BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF045D22

Length=740
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_008782506.1|  PREDICTED: peroxisomal primary amine oxidase       152   6e-39   Phoenix dactylifera
gb|KDP31040.1|  hypothetical protein JCGZ_11416                         151   6e-38   Jatropha curcas
ref|XP_004239124.1|  PREDICTED: copper amine oxidase 1                  150   1e-37   Solanum lycopersicum
ref|XP_002273532.2|  PREDICTED: copper amine oxidase 1 isoform X1       150   2e-37   Vitis vinifera
ref|XP_010907652.1|  PREDICTED: copper amine oxidase 1                  146   3e-36   Elaeis guineensis
ref|XP_006357609.1|  PREDICTED: copper amine oxidase 1-like             146   4e-36   Solanum tuberosum [potatoes]
ref|XP_009600855.1|  PREDICTED: copper amine oxidase 1-like             145   7e-36   Nicotiana tomentosiformis
ref|XP_009379966.1|  PREDICTED: copper amine oxidase 1-like             145   9e-36   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB15626.1|  hypothetical protein B456_002G186900                    145   9e-36   Gossypium raimondii
ref|XP_009802912.1|  PREDICTED: peroxisomal primary amine oxidase...    145   1e-35   Nicotiana sylvestris
gb|KJB50260.1|  hypothetical protein B456_008G160800                    141   2e-35   Gossypium raimondii
ref|XP_008464519.1|  PREDICTED: copper amine oxidase 1 isoform X1       144   2e-35   Cucumis melo [Oriental melon]
ref|XP_010248627.1|  PREDICTED: copper amine oxidase 1-like             144   2e-35   Nelumbo nucifera [Indian lotus]
gb|KJB50259.1|  hypothetical protein B456_008G160800                    142   2e-35   Gossypium raimondii
ref|XP_010251089.1|  PREDICTED: copper amine oxidase 1-like isofo...    143   2e-35   Nelumbo nucifera [Indian lotus]
ref|XP_010251088.1|  PREDICTED: copper amine oxidase 1-like isofo...    143   4e-35   Nelumbo nucifera [Indian lotus]
ref|XP_004138093.1|  PREDICTED: copper methylamine oxidase-like         143   5e-35   
ref|XP_004155025.1|  PREDICTED: copper methylamine oxidase-like         143   5e-35   
gb|KHG02564.1|  Primary amine oxidase                                   142   6e-35   Gossypium arboreum [tree cotton]
gb|KJB50256.1|  hypothetical protein B456_008G160800                    142   9e-35   Gossypium raimondii
gb|KJB50255.1|  hypothetical protein B456_008G160800                    142   1e-34   Gossypium raimondii
gb|KJB50258.1|  hypothetical protein B456_008G160800                    142   1e-34   Gossypium raimondii
ref|XP_006845257.1|  hypothetical protein AMTR_s00005p00262140          142   1e-34   Amborella trichopoda
gb|KJB50257.1|  hypothetical protein B456_008G160800                    142   1e-34   Gossypium raimondii
gb|KJB50254.1|  hypothetical protein B456_008G160800                    142   1e-34   Gossypium raimondii
ref|XP_010100391.1|  Copper methylamine oxidase                         141   2e-34   
ref|XP_008389732.1|  PREDICTED: copper amine oxidase 1-like isofo...    140   3e-34   Malus domestica [apple tree]
ref|XP_008389733.1|  PREDICTED: copper amine oxidase 1-like isofo...    140   3e-34   
gb|KHG02854.1|  Copper methylamine oxidase                              140   4e-34   Gossypium arboreum [tree cotton]
ref|XP_007211293.1|  hypothetical protein PRUPE_ppa002116mg             139   5e-34   
gb|AIS23644.1|  amine oxidase 1                                         140   5e-34   Malus domestica [apple tree]
ref|XP_007225246.1|  hypothetical protein PRUPE_ppa001698mg             140   6e-34   Prunus persica
ref|XP_004301007.1|  PREDICTED: copper amine oxidase 1-like             139   7e-34   Fragaria vesca subsp. vesca
ref|XP_008239321.1|  PREDICTED: copper amine oxidase 1-like             139   8e-34   Prunus mume [ume]
ref|XP_009345773.1|  PREDICTED: copper amine oxidase 1-like             139   1e-33   Pyrus x bretschneideri [bai li]
ref|XP_009403621.1|  PREDICTED: copper amine oxidase 1-like             139   1e-33   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008221920.1|  PREDICTED: copper amine oxidase 1-like             139   2e-33   Prunus mume [ume]
ref|XP_007044780.1|  Copper amine oxidase family protein isoform 4      137   2e-33   
gb|AGZ20104.1|  copper methylamine oxidase-like protein                 138   2e-33   Camellia sinensis [black tea]
ref|XP_009362949.1|  PREDICTED: copper amine oxidase 1-like             138   3e-33   Pyrus x bretschneideri [bai li]
ref|XP_008351782.1|  PREDICTED: peroxisomal primary amine oxidase...    136   3e-33   
ref|XP_006584632.1|  PREDICTED: peroxisomal copper-containing ami...    136   4e-33   
ref|XP_007044779.1|  Copper amine oxidase family protein isoform 3      137   4e-33   
gb|AIS23648.1|  amine oxidase 5                                         137   5e-33   Malus domestica [apple tree]
ref|XP_008380537.1|  PREDICTED: copper amine oxidase 1-like             137   5e-33   
ref|XP_007036330.1|  Copper amine oxidase family protein isoform 2      137   5e-33   
ref|XP_011047814.1|  PREDICTED: copper amine oxidase 1-like isofo...    137   6e-33   Populus euphratica
ref|XP_007044778.1|  Copper amine oxidase family protein isoform 2      137   6e-33   
ref|XP_002322194.2|  hypothetical protein POPTR_0015s09450g             137   6e-33   
ref|XP_003551224.1|  PREDICTED: peroxisomal primary amine oxidase...    137   6e-33   Glycine max [soybeans]
ref|XP_007044777.1|  Copper amine oxidase family protein isoform 1      137   7e-33   
ref|XP_007036329.1|  Copper amine oxidase family protein isoform 1      137   8e-33   
ref|XP_002527922.1|  copper amine oxidase, putative                     137   8e-33   Ricinus communis
emb|CDP12746.1|  unnamed protein product                                136   9e-33   Coffea canephora [robusta coffee]
ref|XP_007158407.1|  hypothetical protein PHAVU_002G150400g             136   1e-32   Phaseolus vulgaris [French bean]
ref|XP_011047815.1|  PREDICTED: copper amine oxidase 1-like isofo...    136   1e-32   Populus euphratica
gb|KHN00390.1|  Copper methylamine oxidase                              136   1e-32   Glycine soja [wild soybean]
ref|XP_003519633.1|  PREDICTED: copper amine oxidase 1-like             136   1e-32   Glycine max [soybeans]
ref|XP_004309984.2|  PREDICTED: copper amine oxidase 1-like             136   1e-32   Fragaria vesca subsp. vesca
ref|XP_006584631.1|  PREDICTED: peroxisomal copper-containing ami...    136   1e-32   
gb|KDP26650.1|  hypothetical protein JCGZ_17808                         135   1e-32   Jatropha curcas
gb|KHN13432.1|  Copper methylamine oxidase                              135   1e-32   Glycine soja [wild soybean]
gb|AIS23647.1|  amine oxidase 4                                         136   2e-32   Malus domestica [apple tree]
ref|XP_007158406.1|  hypothetical protein PHAVU_002G150400g             135   2e-32   Phaseolus vulgaris [French bean]
ref|XP_002318664.1|  hypothetical protein POPTR_0012s08630g             135   2e-32   
ref|XP_011046219.1|  PREDICTED: copper amine oxidase 1-like             135   2e-32   Populus euphratica
ref|XP_006411506.1|  hypothetical protein EUTSA_v100163160mg            131   5e-32   
ref|XP_010646479.1|  PREDICTED: copper amine oxidase 1 isoform X2       134   6e-32   Vitis vinifera
emb|CAN62304.1|  hypothetical protein VITISV_023689                     134   6e-32   Vitis vinifera
ref|XP_006476867.1|  PREDICTED: copper amine oxidase 1-like isofo...    134   7e-32   Citrus sinensis [apfelsine]
ref|XP_009404245.1|  PREDICTED: copper amine oxidase 1-like             134   8e-32   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDO69507.1|  hypothetical protein CISIN_1g004084mg                   133   9e-32   Citrus sinensis [apfelsine]
ref|XP_006439904.1|  hypothetical protein CICLE_v10018950mg             133   1e-31   Citrus clementina [clementine]
ref|XP_008367500.1|  PREDICTED: copper amine oxidase 1-like             133   1e-31   
gb|KDO69506.1|  hypothetical protein CISIN_1g004084mg                   133   1e-31   Citrus sinensis [apfelsine]
ref|XP_002511334.1|  copper amine oxidase, putative                     133   1e-31   Ricinus communis
ref|XP_008464520.1|  PREDICTED: copper amine oxidase 1 isoform X2       132   3e-31   Cucumis melo [Oriental melon]
gb|KEH20162.1|  copper amine oxidase, enzyme domain protein             130   3e-31   Medicago truncatula
ref|XP_010532283.1|  PREDICTED: copper amine oxidase 1-like             132   5e-31   Tarenaya hassleriana [spider flower]
ref|XP_011045264.1|  PREDICTED: copper amine oxidase 1-like isofo...    131   6e-31   Populus euphratica
gb|KJB19703.1|  hypothetical protein B456_003G116000                    130   7e-31   Gossypium raimondii
gb|KEH20159.1|  copper amine oxidase, enzyme domain protein             130   9e-31   Medicago truncatula
ref|XP_004289862.2|  PREDICTED: copper amine oxidase 1-like             130   1e-30   Fragaria vesca subsp. vesca
ref|XP_010102489.1|  Putative primary amine oxidase 2                   130   1e-30   
gb|EPS66989.1|  hypothetical protein M569_07787                         129   1e-30   Genlisea aurea
ref|NP_001237782.1|  peroxisomal copper-containing amine oxidase        130   1e-30   
gb|KDO82259.1|  hypothetical protein CISIN_1g004080mg                   130   1e-30   Citrus sinensis [apfelsine]
gb|KJB19704.1|  hypothetical protein B456_003G116000                    130   1e-30   Gossypium raimondii
emb|CAN76391.1|  hypothetical protein VITISV_023592                     130   1e-30   Vitis vinifera
ref|XP_002277961.1|  PREDICTED: copper amine oxidase 1-like             130   1e-30   Vitis vinifera
emb|CBI14968.3|  unnamed protein product                                131   1e-30   Vitis vinifera
ref|XP_003601195.1|  Primary amine oxidase                              130   1e-30   Medicago truncatula
gb|KJB19705.1|  hypothetical protein B456_003G116000                    130   2e-30   Gossypium raimondii
gb|KJB19706.1|  hypothetical protein B456_003G116000                    130   2e-30   Gossypium raimondii
ref|XP_006438285.1|  hypothetical protein CICLE_v10030749mg             130   2e-30   Citrus clementina [clementine]
gb|KDO82257.1|  hypothetical protein CISIN_1g004080mg                   130   2e-30   Citrus sinensis [apfelsine]
ref|XP_006483934.1|  PREDICTED: copper amine oxidase 1-like             130   2e-30   Citrus sinensis [apfelsine]
ref|XP_006438286.1|  hypothetical protein CICLE_v10030749mg             129   2e-30   
ref|XP_007153778.1|  hypothetical protein PHAVU_003G064200g             129   3e-30   Phaseolus vulgaris [French bean]
gb|AAD23730.1|  putative copper amine oxidase                           129   3e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006476868.1|  PREDICTED: copper amine oxidase 1-like isofo...    129   3e-30   Citrus sinensis [apfelsine]
gb|KCW86671.1|  hypothetical protein EUGRSUZ_B032972                    125   4e-30   Eucalyptus grandis [rose gum]
ref|XP_004509661.1|  PREDICTED: copper methylamine oxidase-like i...    129   4e-30   Cicer arietinum [garbanzo]
ref|NP_181777.2|  copper amine oxidase family protein                   129   5e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007138024.1|  hypothetical protein PHAVU_009G174800g             128   6e-30   Phaseolus vulgaris [French bean]
gb|KCW83296.1|  hypothetical protein EUGRSUZ_B00228                     129   6e-30   Eucalyptus grandis [rose gum]
ref|XP_010044582.1|  PREDICTED: peroxisomal primary amine oxidase...    128   6e-30   Eucalyptus grandis [rose gum]
ref|XP_003527002.1|  PREDICTED: copper amine oxidase 1-like isofo...    128   6e-30   Glycine max [soybeans]
gb|KHG07734.1|  Primary amine oxidase                                   128   7e-30   Gossypium arboreum [tree cotton]
ref|XP_011071936.1|  PREDICTED: copper amine oxidase 1-like             128   7e-30   Sesamum indicum [beniseed]
emb|CDY14839.1|  BnaC04g48360D                                          128   7e-30   Brassica napus [oilseed rape]
ref|XP_010027284.1|  PREDICTED: copper amine oxidase 1                  128   8e-30   Eucalyptus grandis [rose gum]
ref|XP_010506075.1|  PREDICTED: copper amine oxidase 1-like isofo...    128   8e-30   Camelina sativa [gold-of-pleasure]
gb|EYU22171.1|  hypothetical protein MIMGU_mgv1a001639mg                128   9e-30   Erythranthe guttata [common monkey flower]
gb|KDO82258.1|  hypothetical protein CISIN_1g004080mg                   127   9e-30   Citrus sinensis [apfelsine]
ref|XP_006438284.1|  hypothetical protein CICLE_v10030749mg             127   9e-30   
ref|XP_006293724.1|  hypothetical protein CARUB_v10022684mg             128   9e-30   Capsella rubella
ref|XP_004489782.1|  PREDICTED: copper methylamine oxidase-like         127   1e-29   Cicer arietinum [garbanzo]
ref|XP_002314600.1|  copper amine oxidase family protein                127   1e-29   Populus trichocarpa [western balsam poplar]
ref|XP_011045265.1|  PREDICTED: copper amine oxidase 1-like isofo...    127   1e-29   Populus euphratica
emb|CDY47975.1|  BnaA04g24530D                                          127   1e-29   Brassica napus [oilseed rape]
ref|XP_009142070.1|  PREDICTED: LOW QUALITY PROTEIN: copper amine...    127   1e-29   Brassica rapa
ref|XP_002881856.1|  hypothetical protein ARALYDRAFT_903619             127   1e-29   Arabidopsis lyrata subsp. lyrata
ref|XP_010517774.1|  PREDICTED: copper amine oxidase 1-like             127   2e-29   Camelina sativa [gold-of-pleasure]
gb|ACW82416.1|  putative copper amine oxidase                           125   2e-29   Olea europaea
ref|XP_006581907.1|  PREDICTED: copper amine oxidase 1-like isofo...    126   2e-29   Glycine max [soybeans]
gb|KFK37100.1|  hypothetical protein AALP_AA4G213000                    126   3e-29   Arabis alpina [alpine rockcress]
gb|KEH27747.1|  copper amine oxidase, enzyme domain protein             126   3e-29   Medicago truncatula
ref|XP_010508564.1|  PREDICTED: copper amine oxidase 1-like             126   3e-29   Camelina sativa [gold-of-pleasure]
gb|EMS61925.1|  Copper methylamine oxidase                              126   3e-29   Triticum urartu
gb|KEH20160.1|  copper amine oxidase, enzyme domain protein             124   3e-29   Medicago truncatula
emb|CDY22564.1|  BnaC03g23740D                                          127   3e-29   Brassica napus [oilseed rape]
ref|XP_003613133.1|  Copper amine oxidase                               126   4e-29   
gb|AES96091.2|  copper amine oxidase, enzyme domain protein             125   4e-29   Medicago truncatula
gb|KEH35029.1|  copper amine oxidase, enzyme domain protein             125   5e-29   Medicago truncatula
gb|KEH20164.1|  copper amine oxidase, enzyme domain protein             125   5e-29   Medicago truncatula
gb|KEH20161.1|  copper amine oxidase, enzyme domain protein             125   6e-29   Medicago truncatula
ref|XP_011101289.1|  PREDICTED: copper amine oxidase 1-like             125   7e-29   Sesamum indicum [beniseed]
gb|KEH20158.1|  copper amine oxidase, enzyme domain protein             124   1e-28   Medicago truncatula
gb|KEH20163.1|  copper amine oxidase, enzyme domain protein             124   1e-28   Medicago truncatula
ref|XP_010678857.1|  PREDICTED: copper amine oxidase 1-like isofo...    124   1e-28   Beta vulgaris subsp. vulgaris [field beet]
gb|KEH20157.1|  copper amine oxidase, enzyme domain protein             124   1e-28   Medicago truncatula
ref|XP_010533488.1|  PREDICTED: copper amine oxidase 1-like             124   1e-28   Tarenaya hassleriana [spider flower]
ref|XP_004501882.1|  PREDICTED: copper methylamine oxidase-like         124   1e-28   Cicer arietinum [garbanzo]
ref|XP_010678856.1|  PREDICTED: copper amine oxidase 1-like isofo...    124   1e-28   Beta vulgaris subsp. vulgaris [field beet]
emb|CDY35376.1|  BnaA03g19840D                                          125   2e-28   Brassica napus [oilseed rape]
ref|XP_009133538.1|  PREDICTED: copper amine oxidase 1-like             124   2e-28   Brassica rapa
ref|XP_006347431.1|  PREDICTED: copper amine oxidase 1-like             123   3e-28   Solanum tuberosum [potatoes]
ref|XP_009606421.1|  PREDICTED: copper amine oxidase 1-like             123   4e-28   Nicotiana tomentosiformis
ref|XP_009778427.1|  PREDICTED: copper amine oxidase 1-like             123   4e-28   Nicotiana sylvestris
gb|ABR16250.1|  unknown                                                 123   5e-28   Picea sitchensis
tpg|DAA37329.1|  TPA: hypothetical protein ZEAMMB73_085776              119   9e-28   
ref|XP_007155469.1|  hypothetical protein PHAVU_003G204000g             123   9e-28   Phaseolus vulgaris [French bean]
gb|EMS63127.1|  Primary amine oxidase                                   122   1e-27   Triticum urartu
ref|XP_004244763.1|  PREDICTED: copper amine oxidase 1-like             122   1e-27   Solanum lycopersicum
ref|XP_002448036.1|  hypothetical protein SORBIDRAFT_06g020020          122   1e-27   Sorghum bicolor [broomcorn]
ref|XP_004975956.1|  PREDICTED: copper amine oxidase 1-like             121   1e-27   Setaria italica
ref|XP_003581353.1|  PREDICTED: copper amine oxidase 1-like             121   1e-27   Brachypodium distachyon [annual false brome]
ref|XP_006600619.1|  PREDICTED: copper amine oxidase 1-like isofo...    120   2e-27   Glycine max [soybeans]
ref|XP_006600618.1|  PREDICTED: copper amine oxidase 1-like isofo...    120   3e-27   Glycine max [soybeans]
gb|EAY94528.1|  hypothetical protein OsI_16305                          120   4e-27   Oryza sativa Indica Group [Indian rice]
ref|XP_008668433.1|  PREDICTED: uncharacterized protein LOC100383...    120   4e-27   
gb|EAZ31082.1|  hypothetical protein OsJ_15179                          120   4e-27   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006600617.1|  PREDICTED: copper amine oxidase 1-like isofo...    120   4e-27   Glycine max [soybeans]
ref|XP_010322539.1|  PREDICTED: copper amine oxidase 1-like             120   4e-27   Solanum lycopersicum
ref|XP_003550715.1|  PREDICTED: copper amine oxidase 1-like isofo...    120   6e-27   Glycine max [soybeans]
emb|CAH67316.1|  OSIGBa0106G07.12                                       119   1e-26   Oryza sativa [red rice]
emb|CAE05498.2|  OSJNBa0022H21.18                                       119   1e-26   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006351050.1|  PREDICTED: copper amine oxidase 1-like             119   1e-26   
gb|EAZ29581.1|  hypothetical protein OsJ_13655                          117   3e-26   Oryza sativa Japonica Group [Japonica rice]
emb|CAE02362.2|  OSJNBb0016B03.15                                       117   4e-26   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006652410.1|  PREDICTED: copper amine oxidase 1-like             115   1e-25   
ref|XP_010682433.1|  PREDICTED: copper amine oxidase 1-like             115   3e-25   Beta vulgaris subsp. vulgaris [field beet]
gb|EEC76708.1|  hypothetical protein OsI_14715                          113   8e-25   Oryza sativa Indica Group [Indian rice]
ref|XP_009618866.1|  PREDICTED: copper amine oxidase 1-like isofo...    111   4e-24   Nicotiana tomentosiformis
ref|XP_009773282.1|  PREDICTED: copper amine oxidase 1-like             111   4e-24   Nicotiana sylvestris
ref|XP_009618862.1|  PREDICTED: copper amine oxidase 1-like isofo...    111   5e-24   Nicotiana tomentosiformis
dbj|BAF49520.1|  N-methylputrescine oxidase                             111   5e-24   Nicotiana tabacum [American tobacco]
ref|XP_009618867.1|  PREDICTED: copper amine oxidase 1-like isofo...    110   7e-24   Nicotiana tomentosiformis
gb|KHN18421.1|  Copper methylamine oxidase                              109   1e-23   Glycine soja [wild soybean]
ref|XP_001759255.1|  predicted protein                                  107   1e-22   
ref|XP_001757203.1|  predicted protein                                  107   1e-22   
gb|EMT09520.1|  Copper methylamine oxidase                              102   5e-21   
emb|CDP13212.1|  unnamed protein product                              99.0    2e-20   Coffea canephora [robusta coffee]
ref|XP_003601196.1|  Primary amine oxidase                            98.6    9e-20   
ref|XP_001774529.1|  predicted protein                                95.1    1e-18   
ref|XP_002977869.1|  hypothetical protein SELMODRAFT_443642           92.0    2e-17   Selaginella moellendorffii
ref|XP_008373307.1|  PREDICTED: uncharacterized protein LOC103436643  89.0    4e-17   
ref|XP_002979456.1|  hypothetical protein SELMODRAFT_153358           65.1    1e-08   
ref|XP_002462763.1|  hypothetical protein SORBIDRAFT_02g031550        64.7    1e-08   
ref|XP_001753509.1|  predicted protein                                63.2    4e-08   



>ref|XP_008782506.1| PREDICTED: peroxisomal primary amine oxidase, partial [Phoenix 
dactylifera]
Length=571

 Score =   152 bits (384),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 99/160 (62%), Positives = 118/160 (74%), Gaps = 4/160 (3%)
 Frame = +2

Query  266  MASTPEKATLQSRNDSVVAAADGDVLQEWTSSVERQIGQREavaaasplaaVIDSIEQPP  445
            MA+T EKAT      +  A  DG + +E T  V       +   A + ++++I  +E+ P
Sbjct  1    MATTEEKATPCCA--TATAGGDGGLRREATGVVREWTAGEKQSVATASMSSMIRPVEEIP  58

Query  446  ASSAKVSV--LPNTMRAQSRHPLDPLTAAEISvavatvraagatPEVRDSMRFAEVSLVE  619
              SAK S   LP  MRAQ++HPLDPL+AAEISVAVATVRAAGATPEVRDSMRF EV L+E
Sbjct  59   EPSAKPSAKGLPMMMRAQTKHPLDPLSAAEISVAVATVRAAGATPEVRDSMRFVEVVLLE  118

Query  620  PDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPRQA  739
            P+K+VVALADAYFFPPFQPSLLPRTK GPVIPSKLPPR+A
Sbjct  119  PEKHVVALADAYFFPPFQPSLLPRTKGGPVIPSKLPPRRA  158



>gb|KDP31040.1| hypothetical protein JCGZ_11416 [Jatropha curcas]
Length=787

 Score =   151 bits (381),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 98/173 (57%), Positives = 123/173 (71%), Gaps = 18/173 (10%)
 Frame = +2

Query  266  MASTPEKAT-----LQSRNDSVVAAADG---------DVLQEWTSSV-ERQIGQREavaa  400
            MASTP+K T       S +DS  A  +          + +Q+W+    + Q+G++ A++ 
Sbjct  1    MASTPKKTTPPSSCCVSESDSTTARREAAPVPSSVVANAVQDWSDRRRDDQVGEKAAIST  60

Query  401  asplaaVIDSIEQPPASSAKVSVLPNTMRAQSRHPLDPLTAAEISvavatvraagatPEV  580
                   +DS+ +P  ++   + +P  +RAQ+RHPLDPL+AAEISVAVATVRAAGATPEV
Sbjct  61   LIRP---VDSVSEPSTNATTKAAIPVMLRAQTRHPLDPLSAAEISVAVATVRAAGATPEV  117

Query  581  RDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPRQA  739
            RDSMRF EV LVEPDKNVVALADAYFFPPFQPSLLPRTK GPVIP+KLPPR+A
Sbjct  118  RDSMRFIEVVLVEPDKNVVALADAYFFPPFQPSLLPRTKGGPVIPTKLPPRRA  170



>ref|XP_004239124.1| PREDICTED: copper amine oxidase 1 [Solanum lycopersicum]
Length=776

 Score =   150 bits (379),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 103/162 (64%), Positives = 119/162 (73%), Gaps = 4/162 (2%)
 Frame = +2

Query  266  MASTPEKATLQ--SRNDSVVAAADGDVLQEWTSSVERQIGQREavaaasplaaVIDSIEQ  439
            MAS  EK T+   SRN S  +  + +     T   +    +  + AA S L AVIDSI++
Sbjct  1    MASAQEKTTVSAPSRNASAASETEWNAGGTVTDVSDLSSTRSASSAAPSTLTAVIDSIDR  60

Query  440  PPASSAK--VSVLPNTMRAQSRHPLDPLTAAEISvavatvraagatPEVRDSMRFAEVSL  613
            P A + +  V  LP  +RAQ+ HPLDPLTAAEISVAVATVRAAG+TPEVRDSMRF EV L
Sbjct  61   PSAQNQQPAVKGLPTLLRAQTHHPLDPLTAAEISVAVATVRAAGSTPEVRDSMRFVEVVL  120

Query  614  VEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPRQA  739
            VEPDK+VVALADAYFFPPFQPSLLPRTK GPVIPSKLPPR+A
Sbjct  121  VEPDKSVVALADAYFFPPFQPSLLPRTKGGPVIPSKLPPRKA  162



>ref|XP_002273532.2| PREDICTED: copper amine oxidase 1 isoform X1 [Vitis vinifera]
 emb|CBI23365.3| unnamed protein product [Vitis vinifera]
Length=774

 Score =   150 bits (378),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 101/164 (62%), Positives = 117/164 (71%), Gaps = 9/164 (5%)
 Frame = +2

Query  266  MASTPEKATLQSRNDSVVAAAD--GDVLQEWTSS----VERQIGQREavaaasplaaVID  427
            MA+  EKAT     D+  A      +VLQ+W+ +     E QI +R  VA        +D
Sbjct  1    MAAATEKATTCCIEDAKPAPVRKASNVLQDWSVAGSAPSEDQISKRATVATLIRS---VD  57

Query  428  SIEQPPASSAKVSVLPNTMRAQSRHPLDPLTAAEISvavatvraagatPEVRDSMRFAEV  607
            S+ QP A+      +P  +RAQ+ HPLDPL+AAEISVAVATVRAAGATPEVRDSMRF EV
Sbjct  58   SLPQPAANPTATKGIPIMLRAQTSHPLDPLSAAEISVAVATVRAAGATPEVRDSMRFVEV  117

Query  608  SLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPRQA  739
             LVEP+K+VVALADAYFFPPFQPSLLPRTK GPVIPSKLPPRQA
Sbjct  118  VLVEPEKHVVALADAYFFPPFQPSLLPRTKGGPVIPSKLPPRQA  161



>ref|XP_010907652.1| PREDICTED: copper amine oxidase 1 [Elaeis guineensis]
Length=771

 Score =   146 bits (369),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 98/160 (61%), Positives = 116/160 (73%), Gaps = 4/160 (3%)
 Frame = +2

Query  266  MASTPEKATLQSRNDSVVAAADGDVLQEWTSSVERQIGQREavaaasplaaVIDSIEQPP  445
            MA+T EKAT      S  A  DG + +E    V       +   A + ++++I  +E+ P
Sbjct  1    MATTEEKATPCCA--SAPAGGDGGLRREAAGVVREWTAGEKQTVATAAMSSLIRPVEEIP  58

Query  446  ASSAKVSV--LPNTMRAQSRHPLDPLTAAEISvavatvraagatPEVRDSMRFAEVSLVE  619
              SAK S   LP  MRAQ++HPLDPL+AAEISVAVATVRAAGATPEVRDSMRF EV L+E
Sbjct  59   EPSAKPSTKGLPMMMRAQTKHPLDPLSAAEISVAVATVRAAGATPEVRDSMRFVEVVLLE  118

Query  620  PDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPRQA  739
            P+K+VVALADAYFFPPFQPSLLPRTK GPVIPSKLP R+A
Sbjct  119  PEKHVVALADAYFFPPFQPSLLPRTKGGPVIPSKLPARRA  158



>ref|XP_006357609.1| PREDICTED: copper amine oxidase 1-like [Solanum tuberosum]
Length=776

 Score =   146 bits (368),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 87/109 (80%), Positives = 95/109 (87%), Gaps = 2/109 (2%)
 Frame = +2

Query  419  VIDSIEQPPASSAK--VSVLPNTMRAQSRHPLDPLTAAEISvavatvraagatPEVRDSM  592
            VIDSI+ P A + +  V  LP  +RAQ+ HPLDPLTAAEISVAVATVRAAG+TPEVRDSM
Sbjct  54   VIDSIDLPAAPNQQPVVKGLPILLRAQTHHPLDPLTAAEISVAVATVRAAGSTPEVRDSM  113

Query  593  RFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPRQA  739
            RF EV LVEPDK+VVALADAYFFPPFQPSLLPRTK GPVIPSKLPPR+A
Sbjct  114  RFVEVVLVEPDKSVVALADAYFFPPFQPSLLPRTKGGPVIPSKLPPRKA  162



>ref|XP_009600855.1| PREDICTED: copper amine oxidase 1-like [Nicotiana tomentosiformis]
Length=779

 Score =   145 bits (366),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 102/168 (61%), Positives = 119/168 (71%), Gaps = 13/168 (8%)
 Frame = +2

Query  266  MASTPEKATLQSRNDSVVAAADGDVLQEWTSS-VERQIGQREavaaasplaa--------  418
            MAST EKAT  S + +  AA       EWT++    +I  R +   ++  A         
Sbjct  1    MASTQEKATASSPSRNASAA---QFSPEWTAAGTVAEISDRSSTTRSAANAKTTATAAVA  57

Query  419  VIDSIEQPPASSA-KVSVLPNTMRAQSRHPLDPLTAAEISvavatvraagatPEVRDSMR  595
            VIDSI++P   +A  V  LP  +RAQS HPLDPLTAAEI+VAVATVRAAG+TPEVRDSMR
Sbjct  58   VIDSIDRPSLPNAPAVKGLPTLLRAQSHHPLDPLTAAEIAVAVATVRAAGSTPEVRDSMR  117

Query  596  FAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPRQA  739
            F E  LVEPDK+V+ALADAYFFPPFQPSLLPRTK GPVIPSKLPPR+A
Sbjct  118  FVEAVLVEPDKSVIALADAYFFPPFQPSLLPRTKGGPVIPSKLPPRKA  165



>ref|XP_009379966.1| PREDICTED: copper amine oxidase 1-like [Musa acuminata subsp. 
malaccensis]
Length=771

 Score =   145 bits (365),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 99/162 (61%), Positives = 119/162 (73%), Gaps = 6/162 (4%)
 Frame = +2

Query  266  MASTPEKATLQSRNDSVVAAADGDV---LQEW-TSSVERQIGQREavaaasplaaVIDSI  433
            MA+T EKAT    +  V  A  G V   +QEW T++V++Q       A +  +A V D +
Sbjct  1    MAATQEKATPAHASVGVAGAKAGGVPGPVQEWVTAAVDKQASAPPVEAVSPLIAPVED-V  59

Query  434  EQPPASSAKVSVLPNTMRAQSRHPLDPLTAAEISvavatvraagatPEVRDSMRFAEVSL  613
            + PPA  +   + P  MRAQ+ HPLDPL++AEISVAVATVRAAGATPEVRD MRF EV L
Sbjct  60   QDPPAKPSSKGI-PVMMRAQTSHPLDPLSSAEISVAVATVRAAGATPEVRDGMRFIEVVL  118

Query  614  VEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPRQA  739
            +EP+KN+VALADAYFFPPFQPSLLPRTK GPVIPSKLPPR+A
Sbjct  119  LEPEKNIVALADAYFFPPFQPSLLPRTKGGPVIPSKLPPRRA  160



>gb|KJB15626.1| hypothetical protein B456_002G186900 [Gossypium raimondii]
Length=771

 Score =   145 bits (365),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 101/165 (61%), Positives = 124/165 (75%), Gaps = 14/165 (8%)
 Frame = +2

Query  266  MASTPEKATLQSRNDSVVAAADGDVLQEWTSSVERQIGQREavaaasplaaVI---DSIE  436
            MAST EKAT ++   S  +++   VLQ W+ +   +    + +  A+ +AA+I   ++I 
Sbjct  1    MASTQEKATHKNNTPSPSSSSSAQVLQNWSLAAPSE----DPIPKAASMAALIRPAETIA  56

Query  437  QPPAS----SAKVSVLPNTMRAQSRHPLDPLTAAEISvavatvraagatPEVRDSMRFAE  604
             PPA+    S  +S++P   RAQ+ HPLDPL+AAEISVAVATVRAAGATPEVRDSMRF E
Sbjct  57   DPPATKTTTSKGISIMP---RAQTSHPLDPLSAAEISVAVATVRAAGATPEVRDSMRFIE  113

Query  605  VSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPRQA  739
            V LVEPDK+VVALADAYFFPPFQPSLLPRTK GPVIPSKLPPR+A
Sbjct  114  VVLVEPDKHVVALADAYFFPPFQPSLLPRTKGGPVIPSKLPPRKA  158



>ref|XP_009802912.1| PREDICTED: peroxisomal primary amine oxidase-like [Nicotiana 
sylvestris]
Length=779

 Score =   145 bits (365),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 101/168 (60%), Positives = 119/168 (71%), Gaps = 13/168 (8%)
 Frame = +2

Query  266  MASTPEKATLQSRNDSVVAAADGDVLQEWTSS-VERQIGQREavaaasplaa--------  418
            MAST EKAT+ S + +  AA       EWT++    +I  R +   ++  A         
Sbjct  1    MASTQEKATVSSPSRNASAA---QFSSEWTAAGTVAEISDRSSTTRSAANAKTTATAAVA  57

Query  419  VIDSIEQPPASSA-KVSVLPNTMRAQSRHPLDPLTAAEISvavatvraagatPEVRDSMR  595
            VIDSI++P   +   V  LP  +RAQS HPLDPLTAAEI+VAVATVRAAG+TPEVRDSMR
Sbjct  58   VIDSIDRPSLPNPPAVKGLPTLLRAQSHHPLDPLTAAEIAVAVATVRAAGSTPEVRDSMR  117

Query  596  FAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPRQA  739
            F E  LVEPDK+V+ALADAYFFPPFQPSLLPRTK GPVIPSKLPPR+A
Sbjct  118  FVEAVLVEPDKSVIALADAYFFPPFQPSLLPRTKGGPVIPSKLPPRKA  165



>gb|KJB50260.1| hypothetical protein B456_008G160800 [Gossypium raimondii]
Length=446

 Score =   141 bits (356),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 101/182 (55%), Positives = 121/182 (66%), Gaps = 30/182 (16%)
 Frame = +2

Query  266  MASTPEKAT---LQSRNDSV----------VAAADGDVLQEWTSSV-------ERQIGQR  385
            MAST EKAT   +   ND +             +   VLQ W+ ++       E  I +R
Sbjct  1    MASTQEKATHCCIPKTNDDIKNNNKAPPPPPPPSSTKVLQNWSVALVSGSNPSEDTISKR  60

Query  386  EavaaasplaaVIDSIEQPPAS----SAKVSVLPNTMRAQSRHPLDPLTAAEISvavatv  553
             ++A        ++ I  PPA+    S  +S++P   RAQ+ HPLDPL+AAEISVAVATV
Sbjct  61   ASMATLIRP---VEPISDPPATNTTTSKGISIMP---RAQTSHPLDPLSAAEISVAVATV  114

Query  554  raagatPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  733
            RAAG TPEVRDSMRF EV+LVEP+K+VVALADAYFFPPFQPSLLPRTK GPVIPSKLPPR
Sbjct  115  RAAGKTPEVRDSMRFIEVALVEPEKHVVALADAYFFPPFQPSLLPRTKGGPVIPSKLPPR  174

Query  734  QA  739
            QA
Sbjct  175  QA  176



>ref|XP_008464519.1| PREDICTED: copper amine oxidase 1 isoform X1 [Cucumis melo]
Length=791

 Score =   144 bits (363),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 91/162 (56%), Positives = 117/162 (72%), Gaps = 4/162 (2%)
 Frame = +2

Query  260  IAMASTPEKATLQSRNDSVVAAADGDVLQEWTSSVERQIGQREavaaasplaaV--IDSI  433
            +   ST   +T   R  + VA+A+  V+Q+W  +   +   R      +  + V  ++ I
Sbjct  15   VCCHSTAAGSTTVPREAASVASAN--VVQDWNLTTNDRADDRRTSKNVAIPSLVRSVEPI  72

Query  434  EQPPASSAKVSVLPNTMRAQSRHPLDPLTAAEISvavatvraagatPEVRDSMRFAEVSL  613
             +P  +++   V+P  +RAQSRHPLDPL+AAEISVAVATVRAAGATPEVRDSMRF EV L
Sbjct  73   PEPSTNASSKGVVPPMLRAQSRHPLDPLSAAEISVAVATVRAAGATPEVRDSMRFIEVVL  132

Query  614  VEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPRQA  739
            +EP+K+VVALADAYFFPPFQPSLLP+TK GPVIP+KLPPR+A
Sbjct  133  LEPEKHVVALADAYFFPPFQPSLLPKTKGGPVIPTKLPPRRA  174



>ref|XP_010248627.1| PREDICTED: copper amine oxidase 1-like [Nelumbo nucifera]
Length=780

 Score =   144 bits (363),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 100/170 (59%), Positives = 115/170 (68%), Gaps = 14/170 (8%)
 Frame = +2

Query  266  MASTPEKATLQSRND---------SVVAAADGDVLQEWT-SSVERQIGQREavaaaspla  415
            MA+T EKAT    +D         +V +    DV+Q+W+  +V+    QR      +   
Sbjct  1    MATTEEKATSCCISDKPAAVHRKAAVSSTTVADVVQDWSVDNVDGSDDQRHKRGVMTTS-  59

Query  416  aVIDSIEQPPASSAKVSV--LPNTMRAQSRHPLDPLTAAEISvavatvraagatPEVRDS  589
             VI  ++  P SS   S   L   MRAQS HPLDPL AAEISVAVATVRAAGATPEVRD 
Sbjct  60   -VIRPVDSLPESSVNASSKGLQVMMRAQSSHPLDPLLAAEISVAVATVRAAGATPEVRDG  118

Query  590  MRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPRQA  739
            MRF EV L+EPDKNVVALADAYFFPPFQPSLLP+TK GPVIPSKLPPR+A
Sbjct  119  MRFIEVVLLEPDKNVVALADAYFFPPFQPSLLPKTKGGPVIPSKLPPRRA  168



>gb|KJB50259.1| hypothetical protein B456_008G160800 [Gossypium raimondii]
Length=552

 Score =   142 bits (358),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 101/182 (55%), Positives = 121/182 (66%), Gaps = 30/182 (16%)
 Frame = +2

Query  266  MASTPEKAT---LQSRNDSV----------VAAADGDVLQEWTSSV-------ERQIGQR  385
            MAST EKAT   +   ND +             +   VLQ W+ ++       E  I +R
Sbjct  1    MASTQEKATHCCIPKTNDDIKNNNKAPPPPPPPSSTKVLQNWSVALVSGSNPSEDTISKR  60

Query  386  EavaaasplaaVIDSIEQPPAS----SAKVSVLPNTMRAQSRHPLDPLTAAEISvavatv  553
             ++A        ++ I  PPA+    S  +S++P   RAQ+ HPLDPL+AAEISVAVATV
Sbjct  61   ASMATLIRP---VEPISDPPATNTTTSKGISIMP---RAQTSHPLDPLSAAEISVAVATV  114

Query  554  raagatPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  733
            RAAG TPEVRDSMRF EV+LVEP+K+VVALADAYFFPPFQPSLLPRTK GPVIPSKLPPR
Sbjct  115  RAAGKTPEVRDSMRFIEVALVEPEKHVVALADAYFFPPFQPSLLPRTKGGPVIPSKLPPR  174

Query  734  QA  739
            QA
Sbjct  175  QA  176



>ref|XP_010251089.1| PREDICTED: copper amine oxidase 1-like isoform X2 [Nelumbo nucifera]
Length=740

 Score =   143 bits (361),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 99/162 (61%), Positives = 118/162 (73%), Gaps = 12/162 (7%)
 Frame = +2

Query  266  MASTPEKATLQSRNDSVVAAADGDVLQEWT--SSVERQIGQREavaaasplaaVIDSIEQ  439
            MA+T EKAT  +   +V         Q+WT  ++V+R   Q    A  S L   +DS+ +
Sbjct  1    MATTEEKATTMAAASAVANVV-----QDWTVVNAVDRSSDQHHKRATISTLIGPVDSMPE  55

Query  440  PPA--SSAKVSVLPNTMRAQSRHPLDPLTAAEISvavatvraagatPEVRDSMRFAEVSL  613
            P A  S+  + V+   MRAQ+ HPLDPL+AAEISVAVATVRAAGATPEVRDSMRF EV L
Sbjct  56   PSANVSTKGIQVM---MRAQTSHPLDPLSAAEISVAVATVRAAGATPEVRDSMRFIEVVL  112

Query  614  VEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPRQA  739
            +EPDKNVVALADAYFFPPFQPSLLP++K GPVIPSKLPPR+A
Sbjct  113  LEPDKNVVALADAYFFPPFQPSLLPKSKGGPVIPSKLPPRRA  154



>ref|XP_010251088.1| PREDICTED: copper amine oxidase 1-like isoform X1 [Nelumbo nucifera]
Length=766

 Score =   143 bits (360),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 99/162 (61%), Positives = 118/162 (73%), Gaps = 12/162 (7%)
 Frame = +2

Query  266  MASTPEKATLQSRNDSVVAAADGDVLQEWT--SSVERQIGQREavaaasplaaVIDSIEQ  439
            MA+T EKAT  +   +V         Q+WT  ++V+R   Q    A  S L   +DS+ +
Sbjct  1    MATTEEKATTMAAASAVANVV-----QDWTVVNAVDRSSDQHHKRATISTLIGPVDSMPE  55

Query  440  PPA--SSAKVSVLPNTMRAQSRHPLDPLTAAEISvavatvraagatPEVRDSMRFAEVSL  613
            P A  S+  + V+   MRAQ+ HPLDPL+AAEISVAVATVRAAGATPEVRDSMRF EV L
Sbjct  56   PSANVSTKGIQVM---MRAQTSHPLDPLSAAEISVAVATVRAAGATPEVRDSMRFIEVVL  112

Query  614  VEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPRQA  739
            +EPDKNVVALADAYFFPPFQPSLLP++K GPVIPSKLPPR+A
Sbjct  113  LEPDKNVVALADAYFFPPFQPSLLPKSKGGPVIPSKLPPRRA  154



>ref|XP_004138093.1| PREDICTED: copper methylamine oxidase-like [Cucumis sativus]
Length=794

 Score =   143 bits (360),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 93/174 (53%), Positives = 119/174 (68%), Gaps = 16/174 (9%)
 Frame = +2

Query  266  MASTPEKATLQSRNDSVVAAADG--------------DVLQEWTSSVERQIGQREavaaa  403
            MA   +KATL S +    ++A G              +V+Q+W  +   +   R      
Sbjct  1    MAPASKKATLFSSDVCCHSSAAGSTTVPREAASVASANVVQDWNLTTNDRADDRRTSKNV  60

Query  404  splaaV--IDSIEQPPASSAKVSVLPNTMRAQSRHPLDPLTAAEISvavatvraagatPE  577
            +  + V  ++ I +P  +++   V+P  +RAQSRHPLDPL+AAEISVAVATVRAAGATPE
Sbjct  61   AIPSLVRSVEPIPEPSTNASSKGVVPPMLRAQSRHPLDPLSAAEISVAVATVRAAGATPE  120

Query  578  VRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPRQA  739
            VRDSMRF EV L+EP+K+VVALADAYFFPPFQPSLLP+TK GPVIP+KLPPR+A
Sbjct  121  VRDSMRFIEVVLLEPEKHVVALADAYFFPPFQPSLLPKTKGGPVIPTKLPPRRA  174



>ref|XP_004155025.1| PREDICTED: copper methylamine oxidase-like [Cucumis sativus]
 gb|KGN63544.1| hypothetical protein Csa_1G004100 [Cucumis sativus]
Length=791

 Score =   143 bits (360),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 93/174 (53%), Positives = 119/174 (68%), Gaps = 16/174 (9%)
 Frame = +2

Query  266  MASTPEKATLQSRNDSVVAAADG--------------DVLQEWTSSVERQIGQREavaaa  403
            MA   +KATL S +    ++A G              +V+Q+W  +   +   R      
Sbjct  1    MAPASKKATLFSSDVCCHSSAAGSTTVPREAASVASANVVQDWNLTTNDRADDRRTSKNV  60

Query  404  splaaV--IDSIEQPPASSAKVSVLPNTMRAQSRHPLDPLTAAEISvavatvraagatPE  577
            +  + V  ++ I +P  +++   V+P  +RAQSRHPLDPL+AAEISVAVATVRAAGATPE
Sbjct  61   AIPSLVRSVEPIPEPSTNASSKGVVPPMLRAQSRHPLDPLSAAEISVAVATVRAAGATPE  120

Query  578  VRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPRQA  739
            VRDSMRF EV L+EP+K+VVALADAYFFPPFQPSLLP+TK GPVIP+KLPPR+A
Sbjct  121  VRDSMRFIEVVLLEPEKHVVALADAYFFPPFQPSLLPKTKGGPVIPTKLPPRRA  174



>gb|KHG02564.1| Primary amine oxidase [Gossypium arboreum]
Length=756

 Score =   142 bits (359),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 101/165 (61%), Positives = 122/165 (74%), Gaps = 15/165 (9%)
 Frame = +2

Query  266  MASTPEKATLQSRNDSVVAAADGDVLQEWTSSVERQIGQREavaaasplaaVI---DSIE  436
            MAST EKAT    N    +++   VLQ W+ +   +    + +  A+ +AA+I   ++I 
Sbjct  1    MASTQEKAT-HKNNTPSSSSSSAQVLQNWSLAAPSE----DPIPKAASMAALIRPAETIA  55

Query  437  QPPAS----SAKVSVLPNTMRAQSRHPLDPLTAAEISvavatvraagatPEVRDSMRFAE  604
             PPA+    S  +S++P   RAQ+ HPLDPL+AAEISVAVATVRAAGATPEVRDSMRF E
Sbjct  56   DPPATKTTTSKGISIMP---RAQTSHPLDPLSAAEISVAVATVRAAGATPEVRDSMRFIE  112

Query  605  VSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPRQA  739
            V LVEPDK+VVALADAYFFPPFQPSLLPRTK GPVIPSKLPPR+A
Sbjct  113  VVLVEPDKHVVALADAYFFPPFQPSLLPRTKGGPVIPSKLPPRKA  157



>gb|KJB50256.1| hypothetical protein B456_008G160800 [Gossypium raimondii]
Length=751

 Score =   142 bits (357),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 101/182 (55%), Positives = 121/182 (66%), Gaps = 30/182 (16%)
 Frame = +2

Query  266  MASTPEKAT---LQSRNDSV----------VAAADGDVLQEWTSSV-------ERQIGQR  385
            MAST EKAT   +   ND +             +   VLQ W+ ++       E  I +R
Sbjct  1    MASTQEKATHCCIPKTNDDIKNNNKAPPPPPPPSSTKVLQNWSVALVSGSNPSEDTISKR  60

Query  386  EavaaasplaaVIDSIEQPPAS----SAKVSVLPNTMRAQSRHPLDPLTAAEISvavatv  553
             ++A        ++ I  PPA+    S  +S++P   RAQ+ HPLDPL+AAEISVAVATV
Sbjct  61   ASMATLIRP---VEPISDPPATNTTTSKGISIMP---RAQTSHPLDPLSAAEISVAVATV  114

Query  554  raagatPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  733
            RAAG TPEVRDSMRF EV+LVEP+K+VVALADAYFFPPFQPSLLPRTK GPVIPSKLPPR
Sbjct  115  RAAGKTPEVRDSMRFIEVALVEPEKHVVALADAYFFPPFQPSLLPRTKGGPVIPSKLPPR  174

Query  734  QA  739
            QA
Sbjct  175  QA  176



>gb|KJB50255.1| hypothetical protein B456_008G160800 [Gossypium raimondii]
Length=757

 Score =   142 bits (357),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 101/182 (55%), Positives = 121/182 (66%), Gaps = 30/182 (16%)
 Frame = +2

Query  266  MASTPEKAT---LQSRNDSV----------VAAADGDVLQEWTSSV-------ERQIGQR  385
            MAST EKAT   +   ND +             +   VLQ W+ ++       E  I +R
Sbjct  1    MASTQEKATHCCIPKTNDDIKNNNKAPPPPPPPSSTKVLQNWSVALVSGSNPSEDTISKR  60

Query  386  EavaaasplaaVIDSIEQPPAS----SAKVSVLPNTMRAQSRHPLDPLTAAEISvavatv  553
             ++A        ++ I  PPA+    S  +S++P   RAQ+ HPLDPL+AAEISVAVATV
Sbjct  61   ASMATLIRP---VEPISDPPATNTTTSKGISIMP---RAQTSHPLDPLSAAEISVAVATV  114

Query  554  raagatPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  733
            RAAG TPEVRDSMRF EV+LVEP+K+VVALADAYFFPPFQPSLLPRTK GPVIPSKLPPR
Sbjct  115  RAAGKTPEVRDSMRFIEVALVEPEKHVVALADAYFFPPFQPSLLPRTKGGPVIPSKLPPR  174

Query  734  QA  739
            QA
Sbjct  175  QA  176



>gb|KJB50258.1| hypothetical protein B456_008G160800 [Gossypium raimondii]
Length=779

 Score =   142 bits (357),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 101/182 (55%), Positives = 121/182 (66%), Gaps = 30/182 (16%)
 Frame = +2

Query  266  MASTPEKAT---LQSRNDSV----------VAAADGDVLQEWTSSV-------ERQIGQR  385
            MAST EKAT   +   ND +             +   VLQ W+ ++       E  I +R
Sbjct  1    MASTQEKATHCCIPKTNDDIKNNNKAPPPPPPPSSTKVLQNWSVALVSGSNPSEDTISKR  60

Query  386  EavaaasplaaVIDSIEQPPAS----SAKVSVLPNTMRAQSRHPLDPLTAAEISvavatv  553
             ++A        ++ I  PPA+    S  +S++P   RAQ+ HPLDPL+AAEISVAVATV
Sbjct  61   ASMATLIRP---VEPISDPPATNTTTSKGISIMP---RAQTSHPLDPLSAAEISVAVATV  114

Query  554  raagatPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  733
            RAAG TPEVRDSMRF EV+LVEP+K+VVALADAYFFPPFQPSLLPRTK GPVIPSKLPPR
Sbjct  115  RAAGKTPEVRDSMRFIEVALVEPEKHVVALADAYFFPPFQPSLLPRTKGGPVIPSKLPPR  174

Query  734  QA  739
            QA
Sbjct  175  QA  176



>ref|XP_006845257.1| hypothetical protein AMTR_s00005p00262140 [Amborella trichopoda]
 gb|ERN06932.1| hypothetical protein AMTR_s00005p00262140 [Amborella trichopoda]
Length=786

 Score =   142 bits (357),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 80/106 (75%), Positives = 92/106 (87%), Gaps = 3/106 (3%)
 Frame = +2

Query  422  IDSIEQPPASSAKVSVLPNTMRAQSRHPLDPLTAAEISvavatvraagatPEVRDSMRFA  601
            +D++ +PPA  A + V+   MRAQ+RHPLDPL+AAEI+VAVATVRAAG TPEVRD MRF 
Sbjct  72   VDALHEPPAKGAGIHVM---MRAQTRHPLDPLSAAEIAVAVATVRAAGKTPEVRDGMRFI  128

Query  602  EVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPRQA  739
            EV L EPDK+VVALADAYFFPPFQPSLLP+TK GPVIPSKLPPR+A
Sbjct  129  EVVLWEPDKSVVALADAYFFPPFQPSLLPKTKGGPVIPSKLPPRRA  174



>gb|KJB50257.1| hypothetical protein B456_008G160800 [Gossypium raimondii]
Length=775

 Score =   142 bits (357),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 101/182 (55%), Positives = 121/182 (66%), Gaps = 30/182 (16%)
 Frame = +2

Query  266  MASTPEKAT---LQSRNDSV----------VAAADGDVLQEWTSSV-------ERQIGQR  385
            MAST EKAT   +   ND +             +   VLQ W+ ++       E  I +R
Sbjct  1    MASTQEKATHCCIPKTNDDIKNNNKAPPPPPPPSSTKVLQNWSVALVSGSNPSEDTISKR  60

Query  386  EavaaasplaaVIDSIEQPPAS----SAKVSVLPNTMRAQSRHPLDPLTAAEISvavatv  553
             ++A        ++ I  PPA+    S  +S++P   RAQ+ HPLDPL+AAEISVAVATV
Sbjct  61   ASMATLIRP---VEPISDPPATNTTTSKGISIMP---RAQTSHPLDPLSAAEISVAVATV  114

Query  554  raagatPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  733
            RAAG TPEVRDSMRF EV+LVEP+K+VVALADAYFFPPFQPSLLPRTK GPVIPSKLPPR
Sbjct  115  RAAGKTPEVRDSMRFIEVALVEPEKHVVALADAYFFPPFQPSLLPRTKGGPVIPSKLPPR  174

Query  734  QA  739
            QA
Sbjct  175  QA  176



>gb|KJB50254.1| hypothetical protein B456_008G160800 [Gossypium raimondii]
Length=789

 Score =   142 bits (357),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 101/182 (55%), Positives = 121/182 (66%), Gaps = 30/182 (16%)
 Frame = +2

Query  266  MASTPEKAT---LQSRNDSV----------VAAADGDVLQEWTSSV-------ERQIGQR  385
            MAST EKAT   +   ND +             +   VLQ W+ ++       E  I +R
Sbjct  1    MASTQEKATHCCIPKTNDDIKNNNKAPPPPPPPSSTKVLQNWSVALVSGSNPSEDTISKR  60

Query  386  EavaaasplaaVIDSIEQPPAS----SAKVSVLPNTMRAQSRHPLDPLTAAEISvavatv  553
             ++A        ++ I  PPA+    S  +S++P   RAQ+ HPLDPL+AAEISVAVATV
Sbjct  61   ASMATLIRP---VEPISDPPATNTTTSKGISIMP---RAQTSHPLDPLSAAEISVAVATV  114

Query  554  raagatPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPR  733
            RAAG TPEVRDSMRF EV+LVEP+K+VVALADAYFFPPFQPSLLPRTK GPVIPSKLPPR
Sbjct  115  RAAGKTPEVRDSMRFIEVALVEPEKHVVALADAYFFPPFQPSLLPRTKGGPVIPSKLPPR  174

Query  734  QA  739
            QA
Sbjct  175  QA  176



>ref|XP_010100391.1| Copper methylamine oxidase [Morus notabilis]
 gb|EXB82525.1| Copper methylamine oxidase [Morus notabilis]
Length=841

 Score =   141 bits (356),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 86/110 (78%), Positives = 94/110 (85%), Gaps = 4/110 (4%)
 Frame = +2

Query  422  IDSI--EQPPA--SSAKVSVLPNTMRAQSRHPLDPLTAAEISvavatvraagatPEVRDS  589
            +DS+  + PP   +SA    +P  MRAQ+ HPLDPL+AAEISVAVATVRAAGATPEVRDS
Sbjct  73   VDSLQADDPPTNTTSASSKGIPAMMRAQTSHPLDPLSAAEISVAVATVRAAGATPEVRDS  132

Query  590  MRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPRQA  739
            MRF EV LVEPDK+VVALADAYFFPPFQPSLLPRTK GPVIPSKLPPRQA
Sbjct  133  MRFVEVVLVEPDKHVVALADAYFFPPFQPSLLPRTKGGPVIPSKLPPRQA  182



>ref|XP_008389732.1| PREDICTED: copper amine oxidase 1-like isoform X1 [Malus domestica]
Length=781

 Score =   140 bits (354),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 96/164 (59%), Positives = 115/164 (70%), Gaps = 8/164 (5%)
 Frame = +2

Query  266  MASTPEKAT---LQSRNDSVVAAADGDVLQEWTSSVERQIGQREavaaasplaaVIDSIE  436
            MA+T EKAT     S   S +    G+ ++ WT S        + +   + +  +I  +E
Sbjct  1    MATTQEKATPRDAASAESSALLRKAGEPVRNWTGSASDL--DSDPIRTRASVPTLIRPME  58

Query  437  QPPA---SSAKVSVLPNTMRAQSRHPLDPLTAAEISvavatvraagatPEVRDSMRFAEV  607
              PA   ++A    +P  +RAQS HPL+PL+AAEISVAVATVRAAGATPEVRDSMRF EV
Sbjct  59   SLPAPSTNTAATKGIPVMLRAQSSHPLEPLSAAEISVAVATVRAAGATPEVRDSMRFVEV  118

Query  608  SLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPRQA  739
            +LVEPDK VVALADAYFFPPFQPSLLPRTK GP+IPSKLPPRQA
Sbjct  119  ALVEPDKRVVALADAYFFPPFQPSLLPRTKGGPMIPSKLPPRQA  162



>ref|XP_008389733.1| PREDICTED: copper amine oxidase 1-like isoform X2 [Malus domestica]
Length=775

 Score =   140 bits (354),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 96/164 (59%), Positives = 115/164 (70%), Gaps = 8/164 (5%)
 Frame = +2

Query  266  MASTPEKAT---LQSRNDSVVAAADGDVLQEWTSSVERQIGQREavaaasplaaVIDSIE  436
            MA+T EKAT     S   S +    G+ ++ WT S        + +   + +  +I  +E
Sbjct  1    MATTQEKATPRDAASAESSALLRKAGEPVRNWTGSASDL--DSDPIRTRASVPTLIRPME  58

Query  437  QPPA---SSAKVSVLPNTMRAQSRHPLDPLTAAEISvavatvraagatPEVRDSMRFAEV  607
              PA   ++A    +P  +RAQS HPL+PL+AAEISVAVATVRAAGATPEVRDSMRF EV
Sbjct  59   SLPAPSTNTAATKGIPVMLRAQSSHPLEPLSAAEISVAVATVRAAGATPEVRDSMRFVEV  118

Query  608  SLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPRQA  739
            +LVEPDK VVALADAYFFPPFQPSLLPRTK GP+IPSKLPPRQA
Sbjct  119  ALVEPDKRVVALADAYFFPPFQPSLLPRTKGGPMIPSKLPPRQA  162



>gb|KHG02854.1| Copper methylamine oxidase [Gossypium arboreum]
Length=804

 Score =   140 bits (354),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 100/181 (55%), Positives = 122/181 (67%), Gaps = 29/181 (16%)
 Frame = +2

Query  266  MASTPEKAT---LQSRNDSV---------VAAADGDVLQEWTSSV-------ERQIGQRE  388
            MAST EKAT   +   ND +           ++   VLQ W+ ++       E  I +R 
Sbjct  1    MASTQEKATHCCIPKTNDDIKNNKAPRPPPPSSSTKVLQNWSVALVSGSNPSEDTISKRA  60

Query  389  avaaasplaaVIDSIEQPPAS----SAKVSVLPNTMRAQSRHPLDPLTAAEISvavatvr  556
            ++A        ++ I  PPA+    S  +S++P   RAQ+ HPLDPL+AAEISVAVATVR
Sbjct  61   SMATLIRP---VEPISDPPATNTTTSKGISIMP---RAQTSHPLDPLSAAEISVAVATVR  114

Query  557  aagatPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPRQ  736
            AAG TPEVRDSMRF EV+LVEP+K+VVALADAYFFPPFQPSL+PRTK GPVIPSKLPPRQ
Sbjct  115  AAGKTPEVRDSMRFIEVALVEPEKHVVALADAYFFPPFQPSLIPRTKGGPVIPSKLPPRQ  174

Query  737  A  739
            A
Sbjct  175  A  175



>ref|XP_007211293.1| hypothetical protein PRUPE_ppa002116mg [Prunus persica]
 gb|EMJ12492.1| hypothetical protein PRUPE_ppa002116mg [Prunus persica]
Length=714

 Score =   139 bits (351),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 89/147 (61%), Positives = 113/147 (77%), Gaps = 13/147 (9%)
 Frame = +2

Query  308  DSVVAAADGDVLQEWTS---SVERQIGQREavaaasplaaVIDSIEQPPASSAKVSVLPN  478
            ++VV+A+   V+Q+WT+   S +R+  QR       P    + S+   P+++A  + +P 
Sbjct  30   NAVVSAS---VVQDWTAIAGSEDRRDDQR-------PKKIAMASLITEPSANASTTGIPI  79

Query  479  TMRAQSRHPLDPLTAAEISvavatvraagatPEVRDSMRFAEVSLVEPDKNVVALADAYF  658
             +R Q+RHPLDPL+AAEISVAVATVRAAGATPEVRDSMRF EV L+EPDK+VV LADAYF
Sbjct  80   MLRPQTRHPLDPLSAAEISVAVATVRAAGATPEVRDSMRFVEVVLLEPDKHVVGLADAYF  139

Query  659  FPPFQPSLLPRTKKGPVIPSKLPPRQA  739
            FPPFQPSLLPRTK GP+IP+KLPPR+A
Sbjct  140  FPPFQPSLLPRTKGGPIIPTKLPPRRA  166



>gb|AIS23644.1| amine oxidase 1 [Malus domestica]
Length=775

 Score =   140 bits (352),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 81/106 (76%), Positives = 92/106 (87%), Gaps = 0/106 (0%)
 Frame = +2

Query  422  IDSIEQPPASSAKVSVLPNTMRAQSRHPLDPLTAAEISvavatvraagatPEVRDSMRFA  601
            ++S+  P  ++A    +P  +RAQS HPL+PL+AAEISVAVATVRAAGATPEVRDSMRF 
Sbjct  57   MESLPAPSTNTAATKGIPVMLRAQSSHPLEPLSAAEISVAVATVRAAGATPEVRDSMRFV  116

Query  602  EVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPRQA  739
            EV+LVEPDK VVALADAYFFPPFQPSLLPRTK GP+IPSKLPPRQA
Sbjct  117  EVALVEPDKRVVALADAYFFPPFQPSLLPRTKGGPMIPSKLPPRQA  162



>ref|XP_007225246.1| hypothetical protein PRUPE_ppa001698mg [Prunus persica]
 gb|EMJ26445.1| hypothetical protein PRUPE_ppa001698mg [Prunus persica]
Length=777

 Score =   140 bits (352),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 95/167 (57%), Positives = 122/167 (73%), Gaps = 12/167 (7%)
 Frame = +2

Query  266  MASTPEKAT------LQSRNDSVVAAADGDVLQEWTSSVERQIGQREavaaasplaaVID  427
            MA+T EKAT      + +++ +++  A  D +++WT S       ++ +   + +  +I 
Sbjct  1    MAATQEKATPCCLDAVPAKSSALLRKAS-DPMRDWTVSGSDP--SQDPIRNRAAVPTLIR  57

Query  428  SIEQPPASSAKVSV---LPNTMRAQSRHPLDPLTAAEISvavatvraagatPEVRDSMRF  598
             IE  PA+S   +    +P  +RAQ+ HPL+PL+AAEISVAVATVRAAGATPEVRDSMRF
Sbjct  58   PIETLPATSTNTTAAKGIPVMLRAQTSHPLEPLSAAEISVAVATVRAAGATPEVRDSMRF  117

Query  599  AEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPRQA  739
             EV+LVEPDK+VVALADAYFFPPFQPSLLPRTK GP+IPSKLPPRQA
Sbjct  118  VEVALVEPDKHVVALADAYFFPPFQPSLLPRTKGGPMIPSKLPPRQA  164



>ref|XP_004301007.1| PREDICTED: copper amine oxidase 1-like [Fragaria vesca subsp. 
vesca]
Length=789

 Score =   139 bits (351),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 88/145 (61%), Positives = 110/145 (76%), Gaps = 5/145 (3%)
 Frame = +2

Query  305  NDSVVAAADGDVLQEWTSSVERQIGQREavaaasplaaVIDSIEQPPASSAKVSVLPNTM  484
            +++VV+AA   V ++WT SV     +R+         A+   + +P A +A  + +P  +
Sbjct  33   SNAVVSAA---VAKDWTGSVTED--RRDDQRVPPKKIAMASLVSEPSAKNASAAGIPIMV  87

Query  485  RAQSRHPLDPLTAAEISvavatvraagatPEVRDSMRFAEVSLVEPDKNVVALADAYFFP  664
            R QSRHPL+PL+ AEISVAVATVRAAGATPEVRDSMRF EV L+EPDK+VVALADAYFFP
Sbjct  88   RPQSRHPLEPLSPAEISVAVATVRAAGATPEVRDSMRFVEVVLLEPDKHVVALADAYFFP  147

Query  665  PFQPSLLPRTKKGPVIPSKLPPRQA  739
            PFQP+LLPRTK GP+IPSKLPPR+A
Sbjct  148  PFQPTLLPRTKGGPIIPSKLPPRRA  172



>ref|XP_008239321.1| PREDICTED: copper amine oxidase 1-like [Prunus mume]
Length=784

 Score =   139 bits (351),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 88/147 (60%), Positives = 112/147 (76%), Gaps = 13/147 (9%)
 Frame = +2

Query  308  DSVVAAADGDVLQEWTS---SVERQIGQREavaaasplaaVIDSIEQPPASSAKVSVLPN  478
            ++VV+A+   V+Q+WT+   S +R+  QR            + S+   P+++A  + +P 
Sbjct  30   NAVVSAS---VVQDWTAIAGSEDRRDDQRPKKIG-------MASLITEPSANASTTGIPI  79

Query  479  TMRAQSRHPLDPLTAAEISvavatvraagatPEVRDSMRFAEVSLVEPDKNVVALADAYF  658
             +R Q+RHPLDPL+AAEISVAVATVRAAGATPEVRDSMRF EV L+EPDK+VV LADAYF
Sbjct  80   MLRPQTRHPLDPLSAAEISVAVATVRAAGATPEVRDSMRFVEVVLLEPDKHVVGLADAYF  139

Query  659  FPPFQPSLLPRTKKGPVIPSKLPPRQA  739
            FPPFQPSLLPRTK GP+IP+KLPPR+A
Sbjct  140  FPPFQPSLLPRTKGGPIIPTKLPPRRA  166



>ref|XP_009345773.1| PREDICTED: copper amine oxidase 1-like [Pyrus x bretschneideri]
Length=785

 Score =   139 bits (350),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 91/159 (57%), Positives = 113/159 (71%), Gaps = 8/159 (5%)
 Frame = +2

Query  263  AMASTPEKATLQSRNDSVVAAADGDVLQEWTSSVERQIGQREavaaasplaaVIDSIEQP  442
            ++A  P +A   S N  V A+A    LQ+WTS      G  +      P    + ++   
Sbjct  18   SVALVPREAAQTSSNAVVSASA----LQDWTSVA----GTEDRRDDQRPKKIAMAALIPE  69

Query  443  PASSAKVSVLPNTMRAQSRHPLDPLTAAEISvavatvraagatPEVRDSMRFAEVSLVEP  622
            P+++A  + +   +R Q+RHPLDPL+AAEISVAVATVRAAGATPEVRDSMRF EV L+EP
Sbjct  70   PSANASTTGISIMLRPQTRHPLDPLSAAEISVAVATVRAAGATPEVRDSMRFVEVVLLEP  129

Query  623  DKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPRQA  739
            DK+VVALADAYFFPPFQPSLLPRTK GP+IP+KLPPR+A
Sbjct  130  DKHVVALADAYFFPPFQPSLLPRTKGGPIIPTKLPPRRA  168



>ref|XP_009403621.1| PREDICTED: copper amine oxidase 1-like [Musa acuminata subsp. 
malaccensis]
Length=775

 Score =   139 bits (349),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 80/106 (75%), Positives = 93/106 (88%), Gaps = 1/106 (1%)
 Frame = +2

Query  422  IDSIEQPPASSAKVSVLPNTMRAQSRHPLDPLTAAEISvavatvraagatPEVRDSMRFA  601
            ++ ++ PPA  A +  +P  MRAQ+RHPLDPL+AAEISVAVATVR+AGATPEVRDSMRF 
Sbjct  60   VEDVKDPPAK-ASLPGIPMMMRAQTRHPLDPLSAAEISVAVATVRSAGATPEVRDSMRFV  118

Query  602  EVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPRQA  739
            EV L+EP+KN+VALADAYFFPPFQPSLLPRTK GPVI SKLPPR+A
Sbjct  119  EVVLLEPEKNIVALADAYFFPPFQPSLLPRTKGGPVILSKLPPRRA  164



>ref|XP_008221920.1| PREDICTED: copper amine oxidase 1-like [Prunus mume]
Length=777

 Score =   139 bits (349),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 79/106 (75%), Positives = 92/106 (87%), Gaps = 0/106 (0%)
 Frame = +2

Query  422  IDSIEQPPASSAKVSVLPNTMRAQSRHPLDPLTAAEISvavatvraagatPEVRDSMRFA  601
            I+++  P  ++     +P  +RAQ+ HPL+PL+AAEISVAVATVRAAGATPEVRDSMRF 
Sbjct  59   IETLPAPSTNTTATKGIPVMLRAQTSHPLEPLSAAEISVAVATVRAAGATPEVRDSMRFV  118

Query  602  EVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPRQA  739
            EV+LVEPDK+VVALADAYFFPPFQPSLLPRTK GP+IPSKLPPRQA
Sbjct  119  EVALVEPDKHVVALADAYFFPPFQPSLLPRTKGGPMIPSKLPPRQA  164



>ref|XP_007044780.1| Copper amine oxidase family protein isoform 4 [Theobroma cacao]
 gb|EOY00612.1| Copper amine oxidase family protein isoform 4 [Theobroma cacao]
Length=646

 Score =   137 bits (345),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 99/176 (56%), Positives = 119/176 (68%), Gaps = 21/176 (12%)
 Frame = +2

Query  266  MASTPEKAT---LQSRNDSVVAAADG-------DVLQEWTSSVERQ-IGQREavaaaspl  412
            MAST EKAT   +   ND V             +VLQ W+ +V    +   + +   + +
Sbjct  1    MASTQEKATPCCIPKTNDDVSKKTSSSSSSSSTEVLQNWSLAVGSGPVPSEDPIPKTASM  60

Query  413  aaVIDSIE-------QPPASSAKVSVLPNTMRAQSRHPLDPLTAAEISvavatvraagat  571
            A +I  +E          A++  +S++P   RAQ+ HPLDPL+AAEISVAVATVRAAGAT
Sbjct  61   ATLIRPVEPISDPSAAKIATTKGISIMP---RAQTSHPLDPLSAAEISVAVATVRAAGAT  117

Query  572  PEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPRQA  739
            PEVRDSMRF EV LVEPDK+VVALADAYFFPPFQPSLLPRTK GP+IPSKLPPRQA
Sbjct  118  PEVRDSMRFIEVVLVEPDKHVVALADAYFFPPFQPSLLPRTKGGPLIPSKLPPRQA  173



>gb|AGZ20104.1| copper methylamine oxidase-like protein [Camellia sinensis]
Length=751

 Score =   138 bits (347),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 80/101 (79%), Positives = 86/101 (85%), Gaps = 0/101 (0%)
 Frame = +2

Query  437  QPPASSAKVSVLPNTMRAQSRHPLDPLTAAEISvavatvraagatPEVRDSMRFAEVSLV  616
            QP  +      LP  +RAQ+RHPLDPLTAAEISVAV TVRAAGATPEVRD MRF EV L+
Sbjct  38   QPSLNPTSSKGLPVMVRAQTRHPLDPLTAAEISVAVVTVRAAGATPEVRDGMRFIEVVLL  97

Query  617  EPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPRQA  739
            EPDK+VVALADAYFFPPFQPSLLPRTK GP+IPSKLPPRQA
Sbjct  98   EPDKHVVALADAYFFPPFQPSLLPRTKGGPLIPSKLPPRQA  138



>ref|XP_009362949.1| PREDICTED: copper amine oxidase 1-like [Pyrus x bretschneideri]
Length=785

 Score =   138 bits (347),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 90/159 (57%), Positives = 112/159 (70%), Gaps = 8/159 (5%)
 Frame = +2

Query  263  AMASTPEKATLQSRNDSVVAAADGDVLQEWTSSVERQIGQREavaaasplaaVIDSIEQP  442
            ++A  P +A   S N  V A+A    LQ+WTS      G  +      P    + ++   
Sbjct  18   SVALVPREAAQTSSNAVVSASA----LQDWTSVA----GTEDRRDDQRPKKIAMAALIPE  69

Query  443  PASSAKVSVLPNTMRAQSRHPLDPLTAAEISvavatvraagatPEVRDSMRFAEVSLVEP  622
            P+++A  + +   +R Q+RHPLDPL+AAEISVAVATVRAAGATPEVRD MRF EV L+EP
Sbjct  70   PSANASTTGISIMLRPQTRHPLDPLSAAEISVAVATVRAAGATPEVRDGMRFVEVVLLEP  129

Query  623  DKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPRQA  739
            DK+VVALADAYFFPPFQPSLLPRTK GP+IP+KLPPR+A
Sbjct  130  DKHVVALADAYFFPPFQPSLLPRTKGGPIIPTKLPPRRA  168



>ref|XP_008351782.1| PREDICTED: peroxisomal primary amine oxidase-like [Malus domestica]
Length=570

 Score =   136 bits (342),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 85/148 (57%), Positives = 109/148 (74%), Gaps = 7/148 (5%)
 Frame = +2

Query  296  QSRNDSVVAAADGDVLQEWTSSVERQIGQREavaaasplaaVIDSIEQPPASSAKVSVLP  475
            Q+ +++VV+A+    +Q+WT       G  +      P    + ++   P+++A  + + 
Sbjct  31   QTSSNAVVSAS---AVQDWTGVT----GAEDRRDDQRPKKIAMAALIPEPSANASTTGIS  83

Query  476  NTMRAQSRHPLDPLTAAEISvavatvraagatPEVRDSMRFAEVSLVEPDKNVVALADAY  655
              +R Q+RHPLDPL+AAEISVAVATVRAAGATPEVRD MRF EV LVEPDK+VVALADAY
Sbjct  84   IMLRPQTRHPLDPLSAAEISVAVATVRAAGATPEVRDGMRFVEVVLVEPDKHVVALADAY  143

Query  656  FFPPFQPSLLPRTKKGPVIPSKLPPRQA  739
            FFPPFQPSLLPRTK GP+IP+KLPPR+A
Sbjct  144  FFPPFQPSLLPRTKGGPIIPTKLPPRRA  171



>ref|XP_006584632.1| PREDICTED: peroxisomal copper-containing amine oxidase isoform 
X2 [Glycine max]
Length=611

 Score =   136 bits (342),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 82/108 (76%), Positives = 93/108 (86%), Gaps = 5/108 (5%)
 Frame = +2

Query  422  IDSIEQPP--ASSAKVSVLPNTMRAQSRHPLDPLTAAEISvavatvraagatPEVRDSMR  595
            I +I+ PP  AS+  ++V+   +RAQ+ HPLDPLTAAEISVAVATVRAAGATPEVRD MR
Sbjct  49   ISAIDSPPKTASAKGITVM---VRAQTSHPLDPLTAAEISVAVATVRAAGATPEVRDGMR  105

Query  596  FAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPRQA  739
            F EV LVEP+K VVALADAYFFPPFQPSLLPRTK GPVIP+KLPPR+A
Sbjct  106  FIEVDLVEPEKQVVALADAYFFPPFQPSLLPRTKGGPVIPTKLPPRKA  153



>ref|XP_007044779.1| Copper amine oxidase family protein isoform 3 [Theobroma cacao]
 gb|EOY00611.1| Copper amine oxidase family protein isoform 3 [Theobroma cacao]
Length=754

 Score =   137 bits (345),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 99/176 (56%), Positives = 119/176 (68%), Gaps = 21/176 (12%)
 Frame = +2

Query  266  MASTPEKAT---LQSRNDSVVAAADG-------DVLQEWTSSVERQ-IGQREavaaaspl  412
            MAST EKAT   +   ND V             +VLQ W+ +V    +   + +   + +
Sbjct  1    MASTQEKATPCCIPKTNDDVSKKTSSSSSSSSTEVLQNWSLAVGSGPVPSEDPIPKTASM  60

Query  413  aaVIDSIE-------QPPASSAKVSVLPNTMRAQSRHPLDPLTAAEISvavatvraagat  571
            A +I  +E          A++  +S++P   RAQ+ HPLDPL+AAEISVAVATVRAAGAT
Sbjct  61   ATLIRPVEPISDPSAAKIATTKGISIMP---RAQTSHPLDPLSAAEISVAVATVRAAGAT  117

Query  572  PEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPRQA  739
            PEVRDSMRF EV LVEPDK+VVALADAYFFPPFQPSLLPRTK GP+IPSKLPPRQA
Sbjct  118  PEVRDSMRFIEVVLVEPDKHVVALADAYFFPPFQPSLLPRTKGGPLIPSKLPPRQA  173



>gb|AIS23648.1| amine oxidase 5 [Malus domestica]
Length=788

 Score =   137 bits (345),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 77/99 (78%), Positives = 90/99 (91%), Gaps = 0/99 (0%)
 Frame = +2

Query  443  PASSAKVSVLPNTMRAQSRHPLDPLTAAEISvavatvraagatPEVRDSMRFAEVSLVEP  622
            P+++A  + +P  +R Q+RHPLDPL+AAEISVAVATVRAAGATPEVRDSMRF EV L+EP
Sbjct  73   PSANASTAGIPIMLRPQTRHPLDPLSAAEISVAVATVRAAGATPEVRDSMRFVEVVLLEP  132

Query  623  DKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPRQA  739
            DK+VVALADAYFFPPFQPSLLPRTK GP+IP+KLPPR+A
Sbjct  133  DKHVVALADAYFFPPFQPSLLPRTKGGPIIPTKLPPRRA  171



>ref|XP_008380537.1| PREDICTED: copper amine oxidase 1-like [Malus domestica]
Length=788

 Score =   137 bits (345),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 77/99 (78%), Positives = 90/99 (91%), Gaps = 0/99 (0%)
 Frame = +2

Query  443  PASSAKVSVLPNTMRAQSRHPLDPLTAAEISvavatvraagatPEVRDSMRFAEVSLVEP  622
            P+++A  + +P  +R Q+RHPLDPL+AAEISVAVATVRAAGATPEVRDSMRF EV L+EP
Sbjct  73   PSANASTAGIPIMLRPQTRHPLDPLSAAEISVAVATVRAAGATPEVRDSMRFVEVVLLEP  132

Query  623  DKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPRQA  739
            DK+VVALADAYFFPPFQPSLLPRTK GP+IP+KLPPR+A
Sbjct  133  DKHVVALADAYFFPPFQPSLLPRTKGGPIIPTKLPPRRA  171



>ref|XP_007036330.1| Copper amine oxidase family protein isoform 2 [Theobroma cacao]
 gb|EOY20831.1| Copper amine oxidase family protein isoform 2 [Theobroma cacao]
Length=755

 Score =   137 bits (345),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 92/138 (67%), Positives = 107/138 (78%), Gaps = 11/138 (8%)
 Frame = +2

Query  344  QEWT-SSVERQIGQREavaaasplaaVIDSIEQPPASSA-----KVSVLPNTMRAQSRHP  505
            QEWT +S +R+  QR   AA + L   +DS+  P  S+A      + +LP   RAQ+ HP
Sbjct  48   QEWTVASRDRRDDQRATKAAMASLIHPVDSL--PDTSTAAPSTKGIQILP---RAQTSHP  102

Query  506  LDPLTAAEISvavatvraagatPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLL  685
            LDPL+AAEISVAVATVRAAGATPEVRD MRF EV L+EPDK+VVALADAYFFPPFQPSLL
Sbjct  103  LDPLSAAEISVAVATVRAAGATPEVRDGMRFVEVVLLEPDKHVVALADAYFFPPFQPSLL  162

Query  686  PRTKKGPVIPSKLPPRQA  739
            PRTK GPVIP+KLPPR+A
Sbjct  163  PRTKGGPVIPTKLPPRRA  180



>ref|XP_011047814.1| PREDICTED: copper amine oxidase 1-like isoform X1 [Populus euphratica]
Length=774

 Score =   137 bits (345),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 79/108 (73%), Positives = 94/108 (87%), Gaps = 1/108 (1%)
 Frame = +2

Query  419  VIDSIEQP-PASSAKVSVLPNTMRAQSRHPLDPLTAAEISvavatvraagatPEVRDSMR  595
            V+DS+ +P   +S   +V+P  +RAQ+ HPLDPL+AAEISVAVATVRAAGATPE+RDSMR
Sbjct  50   VVDSLPEPSKTASGTKTVIPVMLRAQTSHPLDPLSAAEISVAVATVRAAGATPELRDSMR  109

Query  596  FAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPRQA  739
            F EV L EPDK+VVALADAYFFPPFQPSLLPR+K GP+IP+KLPPR+A
Sbjct  110  FVEVVLFEPDKHVVALADAYFFPPFQPSLLPRSKGGPIIPTKLPPRRA  157



>ref|XP_007044778.1| Copper amine oxidase family protein isoform 2 [Theobroma cacao]
 gb|EOY00610.1| Copper amine oxidase family protein isoform 2 [Theobroma cacao]
Length=769

 Score =   137 bits (344),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 99/176 (56%), Positives = 119/176 (68%), Gaps = 21/176 (12%)
 Frame = +2

Query  266  MASTPEKAT---LQSRNDSVVAAADG-------DVLQEWTSSVERQ-IGQREavaaaspl  412
            MAST EKAT   +   ND V             +VLQ W+ +V    +   + +   + +
Sbjct  1    MASTQEKATPCCIPKTNDDVSKKTSSSSSSSSTEVLQNWSLAVGSGPVPSEDPIPKTASM  60

Query  413  aaVIDSIE-------QPPASSAKVSVLPNTMRAQSRHPLDPLTAAEISvavatvraagat  571
            A +I  +E          A++  +S++P   RAQ+ HPLDPL+AAEISVAVATVRAAGAT
Sbjct  61   ATLIRPVEPISDPSAAKIATTKGISIMP---RAQTSHPLDPLSAAEISVAVATVRAAGAT  117

Query  572  PEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPRQA  739
            PEVRDSMRF EV LVEPDK+VVALADAYFFPPFQPSLLPRTK GP+IPSKLPPRQA
Sbjct  118  PEVRDSMRFIEVVLVEPDKHVVALADAYFFPPFQPSLLPRTKGGPLIPSKLPPRQA  173



>ref|XP_002322194.2| hypothetical protein POPTR_0015s09450g [Populus trichocarpa]
 gb|EEF06321.2| hypothetical protein POPTR_0015s09450g [Populus trichocarpa]
Length=773

 Score =   137 bits (344),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 80/108 (74%), Positives = 94/108 (87%), Gaps = 1/108 (1%)
 Frame = +2

Query  419  VIDSIEQPP-ASSAKVSVLPNTMRAQSRHPLDPLTAAEISvavatvraagatPEVRDSMR  595
            V+DS+ +P   +SA  + +P  +RAQ+ HPLDPL+AAEISVAVATVRAAGATPE+RDSMR
Sbjct  53   VVDSLPEPSRTASATKTAIPVMLRAQTSHPLDPLSAAEISVAVATVRAAGATPELRDSMR  112

Query  596  FAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPRQA  739
            F EV L+EPDK+VVALADAYFFPPFQPSLLPRTK GP+IP KLPPR+A
Sbjct  113  FIEVVLLEPDKHVVALADAYFFPPFQPSLLPRTKGGPIIPMKLPPRRA  160



>ref|XP_003551224.1| PREDICTED: peroxisomal primary amine oxidase-like isoform X1 
[Glycine max]
 gb|KHN07220.1| Primary amine oxidase [Glycine soja]
Length=764

 Score =   137 bits (344),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 83/108 (77%), Positives = 94/108 (87%), Gaps = 5/108 (5%)
 Frame = +2

Query  422  IDSIEQPP--ASSAKVSVLPNTMRAQSRHPLDPLTAAEISvavatvraagatPEVRDSMR  595
            I +I+ PP  AS+  ++V+   +RAQ+ HPLDPLTAAEISVAVATVRAAGATPEVRDSMR
Sbjct  47   ISAIDSPPKTASAKGITVM---VRAQTSHPLDPLTAAEISVAVATVRAAGATPEVRDSMR  103

Query  596  FAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPRQA  739
            F EV LVEP+K VVALADAYFFPPFQPSLLPRTK GPVIP+KLPPR+A
Sbjct  104  FIEVDLVEPEKQVVALADAYFFPPFQPSLLPRTKGGPVIPTKLPPRKA  151



>ref|XP_007044777.1| Copper amine oxidase family protein isoform 1 [Theobroma cacao]
 gb|EOY00609.1| Copper amine oxidase family protein isoform 1 [Theobroma cacao]
Length=797

 Score =   137 bits (344),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 80/98 (82%), Positives = 89/98 (91%), Gaps = 3/98 (3%)
 Frame = +2

Query  446  ASSAKVSVLPNTMRAQSRHPLDPLTAAEISvavatvraagatPEVRDSMRFAEVSLVEPD  625
            A++  +S++P   RAQ+ HPLDPL+AAEISVAVATVRAAGATPEVRDSMRF EV LVEPD
Sbjct  90   ATTKGISIMP---RAQTSHPLDPLSAAEISVAVATVRAAGATPEVRDSMRFIEVVLVEPD  146

Query  626  KNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPRQA  739
            K+VVALADAYFFPPFQPSLLPRTK GP+IPSKLPPRQA
Sbjct  147  KHVVALADAYFFPPFQPSLLPRTKGGPLIPSKLPPRQA  184



>ref|XP_007036329.1| Copper amine oxidase family protein isoform 1 [Theobroma cacao]
 gb|EOY20830.1| Copper amine oxidase family protein isoform 1 [Theobroma cacao]
Length=797

 Score =   137 bits (344),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 92/138 (67%), Positives = 107/138 (78%), Gaps = 11/138 (8%)
 Frame = +2

Query  344  QEWT-SSVERQIGQREavaaasplaaVIDSIEQPPASSA-----KVSVLPNTMRAQSRHP  505
            QEWT +S +R+  QR   AA + L   +DS+  P  S+A      + +LP   RAQ+ HP
Sbjct  48   QEWTVASRDRRDDQRATKAAMASLIHPVDSL--PDTSTAAPSTKGIQILP---RAQTSHP  102

Query  506  LDPLTAAEISvavatvraagatPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLL  685
            LDPL+AAEISVAVATVRAAGATPEVRD MRF EV L+EPDK+VVALADAYFFPPFQPSLL
Sbjct  103  LDPLSAAEISVAVATVRAAGATPEVRDGMRFVEVVLLEPDKHVVALADAYFFPPFQPSLL  162

Query  686  PRTKKGPVIPSKLPPRQA  739
            PRTK GPVIP+KLPPR+A
Sbjct  163  PRTKGGPVIPTKLPPRRA  180



>ref|XP_002527922.1| copper amine oxidase, putative [Ricinus communis]
 gb|EEF34479.1| copper amine oxidase, putative [Ricinus communis]
Length=795

 Score =   137 bits (344),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 87/141 (62%), Positives = 103/141 (73%), Gaps = 7/141 (5%)
 Frame = +2

Query  338  VLQEWTSSVERQIGQ-----REavaaasplaaVIDSIEQP--PASSAKVSVLPNTMRAQS  496
            VLQ+W+ +    + Q     R +    S L   +DS+  P  P +      +P   RAQ+
Sbjct  41   VLQDWSVAPVSNLAQDPIRDRSSTTTMSSLIQPVDSLTDPTPPPNPVSAKGIPTMTRAQT  100

Query  497  RHPLDPLTAAEISvavatvraagatPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQP  676
             HPLDPLTAAEISVAVATVRAAGATPEVRDSMRF EV L+EP+KNVVALADAYFFPPFQP
Sbjct  101  SHPLDPLTAAEISVAVATVRAAGATPEVRDSMRFVEVVLLEPEKNVVALADAYFFPPFQP  160

Query  677  SLLPRTKKGPVIPSKLPPRQA  739
            SL+PRTK GP+IP+KLPPR+A
Sbjct  161  SLIPRTKGGPLIPTKLPPRKA  181



>emb|CDP12746.1| unnamed protein product [Coffea canephora]
Length=773

 Score =   136 bits (343),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 91/158 (58%), Positives = 109/158 (69%), Gaps = 2/158 (1%)
 Frame = +2

Query  266  MASTPEKATLQSRNDSVVAAADGDVLQEWTSSVERQIGQREavaaasplaaVIDSIEQPP  445
            MA+  +KAT  S   SV A A   +++   ++V   +  ++     +    V   +   P
Sbjct  1    MAAVTQKATPPSPTSSVAAGASSVLVRREAAAVASAL--QDWNDDHTGKKQVASVVRSEP  58

Query  446  ASSAKVSVLPNTMRAQSRHPLDPLTAAEISvavatvraagatPEVRDSMRFAEVSLVEPD  625
            AS+A    +    RAQ+ HPLDPLTAAEISVAVATVRAAGATPEVRD MRF EV L+EP+
Sbjct  59   ASNASNKGIQLLQRAQTCHPLDPLTAAEISVAVATVRAAGATPEVRDGMRFVEVVLLEPE  118

Query  626  KNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPRQA  739
            KNVVALADAYFFPPFQPSLLPRTK GP IPSKLPPR+A
Sbjct  119  KNVVALADAYFFPPFQPSLLPRTKGGPAIPSKLPPRRA  156



>ref|XP_007158407.1| hypothetical protein PHAVU_002G150400g [Phaseolus vulgaris]
 gb|ESW30401.1| hypothetical protein PHAVU_002G150400g [Phaseolus vulgaris]
Length=769

 Score =   136 bits (343),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 93/159 (58%), Positives = 110/159 (69%), Gaps = 4/159 (3%)
 Frame = +2

Query  266  MASTPEKATLQSRNDSVVAAADGDVLQEWTSSVERQIGQREavaaasplaaVIDSI-EQP  442
            MA+  EKAT  + +++  A+    V   W          R    + S L + +DS  + P
Sbjct  1    MATAQEKATPNNLSNNPTASNSSAVPSSWAHPTADPFRNR---PSVSALVSAVDSFPDPP  57

Query  443  PASSAKVSVLPNTMRAQSRHPLDPLTAAEISvavatvraagatPEVRDSMRFAEVSLVEP  622
            P +++    +P  MR Q+ HPLDPL+AAEISVAVATVRAAGATPEVRDSMRF EV LVEP
Sbjct  58   PKTTSTTKGIPVMMRVQTCHPLDPLSAAEISVAVATVRAAGATPEVRDSMRFVEVVLVEP  117

Query  623  DKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPRQA  739
             K VVALADAYFFPPFQPSLLPRTK GPVIPSKLPPR+A
Sbjct  118  AKQVVALADAYFFPPFQPSLLPRTKGGPVIPSKLPPRRA  156



>ref|XP_011047815.1| PREDICTED: copper amine oxidase 1-like isoform X2 [Populus euphratica]
Length=771

 Score =   136 bits (342),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 95/107 (89%), Gaps = 2/107 (2%)
 Frame = +2

Query  419  VIDSIEQPPASSAKVSVLPNTMRAQSRHPLDPLTAAEISvavatvraagatPEVRDSMRF  598
            V+DS+ +P  +++  +V+P  +RAQ+ HPLDPL+AAEISVAVATVRAAGATPE+RDSMRF
Sbjct  50   VVDSLPEPSKTAS--AVIPVMLRAQTSHPLDPLSAAEISVAVATVRAAGATPELRDSMRF  107

Query  599  AEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPRQA  739
             EV L EPDK+VVALADAYFFPPFQPSLLPR+K GP+IP+KLPPR+A
Sbjct  108  VEVVLFEPDKHVVALADAYFFPPFQPSLLPRSKGGPIIPTKLPPRRA  154



>gb|KHN00390.1| Copper methylamine oxidase [Glycine soja]
Length=770

 Score =   136 bits (342),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 80/107 (75%), Positives = 90/107 (84%), Gaps = 1/107 (1%)
 Frame = +2

Query  422  IDSIEQPP-ASSAKVSVLPNTMRAQSRHPLDPLTAAEISvavatvraagatPEVRDSMRF  598
            +DS   PP  +++    +P   RAQ+ HPLDPL+AAEISVAVATVRAAGATPEVRDSMRF
Sbjct  41   VDSFSDPPPNTTSTTKGIPVMTRAQTCHPLDPLSAAEISVAVATVRAAGATPEVRDSMRF  100

Query  599  AEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPRQA  739
             EV LVEPDK VVALADAYFFPPFQPSLLPRTK GP+IP+KLPPR+A
Sbjct  101  VEVVLVEPDKQVVALADAYFFPPFQPSLLPRTKGGPLIPTKLPPRKA  147



>ref|XP_003519633.1| PREDICTED: copper amine oxidase 1-like [Glycine max]
Length=760

 Score =   136 bits (342),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 80/107 (75%), Positives = 90/107 (84%), Gaps = 1/107 (1%)
 Frame = +2

Query  422  IDSIEQPP-ASSAKVSVLPNTMRAQSRHPLDPLTAAEISvavatvraagatPEVRDSMRF  598
            +DS   PP  +++    +P   RAQ+ HPLDPL+AAEISVAVATVRAAGATPEVRDSMRF
Sbjct  41   VDSFSDPPPNTTSTTKGIPVMTRAQTCHPLDPLSAAEISVAVATVRAAGATPEVRDSMRF  100

Query  599  AEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPRQA  739
             EV LVEPDK VVALADAYFFPPFQPSLLPRTK GP+IP+KLPPR+A
Sbjct  101  VEVVLVEPDKQVVALADAYFFPPFQPSLLPRTKGGPLIPTKLPPRKA  147



>ref|XP_004309984.2| PREDICTED: copper amine oxidase 1-like [Fragaria vesca subsp. 
vesca]
Length=780

 Score =   136 bits (342),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 79/90 (88%), Positives = 84/90 (93%), Gaps = 0/90 (0%)
 Frame = +2

Query  470  LPNTMRAQSRHPLDPLTAAEISvavatvraagatPEVRDSMRFAEVSLVEPDKNVVALAD  649
            LP  +RAQS HPL+PL+AAEISVAVATVRAAGATPEVRDSMRF EV+LVEPDK VVALAD
Sbjct  78   LPVMLRAQSSHPLEPLSAAEISVAVATVRAAGATPEVRDSMRFVEVALVEPDKRVVALAD  137

Query  650  AYFFPPFQPSLLPRTKKGPVIPSKLPPRQA  739
            AYFFPPFQPSLLPRTK GP+IPSKLPPRQA
Sbjct  138  AYFFPPFQPSLLPRTKGGPMIPSKLPPRQA  167



>ref|XP_006584631.1| PREDICTED: peroxisomal copper-containing amine oxidase isoform 
X1 [Glycine max]
Length=766

 Score =   136 bits (342),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 82/108 (76%), Positives = 93/108 (86%), Gaps = 5/108 (5%)
 Frame = +2

Query  422  IDSIEQPP--ASSAKVSVLPNTMRAQSRHPLDPLTAAEISvavatvraagatPEVRDSMR  595
            I +I+ PP  AS+  ++V+   +RAQ+ HPLDPLTAAEISVAVATVRAAGATPEVRD MR
Sbjct  49   ISAIDSPPKTASAKGITVM---VRAQTSHPLDPLTAAEISVAVATVRAAGATPEVRDGMR  105

Query  596  FAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPRQA  739
            F EV LVEP+K VVALADAYFFPPFQPSLLPRTK GPVIP+KLPPR+A
Sbjct  106  FIEVDLVEPEKQVVALADAYFFPPFQPSLLPRTKGGPVIPTKLPPRKA  153



>gb|KDP26650.1| hypothetical protein JCGZ_17808 [Jatropha curcas]
Length=669

 Score =   135 bits (340),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 76/85 (89%), Positives = 80/85 (94%), Gaps = 0/85 (0%)
 Frame = +2

Query  485  RAQSRHPLDPLTAAEISvavatvraagatPEVRDSMRFAEVSLVEPDKNVVALADAYFFP  664
            RAQ+ HPLDPLTAAEISVAV TVRAAGATPEVRDSMRF EV L+EPDKNVVALADAYFFP
Sbjct  88   RAQTSHPLDPLTAAEISVAVGTVRAAGATPEVRDSMRFVEVVLLEPDKNVVALADAYFFP  147

Query  665  PFQPSLLPRTKKGPVIPSKLPPRQA  739
            PFQPSLLPRTK GPVIP+KLPPR+A
Sbjct  148  PFQPSLLPRTKGGPVIPTKLPPRKA  172



>gb|KHN13432.1| Copper methylamine oxidase [Glycine soja]
Length=738

 Score =   135 bits (341),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 82/108 (76%), Positives = 93/108 (86%), Gaps = 5/108 (5%)
 Frame = +2

Query  422  IDSIEQPP--ASSAKVSVLPNTMRAQSRHPLDPLTAAEISvavatvraagatPEVRDSMR  595
            I +I+ PP  AS+  ++V+   +RAQ+ HPLDPLTAAEISVAVATVRAAGATPEVRD MR
Sbjct  49   ISAIDSPPKTASAKGITVM---VRAQTSHPLDPLTAAEISVAVATVRAAGATPEVRDGMR  105

Query  596  FAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPRQA  739
            F EV LVEP+K VVALADAYFFPPFQPSLLPRTK GPVIP+KLPPR+A
Sbjct  106  FIEVDLVEPEKQVVALADAYFFPPFQPSLLPRTKGGPVIPTKLPPRKA  153



>gb|AIS23647.1| amine oxidase 4 [Malus domestica]
Length=788

 Score =   136 bits (342),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 85/148 (57%), Positives = 109/148 (74%), Gaps = 7/148 (5%)
 Frame = +2

Query  296  QSRNDSVVAAADGDVLQEWTSSVERQIGQREavaaasplaaVIDSIEQPPASSAKVSVLP  475
            Q+ +++VV+A+    +Q+WT       G  +      P    + ++   P+++A  + + 
Sbjct  31   QTSSNAVVSAS---AVQDWTGVT----GAEDRRDDQRPKKIAMAALIPEPSANASTTGIS  83

Query  476  NTMRAQSRHPLDPLTAAEISvavatvraagatPEVRDSMRFAEVSLVEPDKNVVALADAY  655
              +R Q+RHPLDPL+AAEISVAVATVRAAGATPEVRD MRF EV LVEPDK+VVALADAY
Sbjct  84   IMLRPQTRHPLDPLSAAEISVAVATVRAAGATPEVRDGMRFVEVVLVEPDKHVVALADAY  143

Query  656  FFPPFQPSLLPRTKKGPVIPSKLPPRQA  739
            FFPPFQPSLLPRTK GP+IP+KLPPR+A
Sbjct  144  FFPPFQPSLLPRTKGGPIIPTKLPPRRA  171



>ref|XP_007158406.1| hypothetical protein PHAVU_002G150400g [Phaseolus vulgaris]
 gb|ESW30400.1| hypothetical protein PHAVU_002G150400g [Phaseolus vulgaris]
Length=757

 Score =   135 bits (341),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 81/107 (76%), Positives = 90/107 (84%), Gaps = 1/107 (1%)
 Frame = +2

Query  422  IDSI-EQPPASSAKVSVLPNTMRAQSRHPLDPLTAAEISvavatvraagatPEVRDSMRF  598
            +DS  + PP +++    +P  MR Q+ HPLDPL+AAEISVAVATVRAAGATPEVRDSMRF
Sbjct  38   VDSFPDPPPKTTSTTKGIPVMMRVQTCHPLDPLSAAEISVAVATVRAAGATPEVRDSMRF  97

Query  599  AEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPRQA  739
             EV LVEP K VVALADAYFFPPFQPSLLPRTK GPVIPSKLPPR+A
Sbjct  98   VEVVLVEPAKQVVALADAYFFPPFQPSLLPRTKGGPVIPSKLPPRRA  144



>ref|XP_002318664.1| hypothetical protein POPTR_0012s08630g [Populus trichocarpa]
 gb|EEE96884.1| hypothetical protein POPTR_0012s08630g [Populus trichocarpa]
Length=751

 Score =   135 bits (341),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 78/107 (73%), Positives = 95/107 (89%), Gaps = 2/107 (2%)
 Frame = +2

Query  419  VIDSIEQPPASSAKVSVLPNTMRAQSRHPLDPLTAAEISvavatvraagatPEVRDSMRF  598
            V+DS+ +P  +++  +V+P  +RAQ+ HPLDPL+AAEISVAVATVRAAGATPE+RDSMRF
Sbjct  50   VVDSLPEPSKTAS--AVIPVMLRAQTSHPLDPLSAAEISVAVATVRAAGATPELRDSMRF  107

Query  599  AEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPRQA  739
             EV L EPDK+VVALADAYFFPPFQPSLLPR+K GP+IP+KLPPR+A
Sbjct  108  VEVVLFEPDKHVVALADAYFFPPFQPSLLPRSKGGPIIPTKLPPRRA  154



>ref|XP_011046219.1| PREDICTED: copper amine oxidase 1-like [Populus euphratica]
Length=777

 Score =   135 bits (341),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 79/108 (73%), Positives = 93/108 (86%), Gaps = 1/108 (1%)
 Frame = +2

Query  419  VIDSIEQPP-ASSAKVSVLPNTMRAQSRHPLDPLTAAEISvavatvraagatPEVRDSMR  595
            V+DS+ +P   +S   + +P  +RAQ+ HPLDPL+AAEISVAVATVRAAGATPE+RDSMR
Sbjct  53   VVDSLPKPSRTASGTKTAIPVMLRAQTSHPLDPLSAAEISVAVATVRAAGATPELRDSMR  112

Query  596  FAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPRQA  739
            F EV L+EPDK+VVALADAYFFPPFQPSLLPRTK GP+IP KLPPR+A
Sbjct  113  FIEVVLLEPDKHVVALADAYFFPPFQPSLLPRTKGGPIIPMKLPPRRA  160



>ref|XP_006411506.1| hypothetical protein EUTSA_v100163160mg, partial [Eutrema salsugineum]
 gb|ESQ52959.1| hypothetical protein EUTSA_v100163160mg, partial [Eutrema salsugineum]
Length=392

 Score =   131 bits (330),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 90/166 (54%), Positives = 114/166 (69%), Gaps = 12/166 (7%)
 Frame = +2

Query  266  MASTPEKATLQSRNDSV-----VAAADGDVLQEWTSSVERQIGQREavaaasplaaVIDS  430
            MAST +KAT  + +        +A+A  + +  W+        QR +  A   +   +DS
Sbjct  1    MASTSKKATACAHHGGSAPPPKLASAVSNTVAGWSGGSSEGENQRASKLALESVIRPVDS  60

Query  431  I---EQPPASSAKVSVLPNTMRAQSRHPLDPLTAAEISvavatvraagatPEVRDSMRFA  601
            +    + PA+   +SV+P   R +++HPLDPL+AAEISVAVATVRAAGA PEVRDSMRF 
Sbjct  61   LPDTAKKPANKG-ISVMP---RTETKHPLDPLSAAEISVAVATVRAAGANPEVRDSMRFI  116

Query  602  EVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPRQA  739
            EV+ VEP+K+VVALADAYFFPPFQPSLLPR K GPVIP KLPPR+A
Sbjct  117  EVASVEPEKHVVALADAYFFPPFQPSLLPRNKAGPVIPMKLPPRRA  162



>ref|XP_010646479.1| PREDICTED: copper amine oxidase 1 isoform X2 [Vitis vinifera]
Length=700

 Score =   134 bits (336),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 77/86 (90%), Positives = 82/86 (95%), Gaps = 0/86 (0%)
 Frame = +2

Query  482  MRAQSRHPLDPLTAAEISvavatvraagatPEVRDSMRFAEVSLVEPDKNVVALADAYFF  661
            +RAQ+ HPLDPL+AAEISVAVATVRAAGATPEVRDSMRF EV LVEP+K+VVALADAYFF
Sbjct  2    LRAQTSHPLDPLSAAEISVAVATVRAAGATPEVRDSMRFVEVVLVEPEKHVVALADAYFF  61

Query  662  PPFQPSLLPRTKKGPVIPSKLPPRQA  739
            PPFQPSLLPRTK GPVIPSKLPPRQA
Sbjct  62   PPFQPSLLPRTKGGPVIPSKLPPRQA  87



>emb|CAN62304.1| hypothetical protein VITISV_023689 [Vitis vinifera]
Length=706

 Score =   134 bits (336),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 77/86 (90%), Positives = 82/86 (95%), Gaps = 0/86 (0%)
 Frame = +2

Query  482  MRAQSRHPLDPLTAAEISvavatvraagatPEVRDSMRFAEVSLVEPDKNVVALADAYFF  661
            +RAQ+ HPLDPL+AAEISVAVATVRAAGATPEVRDSMRF EV LVEP+K+VVALADAYFF
Sbjct  2    LRAQTSHPLDPLSAAEISVAVATVRAAGATPEVRDSMRFVEVVLVEPEKHVVALADAYFF  61

Query  662  PPFQPSLLPRTKKGPVIPSKLPPRQA  739
            PPFQPSLLPRTK GPVIPSKLPPRQA
Sbjct  62   PPFQPSLLPRTKGGPVIPSKLPPRQA  87



>ref|XP_006476867.1| PREDICTED: copper amine oxidase 1-like isoform X1 [Citrus sinensis]
Length=775

 Score =   134 bits (337),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 99/167 (59%), Positives = 118/167 (71%), Gaps = 18/167 (11%)
 Frame = +2

Query  266  MASTPEKATLQSRN------DSV-VAAADGDVLQEWTSSVERQIGQREavaaasplaaVI  424
            MAST +KATL S +      DSV V+A    ++++W+S       Q    AA + L   +
Sbjct  1    MASTSKKATLSSFSAQALAQDSVSVSAPRASMVRDWSSD------QPPKNAAIASLIRPV  54

Query  425  DSIEQPPA--SSAKVSVLPNTMRAQSRHPLDPLTAAEISvavatvraagatPEVRDSMRF  598
            D + +  +  SS  ++ +P   R Q+ HPLDPL+ AEISVAVATVRAAG TPEVRDSMRF
Sbjct  55   DPLAETSSNPSSKGITAMP---RPQTSHPLDPLSPAEISVAVATVRAAGPTPEVRDSMRF  111

Query  599  AEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPRQA  739
             EV LVEPDKNVVALADAYFFPPFQPSLLPRTK GPVIPSKLPPR+A
Sbjct  112  VEVVLVEPDKNVVALADAYFFPPFQPSLLPRTKGGPVIPSKLPPRRA  158



>ref|XP_009404245.1| PREDICTED: copper amine oxidase 1-like [Musa acuminata subsp. 
malaccensis]
Length=767

 Score =   134 bits (336),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 96/160 (60%), Positives = 107/160 (67%), Gaps = 6/160 (4%)
 Frame = +2

Query  266  MASTPEKATLQSRNDSVVAAADGDVLQEWTSSVERQIGQREavaaasplaaVIDSIEQPP  445
            MA+T EKAT        V  A G V QEW    + +   R A      +  +I   E  P
Sbjct  1    MAATQEKATHADPPICDVVGAKGAV-QEWVPVADER---RAAAPQVEAVGKLIAPAEDVP  56

Query  446  ASSAKVS--VLPNTMRAQSRHPLDPLTAAEISvavatvraagatPEVRDSMRFAEVSLVE  619
            A   K S   +P  MRAQ+ HPLDPL+AAEI VAVATVRAAGATPEVRD MRF EV L+E
Sbjct  57   APPMKPSSKAIPIVMRAQNSHPLDPLSAAEILVAVATVRAAGATPEVRDGMRFIEVVLLE  116

Query  620  PDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPRQA  739
            P+KNVVALADAYFFPPFQPSLLPRTK GPVI  KLPPR+A
Sbjct  117  PEKNVVALADAYFFPPFQPSLLPRTKGGPVILGKLPPRRA  156



>gb|KDO69507.1| hypothetical protein CISIN_1g004084mg [Citrus sinensis]
Length=735

 Score =   133 bits (335),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 99/171 (58%), Positives = 116/171 (68%), Gaps = 26/171 (15%)
 Frame = +2

Query  266  MASTPEKATLQSRN------DSV-VAAADGDVLQEWTSSVERQIGQREavaaasplaaVI  424
            MAST +KATL S +      DSV V+A    ++++W+S                P  A I
Sbjct  1    MASTSKKATLSSFSAQALAQDSVSVSAPRASMVRDWSSD-------------QPPKNAAI  47

Query  425  DSIEQPPASSAKVSVLPNTM------RAQSRHPLDPLTAAEISvavatvraagatPEVRD  586
             S+ +P    A+ S+ P++       R Q+ HPLDPL+ AEISVAVATVRAAG TPEVRD
Sbjct  48   ASLIRPVDPLAETSLNPSSKGITAMPRPQTSHPLDPLSPAEISVAVATVRAAGPTPEVRD  107

Query  587  SMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPRQA  739
            SMRF EV LVEPDKNVVALADAYFFPPFQPSLLPRTK GPVIPSKLPPR+A
Sbjct  108  SMRFVEVVLVEPDKNVVALADAYFFPPFQPSLLPRTKGGPVIPSKLPPRRA  158



>ref|XP_006439904.1| hypothetical protein CICLE_v10018950mg [Citrus clementina]
 gb|ESR53144.1| hypothetical protein CICLE_v10018950mg [Citrus clementina]
Length=775

 Score =   133 bits (335),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 99/167 (59%), Positives = 117/167 (70%), Gaps = 18/167 (11%)
 Frame = +2

Query  266  MASTPEKATLQSRN------DSV-VAAADGDVLQEWTSSVERQIGQREavaaasplaaVI  424
            MAST +KATL S +      DSV V+A    ++++W+S       Q    AA + L   +
Sbjct  1    MASTSKKATLSSFSAQALAQDSVSVSAPRASMVRDWSSD------QPPKNAAIASLIHPV  54

Query  425  DSIEQPPA--SSAKVSVLPNTMRAQSRHPLDPLTAAEISvavatvraagatPEVRDSMRF  598
            D + +     SS  ++ +P   R Q+ HPLDPL+ AEISVAVATVRAAG TPEVRDSMRF
Sbjct  55   DPLAETSLNPSSKGITAMP---RPQTSHPLDPLSPAEISVAVATVRAAGPTPEVRDSMRF  111

Query  599  AEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPRQA  739
             EV LVEPDKNVVALADAYFFPPFQPSLLPRTK GPVIPSKLPPR+A
Sbjct  112  VEVVLVEPDKNVVALADAYFFPPFQPSLLPRTKGGPVIPSKLPPRRA  158



>ref|XP_008367500.1| PREDICTED: copper amine oxidase 1-like [Malus domestica]
Length=788

 Score =   133 bits (335),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 84/148 (57%), Positives = 108/148 (73%), Gaps = 7/148 (5%)
 Frame = +2

Query  296  QSRNDSVVAAADGDVLQEWTSSVERQIGQREavaaasplaaVIDSIEQPPASSAKVSVLP  475
            Q+ +++VV+A+    +Q+WT       G  +      P    + ++   P+++A  + + 
Sbjct  31   QTSSNAVVSAS---AVQDWTGVT----GAEDRRDDQRPKKIAMAALIPEPSANASTTGIS  83

Query  476  NTMRAQSRHPLDPLTAAEISvavatvraagatPEVRDSMRFAEVSLVEPDKNVVALADAY  655
              +R Q+RHPLDPL+AAEISVAVATVRAAGATPEVRD MRF EV L EPDK+VVALADAY
Sbjct  84   IMLRPQTRHPLDPLSAAEISVAVATVRAAGATPEVRDXMRFVEVVLXEPDKHVVALADAY  143

Query  656  FFPPFQPSLLPRTKKGPVIPSKLPPRQA  739
            FFPPFQPSLLPRTK GP+IP+KLPPR+A
Sbjct  144  FFPPFQPSLLPRTKGGPIIPTKLPPRRA  171



>gb|KDO69506.1| hypothetical protein CISIN_1g004084mg [Citrus sinensis]
Length=775

 Score =   133 bits (335),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 99/171 (58%), Positives = 116/171 (68%), Gaps = 26/171 (15%)
 Frame = +2

Query  266  MASTPEKATLQSRN------DSV-VAAADGDVLQEWTSSVERQIGQREavaaasplaaVI  424
            MAST +KATL S +      DSV V+A    ++++W+S                P  A I
Sbjct  1    MASTSKKATLSSFSAQALAQDSVSVSAPRASMVRDWSSD-------------QPPKNAAI  47

Query  425  DSIEQPPASSAKVSVLPNTM------RAQSRHPLDPLTAAEISvavatvraagatPEVRD  586
             S+ +P    A+ S+ P++       R Q+ HPLDPL+ AEISVAVATVRAAG TPEVRD
Sbjct  48   ASLIRPVDPLAETSLNPSSKGITAMPRPQTSHPLDPLSPAEISVAVATVRAAGPTPEVRD  107

Query  587  SMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPRQA  739
            SMRF EV LVEPDKNVVALADAYFFPPFQPSLLPRTK GPVIPSKLPPR+A
Sbjct  108  SMRFVEVVLVEPDKNVVALADAYFFPPFQPSLLPRTKGGPVIPSKLPPRRA  158



>ref|XP_002511334.1| copper amine oxidase, putative [Ricinus communis]
 gb|EEF51936.1| copper amine oxidase, putative [Ricinus communis]
Length=797

 Score =   133 bits (334),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 86/137 (63%), Positives = 103/137 (75%), Gaps = 5/137 (4%)
 Frame = +2

Query  335  DVLQEWTSSVERQIGQREavaaasplaaVIDS-IEQPPASSAKVSVLPNTMRAQSRHPLD  511
            +VLQ+W   ++R I +           A + S I +P  +++    +P  +RAQ+ HPLD
Sbjct  47   NVLQDW---IDRPINKGADDNKLPAKNAAVASLIPEPSTTNSTNKGIPVMLRAQTSHPLD  103

Query  512  PLTAAEISvavatvraagatPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPR  691
            PL+AAEISVAVATVRAAGATPEVRDSMRF EV L+EPDK VVALADAYFFPPFQPSLLPR
Sbjct  104  PLSAAEISVAVATVRAAGATPEVRDSMRFVEVVLLEPDKQVVALADAYFFPPFQPSLLPR  163

Query  692  TK-KGPVIPSKLPPRQA  739
            TK  GPVIP+KLPPR+A
Sbjct  164  TKGGGPVIPTKLPPRRA  180



>ref|XP_008464520.1| PREDICTED: copper amine oxidase 1 isoform X2 [Cucumis melo]
Length=704

 Score =   132 bits (331),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 75/86 (87%), Positives = 83/86 (97%), Gaps = 0/86 (0%)
 Frame = +2

Query  482  MRAQSRHPLDPLTAAEISvavatvraagatPEVRDSMRFAEVSLVEPDKNVVALADAYFF  661
            +RAQSRHPLDPL+AAEISVAVATVRAAGATPEVRDSMRF EV L+EP+K+VVALADAYFF
Sbjct  2    LRAQSRHPLDPLSAAEISVAVATVRAAGATPEVRDSMRFIEVVLLEPEKHVVALADAYFF  61

Query  662  PPFQPSLLPRTKKGPVIPSKLPPRQA  739
            PPFQPSLLP+TK GPVIP+KLPPR+A
Sbjct  62   PPFQPSLLPKTKGGPVIPTKLPPRRA  87



>gb|KEH20162.1| copper amine oxidase, enzyme domain protein [Medicago truncatula]
Length=629

 Score =   130 bits (328),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 88/156 (56%), Positives = 108/156 (69%), Gaps = 15/156 (10%)
 Frame = +2

Query  272  STPEKATLQSRNDSVVAAADGDVLQEWTSSVERQIGQREavaaasplaaVIDSIEQPPAS  451
            +TP   +LQ++N +  +A   +V Q+     ++Q+          P  + +DS   PP  
Sbjct  8    TTPICCSLQNKNKTAASATSPNVPQQ-----KQQL----------PFISAVDSRLDPPPK  52

Query  452  SAKVSVLPNTMRAQSRHPLDPLTAAEISvavatvraagatPEVRDSMRFAEVSLVEPDKN  631
            SA    +    +AQ+ HPLDPL+AAEISVAVATVRAAGATPEVRD +RF EV LVEP+K 
Sbjct  53   SASSKGITVMAKAQTCHPLDPLSAAEISVAVATVRAAGATPEVRDGIRFIEVGLVEPEKQ  112

Query  632  VVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPRQA  739
            VVALADAYFFPPFQPSLLPR K GPVIPSKLPPR+A
Sbjct  113  VVALADAYFFPPFQPSLLPRIKGGPVIPSKLPPRKA  148



>ref|XP_010532283.1| PREDICTED: copper amine oxidase 1-like [Tarenaya hassleriana]
Length=789

 Score =   132 bits (331),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 81/109 (74%), Positives = 94/109 (86%), Gaps = 7/109 (6%)
 Frame = +2

Query  422  IDSI---EQPPASSAKVSVLPNTMRAQSRHPLDPLTAAEISvavatvraagatPEVRDSM  592
            +DSI    Q PA+   +S++P   R +++HPLDPL+AAEISVAVATVRAAGATPEVRDSM
Sbjct  64   VDSIPDTTQKPANKG-ISLMP---RTETKHPLDPLSAAEISVAVATVRAAGATPEVRDSM  119

Query  593  RFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPRQA  739
            RF EV LVEPDK+VVALADAYFFPPFQPSLLPR+K GPVIP+KLPPR+A
Sbjct  120  RFIEVVLVEPDKHVVALADAYFFPPFQPSLLPRSKGGPVIPTKLPPRRA  168



>ref|XP_011045264.1| PREDICTED: copper amine oxidase 1-like isoform X1 [Populus euphratica]
Length=766

 Score =   131 bits (329),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 99/165 (60%), Positives = 114/165 (69%), Gaps = 19/165 (12%)
 Frame = +2

Query  266  MASTPEKATLQSRNDSVVAAADGD-VLQEWTSSVERQIGQREavaaasplaaVIDSIEQP  442
            MA+T EKAT  S   +   AA  D VLQ W+   +  I +R   +          S+ +P
Sbjct  1    MATTQEKATPTSFASAAGKAAAADGVLQSWSDPSQDPITKRSPTSV---------SLIRP  51

Query  443  PASSAKVSVLPNT------MRAQSRHPLDPLTAAEISvavatvraagatPEVRDSMRFAE  604
             +S   +S  PNT       RAQ+ HPL+PLTAAEISVAVATVRAAGATPEVRDSMRF E
Sbjct  52   VSS---LSPDPNTKGITIMTRAQTCHPLEPLTAAEISVAVATVRAAGATPEVRDSMRFVE  108

Query  605  VSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPRQA  739
            V LVEP K+VVALADAYFFPPFQPSLLPRTK GPVIP+KLPPR+A
Sbjct  109  VVLVEPVKHVVALADAYFFPPFQPSLLPRTKGGPVIPTKLPPRRA  153



>gb|KJB19703.1| hypothetical protein B456_003G116000 [Gossypium raimondii]
Length=660

 Score =   130 bits (327),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 86/136 (63%), Positives = 102/136 (75%), Gaps = 6/136 (4%)
 Frame = +2

Query  335  DVLQEWT-SSVERQIGQREavaaasplaaVIDSIEQPPASSAKVSVLPNTMRAQSRHPLD  511
            ++L EWT  S +R+       AA + L   +DS+  P  S+  + +     R Q+ HPLD
Sbjct  44   NLLHEWTLGSTDRRDDSSATKAAMASLIRPVDSL--PDTSTKGIQIF---TRPQTSHPLD  98

Query  512  PLTAAEISvavatvraagatPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPR  691
            PL+AAEISVAVATVRAAGATPEVRDSMRF EV L+EPDK+VVALADAYFFPPFQPSLLPR
Sbjct  99   PLSAAEISVAVATVRAAGATPEVRDSMRFVEVVLLEPDKHVVALADAYFFPPFQPSLLPR  158

Query  692  TKKGPVIPSKLPPRQA  739
            TK GPVIP+KLP R+A
Sbjct  159  TKNGPVIPTKLPLRRA  174



>gb|KEH20159.1| copper amine oxidase, enzyme domain protein [Medicago truncatula]
Length=761

 Score =   130 bits (328),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 88/161 (55%), Positives = 110/161 (68%), Gaps = 15/161 (9%)
 Frame = +2

Query  257  SIAMASTPEKATLQSRNDSVVAAADGDVLQEWTSSVERQIGQREavaaasplaaVIDSIE  436
            ++   +TP   +LQ++N +  +A   +V Q+     ++Q+          P  + +DS  
Sbjct  3    TVEEKTTPICCSLQNKNKTAASATSPNVPQQ-----KQQL----------PFISAVDSRL  47

Query  437  QPPASSAKVSVLPNTMRAQSRHPLDPLTAAEISvavatvraagatPEVRDSMRFAEVSLV  616
             PP  SA    +    +AQ+ HPLDPL+AAEISVAVATVRAAGATPEVRD +RF EV LV
Sbjct  48   DPPPKSASSKGITVMAKAQTCHPLDPLSAAEISVAVATVRAAGATPEVRDGIRFIEVGLV  107

Query  617  EPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPRQA  739
            EP+K VVALADAYFFPPFQPSLLPR K GPVIPSKLPPR+A
Sbjct  108  EPEKQVVALADAYFFPPFQPSLLPRIKGGPVIPSKLPPRKA  148



>ref|XP_004289862.2| PREDICTED: copper amine oxidase 1-like [Fragaria vesca subsp. 
vesca]
Length=740

 Score =   130 bits (328),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 78/103 (76%), Positives = 89/103 (86%), Gaps = 3/103 (3%)
 Frame = +2

Query  440  PPASS---AKVSVLPNTMRAQSRHPLDPLTAAEISvavatvraagatPEVRDSMRFAEVS  610
            PP+++   A  + +P  +RAQSRHPL+PL  AEISVAVATVRAAGATPEVRD MRFAEV 
Sbjct  29   PPSNAVVLASTAGIPIMVRAQSRHPLEPLCPAEISVAVATVRAAGATPEVRDGMRFAEVV  88

Query  611  LVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPRQA  739
            L+EPDK+VVALADAYFFPPFQPSLLPRTK G +IPSKLPPR+A
Sbjct  89   LLEPDKHVVALADAYFFPPFQPSLLPRTKGGHMIPSKLPPRRA  131



>ref|XP_010102489.1| Putative primary amine oxidase 2 [Morus notabilis]
 gb|EXB93553.1| Putative primary amine oxidase 2 [Morus notabilis]
Length=708

 Score =   130 bits (327),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 79/97 (81%), Positives = 84/97 (87%), Gaps = 3/97 (3%)
 Frame = +2

Query  449  SSAKVSVLPNTMRAQSRHPLDPLTAAEISvavatvraagatPEVRDSMRFAEVSLVEPDK  628
            S+  +S++P   RAQS HPLDPL+AAEISVAVATVRAAGATPEVRD MRF EV LVEPDK
Sbjct  77   STKGISIMP---RAQSSHPLDPLSAAEISVAVATVRAAGATPEVRDGMRFIEVVLVEPDK  133

Query  629  NVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPRQA  739
             VVALADAYFFPPFQPSLLPRTK  P IPSKLPPRQA
Sbjct  134  QVVALADAYFFPPFQPSLLPRTKGAPKIPSKLPPRQA  170



>gb|EPS66989.1| hypothetical protein M569_07787, partial [Genlisea aurea]
Length=574

 Score =   129 bits (324),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 76/97 (78%), Positives = 85/97 (88%), Gaps = 3/97 (3%)
 Frame = +2

Query  449  SSAKVSVLPNTMRAQSRHPLDPLTAAEISvavatvraagatPEVRDSMRFAEVSLVEPDK  628
             +A + +LP   RAQS+HPLD L+AAEISVAV TVRAAGATPEVRDSMRF EV L+EP+K
Sbjct  69   GAASIQILP---RAQSKHPLDLLSAAEISVAVRTVRAAGATPEVRDSMRFIEVVLLEPEK  125

Query  629  NVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPRQA  739
            NVVALADAYFFPPFQPSLLPRT+ GPVIPSKLP R+A
Sbjct  126  NVVALADAYFFPPFQPSLLPRTRGGPVIPSKLPARRA  162



>ref|NP_001237782.1| peroxisomal copper-containing amine oxidase [Glycine max]
 gb|AAD40979.1|AF089851_1 peroxisomal copper-containing amine oxidase [Glycine max]
Length=701

 Score =   130 bits (327),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 75/86 (87%), Positives = 80/86 (93%), Gaps = 0/86 (0%)
 Frame = +2

Query  482  MRAQSRHPLDPLTAAEISvavatvraagatPEVRDSMRFAEVSLVEPDKNVVALADAYFF  661
            +RAQ+ HPLDPLTAAEISVAVATVRAAGATPEVRD MRF EV LVEP+K VVALADAYFF
Sbjct  2    VRAQTSHPLDPLTAAEISVAVATVRAAGATPEVRDGMRFIEVDLVEPEKQVVALADAYFF  61

Query  662  PPFQPSLLPRTKKGPVIPSKLPPRQA  739
            PPFQPSLLPRTK GPVIP+KLPPR+A
Sbjct  62   PPFQPSLLPRTKGGPVIPTKLPPRKA  87



>gb|KDO82259.1| hypothetical protein CISIN_1g004080mg [Citrus sinensis]
Length=716

 Score =   130 bits (327),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 74/90 (82%), Positives = 82/90 (91%), Gaps = 0/90 (0%)
 Frame = +2

Query  470  LPNTMRAQSRHPLDPLTAAEISvavatvraagatPEVRDSMRFAEVSLVEPDKNVVALAD  649
            +P  +RAQ+ HPLDPL+AAEISVAVATVRAAGATPEVRDSMRF EV  VEPDK VVALAD
Sbjct  73   IPMMVRAQTSHPLDPLSAAEISVAVATVRAAGATPEVRDSMRFVEVVRVEPDKQVVALAD  132

Query  650  AYFFPPFQPSLLPRTKKGPVIPSKLPPRQA  739
            AYFFPPFQPSL+PRTK GP+IP+KLPPR+A
Sbjct  133  AYFFPPFQPSLIPRTKGGPIIPTKLPPRRA  162



>gb|KJB19704.1| hypothetical protein B456_003G116000 [Gossypium raimondii]
Length=743

 Score =   130 bits (327),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 86/136 (63%), Positives = 102/136 (75%), Gaps = 6/136 (4%)
 Frame = +2

Query  335  DVLQEWT-SSVERQIGQREavaaasplaaVIDSIEQPPASSAKVSVLPNTMRAQSRHPLD  511
            ++L EWT  S +R+       AA + L   +DS+  P  S+  + +     R Q+ HPLD
Sbjct  44   NLLHEWTLGSTDRRDDSSATKAAMASLIRPVDSL--PDTSTKGIQIF---TRPQTSHPLD  98

Query  512  PLTAAEISvavatvraagatPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPR  691
            PL+AAEISVAVATVRAAGATPEVRDSMRF EV L+EPDK+VVALADAYFFPPFQPSLLPR
Sbjct  99   PLSAAEISVAVATVRAAGATPEVRDSMRFVEVVLLEPDKHVVALADAYFFPPFQPSLLPR  158

Query  692  TKKGPVIPSKLPPRQA  739
            TK GPVIP+KLP R+A
Sbjct  159  TKNGPVIPTKLPLRRA  174



>emb|CAN76391.1| hypothetical protein VITISV_023592 [Vitis vinifera]
Length=790

 Score =   130 bits (328),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 87/137 (64%), Positives = 101/137 (74%), Gaps = 8/137 (6%)
 Frame = +2

Query  335  DVLQEWTSSVERQIGQREavaaasplaaVIDSIEQPPASSAKVSV--LPNTMRAQSRHPL  508
            DV Q+W+       G++      + LA++I  +E    +SA  SV  +    RAQ+ HPL
Sbjct  44   DVEQDWSGVGVVGDGKK------AALASLIRPVEPIAGASANASVKGIQIMTRAQTCHPL  97

Query  509  DPLTAAEISvavatvraagatPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLP  688
            DPL+A EISVAVATVRAAGATPEVRD MRF EV L EPDK+VVALADAYFFPPFQPSLLP
Sbjct  98   DPLSATEISVAVATVRAAGATPEVRDGMRFVEVVLYEPDKHVVALADAYFFPPFQPSLLP  157

Query  689  RTKKGPVIPSKLPPRQA  739
            RTK GPVIPSKLPPR+A
Sbjct  158  RTKGGPVIPSKLPPRKA  174



>ref|XP_002277961.1| PREDICTED: copper amine oxidase 1-like [Vitis vinifera]
Length=791

 Score =   130 bits (328),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 87/137 (64%), Positives = 101/137 (74%), Gaps = 8/137 (6%)
 Frame = +2

Query  335  DVLQEWTSSVERQIGQREavaaasplaaVIDSIEQPPASSAKVSV--LPNTMRAQSRHPL  508
            DV Q+W+       G++      + LA++I  +E    +SA  SV  +    RAQ+ HPL
Sbjct  44   DVEQDWSGVGVVGDGKK------AALASLIRPVEPIAGASANASVKGIQIMTRAQTCHPL  97

Query  509  DPLTAAEISvavatvraagatPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLP  688
            DPL+A EISVAVATVRAAGATPEVRD MRF EV L EPDK+VVALADAYFFPPFQPSLLP
Sbjct  98   DPLSATEISVAVATVRAAGATPEVRDGMRFVEVVLYEPDKHVVALADAYFFPPFQPSLLP  157

Query  689  RTKKGPVIPSKLPPRQA  739
            RTK GPVIPSKLPPR+A
Sbjct  158  RTKGGPVIPSKLPPRKA  174



>emb|CBI14968.3| unnamed protein product [Vitis vinifera]
Length=1372

 Score =   131 bits (330),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 87/137 (64%), Positives = 101/137 (74%), Gaps = 8/137 (6%)
 Frame = +2

Query  335  DVLQEWTSSVERQIGQREavaaasplaaVIDSIEQPPASSAKVSV--LPNTMRAQSRHPL  508
            DV Q+W+       G++      + LA++I  +E    +SA  SV  +    RAQ+ HPL
Sbjct  44   DVEQDWSGVGVVGDGKK------AALASLIRPVEPIAGASANASVKGIQIMTRAQTCHPL  97

Query  509  DPLTAAEISvavatvraagatPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLP  688
            DPL+A EISVAVATVRAAGATPEVRD MRF EV L EPDK+VVALADAYFFPPFQPSLLP
Sbjct  98   DPLSATEISVAVATVRAAGATPEVRDGMRFVEVVLYEPDKHVVALADAYFFPPFQPSLLP  157

Query  689  RTKKGPVIPSKLPPRQA  739
            RTK GPVIPSKLPPR+A
Sbjct  158  RTKGGPVIPSKLPPRKA  174



>ref|XP_003601195.1| Primary amine oxidase [Medicago truncatula]
 gb|AES71446.1| copper amine oxidase, enzyme domain protein [Medicago truncatula]
Length=769

 Score =   130 bits (327),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 79/107 (74%), Positives = 92/107 (86%), Gaps = 1/107 (1%)
 Frame = +2

Query  422  IDSIEQPPASSAKVSVLPNTM-RAQSRHPLDPLTAAEISvavatvraagatPEVRDSMRF  598
            +DS+ +P +++A  S    +M R QS HPLDPL+AAEISVAVATVRAAGATPE+RDSMRF
Sbjct  46   LDSLPEPSSTNAPTSKGITSMTRPQSSHPLDPLSAAEISVAVATVRAAGATPELRDSMRF  105

Query  599  AEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPRQA  739
             EV L+EPDK+VVALADAYFFPPFQPSLLPR+K GPVIP+KLPPR A
Sbjct  106  IEVVLLEPDKHVVALADAYFFPPFQPSLLPRSKGGPVIPTKLPPRCA  152



>gb|KJB19705.1| hypothetical protein B456_003G116000 [Gossypium raimondii]
Length=795

 Score =   130 bits (327),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 86/136 (63%), Positives = 102/136 (75%), Gaps = 6/136 (4%)
 Frame = +2

Query  335  DVLQEWT-SSVERQIGQREavaaasplaaVIDSIEQPPASSAKVSVLPNTMRAQSRHPLD  511
            ++L EWT  S +R+       AA + L   +DS+  P  S+  + +     R Q+ HPLD
Sbjct  44   NLLHEWTLGSTDRRDDSSATKAAMASLIRPVDSL--PDTSTKGIQIF---TRPQTSHPLD  98

Query  512  PLTAAEISvavatvraagatPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPR  691
            PL+AAEISVAVATVRAAGATPEVRDSMRF EV L+EPDK+VVALADAYFFPPFQPSLLPR
Sbjct  99   PLSAAEISVAVATVRAAGATPEVRDSMRFVEVVLLEPDKHVVALADAYFFPPFQPSLLPR  158

Query  692  TKKGPVIPSKLPPRQA  739
            TK GPVIP+KLP R+A
Sbjct  159  TKNGPVIPTKLPLRRA  174



>gb|KJB19706.1| hypothetical protein B456_003G116000 [Gossypium raimondii]
 gb|KJB19707.1| hypothetical protein B456_003G116000 [Gossypium raimondii]
Length=791

 Score =   130 bits (327),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 86/136 (63%), Positives = 102/136 (75%), Gaps = 6/136 (4%)
 Frame = +2

Query  335  DVLQEWT-SSVERQIGQREavaaasplaaVIDSIEQPPASSAKVSVLPNTMRAQSRHPLD  511
            ++L EWT  S +R+       AA + L   +DS+  P  S+  + +     R Q+ HPLD
Sbjct  44   NLLHEWTLGSTDRRDDSSATKAAMASLIRPVDSL--PDTSTKGIQIF---TRPQTSHPLD  98

Query  512  PLTAAEISvavatvraagatPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPR  691
            PL+AAEISVAVATVRAAGATPEVRDSMRF EV L+EPDK+VVALADAYFFPPFQPSLLPR
Sbjct  99   PLSAAEISVAVATVRAAGATPEVRDSMRFVEVVLLEPDKHVVALADAYFFPPFQPSLLPR  158

Query  692  TKKGPVIPSKLPPRQA  739
            TK GPVIP+KLP R+A
Sbjct  159  TKNGPVIPTKLPLRRA  174



>ref|XP_006438285.1| hypothetical protein CICLE_v10030749mg [Citrus clementina]
 gb|ESR51525.1| hypothetical protein CICLE_v10030749mg [Citrus clementina]
Length=775

 Score =   130 bits (326),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 74/90 (82%), Positives = 82/90 (91%), Gaps = 0/90 (0%)
 Frame = +2

Query  470  LPNTMRAQSRHPLDPLTAAEISvavatvraagatPEVRDSMRFAEVSLVEPDKNVVALAD  649
            +P  +RAQ+ HPLDPL+AAEISVAVATVRAAGATPEVRDSMRF EV  VEPDK VVALAD
Sbjct  73   IPMMVRAQTSHPLDPLSAAEISVAVATVRAAGATPEVRDSMRFVEVVRVEPDKQVVALAD  132

Query  650  AYFFPPFQPSLLPRTKKGPVIPSKLPPRQA  739
            AYFFPPFQPSL+PRTK GP+IP+KLPPR+A
Sbjct  133  AYFFPPFQPSLIPRTKGGPIIPTKLPPRRA  162



>gb|KDO82257.1| hypothetical protein CISIN_1g004080mg [Citrus sinensis]
Length=775

 Score =   130 bits (326),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 74/90 (82%), Positives = 82/90 (91%), Gaps = 0/90 (0%)
 Frame = +2

Query  470  LPNTMRAQSRHPLDPLTAAEISvavatvraagatPEVRDSMRFAEVSLVEPDKNVVALAD  649
            +P  +RAQ+ HPLDPL+AAEISVAVATVRAAGATPEVRDSMRF EV  VEPDK VVALAD
Sbjct  73   IPMMVRAQTSHPLDPLSAAEISVAVATVRAAGATPEVRDSMRFVEVVRVEPDKQVVALAD  132

Query  650  AYFFPPFQPSLLPRTKKGPVIPSKLPPRQA  739
            AYFFPPFQPSL+PRTK GP+IP+KLPPR+A
Sbjct  133  AYFFPPFQPSLIPRTKGGPIIPTKLPPRRA  162



>ref|XP_006483934.1| PREDICTED: copper amine oxidase 1-like [Citrus sinensis]
Length=775

 Score =   130 bits (326),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 74/90 (82%), Positives = 82/90 (91%), Gaps = 0/90 (0%)
 Frame = +2

Query  470  LPNTMRAQSRHPLDPLTAAEISvavatvraagatPEVRDSMRFAEVSLVEPDKNVVALAD  649
            +P  +RAQ+ HPLDPL+AAEISVAVATVRAAGATPEVRDSMRF EV  VEPDK VVALAD
Sbjct  73   IPMMVRAQTSHPLDPLSAAEISVAVATVRAAGATPEVRDSMRFVEVVRVEPDKQVVALAD  132

Query  650  AYFFPPFQPSLLPRTKKGPVIPSKLPPRQA  739
            AYFFPPFQPSL+PRTK GP+IP+KLPPR+A
Sbjct  133  AYFFPPFQPSLIPRTKGGPIIPTKLPPRRA  162



>ref|XP_006438286.1| hypothetical protein CICLE_v10030749mg [Citrus clementina]
 gb|ESR51526.1| hypothetical protein CICLE_v10030749mg [Citrus clementina]
Length=785

 Score =   129 bits (325),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 74/90 (82%), Positives = 82/90 (91%), Gaps = 0/90 (0%)
 Frame = +2

Query  470  LPNTMRAQSRHPLDPLTAAEISvavatvraagatPEVRDSMRFAEVSLVEPDKNVVALAD  649
            +P  +RAQ+ HPLDPL+AAEISVAVATVRAAGATPEVRDSMRF EV  VEPDK VVALAD
Sbjct  73   IPMMVRAQTSHPLDPLSAAEISVAVATVRAAGATPEVRDSMRFVEVVRVEPDKQVVALAD  132

Query  650  AYFFPPFQPSLLPRTKKGPVIPSKLPPRQA  739
            AYFFPPFQPSL+PRTK GP+IP+KLPPR+A
Sbjct  133  AYFFPPFQPSLIPRTKGGPIIPTKLPPRRA  162



>ref|XP_007153778.1| hypothetical protein PHAVU_003G064200g [Phaseolus vulgaris]
 gb|ESW25772.1| hypothetical protein PHAVU_003G064200g [Phaseolus vulgaris]
Length=755

 Score =   129 bits (324),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 81/108 (75%), Positives = 91/108 (84%), Gaps = 5/108 (5%)
 Frame = +2

Query  422  IDSIEQPP--ASSAKVSVLPNTMRAQSRHPLDPLTAAEISvavatvraagatPEVRDSMR  595
            I +I  PP  AS+  +SV+   +RAQ+ HPLDPL+AAEISVAVATVRAAGATPEVRD MR
Sbjct  37   IPAINPPPKTASAKGISVM---VRAQTSHPLDPLSAAEISVAVATVRAAGATPEVRDGMR  93

Query  596  FAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPRQA  739
            F EV LVEP+K VVALADAYFFPPFQPSLLPRTK GPVIP+KLP R+A
Sbjct  94   FIEVDLVEPEKQVVALADAYFFPPFQPSLLPRTKGGPVIPTKLPLRKA  141



>gb|AAD23730.1| putative copper amine oxidase [Arabidopsis thaliana]
 gb|AAM15387.1| putative copper amine oxidase [Arabidopsis thaliana]
Length=759

 Score =   129 bits (324),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 77/105 (73%), Positives = 88/105 (84%), Gaps = 4/105 (4%)
 Frame = +2

Query  425  DSIEQPPASSAKVSVLPNTMRAQSRHPLDPLTAAEISvavatvraagatPEVRDSMRFAE  604
            D+  + PA+   +SV+P   R +++HPLDPL+AAEISVAVATVRAAGA PEVRD MRF E
Sbjct  59   DNTAKKPANKG-ISVMP---RTETKHPLDPLSAAEISVAVATVRAAGANPEVRDGMRFIE  114

Query  605  VSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPRQA  739
            V+ VEPDK VVALADAYFFPPFQPSLLPRTK GPVIP KLPPR+A
Sbjct  115  VASVEPDKQVVALADAYFFPPFQPSLLPRTKSGPVIPMKLPPRRA  159



>ref|XP_006476868.1| PREDICTED: copper amine oxidase 1-like isoform X2 [Citrus sinensis]
Length=704

 Score =   129 bits (323),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 75/85 (88%), Positives = 78/85 (92%), Gaps = 0/85 (0%)
 Frame = +2

Query  485  RAQSRHPLDPLTAAEISvavatvraagatPEVRDSMRFAEVSLVEPDKNVVALADAYFFP  664
            R Q+ HPLDPL+ AEISVAVATVRAAG TPEVRDSMRF EV LVEPDKNVVALADAYFFP
Sbjct  3    RPQTSHPLDPLSPAEISVAVATVRAAGPTPEVRDSMRFVEVVLVEPDKNVVALADAYFFP  62

Query  665  PFQPSLLPRTKKGPVIPSKLPPRQA  739
            PFQPSLLPRTK GPVIPSKLPPR+A
Sbjct  63   PFQPSLLPRTKGGPVIPSKLPPRRA  87



>gb|KCW86671.1| hypothetical protein EUGRSUZ_B032972, partial [Eucalyptus grandis]
 gb|KCW86672.1| hypothetical protein EUGRSUZ_B032972, partial [Eucalyptus grandis]
Length=312

 Score =   125 bits (313),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 74/86 (86%), Positives = 79/86 (92%), Gaps = 0/86 (0%)
 Frame = +2

Query  482  MRAQSRHPLDPLTAAEISvavatvraagatPEVRDSMRFAEVSLVEPDKNVVALADAYFF  661
            ++ QS HPLDPL+AAEISVAVATVRAAGATPEVRDSMRF EV L+EP K VVALADAYFF
Sbjct  2    VKPQSSHPLDPLSAAEISVAVATVRAAGATPEVRDSMRFVEVVLLEPGKQVVALADAYFF  61

Query  662  PPFQPSLLPRTKKGPVIPSKLPPRQA  739
            PPFQPSLLPRTK GP+IPSKLPPRQA
Sbjct  62   PPFQPSLLPRTKGGPMIPSKLPPRQA  87



>ref|XP_004509661.1| PREDICTED: copper methylamine oxidase-like isoform X1 [Cicer 
arietinum]
Length=760

 Score =   129 bits (323),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 73/85 (86%), Positives = 81/85 (95%), Gaps = 0/85 (0%)
 Frame = +2

Query  485  RAQSRHPLDPLTAAEISvavatvraagatPEVRDSMRFAEVSLVEPDKNVVALADAYFFP  664
            +AQ+ HPLDPL+AAEISVA+ATVRAAGATPEVRDSMRF EV +VEP+K+VVALADAYFFP
Sbjct  63   KAQTCHPLDPLSAAEISVAIATVRAAGATPEVRDSMRFIEVDMVEPEKHVVALADAYFFP  122

Query  665  PFQPSLLPRTKKGPVIPSKLPPRQA  739
            PFQPSLLPRTK GPVIPSKLPPR+A
Sbjct  123  PFQPSLLPRTKGGPVIPSKLPPRKA  147



>ref|NP_181777.2| copper amine oxidase family protein [Arabidopsis thaliana]
 gb|AAM53275.1| putative copper amine oxidase [Arabidopsis thaliana]
 gb|AAN15348.1| putative copper amine oxidase [Arabidopsis thaliana]
 gb|AEC10126.1| copper amine oxidase family protein [Arabidopsis thaliana]
Length=776

 Score =   129 bits (323),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 77/105 (73%), Positives = 88/105 (84%), Gaps = 4/105 (4%)
 Frame = +2

Query  425  DSIEQPPASSAKVSVLPNTMRAQSRHPLDPLTAAEISvavatvraagatPEVRDSMRFAE  604
            D+  + PA+   +SV+P   R +++HPLDPL+AAEISVAVATVRAAGA PEVRD MRF E
Sbjct  59   DNTAKKPANKG-ISVMP---RTETKHPLDPLSAAEISVAVATVRAAGANPEVRDGMRFIE  114

Query  605  VSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPRQA  739
            V+ VEPDK VVALADAYFFPPFQPSLLPRTK GPVIP KLPPR+A
Sbjct  115  VASVEPDKQVVALADAYFFPPFQPSLLPRTKSGPVIPMKLPPRRA  159



>ref|XP_007138024.1| hypothetical protein PHAVU_009G174800g [Phaseolus vulgaris]
 gb|ESW10018.1| hypothetical protein PHAVU_009G174800g [Phaseolus vulgaris]
Length=770

 Score =   128 bits (322),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 74/85 (87%), Positives = 79/85 (93%), Gaps = 0/85 (0%)
 Frame = +2

Query  485  RAQSRHPLDPLTAAEISvavatvraagatPEVRDSMRFAEVSLVEPDKNVVALADAYFFP  664
            R QS HPLDPLTAAEISVAVATVRAAGATPE+RDSMRF EV L+EPDKNVVALADAYFFP
Sbjct  69   RPQSSHPLDPLTAAEISVAVATVRAAGATPELRDSMRFIEVVLLEPDKNVVALADAYFFP  128

Query  665  PFQPSLLPRTKKGPVIPSKLPPRQA  739
            PFQPSLLPRT+ GP+IP+KLPPR A
Sbjct  129  PFQPSLLPRTRGGPLIPTKLPPRCA  153



>gb|KCW83296.1| hypothetical protein EUGRSUZ_B00228 [Eucalyptus grandis]
Length=1349

 Score =   129 bits (325),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 75/106 (71%), Positives = 89/106 (84%), Gaps = 1/106 (1%)
 Frame = +2

Query  422  IDSIEQPPASSAKVSVLPNTMRAQSRHPLDPLTAAEISvavatvraagatPEVRDSMRFA  601
            +DS+ +P A++    V     RAQ+ HPLDPL+AAEISVAVATVRAAG+TPE+RD MRF 
Sbjct  48   VDSLPEPSATALTKGV-AVMQRAQTSHPLDPLSAAEISVAVATVRAAGSTPEIRDGMRFV  106

Query  602  EVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPRQA  739
            EV L+EP K+VVALADAYFFPPFQPSLLPRTK GPV+P+KLPPR+A
Sbjct  107  EVVLLEPGKHVVALADAYFFPPFQPSLLPRTKSGPVLPAKLPPRRA  152



>ref|XP_010044582.1| PREDICTED: peroxisomal primary amine oxidase-like [Eucalyptus 
grandis]
Length=796

 Score =   128 bits (322),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 77/99 (78%), Positives = 84/99 (85%), Gaps = 0/99 (0%)
 Frame = +2

Query  443  PASSAKVSVLPNTMRAQSRHPLDPLTAAEISvavatvraagatPEVRDSMRFAEVSLVEP  622
            PA +     +P  ++ QS HPLDPL+AAEISVAVATVRAAGATPEVRDSMRF EV L+EP
Sbjct  76   PAITPANKGIPVMVKPQSSHPLDPLSAAEISVAVATVRAAGATPEVRDSMRFVEVVLLEP  135

Query  623  DKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPRQA  739
             K VVALADAYFFPPFQPSLLPRTK GP+IPSKLPPRQA
Sbjct  136  GKQVVALADAYFFPPFQPSLLPRTKGGPMIPSKLPPRQA  174



>ref|XP_003527002.1| PREDICTED: copper amine oxidase 1-like isoform X1 [Glycine max]
Length=774

 Score =   128 bits (322),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 78/105 (74%), Positives = 89/105 (85%), Gaps = 5/105 (5%)
 Frame = +2

Query  431  IEQPPASSAK--VSVLPNTMRAQSRHPLDPLTAAEISvavatvraagatPEVRDSMRFAE  604
            I    AS+AK  V+ +P   RAQS HPLDPL+AAEISVAVATVRAAG+TPE+RDSMRF E
Sbjct  56   ISSTNASAAKGVVAAMP---RAQSSHPLDPLSAAEISVAVATVRAAGSTPELRDSMRFIE  112

Query  605  VSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPRQA  739
            + L+EPDKNVVALADAYFFPPFQPSLLPR + GP+IP+KLPPR A
Sbjct  113  IVLLEPDKNVVALADAYFFPPFQPSLLPRARGGPLIPAKLPPRCA  157



>gb|KHG07734.1| Primary amine oxidase [Gossypium arboreum]
Length=777

 Score =   128 bits (322),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 86/136 (63%), Positives = 102/136 (75%), Gaps = 6/136 (4%)
 Frame = +2

Query  335  DVLQEWT-SSVERQIGQREavaaasplaaVIDSIEQPPASSAKVSVLPNTMRAQSRHPLD  511
            ++L EWT  S +R+       AA + L   +DS+  P  S+  + +L    R Q+ HPLD
Sbjct  44   NLLHEWTLGSTDRRDDSSATKAAMASLIRPVDSL--PDTSTKGIQIL---TRPQTSHPLD  98

Query  512  PLTAAEISvavatvraagatPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPR  691
            PL+AAEISVAVATVRAAGATPEVRDSMRF EV L+EPDK+VVALADAYFFPPFQPSLLPR
Sbjct  99   PLSAAEISVAVATVRAAGATPEVRDSMRFVEVVLLEPDKHVVALADAYFFPPFQPSLLPR  158

Query  692  TKKGPVIPSKLPPRQA  739
            TK GPVI +KLP R+A
Sbjct  159  TKNGPVISTKLPLRRA  174



>ref|XP_011071936.1| PREDICTED: copper amine oxidase 1-like [Sesamum indicum]
Length=786

 Score =   128 bits (322),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 75/98 (77%), Positives = 85/98 (87%), Gaps = 3/98 (3%)
 Frame = +2

Query  446  ASSAKVSVLPNTMRAQSRHPLDPLTAAEISvavatvraagatPEVRDSMRFAEVSLVEPD  625
            A++  + V+P   RAQ++HPLDPL+AAEISVAV TVRAAGATPEVRDSMRF EV L+EPD
Sbjct  74   ATAKGIQVMP---RAQTKHPLDPLSAAEISVAVGTVRAAGATPEVRDSMRFIEVVLLEPD  130

Query  626  KNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPRQA  739
            K+VVALADAYFFPPFQPSLL RTK GP IP KLPPR+A
Sbjct  131  KHVVALADAYFFPPFQPSLLARTKGGPAIPFKLPPRRA  168



>emb|CDY14839.1| BnaC04g48360D [Brassica napus]
Length=775

 Score =   128 bits (321),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 78/112 (70%), Positives = 92/112 (82%), Gaps = 6/112 (5%)
 Frame = +2

Query  419  VIDSIEQPPASSAK-----VSVLPNTMRAQSRHPLDPLTAAEISvavatvraagatPEVR  583
            VI  ++  P ++ K     +SV+P   R +++HPLDPL+AAEISVAVATVRAAGA PEVR
Sbjct  49   VIRPVDSMPGTAKKPANKGISVMP-MPRTETKHPLDPLSAAEISVAVATVRAAGANPEVR  107

Query  584  DSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPRQA  739
            DSMRF EV+ VEP+KNVVALADAYFFPPFQPSLLPRTK GPVIP +LPPR+A
Sbjct  108  DSMRFIEVASVEPEKNVVALADAYFFPPFQPSLLPRTKAGPVIPMRLPPRRA  159



>ref|XP_010027284.1| PREDICTED: copper amine oxidase 1 [Eucalyptus grandis]
Length=769

 Score =   128 bits (321),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 76/108 (70%), Positives = 92/108 (85%), Gaps = 5/108 (5%)
 Frame = +2

Query  422  IDSIEQPPAS--SAKVSVLPNTMRAQSRHPLDPLTAAEISvavatvraagatPEVRDSMR  595
            +DS+ +P A+  +  V+V+    RAQ+ HPLDPL+AAEISVAVATVRAAG+TPE+RD MR
Sbjct  48   VDSLPEPSATALTKGVAVM---QRAQTSHPLDPLSAAEISVAVATVRAAGSTPEIRDGMR  104

Query  596  FAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPRQA  739
            F EV L+EP K+VVALADAYFFPPFQPSLLPRTK GPV+P+KLPPR+A
Sbjct  105  FVEVVLLEPGKHVVALADAYFFPPFQPSLLPRTKSGPVLPAKLPPRRA  152



>ref|XP_010506075.1| PREDICTED: copper amine oxidase 1-like isoform X1 [Camelina sativa]
 ref|XP_010506076.1| PREDICTED: copper amine oxidase 1-like isoform X2 [Camelina sativa]
Length=779

 Score =   128 bits (321),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 76/105 (72%), Positives = 90/105 (86%), Gaps = 5/105 (5%)
 Frame = +2

Query  425  DSIEQPPASSAKVSVLPNTMRAQSRHPLDPLTAAEISvavatvraagatPEVRDSMRFAE  604
            D+ ++P  ++  +SV+P   R +++HPLDPL+AAEISVAVATVRAAGA PEVRD MRF E
Sbjct  63   DTAKKP--ANKGISVMP---RTETKHPLDPLSAAEISVAVATVRAAGANPEVRDGMRFIE  117

Query  605  VSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPRQA  739
            V+ VEPDK+VVALADAYFFPPFQPSLLPRTK GPVIP KLPPR+A
Sbjct  118  VASVEPDKHVVALADAYFFPPFQPSLLPRTKSGPVIPMKLPPRRA  162



>gb|EYU22171.1| hypothetical protein MIMGU_mgv1a001639mg [Erythranthe guttata]
Length=781

 Score =   128 bits (321),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 79/106 (75%), Positives = 88/106 (83%), Gaps = 6/106 (6%)
 Frame = +2

Query  431  IEQPPASSA---KVSVLPNTMRAQSRHPLDPLTAAEISvavatvraagatPEVRDSMRFA  601
            I   P+SS     + V+P   RAQ++HPLDPL+A EISVAVATVRAAGATPEVRDSMRF 
Sbjct  59   ITTEPSSSTPAKGIQVMP---RAQTKHPLDPLSATEISVAVATVRAAGATPEVRDSMRFV  115

Query  602  EVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPRQA  739
            EV L+EP+K VVALADAYFFPPFQPSLLPRTK GP IPSKLPPR+A
Sbjct  116  EVVLLEPEKQVVALADAYFFPPFQPSLLPRTKGGPAIPSKLPPRRA  161



>gb|KDO82258.1| hypothetical protein CISIN_1g004080mg [Citrus sinensis]
Length=701

 Score =   127 bits (320),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 73/86 (85%), Positives = 80/86 (93%), Gaps = 0/86 (0%)
 Frame = +2

Query  482  MRAQSRHPLDPLTAAEISvavatvraagatPEVRDSMRFAEVSLVEPDKNVVALADAYFF  661
            +RAQ+ HPLDPL+AAEISVAVATVRAAGATPEVRDSMRF EV  VEPDK VVALADAYFF
Sbjct  3    VRAQTSHPLDPLSAAEISVAVATVRAAGATPEVRDSMRFVEVVRVEPDKQVVALADAYFF  62

Query  662  PPFQPSLLPRTKKGPVIPSKLPPRQA  739
            PPFQPSL+PRTK GP+IP+KLPPR+A
Sbjct  63   PPFQPSLIPRTKGGPIIPTKLPPRRA  88



>ref|XP_006438284.1| hypothetical protein CICLE_v10030749mg [Citrus clementina]
 gb|ESR51524.1| hypothetical protein CICLE_v10030749mg [Citrus clementina]
Length=701

 Score =   127 bits (320),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 73/86 (85%), Positives = 80/86 (93%), Gaps = 0/86 (0%)
 Frame = +2

Query  482  MRAQSRHPLDPLTAAEISvavatvraagatPEVRDSMRFAEVSLVEPDKNVVALADAYFF  661
            +RAQ+ HPLDPL+AAEISVAVATVRAAGATPEVRDSMRF EV  VEPDK VVALADAYFF
Sbjct  3    VRAQTSHPLDPLSAAEISVAVATVRAAGATPEVRDSMRFVEVVRVEPDKQVVALADAYFF  62

Query  662  PPFQPSLLPRTKKGPVIPSKLPPRQA  739
            PPFQPSL+PRTK GP+IP+KLPPR+A
Sbjct  63   PPFQPSLIPRTKGGPIIPTKLPPRRA  88



>ref|XP_006293724.1| hypothetical protein CARUB_v10022684mg [Capsella rubella]
 gb|EOA26622.1| hypothetical protein CARUB_v10022684mg [Capsella rubella]
Length=771

 Score =   128 bits (321),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 76/105 (72%), Positives = 90/105 (86%), Gaps = 5/105 (5%)
 Frame = +2

Query  425  DSIEQPPASSAKVSVLPNTMRAQSRHPLDPLTAAEISvavatvraagatPEVRDSMRFAE  604
            D+ ++P  ++  +SV+P   R +++HPLDPL+AAEISVAVATVRAAGA PEVRD MRF E
Sbjct  55   DTAKKP--ANKGISVMP---RTETKHPLDPLSAAEISVAVATVRAAGANPEVRDGMRFIE  109

Query  605  VSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPRQA  739
            V+ VEPDK+VVALADAYFFPPFQPSLLPRTK GPVIP KLPPR+A
Sbjct  110  VASVEPDKHVVALADAYFFPPFQPSLLPRTKSGPVIPMKLPPRRA  154



>ref|XP_004489782.1| PREDICTED: copper methylamine oxidase-like [Cicer arietinum]
Length=761

 Score =   127 bits (320),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 80/107 (75%), Positives = 88/107 (82%), Gaps = 3/107 (3%)
 Frame = +2

Query  422  IDSIEQPPASSAKVSVLPNTMRAQSRHPLDPLTAAEISvavatvraagatPEVRDSMRFA  601
            +DS   PP ++     +P  MRAQ+ HPLDPLTAAEISVAVATVRAAGATPEVRDSMRF 
Sbjct  44   LDSF--PPKTTPTTKGIPVMMRAQTCHPLDPLTAAEISVAVATVRAAGATPEVRDSMRFV  101

Query  602  EVSLVEPDKNVVALADAYFFPPFQPSLLPRTK-KGPVIPSKLPPRQA  739
            EV LVEP K VVALADAYFFPPFQPSLLPRTK  GP+IP+KLP R+A
Sbjct  102  EVVLVEPVKQVVALADAYFFPPFQPSLLPRTKGGGPLIPTKLPTRKA  148



>ref|XP_002314600.1| copper amine oxidase family protein [Populus trichocarpa]
 gb|EEF00771.1| copper amine oxidase family protein [Populus trichocarpa]
Length=700

 Score =   127 bits (320),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 75/85 (88%), Positives = 80/85 (94%), Gaps = 0/85 (0%)
 Frame = +2

Query  485  RAQSRHPLDPLTAAEISvavatvraagatPEVRDSMRFAEVSLVEPDKNVVALADAYFFP  664
            RAQ+ HPL+PLTAAEISVAVATVRAAGATPEVRDSMRF EV LVEP K+VVALADAYFFP
Sbjct  3    RAQTCHPLEPLTAAEISVAVATVRAAGATPEVRDSMRFVEVVLVEPVKHVVALADAYFFP  62

Query  665  PFQPSLLPRTKKGPVIPSKLPPRQA  739
            PFQPSLLPRTK GPVIP+KLPPR+A
Sbjct  63   PFQPSLLPRTKGGPVIPTKLPPRRA  87



>ref|XP_011045265.1| PREDICTED: copper amine oxidase 1-like isoform X2 [Populus euphratica]
Length=700

 Score =   127 bits (319),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 75/85 (88%), Positives = 80/85 (94%), Gaps = 0/85 (0%)
 Frame = +2

Query  485  RAQSRHPLDPLTAAEISvavatvraagatPEVRDSMRFAEVSLVEPDKNVVALADAYFFP  664
            RAQ+ HPL+PLTAAEISVAVATVRAAGATPEVRDSMRF EV LVEP K+VVALADAYFFP
Sbjct  3    RAQTCHPLEPLTAAEISVAVATVRAAGATPEVRDSMRFVEVVLVEPVKHVVALADAYFFP  62

Query  665  PFQPSLLPRTKKGPVIPSKLPPRQA  739
            PFQPSLLPRTK GPVIP+KLPPR+A
Sbjct  63   PFQPSLLPRTKGGPVIPTKLPPRRA  87



>emb|CDY47975.1| BnaA04g24530D [Brassica napus]
Length=775

 Score =   127 bits (320),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 76/105 (72%), Positives = 91/105 (87%), Gaps = 3/105 (3%)
 Frame = +2

Query  425  DSIEQPPASSAKVSVLPNTMRAQSRHPLDPLTAAEISvavatvraagatPEVRDSMRFAE  604
            D+ ++P  ++  +SV+P   R +++HPLDPL+AAEISVAVATVRAAGA PEVRDSMRF E
Sbjct  58   DTAKKP--ATKGISVMP-MPRTETKHPLDPLSAAEISVAVATVRAAGANPEVRDSMRFIE  114

Query  605  VSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPRQA  739
            V+ VEP+KNVVALADAYFFPPFQPSLLPRTK GPVIP +LPPR+A
Sbjct  115  VASVEPEKNVVALADAYFFPPFQPSLLPRTKAGPVIPMRLPPRRA  159



>ref|XP_009142070.1| PREDICTED: LOW QUALITY PROTEIN: copper amine oxidase 1 [Brassica 
rapa]
Length=778

 Score =   127 bits (319),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 76/105 (72%), Positives = 91/105 (87%), Gaps = 3/105 (3%)
 Frame = +2

Query  425  DSIEQPPASSAKVSVLPNTMRAQSRHPLDPLTAAEISvavatvraagatPEVRDSMRFAE  604
            D+ ++P  ++  +SV+P   R +++HPLDPL+AAEISVAVATVRAAGA PEVRDSMRF E
Sbjct  61   DTAKKP--ANKGISVMP-MPRTETKHPLDPLSAAEISVAVATVRAAGANPEVRDSMRFIE  117

Query  605  VSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPRQA  739
            V+ VEP+KNVVALADAYFFPPFQPSLLPRTK GPVIP +LPPR+A
Sbjct  118  VASVEPEKNVVALADAYFFPPFQPSLLPRTKAGPVIPMRLPPRRA  162



>ref|XP_002881856.1| hypothetical protein ARALYDRAFT_903619 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58115.1| hypothetical protein ARALYDRAFT_903619 [Arabidopsis lyrata subsp. 
lyrata]
Length=775

 Score =   127 bits (319),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 76/105 (72%), Positives = 89/105 (85%), Gaps = 5/105 (5%)
 Frame = +2

Query  425  DSIEQPPASSAKVSVLPNTMRAQSRHPLDPLTAAEISvavatvraagatPEVRDSMRFAE  604
            D+ ++P  ++  +SV+P   R +++HPLDPL+AAEISVAVATVRAAGA PEVRD MRF E
Sbjct  59   DTAKKP--ANKGISVMP---RTETKHPLDPLSAAEISVAVATVRAAGANPEVRDGMRFIE  113

Query  605  VSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPRQA  739
            V+ VEPDK VVALADAYFFPPFQPSLLPRTK GPVIP KLPPR+A
Sbjct  114  VASVEPDKQVVALADAYFFPPFQPSLLPRTKSGPVIPMKLPPRRA  158



>ref|XP_010517774.1| PREDICTED: copper amine oxidase 1-like [Camelina sativa]
Length=781

 Score =   127 bits (319),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 77/108 (71%), Positives = 89/108 (82%), Gaps = 5/108 (5%)
 Frame = +2

Query  422  IDSIEQPPASSAK--VSVLPNTMRAQSRHPLDPLTAAEISvavatvraagatPEVRDSMR  595
            +DS+  P    A   +SV+P   R +++HPLDPL+AAEISVAVATVRAAGA PEVRD MR
Sbjct  60   VDSLPDPAKKPANKGISVMP---RTETKHPLDPLSAAEISVAVATVRAAGANPEVRDGMR  116

Query  596  FAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPRQA  739
            F EV+ VEP+K+VVALADAYFFPPFQPSLLPRTK GPVIP KLPPR+A
Sbjct  117  FIEVASVEPEKHVVALADAYFFPPFQPSLLPRTKSGPVIPMKLPPRRA  164



>gb|ACW82416.1| putative copper amine oxidase, partial [Olea europaea]
Length=529

 Score =   125 bits (313),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 74/98 (76%), Positives = 83/98 (85%), Gaps = 3/98 (3%)
 Frame = +2

Query  446  ASSAKVSVLPNTMRAQSRHPLDPLTAAEISvavatvraagatPEVRDSMRFAEVSLVEPD  625
            A++  + V+P   RAQ+ HPLDPL+AAEISVAVATV AAGATPEVRD MRF EV L+EPD
Sbjct  73   AATKGIQVMP---RAQTVHPLDPLSAAEISVAVATVMAAGATPEVRDGMRFIEVVLLEPD  129

Query  626  KNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPRQA  739
            K+VVALADAYFF PFQPSLLPRTK G  IPSKLPPR+A
Sbjct  130  KHVVALADAYFFSPFQPSLLPRTKGGLTIPSKLPPRRA  167



>ref|XP_006581907.1| PREDICTED: copper amine oxidase 1-like isoform X2 [Glycine max]
Length=724

 Score =   126 bits (317),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 71/85 (84%), Positives = 79/85 (93%), Gaps = 0/85 (0%)
 Frame = +2

Query  485  RAQSRHPLDPLTAAEISvavatvraagatPEVRDSMRFAEVSLVEPDKNVVALADAYFFP  664
            RAQS HPLDPL+AAEISVAVATVRAAG+TPE+RDSMRF E+ L+EPDKNVVALADAYFFP
Sbjct  23   RAQSSHPLDPLSAAEISVAVATVRAAGSTPELRDSMRFIEIVLLEPDKNVVALADAYFFP  82

Query  665  PFQPSLLPRTKKGPVIPSKLPPRQA  739
            PFQPSLLPR + GP+IP+KLPPR A
Sbjct  83   PFQPSLLPRARGGPLIPAKLPPRCA  107



>gb|KFK37100.1| hypothetical protein AALP_AA4G213000 [Arabis alpina]
Length=767

 Score =   126 bits (317),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 74/97 (76%), Positives = 85/97 (88%), Gaps = 3/97 (3%)
 Frame = +2

Query  449  SSAKVSVLPNTMRAQSRHPLDPLTAAEISvavatvraagatPEVRDSMRFAEVSLVEPDK  628
            S+  +SV+P   R +++HPLDPL+AAEISVAVATVRAAGA PEVRDSMRF EV+ VEP+K
Sbjct  56   SNKGISVMP---RTETKHPLDPLSAAEISVAVATVRAAGANPEVRDSMRFIEVASVEPEK  112

Query  629  NVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPRQA  739
            +VVALADAYFFPPFQPSLLPR K GPVIP KLPPR+A
Sbjct  113  HVVALADAYFFPPFQPSLLPRNKAGPVIPMKLPPRRA  149



>gb|KEH27747.1| copper amine oxidase, enzyme domain protein [Medicago truncatula]
Length=714

 Score =   126 bits (316),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 77/101 (76%), Positives = 85/101 (84%), Gaps = 1/101 (1%)
 Frame = +2

Query  440  PPASSAKVSVLPNTMRAQSRHPLDPLTAAEISvavatvraagatPEVRDSMRFAEVSLVE  619
            PP ++     +P  MRAQ+ HPLDPL+AAEISVAVATVRAAGATPEVRDSMRF EV LVE
Sbjct  24   PPKTTPTTKGIPVMMRAQTCHPLDPLSAAEISVAVATVRAAGATPEVRDSMRFVEVVLVE  83

Query  620  PDKNVVALADAYFFPPFQPSLLPRTK-KGPVIPSKLPPRQA  739
            P K VVALADAYFFPPFQPSLLPRTK  GP+IP+KLP R+A
Sbjct  84   PVKQVVALADAYFFPPFQPSLLPRTKGGGPLIPTKLPTRKA  124



>ref|XP_010508564.1| PREDICTED: copper amine oxidase 1-like [Camelina sativa]
Length=781

 Score =   126 bits (317),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 75/105 (71%), Positives = 90/105 (86%), Gaps = 5/105 (5%)
 Frame = +2

Query  425  DSIEQPPASSAKVSVLPNTMRAQSRHPLDPLTAAEISvavatvraagatPEVRDSMRFAE  604
            D+ ++P  ++  +SV+P   R +++HPLDPL+AAEISVAVATVRAAGA PEVRD MRF E
Sbjct  65   DTAKKP--ANKGISVMP---RTETKHPLDPLSAAEISVAVATVRAAGANPEVRDGMRFIE  119

Query  605  VSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPRQA  739
            V+ VEP+K+VVALADAYFFPPFQPSLLPRTK GPVIP KLPPR+A
Sbjct  120  VASVEPEKHVVALADAYFFPPFQPSLLPRTKSGPVIPMKLPPRRA  164



>gb|EMS61925.1| Copper methylamine oxidase [Triticum urartu]
Length=760

 Score =   126 bits (316),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 80/119 (67%), Positives = 92/119 (77%), Gaps = 12/119 (10%)
 Frame = +2

Query  419  VIDSIEQPPASSAKVSV--LPNTMRAQSRHPLDPLTAAEISvavatvraagatPEV----  580
            V++ I   P+++AK S   +P   RAQ  HPLDPL+AAEI+VAVATVRAAG TPEV    
Sbjct  31   VMEEITDSPSTTAKASSKGIPIMTRAQRSHPLDPLSAAEIAVAVATVRAAGRTPEVCQPI  90

Query  581  ------RDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPRQA  739
                  RDSMRF EV L+EP+KNVVALADAYFFPPFQPSLLPRTK GPVIPS+LPPR+A
Sbjct  91   PFSQIVRDSMRFVEVVLLEPEKNVVALADAYFFPPFQPSLLPRTKGGPVIPSRLPPRRA  149



>gb|KEH20160.1| copper amine oxidase, enzyme domain protein [Medicago truncatula]
Length=568

 Score =   124 bits (312),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 72/85 (85%), Positives = 78/85 (92%), Gaps = 0/85 (0%)
 Frame = +2

Query  485  RAQSRHPLDPLTAAEISvavatvraagatPEVRDSMRFAEVSLVEPDKNVVALADAYFFP  664
            +AQ+ HPLDPL+AAEISVAVATVRAAGATPEVRD +RF EV LVEP+K VVALADAYFFP
Sbjct  3    KAQTCHPLDPLSAAEISVAVATVRAAGATPEVRDGIRFIEVGLVEPEKQVVALADAYFFP  62

Query  665  PFQPSLLPRTKKGPVIPSKLPPRQA  739
            PFQPSLLPR K GPVIPSKLPPR+A
Sbjct  63   PFQPSLLPRIKGGPVIPSKLPPRKA  87



>emb|CDY22564.1| BnaC03g23740D [Brassica napus]
Length=1075

 Score =   127 bits (318),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 79/109 (72%), Positives = 92/109 (84%), Gaps = 7/109 (6%)
 Frame = +2

Query  422  IDSI---EQPPASSAKVSVLPNTMRAQSRHPLDPLTAAEISvavatvraagatPEVRDSM  592
            +DSI    + PA+   +SV P   R++++HPLDPL+AAEISVAVATVRAAGA PEVRDSM
Sbjct  35   VDSIPDTAKKPANKG-ISVTP---RSETKHPLDPLSAAEISVAVATVRAAGANPEVRDSM  90

Query  593  RFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPRQA  739
            RF EV+ VEP+K+VVALADAYFFPPFQPSLLPRTK GPVIP KLPPR+A
Sbjct  91   RFIEVASVEPEKHVVALADAYFFPPFQPSLLPRTKAGPVIPMKLPPRRA  139



>ref|XP_003613133.1| Copper amine oxidase [Medicago truncatula]
Length=750

 Score =   126 bits (316),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 77/101 (76%), Positives = 85/101 (84%), Gaps = 1/101 (1%)
 Frame = +2

Query  440  PPASSAKVSVLPNTMRAQSRHPLDPLTAAEISvavatvraagatPEVRDSMRFAEVSLVE  619
            PP ++     +P  MRAQ+ HPLDPL+AAEISVAVATVRAAGATPEVRDSMRF EV LVE
Sbjct  24   PPKTTPTTKGIPVMMRAQTCHPLDPLSAAEISVAVATVRAAGATPEVRDSMRFVEVVLVE  83

Query  620  PDKNVVALADAYFFPPFQPSLLPRTK-KGPVIPSKLPPRQA  739
            P K VVALADAYFFPPFQPSLLPRTK  GP+IP+KLP R+A
Sbjct  84   PVKQVVALADAYFFPPFQPSLLPRTKGGGPLIPTKLPTRKA  124



>gb|AES96091.2| copper amine oxidase, enzyme domain protein [Medicago truncatula]
Length=737

 Score =   125 bits (315),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 77/101 (76%), Positives = 85/101 (84%), Gaps = 1/101 (1%)
 Frame = +2

Query  440  PPASSAKVSVLPNTMRAQSRHPLDPLTAAEISvavatvraagatPEVRDSMRFAEVSLVE  619
            PP ++     +P  MRAQ+ HPLDPL+AAEISVAVATVRAAGATPEVRDSMRF EV LVE
Sbjct  24   PPKTTPTTKGIPVMMRAQTCHPLDPLSAAEISVAVATVRAAGATPEVRDSMRFVEVVLVE  83

Query  620  PDKNVVALADAYFFPPFQPSLLPRTK-KGPVIPSKLPPRQA  739
            P K VVALADAYFFPPFQPSLLPRTK  GP+IP+KLP R+A
Sbjct  84   PVKQVVALADAYFFPPFQPSLLPRTKGGGPLIPTKLPTRKA  124



>gb|KEH35029.1| copper amine oxidase, enzyme domain protein [Medicago truncatula]
Length=704

 Score =   125 bits (315),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 73/85 (86%), Positives = 79/85 (93%), Gaps = 0/85 (0%)
 Frame = +2

Query  485  RAQSRHPLDPLTAAEISvavatvraagatPEVRDSMRFAEVSLVEPDKNVVALADAYFFP  664
            R QS HPLDPL+AAEISVAVATVRAAGATPE+RDSMRF EV L+EPDK+VVALADAYFFP
Sbjct  3    RPQSSHPLDPLSAAEISVAVATVRAAGATPELRDSMRFIEVVLLEPDKHVVALADAYFFP  62

Query  665  PFQPSLLPRTKKGPVIPSKLPPRQA  739
            PFQPSLLPR+K GPVIP+KLPPR A
Sbjct  63   PFQPSLLPRSKGGPVIPTKLPPRCA  87



>gb|KEH20164.1| copper amine oxidase, enzyme domain protein [Medicago truncatula]
Length=619

 Score =   125 bits (313),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 72/85 (85%), Positives = 78/85 (92%), Gaps = 0/85 (0%)
 Frame = +2

Query  485  RAQSRHPLDPLTAAEISvavatvraagatPEVRDSMRFAEVSLVEPDKNVVALADAYFFP  664
            +AQ+ HPLDPL+AAEISVAVATVRAAGATPEVRD +RF EV LVEP+K VVALADAYFFP
Sbjct  77   KAQTCHPLDPLSAAEISVAVATVRAAGATPEVRDGIRFIEVGLVEPEKQVVALADAYFFP  136

Query  665  PFQPSLLPRTKKGPVIPSKLPPRQA  739
            PFQPSLLPR K GPVIPSKLPPR+A
Sbjct  137  PFQPSLLPRIKGGPVIPSKLPPRKA  161



>gb|KEH20161.1| copper amine oxidase, enzyme domain protein [Medicago truncatula]
Length=642

 Score =   125 bits (313),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 72/85 (85%), Positives = 78/85 (92%), Gaps = 0/85 (0%)
 Frame = +2

Query  485  RAQSRHPLDPLTAAEISvavatvraagatPEVRDSMRFAEVSLVEPDKNVVALADAYFFP  664
            +AQ+ HPLDPL+AAEISVAVATVRAAGATPEVRD +RF EV LVEP+K VVALADAYFFP
Sbjct  77   KAQTCHPLDPLSAAEISVAVATVRAAGATPEVRDGIRFIEVGLVEPEKQVVALADAYFFP  136

Query  665  PFQPSLLPRTKKGPVIPSKLPPRQA  739
            PFQPSLLPR K GPVIPSKLPPR+A
Sbjct  137  PFQPSLLPRIKGGPVIPSKLPPRKA  161



>ref|XP_011101289.1| PREDICTED: copper amine oxidase 1-like [Sesamum indicum]
Length=777

 Score =   125 bits (314),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 73/98 (74%), Positives = 85/98 (87%), Gaps = 3/98 (3%)
 Frame = +2

Query  446  ASSAKVSVLPNTMRAQSRHPLDPLTAAEISvavatvraagatPEVRDSMRFAEVSLVEPD  625
            A++  + ++P   RAQ++HPLDPL+A EISVAVATVRAAGATPEVRDSMRF EV L+EP+
Sbjct  66   ATTKGIQLMP---RAQTKHPLDPLSATEISVAVATVRAAGATPEVRDSMRFIEVVLLEPE  122

Query  626  KNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPRQA  739
            K+VV LADAYFFPPFQPSLLPR K GP IPSKLPPR+A
Sbjct  123  KHVVGLADAYFFPPFQPSLLPRAKGGPEIPSKLPPRRA  160



>gb|KEH20158.1| copper amine oxidase, enzyme domain protein [Medicago truncatula]
Length=700

 Score =   124 bits (312),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 72/85 (85%), Positives = 78/85 (92%), Gaps = 0/85 (0%)
 Frame = +2

Query  485  RAQSRHPLDPLTAAEISvavatvraagatPEVRDSMRFAEVSLVEPDKNVVALADAYFFP  664
            +AQ+ HPLDPL+AAEISVAVATVRAAGATPEVRD +RF EV LVEP+K VVALADAYFFP
Sbjct  3    KAQTCHPLDPLSAAEISVAVATVRAAGATPEVRDGIRFIEVGLVEPEKQVVALADAYFFP  62

Query  665  PFQPSLLPRTKKGPVIPSKLPPRQA  739
            PFQPSLLPR K GPVIPSKLPPR+A
Sbjct  63   PFQPSLLPRIKGGPVIPSKLPPRKA  87



>gb|KEH20163.1| copper amine oxidase, enzyme domain protein [Medicago truncatula]
Length=724

 Score =   124 bits (312),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 72/85 (85%), Positives = 78/85 (92%), Gaps = 0/85 (0%)
 Frame = +2

Query  485  RAQSRHPLDPLTAAEISvavatvraagatPEVRDSMRFAEVSLVEPDKNVVALADAYFFP  664
            +AQ+ HPLDPL+AAEISVAVATVRAAGATPEVRD +RF EV LVEP+K VVALADAYFFP
Sbjct  27   KAQTCHPLDPLSAAEISVAVATVRAAGATPEVRDGIRFIEVGLVEPEKQVVALADAYFFP  86

Query  665  PFQPSLLPRTKKGPVIPSKLPPRQA  739
            PFQPSLLPR K GPVIPSKLPPR+A
Sbjct  87   PFQPSLLPRIKGGPVIPSKLPPRKA  111



>ref|XP_010678857.1| PREDICTED: copper amine oxidase 1-like isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=698

 Score =   124 bits (311),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 74/108 (69%), Positives = 90/108 (83%), Gaps = 4/108 (4%)
 Frame = +2

Query  419  VIDS-IEQPPASSAKVSVLPNTMRAQSRHPLDPLTAAEISvavatvraagatPEVRDSMR  595
            V+DS ++    S+  + ++PN     + HPL+PL+AAEISVAVATVRAAGATPEVRDSMR
Sbjct  26   VLDSTLDHATLSTKGIHIMPN---GWTTHPLNPLSAAEISVAVATVRAAGATPEVRDSMR  82

Query  596  FAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPRQA  739
            F EV+LVEP+K++VALADAYFFPPFQPSL+PRTK GP IPSKLP R+A
Sbjct  83   FIEVALVEPEKHIVALADAYFFPPFQPSLVPRTKGGPFIPSKLPLRKA  130



>gb|KEH20157.1| copper amine oxidase, enzyme domain protein [Medicago truncatula]
Length=774

 Score =   124 bits (312),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 72/85 (85%), Positives = 78/85 (92%), Gaps = 0/85 (0%)
 Frame = +2

Query  485  RAQSRHPLDPLTAAEISvavatvraagatPEVRDSMRFAEVSLVEPDKNVVALADAYFFP  664
            +AQ+ HPLDPL+AAEISVAVATVRAAGATPEVRD +RF EV LVEP+K VVALADAYFFP
Sbjct  77   KAQTCHPLDPLSAAEISVAVATVRAAGATPEVRDGIRFIEVGLVEPEKQVVALADAYFFP  136

Query  665  PFQPSLLPRTKKGPVIPSKLPPRQA  739
            PFQPSLLPR K GPVIPSKLPPR+A
Sbjct  137  PFQPSLLPRIKGGPVIPSKLPPRKA  161



>ref|XP_010533488.1| PREDICTED: copper amine oxidase 1-like [Tarenaya hassleriana]
Length=787

 Score =   124 bits (312),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 73/105 (70%), Positives = 90/105 (86%), Gaps = 5/105 (5%)
 Frame = +2

Query  425  DSIEQPPASSAKVSVLPNTMRAQSRHPLDPLTAAEISvavatvraagatPEVRDSMRFAE  604
            D+ ++P  ++  +S++P   R +++HPLDPL+AAEISVAVATVRAAGATPEVRD MRF E
Sbjct  70   DTTKKP--ANKGISLMP---RTETKHPLDPLSAAEISVAVATVRAAGATPEVRDGMRFIE  124

Query  605  VSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPRQA  739
            V L+EP+K VVALADAYFFPPFQPSLLPR K GP+IP+KLPPR+A
Sbjct  125  VVLIEPEKRVVALADAYFFPPFQPSLLPRFKGGPIIPTKLPPRRA  169



>ref|XP_004501882.1| PREDICTED: copper methylamine oxidase-like [Cicer arietinum]
Length=767

 Score =   124 bits (312),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 72/83 (87%), Positives = 78/83 (94%), Gaps = 0/83 (0%)
 Frame = +2

Query  485  RAQSRHPLDPLTAAEISvavatvraagatPEVRDSMRFAEVSLVEPDKNVVALADAYFFP  664
            R QS HPLDPL+AAEISVAVATVRAAGATPE+RDSMRF EV L+EPDK+VVALADAYFFP
Sbjct  66   RPQSSHPLDPLSAAEISVAVATVRAAGATPELRDSMRFIEVVLLEPDKHVVALADAYFFP  125

Query  665  PFQPSLLPRTKKGPVIPSKLPPR  733
            PFQPSLLPR+K GPVIP+KLPPR
Sbjct  126  PFQPSLLPRSKGGPVIPTKLPPR  148



>ref|XP_010678856.1| PREDICTED: copper amine oxidase 1-like isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=745

 Score =   124 bits (311),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 74/108 (69%), Positives = 90/108 (83%), Gaps = 4/108 (4%)
 Frame = +2

Query  419  VIDS-IEQPPASSAKVSVLPNTMRAQSRHPLDPLTAAEISvavatvraagatPEVRDSMR  595
            V+DS ++    S+  + ++PN     + HPL+PL+AAEISVAVATVRAAGATPEVRDSMR
Sbjct  26   VLDSTLDHATLSTKGIHIMPN---GWTTHPLNPLSAAEISVAVATVRAAGATPEVRDSMR  82

Query  596  FAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPRQA  739
            F EV+LVEP+K++VALADAYFFPPFQPSL+PRTK GP IPSKLP R+A
Sbjct  83   FIEVALVEPEKHIVALADAYFFPPFQPSLVPRTKGGPFIPSKLPLRKA  130



>emb|CDY35376.1| BnaA03g19840D [Brassica napus]
Length=1065

 Score =   125 bits (313),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 78/109 (72%), Positives = 91/109 (83%), Gaps = 7/109 (6%)
 Frame = +2

Query  422  IDSI---EQPPASSAKVSVLPNTMRAQSRHPLDPLTAAEISvavatvraagatPEVRDSM  592
            +DSI    + PA+   +SV P   R++++HPLDPL+AAEISVAVATVRAAGA PEVRDSM
Sbjct  35   VDSIPDTAKKPANKG-ISVTP---RSETKHPLDPLSAAEISVAVATVRAAGANPEVRDSM  90

Query  593  RFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPRQA  739
            RF EV+ VEP+K+VVALADAYFFPPFQPSLLPR K GPVIP KLPPR+A
Sbjct  91   RFIEVASVEPEKHVVALADAYFFPPFQPSLLPRNKSGPVIPMKLPPRRA  139



>ref|XP_009133538.1| PREDICTED: copper amine oxidase 1-like [Brassica rapa]
Length=757

 Score =   124 bits (311),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 78/109 (72%), Positives = 91/109 (83%), Gaps = 7/109 (6%)
 Frame = +2

Query  422  IDSI---EQPPASSAKVSVLPNTMRAQSRHPLDPLTAAEISvavatvraagatPEVRDSM  592
            +DSI    + PA+   +SV P   R++++HPLDPL+AAEISVAVATVRAAGA PEVRDSM
Sbjct  35   VDSIPDTAKKPANKG-ISVTP---RSETKHPLDPLSAAEISVAVATVRAAGANPEVRDSM  90

Query  593  RFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPRQA  739
            RF EV+ VEP+K+VVALADAYFFPPFQPSLLPR K GPVIP KLPPR+A
Sbjct  91   RFIEVASVEPEKHVVALADAYFFPPFQPSLLPRNKSGPVIPMKLPPRRA  139



>ref|XP_006347431.1| PREDICTED: copper amine oxidase 1-like [Solanum tuberosum]
Length=769

 Score =   123 bits (309),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 85/107 (79%), Gaps = 1/107 (1%)
 Frame = +2

Query  419  VIDSIEQPPASSAKVSVLPNTMRAQSRHPLDPLTAAEISvavatvraagatPEVRDSMRF  598
            V D  EQ PA ++   V+    RAQ+ HPLDPLTAAEISVAVATVRAAG TPEVRD MRF
Sbjct  46   VDDQKEQTPAIASS-KVIQIMHRAQTCHPLDPLTAAEISVAVATVRAAGDTPEVRDGMRF  104

Query  599  AEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPRQA  739
             EV L+EPDK  VALADAYF+PPFQ SLLPRTK G ++PSKLPPR+A
Sbjct  105  VEVVLLEPDKTFVALADAYFYPPFQSSLLPRTKGGLLVPSKLPPRRA  151



>ref|XP_009606421.1| PREDICTED: copper amine oxidase 1-like [Nicotiana tomentosiformis]
Length=786

 Score =   123 bits (309),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 86/172 (50%), Positives = 107/172 (62%), Gaps = 18/172 (10%)
 Frame = +2

Query  266  MASTPEKAT--------------LQSRNDSVVAAADGDVLQEWTSSVERQIGQREavaaa  403
            MA+T +K T              +  R  +   A  GD LQ W +       Q++  ++A
Sbjct  1    MATTKQKVTAPSSSTAPCCPSTSILRREATAAVAGVGDGLQNWNNVPSVDDKQKKTASSA  60

Query  404  splaaVIDSIEQPPASSAKVSVLPNTMRAQSRHPLDPLTAAEISvavatvraagatPEVR  583
                A      +P +S+     +    RAQ+ HPLDPL+AAEISVAVATVRAAG TPEVR
Sbjct  61   LASLAST----EPLSSNTSTKGIQIMTRAQTCHPLDPLSAAEISVAVATVRAAGETPEVR  116

Query  584  DSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPRQA  739
            D MRF EV L+EPDK+VVALADAYFFPPFQ SL+PRTK G +IP+KLPPR+A
Sbjct  117  DGMRFIEVVLLEPDKSVVALADAYFFPPFQSSLMPRTKGGSLIPTKLPPRRA  168



>ref|XP_009778427.1| PREDICTED: copper amine oxidase 1-like [Nicotiana sylvestris]
 gb|ABI93948.1| methylputrescine oxidase [Nicotiana tabacum]
 dbj|BAF49519.1| N-methylputrescine oxidase [Nicotiana tabacum]
Length=790

 Score =   123 bits (309),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 83/152 (55%), Positives = 104/152 (68%), Gaps = 8/152 (5%)
 Frame = +2

Query  290  TLQSRNDSVVAAADGDVLQEWTS--SVERQIGQREavaaasplaaVIDSIEQPPASSAKV  463
            ++  R  +   A  GD LQ WT+  SV+ +  Q++  ++A           +P +++   
Sbjct  27   SILRREATAAIAVVGDGLQNWTNIPSVDEK--QKKTASSALASLPTT----EPLSTNTST  80

Query  464  SVLPNTMRAQSRHPLDPLTAAEISvavatvraagatPEVRDSMRFAEVSLVEPDKNVVAL  643
              +    RAQ+ HPLDPL+AAEISVAVATVRAAG TPEVRD MRF EV LVEPDK+VVAL
Sbjct  81   KGIQIMTRAQTCHPLDPLSAAEISVAVATVRAAGETPEVRDGMRFIEVVLVEPDKSVVAL  140

Query  644  ADAYFFPPFQPSLLPRTKKGPVIPSKLPPRQA  739
            ADAYFFPPFQ SL+PRTK G  IP+KLPPR+A
Sbjct  141  ADAYFFPPFQSSLMPRTKGGSQIPTKLPPRRA  172



>gb|ABR16250.1| unknown [Picea sitchensis]
Length=788

 Score =   123 bits (308),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 69/86 (80%), Positives = 78/86 (91%), Gaps = 0/86 (0%)
 Frame = +2

Query  482  MRAQSRHPLDPLTAAEISvavatvraagatPEVRDSMRFAEVSLVEPDKNVVALADAYFF  661
            +RA  RHPL+PL+AAEI+VAV+TVRAAGATPE+RD MRF EV L EPDK+VVALADAYFF
Sbjct  92   LRANPRHPLEPLSAAEIAVAVSTVRAAGATPEMRDGMRFIEVVLKEPDKHVVALADAYFF  151

Query  662  PPFQPSLLPRTKKGPVIPSKLPPRQA  739
            PPFQPSLLP+TK GPVIP +LPPRQA
Sbjct  152  PPFQPSLLPKTKGGPVIPRQLPPRQA  177



>tpg|DAA37329.1| TPA: hypothetical protein ZEAMMB73_085776 [Zea mays]
Length=442

 Score =   119 bits (299),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 78/123 (63%), Positives = 92/123 (75%), Gaps = 2/123 (2%)
 Frame = +2

Query  377  GQREavaaasplaaVIDSIE--QPPASSAKVSVLPNTMRAQSRHPLDPLTAAEISvavat  550
            G+R + +AA    AVI+ I   QP  + A    +P   RAQ  HPLDPL+AAEI+VAVAT
Sbjct  46   GERVSASAAGSSGAVIEEIAAVQPTTAKASSKGIPIMTRAQRCHPLDPLSAAEIAVAVAT  105

Query  551  vraagatPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPP  730
            VR AG +PE RDSMRF E  L+EP+KNVVALADAYFFPPFQPSLLPR+K   VIPS+LPP
Sbjct  106  VRVAGRSPEERDSMRFVEAVLLEPEKNVVALADAYFFPPFQPSLLPRSKGSAVIPSRLPP  165

Query  731  RQA  739
            R+A
Sbjct  166  RRA  168



>ref|XP_007155469.1| hypothetical protein PHAVU_003G204000g [Phaseolus vulgaris]
 gb|ESW27463.1| hypothetical protein PHAVU_003G204000g [Phaseolus vulgaris]
Length=1289

 Score =   123 bits (308),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 70/90 (78%), Positives = 78/90 (87%), Gaps = 0/90 (0%)
 Frame = +2

Query  470  LPNTMRAQSRHPLDPLTAAEISvavatvraagatPEVRDSMRFAEVSLVEPDKNVVALAD  649
            +  T   QS HPLDPL+AAEISVAVATVR AG TPE+RD+MRF EV L+EPDK+VVALAD
Sbjct  33   ITTTAGFQSSHPLDPLSAAEISVAVATVREAGVTPELRDNMRFIEVVLLEPDKHVVALAD  92

Query  650  AYFFPPFQPSLLPRTKKGPVIPSKLPPRQA  739
            AYFFPPFQPSLLPRTK+G VI SKLPPR+A
Sbjct  93   AYFFPPFQPSLLPRTKEGTVISSKLPPRRA  122



>gb|EMS63127.1| Primary amine oxidase [Triticum urartu]
Length=735

 Score =   122 bits (305),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 73/104 (70%), Positives = 82/104 (79%), Gaps = 0/104 (0%)
 Frame = +2

Query  428  SIEQPPASSAKVSVLPNTMRAQSRHPLDPLTAAEISvavatvraagatPEVRDSMRFAEV  607
            S  QP  + A    +P   RAQ  HPLDPL+AAEI+VAVATVRAAG +PE RDSMRF E 
Sbjct  18   SAAQPTTAKASSKGIPIMTRAQRFHPLDPLSAAEIAVAVATVRAAGKSPEERDSMRFVEA  77

Query  608  SLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPRQA  739
             L+EP+KNVVALADAYFFPPFQPSLLPRTK   VIPS+LPPR+A
Sbjct  78   VLLEPEKNVVALADAYFFPPFQPSLLPRTKGSAVIPSRLPPRRA  121



>ref|XP_004244763.1| PREDICTED: copper amine oxidase 1-like [Solanum lycopersicum]
Length=788

 Score =   122 bits (305),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 69/86 (80%), Positives = 78/86 (91%), Gaps = 0/86 (0%)
 Frame = +2

Query  482  MRAQSRHPLDPLTAAEISvavatvraagatPEVRDSMRFAEVSLVEPDKNVVALADAYFF  661
            +RAQ+ HPLDPL+AAEISVAVATVRAAG TPEVRD MRF EV L+EPDK+VVALADAYFF
Sbjct  84   LRAQTCHPLDPLSAAEISVAVATVRAAGETPEVRDGMRFIEVVLLEPDKSVVALADAYFF  143

Query  662  PPFQPSLLPRTKKGPVIPSKLPPRQA  739
            PPFQ SL+PRTK G +IP+KLPPR+A
Sbjct  144  PPFQSSLMPRTKGGSLIPTKLPPRRA  169



>ref|XP_002448036.1| hypothetical protein SORBIDRAFT_06g020020 [Sorghum bicolor]
 gb|EES12364.1| hypothetical protein SORBIDRAFT_06g020020 [Sorghum bicolor]
Length=782

 Score =   122 bits (305),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 72/101 (71%), Positives = 82/101 (81%), Gaps = 0/101 (0%)
 Frame = +2

Query  437  QPPASSAKVSVLPNTMRAQSRHPLDPLTAAEISvavatvraagatPEVRDSMRFAEVSLV  616
            QP  + A    +P   RAQ  HPLDPL+AAEI+VAVATVRAAG +PE RDSMRF EV L+
Sbjct  70   QPTTAKASSKGIPIMTRAQRCHPLDPLSAAEIAVAVATVRAAGRSPEERDSMRFVEVVLL  129

Query  617  EPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPRQA  739
            EP+KNVVALADAYFFPPFQPSLLPR+K   VIPS+LPPR+A
Sbjct  130  EPEKNVVALADAYFFPPFQPSLLPRSKGSAVIPSRLPPRRA  170



>ref|XP_004975956.1| PREDICTED: copper amine oxidase 1-like [Setaria italica]
Length=781

 Score =   121 bits (304),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 71/101 (70%), Positives = 80/101 (79%), Gaps = 0/101 (0%)
 Frame = +2

Query  437  QPPASSAKVSVLPNTMRAQSRHPLDPLTAAEISvavatvraagatPEVRDSMRFAEVSLV  616
            QP  + A    +P   RAQ  HPLDPL+AAEI+VAV TVRAAG +PE RDSMRF E  L+
Sbjct  68   QPTTAKASSKGIPIMTRAQRCHPLDPLSAAEIAVAVVTVRAAGRSPEERDSMRFVEAVLL  127

Query  617  EPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPRQA  739
            EP+KNVVALADAYFFPPFQPSLLPRTK   VIPS+LPPR+A
Sbjct  128  EPNKNVVALADAYFFPPFQPSLLPRTKGSAVIPSRLPPRRA  168



>ref|XP_003581353.1| PREDICTED: copper amine oxidase 1-like [Brachypodium distachyon]
Length=771

 Score =   121 bits (304),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 72/101 (71%), Positives = 81/101 (80%), Gaps = 0/101 (0%)
 Frame = +2

Query  437  QPPASSAKVSVLPNTMRAQSRHPLDPLTAAEISvavatvraagatPEVRDSMRFAEVSLV  616
            QP  + A    +P   RAQ  HPLDPL+AAEI+VAVATVRAAG +PE RDSMRF E  L+
Sbjct  58   QPTTAKASSKGIPIMTRAQRFHPLDPLSAAEIAVAVATVRAAGKSPEERDSMRFVEAVLL  117

Query  617  EPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPRQA  739
            EP+KNVVALADAYFFPPFQPSLLPRTK   VIPS+LPPR+A
Sbjct  118  EPEKNVVALADAYFFPPFQPSLLPRTKGSAVIPSRLPPRRA  158



>ref|XP_006600619.1| PREDICTED: copper amine oxidase 1-like isoform X4 [Glycine max]
Length=680

 Score =   120 bits (302),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 77/104 (74%), Positives = 85/104 (82%), Gaps = 1/104 (1%)
 Frame = +2

Query  431  IEQPPASSAKVSVLPNTM-RAQSRHPLDPLTAAEISvavatvraagatPEVRDSMRFAEV  607
            I +P A+ A      +TM R QS HPLDPL+AAEISVAVATVRAAGATPE+RDS+RF EV
Sbjct  29   ISEPSATHALPPKGISTMSRTQSSHPLDPLSAAEISVAVATVRAAGATPELRDSIRFIEV  88

Query  608  SLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPRQA  739
             L+EPDK+VVALADAYFF PFQPSLLPRTK G VIPS LPPR A
Sbjct  89   VLLEPDKHVVALADAYFFSPFQPSLLPRTKGGAVIPSNLPPRCA  132



>ref|XP_006600618.1| PREDICTED: copper amine oxidase 1-like isoform X3 [Glycine max]
Length=697

 Score =   120 bits (302),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 77/104 (74%), Positives = 85/104 (82%), Gaps = 1/104 (1%)
 Frame = +2

Query  431  IEQPPASSAKVSVLPNTM-RAQSRHPLDPLTAAEISvavatvraagatPEVRDSMRFAEV  607
            I +P A+ A      +TM R QS HPLDPL+AAEISVAVATVRAAGATPE+RDS+RF EV
Sbjct  29   ISEPSATHALPPKGISTMSRTQSSHPLDPLSAAEISVAVATVRAAGATPELRDSIRFIEV  88

Query  608  SLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPRQA  739
             L+EPDK+VVALADAYFF PFQPSLLPRTK G VIPS LPPR A
Sbjct  89   VLLEPDKHVVALADAYFFSPFQPSLLPRTKGGAVIPSNLPPRCA  132



>gb|EAY94528.1| hypothetical protein OsI_16305 [Oryza sativa Indica Group]
Length=787

 Score =   120 bits (301),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 68/90 (76%), Positives = 77/90 (86%), Gaps = 0/90 (0%)
 Frame = +2

Query  470  LPNTMRAQSRHPLDPLTAAEISvavatvraagatPEVRDSMRFAEVSLVEPDKNVVALAD  649
            +P   RAQ  HPLDPL+AAEI+VA+ATVRAAG +PE RD MRF EV L+EP+KNVVALAD
Sbjct  86   IPIMTRAQRSHPLDPLSAAEIAVAIATVRAAGKSPEERDGMRFVEVVLLEPEKNVVALAD  145

Query  650  AYFFPPFQPSLLPRTKKGPVIPSKLPPRQA  739
            AYFFPPFQPSLLPRTK   VIPS+LPPR+A
Sbjct  146  AYFFPPFQPSLLPRTKGSAVIPSRLPPRRA  175



>ref|XP_008668433.1| PREDICTED: uncharacterized protein LOC100383438 isoform X1 [Zea 
mays]
 tpg|DAA37327.1| TPA: hypothetical protein ZEAMMB73_085776 [Zea mays]
 tpg|DAA37328.1| TPA: hypothetical protein ZEAMMB73_085776 [Zea mays]
Length=780

 Score =   120 bits (301),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 78/123 (63%), Positives = 92/123 (75%), Gaps = 2/123 (2%)
 Frame = +2

Query  377  GQREavaaasplaaVIDSIE--QPPASSAKVSVLPNTMRAQSRHPLDPLTAAEISvavat  550
            G+R + +AA    AVI+ I   QP  + A    +P   RAQ  HPLDPL+AAEI+VAVAT
Sbjct  46   GERVSASAAGSSGAVIEEIAAVQPTTAKASSKGIPIMTRAQRCHPLDPLSAAEIAVAVAT  105

Query  551  vraagatPEVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPP  730
            VR AG +PE RDSMRF E  L+EP+KNVVALADAYFFPPFQPSLLPR+K   VIPS+LPP
Sbjct  106  VRVAGRSPEERDSMRFVEAVLLEPEKNVVALADAYFFPPFQPSLLPRSKGSAVIPSRLPP  165

Query  731  RQA  739
            R+A
Sbjct  166  RRA  168



>gb|EAZ31082.1| hypothetical protein OsJ_15179 [Oryza sativa Japonica Group]
Length=838

 Score =   120 bits (302),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 68/90 (76%), Positives = 77/90 (86%), Gaps = 0/90 (0%)
 Frame = +2

Query  470  LPNTMRAQSRHPLDPLTAAEISvavatvraagatPEVRDSMRFAEVSLVEPDKNVVALAD  649
            +P   RAQ  HPLDPL+AAEI+VA+ATVRAAG +PE RD MRF EV L+EP+KNVVALAD
Sbjct  137  IPIMTRAQRSHPLDPLSAAEIAVAIATVRAAGKSPEERDGMRFVEVVLLEPEKNVVALAD  196

Query  650  AYFFPPFQPSLLPRTKKGPVIPSKLPPRQA  739
            AYFFPPFQPSLLPRTK   VIPS+LPPR+A
Sbjct  197  AYFFPPFQPSLLPRTKGSAVIPSRLPPRRA  226



>ref|XP_006600617.1| PREDICTED: copper amine oxidase 1-like isoform X2 [Glycine max]
Length=722

 Score =   120 bits (300),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 77/104 (74%), Positives = 85/104 (82%), Gaps = 1/104 (1%)
 Frame = +2

Query  431  IEQPPASSAKVSVLPNTM-RAQSRHPLDPLTAAEISvavatvraagatPEVRDSMRFAEV  607
            I +P A+ A      +TM R QS HPLDPL+AAEISVAVATVRAAGATPE+RDS+RF EV
Sbjct  29   ISEPSATHALPPKGISTMSRTQSSHPLDPLSAAEISVAVATVRAAGATPELRDSIRFIEV  88

Query  608  SLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPRQA  739
             L+EPDK+VVALADAYFF PFQPSLLPRTK G VIPS LPPR A
Sbjct  89   VLLEPDKHVVALADAYFFSPFQPSLLPRTKGGAVIPSNLPPRCA  132



>ref|XP_010322539.1| PREDICTED: copper amine oxidase 1-like [Solanum lycopersicum]
Length=774

 Score =   120 bits (301),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 73/104 (70%), Positives = 82/104 (79%), Gaps = 5/104 (5%)
 Frame = +2

Query  434  EQPPA--SSAKVSVLPNTMRAQSRHPLDPLTAAEISvavatvraagatPEVRDSMRFAEV  607
            EQ PA  SS  + ++    RA + HPLDPLTAAEISVAVATVRAAG TPEVRD MRF EV
Sbjct  56   EQTPATASSKGIQIM---HRAHTCHPLDPLTAAEISVAVATVRAAGDTPEVRDGMRFVEV  112

Query  608  SLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPRQA  739
             L+EPDK  VALADAYF+PPFQ SL+PRTK G ++PSKLPPR A
Sbjct  113  VLLEPDKTFVALADAYFYPPFQSSLMPRTKGGLLVPSKLPPRHA  156



>ref|XP_003550715.1| PREDICTED: copper amine oxidase 1-like isoform X1 [Glycine max]
Length=751

 Score =   120 bits (300),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 77/104 (74%), Positives = 85/104 (82%), Gaps = 1/104 (1%)
 Frame = +2

Query  431  IEQPPASSAKVSVLPNTM-RAQSRHPLDPLTAAEISvavatvraagatPEVRDSMRFAEV  607
            I +P A+ A      +TM R QS HPLDPL+AAEISVAVATVRAAGATPE+RDS+RF EV
Sbjct  29   ISEPSATHALPPKGISTMSRTQSSHPLDPLSAAEISVAVATVRAAGATPELRDSIRFIEV  88

Query  608  SLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPRQA  739
             L+EPDK+VVALADAYFF PFQPSLLPRTK G VIPS LPPR A
Sbjct  89   VLLEPDKHVVALADAYFFSPFQPSLLPRTKGGAVIPSNLPPRCA  132



>emb|CAH67316.1| OSIGBa0106G07.12 [Oryza sativa Indica Group]
Length=699

 Score =   119 bits (297),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 67/85 (79%), Positives = 75/85 (88%), Gaps = 0/85 (0%)
 Frame = +2

Query  485  RAQSRHPLDPLTAAEISvavatvraagatPEVRDSMRFAEVSLVEPDKNVVALADAYFFP  664
            RAQ  HPLDPL+AAEI+VA+ATVRAAG +PE RD MRF EV L+EP+KNVVALADAYFFP
Sbjct  3    RAQRSHPLDPLSAAEIAVAIATVRAAGKSPEERDGMRFVEVVLLEPEKNVVALADAYFFP  62

Query  665  PFQPSLLPRTKKGPVIPSKLPPRQA  739
            PFQPSLLPRTK   VIPS+LPPR+A
Sbjct  63   PFQPSLLPRTKGSAVIPSRLPPRRA  87



>emb|CAE05498.2| OSJNBa0022H21.18 [Oryza sativa Japonica Group]
Length=699

 Score =   119 bits (297),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 67/85 (79%), Positives = 75/85 (88%), Gaps = 0/85 (0%)
 Frame = +2

Query  485  RAQSRHPLDPLTAAEISvavatvraagatPEVRDSMRFAEVSLVEPDKNVVALADAYFFP  664
            RAQ  HPLDPL+AAEI+VA+ATVRAAG +PE RD MRF EV L+EP+KNVVALADAYFFP
Sbjct  3    RAQRSHPLDPLSAAEIAVAIATVRAAGKSPEERDGMRFVEVVLLEPEKNVVALADAYFFP  62

Query  665  PFQPSLLPRTKKGPVIPSKLPPRQA  739
            PFQPSLLPRTK   VIPS+LPPR+A
Sbjct  63   PFQPSLLPRTKGSAVIPSRLPPRRA  87



>ref|XP_006351050.1| PREDICTED: copper amine oxidase 1-like [Solanum tuberosum]
Length=786

 Score =   119 bits (297),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 67/86 (78%), Positives = 77/86 (90%), Gaps = 0/86 (0%)
 Frame = +2

Query  482  MRAQSRHPLDPLTAAEISvavatvraagatPEVRDSMRFAEVSLVEPDKNVVALADAYFF  661
            ++AQ+ HPLDPL+AAEISVAVATVRAAG TPEVRD MRF EV L+EPDK+VVALADAYFF
Sbjct  82   LKAQTCHPLDPLSAAEISVAVATVRAAGETPEVRDGMRFIEVVLLEPDKSVVALADAYFF  141

Query  662  PPFQPSLLPRTKKGPVIPSKLPPRQA  739
            PPFQ SL+PR K G +IP+KLPPR+A
Sbjct  142  PPFQSSLMPRNKGGSLIPTKLPPRRA  167



>gb|EAZ29581.1| hypothetical protein OsJ_13655 [Oryza sativa Japonica Group]
Length=819

 Score =   117 bits (294),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 62/85 (73%), Positives = 73/85 (86%), Gaps = 0/85 (0%)
 Frame = +2

Query  485  RAQSRHPLDPLTAAEISvavatvraagatPEVRDSMRFAEVSLVEPDKNVVALADAYFFP  664
            R Q  HPLDPL+AAEI+VAV TV+AA +TPEVRD MRF EV+L+EP+KNVVALADAYFFP
Sbjct  104  RTQRSHPLDPLSAAEIAVAVTTVKAAASTPEVRDGMRFVEVALLEPEKNVVALADAYFFP  163

Query  665  PFQPSLLPRTKKGPVIPSKLPPRQA  739
            PFQPSLLP  +  P+IP+KLPP +A
Sbjct  164  PFQPSLLPGNRNAPIIPTKLPPSRA  188



>emb|CAE02362.2| OSJNBb0016B03.15 [Oryza sativa Japonica Group]
Length=792

 Score =   117 bits (294),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 62/85 (73%), Positives = 73/85 (86%), Gaps = 0/85 (0%)
 Frame = +2

Query  485  RAQSRHPLDPLTAAEISvavatvraagatPEVRDSMRFAEVSLVEPDKNVVALADAYFFP  664
            R Q  HPLDPL+AAEI+VAV TV+AA +TPEVRD MRF EV+L+EP+KNVVALADAYFFP
Sbjct  104  RTQRSHPLDPLSAAEIAVAVTTVKAAASTPEVRDGMRFVEVALLEPEKNVVALADAYFFP  163

Query  665  PFQPSLLPRTKKGPVIPSKLPPRQA  739
            PFQPSLLP  +  P+IP+KLPP +A
Sbjct  164  PFQPSLLPGNRNAPIIPTKLPPSRA  188



>ref|XP_006652410.1| PREDICTED: copper amine oxidase 1-like [Oryza brachyantha]
Length=699

 Score =   115 bits (289),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 67/85 (79%), Positives = 74/85 (87%), Gaps = 0/85 (0%)
 Frame = +2

Query  485  RAQSRHPLDPLTAAEISvavatvraagatPEVRDSMRFAEVSLVEPDKNVVALADAYFFP  664
            RAQ  HPLDPL+AAEI+VAVATVRAAG +PE RD MRF E  L+EP+KNVVALADAYFFP
Sbjct  3    RAQRSHPLDPLSAAEIAVAVATVRAAGKSPEERDGMRFVEAVLLEPEKNVVALADAYFFP  62

Query  665  PFQPSLLPRTKKGPVIPSKLPPRQA  739
            PFQPSLLPRTK   VIPS+LPPR+A
Sbjct  63   PFQPSLLPRTKGSAVIPSRLPPRRA  87



>ref|XP_010682433.1| PREDICTED: copper amine oxidase 1-like [Beta vulgaris subsp. 
vulgaris]
Length=773

 Score =   115 bits (287),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 68/97 (70%), Positives = 81/97 (84%), Gaps = 0/97 (0%)
 Frame = +2

Query  449  SSAKVSVLPNTMRAQSRHPLDPLTAAEISvavatvraagatPEVRDSMRFAEVSLVEPDK  628
            ++AK  V+   ++A++ HPLDPL+A EI VAVATVRAAGATPE RD MRF EV LVEP+K
Sbjct  63   AAAKAKVIQMPLKARTSHPLDPLSATEIKVAVATVRAAGATPEERDGMRFIEVVLVEPEK  122

Query  629  NVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPRQA  739
            +V+A+ADAYFFPPFQPSLL RT+   VIPSKLPPRQA
Sbjct  123  HVIAMADAYFFPPFQPSLLTRTRGRHVIPSKLPPRQA  159



>gb|EEC76708.1| hypothetical protein OsI_14715 [Oryza sativa Indica Group]
Length=729

 Score =   113 bits (283),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 61/85 (72%), Positives = 72/85 (85%), Gaps = 0/85 (0%)
 Frame = +2

Query  485  RAQSRHPLDPLTAAEISvavatvraagatPEVRDSMRFAEVSLVEPDKNVVALADAYFFP  664
            R Q  HPLDPL+AAEI+VAV TV+AA +TPEVRD MRF EV+L+EP+KNVVALADAYFF 
Sbjct  14   RTQRSHPLDPLSAAEIAVAVTTVKAAASTPEVRDGMRFVEVALLEPEKNVVALADAYFFR  73

Query  665  PFQPSLLPRTKKGPVIPSKLPPRQA  739
            PFQPSLLP  +  P+I +KLPPR+A
Sbjct  74   PFQPSLLPGNRNAPIIATKLPPRRA  98



>ref|XP_009618866.1| PREDICTED: copper amine oxidase 1-like isoform X2 [Nicotiana 
tomentosiformis]
Length=723

 Score =   111 bits (278),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 66/85 (78%), Positives = 73/85 (86%), Gaps = 0/85 (0%)
 Frame = +2

Query  485  RAQSRHPLDPLTAAEISvavatvraagatPEVRDSMRFAEVSLVEPDKNVVALADAYFFP  664
            RA + HPLDPL+AAEISVAVATVRAAG TPEVRD MRF EV L+EPDK+VVALADAYFFP
Sbjct  64   RAHTCHPLDPLSAAEISVAVATVRAAGETPEVRDGMRFIEVVLLEPDKSVVALADAYFFP  123

Query  665  PFQPSLLPRTKKGPVIPSKLPPRQA  739
            PFQ SL+ R K G  IP+KLPPR+A
Sbjct  124  PFQSSLMSRRKGGLPIPTKLPPRRA  148



>ref|XP_009773282.1| PREDICTED: copper amine oxidase 1-like [Nicotiana sylvestris]
 ref|XP_009773283.1| PREDICTED: copper amine oxidase 1-like [Nicotiana sylvestris]
Length=774

 Score =   111 bits (278),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 69/101 (68%), Positives = 79/101 (78%), Gaps = 0/101 (0%)
 Frame = +2

Query  437  QPPASSAKVSVLPNTMRAQSRHPLDPLTAAEISvavatvraagatPEVRDSMRFAEVSLV  616
            QPP+S+          RA + HPLDPL+AAEISVAVATVRAAG TPEVRD MRF EV L+
Sbjct  56   QPPSSNPSGKGKQIMPRAHTCHPLDPLSAAEISVAVATVRAAGETPEVRDGMRFIEVVLL  115

Query  617  EPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPRQA  739
            EPDK+V+ALADAYFFPPFQ SL+ R K G  IP+KLPPR+A
Sbjct  116  EPDKSVIALADAYFFPPFQSSLMSRRKGGLPIPTKLPPRRA  156



>ref|XP_009618862.1| PREDICTED: copper amine oxidase 1-like isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009618864.1| PREDICTED: copper amine oxidase 1-like isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009618865.1| PREDICTED: copper amine oxidase 1-like isoform X1 [Nicotiana 
tomentosiformis]
Length=766

 Score =   111 bits (277),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 66/85 (78%), Positives = 73/85 (86%), Gaps = 0/85 (0%)
 Frame = +2

Query  485  RAQSRHPLDPLTAAEISvavatvraagatPEVRDSMRFAEVSLVEPDKNVVALADAYFFP  664
            RA + HPLDPL+AAEISVAVATVRAAG TPEVRD MRF EV L+EPDK+VVALADAYFFP
Sbjct  64   RAHTCHPLDPLSAAEISVAVATVRAAGETPEVRDGMRFIEVVLLEPDKSVVALADAYFFP  123

Query  665  PFQPSLLPRTKKGPVIPSKLPPRQA  739
            PFQ SL+ R K G  IP+KLPPR+A
Sbjct  124  PFQSSLMSRRKGGLPIPTKLPPRRA  148



>dbj|BAF49520.1| N-methylputrescine oxidase [Nicotiana tabacum]
Length=766

 Score =   111 bits (277),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 66/85 (78%), Positives = 73/85 (86%), Gaps = 0/85 (0%)
 Frame = +2

Query  485  RAQSRHPLDPLTAAEISvavatvraagatPEVRDSMRFAEVSLVEPDKNVVALADAYFFP  664
            RA + HPLDPL+AAEISVAVATVRAAG TPEVRD MRF EV L+EPDK+VVALADAYFFP
Sbjct  64   RAHTCHPLDPLSAAEISVAVATVRAAGETPEVRDGMRFIEVVLLEPDKSVVALADAYFFP  123

Query  665  PFQPSLLPRTKKGPVIPSKLPPRQA  739
            PFQ SL+ R K G  IP+KLPPR+A
Sbjct  124  PFQSSLMSRRKGGLPIPTKLPPRRA  148



>ref|XP_009618867.1| PREDICTED: copper amine oxidase 1-like isoform X3 [Nicotiana 
tomentosiformis]
Length=702

 Score =   110 bits (276),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 66/85 (78%), Positives = 73/85 (86%), Gaps = 0/85 (0%)
 Frame = +2

Query  485  RAQSRHPLDPLTAAEISvavatvraagatPEVRDSMRFAEVSLVEPDKNVVALADAYFFP  664
            RA + HPLDPL+AAEISVAVATVRAAG TPEVRD MRF EV L+EPDK+VVALADAYFFP
Sbjct  64   RAHTCHPLDPLSAAEISVAVATVRAAGETPEVRDGMRFIEVVLLEPDKSVVALADAYFFP  123

Query  665  PFQPSLLPRTKKGPVIPSKLPPRQA  739
            PFQ SL+ R K G  IP+KLPPR+A
Sbjct  124  PFQSSLMSRRKGGLPIPTKLPPRRA  148



>gb|KHN18421.1| Copper methylamine oxidase [Glycine soja]
Length=711

 Score =   109 bits (273),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 65/104 (63%), Positives = 73/104 (70%), Gaps = 13/104 (13%)
 Frame = +2

Query  431  IEQPPASSAKVSVLPNTM-RAQSRHPLDPLTAAEISvavatvraagatPEVRDSMRFAEV  607
            I +P A+ A      +TM R QS HPLDPL+AAEISVA            +RDS+RF EV
Sbjct  29   ISEPSATHALPPKGISTMSRTQSSHPLDPLSAAEISVA------------LRDSIRFIEV  76

Query  608  SLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPRQA  739
             L+EPDK+VVALADAYFF PFQPSLLPRTK G VIPS LPPR A
Sbjct  77   VLLEPDKHVVALADAYFFSPFQPSLLPRTKGGAVIPSNLPPRCA  120



>ref|XP_001759255.1| predicted protein [Physcomitrella patens]
 gb|EDQ75939.1| predicted protein [Physcomitrella patens]
Length=715

 Score =   107 bits (267),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 64/88 (73%), Positives = 73/88 (83%), Gaps = 1/88 (1%)
 Frame = +2

Query  479  TMRAQSRHPLDPLTAAEISvavatvraagatPEVRDSMRFAEVSLVEPDKNVVALADAYF  658
             +R+QS HPLDPLT  EI+VA+ATVRAAGATPEVRD MRF EV L EPDKNVVALADAYF
Sbjct  8    VLRSQSAHPLDPLTPTEIAVAIATVRAAGATPEVRDGMRFVEVVLNEPDKNVVALADAYF  67

Query  659  FPPFQPSLL-PRTKKGPVIPSKLPPRQA  739
            FPP+QP+L  P+ K G + P +LPPRQA
Sbjct  68   FPPYQPTLYRPKAKGGAMYPLQLPPRQA  95



>ref|XP_001757203.1| predicted protein [Physcomitrella patens]
 gb|EDQ78062.1| predicted protein [Physcomitrella patens]
Length=715

 Score =   107 bits (266),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 64/88 (73%), Positives = 73/88 (83%), Gaps = 1/88 (1%)
 Frame = +2

Query  479  TMRAQSRHPLDPLTAAEISvavatvraagatPEVRDSMRFAEVSLVEPDKNVVALADAYF  658
             +R+QS HPLDPLT  EI+VA+ATVRAAGATPEVRD MRF EV L EPDKNVVALADAYF
Sbjct  8    VLRSQSAHPLDPLTPTEIAVAIATVRAAGATPEVRDGMRFVEVVLNEPDKNVVALADAYF  67

Query  659  FPPFQPSLL-PRTKKGPVIPSKLPPRQA  739
            FPP+QP+L  P+ K G + P +LPPRQA
Sbjct  68   FPPYQPTLYRPKAKGGAMYPLQLPPRQA  95



>gb|EMT09520.1| Copper methylamine oxidase [Aegilops tauschii]
Length=808

 Score =   102 bits (255),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 47/55 (85%), Positives = 52/55 (95%), Gaps = 0/55 (0%)
 Frame = +2

Query  575  EVRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPRQA  739
            +VRDSMRF EV L+EP+KNVVALADAYFFPPFQPSLLPRTK GPVIPS+LPPR+A
Sbjct  143  KVRDSMRFVEVVLLEPEKNVVALADAYFFPPFQPSLLPRTKGGPVIPSRLPPRRA  197


 Score =   102 bits (254),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 47/54 (87%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +2

Query  578  VRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPRQA  739
            VRDSMRF EV L+EP+KNVVALADAYFFPPFQPSLLPRTK GPVIPS+LPPR+A
Sbjct  56   VRDSMRFVEVVLLEPEKNVVALADAYFFPPFQPSLLPRTKGGPVIPSRLPPRRA  109



>emb|CDP13212.1| unnamed protein product [Coffea canephora]
Length=425

 Score = 99.0 bits (245),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 60/64 (94%), Positives = 61/64 (95%), Gaps = 0/64 (0%)
 Frame = +2

Query  485  RAQSRHPLDPLTAAEISvavatvraagatPEVRDSMRFAEVSLVEPDKNVVALADAYFFP  664
            RAQ+RHPLDPLTAAEISVAVATVRAAGATPEVRDSMRF EV LVEP KNVVALADAYFFP
Sbjct  3    RAQTRHPLDPLTAAEISVAVATVRAAGATPEVRDSMRFIEVGLVEPPKNVVALADAYFFP  62

Query  665  PFQP  676
            PFQP
Sbjct  63   PFQP  66



>ref|XP_003601196.1| Primary amine oxidase [Medicago truncatula]
Length=674

 Score = 98.6 bits (244),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 45/54 (83%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = +2

Query  578  VRDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPRQA  739
            +RDSMRF EV L+EPDK+VVALADAYFFPPFQPSLLPR+K GPVIP+KLPPR A
Sbjct  4    LRDSMRFIEVVLLEPDKHVVALADAYFFPPFQPSLLPRSKGGPVIPTKLPPRCA  57



>ref|XP_001774529.1| predicted protein [Physcomitrella patens]
 gb|EDQ60597.1| predicted protein [Physcomitrella patens]
Length=705

 Score = 95.1 bits (235),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 59/88 (67%), Positives = 68/88 (77%), Gaps = 1/88 (1%)
 Frame = +2

Query  479  TMRAQSRHPLDPLTAAEISvavatvraagatPEVRDSMRFAEVSLVEPDKNVVALADAYF  658
             +R+QS HPLDPL+  EI+VA+ATVRAAG TPEVRD MRF EV L EPDKNVVA+ADAYF
Sbjct  3    VLRSQSAHPLDPLSPTEIAVAIATVRAAGETPEVRDGMRFVEVVLNEPDKNVVAMADAYF  62

Query  659  FPPFQPSLLPRTKKGPVIPS-KLPPRQA  739
            FPP+QP L     K  + PS +LP RQA
Sbjct  63   FPPYQPMLFKPKGKPTIYPSLQLPHRQA  90



>ref|XP_002977869.1| hypothetical protein SELMODRAFT_443642 [Selaginella moellendorffii]
 gb|EFJ21207.1| hypothetical protein SELMODRAFT_443642 [Selaginella moellendorffii]
Length=797

 Score = 92.0 bits (227),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 54/88 (61%), Positives = 67/88 (76%), Gaps = 2/88 (2%)
 Frame = +2

Query  482  MRAQSRHPLDPLTAAEISvavatvraagatPEVRDSMRFAEVSLVEPDKNVVALADAYFF  661
            ++AQ  HPLDPL+ AEI VA  TVR AG + E+RD+MRF EV L EP+K+VVALADA+FF
Sbjct  75   LKAQQSHPLDPLSPAEIKVATETVRGAGKSAEIRDAMRFVEVVLNEPEKDVVALADAHFF  134

Query  662  PPFQPSLLPRT--KKGPVIPSKLPPRQA  739
            PP+ P+   RT  K  P+IP +LPPRQA
Sbjct  135  PPYHPAQGLRTTAKGLPLIPFQLPPRQA  162



>ref|XP_008373307.1| PREDICTED: uncharacterized protein LOC103436643 [Malus domestica]
Length=388

 Score = 89.0 bits (219),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 40/47 (85%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = +2

Query  590  MRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPP  730
            MRF EV+LVEPDK VVALADAYFFPPFQPSL PRTK GP+IPS+LPP
Sbjct  1    MRFVEVALVEPDKRVVALADAYFFPPFQPSLFPRTKGGPMIPSELPP  47



>ref|XP_002979456.1| hypothetical protein SELMODRAFT_153358 [Selaginella moellendorffii]
 gb|EFJ19345.1| hypothetical protein SELMODRAFT_153358 [Selaginella moellendorffii]
Length=668

 Score = 65.1 bits (157),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 40/52 (77%), Gaps = 2/52 (4%)
 Frame = +2

Query  590  MRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRT--KKGPVIPSKLPPRQA  739
            MRF EV L EP+K+VVALADA+FFPP+ P+   RT  K  P+IP +LPPRQA
Sbjct  1    MRFVEVVLNEPEKDVVALADAHFFPPYHPAQGLRTTAKGLPLIPFQLPPRQA  52



>ref|XP_002462763.1| hypothetical protein SORBIDRAFT_02g031550 [Sorghum bicolor]
 gb|EER99284.1| hypothetical protein SORBIDRAFT_02g031550 [Sorghum bicolor]
Length=651

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 33/53 (62%), Positives = 39/53 (74%), Gaps = 3/53 (6%)
 Frame = +2

Query  581  RDSMRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPRQA  739
            R  MRF EV L+EP+KNVVALADAY    FQPS+LPR +    +PS LPPR+A
Sbjct  9    RQCMRFVEVVLLEPEKNVVALADAYH---FQPSVLPRMQGYDGVPSILPPRRA  58



>ref|XP_001753509.1| predicted protein [Physcomitrella patens]
 gb|EDQ81732.1| predicted protein [Physcomitrella patens]
Length=668

 Score = 63.2 bits (152),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = +2

Query  590  MRFAEVSLVEPDKNVVALADAYFFPPFQPSLLPRTKKGPVIPSKLPPRQA  739
            MRF EV L EP+K+VVA+ADAYFFPP+QP L     K  + P +LP R+A
Sbjct  1    MRFVEVVLSEPEKHVVAMADAYFFPPYQPMLFTLKGKSSLYPLRLPHRRA  50



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1354032766515