SSPL-AGRKAQTVNGNYLLNFQYDPISRSQPRGPPPPPAARRNWKRKPYNKDLFLQANYK  181

Query  643  FVVFSSGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
            F+V  SGNY PE MDPDKML+WEDIICV + TPF VQCPICL
Sbjct  182  FMVLDSGNYSPELMDPDKMLQWEDIICVTYLTPFSVQCPICL  223



>ref|XP_003553982.1| PREDICTED: RING finger protein 10-like isoform X1 [Glycine max]
Length=747

 Score =   126 bits (316),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 84/159 (53%), Positives = 101/159 (64%), Gaps = 17/159 (11%)
 Frame = +1

Query  304  GSCGSPEKVNMSVGQNGIKTLTYHSTGQISVDDRRKSPGPGLPATSHNNSGSTRSQGSMP  483
            G   SPE+ + +  ++     T   TG +S    +++PG            S  S GS P
Sbjct  83   GVMVSPEQNSRTRSRSHGARWTRTRTGTVSYHRNQQTPG------------SVSSHGSAP  130

Query  484  RPTGRRTQMVSGNHLLNFHYDpisrpksr----appprrqpkrkpYNKDLFLQANYKFVV  651
             P GR+ Q V+GN+LLNF YDPISR + R    +P  RR  KRKPY+KDLFLQANYKF V
Sbjct  131  LP-GRKAQTVNGNYLLNFQYDPISRSQPRGPPPSPTTRRHRKRKPYSKDLFLQANYKFTV  189

Query  652  FSSGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
              SGNY PESMDPDKML+WEDIICV + TPF VQCPICL
Sbjct  190  LGSGNYSPESMDPDKMLQWEDIICVTYLTPFSVQCPICL  228



>ref|XP_009129487.1| PREDICTED: RING finger protein 10 isoform X2 [Brassica rapa]
Length=735

 Score =   125 bits (313),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 67/114 (59%), Positives = 82/114 (72%), Gaps = 5/114 (4%)
 Frame = +1

Query  442  HNNSGSTRS--QGSMPRPTGRRTQMVSGNHLLNFHYD---pisrpksrappprrqpkrkp  606
            HN +G + S    S   PTGRR  M+SGNHLLNF YD   P        P  R+  +R+P
Sbjct  129  HNATGPSNSPRVSSHHNPTGRRANMISGNHLLNFQYDPISPQQSRPPPPPQRRQMHRRRP  188

Query  607  YNKDLFLQANYKFVVFSSGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
            YNKDLFLQANYKFVV  +G++ P+SMDPDKML+W++IICV++STP PVQCPICL
Sbjct  189  YNKDLFLQANYKFVVLDTGDHSPDSMDPDKMLQWDNIICVRYSTPSPVQCPICL  242



>ref|XP_009129485.1| PREDICTED: RING finger protein 10 isoform X1 [Brassica rapa]
 ref|XP_009129486.1| PREDICTED: RING finger protein 10 isoform X1 [Brassica rapa]
Length=757

 Score =   125 bits (313),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 67/114 (59%), Positives = 82/114 (72%), Gaps = 5/114 (4%)
 Frame = +1

Query  442  HNNSGSTRS--QGSMPRPTGRRTQMVSGNHLLNFHYD---pisrpksrappprrqpkrkp  606
            HN +G + S    S   PTGRR  M+SGNHLLNF YD   P        P  R+  +R+P
Sbjct  129  HNATGPSNSPRVSSHHNPTGRRANMISGNHLLNFQYDPISPQQSRPPPPPQRRQMHRRRP  188

Query  607  YNKDLFLQANYKFVVFSSGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
            YNKDLFLQANYKFVV  +G++ P+SMDPDKML+W++IICV++STP PVQCPICL
Sbjct  189  YNKDLFLQANYKFVVLDTGDHSPDSMDPDKMLQWDNIICVRYSTPSPVQCPICL  242



>gb|KHM99214.1| RING finger protein 10 [Glycine soja]
Length=748

 Score =   125 bits (313),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 86/168 (51%), Positives = 98/168 (58%), Gaps = 12/168 (7%)
 Frame = +1

Query  295  AALGSCGSPEKVNMSVGQNGIKTLTYHS--TGQISVDDRRKSPGPGLPATSHNNS---GS  459
            AA  SCGS EKV      +G+      +  TG  S    R++      A+ H N    GS
Sbjct  64   AAQDSCGSSEKVTEVGSPSGVMVSPQQNSRTGSRS-HGGRRTGMGTGTASYHRNQQTPGS  122

Query  460  TRSQGSMPRPTGRRTQMVSGNHLLNFHYD-----pisrpksrappprrqpkrkpYNKDLF  624
              S GS P   GR+ Q V+GN+LLNF YD         P       RR  KRKPYNKDLF
Sbjct  123  VHSHGSAP-SAGRKAQTVNGNYLLNFQYDPISRSQPRGPPPPPTTTRRHRKRKPYNKDLF  181

Query  625  LQANYKFVVFSSGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
            LQANYKF+V   GNY PESMDPDKML+WEDIICV + TPF VQCPICL
Sbjct  182  LQANYKFMVLGLGNYSPESMDPDKMLQWEDIICVTYLTPFSVQCPICL  229



>emb|CDY28532.1| BnaC02g36280D [Brassica napus]
Length=727

 Score =   124 bits (312),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 71/114 (62%), Positives = 87/114 (76%), Gaps = 5/114 (4%)
 Frame = +1

Query  442  HNNSGSTRSQ--GSMPRPTGRRTQMVSGNHLLNFHYDpisrpksrap---pprrqpkrkp  606
            HN +G + S    S   PTGRR  M+SGNHLLNF YDPIS  + RAP     R+  +R+P
Sbjct  128  HNATGPSNSPRGSSHHNPTGRRANMISGNHLLNFQYDPISPQQFRAPPPPQRRQMHRRRP  187

Query  607  YNKDLFLQANYKFVVFSSGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
            YNKDLFLQANYKFVV  +G++ P+SMDPDKML+W++IICV++STP PVQCPICL
Sbjct  188  YNKDLFLQANYKFVVLDTGDHSPDSMDPDKMLQWDNIICVRYSTPSPVQCPICL  241



>ref|XP_010249226.1| PREDICTED: RING finger protein 10 isoform X2 [Nelumbo nucifera]
Length=707

 Score =   124 bits (312),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 74/106 (70%), Positives = 81/106 (76%), Gaps = 0/106 (0%)
 Frame = +1

Query  451  SGSTRSQGSMPRPTGRRTQMVSGNHLLNFHYDpisrpksrappprrqpkrkpYNKDLFLQ  630
            SGS     S      R+ QM+S NHLLNFHYDPISRP+ R PPPRRQ K KPYNKDLFLQ
Sbjct  99   SGSANISSSTTHSAIRKNQMMSANHLLNFHYDPISRPQPRIPPPRRQHKIKPYNKDLFLQ  158

Query  631  ANYKFVVFSSGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
            ANYKFVV  SGNY  ES DPDKMLEWED+ICV++ TP  V+CPICL
Sbjct  159  ANYKFVVLDSGNYALESRDPDKMLEWEDVICVRYFTPLTVRCPICL  204



>ref|XP_010249224.1| PREDICTED: RING finger protein 10 isoform X1 [Nelumbo nucifera]
Length=750

 Score =   124 bits (312),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 74/106 (70%), Positives = 81/106 (76%), Gaps = 0/106 (0%)
 Frame = +1

Query  451  SGSTRSQGSMPRPTGRRTQMVSGNHLLNFHYDpisrpksrappprrqpkrkpYNKDLFLQ  630
            SGS     S      R+ QM+S NHLLNFHYDPISRP+ R PPPRRQ K KPYNKDLFLQ
Sbjct  143  SGSANISSSTTHSAIRKNQMMSANHLLNFHYDPISRPQPRIPPPRRQHKIKPYNKDLFLQ  202

Query  631  ANYKFVVFSSGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
            ANYKFVV  SGNY  ES DPDKMLEWED+ICV++ TP  V+CPICL
Sbjct  203  ANYKFVVLDSGNYALESRDPDKMLEWEDVICVRYFTPLTVRCPICL  248



>emb|CDY48977.1| BnaA02g28190D [Brassica napus]
Length=732

 Score =   124 bits (312),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 67/114 (59%), Positives = 82/114 (72%), Gaps = 5/114 (4%)
 Frame = +1

Query  442  HNNSGSTRSQ--GSMPRPTGRRTQMVSGNHLLNFHYD---pisrpksrappprrqpkrkp  606
            HN +G + S    S   PTGRR  M+SGNHLLNF YD   P        P  R+  +R+P
Sbjct  131  HNATGPSNSPRGSSHHNPTGRRANMISGNHLLNFQYDPISPQQFRPPPPPQRRQMHRRRP  190

Query  607  YNKDLFLQANYKFVVFSSGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
            YNKDLFLQANYKFVV  +G++ P+SMDPDKML+W++IICV++STP PVQCPICL
Sbjct  191  YNKDLFLQANYKFVVLDTGDHSPDSMDPDKMLQWDNIICVRYSTPSPVQCPICL  244



>ref|XP_006598997.1| PREDICTED: RING finger protein 10-like [Glycine max]
Length=664

 Score =   123 bits (309),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 72/120 (60%), Positives = 79/120 (66%), Gaps = 9/120 (8%)
 Frame = +1

Query  433  ATSHNNS---GSTRSQGSMPRPTGRRTQMVSGNHLLNFHYD-----pisrpksrappprr  588
            A+ H N    GS  S GS P   GR+ Q V+GN+LLNF YD         P       RR
Sbjct  27   ASYHRNQQTPGSVHSHGSAP-SAGRKAQTVNGNYLLNFQYDPISRSQPRGPPPPPTTTRR  85

Query  589  qpkrkpYNKDLFLQANYKFVVFSSGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
              KRKPYNKDLFLQANYKF+V   GNY PESMDPDKML+WEDIICV + TPF VQCPICL
Sbjct  86   HRKRKPYNKDLFLQANYKFMVLGLGNYSPESMDPDKMLQWEDIICVTYLTPFSVQCPICL  145



>emb|CAA66822.1| hypothetical protein [Arabidopsis thaliana]
Length=441

 Score =   121 bits (303),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 73/115 (63%), Positives = 89/115 (77%), Gaps = 6/115 (5%)
 Frame = +1

Query  442  HNNSG---STRSQGSMPRPTGRRTQMVSGNHLLNFHYDpisrpksrap---pprrqpkrk  603
             +NSG   S R   S   PTGRR  M+SGNHLLNF YDPIS+P+SR P     R+Q K +
Sbjct  47   QHNSGPFNSPRGGVSHHNPTGRRANMISGNHLLNFQYDPISQPQSRGPPPPQRRQQYKGR  106

Query  604  pYNKDLFLQANYKFVVFSSGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
            P+NKDLFL+ANYKFVV  +G++ P+SMDPDKML+W+DIICV++STP PVQCPICL
Sbjct  107  PFNKDLFLKANYKFVVLDTGDHSPDSMDPDKMLQWDDIICVRYSTPSPVQCPICL  161



>ref|XP_006844483.1| hypothetical protein AMTR_s00016p00109400 [Amborella trichopoda]
 gb|ERN06158.1| hypothetical protein AMTR_s00016p00109400 [Amborella trichopoda]
Length=772

 Score =   123 bits (309),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 74/120 (62%), Positives = 90/120 (75%), Gaps = 0/120 (0%)
 Frame = +1

Query  409  KSPGPGLPATSHNNSGSTRSQGSMPRPTGRRTQMVSGNHLLNFHYDpisrpksrappprr  588
            +S G G      ++SG+   QG+      R+ Q V+ NHLLNFHYDPISRP++R PPPRR
Sbjct  123  RSSGAGPQHIDKSSSGAGTHQGNAIHSVSRKNQTVNANHLLNFHYDPISRPQTRMPPPRR  182

Query  589  qpkrkpYNKDLFLQANYKFVVFSSGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
            Q K KPYNKDLFLQANYKFVV  +GN   +S DPDKML+WED++CV++STPF VQCPICL
Sbjct  183  QQKIKPYNKDLFLQANYKFVVVDTGNSALKSKDPDKMLQWEDVVCVRYSTPFSVQCPICL  242



>ref|XP_011097256.1| PREDICTED: RING finger protein 10 [Sesamum indicum]
Length=749

 Score =   123 bits (308),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 69/95 (73%), Positives = 81/95 (85%), Gaps = 2/95 (2%)
 Frame = +1

Query  490  TGRRTQMVSGNHLLNFHYDp--isrpksrappprrqpkrkpYNKDLFLQANYKFVVFSSG  663
            TG+++QMVSGNHLLNFHYDP  +SRP+SRAP  R++ KRKPYNKDLF QANYKFVV  SG
Sbjct  146  TGKKSQMVSGNHLLNFHYDPIPVSRPQSRAPARRKEQKRKPYNKDLFFQANYKFVVLDSG  205

Query  664  NYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
             Y   S+DPDKML W+DIIC+K+STP P+QCPICL
Sbjct  206  TYAAASLDPDKMLCWDDIICLKYSTPLPIQCPICL  240



>ref|XP_006395529.1| hypothetical protein EUTSA_v10003691mg [Eutrema salsugineum]
 gb|ESQ32815.1| hypothetical protein EUTSA_v10003691mg [Eutrema salsugineum]
Length=760

 Score =   123 bits (308),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 67/96 (70%), Positives = 79/96 (82%), Gaps = 3/96 (3%)
 Frame = +1

Query  490  TGRRTQMVSGNHLLNFHYDpisrpksrap---pprrqpkrkpYNKDLFLQANYKFVVFSS  660
            TGRR  M+SGNHLLNF YDPIS  +SR P     R+  KR+PYNKDLFLQANYKFVV  +
Sbjct  148  TGRRANMISGNHLLNFQYDPISPQQSRGPPPPQRRQMYKRRPYNKDLFLQANYKFVVLDT  207

Query  661  GNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
            G++ P+SMDPDKML+WE+IICV++STP PVQCPICL
Sbjct  208  GDHSPDSMDPDKMLQWENIICVRYSTPSPVQCPICL  243



>ref|NP_189307.2| RING/U-box domain-containing protein [Arabidopsis thaliana]
 dbj|BAB01736.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAL67021.1| putative RING zinc finger protein [Arabidopsis thaliana]
 gb|AAO22812.1| putative RING zinc finger protein [Arabidopsis thaliana]
 gb|AEE77205.1| RING/U-box domain-containing protein [Arabidopsis thaliana]
Length=772

 Score =   122 bits (307),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 67/97 (69%), Positives = 82/97 (85%), Gaps = 3/97 (3%)
 Frame = +1

Query  487  PTGRRTQMVSGNHLLNFHYDpisrpksrap---pprrqpkrkpYNKDLFLQANYKFVVFS  657
            PTGRR  M+SGNHLLNF YDPIS+P+SR P     R+Q K +P+NKDLFL+ANYKFVV  
Sbjct  153  PTGRRANMISGNHLLNFQYDPISQPQSRGPPPPQRRQQYKGRPFNKDLFLKANYKFVVLD  212

Query  658  SGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
            +G++ P+SMDPDKML+W+DIICV++STP PVQCPICL
Sbjct  213  TGDHSPDSMDPDKMLQWDDIICVRYSTPSPVQCPICL  249



>ref|XP_008791034.1| PREDICTED: RING finger protein 10 [Phoenix dactylifera]
Length=628

 Score =   122 bits (305),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 72/100 (72%), Positives = 78/100 (78%), Gaps = 0/100 (0%)
 Frame = +1

Query  469  QGSMPRPTGRRTQMVSGNHLLNFHYDpisrpksrappprrqpkrkpYNKDLFLQANYKFV  648
            QGS      RR Q+V+ NHLLNF+YDPISRP+ R PPPRRQ K KPYNKDLFLQANYKFV
Sbjct  2    QGSSAHSAARRNQVVNANHLLNFYYDPISRPQPRLPPPRRQQKIKPYNKDLFLQANYKFV  61

Query  649  VFSSGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
            V   G    E MDPDKML WED+ICV+FSTP PVQCPICL
Sbjct  62   VLDIGCCEVELMDPDKMLRWEDVICVRFSTPIPVQCPICL  101



>ref|XP_002875336.1| hypothetical protein ARALYDRAFT_484446 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51595.1| hypothetical protein ARALYDRAFT_484446 [Arabidopsis lyrata subsp. 
lyrata]
Length=760

 Score =   122 bits (306),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 67/96 (70%), Positives = 81/96 (84%), Gaps = 2/96 (2%)
 Frame = +1

Query  487  PTGRRTQMVSGNHLLNFHYDpisrpksrap--pprrqpkrkpYNKDLFLQANYKFVVFSS  660
            PTGRR  M+SGNHLLNF YDPIS P+SR P    R+Q K +P+NKDLFL+ANYKFVV  +
Sbjct  146  PTGRRANMISGNHLLNFQYDPISPPQSRGPPPQRRQQYKGRPFNKDLFLKANYKFVVLDT  205

Query  661  GNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
            G++ P+SMDPDKML+W+DIICV++STP PVQCPICL
Sbjct  206  GDHSPDSMDPDKMLQWDDIICVRYSTPSPVQCPICL  241



>gb|KFK33594.1| hypothetical protein AALP_AA5G034200 [Arabis alpina]
Length=752

 Score =   121 bits (304),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 73/132 (55%), Positives = 90/132 (68%), Gaps = 9/132 (7%)
 Frame = +1

Query  400  DRRKSPGPGLPATSHNNSGSTRSQGSMPR------PTGRRTQMVSGNHLLNFHYDpisrp  561
            D R++   G    +   S S     + PR      PTGRR  M+SGNHLLNF YDPIS P
Sbjct  104  DGRRNRSRGRATGAGTGSSSQLQHNTAPRGVSHQNPTGRRANMISGNHLLNFQYDPISPP  163

Query  562  ksrap---pprrqpkrkpYNKDLFLQANYKFVVFSSGNYVPESMDPDKMLEWEDIICVKF  732
            +SR       R+  KR+PYNKDLFLQANYKFV+  +G++ P+SMDPDKML+WE+IICV++
Sbjct  164  QSRGFPPPQRRQMFKRRPYNKDLFLQANYKFVLLDTGDHSPDSMDPDKMLQWENIICVRY  223

Query  733  STPFPVQCPICL  768
            STP  VQCPICL
Sbjct  224  STPSSVQCPICL  235



>ref|XP_004145702.1| PREDICTED: RING finger protein 10-like [Cucumis sativus]
Length=742

 Score =   121 bits (304),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 80/154 (52%), Positives = 99/154 (64%), Gaps = 10/154 (6%)
 Frame = +1

Query  328  VNMSVGQNGIKTLTYHSTGQISVDDRRKSPGPGLPAT---SHN--NSGSTRSQGSMPRPT  492
            + M   QN    L   S+G    +D    PG  + +T   SH+  ++ S  S G+  R +
Sbjct  87   LKMPARQNTGTQLQCQSSGH---EDGSVLPGSKMSSTLNSSHDQQSARSANSHGNNKRSS  143

Query  493  GRRTQMVSGNHLLNFHYD--pisrpksrappprrqpkrkpYNKDLFLQANYKFVVFSSGN  666
            G++ Q+ +GNHLLNF YD      P++RAPPPRR  K KPYNKDLFLQANYKFVV  SG 
Sbjct  144  GKKAQITNGNHLLNFQYDPISRPHPRARAPPPRRPQKIKPYNKDLFLQANYKFVVLDSGY  203

Query  667  YVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
            Y  E MDPDKML WEDI+CV++STP  VQCPICL
Sbjct  204  YTDEYMDPDKMLHWEDIVCVRYSTPSLVQCPICL  237



>ref|XP_004159146.1| PREDICTED: RING finger protein 10-like [Cucumis sativus]
Length=654

 Score =   120 bits (302),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 80/152 (53%), Positives = 98/152 (64%), Gaps = 10/152 (7%)
 Frame = +1

Query  334  MSVGQNGIKTLTYHSTGQISVDDRRKSPGPGLPAT---SHN--NSGSTRSQGSMPRPTGR  498
            M   QN    L   S+G    +D    PG  + +T   SH+  ++ S  S G+  R +G+
Sbjct  1    MPARQNTGTQLQCQSSGH---EDGSVLPGSKMSSTLNSSHDQQSARSANSHGNNKRSSGK  57

Query  499  RTQMVSGNHLLNFHYD--pisrpksrappprrqpkrkpYNKDLFLQANYKFVVFSSGNYV  672
            + Q+ +GNHLLNF YD      P++RAPPPRR  K KPYNKDLFLQANYKFVV  SG Y 
Sbjct  58   KAQITNGNHLLNFQYDPISRPHPRARAPPPRRPQKIKPYNKDLFLQANYKFVVLDSGYYT  117

Query  673  PESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
             E MDPDKML WEDI+CV++STP  VQCPICL
Sbjct  118  DEYMDPDKMLHWEDIVCVRYSTPSLVQCPICL  149



>gb|KGN58249.1| hypothetical protein Csa_3G599440 [Cucumis sativus]
Length=653

 Score =   120 bits (302),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 80/152 (53%), Positives = 98/152 (64%), Gaps = 10/152 (7%)
 Frame = +1

Query  334  MSVGQNGIKTLTYHSTGQISVDDRRKSPGPGLPAT---SHN--NSGSTRSQGSMPRPTGR  498
            M   QN    L   S+G    +D    PG  + +T   SH+  ++ S  S G+  R +G+
Sbjct  1    MPARQNTGTQLQCQSSGH---EDGSVLPGSKMSSTLNSSHDQQSARSANSHGNNKRSSGK  57

Query  499  RTQMVSGNHLLNFHYD--pisrpksrappprrqpkrkpYNKDLFLQANYKFVVFSSGNYV  672
            + Q+ +GNHLLNF YD      P++RAPPPRR  K KPYNKDLFLQANYKFVV  SG Y 
Sbjct  58   KAQITNGNHLLNFQYDPISRPHPRARAPPPRRPQKIKPYNKDLFLQANYKFVVLDSGYYT  117

Query  673  PESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
             E MDPDKML WEDI+CV++STP  VQCPICL
Sbjct  118  DEYMDPDKMLHWEDIVCVRYSTPSLVQCPICL  149



>ref|XP_004952585.1| PREDICTED: RING finger protein 10-like [Setaria italica]
Length=745

 Score =   120 bits (301),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 74/114 (65%), Positives = 85/114 (75%), Gaps = 3/114 (3%)
 Frame = +1

Query  436  TSHNNSGSTRSQGSMPRPTGRRTQMVSGNHLLNFHYDpisrpksrappp---rrqpkrkp  606
            T H  SGST  QG+  +   R++Q V+ NHLLNF YDPISRP+ R P     RRQ K KP
Sbjct  133  TDHLASGSTGLQGNGTQMAARKSQAVNANHLLNFQYDPISRPQPRGPRTYPPRRQRKIKP  192

Query  607  YNKDLFLQANYKFVVFSSGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
            YNKDLFLQANYKFVV  +GNY  ESMDPDKML+WEDIICV++ +P  VQCPICL
Sbjct  193  YNKDLFLQANYKFVVLDTGNYQIESMDPDKMLQWEDIICVRYYSPSEVQCPICL  246



>gb|KHN28587.1| RING finger protein 10 [Glycine soja]
Length=719

 Score =   119 bits (299),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 70/123 (57%), Positives = 81/123 (66%), Gaps = 6/123 (5%)
 Frame = +1

Query  412  SPGPGLPATSHNNSGSTRSQGSMPRPTGRRTQMVSGNHLLNFHYD----pisrpksrapp  579
            SP   + +   N+   +RS G+  R T  + Q V+GN+LLNF YD       R     P 
Sbjct  80   SPSGVMVSPEQNSRTRSRSHGA--RWTRTKAQTVNGNYLLNFQYDPISRSQPRGPPPPPT  137

Query  580  prrqpkrkpYNKDLFLQANYKFVVFSSGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCP  759
             RR  KRKPY+KDLFLQANYKF V  SGNY PESMDPDKML+WEDIICV + TPF VQCP
Sbjct  138  TRRHRKRKPYSKDLFLQANYKFTVLGSGNYSPESMDPDKMLQWEDIICVTYLTPFSVQCP  197

Query  760  ICL  768
            ICL
Sbjct  198  ICL  200



>ref|XP_006290605.1| hypothetical protein CARUB_v10016694mg [Capsella rubella]
 gb|EOA23503.1| hypothetical protein CARUB_v10016694mg [Capsella rubella]
Length=769

 Score =   118 bits (296),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 61/97 (63%), Positives = 75/97 (77%), Gaps = 3/97 (3%)
 Frame = +1

Query  487  PTGRRTQMVSGNHLLNFHYD---pisrpksrappprrqpkrkpYNKDLFLQANYKFVVFS  657
            PTGRR  ++SGNHLLNF YD   P        P  R+Q KR+PYNKDLFL+ANYKFVV  
Sbjct  152  PTGRRANVISGNHLLNFQYDPISPPQSRGPPPPQRRQQCKRRPYNKDLFLKANYKFVVLD  211

Query  658  SGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
            +G++ P+SMDPDK L+W++IICV++STP PVQCPICL
Sbjct  212  TGDHSPDSMDPDKALQWDNIICVRYSTPSPVQCPICL  248



>ref|XP_002453901.1| hypothetical protein SORBIDRAFT_04g021110 [Sorghum bicolor]
 gb|EES06877.1| hypothetical protein SORBIDRAFT_04g021110 [Sorghum bicolor]
Length=742

 Score =   118 bits (296),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 73/112 (65%), Positives = 83/112 (74%), Gaps = 3/112 (3%)
 Frame = +1

Query  442  HNNSGSTRSQGSMPRPTGRRTQMVSGNHLLNFHYDpisrpksrappp---rrqpkrkpYN  612
            H  SGST  QG+  +   R+ Q V+ NHLLNF YDPISRP+ R P     RRQ K KPYN
Sbjct  133  HLASGSTGHQGNGTQIAARKNQSVNANHLLNFQYDPISRPQPRGPRTYPPRRQRKIKPYN  192

Query  613  KDLFLQANYKFVVFSSGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
            KDLFLQANYKFVV  +GNY  ESMDPDKML+WEDIICV++ +P  VQCPICL
Sbjct  193  KDLFLQANYKFVVLDTGNYQIESMDPDKMLQWEDIICVRYYSPSEVQCPICL  244



>ref|XP_008450028.1| PREDICTED: RING finger protein 10 isoform X4 [Cucumis melo]
Length=610

 Score =   117 bits (294),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 105/228 (46%), Positives = 128/228 (56%), Gaps = 30/228 (13%)
 Frame = +1

Query  136  NPNSNHG----FLYFPNQHQQEEPSLSISGMGSLRIADsdsasssscsfsetssMGPAAL  303
            NPNS+HG    F + P  H             SLRI+D  S  S S   S +S + PA  
Sbjct  23   NPNSHHGPDSLFSFSPPTH----------SFPSLRISDPRSPLSDSSHVSGSS-LQPA--  69

Query  304  GSCGSPEKVNMSVGQNGIKTLTYHSTGQI------SVDDRRKSPGPGLPAT---SHNNSG  456
                S +KV+ S   N +K     STG +         D    PG  + +T   SH+   
Sbjct  70   NGAESSKKVSDSETLNDLKMPARQSTGTLLQCQSSGHKDGSVLPGSKISSTLNSSHDQQS  129

Query  457  S--TRSQGSMPRPTGRRTQMVSGNHLLNFHYDpisrpksrappp--rrqpkrkpYNKDLF  624
            +    S G+  R +GR+ Q+ +GNHLLNF YDPISRP+ RA  P  RR  K KPYNKDLF
Sbjct  130  ARNANSHGNNKRSSGRKAQITNGNHLLNFQYDPISRPQPRAKAPPPRRPQKIKPYNKDLF  189

Query  625  LQANYKFVVFSSGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
            LQANYKFVV  SG +  E MDPDKML WEDI+CV++STP  VQCPICL
Sbjct  190  LQANYKFVVLDSGYHTDEYMDPDKMLHWEDIVCVRYSTPSLVQCPICL  237



>ref|XP_008450025.1| PREDICTED: RING finger protein 10 isoform X2 [Cucumis melo]
Length=740

 Score =   118 bits (296),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 105/228 (46%), Positives = 128/228 (56%), Gaps = 30/228 (13%)
 Frame = +1

Query  136  NPNSNHG----FLYFPNQHQQEEPSLSISGMGSLRIADsdsasssscsfsetssMGPAAL  303
            NPNS+HG    F + P  H             SLRI+D  S  S S   S +S + PA  
Sbjct  23   NPNSHHGPDSLFSFSPPTH----------SFPSLRISDPRSPLSDSSHVSGSS-LQPA--  69

Query  304  GSCGSPEKVNMSVGQNGIKTLTYHSTGQI------SVDDRRKSPGPGLPAT---SHNNSG  456
                S +KV+ S   N +K     STG +         D    PG  + +T   SH+   
Sbjct  70   NGAESSKKVSDSETLNDLKMPARQSTGTLLQCQSSGHKDGSVLPGSKISSTLNSSHDQQS  129

Query  457  S--TRSQGSMPRPTGRRTQMVSGNHLLNFHYDpisrpksrappp--rrqpkrkpYNKDLF  624
            +    S G+  R +GR+ Q+ +GNHLLNF YDPISRP+ RA  P  RR  K KPYNKDLF
Sbjct  130  ARNANSHGNNKRSSGRKAQITNGNHLLNFQYDPISRPQPRAKAPPPRRPQKIKPYNKDLF  189

Query  625  LQANYKFVVFSSGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
            LQANYKFVV  SG +  E MDPDKML WEDI+CV++STP  VQCPICL
Sbjct  190  LQANYKFVVLDSGYHTDEYMDPDKMLHWEDIVCVRYSTPSLVQCPICL  237



>ref|XP_008450024.1| PREDICTED: RING finger protein 10 isoform X1 [Cucumis melo]
Length=741

 Score =   118 bits (296),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 105/228 (46%), Positives = 128/228 (56%), Gaps = 30/228 (13%)
 Frame = +1

Query  136  NPNSNHG----FLYFPNQHQQEEPSLSISGMGSLRIADsdsasssscsfsetssMGPAAL  303
            NPNS+HG    F + P  H             SLRI+D  S  S S   S +S + PA  
Sbjct  23   NPNSHHGPDSLFSFSPPTH----------SFPSLRISDPRSPLSDSSHVSGSS-LQPA--  69

Query  304  GSCGSPEKVNMSVGQNGIKTLTYHSTGQI------SVDDRRKSPGPGLPAT---SHNNSG  456
                S +KV+ S   N +K     STG +         D    PG  + +T   SH+   
Sbjct  70   NGAESSKKVSDSETLNDLKMPARQSTGTLLQCQSSGHKDGSVLPGSKISSTLNSSHDQQS  129

Query  457  S--TRSQGSMPRPTGRRTQMVSGNHLLNFHYDpisrpksrappp--rrqpkrkpYNKDLF  624
            +    S G+  R +GR+ Q+ +GNHLLNF YDPISRP+ RA  P  RR  K KPYNKDLF
Sbjct  130  ARNANSHGNNKRSSGRKAQITNGNHLLNFQYDPISRPQPRAKAPPPRRPQKIKPYNKDLF  189

Query  625  LQANYKFVVFSSGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
            LQANYKFVV  SG +  E MDPDKML WEDI+CV++STP  VQCPICL
Sbjct  190  LQANYKFVVLDSGYHTDEYMDPDKMLHWEDIVCVRYSTPSLVQCPICL  237



>ref|XP_006290606.1| hypothetical protein CARUB_v10016694mg [Capsella rubella]
 gb|EOA23504.1| hypothetical protein CARUB_v10016694mg [Capsella rubella]
Length=817

 Score =   118 bits (296),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 61/97 (63%), Positives = 75/97 (77%), Gaps = 3/97 (3%)
 Frame = +1

Query  487  PTGRRTQMVSGNHLLNFHYD---pisrpksrappprrqpkrkpYNKDLFLQANYKFVVFS  657
            PTGRR  ++SGNHLLNF YD   P        P  R+Q KR+PYNKDLFL+ANYKFVV  
Sbjct  152  PTGRRANVISGNHLLNFQYDPISPPQSRGPPPPQRRQQCKRRPYNKDLFLKANYKFVVLD  211

Query  658  SGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
            +G++ P+SMDPDK L+W++IICV++STP PVQCPICL
Sbjct  212  TGDHSPDSMDPDKALQWDNIICVRYSTPSPVQCPICL  248



>ref|XP_008450027.1| PREDICTED: RING finger protein 10 isoform X3 [Cucumis melo]
Length=628

 Score =   117 bits (293),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 105/228 (46%), Positives = 128/228 (56%), Gaps = 30/228 (13%)
 Frame = +1

Query  136  NPNSNHG----FLYFPNQHQQEEPSLSISGMGSLRIADsdsasssscsfsetssMGPAAL  303
            NPNS+HG    F + P  H             SLRI+D  S  S S   S +S + PA  
Sbjct  23   NPNSHHGPDSLFSFSPPTH----------SFPSLRISDPRSPLSDSSHVSGSS-LQPA--  69

Query  304  GSCGSPEKVNMSVGQNGIKTLTYHSTGQI------SVDDRRKSPGPGLPAT---SHNNSG  456
                S +KV+ S   N +K     STG +         D    PG  + +T   SH+   
Sbjct  70   NGAESSKKVSDSETLNDLKMPARQSTGTLLQCQSSGHKDGSVLPGSKISSTLNSSHDQQS  129

Query  457  S--TRSQGSMPRPTGRRTQMVSGNHLLNFHYDpisrpksrappp--rrqpkrkpYNKDLF  624
            +    S G+  R +GR+ Q+ +GNHLLNF YDPISRP+ RA  P  RR  K KPYNKDLF
Sbjct  130  ARNANSHGNNKRSSGRKAQITNGNHLLNFQYDPISRPQPRAKAPPPRRPQKIKPYNKDLF  189

Query  625  LQANYKFVVFSSGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
            LQANYKFVV  SG +  E MDPDKML WEDI+CV++STP  VQCPICL
Sbjct  190  LQANYKFVVLDSGYHTDEYMDPDKMLHWEDIVCVRYSTPSLVQCPICL  237



>ref|XP_010514334.1| PREDICTED: RING finger protein 10-like [Camelina sativa]
Length=767

 Score =   117 bits (294),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 62/97 (64%), Positives = 79/97 (81%), Gaps = 3/97 (3%)
 Frame = +1

Query  487  PTGRRTQMVSGNHLLNFHYDpisrpksrappprrqpkrkp---YNKDLFLQANYKFVVFS  657
            PTGRR  M+SGNHLLNF YDPIS P+SR PPP ++ ++     YNKD+FL+ANYKFVV  
Sbjct  150  PTGRRANMISGNHLLNFQYDPISPPQSRGPPPPQRKQQYKGRPYNKDMFLKANYKFVVLD  209

Query  658  SGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
            +G++ P+SMDPDK L+W++IICV++STP PV CPICL
Sbjct  210  TGDHSPDSMDPDKTLQWDNIICVRYSTPSPVHCPICL  246



>ref|XP_010502612.1| PREDICTED: RING finger protein 10-like [Camelina sativa]
Length=766

 Score =   117 bits (294),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 62/97 (64%), Positives = 79/97 (81%), Gaps = 3/97 (3%)
 Frame = +1

Query  487  PTGRRTQMVSGNHLLNFHYDpisrpksrappprrqpkrkp---YNKDLFLQANYKFVVFS  657
            PTGRR  ++SGNHLLNF YDPIS P+SR PPP ++ ++     YNKD+FL+ANYKFVV  
Sbjct  148  PTGRRANIISGNHLLNFQYDPISPPQSRGPPPPQRKQQYKGRPYNKDMFLKANYKFVVLD  207

Query  658  SGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
            +G++ P+SMDPDK L+W++IICV+FSTP PV CPICL
Sbjct  208  TGDHSPDSMDPDKTLQWDNIICVRFSTPSPVHCPICL  244



>ref|XP_010425391.1| PREDICTED: RING finger protein 10-like [Camelina sativa]
Length=771

 Score =   116 bits (291),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 62/97 (64%), Positives = 79/97 (81%), Gaps = 3/97 (3%)
 Frame = +1

Query  487  PTGRRTQMVSGNHLLNFHYDpisrpksrappprrqpkrkp---YNKDLFLQANYKFVVFS  657
            PTGRR  M+SGNHLLNF YDPIS P+SR PPP ++ ++     YNKD+FL+ANYKFVV  
Sbjct  153  PTGRRANMISGNHLLNFQYDPISPPQSRGPPPPQRKQQYKGRPYNKDMFLKANYKFVVLD  212

Query  658  SGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
            +G++ P+SMDPDK L+W++IICV++STP  VQCPICL
Sbjct  213  TGDHSPDSMDPDKTLQWDNIICVRYSTPSTVQCPICL  249



>gb|EYU34830.1| hypothetical protein MIMGU_mgv1a002265mg [Erythranthe guttata]
Length=693

 Score =   115 bits (288),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 64/95 (67%), Positives = 75/95 (79%), Gaps = 2/95 (2%)
 Frame = +1

Query  490  TGRRTQMVSGNHLLNFHYDpisrpksrappp--rrqpkrkpYNKDLFLQANYKFVVFSSG  663
             G++ QM +GNHLLNF YDP+   + ++  P  RRQ KRKPYNKDLFLQANY+FVV  SG
Sbjct  92   AGKKAQMFNGNHLLNFQYDPLPVSRPQSRTPPPRRQQKRKPYNKDLFLQANYRFVVLDSG  151

Query  664  NYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
            NY  ESMDPDKML WE+IIC+K+STP  VQCPICL
Sbjct  152  NYAAESMDPDKMLCWENIICLKYSTPSHVQCPICL  186



>gb|EPS67903.1| hypothetical protein M569_06871, partial [Genlisea aurea]
Length=587

 Score =   113 bits (282),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 59/93 (63%), Positives = 71/93 (76%), Gaps = 1/93 (1%)
 Frame = +1

Query  493  GRRTQMVSGNHLLNFHYDpisrpksrappprrqpkrkp-YNKDLFLQANYKFVVFSSGNY  669
            GR+ QMV+GNHLLNF YDPI   + R  P  ++PK    YNKDLF QANYKFVV  +GNY
Sbjct  4    GRKAQMVNGNHLLNFQYDPIPVSRPRTRPHPQKPKWVKPYNKDLFFQANYKFVVLDTGNY  63

Query  670  VPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
              ES++PDKML WEDIIC+K+S+P PV CP+CL
Sbjct  64   DAESLNPDKMLSWEDIICLKYSSPSPVSCPVCL  96



>ref|XP_003575036.1| PREDICTED: RING finger protein 10 [Brachypodium distachyon]
Length=744

 Score =   113 bits (283),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 72/138 (52%), Positives = 86/138 (62%), Gaps = 7/138 (5%)
 Frame = +1

Query  364  LTYHSTGQISVDDRRKSPGPGLPATSHNNSGSTRSQGSMPRPTGRRTQMVSGNHLLNFHY  543
            L  H       D RR     G+  +  N+  S   QG+      R+ Q V+ NHLLNF Y
Sbjct  111  LPVHDVSSDQADARRL----GMVGSLQNDHSSNGLQGNGALMAARKNQAVNANHLLNFQY  166

Query  544  Dpisr---pksrappprrqpkrkpYNKDLFLQANYKFVVFSSGNYVPESMDPDKMLEWED  714
            DPISR      R  P +RQ K KPYNKDLFLQAN+KFVV  +GNY  ESMDPDKML+WED
Sbjct  167  DPISRPQPRGPRIYPAKRQRKIKPYNKDLFLQANFKFVVLDTGNYQIESMDPDKMLQWED  226

Query  715  IICVKFSTPFPVQCPICL  768
            IICV++ +P  V+CPICL
Sbjct  227  IICVRYCSPSEVRCPICL  244



>dbj|BAK00968.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=731

 Score =   112 bits (279),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 71/138 (51%), Positives = 88/138 (64%), Gaps = 7/138 (5%)
 Frame = +1

Query  364  LTYHSTGQISVDDRRKSPGPGLPATSHNNSGSTRSQGSMPRPTGRRTQMVSGNHLLNFHY  543
            LT HS G +  D +R      L    H++      QG+      R+ Q V+ N+LLNF Y
Sbjct  103  LTVHSGGSVQADVQRLELAGSLEIHHHSDG----LQGNGALMASRKNQAVNANYLLNFQY  158

Query  544  Dpisrpksrappp---rrqpkrkpYNKDLFLQANYKFVVFSSGNYVPESMDPDKMLEWED  714
            DPISR +   P     RRQ K KPYNKDLFLQAN+KFVV  +GNY  +SMDPDKML+WED
Sbjct  159  DPISRLQPHGPRTYPPRRQRKIKPYNKDLFLQANFKFVVLDTGNYQIDSMDPDKMLQWED  218

Query  715  IICVKFSTPFPVQCPICL  768
            IICV++ +P  V+CPICL
Sbjct  219  IICVRYCSPSEVRCPICL  236



>ref|XP_006647257.1| PREDICTED: RING finger protein 10-like [Oryza brachyantha]
Length=681

 Score =   110 bits (276),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 65/119 (55%), Positives = 82/119 (69%), Gaps = 3/119 (3%)
 Frame = +1

Query  421  PGLPATSHNNSGSTRSQGSMPRPTGRRTQMVSGNHLLNFHYDpisr---pksrappprrq  591
            P L  +   +  +T S G+  + T R+ Q V+ NHLLNFHYDPISR      +  P R+Q
Sbjct  64   PELMESLKIDQSTTNSSGNGTQVTARKNQSVNANHLLNFHYDPISRPQPRGPKTYPSRKQ  123

Query  592  pkrkpYNKDLFLQANYKFVVFSSGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
             K +PYNKDLFLQAN+KFVV  +G+Y  E MDPDKML WEDI+CV++ +P  VQCPICL
Sbjct  124  RKIRPYNKDLFLQANFKFVVLDTGSYQMELMDPDKMLPWEDIVCVRYYSPCEVQCPICL  182



>gb|ACN34207.1| unknown [Zea mays]
 gb|AFW71576.1| zinc finger, C3HC4 type family protein [Zea mays]
Length=743

 Score =   110 bits (276),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 69/112 (62%), Positives = 80/112 (71%), Gaps = 4/112 (4%)
 Frame = +1

Query  442  HNNSGSTRSQGSMPRPTGRRTQMVSGNHLLNFHYDpisr---pksrappprrqpkrkpYN  612
            H  SGST   G+  +   R+ Q V+ NHLLNF YDPISR      R   PRRQ K KPYN
Sbjct  135  HLASGST-GLGNGTQIAARKNQTVNANHLLNFQYDPISRPQPRGPRTYLPRRQRKIKPYN  193

Query  613  KDLFLQANYKFVVFSSGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
            KDLF+QANYKFVV  +GNY  +SMDPDKML+WEDIICV++ +P  VQCPICL
Sbjct  194  KDLFIQANYKFVVLDTGNYQIDSMDPDKMLQWEDIICVRYYSPSEVQCPICL  245



>ref|NP_001152489.1| LOC100286129 [Zea mays]
 gb|ACG47846.1| zinc finger, C3HC4 type family protein [Zea mays]
Length=743

 Score =   110 bits (276),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 69/112 (62%), Positives = 80/112 (71%), Gaps = 4/112 (4%)
 Frame = +1

Query  442  HNNSGSTRSQGSMPRPTGRRTQMVSGNHLLNFHYDpisr---pksrappprrqpkrkpYN  612
            H  SGST   G+  +   R+ Q V+ NHLLNF YDPISR      R   PRRQ K KPYN
Sbjct  135  HLASGST-GLGNGTQIAARKNQTVNANHLLNFQYDPISRPQPRGPRTYLPRRQRKIKPYN  193

Query  613  KDLFLQANYKFVVFSSGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
            KDLF+QANYKFVV  +GNY  +SMDPDKML+WEDIICV++ +P  VQCPICL
Sbjct  194  KDLFIQANYKFVVLDTGNYQIDSMDPDKMLQWEDIICVRYYSPSEVQCPICL  245



>gb|AFW71577.1| hypothetical protein ZEAMMB73_891715 [Zea mays]
Length=638

 Score =   110 bits (274),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 69/112 (62%), Positives = 80/112 (71%), Gaps = 4/112 (4%)
 Frame = +1

Query  442  HNNSGSTRSQGSMPRPTGRRTQMVSGNHLLNFHYDpisr---pksrappprrqpkrkpYN  612
            H  SGST   G+  +   R+ Q V+ NHLLNF YDPISR      R   PRRQ K KPYN
Sbjct  135  HLASGST-GLGNGTQIAARKNQTVNANHLLNFQYDPISRPQPRGPRTYLPRRQRKIKPYN  193

Query  613  KDLFLQANYKFVVFSSGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
            KDLF+QANYKFVV  +GNY  +SMDPDKML+WEDIICV++ +P  VQCPICL
Sbjct  194  KDLFIQANYKFVVLDTGNYQIDSMDPDKMLQWEDIICVRYYSPSEVQCPICL  245



>gb|EEC73269.1| hypothetical protein OsI_07406 [Oryza sativa Indica Group]
Length=735

 Score =   110 bits (274),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 66/119 (55%), Positives = 83/119 (70%), Gaps = 3/119 (3%)
 Frame = +1

Query  421  PGLPATSHNNSGSTRSQGSMPRPTGRRTQMVSGNHLLNFHYDpisr---pksrappprrq  591
            P L  +   +  +T S G+  + T R+ Q V+ N+LLNFHYDPISR      R  P RRQ
Sbjct  118  PELMESLKIDQSTTNSSGNGTQVTARKNQSVNANYLLNFHYDPISRPQPRGPRTYPTRRQ  177

Query  592  pkrkpYNKDLFLQANYKFVVFSSGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
             K +PYNKDLFLQAN+KFVV  +G+Y  E MDPDKML+WEDI+CV++ +P  VQCPICL
Sbjct  178  RKIRPYNKDLFLQANFKFVVLDAGSYEIELMDPDKMLQWEDIVCVRYYSPCEVQCPICL  236



>gb|EMT18774.1| RING finger protein 10 [Aegilops tauschii]
Length=564

 Score =   108 bits (270),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 74/138 (54%), Positives = 91/138 (66%), Gaps = 7/138 (5%)
 Frame = +1

Query  364  LTYHSTGQISVDDRRKSPGPGLPATSHNNSGSTRSQGSMPRPTGRRTQMVSGNHLLNFHY  543
            LT HS G +  D +R      L    H++ G    QG+      R+ Q V+ N+LLNF Y
Sbjct  120  LTVHSGGSVQADVQRLELVGSL-EIDHSSDGL---QGNGALMASRKNQAVNANYLLNFQY  175

Query  544  Dpisrpksrappp---rrqpkrkpYNKDLFLQANYKFVVFSSGNYVPESMDPDKMLEWED  714
            DPISRP+ R P     RRQ K KPYNKDLFLQAN+KFVV  +GNY  +SMDPDKML+WED
Sbjct  176  DPISRPQPRGPRTYPPRRQRKIKPYNKDLFLQANFKFVVLDTGNYQIDSMDPDKMLQWED  235

Query  715  IICVKFSTPFPVQCPICL  768
            IICV++ +P  V+CPICL
Sbjct  236  IICVRYCSPSEVRCPICL  253



>ref|NP_001046958.1| Os02g0516600 [Oryza sativa Japonica Group]
 dbj|BAD38143.1| putative ring finger protein 10 [Oryza sativa Japonica Group]
 dbj|BAF08872.1| Os02g0516600 [Oryza sativa Japonica Group]
Length=744

 Score =   109 bits (272),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 64/107 (60%), Positives = 79/107 (74%), Gaps = 3/107 (3%)
 Frame = +1

Query  457  STRSQGSMPRPTGRRTQMVSGNHLLNFHYDpisr---pksrappprrqpkrkpYNKDLFL  627
            +T S G+  + T R+ Q V+ N+LLNFHYDPISR      R  P RRQ K +PYNKDLFL
Sbjct  139  TTNSSGNGTQVTARKNQSVNANYLLNFHYDPISRPQPRGPRTYPTRRQRKIRPYNKDLFL  198

Query  628  QANYKFVVFSSGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
            QAN+KFVV  +G+Y  E MDPDKML+WEDI+CV++ +P  VQCPICL
Sbjct  199  QANFKFVVLDTGSYEIELMDPDKMLQWEDIVCVRYYSPCEVQCPICL  245



>gb|EEE57081.1| hypothetical protein OsJ_06908 [Oryza sativa Japonica Group]
Length=735

 Score =   109 bits (272),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 66/119 (55%), Positives = 83/119 (70%), Gaps = 3/119 (3%)
 Frame = +1

Query  421  PGLPATSHNNSGSTRSQGSMPRPTGRRTQMVSGNHLLNFHYDpisr---pksrappprrq  591
            P L  +   +  +T S G+  + T R+ Q V+ N+LLNFHYDPISR      R  P RRQ
Sbjct  118  PELMESLKIDLSTTNSSGNGTQVTARKNQSVNANYLLNFHYDPISRPQPRGPRTYPTRRQ  177

Query  592  pkrkpYNKDLFLQANYKFVVFSSGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
             K +PYNKDLFLQAN+KFVV  +G+Y  E MDPDKML+WEDI+CV++ +P  VQCPICL
Sbjct  178  RKIRPYNKDLFLQANFKFVVLDTGSYEIELMDPDKMLQWEDIVCVRYYSPCEVQCPICL  236



>ref|XP_009405452.1| PREDICTED: RING finger protein 10 isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=791

 Score =   105 bits (262),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 62/113 (55%), Positives = 78/113 (69%), Gaps = 10/113 (9%)
 Frame = +1

Query  430  PATSHNNSGSTRSQGSMPRPTGRRTQMVSGNHLLNFHYDpisrpksrappprrqpkrkpY  609
            P+  H N+G + +         RR  +++ NHLLNF+YDPISR + R PP R+Q  +  Y
Sbjct  152  PSGLHGNAGQSAT---------RRNNVINANHLLNFYYDPISRSEPRIPPRRQQKIKP-Y  201

Query  610  NKDLFLQANYKFVVFSSGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
            NKDLFLQANYKFVV   G    +SMDPDKML WE++ICV++STP  VQCPICL
Sbjct  202  NKDLFLQANYKFVVLDRGGCEIKSMDPDKMLHWEEVICVRYSTPLLVQCPICL  254



>ref|XP_009405454.1| PREDICTED: RING finger protein 10 isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=781

 Score =   105 bits (262),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 62/113 (55%), Positives = 78/113 (69%), Gaps = 10/113 (9%)
 Frame = +1

Query  430  PATSHNNSGSTRSQGSMPRPTGRRTQMVSGNHLLNFHYDpisrpksrappprrqpkrkpY  609
            P+  H N+G + +         RR  +++ NHLLNF+YDPISR + R PP R+Q  +  Y
Sbjct  152  PSGLHGNAGQSAT---------RRNNVINANHLLNFYYDPISRSEPRIPPRRQQKIKP-Y  201

Query  610  NKDLFLQANYKFVVFSSGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
            NKDLFLQANYKFVV   G    +SMDPDKML WE++ICV++STP  VQCPICL
Sbjct  202  NKDLFLQANYKFVVLDRGGCEIKSMDPDKMLHWEEVICVRYSTPLLVQCPICL  254



>ref|XP_002977414.1| hypothetical protein SELMODRAFT_443565 [Selaginella moellendorffii]
 gb|EFJ21418.1| hypothetical protein SELMODRAFT_443565 [Selaginella moellendorffii]
Length=829

 Score =   101 bits (251),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 56/103 (54%), Positives = 70/103 (68%), Gaps = 0/103 (0%)
 Frame = +1

Query  460  TRSQGSMPRPTGRRTQMVSGNHLLNFHYDpisrpksrappprrqpkrkpYNKDLFLQANY  639
            T SQ S    + RR Q  + NHLLNFHYDPI RP  R P  R+  K + Y+K+LFLQAN+
Sbjct  149  TSSQHSTQPSSSRRGQTWNANHLLNFHYDPIVRPSPRPPQRRQHQKVQAYDKELFLQANF  208

Query  640  KFVVFSSGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
            +F+V   G+Y+  S DPDKMLEWEDI  V+ S+   +QCPICL
Sbjct  209  RFLVSDFGDYLENSTDPDKMLEWEDIALVELSSSVAIQCPICL  251



>ref|XP_002974997.1| hypothetical protein SELMODRAFT_442720 [Selaginella moellendorffii]
 gb|EFJ23782.1| hypothetical protein SELMODRAFT_442720 [Selaginella moellendorffii]
Length=1011

 Score = 97.1 bits (240),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 56/103 (54%), Positives = 70/103 (68%), Gaps = 0/103 (0%)
 Frame = +1

Query  460  TRSQGSMPRPTGRRTQMVSGNHLLNFHYDpisrpksrappprrqpkrkpYNKDLFLQANY  639
            T SQ S    + RR Q  + NHLLNFHYDPI RP  R P  R+  K + Y+K+LFLQAN+
Sbjct  343  TSSQHSTQPSSSRRGQTWNANHLLNFHYDPIVRPSPRPPQRRQHQKVQAYDKELFLQANF  402

Query  640  KFVVFSSGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
            +F+V   G+Y+  S DPDKMLEWEDI  V+ S+   +QCPICL
Sbjct  403  RFLVSDFGDYLENSTDPDKMLEWEDIAIVELSSSVAIQCPICL  445



>gb|ACN41106.1| unknown [Picea sitchensis]
Length=828

 Score = 95.1 bits (235),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 59/110 (54%), Positives = 73/110 (66%), Gaps = 3/110 (3%)
 Frame = +1

Query  448  NSGSTRSQGSMPRPTGRRTQMVSGNHLLNFHYDpisrpksrappp---rrqpkrkpYNKD  618
            N+G+  S  +     GR+ Q ++GNHLLNF+ DPI R     P     RRQ + KPYNKD
Sbjct  150  NAGTGASLATNAIRRGRKGQTLNGNHLLNFYSDPIPRAPRAPPRNLPPRRQQRIKPYNKD  209

Query  619  LFLQANYKFVVFSSGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
            LFLQAN++F+V   G+YV  S +PDKML WED+  V FSTP  VQCPICL
Sbjct  210  LFLQANFRFLVSDMGDYVLNSSNPDKMLLWEDVAAVNFSTPNHVQCPICL  259



>ref|XP_001753592.1| predicted protein [Physcomitrella patens]
 gb|EDQ81815.1| predicted protein [Physcomitrella patens]
Length=877

 Score = 88.2 bits (217),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 58/150 (39%), Positives = 87/150 (58%), Gaps = 8/150 (5%)
 Frame = +1

Query  343  GQNGIKTLTYHSTGQ-ISVDDRRKSPGPGLPATSHNNSGSTRSQ----GSMPRPTGRRTQ  507
            G+ G     + S  + I+V+ + +     + + + N SG +       G+ P  + +   
Sbjct  99   GRKGRHETVHASVSRPINVNGKPRPSSKSITSPARNGSGKSWQHSGNAGTTPPGSKKSQT  158

Query  508  MVSGNHLLNFHYDpisrpksrappp---rrqpkrkpYNKDLFLQANYKFVVFSSGNYVPE  678
            + + NHLLNF YDPI RP  R+      RRQ + +PYNK+LFLQAN++F+V    +Y   
Sbjct  159  LRAANHLLNFQYDPIQRPPPRSHHQPPPRRQKRIQPYNKELFLQANFRFLVSDLADYSLN  218

Query  679  SMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
            + DPDKML+WED++ V  + P PVQCPICL
Sbjct  219  ASDPDKMLQWEDVVAVNVTAPIPVQCPICL  248



>gb|ADN34144.1| hypothetical protein [Cucumis melo subsp. melo]
Length=211

 Score = 68.6 bits (166),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 85/202 (42%), Positives = 105/202 (52%), Gaps = 30/202 (15%)
 Frame = +1

Query  136  NPNSNHG----FLYFPNQHQQEEPSLSISGMGSLRIADsdsasssscsfsetssMGPAAL  303
            NPNS+HG    F + P  H             SLRI+D  S  S S   S +S + PA  
Sbjct  23   NPNSHHGPDSLFSFSPPTH----------SFPSLRISDPRSPLSDSSHVSGSS-LQPA--  69

Query  304  GSCGSPEKVNMSVGQNGIKTLTYHSTGQI------SVDDRRKSPGPGLPAT---SHNNSG  456
                S +KV+ S   N +K     STG +         D    PG  + +T   SH+   
Sbjct  70   NGAESSKKVSDSETLNDLKMPARQSTGTLLQCQSSGHKDGSVLPGSKISSTLNSSHDQQS  129

Query  457  S--TRSQGSMPRPTGRRTQMVSGNHLLNFHYDpisrpksrappp--rrqpkrkpYNKDLF  624
            +    S G+  R +GR+ Q+ +GNHLLNF YDPISRP+ RA  P  RR  K KPYNKDLF
Sbjct  130  ARNANSHGNNKRSSGRKAQITNGNHLLNFQYDPISRPQPRAKAPPPRRPQKIKPYNKDLF  189

Query  625  LQANYKFVVFSSGNYVPESMDP  690
            LQANYKFVV  SG +  E MDP
Sbjct  190  LQANYKFVVLDSGYHTDEYMDP  211



>gb|ESA07679.1| hypothetical protein GLOINDRAFT_349382 [Rhizophagus irregularis 
DAOM 181602]
 gb|EXX54715.1| Mag2p [Rhizophagus irregularis DAOM 197198w]
Length=749

 Score = 69.3 bits (168),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 41/92 (45%), Positives = 56/92 (61%), Gaps = 1/92 (1%)
 Frame = +1

Query  493  GRRTQMVSGNHLLNFHYDpisrpksrappprrqpkrkpYNKDLFLQANYKFVVFSSGNYV  672
             RR Q +S NHLLNF + P    ++  P  +R    +PYNK+ FL AN++F+V S G+Y 
Sbjct  145  NRRGQ-ISLNHLLNFSFPPRQSYQANTPRRQRTVNYQPYNKERFLNANFRFLVKSMGDYT  203

Query  673  PESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
               +DPD +L WEDI  V  ++P    CPICL
Sbjct  204  AYQVDPDILLNWEDIEQVIITSPNTPSCPICL  235



>ref|XP_004367839.1| zinc finger, C3HC4 type (RING finger) domain containing protein 
[Acanthamoeba castellanii str. Neff]
 gb|ELR25084.1| zinc finger, C3HC4 type (RING finger) domain containing protein 
[Acanthamoeba castellanii str. Neff]
Length=777

 Score = 66.6 bits (161),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 48/86 (56%), Gaps = 2/86 (2%)
 Frame = +1

Query  511  VSGNHLLNFHYDpisrpksrappprrqpkrkpYNKDLFLQANYKFVVFSSGNYVPESMDP  690
            V  N+LLNF Y+      S     R       + K+ FLQANY+FVV + G+YV    + 
Sbjct  189  VPANYLLNFTYERPVHDWSAPARRRTPVVE--FKKERFLQANYRFVVNAGGDYVRHLYET  246

Query  691  DKMLEWEDIICVKFSTPFPVQCPICL  768
            D++++W++I  +   TP P  CPICL
Sbjct  247  DQLVDWDEIEQIVLQTPVPYNCPICL  272



>ref|XP_008551291.1| PREDICTED: RING finger protein 10 [Microplitis demolitor]
Length=723

 Score = 65.9 bits (159),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 41/108 (38%), Positives = 56/108 (52%), Gaps = 12/108 (11%)
 Frame = +1

Query  472  GSMPRPTGRRTQMVSGNHLLNFHYDpisrpksrappprrq---------pkrkpYNKDLF  624
            GS+  P  ++  +   NHLLNFHY+P     S     +            +R  YNK+L+
Sbjct  94   GSVMTPGSKKQNL---NHLLNFHYEPRENRSSYGRSSKNYNNSNRWLPPVQRHKYNKELY  150

Query  625  LQANYKFVVFSSGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
            LQAN +FVV   GNY    +DPD ++ WE I  +K  T   + CPICL
Sbjct  151  LQANCQFVVNRDGNYSIHLIDPDTLVNWELIEQIKVQTSENLSCPICL  198



>ref|XP_011308976.1| PREDICTED: RING finger protein 10 [Fopius arisanus]
Length=676

 Score = 65.5 bits (158),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 41/110 (37%), Positives = 58/110 (53%), Gaps = 14/110 (13%)
 Frame = +1

Query  472  GSMPRPTGRRTQMVSGNHLLNFHYDpisrpksrappprrq-----------pkrkpYNKD  618
            GS+  P  ++  +   NHLLNFHY+P  R    +                  +R  YNK+
Sbjct  95   GSVMAPGSKKQNL---NHLLNFHYEPRDRMNINSSGWNSYGRSTNNRWLPPVQRHKYNKE  151

Query  619  LFLQANYKFVVFSSGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
            LFLQAN +FVV S G+Y    +DPD +++W+ I  +K  T   + CPICL
Sbjct  152  LFLQANCQFVVTSDGDYSMHLIDPDTLVDWKMIEQIKIHTSESLSCPICL  201



>ref|XP_005644276.1| hypothetical protein COCSUDRAFT_44557 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE19732.1| hypothetical protein COCSUDRAFT_44557 [Coccomyxa subellipsoidea 
C-169]
Length=916

 Score = 64.7 bits (156),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 40/119 (34%), Positives = 58/119 (49%), Gaps = 7/119 (6%)
 Frame = +1

Query  433  ATSHNNSGSTRSQGSMPRPTGRRTQMVSGNHLLNFHYDpisrpksrappprrqpkr----  600
            + SH++  +     ++   +  RT   S NHLLNF Y+             R        
Sbjct  67   SASHDSPANRTPDAAVLGRSPSRTGFTSANHLLNFQYESRQNTARGGGWAGRGRGGRKGA  126

Query  601  ---kpYNKDLFLQANYKFVVFSSGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
               +PYN++ FLQAN++F+V  + +      D D ML+WEDI+ V   T  PVQCPI L
Sbjct  127  PRPQPYNRNKFLQANFRFLVSDTADLRRHEADADLMLDWEDIVQVDMLTTQPVQCPISL  185



>ref|XP_780048.3| PREDICTED: RING finger protein 10-like [Strongylocentrotus purpuratus]
Length=866

 Score = 62.4 bits (150),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 46/130 (35%), Positives = 69/130 (53%), Gaps = 8/130 (6%)
 Frame = +1

Query  391  SVDDRRKSPGPGLPATSHNNSGST-RSQGSMPRPTGRRTQMVSGNHLLNFHYDpisrpks  567
            +VD R +S G  LPA+  +    T R++     P G   + ++ NHLLNF +       +
Sbjct  66   AVDKRPRSRG--LPASRRDEVTVTQRAEFGSALPHG--PKKLNMNHLLNFTFAARESEDA  121

Query  568  rappprrqpkr---kpYNKDLFLQANYKFVVFSSGNYVPESMDPDKMLEWEDIICVKFST  738
            R     R   R   + +NK+ FLQAN +FVV + GNY  +S+DPD ++EW+ I  ++   
Sbjct  122  RGGSGYRSRSRWGHRRFNKEQFLQANCQFVVKAKGNYKQQSVDPDALVEWDSIEQIRMLG  181

Query  739  PFPVQCPICL  768
                 CPICL
Sbjct  182  HEMPSCPICL  191



>ref|XP_002736630.2| PREDICTED: RING finger protein 10-like [Saccoglossus kowalevskii]
Length=794

 Score = 60.8 bits (146),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 36/86 (42%), Positives = 48/86 (56%), Gaps = 3/86 (3%)
 Frame = +1

Query  520  NHLLNFHY---DpisrpksrappprrqpkrkpYNKDLFLQANYKFVVFSSGNYVPESMDP  690
            NHLLNF Y   +  +   S     +   KR  YNK+ FLQAN +F+V SSG+Y   + DP
Sbjct  110  NHLLNFTYSPRETTTNSGSWKVRNKWGTKRVRYNKEQFLQANCQFIVKSSGDYTVHAADP  169

Query  691  DKMLEWEDIICVKFSTPFPVQCPICL  768
            D ++ WE I  V+  +     CPICL
Sbjct  170  DILVNWELIEQVRIFSHMVPSCPICL  195



>ref|XP_001653450.1| AAEL008854-PA [Aedes aegypti]
 gb|EAT39339.1| AAEL008854-PA [Aedes aegypti]
Length=772

 Score = 60.1 bits (144),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 44/121 (36%), Positives = 63/121 (52%), Gaps = 6/121 (5%)
 Frame = +1

Query  418  GPGLPATSHNNSGSTRSQGSMPRPTGRRTQMVSGNHLLNFHYDpisrpk----srapppr  585
            G GL +   ++ G+ R++       G + Q  S NHLLNFHY P  R +    S+    R
Sbjct  106  GTGLASQGGSDFGTVRNELHSVFSPGSKKQ--SLNHLLNFHYTPRERDQPMRFSKTGNNR  163

Query  586  rqpkrkpYNKDLFLQANYKFVVFSSGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPIC  765
               K+  YNK+ +LQAN +FVV +  +Y P    PD +++W  I  V   +    QCPIC
Sbjct  164  SYVKKVTYNKEQYLQANCQFVVRAGEDYTPVLASPDNLVDWTKIEQVHIFSSEEPQCPIC  223

Query  766  L  768
            L
Sbjct  224  L  224



>gb|KDR09385.1| RING finger protein 10 [Zootermopsis nevadensis]
Length=698

 Score = 59.7 bits (143),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 34/98 (35%), Positives = 49/98 (50%), Gaps = 15/98 (15%)
 Frame = +1

Query  520  NHLLNFHYDpisrp---------------ksrappprrqpkrkpYNKDLFLQANYKFVVF  654
            NHLLNFHY P                   +  +        +  YNK+ FLQAN +FVV 
Sbjct  109  NHLLNFHYAPREGVVPGSGHWHSFPSGVGRHGSARWLTSTHKHKYNKEQFLQANCQFVVK  168

Query  655  SSGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
            + GNY P + +PD ++ W+ I  ++F +   + CPICL
Sbjct  169  ADGNYTPYTSNPDVLVNWDFIEQIRFQSSEMLSCPICL  206



>ref|XP_002427459.1| RING finger protein, putative [Pediculus humanus corporis]
 gb|EEB14721.1| RING finger protein, putative [Pediculus humanus corporis]
Length=730

 Score = 59.7 bits (143),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 37/109 (34%), Positives = 54/109 (50%), Gaps = 9/109 (8%)
 Frame = +1

Query  460  TRSQGSMPRPTGRRTQMVSGNHLLNFHYDpisrpksrappprr------qpkrkpYNKDL  621
            T   GS+  P  ++  +   NHLLNF + P    +S     +         ++  YNK+ 
Sbjct  96   TAEYGSVFVPGSKKQNL---NHLLNFQFAPRVISRSSTNWSQFTSPNWFATQKHKYNKEH  152

Query  622  FLQANYKFVVFSSGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
            FLQAN +FVV    +Y P  +DPD ++EW  I  ++      V CPICL
Sbjct  153  FLQANCQFVVKEDADYTPHLVDPDLLVEWNQIEQIRLQCSALVSCPICL  201



>ref|XP_002504035.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO65293.1| predicted protein [Micromonas sp. RCC299]
Length=2208

 Score = 59.3 bits (142),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 22/54 (41%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = +1

Query  607  YNKDLFLQANYKFVVFSSGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
            Y K+LFLQAN++F+V    +    + DPD M++W+D++ V+ ++  P+ CP+CL
Sbjct  202  YRKELFLQANFRFLVADWADLRGAASDPDHMVDWDDVVLVEMASATPLSCPVCL  255



>gb|ELU04068.1| hypothetical protein CAPTEDRAFT_178155 [Capitella teleta]
Length=769

 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 50/91 (55%), Gaps = 8/91 (9%)
 Frame = +1

Query  520  NHLLNFHYDpisrpksrappprrqpkrkp--------YNKDLFLQANYKFVVFSSGNYVP  675
            NHLLNF ++P++              R          YNK+ FLQAN +F+V +SG+Y  
Sbjct  119  NHLLNFRFEPLTGGGGAGSRRGGARGRGRGRGFKGSWYNKERFLQANCQFIVRASGDYAG  178

Query  676  ESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
             +++PD +++W+ I  V+  T   V CPICL
Sbjct  179  LTVEPDSLVDWDLIEQVRLFTHEVVSCPICL  209



>ref|XP_011137254.1| PREDICTED: RING finger protein 10 [Harpegnathos saltator]
 gb|EFN85979.1| RING finger protein 10 [Harpegnathos saltator]
Length=728

 Score = 58.9 bits (141),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 53/97 (55%), Gaps = 10/97 (10%)
 Frame = +1

Query  508  MVSGNHLLNFHYDpisrpksrappprrqp----------krkpYNKDLFLQANYKFVVFS  657
            +++GNHLLNFHY+P +          R            +R  YNK+ FLQA+ +FVV +
Sbjct  105  LLNGNHLLNFHYEPRNAHNRNMGKSMRSNHNSNRWLPPIQRHKYNKEQFLQASCQFVVIA  164

Query  658  SGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
             G+Y     +PD +++W+ +  +K  +   + CPICL
Sbjct  165  GGDYSLYWTNPDVLVDWKSVEQIKVRSSENLSCPICL  201



>ref|XP_011421757.1| PREDICTED: RING finger protein 10-like [Crassostrea gigas]
Length=780

 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/105 (33%), Positives = 52/105 (50%), Gaps = 15/105 (14%)
 Frame = +1

Query  490  TGRRTQMVSGNHLLNFHYDpisrpksrapp------------prrqpkrkpYNKDLFLQA  633
            +GR+  +   NHLLNF Y   S  +                  +   K+  YNK+ +LQA
Sbjct  110  SGRKANL---NHLLNFTYSRHSGSEKTRGRPAWHFDSHSYGRKKGSTKKSLYNKEQYLQA  166

Query  634  NYKFVVFSSGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
            NY+FVV   G+Y   S+DPD +++W+ I  ++        CPICL
Sbjct  167  NYQFVVKDDGDYSIHSVDPDVLVDWDAIELIRVFGHEVTPCPICL  211



>ref|XP_005844797.1| expressed protein [Chlorella variabilis]
 gb|EFN52695.1| expressed protein [Chlorella variabilis]
Length=584

 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 36/54 (67%), Gaps = 0/54 (0%)
 Frame = +1

Query  607  YNKDLFLQANYKFVVFSSGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
            Y+++ FLQAN++F+V  + +      DPD MLEWED+  V+  +  PV+CPI L
Sbjct  209  YDRNKFLQANFRFLVSDALDVRRFEADPDLMLEWEDVAQVEMLSAAPVRCPITL  262



>ref|XP_001843035.1| RING finger protein 10 [Culex quinquefasciatus]
 gb|EDS30310.1| RING finger protein 10 [Culex quinquefasciatus]
Length=762

 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/90 (39%), Positives = 46/90 (51%), Gaps = 5/90 (6%)
 Frame = +1

Query  514  SGNHLLNFHY-----DpisrpksrappprrqpkrkpYNKDLFLQANYKFVVFSSGNYVPE  678
            S NHLLNFHY     D  +R            K+  YNK+ FLQAN +FVV S  +Y   
Sbjct  141  SLNHLLNFHYAPRDRDQPARLSKTGNNRCYMTKKFSYNKEQFLQANCQFVVRSGEDYEAC  200

Query  679  SMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
               PD+++EW  I  +   +    +CPICL
Sbjct  201  LASPDQLVEWSKIEQIHILSAEEPKCPICL  230



>ref|XP_011168526.1| PREDICTED: RING finger protein 10 isoform X1 [Solenopsis invicta]
Length=722

 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 36/110 (33%), Positives = 54/110 (49%), Gaps = 15/110 (14%)
 Frame = +1

Query  472  GSMPRPTGRRTQMVSGNHLLNFHYDpisrpksrappprrq-----------pkrkpYNKD  618
            GS+  PTGR+    +GNHLLNFHY+              +            +R  Y K+
Sbjct  91   GSVLVPTGRK----NGNHLLNFHYERGYAKGDAQNRDTGRHGSNSNRLLPPVQRHKYKKE  146

Query  619  LFLQANYKFVVFSSGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
             F+QA+ +FVV +S +Y     +PD +++WE I  +       + CPICL
Sbjct  147  QFVQASCQFVVTASKDYSLHLTNPDILVDWESIEQIILHNSENLSCPICL  196



>ref|XP_011168527.1| PREDICTED: RING finger protein 10 isoform X2 [Solenopsis invicta]
Length=720

 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 36/110 (33%), Positives = 54/110 (49%), Gaps = 15/110 (14%)
 Frame = +1

Query  472  GSMPRPTGRRTQMVSGNHLLNFHYDpisrpksrappprrq-----------pkrkpYNKD  618
            GS+  PTGR+    +GNHLLNFHY+              +            +R  Y K+
Sbjct  91   GSVLVPTGRK----NGNHLLNFHYERGYAKGDAQNRDTGRHGSNSNRLLPPVQRHKYKKE  146

Query  619  LFLQANYKFVVFSSGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
             F+QA+ +FVV +S +Y     +PD +++WE I  +       + CPICL
Sbjct  147  QFVQASCQFVVTASKDYSLHLTNPDILVDWESIEQIILHNSENLSCPICL  196



>ref|XP_780309.3| PREDICTED: RING finger protein 10-like, partial [Strongylocentrotus 
purpuratus]
Length=789

 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 47/86 (55%), Gaps = 3/86 (3%)
 Frame = +1

Query  520  NHLLNFHY---DpisrpksrappprrqpkrkpYNKDLFLQANYKFVVFSSGNYVPESMDP  690
            NHLLNF +   +            R +   + +NK+ FLQAN +FVV + GNY  +S+DP
Sbjct  23   NHLLNFTFAARESEDARGGSGYRSRSRWGHRRFNKEQFLQANCQFVVKAKGNYKQQSVDP  82

Query  691  DKMLEWEDIICVKFSTPFPVQCPICL  768
            D ++EW+ I  ++        CPICL
Sbjct  83   DALVEWDSIEQIRMLGHEMPSCPICL  108



>gb|EKC17307.1| RING finger protein 10 [Crassostrea gigas]
Length=437

 Score = 57.4 bits (137),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 35/105 (33%), Positives = 52/105 (50%), Gaps = 15/105 (14%)
 Frame = +1

Query  490  TGRRTQMVSGNHLLNFHYDpisrpksrapp------------prrqpkrkpYNKDLFLQA  633
            +GR+  +   NHLLNF Y   S  +                  +   K+  YNK+ +LQA
Sbjct  92   SGRKANL---NHLLNFTYSRHSGSEKTRGRPAWHFDSHSYGRKKGSTKKSLYNKEQYLQA  148

Query  634  NYKFVVFSSGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
            NY+FVV   G+Y   S+DPD +++W+ I  ++        CPICL
Sbjct  149  NYQFVVKDDGDYSIHSVDPDVLVDWDAIELIRVFGHEVTPCPICL  193



>ref|XP_009017693.1| hypothetical protein HELRODRAFT_191771 [Helobdella robusta]
 gb|ESO04424.1| hypothetical protein HELRODRAFT_191771 [Helobdella robusta]
Length=716

 Score = 57.4 bits (137),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 35/54 (65%), Gaps = 0/54 (0%)
 Frame = +1

Query  607  YNKDLFLQANYKFVVFSSGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
            +NK+ FLQAN +FVV S G+Y   S+DPD + +WE I  VK +      CPICL
Sbjct  47   FNKERFLQANCQFVVKSDGDYGVHSVDPDALAQWELIQQVKLTVHEAPYCPICL  100



>ref|XP_002115739.1| hypothetical protein TRIADDRAFT_59741 [Trichoplax adhaerens]
 gb|EDV21591.1| hypothetical protein TRIADDRAFT_59741 [Trichoplax adhaerens]
Length=621

 Score = 57.0 bits (136),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 32/99 (32%), Positives = 51/99 (52%), Gaps = 2/99 (2%)
 Frame = +1

Query  478  MPRPTGRRTQMVSGNHLLNFHYDpis--rpksrappprrqpkrkpYNKDLFLQANYKFVV  651
            +PR  GR+    S NHLLNF                   + +   +NK+ +LQAN +F+V
Sbjct  51   VPRERGRKKAGQSINHLLNFTISSEDYPTDTHGHHRRNPKYRVSTFNKEQYLQANCQFLV  110

Query  652  FSSGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
             + G+Y   ++DPD +++W++I  V+        CPICL
Sbjct  111  RADGDYALHNIDPDVLVQWDNIEQVRLWCHELPSCPICL  149



>dbj|GAN10619.1| RING finger domain protein [Mucor ambiguus]
Length=691

 Score = 57.0 bits (136),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 29/86 (34%), Positives = 48/86 (56%), Gaps = 0/86 (0%)
 Frame = +1

Query  511  VSGNHLLNFHYDpisrpksrappprrqpkrkpYNKDLFLQANYKFVVFSSGNYVPESMDP  690
            VS NHLL+F +       + +    +    +P+NK+ F+ AN++F++  +GNY+ +  DP
Sbjct  88   VSLNHLLSFSFPERQEAPATSHRKPKVTSYQPFNKERFINANFRFMLNPTGNYIYQLADP  147

Query  691  DKMLEWEDIICVKFSTPFPVQCPICL  768
            D   +W+ I  V  S+     CPICL
Sbjct  148  DINFDWDTIEQVLISSAEAQSCPICL  173



>ref|XP_003054911.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH60163.1| predicted protein [Micromonas pusilla CCMP1545]
Length=771

 Score = 57.0 bits (136),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 21/54 (39%), Positives = 35/54 (65%), Gaps = 0/54 (0%)
 Frame = +1

Query  607  YNKDLFLQANYKFVVFSSGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
            Y K+LFL AN++F+V    +    + DPD M++W+D++ V+     P+ CP+CL
Sbjct  112  YRKELFLHANFRFLVADWADLRGAATDPDHMVDWDDVVAVELGAAAPLACPVCL  165



>gb|EPB83462.1| hypothetical protein HMPREF1544_09790 [Mucor circinelloides f. 
circinelloides 1006PhL]
Length=690

 Score = 56.6 bits (135),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 29/86 (34%), Positives = 48/86 (56%), Gaps = 0/86 (0%)
 Frame = +1

Query  511  VSGNHLLNFHYDpisrpksrappprrqpkrkpYNKDLFLQANYKFVVFSSGNYVPESMDP  690
            VS NHLL+F +       + +    +    +P+NK+ F+ AN++F++  +GNY+ +  DP
Sbjct  84   VSLNHLLSFSFPERQEAPATSHRKPKVTSYQPFNKERFINANFRFMLNPTGNYIYQLADP  143

Query  691  DKMLEWEDIICVKFSTPFPVQCPICL  768
            D   +W+ I  V  S+     CPICL
Sbjct  144  DINFDWDTIEQVLISSAEAQSCPICL  169



>ref|XP_001420844.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO99137.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=689

 Score = 56.6 bits (135),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 21/53 (40%), Positives = 33/53 (62%), Gaps = 0/53 (0%)
 Frame = +1

Query  610  NKDLFLQANYKFVVFSSGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
            ++ LFLQAN++F+V  S +    S D D+M  WED++ V  ++     CP+CL
Sbjct  84   SRALFLQANFRFLVADSADLRASSRDADRMASWEDVVRVDVASAEAFSCPVCL  136



>dbj|BAN20910.1| conserved hypothetical protein [Riptortus pedestris]
Length=752

 Score = 56.6 bits (135),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 31/94 (33%), Positives = 45/94 (48%), Gaps = 9/94 (10%)
 Frame = +1

Query  514  SGNHLLNFHYD---------pisrpksrappprrqpkrkpYNKDLFLQANYKFVVFSSGN  666
            S NHLLNFHY+                 +       +   YNK+ FLQAN +FVV   G+
Sbjct  107  SLNHLLNFHYEPRGEVIQKRQYHSQYGTSTRSLMATQAHKYNKEQFLQANCQFVVREDGD  166

Query  667  YVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
            Y     DPD +++W+ +  +   +   + CPICL
Sbjct  167  YSFNLGDPDLLVDWDHVELIITGSCDKIVCPICL  200



>ref|XP_003705539.1| PREDICTED: RING finger protein 10-like [Megachile rotundata]
Length=721

 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 37/54 (69%), Gaps = 0/54 (0%)
 Frame = +1

Query  607  YNKDLFLQANYKFVVFSSGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
            YNK+ FLQA+ +FVV ++GNY     DPD +++W+ +  +K  +P  + CPICL
Sbjct  149  YNKEQFLQASCQFVVTANGNYSLYLTDPDILVDWKLVEQIKIHSPENLSCPICL  202



>ref|XP_011340136.1| PREDICTED: RING finger protein 10 [Cerapachys biroi]
 gb|EZA53151.1| RING finger protein [Cerapachys biroi]
Length=747

 Score = 55.8 bits (133),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/103 (31%), Positives = 54/103 (52%), Gaps = 12/103 (12%)
 Frame = +1

Query  496  RRTQMVSGNHLLNFHYDpisrpks------------rappprrqpkrkpYNKDLFLQANY  639
            +R++  +GNHLLNF Y+      +            +        ++  YNK+ F+Q++ 
Sbjct  93   QRSKKENGNHLLNFRYERDKVGDAGGLNRNTGRYGRKNNRSLPPVQQHKYNKEQFVQSSC  152

Query  640  KFVVFSSGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
            +FVV + G+Y     DPD +++W+ I  VKF +   + CPICL
Sbjct  153  QFVVSACGDYSLHLSDPDTLVDWKLIEQVKFYSSEELFCPICL  195



>ref|XP_003397460.1| PREDICTED: RING finger protein 10-like [Bombus terrestris]
Length=722

 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 34/97 (35%), Positives = 49/97 (51%), Gaps = 14/97 (14%)
 Frame = +1

Query  520  NHLLNFHYDpisrp--------------ksrappprrqpkrkpYNKDLFLQANYKFVVFS  657
            NHLLNFHY+P                     +       +R  YNK+ FLQA+ +FVV +
Sbjct  104  NHLLNFHYEPREMRGSGTWNHGKSIKGLTRNSNRCLPPVQRHKYNKEQFLQASCQFVVNA  163

Query  658  SGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
            +GNY     DPD +++W+ I  +K  +   + CPICL
Sbjct  164  NGNYTLYLSDPDVLVDWKLIEQIKLHSSENLSCPICL  200



>gb|EPX71098.1| ubiquitin-protein ligase E3 [Schizosaccharomyces octosporus yFS286]
Length=693

 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/103 (38%), Positives = 56/103 (54%), Gaps = 11/103 (11%)
 Frame = +1

Query  490  TGRRTQMVSGNHLLNFHYDpisrpksrappprrqpkrkpY---------NKDLFLQANYK  642
            T RR Q +S NHLLNF + P +   + + PPRR  +   Y         +K  ++ ANY+
Sbjct  120  TNRRGQ-ISLNHLLNFQFAPRNTYSTMSAPPRRTRQYNTYGYGSGYHPMDKARYVNANYR  178

Query  643  FVVFSSGNYVPESMDPDKMLEWEDIICVKFSTPFPVQ-CPICL  768
            F+V   G Y  + +DPD  ++WED+  V  S+ F V  CP CL
Sbjct  179  FIVSPLGEYTYQKLDPDAPVKWEDVWQVLCSSDFQVAVCPFCL  221



>ref|XP_005834147.1| hypothetical protein GUITHDRAFT_137758 [Guillardia theta CCMP2712]
 gb|EKX47167.1| hypothetical protein GUITHDRAFT_137758 [Guillardia theta CCMP2712]
Length=690

 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 41/127 (32%), Positives = 58/127 (46%), Gaps = 6/127 (5%)
 Frame = +1

Query  400  DRRKSPGPGLP----ATSHNNSGSTRSQGSMPRPTGRRTQMVSGNHLLNFHYDpisrpks  567
            ++R+S   G P        +N  S++       P  R+ Q  S  HLLNF         S
Sbjct  18   EKRRSKRAGKPDQQPVAKTSNIASSKPSRPFTTPAPRKGQDAS--HLLNFRTPERRTDMS  75

Query  568  rappprrqpkrkpYNKDLFLQANYKFVVFSSGNYVPESMDPDKMLEWEDIICVKFSTPFP  747
                 RR+  +  Y+KD ++ ANY FVV  S N+      PDK ++W+ +  V  S    
Sbjct  76   NTGSYRRRGPKVRYDKDRYMAANYHFVVDGSQNFSVHLAVPDKAIDWDFVREVHLSEEGC  135

Query  748  VQCPICL  768
             QCPICL
Sbjct  136  YQCPICL  142



>emb|CDS14039.1| hypothetical protein LRAMOSA06210 [Absidia idahoensis var. thermophila]
Length=670

 Score = 55.1 bits (131),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 35/88 (40%), Positives = 48/88 (55%), Gaps = 2/88 (2%)
 Frame = +1

Query  511  VSGNHLLNFHYDpisrpksrappprrqpkrkpYNKDLFLQANYKFVVFSSGNYVPESMDP  690
            VS NHLLNF +     P     P RR  +  PYNK+ FL AN++F+V ++G Y     DP
Sbjct  105  VSLNHLLNFTFPERQAPPPTHGPRRRAVQHVPYNKERFLNANFRFIVSATGEYHVHLADP  164

Query  691  DKMLEWEDI--ICVKFSTPFPVQCPICL  768
            D   EW+ +  + +  S+     CPICL
Sbjct  165  DCAFEWDTVEQVLLIASSEEEQACPICL  192



>ref|XP_002596691.1| hypothetical protein BRAFLDRAFT_219134 [Branchiostoma floridae]
 gb|EEN52703.1| hypothetical protein BRAFLDRAFT_219134, partial [Branchiostoma 
floridae]
Length=696

 Score = 55.1 bits (131),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 37/55 (67%), Gaps = 2/55 (4%)
 Frame = +1

Query  607  YNKDLFLQANYKFVVFSSGNYVPESMDPDKMLEWEDIICVK-FSTPFPVQCPICL  768
            +NK+ FLQ+N +FVV  +G+Y   S DPD +++W+ I  V+ FS   P  CPICL
Sbjct  65   FNKEQFLQSNCQFVVRDTGDYTVHSADPDTLVDWDSIEQVRLFSNEVP-SCPICL  118



>ref|XP_003690653.1| PREDICTED: RING finger protein 10-like [Apis florea]
Length=710

 Score = 55.1 bits (131),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 32/98 (33%), Positives = 47/98 (48%), Gaps = 15/98 (15%)
 Frame = +1

Query  520  NHLLNFHYDpisrpksrappprrqpkr---------------kpYNKDLFLQANYKFVVF  654
            NHLLNFHY+P             +  +                 YNK+ FLQA+ +FVV 
Sbjct  104  NHLLNFHYEPREMQSGSGAWSHGKSMKGFSRNSNRWLPPVQRHKYNKEQFLQASCQFVVS  163

Query  655  SSGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
            ++GNY     DPD +++W  +  +K  +   + CPICL
Sbjct  164  ANGNYTLYLSDPDILVDWRWVEQIKLHSSESLSCPICL  201



>ref|XP_006610485.1| PREDICTED: RING finger protein 10-like [Apis dorsata]
Length=709

 Score = 55.1 bits (131),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 32/98 (33%), Positives = 48/98 (49%), Gaps = 15/98 (15%)
 Frame = +1

Query  520  NHLLNFHYDpisrpksrappprrqpkr---------------kpYNKDLFLQANYKFVVF  654
            NHLLNFHY+P       +     +  +                 YNK+ FLQA+ +FVV 
Sbjct  104  NHLLNFHYEPREMQGGSSAWNHGKSMKGFSRNSNRWLPPVQRHKYNKEQFLQASCQFVVS  163

Query  655  SSGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
            ++GNY     DPD +++W  +  +K  +   + CPICL
Sbjct  164  ANGNYTLYLSDPDILVDWRWVEQIKLHSSESLSCPICL  201



>gb|ETN65851.1| RING finger protein 10 [Anopheles darlingi]
Length=820

 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 46/91 (51%), Gaps = 6/91 (7%)
 Frame = +1

Query  514  SGNHLLNFHY------DpisrpksrappprrqpkrkpYNKDLFLQANYKFVVFSSGNYVP  675
            S NHLLNFHY       P    +S      +   +  YNK+ FLQAN +FVV +  +Y  
Sbjct  141  SLNHLLNFHYAPRDRDQPARFSRSGNVRRTQYASQHSYNKEQFLQANCQFVVRAGEDYGL  200

Query  676  ESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
                PD++++W  I  +   +    QCPICL
Sbjct  201  FQASPDQLVDWAKIEQIHVLSAEEPQCPICL  231



>ref|XP_001639551.1| predicted protein [Nematostella vectensis]
 gb|EDO47488.1| predicted protein [Nematostella vectensis]
Length=748

 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 36/98 (37%), Positives = 56/98 (57%), Gaps = 4/98 (4%)
 Frame = +1

Query  475  SMPRPTGR-RTQMVSGNHLLNFHYDpisrpksrappprrqpkrkpYNKDLFLQANYKFVV  651
            ++ R TG  R    S NHLLNF Y+P  R + + P    + +   +NK+LFLQAN +FVV
Sbjct  116  TLDRATGNGRKNGNSLNHLLNFKYEPRERVQEQRPRTGSKRRVS-FNKELFLQANCQFVV  174

Query  652  FSSGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPIC  765
              + +Y   +M+PD +++W   +  + S     +CPIC
Sbjct  175  SDAADYTVYTMEPDLLVDWN--LIEQVSDKAWHKCPIC  210



>emb|CEF99945.1| Zinc finger, RING/FYVE/PHD-type [Ostreococcus tauri]
Length=698

 Score = 54.7 bits (130),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 20/53 (38%), Positives = 35/53 (66%), Gaps = 0/53 (0%)
 Frame = +1

Query  610  NKDLFLQANYKFVVFSSGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
            +++LFLQ+N++F++    +    S D D+M+ WED++ V+  +   V CPICL
Sbjct  94   SRELFLQSNFRFMLVEYADLDRASRDADRMVSWEDVVAVEHGSVGGVTCPICL  146



>ref|XP_003485829.1| PREDICTED: RING finger protein 10-like [Bombus impatiens]
Length=722

 Score = 54.7 bits (130),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 34/98 (35%), Positives = 49/98 (50%), Gaps = 15/98 (15%)
 Frame = +1

Query  520  NHLLNFHYDpisrpksrappprrq---------------pkrkpYNKDLFLQANYKFVVF  654
            NHLLNFHY+P             +                +R  YNK+ FLQA+ +FVV 
Sbjct  104  NHLLNFHYEPREMQGGSGTWNHGKLIKGLPRNSNRCLPPVQRHKYNKEQFLQASCQFVVN  163

Query  655  SSGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
            ++GNY     DPD +++W+ I  +K  +   + CPICL
Sbjct  164  ANGNYTLYLSDPDVLVDWKLIEQIKLHSSENLSCPICL  201



>emb|CDH55082.1| alkylbase dna n-glycosylase [Lichtheimia corymbifera JMRC:FSU:9682]
Length=677

 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 35/88 (40%), Positives = 48/88 (55%), Gaps = 2/88 (2%)
 Frame = +1

Query  511  VSGNHLLNFHYDpisrpksrappprrqpkrkpYNKDLFLQANYKFVVFSSGNYVPESMDP  690
            VS NHLLNF +     P     P RR  +  PYNK+ FL AN++F+V ++G Y     DP
Sbjct  107  VSLNHLLNFTFPERQAPPPTHGPRRRHVQHAPYNKERFLNANFRFIVSATGEYQVHLADP  166

Query  691  DKMLEWEDI--ICVKFSTPFPVQCPICL  768
            D   EW+ +  + +  S+     CPICL
Sbjct  167  DCAFEWDMVEQVLLIASSEEEQACPICL  194



>gb|EPY53709.1| ubiquitin-protein ligase E3 [Schizosaccharomyces cryophilus OY26]
Length=699

 Score = 54.3 bits (129),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 39/103 (38%), Positives = 56/103 (54%), Gaps = 11/103 (11%)
 Frame = +1

Query  490  TGRRTQMVSGNHLLNFHYDpisrpksrappprrqpkrkpY---------NKDLFLQANYK  642
            T RR Q +S NHLLNF + P +   + + PPRR  +   Y         +K  ++ ANY+
Sbjct  105  TNRRGQ-ISLNHLLNFQFAPRNTYSTMSAPPRRTRQYNTYGYGSGYHPMDKARYVNANYR  163

Query  643  FVVFSSGNYVPESMDPDKMLEWEDIICVKFSTPFPVQ-CPICL  768
            F+V   G Y  + +DPD  ++WED+  V  S+ F V  CP CL
Sbjct  164  FIVSPLGEYQYQKLDPDSPVKWEDVWQVLCSSDFQVAVCPFCL  206



>ref|XP_006695008.1| hypothetical protein CTHT_0046290 [Chaetomium thermophilum var. 
thermophilum DSM 1495]
 gb|EGS20123.1| hypothetical protein CTHT_0046290 [Chaetomium thermophilum var. 
thermophilum DSM 1495]
Length=671

 Score = 53.9 bits (128),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 23/54 (43%), Positives = 34/54 (63%), Gaps = 1/54 (2%)
 Frame = +1

Query  610  NKDLFLQANYKFVVFSSGNYVPESMDPDKMLEWEDIICVKFSTPF-PVQCPICL  768
            +K  ++ ANY+FVV  +GNY  ++ D DK +EW+D++ V  S       CPICL
Sbjct  139  DKARYIHANYRFVVRPTGNYAAQAADADKHIEWDDVLQVIASAESQQAACPICL  192



>ref|XP_317518.4| AGAP007954-PA [Anopheles gambiae str. PEST]
 gb|EAA12865.4| AGAP007954-PA [Anopheles gambiae str. PEST]
Length=799

 Score = 53.9 bits (128),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 36/110 (33%), Positives = 52/110 (47%), Gaps = 16/110 (15%)
 Frame = +1

Query  487  PTGRRTQM----------VSGNHLLNFHYDpisr------pksrappprrqpkrkpYNKD  618
            PTG R ++           S NHLLN+HY P  R       ++             YNK+
Sbjct  122  PTGARGELHSVFTPGSKKQSLNHLLNYHYAPRERDQPVRFTRTGNLRKLTNQSHGSYNKE  181

Query  619  LFLQANYKFVVFSSGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
             FLQAN +FVV +  +Y P    PD++++W  +  +   +    QCPICL
Sbjct  182  QFLQANCQFVVRAGEDYEPLLSAPDQLVDWGKVEQIHVLSSEEPQCPICL  231



>ref|XP_392932.3| PREDICTED: RING finger protein 10-like [Apis mellifera]
Length=695

 Score = 53.9 bits (128),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 32/98 (33%), Positives = 47/98 (48%), Gaps = 15/98 (15%)
 Frame = +1

Query  520  NHLLNFHYDpisrpksrappprrqpkr---------------kpYNKDLFLQANYKFVVF  654
            NHLLNFHY+P             +  +                 YNK+ FLQA+ +FVV 
Sbjct  104  NHLLNFHYEPREMQSGSGAWNHGKSMKGFSRNSNRWLPPVQRHKYNKEQFLQASCQFVVS  163

Query  655  SSGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
            ++GNY     DPD +++W  +  +K  +   + CPICL
Sbjct  164  ANGNYSLYLSDPDILVDWRWVEQIKLHSSESLSCPICL  201



>ref|XP_003082406.1| Predicted E3 ubiquitin ligase (ISS) [Ostreococcus tauri]
Length=583

 Score = 53.9 bits (128),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 20/53 (38%), Positives = 35/53 (66%), Gaps = 0/53 (0%)
 Frame = +1

Query  610  NKDLFLQANYKFVVFSSGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
            +++LFLQ+N++F++    +    S D D+M+ WED++ V+  +   V CPICL
Sbjct  6    SRELFLQSNFRFMLVEYADLDRASRDADRMVSWEDVVAVEHGSVGGVTCPICL  58



>gb|KFM75235.1| hypothetical protein X975_08140, partial [Stegodyphus mimosarum]
Length=680

 Score = 53.9 bits (128),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 44/84 (52%), Gaps = 1/84 (1%)
 Frame = +1

Query  520  NHLLNFHYDpisrpksrappprrqpkrk-pYNKDLFLQANYKFVVFSSGNYVPESMDPDK  696
            NHLLNF   P+    +          +   YNK+LFLQ+N +FVV  SGNY     +PD 
Sbjct  97   NHLLNFTLAPLENRDANQRRIASNRTKLPKYNKELFLQSNCQFVVKDSGNYTVHQKNPDI  156

Query  697  MLEWEDIICVKFSTPFPVQCPICL  768
            ++EW  I  ++  +     CPICL
Sbjct  157  LVEWSLIEEIRLPSHEVPLCPICL  180



>gb|KFH62253.1| hypothetical protein MVEG_11464 [Mortierella verticillata NRRL 
6337]
Length=819

 Score = 53.9 bits (128),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 36/91 (40%), Positives = 51/91 (56%), Gaps = 3/91 (3%)
 Frame = +1

Query  499  RTQMVSGNHLLNFHYDpisrpksrappprrqpkrkp-YNKDLFLQANYKFVVFSSGNYVP  675
            R   VS NHLLNF +   + P++  P  RR+      +NKD F+ AN++F++    NY  
Sbjct  122  RKNQVSLNHLLNFSFPVRAEPQNMGPVRRRRNVGYQPFNKDKFINANFRFLMNPGSNYEV  181

Query  676  ESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
             +MDPD  + WE+I  V  +   P  CPICL
Sbjct  182  FTMDPDVRVCWEEIEQVLIAV--PQSCPICL  210



>gb|EHJ65782.1| hypothetical protein KGM_06029 [Danaus plexippus]
Length=713

 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 47/85 (55%), Gaps = 2/85 (2%)
 Frame = +1

Query  520  NHLLNFHYDpisrpksrappprrqpkrkpY--NKDLFLQANYKFVVFSSGNYVPESMDPD  693
            NHLLNF Y   S    R+  PRRQ +   Y    DL+L+A  +FVV   G+Y    MDPD
Sbjct  108  NHLLNFKYPSRSGTDIRSVAPRRQAQHVSYRHEHDLYLRAYCQFVVKEDGDYKVNLMDPD  167

Query  694  KMLEWEDIICVKFSTPFPVQCPICL  768
              L+WE I  +   +   ++CPICL
Sbjct  168  LPLKWEQIEEIIVRSTGKLECPICL  192



>ref|XP_008209812.1| PREDICTED: RING finger protein 10 [Nasonia vitripennis]
 ref|XP_008209813.1| PREDICTED: RING finger protein 10 [Nasonia vitripennis]
 ref|XP_008209814.1| PREDICTED: RING finger protein 10 [Nasonia vitripennis]
Length=731

 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/95 (34%), Positives = 45/95 (47%), Gaps = 12/95 (13%)
 Frame = +1

Query  520  NHLLNFHY------------DpisrpksrappprrqpkrkpYNKDLFLQANYKFVVFSSG  663
            NHLLNFHY                             +R  YNK+ FLQAN +FVV + G
Sbjct  106  NHLLNFHYAPRDVQGGWSHGRASGYNSHHYNRWLPAVQRHKYNKEQFLQANCQFVVTAKG  165

Query  664  NYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
            +Y     DPD +++W+ I  ++  +   + CPICL
Sbjct  166  DYSLYLNDPDILVDWKLIQQIRVHSSDNLSCPICL  200



>gb|EFX03950.1| ring finger domain containing protein [Grosmannia clavigera kw1407]
Length=710

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/54 (43%), Positives = 34/54 (63%), Gaps = 1/54 (2%)
 Frame = +1

Query  610  NKDLFLQANYKFVVFSSGNYVPESMDPDKMLEWEDIICVKFSTPFPVQ-CPICL  768
            +K  F+ ANY+FVV  +G+Y  ++ D D+ +EW D++ V  ST      CPICL
Sbjct  149  DKARFVHANYRFVVSPTGDYTRQAADADEHVEWADVLQVLASTESQASACPICL  202



>ref|XP_011395030.1| RING-15 protein [Neurospora crassa OR74A]
 gb|ESA42226.1| RING-15 protein [Neurospora crassa OR74A]
 gb|KHE80792.1| hypothetical protein GE21DRAFT_9084 [Neurospora crassa]
Length=739

 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 33/54 (61%), Gaps = 1/54 (2%)
 Frame = +1

Query  610  NKDLFLQANYKFVVFSSGNYVPESMDPDKMLEWEDIICVKFSTPF-PVQCPICL  768
            +K  ++ ANY+FVV   GNY  ++ D D+ LEW DI+ +  ST      CPICL
Sbjct  203  DKARYVHANYRFVVSPGGNYTAQASDADEHLEWTDILQIIASTESQQTSCPICL  256



>ref|XP_009854561.1| hypothetical protein NEUTE1DRAFT_88138 [Neurospora tetrasperma 
FGSC 2508]
 gb|EGO54619.1| hypothetical protein NEUTE1DRAFT_88138 [Neurospora tetrasperma 
FGSC 2508]
 gb|EGZ67925.1| hypothetical protein NEUTE2DRAFT_95887 [Neurospora tetrasperma 
FGSC 2509]
Length=681

 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 33/54 (61%), Gaps = 1/54 (2%)
 Frame = +1

Query  610  NKDLFLQANYKFVVFSSGNYVPESMDPDKMLEWEDIICVKFSTPF-PVQCPICL  768
            +K  ++ ANY+FVV   GNY  ++ D D+ LEW DI+ +  ST      CPICL
Sbjct  145  DKARYVHANYRFVVSPGGNYTAQASDADEHLEWTDILQIVASTESQQTSCPICL  198



>ref|XP_002609585.1| hypothetical protein BRAFLDRAFT_115063 [Branchiostoma floridae]
 gb|EEN65595.1| hypothetical protein BRAFLDRAFT_115063 [Branchiostoma floridae]
Length=834

 Score = 52.8 bits (125),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 34/96 (35%), Positives = 46/96 (48%), Gaps = 14/96 (15%)
 Frame = +1

Query  520  NHLLNFHYDpisrpksrappprrq------------pkrkpYNKDLFLQANYKFVVFSSG  663
            NHLLNF Y+                               P+NK+ FLQ+N +FVV  +G
Sbjct  124  NHLLNFTYERRENASQYGGGQHSSWKSRNKWGRKGSGAAHPFNKEQFLQSNCQFVVRDTG  183

Query  664  NYVPESMDPDKMLEWEDIICVK-FSTPFPVQCPICL  768
            +Y   S DPD +++W+ I  V+ FS   P  CPICL
Sbjct  184  DYTVHSADPDTLVDWDSIEQVRLFSNEVP-SCPICL  218



>ref|XP_011395031.1| RING-15 protein, variant [Neurospora crassa OR74A]
 gb|ESA42227.1| RING-15 protein, variant [Neurospora crassa OR74A]
Length=681

 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 33/54 (61%), Gaps = 1/54 (2%)
 Frame = +1

Query  610  NKDLFLQANYKFVVFSSGNYVPESMDPDKMLEWEDIICVKFSTPF-PVQCPICL  768
            +K  ++ ANY+FVV   GNY  ++ D D+ LEW DI+ +  ST      CPICL
Sbjct  145  DKARYVHANYRFVVSPGGNYTAQASDADEHLEWTDILQIIASTESQQTSCPICL  198



>ref|XP_007936486.1| PREDICTED: RING finger protein 10 [Orycteropus afer afer]
Length=758

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/54 (41%), Positives = 34/54 (63%), Gaps = 0/54 (0%)
 Frame = +1

Query  607  YNKDLFLQANYKFVVFSSGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
            +NK+LFLQAN +FVV  + +Y     DPD ++ W+ +  V+  +   + CPICL
Sbjct  176  FNKELFLQANCQFVVSENQDYTAHFADPDTLVNWDFVEQVRICSHEVLSCPICL  229



>ref|XP_011060457.1| PREDICTED: RING finger protein 10 isoform X1 [Acromyrmex echinatior]
 gb|EGI70202.1| RING finger protein 10 [Acromyrmex echinatior]
Length=741

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/94 (32%), Positives = 46/94 (49%), Gaps = 10/94 (11%)
 Frame = +1

Query  517  GNHLLNFHYDpisrpksrappprrqpkrk----------pYNKDLFLQANYKFVVFSSGN  666
            GNHLLNFHY+      ++     R                YNK+ F+QA+ +FVV +S +
Sbjct  122  GNHLLNFHYERYVMRDAQNRDVGRHNSNSNRLLPPVQRHKYNKEQFVQASCQFVVTASRD  181

Query  667  YVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
            Y     +PD +++W+ I  +       + CPICL
Sbjct  182  YSLHLTNPDILVDWKSIEQIILHNSENLSCPICL  215



>ref|XP_011060466.1| PREDICTED: RING finger protein 10 isoform X2 [Acromyrmex echinatior]
Length=739

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/94 (32%), Positives = 46/94 (49%), Gaps = 10/94 (11%)
 Frame = +1

Query  517  GNHLLNFHYDpisrpksrappprrqpkrk----------pYNKDLFLQANYKFVVFSSGN  666
            GNHLLNFHY+      ++     R                YNK+ F+QA+ +FVV +S +
Sbjct  122  GNHLLNFHYERYVMRDAQNRDVGRHNSNSNRLLPPVQRHKYNKEQFVQASCQFVVTASRD  181

Query  667  YVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
            Y     +PD +++W+ I  +       + CPICL
Sbjct  182  YSLHLTNPDILVDWKSIEQIILHNSENLSCPICL  215



>ref|XP_011060473.1| PREDICTED: RING finger protein 10 isoform X3 [Acromyrmex echinatior]
Length=734

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/94 (32%), Positives = 46/94 (49%), Gaps = 10/94 (11%)
 Frame = +1

Query  517  GNHLLNFHYDpisrpksrappprrqpkrk----------pYNKDLFLQANYKFVVFSSGN  666
            GNHLLNFHY+      ++     R                YNK+ F+QA+ +FVV +S +
Sbjct  122  GNHLLNFHYERYVMRDAQNRDVGRHNSNSNRLLPPVQRHKYNKEQFVQASCQFVVTASRD  181

Query  667  YVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
            Y     +PD +++W+ I  +       + CPICL
Sbjct  182  YSLHLTNPDILVDWKSIEQIILHNSENLSCPICL  215



>ref|XP_001971151.1| GG14590 [Drosophila erecta]
 gb|EDV50177.1| GG14590 [Drosophila erecta]
Length=704

 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 37/116 (32%), Positives = 59/116 (51%), Gaps = 7/116 (6%)
 Frame = +1

Query  433  ATSHNNSGSTRSQGSMPRPTGRRTQMVSGNHLLNFHYDpisrpksrappprrqp----kr  600
            AT ++ SG    + +     G + Q +  NHLLNFH  P    +      ++      ++
Sbjct  104  ATGYSRSGDFDHELNSVYAQGSKKQNL--NHLLNFHCVPRELERGHHHQAQQHHALGGRK  161

Query  601  kpYNKDLFLQANYKFVVFSSGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
            + YNK+ FLQAN++FV+  SG     +  PD +++W  I  +   T   +QCPICL
Sbjct  162  QRYNKEQFLQANFQFVI-RSGAKAQVNGSPDALIDWSYIEQINIQTTEELQCPICL  216



>ref|XP_002083234.1| GD13467 [Drosophila simulans]
 gb|EDX08819.1| GD13467 [Drosophila simulans]
Length=708

 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 37/116 (32%), Positives = 59/116 (51%), Gaps = 7/116 (6%)
 Frame = +1

Query  433  ATSHNNSGSTRSQGSMPRPTGRRTQMVSGNHLLNFHYDpisrpksrappprrqp----kr  600
            AT ++ SG    + +     G + Q +  NHLLNFH  P    +      ++      ++
Sbjct  104  ATGYSRSGDFDHELNSVYTQGSKKQNL--NHLLNFHCVPRELERGHHHQAQQHHGLSGRK  161

Query  601  kpYNKDLFLQANYKFVVFSSGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
            + YNK+ FLQAN++FV+  SG     +  PD +++W  I  +   T   +QCPICL
Sbjct  162  QRYNKEQFLQANFQFVI-RSGAKAQVNGSPDALIDWSYIEQINIQTTEELQCPICL  216



>ref|NP_647623.1| CG12099, isoform B [Drosophila melanogaster]
 ref|NP_728629.1| CG12099, isoform A [Drosophila melanogaster]
 gb|AAF47511.1| CG12099, isoform A [Drosophila melanogaster]
 gb|AAL28656.1| LD09551p [Drosophila melanogaster]
 gb|AAN11490.1| CG12099, isoform B [Drosophila melanogaster]
Length=708

 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 37/116 (32%), Positives = 59/116 (51%), Gaps = 7/116 (6%)
 Frame = +1

Query  433  ATSHNNSGSTRSQGSMPRPTGRRTQMVSGNHLLNFHYDpisrpksrappprrqp----kr  600
            AT ++ SG    + +     G + Q +  NHLLNFH  P    +      ++      ++
Sbjct  104  ATGYSRSGDFDHELNSVYTQGSKKQNL--NHLLNFHCVPRELERGHHHQAQQHHGLSGRK  161

Query  601  kpYNKDLFLQANYKFVVFSSGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
            + YNK+ FLQAN++FV+  SG     +  PD +++W  I  +   T   +QCPICL
Sbjct  162  QRYNKEQFLQANFQFVI-RSGAKAQVNGSPDALIDWSYIEQINIQTTEELQCPICL  216



>ref|XP_011184197.1| PREDICTED: RING finger protein 10 [Bactrocera cucurbitae]
Length=786

 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 45/102 (44%), Gaps = 20/102 (20%)
 Frame = +1

Query  520  NHLLNFHY-------------------DpisrpksrappprrqpkrkpYNKDLFLQANYK  642
            NHLLNFHY                      +    R        KR  YNK+ FLQAN++
Sbjct  150  NHLLNFHYAPRDGDNAFRFNVFGRNGGSGSTAATKRQGANNGANKRHRYNKEQFLQANFQ  209

Query  643  FVVFSSGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
            FVV  SG  +  S  PD +++W  I  +   T    QCPICL
Sbjct  210  FVV-KSGINLSVSASPDNLIDWNLIEQINIQTEEEPQCPICL  250



>ref|XP_011506010.1| PREDICTED: LOW QUALITY PROTEIN: RING finger protein 10 [Ceratosolen 
solmsi marchali]
Length=741

 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/54 (43%), Positives = 34/54 (63%), Gaps = 0/54 (0%)
 Frame = +1

Query  607  YNKDLFLQANYKFVVFSSGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
            YNK+ FLQAN +FVV + G+Y     DPD +++W+ I  ++      + CPICL
Sbjct  146  YNKEQFLQANCQFVVTAKGDYSLYLNDPDILIDWKLIEQIRVHNSENLLCPICL  199



>ref|XP_007229396.1| PREDICTED: RING finger protein 10-like [Astyanax mexicanus]
Length=773

 Score = 51.2 bits (121),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 22/54 (41%), Positives = 32/54 (59%), Gaps = 0/54 (0%)
 Frame = +1

Query  607  YNKDLFLQANYKFVVFSSGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
            +NK+LFLQAN +FVV    +Y     DPD ++ W+ +  V+  +     CPICL
Sbjct  172  FNKELFLQANCQFVVIDDQDYQAHFTDPDTLVSWDSVQQVRIYSHEVPTCPICL  225



>ref|XP_001985429.1| GH17054 [Drosophila grimshawi]
 gb|EDV97777.1| GH17054 [Drosophila grimshawi]
Length=750

 Score = 51.2 bits (121),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 32/88 (36%), Positives = 43/88 (49%), Gaps = 6/88 (7%)
 Frame = +1

Query  520  NHLLNFH-----YDpisrpksrappprrqpkrkpYNKDLFLQANYKFVVFSSGNYVPESM  684
            NHLLNFH         S   +         ++  YNK+ FLQAN++FV+ SS      S 
Sbjct  156  NHLLNFHCVPRQSSSSSDWHATGHGATIARRQPRYNKEQFLQANFQFVIRSSAKAQVNS-  214

Query  685  DPDKMLEWEDIICVKFSTPFPVQCPICL  768
             PD +++W  I  +   T    QCPICL
Sbjct  215  SPDTLIDWSLIEQINIHTTEEPQCPICL  242



>ref|NP_596530.1| hypothetical protein SPBP8B7.23 [Schizosaccharomyces pombe 972h-]
 sp|O94271.1|YORN_SCHPO RecName: Full=Uncharacterized RING finger protein P8B7.23 [Schizosaccharomyces 
pombe 972h-]
 emb|CAA21808.1| ubiquitin-protein ligase E3 implicated in trancription (predicted) 
[Schizosaccharomyces pombe]
Length=673

 Score = 51.2 bits (121),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 37/103 (36%), Positives = 56/103 (54%), Gaps = 11/103 (11%)
 Frame = +1

Query  490  TGRRTQMVSGNHLLNFHYDpisrpksrappprrqpkrkpY---------NKDLFLQANYK  642
            T +R Q ++ NHLLNF + P +   + + PPRR      Y         +K  ++ ANY+
Sbjct  117  TNKRGQ-INLNHLLNFQFTPRTNSNAFSAPPRRSRGYNTYGQGSGHHPMDKSRYVNANYR  175

Query  643  FVVFSSGNYVPESMDPDKMLEWEDIICVKFSTPFPV-QCPICL  768
            FVV   G+Y  + +DPD  ++WED+  V  S+ F +  CP CL
Sbjct  176  FVVSPIGDYQSQKLDPDSPVKWEDVWQVLCSSDFQLAACPFCL  218



>ref|XP_001518584.2| PREDICTED: RING finger protein 10 [Ornithorhynchus anatinus]
Length=816

 Score = 51.2 bits (121),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 37/128 (29%), Positives = 56/128 (44%), Gaps = 11/128 (9%)
 Frame = +1

Query  418  GPGLPATSHNNSGSTRSQGSMPRPTGRRTQM-----VSGNHLLNFHYDpisrpksrappp  582
            G G P +S +N G         R      Q      ++ NHLLNF ++P           
Sbjct  102  GGGKPFSSSSNGGRRDEVAEAQRAEFSPAQFSGPKKINLNHLLNFTFEPRGHGGHSEGSG  161

Query  583  rrqpkrkp------YNKDLFLQANYKFVVFSSGNYVPESMDPDKMLEWEDIICVKFSTPF  744
                 ++       +NK+LFLQAN +FVV +  +Y     DPD ++ W+ +  V+  +  
Sbjct  162  HGNWGKRNKWGHKPFNKELFLQANCQFVVSADQDYTVHFADPDTLVNWDFVEQVRICSHE  221

Query  745  PVQCPICL  768
               CPICL
Sbjct  222  VPSCPICL  229



>ref|XP_002034929.1| GM14204 [Drosophila sechellia]
 gb|EDW50065.1| GM14204 [Drosophila sechellia]
Length=708

 Score = 51.2 bits (121),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 31/87 (36%), Positives = 47/87 (54%), Gaps = 5/87 (6%)
 Frame = +1

Query  520  NHLLNFHYDpisrpksrappprrqp----krkpYNKDLFLQANYKFVVFSSGNYVPESMD  687
            NHLLNFH  P    +      ++      +++ YNK+ FLQAN++FV+  SG     +  
Sbjct  131  NHLLNFHCVPRELERGHHHQAQQHHGLSGRKQRYNKEQFLQANFQFVI-RSGAKAQVNGS  189

Query  688  PDKMLEWEDIICVKFSTPFPVQCPICL  768
            PD +++W  I  +   T   +QCPICL
Sbjct  190  PDALIDWSYIEQINIQTTEELQCPICL  216



>ref|XP_011112993.1| hypothetical protein H072_7231 [Dactylellina haptotyla CBS 200.50]
 gb|EPS39010.1| hypothetical protein H072_7231 [Dactylellina haptotyla CBS 200.50]
Length=773

 Score = 51.2 bits (121),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 22/54 (41%), Positives = 34/54 (63%), Gaps = 1/54 (2%)
 Frame = +1

Query  610  NKDLFLQANYKFVVFSSGNYVPESMDPDKMLEWEDIICVKFST-PFPVQCPICL  768
            +K  ++ ANY+F+V  +G+Y P+S+DPD  L W  I+ +  S+      CPICL
Sbjct  143  DKARYVNANYRFIVDPAGDYRPQSLDPDSTLPWASILQILASSITQTASCPICL  196



>ref|XP_002093140.1| GE20950 [Drosophila yakuba]
 gb|EDW92852.1| GE20950 [Drosophila yakuba]
Length=709

 Score = 50.8 bits (120),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 37/116 (32%), Positives = 58/116 (50%), Gaps = 7/116 (6%)
 Frame = +1

Query  433  ATSHNNSGSTRSQGSMPRPTGRRTQMVSGNHLLNFHYDpisrpksrappprrqp----kr  600
            AT ++ SG    + +     G + Q +  NHLLNFH  P    +      ++      ++
Sbjct  104  ATGYSRSGDFDHELNSVYAQGSKKQNL--NHLLNFHCVPRELERGHHHQAQQHHGLGGRK  161

Query  601  kpYNKDLFLQANYKFVVFSSGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
            + YNK+ FLQAN++FV+  SG        PD +++W  I  +   T   +QCPICL
Sbjct  162  QRYNKEQFLQANFQFVI-RSGAKAQVYGSPDALIDWSYIEQINIQTTEELQCPICL  216



>ref|XP_006995860.1| PREDICTED: RING finger protein 10 isoform X2 [Peromyscus maniculatus 
bairdii]
Length=810

 Score = 50.8 bits (120),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 22/54 (41%), Positives = 33/54 (61%), Gaps = 0/54 (0%)
 Frame = +1

Query  607  YNKDLFLQANYKFVVFSSGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
            +NK+LFLQAN +FVV +  +Y     DPD ++ W+ +  V+  +     CPICL
Sbjct  176  FNKELFLQANCQFVVSADQDYTAHFADPDTLVNWDFVEQVRICSHEVPSCPICL  229



>ref|XP_006995859.1| PREDICTED: RING finger protein 10 isoform X1 [Peromyscus maniculatus 
bairdii]
Length=811

 Score = 50.8 bits (120),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 22/54 (41%), Positives = 33/54 (61%), Gaps = 0/54 (0%)
 Frame = +1

Query  607  YNKDLFLQANYKFVVFSSGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
            +NK+LFLQAN +FVV +  +Y     DPD ++ W+ +  V+  +     CPICL
Sbjct  176  FNKELFLQANCQFVVSADQDYTAHFADPDTLVNWDFVEQVRICSHEVPSCPICL  229



>emb|CEP17430.1| hypothetical protein [Parasitella parasitica]
Length=664

 Score = 50.8 bits (120),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 38/120 (32%), Positives = 54/120 (45%), Gaps = 14/120 (12%)
 Frame = +1

Query  418  GPGLPATSHNNSGSTRSQGSMPRPTGRRTQMVSGNHLLNFHYDpisrpksrappprrqpk  597
            G  L   +    GST  +G            VS NHLL F +     P +      +   
Sbjct  40   GLDLVQVAQRTGGSTDKKGR-----------VSLNHLLGFSFPERQAPPATPHRKAKITS  88

Query  598  rkpYNKDLFLQANY---KFVVFSSGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
             +P+NK+ F+ A Y   +F++  SGNY+ +  DPD   +WE I  V  S+     CPICL
Sbjct  89   YQPFNKERFINAKYGSFRFMLNPSGNYIYQLADPDINFDWETIEQVLISSSEVQLCPICL  148



>ref|XP_010366601.1| PREDICTED: RING finger protein 10 isoform X4 [Rhinopithecus roxellana]
Length=699

 Score = 50.8 bits (120),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 22/54 (41%), Positives = 32/54 (59%), Gaps = 0/54 (0%)
 Frame = +1

Query  607  YNKDLFLQANYKFVVFSSGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
            +NK+LFLQAN +FVV    +Y     DPD ++ W+ +  V+  +     CPICL
Sbjct  176  FNKELFLQANCQFVVCEDQDYTAHFADPDTLVNWDFVEQVRICSHEVPSCPICL  229



>ref|XP_007525335.1| PREDICTED: RING finger protein 10 [Erinaceus europaeus]
Length=808

 Score = 50.8 bits (120),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 49/94 (52%), Gaps = 6/94 (6%)
 Frame = +1

Query  505  QMVSGNHLLNFHYDpisrpksrapp------prrqpkrkpYNKDLFLQANYKFVVFSSGN  666
            + +S NHLLNF ++P  +              R +   KP+NK+LFLQAN +FVV    +
Sbjct  136  KKISLNHLLNFTFEPRGQAGHFEGNGHGSWGKRNKWGHKPFNKELFLQANCQFVVSEDQD  195

Query  667  YVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
            Y     DPD ++ W+ +  V+  +     CPICL
Sbjct  196  YTAHFADPDTLVNWDFVEQVRICSHEVPSCPICL  229



>ref|XP_008003145.1| PREDICTED: RING finger protein 10 isoform X6 [Chlorocebus sabaeus]
Length=705

 Score = 50.8 bits (120),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 22/54 (41%), Positives = 32/54 (59%), Gaps = 0/54 (0%)
 Frame = +1

Query  607  YNKDLFLQANYKFVVFSSGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
            +NK+LFLQAN +FVV    +Y     DPD ++ W+ +  V+  +     CPICL
Sbjct  176  FNKELFLQANCQFVVCEDQDYTAHFADPDTLVNWDFVEQVRICSHEVPSCPICL  229



>ref|XP_009180108.1| PREDICTED: RING finger protein 10 isoform X4 [Papio anubis]
Length=700

 Score = 50.8 bits (120),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 22/54 (41%), Positives = 32/54 (59%), Gaps = 0/54 (0%)
 Frame = +1

Query  607  YNKDLFLQANYKFVVFSSGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
            +NK+LFLQAN +FVV    +Y     DPD ++ W+ +  V+  +     CPICL
Sbjct  176  FNKELFLQANCQFVVCEDQDYTAHFADPDTLVNWDFVEQVRICSHEVPSCPICL  229



>ref|XP_008003147.1| PREDICTED: RING finger protein 10 isoform X7 [Chlorocebus sabaeus]
Length=700

 Score = 50.8 bits (120),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 22/54 (41%), Positives = 32/54 (59%), Gaps = 0/54 (0%)
 Frame = +1

Query  607  YNKDLFLQANYKFVVFSSGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
            +NK+LFLQAN +FVV    +Y     DPD ++ W+ +  V+  +     CPICL
Sbjct  176  FNKELFLQANCQFVVCEDQDYTAHFADPDTLVNWDFVEQVRICSHEVPSCPICL  229



>ref|XP_004718107.1| PREDICTED: LOW QUALITY PROTEIN: ring finger protein 10 [Echinops 
telfairi]
Length=803

 Score = 50.8 bits (120),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 22/54 (41%), Positives = 33/54 (61%), Gaps = 0/54 (0%)
 Frame = +1

Query  607  YNKDLFLQANYKFVVFSSGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
            +NK+LFLQAN +FVV  + +Y     DPD ++ W+ +  V+  +     CPICL
Sbjct  176  FNKELFLQANCQFVVSENQDYTAHFADPDTLVNWDFVEQVRICSHEVPSCPICL  229



>ref|XP_006890492.1| PREDICTED: RING finger protein 10 isoform X1 [Elephantulus edwardii]
 ref|XP_006890493.1| PREDICTED: RING finger protein 10 isoform X2 [Elephantulus edwardii]
Length=810

 Score = 50.8 bits (120),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 22/54 (41%), Positives = 33/54 (61%), Gaps = 0/54 (0%)
 Frame = +1

Query  607  YNKDLFLQANYKFVVFSSGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
            +NK+LFLQAN +FVV  + +Y     DPD ++ W+ +  V+  +     CPICL
Sbjct  176  FNKELFLQANCQFVVSENQDYTAHFADPDTLVNWDFVEQVRICSHEVPSCPICL  229



>ref|XP_004464711.1| PREDICTED: RING finger protein 10 isoform 3 [Dasypus novemcinctus]
Length=701

 Score = 50.4 bits (119),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 22/54 (41%), Positives = 32/54 (59%), Gaps = 0/54 (0%)
 Frame = +1

Query  607  YNKDLFLQANYKFVVFSSGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
            +NK+LFLQAN +FVV    +Y     DPD ++ W+ +  V+  +     CPICL
Sbjct  176  FNKELFLQANCQFVVSEGQDYTAHFADPDTLVNWDFVEQVRICSHEVPSCPICL  229



>ref|XP_003790042.1| PREDICTED: RING finger protein 10 [Otolemur garnettii]
Length=928

 Score = 50.8 bits (120),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 22/54 (41%), Positives = 32/54 (59%), Gaps = 0/54 (0%)
 Frame = +1

Query  607  YNKDLFLQANYKFVVFSSGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
            +NK+LFLQAN +FVV    +Y     DPD ++ W+ +  V+  +     CPICL
Sbjct  318  FNKELFLQANCQFVVSEDQDYTAHFADPDTLVNWDFVEQVRICSHEVPSCPICL  371



>gb|ERE75902.1| RING finger protein 10 [Cricetulus griseus]
Length=705

 Score = 50.4 bits (119),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 22/54 (41%), Positives = 32/54 (59%), Gaps = 0/54 (0%)
 Frame = +1

Query  607  YNKDLFLQANYKFVVFSSGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
            +NK+LFLQAN +FVV    +Y     DPD ++ W+ +  V+  +     CPICL
Sbjct  162  FNKELFLQANCQFVVSEDQDYAAHFADPDTLVNWDFVEQVRICSHEVPSCPICL  215



>ref|XP_003974626.1| PREDICTED: RING finger protein 10-like [Takifugu rubripes]
Length=765

 Score = 50.4 bits (119),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 49/94 (52%), Gaps = 6/94 (6%)
 Frame = +1

Query  505  QMVSGNHLLNFHYDpisrpksrappp------rrqpkrkpYNKDLFLQANYKFVVFSSGN  666
            + +S NHLLNF ++P                 +   K KP+NK+LFLQAN +FVV    +
Sbjct  110  KKISLNHLLNFTFEPRGGNGGDGGHACWGHRNKWGHKHKPFNKELFLQANCQFVVNDEQD  169

Query  667  YVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
            Y     DPD ++ W+ +  V+ ++     CPICL
Sbjct  170  YKAHFTDPDTLVNWDCVQQVRINSHEVPSCPICL  203



>dbj|BAE33735.1| unnamed protein product [Mus musculus]
Length=964

 Score = 50.8 bits (120),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 22/54 (41%), Positives = 32/54 (59%), Gaps = 0/54 (0%)
 Frame = +1

Query  607  YNKDLFLQANYKFVVFSSGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
            +NK+LFLQAN +FVV    +Y     DPD ++ W+ +  V+  +     CPICL
Sbjct  335  FNKELFLQANCQFVVSEDQDYAAHFADPDTLVNWDFVEQVRICSHEVPSCPICL  388



>ref|XP_009424675.1| PREDICTED: RING finger protein 10 isoform X3 [Pan troglodytes]
Length=700

 Score = 50.4 bits (119),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 22/54 (41%), Positives = 32/54 (59%), Gaps = 0/54 (0%)
 Frame = +1

Query  607  YNKDLFLQANYKFVVFSSGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
            +NK+LFLQAN +FVV    +Y     DPD ++ W+ +  V+  +     CPICL
Sbjct  176  FNKELFLQANCQFVVSEDQDYTAHFADPDTLVNWDFVEQVRICSHEVPSCPICL  229



>dbj|BAE02122.1| unnamed protein product [Macaca fascicularis]
Length=606

 Score = 50.4 bits (119),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 22/54 (41%), Positives = 32/54 (59%), Gaps = 0/54 (0%)
 Frame = +1

Query  607  YNKDLFLQANYKFVVFSSGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
            +NK+LFLQAN +FVV    +Y     DPD ++ W+ +  V+  +     CPICL
Sbjct  82   FNKELFLQANCQFVVCEDQDYTAHFADPDTLVNWDFVEQVRICSHEVPSCPICL  135



>ref|XP_005112582.1| PREDICTED: RING finger protein 10-like isoform X1 [Aplysia californica]
Length=896

 Score = 50.4 bits (119),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 22/53 (42%), Positives = 36/53 (68%), Gaps = 0/53 (0%)
 Frame = +1

Query  607  YNKDLFLQANYKFVVFSSGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPIC  765
            YNK+ FLQA+ +FVV  +G Y  +++DPD +++W+ +  V+  +   V CPIC
Sbjct  150  YNKEQFLQASCQFVVQDNGEYSQQAVDPDALVKWDLVELVRVFSTESVLCPIC  202



>ref|XP_005396644.1| PREDICTED: RING finger protein 10 [Chinchilla lanigera]
Length=782

 Score = 50.4 bits (119),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 22/54 (41%), Positives = 32/54 (59%), Gaps = 0/54 (0%)
 Frame = +1

Query  607  YNKDLFLQANYKFVVFSSGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
            +NK+LFLQAN +FVV    +Y     DPD ++ W+ +  V+  +     CPICL
Sbjct  176  FNKELFLQANCQFVVSEDQDYTAHFADPDTLVNWDFVEQVRICSHEVPSCPICL  229



>ref|XP_006640236.1| PREDICTED: RING finger protein 10-like [Lepisosteus oculatus]
Length=770

 Score = 50.4 bits (119),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 33/95 (35%), Positives = 49/95 (52%), Gaps = 7/95 (7%)
 Frame = +1

Query  505  QMVSGNHLLNFHYDpisrpksrap-------pprrqpkrkpYNKDLFLQANYKFVVFSSG  663
            + +S NHLLNF ++P       +          +   K KP+NK+LFLQAN +FVV    
Sbjct  113  KKISLNHLLNFTFEPRGHSGQGSEGHSGWGRRNKWGHKHKPFNKELFLQANCQFVVMDDQ  172

Query  664  NYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
            +Y     DPD ++ W+ +  V+  +     CPICL
Sbjct  173  DYTAHFTDPDTLVNWDCVQQVRIYSHEVPSCPICL  207



>gb|KIH86793.1| hypothetical protein SPBR_08174 [Sporothrix brasiliensis 5110]
Length=836

 Score = 50.4 bits (119),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 22/54 (41%), Positives = 32/54 (59%), Gaps = 1/54 (2%)
 Frame = +1

Query  610  NKDLFLQANYKFVVFSSGNYVPESMDPDKMLEWEDIICVKFSTPFPV-QCPICL  768
            +K  F+ +NY+FVV   GNY  ++ D D  ++W D++ V  ST      CPICL
Sbjct  174  DKARFVHSNYRFVVSPKGNYATQATDADGYIDWSDVLQVLASTESQTSSCPICL  227



>ref|XP_010366598.1| PREDICTED: RING finger protein 10 isoform X1 [Rhinopithecus roxellana]
Length=815

 Score = 50.4 bits (119),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 22/54 (41%), Positives = 32/54 (59%), Gaps = 0/54 (0%)
 Frame = +1

Query  607  YNKDLFLQANYKFVVFSSGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
            +NK+LFLQAN +FVV    +Y     DPD ++ W+ +  V+  +     CPICL
Sbjct  176  FNKELFLQANCQFVVCEDQDYTAHFADPDTLVNWDFVEQVRICSHEVPSCPICL  229



>gb|KFO23766.1| RING finger protein 10 [Fukomys damarensis]
Length=804

 Score = 50.4 bits (119),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 22/54 (41%), Positives = 32/54 (59%), Gaps = 0/54 (0%)
 Frame = +1

Query  607  YNKDLFLQANYKFVVFSSGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
            +NK+LFLQAN +FVV    +Y     DPD ++ W+ +  V+  +     CPICL
Sbjct  170  FNKELFLQANCQFVVSEDQDYTAHFADPDTLVNWDFVEQVRIRSHEVPSCPICL  223



>ref|XP_010366599.1| PREDICTED: RING finger protein 10 isoform X2 [Rhinopithecus roxellana]
Length=810

 Score = 50.4 bits (119),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 22/54 (41%), Positives = 32/54 (59%), Gaps = 0/54 (0%)
 Frame = +1

Query  607  YNKDLFLQANYKFVVFSSGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
            +NK+LFLQAN +FVV    +Y     DPD ++ W+ +  V+  +     CPICL
Sbjct  176  FNKELFLQANCQFVVCEDQDYTAHFADPDTLVNWDFVEQVRICSHEVPSCPICL  229



>ref|XP_005815819.1| PREDICTED: RING finger protein 10-like, partial [Xiphophorus 
maculatus]
Length=276

 Score = 49.7 bits (117),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 33/96 (34%), Positives = 48/96 (50%), Gaps = 8/96 (8%)
 Frame = +1

Query  505  QMVSGNHLLNFHYDpisrpksra--------ppprrqpkrkpYNKDLFLQANYKFVVFSS  660
            + +S NHLLNF ++P                   +   K KP+NK+LFLQAN +FVV   
Sbjct  134  KKISLNHLLNFTFEPRGGNDGVGDGGHSYWGRRNKWGHKNKPFNKELFLQANCQFVVTDD  193

Query  661  GNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
             +Y     DPD ++ W+ +  V+  +     CPICL
Sbjct  194  QDYKAHFTDPDTLVNWDCVQQVRIYSHEMPSCPICL  229



>ref|XP_004843717.1| PREDICTED: RING finger protein 10 [Heterocephalus glaber]
Length=810

 Score = 50.4 bits (119),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 22/54 (41%), Positives = 32/54 (59%), Gaps = 0/54 (0%)
 Frame = +1

Query  607  YNKDLFLQANYKFVVFSSGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
            +NK+LFLQAN +FVV    +Y     DPD ++ W+ +  V+  +     CPICL
Sbjct  177  FNKELFLQANCQFVVSEDQDYTAHFADPDTLVNWDFVEQVRICSHEVPSCPICL  230



>ref|XP_008505347.1| PREDICTED: RING finger protein 10 isoform X1 [Equus przewalskii]
Length=811

 Score = 50.4 bits (119),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 22/54 (41%), Positives = 32/54 (59%), Gaps = 0/54 (0%)
 Frame = +1

Query  607  YNKDLFLQANYKFVVFSSGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
            +NK+LFLQAN +FVV    +Y     DPD ++ W+ +  V+  +     CPICL
Sbjct  176  FNKELFLQANCQFVVSEDQDYTAHFADPDTLVNWDFVEQVRICSHEVPSCPICL  229



>ref|XP_001914782.2| PREDICTED: LOW QUALITY PROTEIN: RING finger protein 10 isoform 
1 [Equus caballus]
Length=812

 Score = 50.4 bits (119),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 22/54 (41%), Positives = 32/54 (59%), Gaps = 0/54 (0%)
 Frame = +1

Query  607  YNKDLFLQANYKFVVFSSGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
            +NK+LFLQAN +FVV    +Y     DPD ++ W+ +  V+  +     CPICL
Sbjct  177  FNKELFLQANCQFVVSEDQDYTAHFADPDTLVNWDFVEQVRICSHEVPSCPICL  230



>ref|XP_005169141.1| PREDICTED: RING finger protein 10 isoform X1 [Danio rerio]
Length=777

 Score = 50.4 bits (119),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 33/96 (34%), Positives = 49/96 (51%), Gaps = 8/96 (8%)
 Frame = +1

Query  505  QMVSGNHLLNFHYDpisrpksra--------ppprrqpkrkpYNKDLFLQANYKFVVFSS  660
            + +S NHLLNF ++P                   +   K KP+NK+LFLQAN +FVV   
Sbjct  131  KKISLNHLLNFTFEPRGGHFGSGGDGHSCWGRRNKWGHKHKPFNKELFLQANCQFVVSDD  190

Query  661  GNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
             +Y     DPD +++W+ +  V+  +     CPICL
Sbjct  191  QDYQAHFTDPDTLVDWDCVQQVRIYSHEVPSCPICL  226



>ref|XP_008838840.1| PREDICTED: RING finger protein 10 [Nannospalax galili]
Length=810

 Score = 50.4 bits (119),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 22/54 (41%), Positives = 32/54 (59%), Gaps = 0/54 (0%)
 Frame = +1

Query  607  YNKDLFLQANYKFVVFSSGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
            +NK+LFLQAN +FVV    +Y     DPD ++ W+ +  V+  +     CPICL
Sbjct  176  FNKELFLQANCQFVVSEDQDYTAHFADPDTLVNWDFVEQVRICSHEVPSCPICL  229



>ref|NP_001116727.1| RING finger protein 10 [Danio rerio]
Length=778

 Score = 50.4 bits (119),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 33/96 (34%), Positives = 49/96 (51%), Gaps = 8/96 (8%)
 Frame = +1

Query  505  QMVSGNHLLNFHYDpisrpksra--------ppprrqpkrkpYNKDLFLQANYKFVVFSS  660
            + +S NHLLNF ++P                   +   K KP+NK+LFLQAN +FVV   
Sbjct  131  KKISLNHLLNFTFEPRGGHFGSGGDGHSCWGRRNKWGHKHKPFNKELFLQANCQFVVSDD  190

Query  661  GNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
             +Y     DPD +++W+ +  V+  +     CPICL
Sbjct  191  QDYQAHFTDPDTLVDWDCVQQVRIYSHEVPSCPICL  226



>ref|XP_010341111.1| PREDICTED: RING finger protein 10 isoform X1 [Saimiri boliviensis 
boliviensis]
Length=726

 Score = 50.4 bits (119),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 22/54 (41%), Positives = 32/54 (59%), Gaps = 0/54 (0%)
 Frame = +1

Query  607  YNKDLFLQANYKFVVFSSGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
            +NK+LFLQAN +FVV    +Y     DPD ++ W+ +  V+  +     CPICL
Sbjct  176  FNKELFLQANCQFVVSEDQDYTAHFADPDTLVNWDFVEQVRICSHEVPSCPICL  229



>ref|XP_008003140.1| PREDICTED: RING finger protein 10 isoform X1 [Chlorocebus sabaeus]
Length=816

 Score = 50.4 bits (119),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 22/54 (41%), Positives = 32/54 (59%), Gaps = 0/54 (0%)
 Frame = +1

Query  607  YNKDLFLQANYKFVVFSSGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
            +NK+LFLQAN +FVV    +Y     DPD ++ W+ +  V+  +     CPICL
Sbjct  176  FNKELFLQANCQFVVCEDQDYTAHFADPDTLVNWDFVEQVRICSHEVPSCPICL  229



>ref|XP_004464709.1| PREDICTED: RING finger protein 10 isoform 1 [Dasypus novemcinctus]
Length=825

 Score = 50.4 bits (119),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 22/54 (41%), Positives = 32/54 (59%), Gaps = 0/54 (0%)
 Frame = +1

Query  607  YNKDLFLQANYKFVVFSSGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
            +NK+LFLQAN +FVV    +Y     DPD ++ W+ +  V+  +     CPICL
Sbjct  176  FNKELFLQANCQFVVSEGQDYTAHFADPDTLVNWDFVEQVRICSHEVPSCPICL  229



>ref|XP_008003143.1| PREDICTED: RING finger protein 10 isoform X4 [Chlorocebus sabaeus]
Length=769

 Score = 50.4 bits (119),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 22/54 (41%), Positives = 32/54 (59%), Gaps = 0/54 (0%)
 Frame = +1

Query  607  YNKDLFLQANYKFVVFSSGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
            +NK+LFLQAN +FVV    +Y     DPD ++ W+ +  V+  +     CPICL
Sbjct  176  FNKELFLQANCQFVVCEDQDYTAHFADPDTLVNWDFVEQVRICSHEVPSCPICL  229



>ref|XP_006865501.1| PREDICTED: RING finger protein 10 isoform X1 [Chrysochloris asiatica]
 ref|XP_006865502.1| PREDICTED: RING finger protein 10 isoform X2 [Chrysochloris asiatica]
Length=809

 Score = 50.4 bits (119),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 22/54 (41%), Positives = 33/54 (61%), Gaps = 0/54 (0%)
 Frame = +1

Query  607  YNKDLFLQANYKFVVFSSGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
            +NK+LFLQAN +FVV  + +Y     DPD ++ W+ +  V+  +     CPICL
Sbjct  179  FNKELFLQANCQFVVSENQDYTAHFADPDTLVNWDFVEQVRICSHEVPSCPICL  232



>ref|XP_008003141.1| PREDICTED: RING finger protein 10 isoform X2 [Chlorocebus sabaeus]
Length=811

 Score = 50.4 bits (119),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 22/54 (41%), Positives = 32/54 (59%), Gaps = 0/54 (0%)
 Frame = +1

Query  607  YNKDLFLQANYKFVVFSSGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
            +NK+LFLQAN +FVV    +Y     DPD ++ W+ +  V+  +     CPICL
Sbjct  176  FNKELFLQANCQFVVCEDQDYTAHFADPDTLVNWDFVEQVRICSHEVPSCPICL  229



>gb|EHH66776.1| hypothetical protein EGM_03829 [Macaca fascicularis]
Length=811

 Score = 50.4 bits (119),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 22/54 (41%), Positives = 32/54 (59%), Gaps = 0/54 (0%)
 Frame = +1

Query  607  YNKDLFLQANYKFVVFSSGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
            +NK+LFLQAN +FVV    +Y     DPD ++ W+ +  V+  +     CPICL
Sbjct  176  FNKELFLQANCQFVVCEDQDYTAHFADPDTLVNWDFVEQVRICSHEVPSCPICL  229



>ref|NP_001247749.1| RING finger protein 10 [Macaca mulatta]
 ref|XP_005572462.1| PREDICTED: RING finger protein 10 isoform X1 [Macaca fascicularis]
Length=811

 Score = 50.4 bits (119),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 22/54 (41%), Positives = 32/54 (59%), Gaps = 0/54 (0%)
 Frame = +1

Query  607  YNKDLFLQANYKFVVFSSGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
            +NK+LFLQAN +FVV    +Y     DPD ++ W+ +  V+  +     CPICL
Sbjct  176  FNKELFLQANCQFVVCEDQDYTAHFADPDTLVNWDFVEQVRICSHEVPSCPICL  229



>ref|XP_009180106.1| PREDICTED: RING finger protein 10 isoform X1 [Papio anubis]
Length=816

 Score = 50.4 bits (119),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 22/54 (41%), Positives = 32/54 (59%), Gaps = 0/54 (0%)
 Frame = +1

Query  607  YNKDLFLQANYKFVVFSSGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
            +NK+LFLQAN +FVV    +Y     DPD ++ W+ +  V+  +     CPICL
Sbjct  176  FNKELFLQANCQFVVCEDQDYTAHFADPDTLVNWDFVEQVRICSHEVPSCPICL  229



>ref|XP_010597230.1| PREDICTED: RING finger protein 10 [Loxodonta africana]
Length=834

 Score = 50.4 bits (119),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 22/54 (41%), Positives = 33/54 (61%), Gaps = 0/54 (0%)
 Frame = +1

Query  607  YNKDLFLQANYKFVVFSSGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
            +NK+LFLQAN +FVV  + +Y     DPD ++ W+ +  V+  +     CPICL
Sbjct  179  FNKELFLQANCQFVVSENQDYTAHFADPDTLVNWDFVEQVRICSHEVPSCPICL  232



>ref|XP_003907310.1| PREDICTED: RING finger protein 10 isoform X2 [Papio anubis]
Length=811

 Score = 50.4 bits (119),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 22/54 (41%), Positives = 32/54 (59%), Gaps = 0/54 (0%)
 Frame = +1

Query  607  YNKDLFLQANYKFVVFSSGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
            +NK+LFLQAN +FVV    +Y     DPD ++ W+ +  V+  +     CPICL
Sbjct  176  FNKELFLQANCQFVVCEDQDYTAHFADPDTLVNWDFVEQVRICSHEVPSCPICL  229



>ref|XP_001956081.1| GF25027 [Drosophila ananassae]
 gb|EDV38887.1| GF25027 [Drosophila ananassae]
Length=723

 Score = 50.4 bits (119),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 30/87 (34%), Positives = 46/87 (53%), Gaps = 6/87 (7%)
 Frame = +1

Query  520  NHLLNFH---YDpisrpksrappprrqpkrkpYNKDLFLQANYKFVV-FSSGNYVPESMD  687
            NHLLNFH    +       +        +++ YNK+ FLQAN++FV+   +  +V  S  
Sbjct  145  NHLLNFHCVPRELERGHHHQHQHHGVGIRKQRYNKEQFLQANFQFVIRLGAKAHVDGS--  202

Query  688  PDKMLEWEDIICVKFSTPFPVQCPICL  768
            PD +++W  I  +   T   +QCPICL
Sbjct  203  PDALIDWSFIEQINIQTTEELQCPICL  229



>ref|XP_007607213.1| PREDICTED: RING finger protein 10 isoform X2 [Cricetulus griseus]
Length=832

 Score = 50.4 bits (119),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 22/54 (41%), Positives = 32/54 (59%), Gaps = 0/54 (0%)
 Frame = +1

Query  607  YNKDLFLQANYKFVVFSSGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
            +NK+LFLQAN +FVV    +Y     DPD ++ W+ +  V+  +     CPICL
Sbjct  198  FNKELFLQANCQFVVSEDQDYAAHFADPDTLVNWDFVEQVRICSHEVPSCPICL  251



>emb|CCG83238.1| RING finger domain protein [Taphrina deformans PYCC 5710]
Length=621

 Score = 50.4 bits (119),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 39/109 (36%), Positives = 51/109 (47%), Gaps = 12/109 (11%)
 Frame = +1

Query  478  MPRPTGR--RTQMVSGNHLLNFHYDpisrpksrappprrqpkrkpY---------NKDLF  624
            +PR T R  R    + NHLLNF Y   S P    P  R       Y         +K  F
Sbjct  52   LPRNTHRHHRKPEANLNHLLNFSYARQSAPAHAMPARRAAKSNPTYGRGSGYHPLDKAHF  111

Query  625  LQANYKFVVFSSGNYVPESMDPDKMLEWEDIICVKFSTPFPVQ-CPICL  768
            + ANY+FVV  SG+Y P  ++ D  + WE+++ V  S       CPICL
Sbjct  112  VNANYRFVVHPSGDYRPNLIESDIPIPWENVLQVLASVQSQCNACPICL  160



>gb|EHH21249.1| hypothetical protein EGK_04266 [Macaca mulatta]
Length=811

 Score = 50.4 bits (119),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 22/54 (41%), Positives = 32/54 (59%), Gaps = 0/54 (0%)
 Frame = +1

Query  607  YNKDLFLQANYKFVVFSSGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
            +NK+LFLQAN +FVV    +Y     DPD ++ W+ +  V+  +     CPICL
Sbjct  176  FNKELFLQANCQFVVCEDQDYTAHFADPDTLVNWDFVEQVRICSHEVPSCPICL  229



>gb|EHB01529.1| RING finger protein 10, partial [Heterocephalus glaber]
Length=780

 Score = 50.4 bits (119),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 22/54 (41%), Positives = 32/54 (59%), Gaps = 0/54 (0%)
 Frame = +1

Query  607  YNKDLFLQANYKFVVFSSGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
            +NK+LFLQAN +FVV    +Y     DPD ++ W+ +  V+  +     CPICL
Sbjct  147  FNKELFLQANCQFVVSEDQDYTAHFADPDTLVNWDFVEQVRICSHEVPSCPICL  200



>ref|XP_006151586.1| PREDICTED: RING finger protein 10 [Tupaia chinensis]
Length=604

 Score = 50.4 bits (119),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 22/54 (41%), Positives = 32/54 (59%), Gaps = 0/54 (0%)
 Frame = +1

Query  607  YNKDLFLQANYKFVVFSSGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
            +NK+LFLQAN +FVV    +Y     DPD ++ W+ +  V+  +     CPICL
Sbjct  82   FNKELFLQANCQFVVSEDQDYTAHFADPDTLVNWDFVEQVRICSHEVPSCPICL  135



>ref|XP_004429964.1| PREDICTED: RING finger protein 10 [Ceratotherium simum simum]
Length=811

 Score = 50.4 bits (119),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 22/54 (41%), Positives = 32/54 (59%), Gaps = 0/54 (0%)
 Frame = +1

Query  607  YNKDLFLQANYKFVVFSSGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
            +NK+LFLQAN +FVV    +Y     DPD ++ W+ +  V+  +     CPICL
Sbjct  176  FNKELFLQANCQFVVSEDQDYTAHFADPDTLVNWDFVEQVRICSHEVPSCPICL  229



>gb|KDN49086.1| hypothetical protein RSAG8_02439, partial [Rhizoctonia solani 
AG-8 WAC10335]
Length=653

 Score = 50.4 bits (119),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 40/107 (37%), Positives = 51/107 (48%), Gaps = 12/107 (11%)
 Frame = +1

Query  484  RPTGRRTQMVSGNHLLNFHYDpisrpksrappprrqp-krkpYNKDLFLQANYKFVVFSS  660
            RP     +  S NHLLNF   P S+P  +  P R +      YN + FL A Y+FV+  +
Sbjct  4    RPQAANKRTESLNHLLNFTLPPRSQPLLQNVPRRSRKPNNVYYNSEKFLNAQYRFVMNPT  63

Query  661  GNYVPESMDPDKMLEWEDI--ICVKFSTPFP---------VQCPICL  768
            G+Y     DPD   +WEDI  I V  S+ F            CPICL
Sbjct  64   GDYTVHFADPDIFFQWEDILQILVPRSSAFASAGTAAEGVTTCPICL  110



>ref|XP_010366600.1| PREDICTED: RING finger protein 10 isoform X3 [Rhinopithecus roxellana]
Length=764

 Score = 50.4 bits (119),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 22/54 (41%), Positives = 32/54 (59%), Gaps = 0/54 (0%)
 Frame = +1

Query  607  YNKDLFLQANYKFVVFSSGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
            +NK+LFLQAN +FVV    +Y     DPD ++ W+ +  V+  +     CPICL
Sbjct  125  FNKELFLQANCQFVVCEDQDYTAHFADPDTLVNWDFVEQVRICSHEVPSCPICL  178



>ref|XP_004636314.1| PREDICTED: RING finger protein 10 isoform X2 [Octodon degus]
Length=810

 Score = 50.4 bits (119),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 22/54 (41%), Positives = 32/54 (59%), Gaps = 0/54 (0%)
 Frame = +1

Query  607  YNKDLFLQANYKFVVFSSGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
            +NK+LFLQAN +FVV    +Y     DPD ++ W+ +  V+  +     CPICL
Sbjct  176  FNKELFLQANCQFVVSEDQDYTAHFADPDTLVNWDFVEQVRICSHEVPSCPICL  229



>gb|EGW10590.1| RING finger protein 10 [Cricetulus griseus]
Length=759

 Score = 50.4 bits (119),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 22/54 (41%), Positives = 32/54 (59%), Gaps = 0/54 (0%)
 Frame = +1

Query  607  YNKDLFLQANYKFVVFSSGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
            +NK+LFLQAN +FVV    +Y     DPD ++ W+ +  V+  +     CPICL
Sbjct  125  FNKELFLQANCQFVVSEDQDYAAHFADPDTLVNWDFVEQVRICSHEVPSCPICL  178



>dbj|BAG54301.1| unnamed protein product [Homo sapiens]
Length=836

 Score = 50.4 bits (119),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 22/54 (41%), Positives = 32/54 (59%), Gaps = 0/54 (0%)
 Frame = +1

Query  607  YNKDLFLQANYKFVVFSSGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
            +NK+LFLQAN +FVV    +Y     DPD ++ W+ +  V+  +     CPICL
Sbjct  201  FNKELFLQANCQFVVSEDQDYTAHFADPDTLVNWDFVEQVRICSHEVPSCPICL  254



>ref|XP_008003142.1| PREDICTED: RING finger protein 10 isoform X3 [Chlorocebus sabaeus]
Length=774

 Score = 50.4 bits (119),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 22/54 (41%), Positives = 32/54 (59%), Gaps = 0/54 (0%)
 Frame = +1

Query  607  YNKDLFLQANYKFVVFSSGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
            +NK+LFLQAN +FVV    +Y     DPD ++ W+ +  V+  +     CPICL
Sbjct  176  FNKELFLQANCQFVVCEDQDYTAHFADPDTLVNWDFVEQVRICSHEVPSCPICL  229



>ref|XP_003478507.1| PREDICTED: LOW QUALITY PROTEIN: RING finger protein 10 [Cavia 
porcellus]
Length=810

 Score = 50.4 bits (119),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 22/54 (41%), Positives = 32/54 (59%), Gaps = 0/54 (0%)
 Frame = +1

Query  607  YNKDLFLQANYKFVVFSSGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
            +NK+LFLQAN +FVV    +Y     DPD ++ W+ +  V+  +     CPICL
Sbjct  176  FNKELFLQANCQFVVSEDQDYTAHFADPDTLVNWDFVEQVRICSHEVPSCPICL  229



>ref|XP_004664185.1| PREDICTED: RING finger protein 10 isoform X2 [Jaculus jaculus]
Length=811

 Score = 50.4 bits (119),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 22/54 (41%), Positives = 32/54 (59%), Gaps = 0/54 (0%)
 Frame = +1

Query  607  YNKDLFLQANYKFVVFSSGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
            +NK+LFLQAN +FVV    +Y     DPD ++ W+ +  V+  +     CPICL
Sbjct  178  FNKELFLQANCQFVVSEDQDYTAHFADPDTLVNWDFVEQVRICSHEVPSCPICL  231



>ref|XP_004664184.1| PREDICTED: RING finger protein 10 isoform X1 [Jaculus jaculus]
Length=812

 Score = 50.4 bits (119),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 22/54 (41%), Positives = 32/54 (59%), Gaps = 0/54 (0%)
 Frame = +1

Query  607  YNKDLFLQANYKFVVFSSGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
            +NK+LFLQAN +FVV    +Y     DPD ++ W+ +  V+  +     CPICL
Sbjct  178  FNKELFLQANCQFVVSEDQDYTAHFADPDTLVNWDFVEQVRICSHEVPSCPICL  231



>ref|XP_010341112.1| PREDICTED: RING finger protein 10 isoform X2 [Saimiri boliviensis 
boliviensis]
Length=675

 Score = 50.4 bits (119),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 22/54 (41%), Positives = 32/54 (59%), Gaps = 0/54 (0%)
 Frame = +1

Query  607  YNKDLFLQANYKFVVFSSGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
            +NK+LFLQAN +FVV    +Y     DPD ++ W+ +  V+  +     CPICL
Sbjct  125  FNKELFLQANCQFVVSEDQDYTAHFADPDTLVNWDFVEQVRICSHEVPSCPICL  178



>ref|XP_006719780.1| PREDICTED: RING finger protein 10 isoform X8 [Homo sapiens]
Length=816

 Score = 50.4 bits (119),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 22/54 (41%), Positives = 32/54 (59%), Gaps = 0/54 (0%)
 Frame = +1

Query  607  YNKDLFLQANYKFVVFSSGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
            +NK+LFLQAN +FVV    +Y     DPD ++ W+ +  V+  +     CPICL
Sbjct  176  FNKELFLQANCQFVVSEDQDYTAHFADPDTLVNWDFVEQVRICSHEVPSCPICL  229



>ref|XP_010602478.1| PREDICTED: RING finger protein 10 [Fukomys damarensis]
Length=859

 Score = 50.4 bits (119),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 22/54 (41%), Positives = 32/54 (59%), Gaps = 0/54 (0%)
 Frame = +1

Query  607  YNKDLFLQANYKFVVFSSGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
            +NK+LFLQAN +FVV    +Y     DPD ++ W+ +  V+  +     CPICL
Sbjct  225  FNKELFLQANCQFVVSEDQDYTAHFADPDTLVNWDFVEQVRIRSHEVPSCPICL  278



>dbj|BAE27391.1| unnamed protein product [Mus musculus]
Length=804

 Score = 50.4 bits (119),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 22/54 (41%), Positives = 32/54 (59%), Gaps = 0/54 (0%)
 Frame = +1

Query  607  YNKDLFLQANYKFVVFSSGNYVPESMDPDKMLEWEDIICVKFSTPFPVQCPICL  768
            +NK+LFLQAN +FVV    +Y     DPD ++ W+ +  V+  +     CPICL
Sbjct  176  FNKELFLQANCQFVVSEDQDYAAHFADPDTLVNWDFVEQVRICSHEVPSCPICL  229



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1467725733100