BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF045D09

Length=818
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009591964.1|  PREDICTED: proton pump-interactor 1-like           279   2e-85   Nicotiana tomentosiformis
ref|XP_009757292.1|  PREDICTED: proton pump-interactor 1-like iso...    279   2e-85   Nicotiana sylvestris
ref|XP_009624854.1|  PREDICTED: proton pump-interactor 1-like           251   1e-74   Nicotiana tomentosiformis
ref|XP_011082687.1|  PREDICTED: proton pump-interactor 1-like           250   2e-74   Sesamum indicum [beniseed]
gb|ADE42483.1|  proton pump interactor 1                                250   2e-74   Solanum tuberosum [potatoes]
ref|XP_006348256.1|  PREDICTED: proton pump-interactor 1-like iso...    249   3e-74   Solanum tuberosum [potatoes]
emb|CDP05926.1|  unnamed protein product                                246   4e-74   Coffea canephora [robusta coffee]
ref|XP_004244233.1|  PREDICTED: proton pump-interactor 1                248   1e-73   Solanum lycopersicum
ref|XP_009757155.1|  PREDICTED: proton pump-interactor 1-like           247   3e-73   Nicotiana sylvestris
ref|XP_009759963.1|  PREDICTED: proton pump-interactor 1-like           234   2e-68   Nicotiana sylvestris
gb|EPS70850.1|  hypothetical protein M569_03909                         233   3e-68   Genlisea aurea
gb|EYU44948.1|  hypothetical protein MIMGU_mgv1a002984mg                230   5e-67   Erythranthe guttata [common monkey flower]
ref|XP_011098299.1|  PREDICTED: proton pump-interactor 1-like iso...    228   3e-66   Sesamum indicum [beniseed]
ref|XP_006358996.1|  PREDICTED: proton pump-interactor 1-like           226   3e-65   
ref|XP_010313900.1|  PREDICTED: proton pump-interactor 1                225   7e-65   
emb|CBI20294.3|  unnamed protein product                                219   6e-64   Vitis vinifera
ref|XP_010260223.1|  PREDICTED: proton pump-interactor 1-like           219   7e-63   Nelumbo nucifera [Indian lotus]
emb|CAN81802.1|  hypothetical protein VITISV_007014                     217   1e-62   Vitis vinifera
ref|XP_002285016.2|  PREDICTED: proton pump-interactor 1                217   6e-62   Vitis vinifera
ref|XP_010272430.1|  PREDICTED: proton pump-interactor 1                216   8e-62   Nelumbo nucifera [Indian lotus]
gb|KJB81955.1|  hypothetical protein B456_013G168900                    214   8e-61   Gossypium raimondii
ref|XP_011043810.1|  PREDICTED: proton pump-interactor 1                214   1e-60   Populus euphratica
ref|XP_002316898.2|  hypothetical protein POPTR_0011s12040g             213   1e-60   
ref|XP_006370248.1|  PROTON PUMP INTERACTOR 1 family protein            211   9e-60   
gb|KDP27063.1|  hypothetical protein JCGZ_20998                         211   1e-59   Jatropha curcas
ref|XP_011029477.1|  PREDICTED: proton pump-interactor 1-like           209   5e-59   Populus euphratica
gb|KJB61874.1|  hypothetical protein B456_009G387800                    204   6e-58   Gossypium raimondii
ref|XP_007021493.1|  Proton pump interactor 1 isoform 3                 202   6e-58   
gb|KJB61873.1|  hypothetical protein B456_009G387800                    203   1e-57   Gossypium raimondii
gb|KHN28064.1|  hypothetical protein glysoja_007796                     204   2e-57   Glycine soja [wild soybean]
ref|XP_007149466.1|  hypothetical protein PHAVU_005G072500g             204   3e-57   Phaseolus vulgaris [French bean]
gb|KCW70003.1|  hypothetical protein EUGRSUZ_F03313                     197   3e-57   Eucalyptus grandis [rose gum]
gb|EYU26378.1|  hypothetical protein MIMGU_mgv1a003327mg                202   9e-57   Erythranthe guttata [common monkey flower]
ref|XP_007021491.1|  Proton pump interactor 1 isoform 1                 203   1e-56   
ref|XP_007021492.1|  Proton pump interactor 1 isoform 2                 203   1e-56   
ref|XP_010537017.1|  PREDICTED: proton pump-interactor 1 isoform X2     202   1e-56   Tarenaya hassleriana [spider flower]
ref|XP_008812164.1|  PREDICTED: LOW QUALITY PROTEIN: proton pump-...    201   2e-56   
ref|XP_006582166.1|  PREDICTED: proton pump-interactor 1-like iso...    201   4e-56   Glycine max [soybeans]
ref|XP_003543239.1|  PREDICTED: proton pump-interactor 1-like iso...    201   6e-56   Glycine max [soybeans]
ref|XP_006413068.1|  hypothetical protein EUTSA_v10027051mg             200   6e-56   
ref|XP_003527243.1|  PREDICTED: proton pump-interactor 1-like iso...    201   6e-56   Glycine max [soybeans]
gb|KHG29389.1|  Uncharacterized protein F383_11608                      199   7e-56   Gossypium arboreum [tree cotton]
ref|XP_010062861.1|  PREDICTED: LOW QUALITY PROTEIN: proton pump-...    197   8e-56   Eucalyptus grandis [rose gum]
gb|KHN40945.1|  hypothetical protein glysoja_038513                     201   9e-56   Glycine soja [wild soybean]
gb|KHG29388.1|  Uncharacterized protein F383_11608                      200   1e-55   Gossypium arboreum [tree cotton]
ref|XP_010539250.1|  PREDICTED: proton pump-interactor 1-like           199   1e-55   Tarenaya hassleriana [spider flower]
emb|CDX89242.1|  BnaA01g16510D                                          195   2e-55   
dbj|BAH19433.1|  AT4G27500                                              195   2e-54   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002869559.1|  hypothetical protein ARALYDRAFT_328945             197   2e-54   
ref|XP_010438598.1|  PREDICTED: proton pump-interactor 1-like iso...    196   2e-54   
ref|XP_010916059.1|  PREDICTED: proton pump-interactor 1-like           196   4e-54   Elaeis guineensis
gb|KDO62511.1|  hypothetical protein CISIN_1g009998mg                   194   5e-54   Citrus sinensis [apfelsine]
ref|XP_006451833.1|  hypothetical protein CICLE_v10008004mg             194   5e-54   
gb|KDO62508.1|  hypothetical protein CISIN_1g009998mg                   194   5e-54   Citrus sinensis [apfelsine]
ref|NP_194480.2|  proton pump interactor 1                              195   7e-54   Arabidopsis thaliana [mouse-ear cress]
gb|KDO62507.1|  hypothetical protein CISIN_1g009998mg                   193   9e-54   Citrus sinensis [apfelsine]
ref|XP_006464761.1|  PREDICTED: proton pump-interactor 1-like iso...    194   1e-53   Citrus sinensis [apfelsine]
ref|XP_010448122.1|  PREDICTED: proton pump-interactor 1-like           194   1e-53   Camelina sativa [gold-of-pleasure]
gb|KGN55124.1|  hypothetical protein Csa_4G637150                       194   1e-53   Cucumis sativus [cucumbers]
ref|XP_004487714.1|  PREDICTED: proton pump-interactor 1-like           194   1e-53   Cicer arietinum [garbanzo]
ref|XP_004141360.1|  PREDICTED: proton pump-interactor 1-like           194   1e-53   
ref|XP_008452453.1|  PREDICTED: proton pump-interactor 1 isoform X1     193   4e-53   Cucumis melo [Oriental melon]
ref|XP_008791753.1|  PREDICTED: proton pump-interactor 1-like iso...    192   1e-52   Phoenix dactylifera
ref|XP_007133182.1|  hypothetical protein PHAVU_011G158400g             191   2e-52   Phaseolus vulgaris [French bean]
ref|XP_006283362.1|  hypothetical protein CARUB_v10004404mg             191   2e-52   Capsella rubella
gb|KJB61861.1|  hypothetical protein B456_009G386800                    190   3e-52   Gossypium raimondii
ref|XP_009405605.1|  PREDICTED: proton pump-interactor 1                190   5e-52   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002533906.1|  DNA double-strand break repair rad50 ATPase,...    190   5e-52   
gb|KCW67362.1|  hypothetical protein EUGRSUZ_F01145                     189   9e-52   Eucalyptus grandis [rose gum]
ref|XP_010060584.1|  PREDICTED: proton pump-interactor 1                189   1e-51   Eucalyptus grandis [rose gum]
ref|XP_006401659.1|  hypothetical protein EUTSA_v10013033mg             189   1e-51   
ref|XP_008791762.1|  PREDICTED: proton pump-interactor 1-like iso...    189   1e-51   Phoenix dactylifera
ref|XP_008226621.1|  PREDICTED: proton pump-interactor 1                189   1e-51   Prunus mume [ume]
ref|XP_008791798.1|  PREDICTED: proton pump-interactor 1-like iso...    189   2e-51   Phoenix dactylifera
ref|XP_007213590.1|  hypothetical protein PRUPE_ppa002743mg             187   5e-51   
gb|ACJ85701.1|  unknown                                                 186   7e-51   Medicago truncatula
ref|XP_003596759.1|  hypothetical protein MTR_2g085330                  187   8e-51   Medicago truncatula
ref|XP_010537014.1|  PREDICTED: proton pump-interactor 1 isoform X1     187   8e-51   
ref|XP_003596760.1|  hypothetical protein MTR_2g085330                  186   9e-51   
emb|CDY14276.1|  BnaA08g14070D                                          187   9e-51   Brassica napus [oilseed rape]
ref|XP_010433357.1|  PREDICTED: proton pump-interactor 1 isoform X1     186   1e-50   Camelina sativa [gold-of-pleasure]
ref|XP_009109131.1|  PREDICTED: proton pump-interactor 1-like iso...    186   1e-50   Brassica rapa
ref|XP_009143539.1|  PREDICTED: proton pump-interactor 1                186   1e-50   Brassica rapa
ref|XP_009109134.1|  PREDICTED: proton pump-interactor 1-like iso...    186   1e-50   Brassica rapa
gb|AES67011.2|  proton pump interactor, putative                        186   1e-50   Medicago truncatula
gb|KHG17422.1|  Translation initiation factor IF-2                      183   3e-50   Gossypium arboreum [tree cotton]
emb|CAB43882.1|  proton pump interactor                                 185   5e-50   Arabidopsis thaliana [mouse-ear cress]
emb|CDY56314.1|  BnaC07g50300D                                          182   7e-50   Brassica napus [oilseed rape]
ref|XP_009137666.1|  PREDICTED: proton pump-interactor 1-like           182   3e-49   Brassica rapa
emb|CDY29843.1|  BnaA03g48640D                                          182   4e-49   Brassica napus [oilseed rape]
gb|KJB13348.1|  hypothetical protein B456_002G069700                    182   5e-49   Gossypium raimondii
ref|XP_010925566.1|  PREDICTED: proton pump-interactor 1-like           181   9e-49   Elaeis guineensis
emb|CDX97389.1|  BnaC08g12540D                                          181   1e-48   
ref|XP_008386183.1|  PREDICTED: proton pump-interactor 1-like           179   3e-48   
ref|XP_009356802.1|  PREDICTED: proton pump-interactor 1                179   5e-48   Pyrus x bretschneideri [bai li]
ref|XP_008794130.1|  PREDICTED: proton pump-interactor 1-like iso...    177   3e-47   Phoenix dactylifera
ref|XP_008794129.1|  PREDICTED: proton pump-interactor 1-like iso...    177   3e-47   
ref|XP_008367008.1|  PREDICTED: proton pump-interactor 1-like           177   3e-47   
ref|XP_004296510.1|  PREDICTED: proton pump-interactor 1                176   8e-47   Fragaria vesca subsp. vesca
ref|XP_009340981.1|  PREDICTED: proton pump-interactor 1-like           172   2e-45   Pyrus x bretschneideri [bai li]
ref|XP_010091118.1|  hypothetical protein L484_011324                   171   4e-45   
emb|CDY19058.1|  BnaC01g20100D                                          170   9e-45   Brassica napus [oilseed rape]
ref|XP_006859020.1|  hypothetical protein AMTR_s00068p00168490          170   1e-44   
ref|XP_003610440.1|  hypothetical protein MTR_4g132200                  157   2e-40   Medicago truncatula
gb|KJB61847.1|  hypothetical protein B456_009G3861001                   149   8e-39   Gossypium raimondii
ref|XP_006665154.1|  PREDICTED: proton pump-interactor 1-like           147   4e-38   Oryza brachyantha
gb|EEC83520.1|  hypothetical protein OsI_29109                          150   6e-38   Oryza sativa Indica Group [Indian rice]
ref|NP_001061721.1|  Os08g0390000                                       148   5e-37   
ref|XP_006659373.1|  PREDICTED: proton pump-interactor 1-like           147   9e-37   Oryza brachyantha
ref|XP_010675523.1|  PREDICTED: proton pump-interactor 1-like           147   9e-37   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006659372.1|  PREDICTED: proton pump-interactor 1-like           147   1e-36   
emb|CDP19179.1|  unnamed protein product                                137   9e-36   Coffea canephora [robusta coffee]
ref|XP_010545836.1|  PREDICTED: proton pump-interactor 2                143   2e-35   Tarenaya hassleriana [spider flower]
ref|XP_004956633.1|  PREDICTED: proton pump-interactor 1-like iso...    143   2e-35   Setaria italica
ref|XP_002460089.1|  hypothetical protein SORBIDRAFT_02g022580          143   2e-35   Sorghum bicolor [broomcorn]
ref|XP_008652588.1|  PREDICTED: proton pump-interactor 1-like           139   4e-34   Zea mays [maize]
ref|XP_008670143.1|  PREDICTED: proton pump-interactor 1-like           139   7e-34   Zea mays [maize]
gb|EMT01136.1|  hypothetical protein F775_28527                         133   9e-32   
gb|EMS53935.1|  hypothetical protein TRIUR3_33747                       133   2e-31   Triticum urartu
ref|XP_003578006.1|  PREDICTED: proton pump-interactor 1-like           130   9e-31   Brachypodium distachyon [annual false brome]
ref|XP_008463002.1|  PREDICTED: proton pump-interactor 1-like           117   5e-29   Cucumis melo [Oriental melon]
ref|NP_001062938.1|  Os09g0346400                                       125   7e-29   
gb|EEE69525.1|  hypothetical protein OsJ_28988                          125   7e-29   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ08718.1|  hypothetical protein OsI_30986                          125   7e-29   Oryza sativa Indica Group [Indian rice]
gb|KDO62512.1|  hypothetical protein CISIN_1g009998mg                   119   2e-27   Citrus sinensis [apfelsine]
gb|KJB61875.1|  hypothetical protein B456_009G387800                    119   3e-27   Gossypium raimondii
gb|KHG29104.1|  Uncharacterized protein F383_15123                      118   6e-27   Gossypium arboreum [tree cotton]
gb|KHG29103.1|  Uncharacterized protein F383_15123                      118   8e-27   Gossypium arboreum [tree cotton]
gb|AFK48950.1|  unknown                                               90.5    1e-18   Lotus japonicus
ref|XP_002460088.1|  hypothetical protein SORBIDRAFT_02g022570        89.0    3e-17   
ref|XP_010535087.1|  PREDICTED: proton pump-interactor 2 isoform X3   91.3    3e-17   Tarenaya hassleriana [spider flower]
ref|XP_010535085.1|  PREDICTED: proton pump-interactor 2 isoform X2   91.3    4e-17   Tarenaya hassleriana [spider flower]
ref|XP_010535084.1|  PREDICTED: proton pump-interactor 2 isoform X1   90.9    4e-17   Tarenaya hassleriana [spider flower]
ref|XP_008452455.1|  PREDICTED: proton pump-interactor 1 isoform X3   89.0    1e-16   
ref|XP_004959394.1|  PREDICTED: uncharacterized protein LOC101765357  88.6    5e-16   
gb|KJB61862.1|  hypothetical protein B456_009G386900                  84.7    3e-15   Gossypium raimondii
ref|XP_001783056.1|  predicted protein                                85.5    4e-15   
gb|KJB61876.1|  hypothetical protein B456_009G387800                  84.0    6e-15   Gossypium raimondii
ref|XP_001777574.1|  predicted protein                                80.1    2e-13   
ref|XP_002517900.1|  hypothetical protein RCOM_1174050                65.1    8e-09   
ref|XP_005848881.1|  hypothetical protein CHLNCDRAFT_144263           63.2    6e-08   Chlorella variabilis
ref|XP_010657116.1|  PREDICTED: proton pump-interactor 1-like         57.8    2e-06   
emb|CCD74476.1|  proton pump interactor 2                             56.6    9e-06   Arabidopsis halleri subsp. halleri
ref|XP_010539756.1|  PREDICTED: uncharacterized protein LOC104813728  56.2    2e-05   Tarenaya hassleriana [spider flower]
ref|XP_010535088.1|  PREDICTED: proton pump-interactor 2 isoform X4   54.3    5e-05   
gb|KDO85279.1|  hypothetical protein CISIN_1g000926mg                 53.9    8e-05   Citrus sinensis [apfelsine]
gb|KDO85275.1|  hypothetical protein CISIN_1g000926mg                 53.9    9e-05   Citrus sinensis [apfelsine]
ref|XP_006435482.1|  hypothetical protein CICLE_v10000062mg           53.9    9e-05   Citrus clementina [clementine]
ref|XP_006494446.1|  PREDICTED: microtubule-associated protein fu...  53.9    9e-05   Citrus sinensis [apfelsine]
gb|KDO85278.1|  hypothetical protein CISIN_1g000926mg                 53.9    9e-05   Citrus sinensis [apfelsine]
gb|KDO85277.1|  hypothetical protein CISIN_1g000926mg                 53.9    9e-05   Citrus sinensis [apfelsine]
ref|XP_006435481.1|  hypothetical protein CICLE_v10000062mg           53.9    1e-04   
ref|NP_188152.3|  proton pump interactor 2                            53.5    1e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009372666.1|  PREDICTED: microtubule-associated protein 1B...  52.4    3e-04   
ref|XP_008373330.1|  PREDICTED: calponin homology domain-containi...  52.0    4e-04   



>ref|XP_009591964.1| PREDICTED: proton pump-interactor 1-like [Nicotiana tomentosiformis]
Length=630

 Score =   279 bits (714),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 157/237 (66%), Positives = 186/237 (78%), Gaps = 6/237 (3%)
 Frame = +3

Query  123  MGVDVESKLAHVSVETGSENGGSLKENG-----TVPNEPIKFGSHGAEEPIKEDVKKAPA  287
            MG+DVE+KL HV VE GSE+   LKENG     +V  EPIKFGSHG EEP +E+V + P 
Sbjct  1    MGIDVEAKLVHVPVEAGSEHNNLLKENGKMSHGSVITEPIKFGSHGTEEPKEEEVSRTPV  60

Query  288  INLPKDAVVEDWPAPQQIHSFYLVKYRTFEDqklkakleqaekelhkkNQARSVMIDNLR  467
             N+PKDAV EDWP P+QIHSFY+VK+R FED KLKAK+E AE+EL KKNQARS +I+ L+
Sbjct  61   SNVPKDAV-EDWPEPKQIHSFYIVKFRRFEDPKLKAKIELAERELQKKNQARSQIIEKLK  119

Query  468  AKRAARSELINERKSLSAERQQFRSQMDEKRKVMEPLQQALGKLRGNNAGGRDQRSVIFS  647
            AKRA RS++I +RKSLSAE ++F S +DEKRK MEPLQQALG+LRG    GR++  ++ S
Sbjct  120  AKRAERSKVIEQRKSLSAENKEFWSTIDEKRKEMEPLQQALGQLRGGRDAGRERGPIVCS  179

Query  648  SEAELNDYIKSLQYRIQHESITLNEEKQILREIKQFEGTRDKVIAHAAERAKIQESL  818
            SE ELN  IKSLQYRIQHESI LNEEKQILREIKQ EGTR+ V   AA RA+I ESL
Sbjct  180  SEQELNSLIKSLQYRIQHESIPLNEEKQILREIKQLEGTREAVKEKAAARAQIHESL  236



>ref|XP_009757292.1| PREDICTED: proton pump-interactor 1-like isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009757293.1| PREDICTED: proton pump-interactor 1-like isoform X2 [Nicotiana 
sylvestris]
Length=630

 Score =   279 bits (713),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 158/237 (67%), Positives = 185/237 (78%), Gaps = 6/237 (3%)
 Frame = +3

Query  123  MGVDVESKLAHVSVETGSENGGSLKENGTVPN-----EPIKFGSHGAEEPIKEDVKKAPA  287
            MG+DVE+KL HV VE GSE    LKENG + +     EPIKFGSHG EEP KE+V + P 
Sbjct  1    MGIDVEAKLVHVPVEAGSEQSNLLKENGKMNHGSGITEPIKFGSHGTEEPKKEEVSRTPV  60

Query  288  INLPKDAVVEDWPAPQQIHSFYLVKYRTFEDqklkakleqaekelhkkNQARSVMIDNLR  467
             N+PKDAV EDWP P+QIHSFYLVK+R FED KLKAK+E AE+EL KKNQARS +I+ L+
Sbjct  61   SNVPKDAV-EDWPEPKQIHSFYLVKFRRFEDPKLKAKIELAERELQKKNQARSQIIEKLK  119

Query  468  AKRAARSELINERKSLSAERQQFRSQMDEKRKVMEPLQQALGKLRGNNAGGRDQRSVIFS  647
            AKRA RS++I +RKSLSAE ++F S +DEKRK MEPLQQALG+LRG    GR++  ++ S
Sbjct  120  AKRAERSKVIEQRKSLSAENKEFWSTIDEKRKEMEPLQQALGQLRGARDAGRERGPIVCS  179

Query  648  SEAELNDYIKSLQYRIQHESITLNEEKQILREIKQFEGTRDKVIAHAAERAKIQESL  818
            SE ELN  IKSLQYRIQHESI LNEEKQILREIKQ EGTR+ V   AA RA+I ESL
Sbjct  180  SEQELNSLIKSLQYRIQHESIPLNEEKQILREIKQLEGTREAVKEKAAARAQIHESL  236



>ref|XP_009624854.1| PREDICTED: proton pump-interactor 1-like [Nicotiana tomentosiformis]
 ref|XP_009624855.1| PREDICTED: proton pump-interactor 1-like [Nicotiana tomentosiformis]
Length=623

 Score =   251 bits (640),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 150/237 (63%), Positives = 179/237 (76%), Gaps = 6/237 (3%)
 Frame = +3

Query  123  MGVDVESKLAHVSVETGSENGGSLKEN-----GTVPNEPIKFGSHGAEEPIKEDVKKAPA  287
            MG D+ES+LAHVSVETG+E     KEN     G   NE I FGSHG +E IKE  KK P 
Sbjct  1    MGRDMESQLAHVSVETGTEQKNLPKENKKKNHGVGVNETINFGSHGTQETIKEAGKKVPV  60

Query  288  INLPKDAVVEDWPAPQQIHSFYLVKYRTFEDqklkakleqaekelhkkNQARSVMIDNLR  467
             +L KDAV +DWPAP+QIHSFY+V+YR FEDQKLKAK + AEKEL K N+ARS +I+ L+
Sbjct  61   SSLRKDAV-DDWPAPKQIHSFYIVRYRRFEDQKLKAKFDLAEKELQKMNKARSQVIEKLK  119

Query  468  AKRAARSELINERKSLSAERQQFRSQMDEKRKVMEPLQQALGKLRGNNAGGRDQRSVIFS  647
            A RA RS+LI++RKS+SAE Q+F + + EKRK MEPLQ ALGKLRG    GR+  S + S
Sbjct  120  AIRAERSKLIDQRKSVSAENQEFWAVIGEKRKEMEPLQDALGKLRGPRKAGREGGSSLCS  179

Query  648  SEAELNDYIKSLQYRIQHESITLNEEKQILREIKQFEGTRDKVIAHAAERAKIQESL  818
            SE EL+D IKSLQYRIQHESI L EEKQILREIK+ EGTR +V  H A RA+IQ+S+
Sbjct  180  SEEELDDLIKSLQYRIQHESIPLTEEKQILREIKRLEGTRGEVRDHMAMRAQIQDSI  236



>ref|XP_011082687.1| PREDICTED: proton pump-interactor 1-like [Sesamum indicum]
 ref|XP_011082688.1| PREDICTED: proton pump-interactor 1-like [Sesamum indicum]
 ref|XP_011082689.1| PREDICTED: proton pump-interactor 1-like [Sesamum indicum]
Length=618

 Score =   250 bits (638),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 154/235 (66%), Positives = 185/235 (79%), Gaps = 13/235 (6%)
 Frame = +3

Query  123  MGVDV-ESKLAHVSVETGSENGGSLKENGTVPNEP--IKFGSHGAEEPIKEDVKKAPAIN  293
            MGV+V +S L    +ETGSE       N +V NE   IKFGSH  +EP+K +V K    N
Sbjct  1    MGVEVVDSNLP--VIETGSEA------NMSVANEKVNIKFGSHVVDEPVKGEVNKVSESN  52

Query  294  LPKDAVVEDWPAPQQIHSFYLVKYRTFEDqklkakleqaekelhkkNQARSVMIDNLRAK  473
            LPKDAV ++WP P+QIHSFY+V+YR  EDQKLKAKL+ AEKEL KKNQARS +++ +RAK
Sbjct  53   LPKDAV-DEWPEPKQIHSFYVVRYRALEDQKLKAKLDVAEKELQKKNQARSQIVEKIRAK  111

Query  474  RAARSELINERKSLSAERQQFRSQMDEKRKVMEPLQQALGKLRGNNAGGRDQRSVIFSSE  653
            RA RS++I + +SLS E +QFR+ MDEKRK MEPLQQALGKLRG  +GGRD+ S + SSE
Sbjct  112  RADRSQIIAQIRSLSVENKQFRTIMDEKRKEMEPLQQALGKLRGT-SGGRDRGSGVCSSE  170

Query  654  AELNDYIKSLQYRIQHESITLNEEKQILREIKQFEGTRDKVIAHAAERAKIQESL  818
             ELND IKSLQYRIQHESI L+EEKQILREIKQ EGTR+KVIA+AAERA+IQ+SL
Sbjct  171  EELNDIIKSLQYRIQHESIPLSEEKQILREIKQLEGTREKVIANAAERARIQDSL  225



>gb|ADE42483.1| proton pump interactor 1 [Solanum tuberosum]
Length=629

 Score =   250 bits (638),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 148/238 (62%), Positives = 177/238 (74%), Gaps = 8/238 (3%)
 Frame = +3

Query  123  MGVDVESKLAHVSVETGSENGGSLKENGTVPN------EPIKFGSHGAEEPIKEDVKKAP  284
            MGV+VE+KL HV VE GSE    LKENG  PN      EPIKFGSHG EEP KE+V + P
Sbjct  1    MGVEVEAKLVHVPVEAGSEQINLLKENGK-PNHVSGITEPIKFGSHGTEEPKKEEVSRIP  59

Query  285  AINLPKDAVVEDWPAPQQIHSFYLVKYRTFEDqklkakleqaekelhkkNQARSVMIDNL  464
              N+PKDAV EDWP P+QIHSFY VK+R F+D KLKA++E AEKEL KKNQARS +I+ L
Sbjct  60   VSNVPKDAV-EDWPEPKQIHSFYTVKFRRFDDPKLKARIELAEKELQKKNQARSQIIEKL  118

Query  465  RAKRAARSELINERKSLSAERQQFRSQMDEKRKVMEPLQQALGKLRGNNAGGRDQRSVIF  644
            +AKRA +S  I +RK+LSAE ++F S +D K K M PL +ALG+LRG+   GR++   + 
Sbjct  119  KAKRAEKSIFIEQRKALSAENKEFWSAIDGKIKEMVPLHEALGQLRGSRNAGRERGPTVC  178

Query  645  SSEAELNDYIKSLQYRIQHESITLNEEKQILREIKQFEGTRDKVIAHAAERAKIQESL  818
            SSE ELN  IK LQYRIQHESI LNEEKQILREIKQ EGTR+ V   AA RA+I E++
Sbjct  179  SSEEELNHLIKGLQYRIQHESIPLNEEKQILREIKQLEGTREDVKKVAAARAQIHETM  236



>ref|XP_006348256.1| PREDICTED: proton pump-interactor 1-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006348257.1| PREDICTED: proton pump-interactor 1-like isoform X2 [Solanum 
tuberosum]
Length=629

 Score =   249 bits (637),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 148/238 (62%), Positives = 177/238 (74%), Gaps = 8/238 (3%)
 Frame = +3

Query  123  MGVDVESKLAHVSVETGSENGGSLKENGTVPN------EPIKFGSHGAEEPIKEDVKKAP  284
            MGV+VE+KL HV VE GSE    LKENG  PN      EPIKFGSHG EEP KE+V + P
Sbjct  1    MGVEVEAKLVHVPVEAGSEQINLLKENGK-PNHVSGITEPIKFGSHGTEEPKKEEVSRIP  59

Query  285  AINLPKDAVVEDWPAPQQIHSFYLVKYRTFEDqklkakleqaekelhkkNQARSVMIDNL  464
              N+PKDAV EDWP P+QIHSFY VK+R F+D KLKA++E AEKEL KKNQARS +I+ L
Sbjct  60   VSNVPKDAV-EDWPEPKQIHSFYTVKFRRFDDPKLKARIELAEKELQKKNQARSQIIEKL  118

Query  465  RAKRAARSELINERKSLSAERQQFRSQMDEKRKVMEPLQQALGKLRGNNAGGRDQRSVIF  644
            +AKRA +S  I +RK+LSAE ++F S +D K K M PL +ALG+LRG+   GR++   + 
Sbjct  119  KAKRAEKSIFIEQRKALSAENKEFWSAIDGKIKEMVPLHEALGQLRGSRNAGRERGPTVC  178

Query  645  SSEAELNDYIKSLQYRIQHESITLNEEKQILREIKQFEGTRDKVIAHAAERAKIQESL  818
            SSE ELN  IK LQYRIQHESI LNEEKQILREIKQ EGTR+ V   AA RA+I E++
Sbjct  179  SSEEELNHLIKGLQYRIQHESIPLNEEKQILREIKQLEGTREDVKKVAAARAQIHETM  236



>emb|CDP05926.1| unnamed protein product [Coffea canephora]
Length=515

 Score =   246 bits (629),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 151/238 (63%), Positives = 178/238 (75%), Gaps = 11/238 (5%)
 Frame = +3

Query  123  MGVDV-ESKLAHVSVETGSENGGSLKENGTVPN-----EPIKFGSHGAEEPIKEDVKKAP  284
            MGV+V ESKL HVS ET  E    LKENG + N     EPI FGSHG +EP+K +  KA 
Sbjct  1    MGVEVVESKLPHVSGETAGEENSLLKENGKISNVMGLSEPITFGSHGMDEPVKGEKNKAA  60

Query  285  AINLPKDAVVEDWPAPQQIHSFYLVKYRTFEDqklkakleqaekelhkkNQARSVMIDNL  464
             +N PKDAV ++WPAP+QIHSFY V+YR  EDQKLKAKL+QA+ EL KKNQARS +I+ L
Sbjct  61   EVNFPKDAV-DEWPAPKQIHSFYFVRYRLHEDQKLKAKLDQADTELQKKNQARSQLIEKL  119

Query  465  RAKRAARSELINERKSLSAERQQFRSQMDEKRKVMEPLQQALGKLRGNNAGGRDQRSVIF  644
            R  +A R++ I   K L+ E +Q+R  +DEK+K  EPLQQALG+L G    GRD+ S I 
Sbjct  120  RKLKADRAQKIAFLKDLNKENKQYRELIDEKKKEREPLQQALGQLHG----GRDRGSGIC  175

Query  645  SSEAELNDYIKSLQYRIQHESITLNEEKQILREIKQFEGTRDKVIAHAAERAKIQESL  818
            SSE ELN  IKSLQY IQHESITLNEEKQILREIKQ EGTR+KVIA+AA RAKIQES+
Sbjct  176  SSEEELNHRIKSLQYHIQHESITLNEEKQILREIKQLEGTREKVIANAALRAKIQESM  233



>ref|XP_004244233.1| PREDICTED: proton pump-interactor 1 [Solanum lycopersicum]
Length=628

 Score =   248 bits (633),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 146/238 (61%), Positives = 178/238 (75%), Gaps = 9/238 (4%)
 Frame = +3

Query  123  MGVDVESKLAHVSVETGSENGGSLKENGTVPN------EPIKFGSHGAEEPIKEDVKKAP  284
            MGV+VE+KL HV VE G+E    LKENG  PN      EPIKFGSHG EEP KE++ + P
Sbjct  1    MGVEVEAKLVHVPVEAGTEQINLLKENGK-PNHVSGITEPIKFGSHGTEEP-KEEISRIP  58

Query  285  AINLPKDAVVEDWPAPQQIHSFYLVKYRTFEDqklkakleqaekelhkkNQARSVMIDNL  464
              N+PKDAV EDWP P+Q+HSFY VK+R F+D KLKA++E AEKEL KKNQARS +I+ L
Sbjct  59   VSNVPKDAV-EDWPEPKQVHSFYTVKFRRFDDPKLKARIELAEKELQKKNQARSQIIEKL  117

Query  465  RAKRAARSELINERKSLSAERQQFRSQMDEKRKVMEPLQQALGKLRGNNAGGRDQRSVIF  644
            +AKRA +S  I +RK+LSAE ++FRS +D K K M PL +ALG+LRG+   GR++   + 
Sbjct  118  KAKRAEKSIFIEQRKALSAENKEFRSAIDGKIKEMAPLHEALGQLRGSRNAGRERGPTVC  177

Query  645  SSEAELNDYIKSLQYRIQHESITLNEEKQILREIKQFEGTRDKVIAHAAERAKIQESL  818
            SSE ELN  IK LQYRIQHESI LNEEKQILREIKQ EGTR+ V   AA RA+I E++
Sbjct  178  SSEEELNHLIKGLQYRIQHESIPLNEEKQILREIKQLEGTREDVKKVAAARAQIHETM  235



>ref|XP_009757155.1| PREDICTED: proton pump-interactor 1-like [Nicotiana sylvestris]
 ref|XP_009757157.1| PREDICTED: proton pump-interactor 1-like [Nicotiana sylvestris]
Length=622

 Score =   247 bits (630),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 149/237 (63%), Positives = 178/237 (75%), Gaps = 6/237 (3%)
 Frame = +3

Query  123  MGVDVESKLAHVSVETGSENGGSLKEN-----GTVPNEPIKFGSHGAEEPIKEDVKKAPA  287
            MG D+ES+LAHVSVETG+E     KEN     G   NE IKF SHG++E  KE  K  P 
Sbjct  1    MGRDMESQLAHVSVETGTEQKNLPKENKKKNHGVGVNETIKFRSHGSQETNKEAGKNVPV  60

Query  288  INLPKDAVVEDWPAPQQIHSFYLVKYRTFEDqklkakleqaekelhkkNQARSVMIDNLR  467
             +L KDAV +DWPAP+QIHSFY+V+YR FEDQKLKAK + AEKEL K N+ARS +I+ L+
Sbjct  61   SSLRKDAV-DDWPAPKQIHSFYIVRYRRFEDQKLKAKFDLAEKELQKMNKARSQVIEKLK  119

Query  468  AKRAARSELINERKSLSAERQQFRSQMDEKRKVMEPLQQALGKLRGNNAGGRDQRSVIFS  647
            A RA RS+LI +RKS+SAE Q+F + + EKRK MEPLQ ALGKLRG    GR+  S + S
Sbjct  120  AIRAERSKLIEQRKSVSAENQEFWAVIGEKRKEMEPLQDALGKLRGPRKAGREGGSSLCS  179

Query  648  SEAELNDYIKSLQYRIQHESITLNEEKQILREIKQFEGTRDKVIAHAAERAKIQESL  818
            SE EL+D IKSLQYRIQHESITL EEKQILREIK+ EGTR +V  H A RA+IQ+S+
Sbjct  180  SEEELDDLIKSLQYRIQHESITLTEEKQILREIKRLEGTRGEVRDHMAMRAQIQDSI  236



>ref|XP_009759963.1| PREDICTED: proton pump-interactor 1-like [Nicotiana sylvestris]
Length=629

 Score =   234 bits (598),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 138/236 (58%), Positives = 179/236 (76%), Gaps = 6/236 (3%)
 Frame = +3

Query  123  MGVDVESKLAHVSVETGSENGGSLKENGTVPN-----EPIKFGSHGAEEPIKEDVKKAPA  287
            MG+DV S+LAH+  ETG E    LKENG + +     +P+KFGSHG EEPIKE+ K+ P 
Sbjct  1    MGIDVGSQLAHILAETGIEQNNILKENGKMNHVAGVTDPVKFGSHGTEEPIKEERKRVPL  60

Query  288  INLPKDAVVEDWPAPQQIHSFYLVKYRTFEDqklkakleqaekelhkkNQARSVMIDNLR  467
            I+L ++AV ++WP  +Q+HSFY+VKYR FEDQKLK+K+EQAE EL KKN+A+S +I+ L+
Sbjct  61   ISLRENAV-DEWPQEKQVHSFYIVKYRRFEDQKLKSKIEQAEIELQKKNKAKSQIIEKLK  119

Query  468  AKRAARSELINERKSLSAERQQFRSQMDEKRKVMEPLQQALGKLRGNNAGGRDQRSVIFS  647
              RA R++LI +RKSL AE QQF +++DEKRK ++PL  ALG+LRG    G ++   + S
Sbjct  120  LIRADRAQLIEQRKSLRAENQQFWTKIDEKRKEVKPLHDALGELRGARNTGTERGYSLCS  179

Query  648  SEAELNDYIKSLQYRIQHESITLNEEKQILREIKQFEGTRDKVIAHAAERAKIQES  815
            SE ELN+ IKSL+YRIQHESI+LNEEKQILREIK  EGTR+ V  +AA RA I ES
Sbjct  180  SEEELNNLIKSLEYRIQHESISLNEEKQILREIKLLEGTRENVKKNAATRADILES  235



>gb|EPS70850.1| hypothetical protein M569_03909, partial [Genlisea aurea]
Length=598

 Score =   233 bits (594),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 144/235 (61%), Positives = 182/235 (77%), Gaps = 9/235 (4%)
 Frame = +3

Query  120  IMGVDV-ESKLAHVSVETGSENGGSLKENGTVPNEPIKFGSHGAEEPIKEDVKKAPAINL  296
             MG+DV ES +A V +E GSE G SL +N  V    IKFGSHG ++ +K +V + P  NL
Sbjct  3    FMGMDVAESNVAAV-LEPGSEAGLSL-DNEHVK---IKFGSHGTDQLLKGEVNEVPESNL  57

Query  297  PKDAVVEDWPAPQQIHSFYLVKYRTFEDqklkakleqaekelhkkNQARSVMIDNLRAKR  476
            P +A  ++WP P+QIHSFY+V+YRTFEDQ LK K+E AEKEL KKNQAR  +++ ++AKR
Sbjct  58   PTNAT-DEWPQPKQIHSFYIVRYRTFEDQNLKVKMESAEKELQKKNQARLEIVEKIKAKR  116

Query  477  AARSELINERKSLSAERQQFRSQMDEKRKVMEPLQQALGKLRGNNAGGRDQR-SVIFSSE  653
            A R+++I + ++LS E +QFR+ MDEKRK MEPLQQALGKLRG ++GGRD R S + S+E
Sbjct  117  ADRAQVIAQIRNLSVENKQFRTVMDEKRKEMEPLQQALGKLRG-SSGGRDNRGSNLCSTE  175

Query  654  AELNDYIKSLQYRIQHESITLNEEKQILREIKQFEGTRDKVIAHAAERAKIQESL  818
             ELND IK LQYRIQHES TLNEEKQIL+EIK+ EGTR+KVIA+A ERA I+ SL
Sbjct  176  EELNDLIKGLQYRIQHESNTLNEEKQILKEIKRLEGTREKVIANATERAMIEVSL  230



>gb|EYU44948.1| hypothetical protein MIMGU_mgv1a002984mg [Erythranthe guttata]
Length=619

 Score =   230 bits (587),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 135/217 (62%), Positives = 165/217 (76%), Gaps = 11/217 (5%)
 Frame = +3

Query  198  ENGTVPNEP-------IKFGSHGAEEPIKEDVKKAPAIN-LPKDAVVEDWPAPQQIHSFY  353
            +NG+  NE        IKFGSHG EEP K +     A N LP DAV ++WP P+QIHSFY
Sbjct  14   DNGSAANESMDNEKVNIKFGSHGVEEPAKGEANSVSAPNNLPTDAV-DEWPEPKQIHSFY  72

Query  354  LVKYRTFEDqklkakleqaekelhkkNQARSVMIDNLRAKRAARSELINERKSLSAERQQ  533
            +V+YR  ED  LKAKL+ A+KEL KKNQAR  +I+ LRAKR  R +++ E +SLS E +Q
Sbjct  73   IVRYRALEDHNLKAKLDLADKELQKKNQARFQIIEKLRAKRGDRGQVLAEIRSLSVENRQ  132

Query  534  FRSQMDEKRKVMEPLQQALGKLRGNNAGGRDQRS--VIFSSEAELNDYIKSLQYRIQHES  707
            FR+ +DEKRK MEPLQQALGKLRGN++GG  ++   +I SSEAELN+ IKSL+YRIQHES
Sbjct  133  FRTIIDEKRKEMEPLQQALGKLRGNSSGGGREKGSGIICSSEAELNNLIKSLEYRIQHES  192

Query  708  ITLNEEKQILREIKQFEGTRDKVIAHAAERAKIQESL  818
            I L+EEKQI+REIKQ EGTRDKVI  AAERAKIQ+S+
Sbjct  193  IPLSEEKQIMREIKQLEGTRDKVIVFAAERAKIQDSM  229



>ref|XP_011098299.1| PREDICTED: proton pump-interactor 1-like isoform X1 [Sesamum 
indicum]
 ref|XP_011098300.1| PREDICTED: proton pump-interactor 1-like isoform X2 [Sesamum 
indicum]
Length=618

 Score =   228 bits (582),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 142/232 (61%), Positives = 172/232 (74%), Gaps = 7/232 (3%)
 Frame = +3

Query  123  MGVDVESKLAHVSVETGSENGGSLKENGTVPNEPIKFGSHGAEEPIKEDVKKAPAINLPK  302
            MGV+V     +V  ET  EN  ++   G   N  IKFGSH AEEP K  + K     +PK
Sbjct  1    MGVEVAESKINVMAET--ENEANVPPEGGKVN--IKFGSHAAEEPAKGHLNKLSDSGIPK  56

Query  303  DAVVEDWPAPQQIHSFYLVKYRTFEDqklkakleqaekelhkkNQARSVMIDNLRAKRAA  482
            DAV ++WP P Q+HSFY+V+YR FED++LKAKL+ AEK+L KKNQARS +++ LR KRAA
Sbjct  57   DAV-DEWPEPAQVHSFYIVRYRAFEDRELKAKLDAAEKDLQKKNQARSQIVEKLRGKRAA  115

Query  483  RSELINERKSLSAERQQFRSQMDEKRKVMEPLQQALGKLRGNNAGGRDQRSVIFSSEAEL  662
            RSE+ ++  SLS E +Q+R  MD K K MEPLQQALGKLRG  AG R++ S + SSE EL
Sbjct  116  RSEIRSQIHSLSVESKQYREVMDGKIKEMEPLQQALGKLRG--AGPRERGSGLCSSEEEL  173

Query  663  NDYIKSLQYRIQHESITLNEEKQILREIKQFEGTRDKVIAHAAERAKIQESL  818
            ND IKSL YRIQHESI L+EEKQILREIKQ EGTR+KVIA AAERA+IQ+SL
Sbjct  174  NDLIKSLHYRIQHESIPLSEEKQILREIKQLEGTREKVIAIAAERARIQDSL  225



>ref|XP_006358996.1| PREDICTED: proton pump-interactor 1-like [Solanum tuberosum]
Length=625

 Score =   226 bits (575),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 134/231 (58%), Positives = 167/231 (72%), Gaps = 6/231 (3%)
 Frame = +3

Query  141  SKLAHVSVETGSENGGSLKENGTV-----PNEPIKFGSHGAEEPIKEDVKKAPAINLPKD  305
            S+ A V  ET SE     KEN  +      NEPIKFGSHG +EPIKE+ KK P   L KD
Sbjct  3    SQSARVPAETASEKKNLPKENKKMNNDAKVNEPIKFGSHGTKEPIKEEGKKVPVTALRKD  62

Query  306  AVVEDWPAPQQIHSFYLVKYRTFEDqklkakleqaekelhkkNQARSVMIDNLRAKRAAR  485
            AV EDWP P+QIHSFY+V+YR FEDQ LK K + AEKEL K N+AR  +I+ LRA+RA R
Sbjct  63   AV-EDWPEPKQIHSFYIVRYRRFEDQNLKPKFDLAEKELQKMNKARFQLIEKLRARRAER  121

Query  486  SELINERKSLSAERQQFRSQMDEKRKVMEPLQQALGKLRGNNAGGRDQRSVIFSSEAELN  665
            SEL  +RKS+SAE Q+F + ++ KRK ++PLQ ALGKLRG    GR+  + + SSE +L+
Sbjct  122  SELFGQRKSVSAENQEFWTVIEGKRKEIKPLQDALGKLRGPRKDGREGGAGLCSSEVDLD  181

Query  666  DYIKSLQYRIQHESITLNEEKQILREIKQFEGTRDKVIAHAAERAKIQESL  818
            + IKSLQYRIQHESI L EEK+ILREIKQ EGTR ++  + A RA+IQ+S+
Sbjct  182  NLIKSLQYRIQHESIPLTEEKKILREIKQLEGTRGEIKENVALRAQIQDSM  232



>ref|XP_010313900.1| PREDICTED: proton pump-interactor 1 [Solanum lycopersicum]
Length=624

 Score =   225 bits (573),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 135/231 (58%), Positives = 166/231 (72%), Gaps = 6/231 (3%)
 Frame = +3

Query  141  SKLAHVSVETGSENGGSLKEN-----GTVPNEPIKFGSHGAEEPIKEDVKKAPAINLPKD  305
            S+ A V  ET SE     KEN     G   NEPIKFGSHG +EPIKE+ KK P   L KD
Sbjct  3    SQSARVPAETVSEKKNLPKENKKMNNGAKVNEPIKFGSHGTKEPIKEEGKKVPVTALRKD  62

Query  306  AVVEDWPAPQQIHSFYLVKYRTFEDqklkakleqaekelhkkNQARSVMIDNLRAKRAAR  485
            AV EDWP P+QIHSFY+V+YR FEDQ LK K +QAEKEL K N+ R  +I+ LRA+RA R
Sbjct  63   AV-EDWPEPKQIHSFYIVRYRRFEDQNLKPKFDQAEKELQKMNKTRFQLIEKLRARRAER  121

Query  486  SELINERKSLSAERQQFRSQMDEKRKVMEPLQQALGKLRGNNAGGRDQRSVIFSSEAELN  665
            SEL  +RK +SAE ++FR+ ++ KRK ++PLQ ALGKLRG    GR+    + SSEAEL+
Sbjct  122  SELFGQRKPVSAENKEFRTVIEGKRKEIKPLQDALGKLRGPRKDGREGGVGLCSSEAELD  181

Query  666  DYIKSLQYRIQHESITLNEEKQILREIKQFEGTRDKVIAHAAERAKIQESL  818
            + IKSLQYRIQHESI L EEK+ILREIKQ EGTR ++  +   RA+IQ+S+
Sbjct  182  NLIKSLQYRIQHESIPLTEEKKILREIKQLEGTRGEIKENVVLRAQIQDSM  232



>emb|CBI20294.3| unnamed protein product [Vitis vinifera]
Length=478

 Score =   219 bits (558),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 135/250 (54%), Positives = 179/250 (72%), Gaps = 12/250 (5%)
 Frame = +3

Query  96   SLYFAFIEIMGVDVES-KLAHVSVETGSENGGSL---KENGTVP-----NEPIKFGSHGA  248
            +   +F + MGV+V   + A   VE G+E   +L   KENG +       EPIKFGSHG 
Sbjct  22   AFSISFGDTMGVEVVGFEAAPAPVEAGTEAESALLHDKENGKLDQGPGVTEPIKFGSHG-  80

Query  249  EEPIKEDVKKAPAINLPKDAVVEDWPAPQQIHSFYLVKYRTFEDqklkakleqaekelhk  428
            +EP+K +     + N PKD VV++WPAP+QIHSFY VKYR+++D K+KAKL+QA+KE+ +
Sbjct  81   DEPVKGEGNNV-SDNFPKD-VVDEWPAPKQIHSFYFVKYRSYDDPKIKAKLDQADKEIQR  138

Query  429  kNQARSVMIDNLRAKRAARSELINERKSLSAERQQFRSQMDEKRKVMEPLQQALGKLRGN  608
            +NQAR  + + LRAK++ R++++++ KSL AE +QFR  +D KRK MEPLQ ALGKLR  
Sbjct  139  RNQARFQITEGLRAKKSDRAQMLSQLKSLKAEDEQFRMIVDGKRKEMEPLQHALGKLRST  198

Query  609  NAGGRDQRSVIFSSEAELNDYIKSLQYRIQHESITLNEEKQILREIKQFEGTRDKVIAHA  788
            N+  R++   + SSE ELND I+SL Y +QHESI L EEKQILREIKQ E TR+KVIA A
Sbjct  199  NSANRERGGTLCSSEEELNDLIQSLHYHMQHESIPLAEEKQILREIKQLEATREKVIAGA  258

Query  789  AERAKIQESL  818
            A RAKIQ+SL
Sbjct  259  AMRAKIQDSL  268



>ref|XP_010260223.1| PREDICTED: proton pump-interactor 1-like [Nelumbo nucifera]
Length=620

 Score =   219 bits (559),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 130/236 (55%), Positives = 179/236 (76%), Gaps = 8/236 (3%)
 Frame = +3

Query  114  IEIMGVDVESKLAHVSVETGSENGGSLKEN-GTVPNEPIKFGSHGAEEPIKEDVKKAPAI  290
            +E++  D       V V+ GS+  GS K N G+  +EPIKFGSHG +  IK +++     
Sbjct  3    VEVLAAD----FTQVPVKDGSDEKGSAKLNQGSGLDEPIKFGSHGNDGAIKAEMETIS--  56

Query  291  NLPKDAVVEDWPAPQQIHSFYLVKYRTFEDqklkakleqaekelhkkNQARSVMIDNLRA  470
            ++PKDAV ++WPAP+QIH+FY VK+R++ED KL+AK+E A+KEL K+ Q+R  + D++RA
Sbjct  57   DVPKDAV-DEWPAPKQIHTFYFVKFRSYEDPKLRAKIELADKELQKRTQSRIQINDSIRA  115

Query  471  KRAARSELINERKSLSAERQQFRSQMDEKRKVMEPLQQALGKLRGNNAGGRDQRSVIFSS  650
            KRA R+++I + K L+AE +++RS +DEKRK MEPLQQALGKLR  N   R++   + SS
Sbjct  116  KRAERAQVIAQLKPLTAEDKRYRSIVDEKRKEMEPLQQALGKLRSANNANRERGVGLCSS  175

Query  651  EAELNDYIKSLQYRIQHESITLNEEKQILREIKQFEGTRDKVIAHAAERAKIQESL  818
            EAELND I+SL YR+QHESI+L EEKQ+LREIKQ EGTR+KVIA+AA +AKI++SL
Sbjct  176  EAELNDLIQSLHYRMQHESISLVEEKQLLREIKQLEGTREKVIANAAMKAKIEDSL  231



>emb|CAN81802.1| hypothetical protein VITISV_007014 [Vitis vinifera]
Length=536

 Score =   217 bits (552),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 134/241 (56%), Positives = 175/241 (73%), Gaps = 12/241 (5%)
 Frame = +3

Query  123  MGVDVES-KLAHVSVETGSENGGSL---KENGTVP-----NEPIKFGSHGAEEPIKEDVK  275
            MGV+V   + A   VE G+E   +L   KENG +       EPIKFGSHG +EP+K +  
Sbjct  1    MGVEVVGFEAAPAPVEAGTEAESALLHDKENGKLDQGPGVTEPIKFGSHG-DEPVKGEGN  59

Query  276  KAPAINLPKDAVVEDWPAPQQIHSFYLVKYRTFEDqklkakleqaekelhkkNQARSVMI  455
               + N PKD VV++WPAP+QIHSFY VKYR+++D K+KAKL+QA+KE+ ++NQAR  + 
Sbjct  60   NV-SDNFPKD-VVDEWPAPKQIHSFYFVKYRSYDDPKIKAKLDQADKEIQRRNQARFQIT  117

Query  456  DNLRAKRAARSELINERKSLSAERQQFRSQMDEKRKVMEPLQQALGKLRGNNAGGRDQRS  635
            + LRAK++ R++++++ KSL AE +QFR  +D KRK MEPLQ ALGKLR  N+  R++  
Sbjct  118  EGLRAKKSDRAQMLSQLKSLKAEDEQFRMIVDGKRKEMEPLQHALGKLRSTNSANRERGG  177

Query  636  VIFSSEAELNDYIKSLQYRIQHESITLNEEKQILREIKQFEGTRDKVIAHAAERAKIQES  815
             + SSE ELND I+SL Y +QHESI L EEKQILREIKQ E TR+KVIA AA RAKIQ+S
Sbjct  178  TLCSSEEELNDLIQSLHYHMQHESIPLAEEKQILREIKQLEATREKVIAGAAMRAKIQDS  237

Query  816  L  818
            L
Sbjct  238  L  238



>ref|XP_002285016.2| PREDICTED: proton pump-interactor 1 [Vitis vinifera]
 ref|XP_010644191.1| PREDICTED: proton pump-interactor 1 [Vitis vinifera]
Length=627

 Score =   217 bits (552),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 134/241 (56%), Positives = 175/241 (73%), Gaps = 12/241 (5%)
 Frame = +3

Query  123  MGVDVES-KLAHVSVETGSENGGSL---KENGTVP-----NEPIKFGSHGAEEPIKEDVK  275
            MGV+V   + A   VE G+E   +L   KENG +       EPIKFGSHG +EP+K +  
Sbjct  1    MGVEVVGFEAAPAPVEAGTEAESALLHDKENGKLDQGPGVTEPIKFGSHG-DEPVKGEGN  59

Query  276  KAPAINLPKDAVVEDWPAPQQIHSFYLVKYRTFEDqklkakleqaekelhkkNQARSVMI  455
               + N PKD VV++WPAP+QIHSFY VKYR+++D K+KAKL+QA+KE+ ++NQAR  + 
Sbjct  60   NV-SDNFPKD-VVDEWPAPKQIHSFYFVKYRSYDDPKIKAKLDQADKEIQRRNQARFQIT  117

Query  456  DNLRAKRAARSELINERKSLSAERQQFRSQMDEKRKVMEPLQQALGKLRGNNAGGRDQRS  635
            + LRAK++ R++++++ KSL AE +QFR  +D KRK MEPLQ ALGKLR  N+  R++  
Sbjct  118  EGLRAKKSDRAQMLSQLKSLKAEDEQFRMIVDGKRKEMEPLQHALGKLRSTNSANRERGG  177

Query  636  VIFSSEAELNDYIKSLQYRIQHESITLNEEKQILREIKQFEGTRDKVIAHAAERAKIQES  815
             + SSE ELND I+SL Y +QHESI L EEKQILREIKQ E TR+KVIA AA RAKIQ+S
Sbjct  178  TLCSSEEELNDLIQSLHYHMQHESIPLAEEKQILREIKQLEATREKVIAGAAMRAKIQDS  237

Query  816  L  818
            L
Sbjct  238  L  238



>ref|XP_010272430.1| PREDICTED: proton pump-interactor 1 [Nelumbo nucifera]
Length=614

 Score =   216 bits (551),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 130/234 (56%), Positives = 179/234 (76%), Gaps = 5/234 (2%)
 Frame = +3

Query  123  MGVDV-ESKLAHVSVETGSENGGSLKEN-GTVPNEPIKFGSHGAEEPIKEDVKKAPAINL  296
            M V+V  +++  V+V+ G+E   S + N G   +EPIKFGSHG + P+K +V   P    
Sbjct  1    MPVEVMRAEIVQVAVKDGNEEIDSRELNQGLALDEPIKFGSHGTDGPVKAEVNALPVA--  58

Query  297  PKDAVVEDWPAPQQIHSFYLVKYRTFEDqklkakleqaekelhkkNQARSVMIDNLRAKR  476
            PKDA  ++WPAP+QI+SFY VKYR++ED KLKAK++QA+KEL KKNQAR  + D +R K+
Sbjct  59   PKDAA-DEWPAPKQIYSFYFVKYRSYEDPKLKAKIDQADKELQKKNQARLKINDLIREKK  117

Query  477  AARSELINERKSLSAERQQFRSQMDEKRKVMEPLQQALGKLRGNNAGGRDQRSVIFSSEA  656
            + R+++I++ K L+AE +++RS +DEKRK MEPLQQALGKLR  N   R++   + SSEA
Sbjct  118  SERAQIISQLKPLTAEDKRYRSIVDEKRKEMEPLQQALGKLRSANNASRERGIGLCSSEA  177

Query  657  ELNDYIKSLQYRIQHESITLNEEKQILREIKQFEGTRDKVIAHAAERAKIQESL  818
            ELN++I+SL YR+QHESI+L EEKQ+LREIKQ EGTR+KVIA+A  +AKI++SL
Sbjct  178  ELNEFIQSLHYRMQHESISLVEEKQLLREIKQLEGTREKVIANAVMKAKIEDSL  231



>gb|KJB81955.1| hypothetical protein B456_013G168900 [Gossypium raimondii]
 gb|KJB81956.1| hypothetical protein B456_013G168900 [Gossypium raimondii]
Length=643

 Score =   214 bits (546),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 136/241 (56%), Positives = 177/241 (73%), Gaps = 13/241 (5%)
 Frame = +3

Query  123  MGVDVE-SKLAHVSVETGSENGGSL---KENG-----TVPNEPIKFGSHGAEEPIKEDVK  275
            MGV+V  S++A  SV+  +E   SL   KENG      V +EPIKFGS+  EE  K + K
Sbjct  1    MGVEVVGSEMAKASVDKSTEVEKSLVHDKENGKLDKDPVHSEPIKFGSN-VEESNKGEEK  59

Query  276  KAPAINLPKDAVVEDWPAPQQIHSFYLVKYRTFEDqklkakleqaekelhkkNQARSVMI  455
             A   N P DAVVE WPAP+QIHSFY V+YR ++D K+KAK++QA+KE+ K N+AR  + 
Sbjct  60   NASDANFPSDAVVE-WPAPKQIHSFYFVRYRPYDDPKIKAKIDQADKEVQKWNKARFQLT  118

Query  456  DNLRAKRAARSELINERKSLSAERQQFRSQMDEKRKVMEPLQQALGKLRGNNAGGRDQRS  635
            D ++A ++ R+EL+++ K+L+ + +QF++ + EK+K +EPLQQALGKLR NN      R 
Sbjct  119  DEIKAYKSDRAELLSQVKALNIDFEQFKTMLGEKKKELEPLQQALGKLRNNN--NESGRG  176

Query  636  VIFSSEAELNDYIKSLQYRIQHESITLNEEKQILREIKQFEGTRDKVIAHAAERAKIQES  815
             I SSE ELND+I SLQYRIQHESI L+EEKQ+LREIKQ EGTR+KVIA+AA RAKIQES
Sbjct  177  GICSSEEELNDFIYSLQYRIQHESIPLSEEKQLLREIKQLEGTREKVIANAAMRAKIQES  236

Query  816  L  818
            L
Sbjct  237  L  237



>ref|XP_011043810.1| PREDICTED: proton pump-interactor 1 [Populus euphratica]
Length=616

 Score =   214 bits (544),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 120/202 (59%), Positives = 158/202 (78%), Gaps = 5/202 (2%)
 Frame = +3

Query  213  PNEPIKFGSHGAEEPIKEDVKKAPAINLPKDAVVEDWPAPQQIHSFYLVKYRTFEDqklk  392
            P EPI+FGSHG EEP++ +       NLPKDA+ ++WPAP++IHSFY V YR ++D K+K
Sbjct  40   PTEPIQFGSHG-EEPVRAEGNDVTDANLPKDAI-DEWPAPKKIHSFYFVIYRQYDDPKIK  97

Query  393  akleqaekelhkkNQARSVMIDNLRAKRAARSELINERKSLSAERQQFRSQMDEKRKVME  572
            +K++QA+KE+ K+N +R  + + L+AKRA R+EL+N+ ++L  E +Q++S  DEK+K +E
Sbjct  98   SKIDQADKEIQKRNLSRFEITEELKAKRAKRAELVNQVRTLKNEGRQYKSMFDEKKKKIE  157

Query  573  PLQQALGKLRGNNAGGRDQRSVIFSSEAELNDYIKSLQYRIQHESITLNEEKQILREIKQ  752
            PLQQALGKLR  N+ GR     + SSE ELND I SLQYRIQHESI L EEKQILREIKQ
Sbjct  158  PLQQALGKLRDTNSAGR---VGLCSSEEELNDLIYSLQYRIQHESIPLTEEKQILREIKQ  214

Query  753  FEGTRDKVIAHAAERAKIQESL  818
            FEGTR+KVIA+AA RAKIQ+S+
Sbjct  215  FEGTREKVIANAAMRAKIQDSM  236



>ref|XP_002316898.2| hypothetical protein POPTR_0011s12040g [Populus trichocarpa]
 gb|EEE97510.2| hypothetical protein POPTR_0011s12040g [Populus trichocarpa]
Length=619

 Score =   213 bits (543),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 129/220 (59%), Positives = 162/220 (74%), Gaps = 7/220 (3%)
 Frame = +3

Query  159  SVETGSENGGSLKENGTVPNEPIKFGSHGAEEPIKEDVKKAPAINLPKDAVVEDWPAPQQ  338
            SV    ENG   K +G    EPI+FGSHG EEP+K +       NLPKDAV ++WPAP+Q
Sbjct  24   SVLHQKENGKLDKVSGL--TEPIQFGSHG-EEPVKAEGNDVTDANLPKDAV-DEWPAPKQ  79

Query  339  IHSFYLVKYRTFEDqklkakleqaekelhkkNQARSVMIDNLRAKRAARSELINERKSLS  518
            +HSFY V YR ++D K+KAK++QA+KE+ K+NQ+R  + + L+ +R+ R+ELIN+ ++L 
Sbjct  80   VHSFYFVTYRLYDDPKIKAKIDQADKEIQKRNQSRFQITEELKDRRSKRAELINQVRALK  139

Query  519  AERQQFRSQMDEKRKVMEPLQQALGKLRGNNAGGRDQRSVIFSSEAELNDYIKSLQYRIQ  698
             E +Q++S  DEKRK MEPLQQALGKLR  N  GR     I SSE ELND I SLQYR+Q
Sbjct  140  NEGRQYKSIFDEKRKEMEPLQQALGKLRNTNNAGR---VGICSSEEELNDLIYSLQYRMQ  196

Query  699  HESITLNEEKQILREIKQFEGTRDKVIAHAAERAKIQESL  818
            HESI L EEKQILREIKQ EGTR+KVIA+AA R KIQ+SL
Sbjct  197  HESIPLTEEKQILREIKQLEGTREKVIANAAMRTKIQDSL  236



>ref|XP_006370248.1| PROTON PUMP INTERACTOR 1 family protein [Populus trichocarpa]
 gb|ERP66817.1| PROTON PUMP INTERACTOR 1 family protein [Populus trichocarpa]
Length=603

 Score =   211 bits (536),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 119/201 (59%), Positives = 156/201 (78%), Gaps = 5/201 (2%)
 Frame = +3

Query  216  NEPIKFGSHGAEEPIKEDVKKAPAINLPKDAVVEDWPAPQQIHSFYLVKYRTFEDqklka  395
             EPI+FGSHG EEP++ +       NLPKDA+ ++WPAP+QIHSFY V YR ++D K+K+
Sbjct  41   TEPIQFGSHG-EEPVRAEGNDVTDANLPKDAI-DEWPAPKQIHSFYFVTYRQYDDPKIKS  98

Query  396  kleqaekelhkkNQARSVMIDNLRAKRAARSELINERKSLSAERQQFRSQMDEKRKVMEP  575
            K++QA+KE+ K+N +R  + + L+A RA R+EL+N+ ++L  E +Q++S  DEK+K +EP
Sbjct  99   KIDQADKEIQKRNLSRFEITEELKAIRAKRAELVNQVRTLKNEGRQYKSMFDEKKKKIEP  158

Query  576  LQQALGKLRGNNAGGRDQRSVIFSSEAELNDYIKSLQYRIQHESITLNEEKQILREIKQF  755
            LQQALGKLR  N+ GR     + SSE ELND I SLQYRIQHESI L EEKQILREIKQF
Sbjct  159  LQQALGKLRDTNSAGR---GGLCSSEEELNDLIYSLQYRIQHESIPLTEEKQILREIKQF  215

Query  756  EGTRDKVIAHAAERAKIQESL  818
            EGTR+KVIA+AA RAKIQ+S+
Sbjct  216  EGTREKVIANAAMRAKIQDSM  236



>gb|KDP27063.1| hypothetical protein JCGZ_20998 [Jatropha curcas]
Length=622

 Score =   211 bits (537),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 132/241 (55%), Positives = 171/241 (71%), Gaps = 15/241 (6%)
 Frame = +3

Query  123  MGVDV-ESKLAHVSVETGSENGGSL---KENGTVP-----NEPIKFGSHGAEEPIKEDVK  275
            MGV+V  S++AHV VET +E   S    KENG +       EPIKFGS   EEP KE   
Sbjct  1    MGVEVVGSEMAHVPVETVAEVDNSFLHEKENGKLDMESGFKEPIKFGSQD-EEPAKEADI  59

Query  276  KAPAINLPKDAVVEDWPAPQQIHSFYLVKYRTFEDqklkakleqaekelhkkNQARSVMI  455
             A A   PK+A  ++WPAP+QIH+FY V+YR F+D K+KAK++ A++E+ + NQ+R  ++
Sbjct  60   VADA-KFPKEAA-DEWPAPRQIHTFYFVRYRPFDDPKIKAKIDSADREIQRTNQSRFQIL  117

Query  456  DNLRAKRAARSELINERKSLSAERQQFRSQMDEKRKVMEPLQQALGKLRGNNAGGRDQRS  635
            + L+AKR+ R+EL+ + K+L  E  Q+R+ +DEKRK +EPLQQALGKLR  N  GR    
Sbjct  118  EELKAKRSVRAELMEQVKTLRNENDQYRNIVDEKRKEIEPLQQALGKLRSTNNAGR---G  174

Query  636  VIFSSEAELNDYIKSLQYRIQHESITLNEEKQILREIKQFEGTRDKVIAHAAERAKIQES  815
             + SSE ELND I  L+Y I+HESI L EEK+ILREIKQ EGTRDKVIA+AA RAKIQ+S
Sbjct  175  ALCSSEEELNDVINGLRYCIEHESIPLTEEKKILREIKQLEGTRDKVIANAAMRAKIQDS  234

Query  816  L  818
            L
Sbjct  235  L  235



>ref|XP_011029477.1| PREDICTED: proton pump-interactor 1-like [Populus euphratica]
Length=622

 Score =   209 bits (532),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 121/201 (60%), Positives = 154/201 (77%), Gaps = 5/201 (2%)
 Frame = +3

Query  216  NEPIKFGSHGAEEPIKEDVKKAPAINLPKDAVVEDWPAPQQIHSFYLVKYRTFEDqklka  395
             EPI+FGSHG EEP+K +       NLPKDAV ++WPAP+Q+HSFY V YR ++D K+KA
Sbjct  41   TEPIQFGSHG-EEPVKAEGNDVTDDNLPKDAV-DEWPAPKQVHSFYFVTYRLYDDPKIKA  98

Query  396  kleqaekelhkkNQARSVMIDNLRAKRAARSELINERKSLSAERQQFRSQMDEKRKVMEP  575
            K++QA+KE+ K+NQ+R  + + L+ +R+ R+ELIN+ ++L  E +Q++S  DEK+K MEP
Sbjct  99   KIDQADKEIQKRNQSRFQITEELKDRRSKRAELINQVRALKNEGRQYKSIFDEKKKEMEP  158

Query  576  LQQALGKLRGNNAGGRDQRSVIFSSEAELNDYIKSLQYRIQHESITLNEEKQILREIKQF  755
            LQQALGKLR  N  GR     I SSE ELND I SLQYR+QHESI L EEKQILREIKQ 
Sbjct  159  LQQALGKLRNTNNAGR---VGICSSEEELNDLIYSLQYRMQHESIPLTEEKQILREIKQL  215

Query  756  EGTRDKVIAHAAERAKIQESL  818
            EGTR+KVIA+AA R KIQ+SL
Sbjct  216  EGTREKVIANAAMRTKIQDSL  236



>gb|KJB61874.1| hypothetical protein B456_009G387800 [Gossypium raimondii]
Length=537

 Score =   204 bits (520),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 128/244 (52%), Positives = 177/244 (73%), Gaps = 11/244 (5%)
 Frame = +3

Query  108  AFIEIMGVDV-ESKLAHVSVETGSENGGS-LKENGT-----VPNEPIKFGSHGAEEPIKE  266
            + + +MGV+V +S L  +S++  +E   S L ENG      V N PI   SH +EEP KE
Sbjct  6    SILCLMGVEVVDSDLTQLSIDKVTEVDKSFLHENGKLDKDPVYNNPIDVDSH-SEEPDKE  64

Query  267  DVKKAPAINLPKDAVVEDWPAPQQIHSFYLVKYRTFEDqklkakleqaekelhkkNQARS  446
            +   A   + PKDAVVE WPAP+QIHSF+ ++YR +ED  +KAKL+QA+KE+ K N+AR 
Sbjct  65   EENGASDPDFPKDAVVE-WPAPKQIHSFHFIRYRFYEDPAIKAKLDQADKEIQKWNKARF  123

Query  447  VMIDNLRAKRAARSELINERKSLSAERQQFRSQMDEKRKVMEPLQQALGKLRGNNAGGRD  626
             + D L+AKRA RSE++++ ++L+ + +QF++ +DEK+K +EPLQQALGKLR N     D
Sbjct  124  KLTDELKAKRAERSEMLSQVRALNVDFEQFKTILDEKKKEIEPLQQALGKLRNNK--DVD  181

Query  627  QRSVIFSSEAELNDYIKSLQYRIQHESITLNEEKQILREIKQFEGTRDKVIAHAAERAKI  806
             R  + +SE EL+  I SLQYRIQHESI+L+EEK+IL+EIK  EGTR+KVIA+AA R+KI
Sbjct  182  NRLSLCASEEELDFIIHSLQYRIQHESISLSEEKRILKEIKHLEGTREKVIANAAMRSKI  241

Query  807  QESL  818
            Q+SL
Sbjct  242  QDSL  245



>ref|XP_007021493.1| Proton pump interactor 1 isoform 3 [Theobroma cacao]
 gb|EOY13018.1| Proton pump interactor 1 isoform 3 [Theobroma cacao]
Length=448

 Score =   202 bits (515),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 137/241 (57%), Positives = 177/241 (73%), Gaps = 13/241 (5%)
 Frame = +3

Query  123  MGVDV-ESKLAHVSVETGSENGGSL---KENGT-----VPNEPIKFGSHGAEEPIKEDVK  275
            MGV+V  S +A VSV+  +E   S    KENG      V +EPIK GS G EEP K +  
Sbjct  1    MGVEVVGSDMAQVSVDKVAEVEKSFLHDKENGKLDKDPVHDEPIKLGSLG-EEPDKGEEI  59

Query  276  KAPAINLPKDAVVEDWPAPQQIHSFYLVKYRTFEDqklkakleqaekelhkkNQARSVMI  455
             A   N PKDAV ++WPAP+QIHSFY V+YR ++D K+KAK++QA+KE+ K N+AR  + 
Sbjct  60   NASDANFPKDAV-DEWPAPKQIHSFYFVRYRPYDDPKIKAKIDQADKEIQKWNKARFQLT  118

Query  456  DNLRAKRAARSELINERKSLSAERQQFRSQMDEKRKVMEPLQQALGKLRGNNAGGRDQRS  635
            ++L+ KR+ R+EL+++ K+L+ + +QF++ + EK+K MEPLQQALGKLR NN  G   R 
Sbjct  119  EDLKVKRSDRAELLSQVKALNIDFEQFKAILGEKKKEMEPLQQALGKLRNNNNAG--GRG  176

Query  636  VIFSSEAELNDYIKSLQYRIQHESITLNEEKQILREIKQFEGTRDKVIAHAAERAKIQES  815
             I SSE ELND I SLQYRIQHESI L+EEKQ+LREIKQ EGTR+KVIA+AA RAKIQ+S
Sbjct  177  GICSSEEELNDIIHSLQYRIQHESIPLSEEKQLLREIKQLEGTREKVIANAAMRAKIQDS  236

Query  816  L  818
            L
Sbjct  237  L  237



>gb|KJB61873.1| hypothetical protein B456_009G387800 [Gossypium raimondii]
Length=527

 Score =   203 bits (517),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 128/239 (54%), Positives = 174/239 (73%), Gaps = 11/239 (5%)
 Frame = +3

Query  123  MGVDV-ESKLAHVSVETGSENGGS-LKENGT-----VPNEPIKFGSHGAEEPIKEDVKKA  281
            MGV+V +S L  +S++  +E   S L ENG      V N PI   SH +EEP KE+   A
Sbjct  1    MGVEVVDSDLTQLSIDKVTEVDKSFLHENGKLDKDPVYNNPIDVDSH-SEEPDKEEENGA  59

Query  282  PAINLPKDAVVEDWPAPQQIHSFYLVKYRTFEDqklkakleqaekelhkkNQARSVMIDN  461
               + PKDAVVE WPAP+QIHSF+ ++YR +ED  +KAKL+QA+KE+ K N+AR  + D 
Sbjct  60   SDPDFPKDAVVE-WPAPKQIHSFHFIRYRFYEDPAIKAKLDQADKEIQKWNKARFKLTDE  118

Query  462  LRAKRAARSELINERKSLSAERQQFRSQMDEKRKVMEPLQQALGKLRGNNAGGRDQRSVI  641
            L+AKRA RSE++++ ++L+ + +QF++ +DEK+K +EPLQQALGKLR N     D R  +
Sbjct  119  LKAKRAERSEMLSQVRALNVDFEQFKTILDEKKKEIEPLQQALGKLRNNK--DVDNRLSL  176

Query  642  FSSEAELNDYIKSLQYRIQHESITLNEEKQILREIKQFEGTRDKVIAHAAERAKIQESL  818
             +SE EL+  I SLQYRIQHESI+L+EEK+IL+EIK  EGTR+KVIA+AA R+KIQ+SL
Sbjct  177  CASEEELDFIIHSLQYRIQHESISLSEEKRILKEIKHLEGTREKVIANAAMRSKIQDSL  235



>gb|KHN28064.1| hypothetical protein glysoja_007796 [Glycine soja]
Length=625

 Score =   204 bits (520),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 127/243 (52%), Positives = 166/243 (68%), Gaps = 18/243 (7%)
 Frame = +3

Query  117  EIMGVDVESKLAHVSVETGSENGGSL---KENGTVPNE------PIKFGSHGAEEPIKED  269
            E++G +    +    VE G+E G  +   KENG +  +       IKFG+HG EE  K+ 
Sbjct  4    EVVGFE----MVQGPVENGTEGGKPVLNEKENGKLEKDVGAAADAIKFGTHG-EESAKKK  58

Query  270  VKKAPAINLPKDAVVEDWPAPQQIHSFYLVKYRTFEDqklkakleqaekelhkkNQARSV  449
                  +N PKDA  EDWPAP+QIHSFY V++R ++D  +K+K++ ++K++ KKNQAR  
Sbjct  59   GNDVSDVNAPKDAA-EDWPAPKQIHSFYFVRWRPYDDPTIKSKIDLSDKDISKKNQARFQ  117

Query  450  MIDNLRAKRAARSELINERKSLSAERQQFRSQMDEKRKVMEPLQQALGKLRGNNAGGRDQ  629
            + + L+AKRA R ELI++ KSL  + +QF+S +DEK K + PLQQALGKLR  N  GR  
Sbjct  118  ITEALKAKRAERVELISQVKSLRGDSRQFQSIVDEKLKEIGPLQQALGKLRTTNNAGR--  175

Query  630  RSVIFSSEAELNDYIKSLQYRIQHESITLNEEKQILREIKQFEGTRDKVIAHAAERAKIQ  809
               + SSE ELN  I SLQYRIQHESI L EEKQILREIKQ EGTR+KVIA+AA RAK+Q
Sbjct  176  -GGLCSSEDELNSVIYSLQYRIQHESIPLTEEKQILREIKQLEGTREKVIANAAMRAKLQ  234

Query  810  ESL  818
            ES+
Sbjct  235  ESM  237



>ref|XP_007149466.1| hypothetical protein PHAVU_005G072500g [Phaseolus vulgaris]
 gb|ESW21460.1| hypothetical protein PHAVU_005G072500g [Phaseolus vulgaris]
Length=616

 Score =   204 bits (519),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 126/243 (52%), Positives = 167/243 (69%), Gaps = 19/243 (8%)
 Frame = +3

Query  114  IEIMGVDVESKLAHVSVETGSENGGSL---KENGTVPN-----EPIKFGSHGAEEPIKED  269
            +E++G +    +    VE G+E G  +   KENG +       E IKFGSHG E     D
Sbjct  3    VEVVGFE----MVQGPVENGAEGGKPVLHEKENGKLEKDVGAVEAIKFGSHGDESAKGND  58

Query  270  VKKAPAINLPKDAVVEDWPAPQQIHSFYLVKYRTFEDqklkakleqaekelhkkNQARSV  449
            V +A   N+P+DA  E+WPAP+QIHS+Y V++R +ED  +K+K++  +KE+ KKNQ R  
Sbjct  59   VSEA---NVPRDAA-EEWPAPKQIHSYYFVRWRPYEDPTIKSKIDLLDKEISKKNQGRFQ  114

Query  450  MIDNLRAKRAARSELINERKSLSAERQQFRSQMDEKRKVMEPLQQALGKLRGNNAGGRDQ  629
            + + L+AKR+ R+ELI++ KSL  + +QF+S +DEK K +EPLQQALGKLR  N  GR  
Sbjct  115  ITEALKAKRSERAELISQIKSLRGDSRQFQSIVDEKIKEIEPLQQALGKLRNTNNAGR--  172

Query  630  RSVIFSSEAELNDYIKSLQYRIQHESITLNEEKQILREIKQFEGTRDKVIAHAAERAKIQ  809
               + SSE ELN  I SLQYRIQHESI L EEKQ+LREIKQ EGTR+KVIA+AA R K+Q
Sbjct  173  -GGLCSSEEELNTVIYSLQYRIQHESIPLTEEKQLLREIKQLEGTREKVIANAAMRTKLQ  231

Query  810  ESL  818
            ES+
Sbjct  232  ESM  234



>gb|KCW70003.1| hypothetical protein EUGRSUZ_F03313 [Eucalyptus grandis]
Length=317

 Score =   197 bits (501),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 119/235 (51%), Positives = 164/235 (70%), Gaps = 8/235 (3%)
 Frame = +3

Query  114  IEIMGVDVESKLAHVSVETGSENGGSLKENGTVPNEPIKFGSHGAEEPIKEDVKKAPAIN  293
            IEI G +    +A   +ET  E      + GT   E + FGSH  E+PI  +  +   +N
Sbjct  3    IEIAGFE----MAPAPMETPYEKDNGQFDKGTKLGEAVTFGSH-EEKPILGEGNQVSEVN  57

Query  294  LPKDAVVEDWPAPQQIHSFYLVKYRTFEDqklkakleqaekelhkkNQARSVMIDNLRAK  473
             PKDAV ++WPAP++IH+FY++K+R++ED  +K K+EQA+KE+ ++NQA+  + D LR K
Sbjct  58   FPKDAV-DEWPAPKRIHTFYIMKFRSYEDPSIKVKIEQADKEIQRRNQAKFQITDALREK  116

Query  474  RAARSELINERKSLSAERQQFRSQMDEKRKVMEPLQQALGKLRGNNAGGRDQRSVIFSSE  653
            R+ RS+LI + ++L  E + F S +DEK+K MEPL +ALGKLR  N GGR   S + SSE
Sbjct  117  RSERSDLIAQLRALGEENRTFHSILDEKKKDMEPLHEALGKLRHANTGGRG--SGLCSSE  174

Query  654  AELNDYIKSLQYRIQHESITLNEEKQILREIKQFEGTRDKVIAHAAERAKIQESL  818
             ELN  I+SL Y IQHESI L EEKQILREIKQ EGTR+KVIA+AA +A++Q+S+
Sbjct  175  EELNQLIQSLNYHIQHESIPLTEEKQILREIKQLEGTREKVIANAAMKAEVQKSV  229



>gb|EYU26378.1| hypothetical protein MIMGU_mgv1a003327mg [Erythranthe guttata]
Length=592

 Score =   202 bits (515),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 124/211 (59%), Positives = 148/211 (70%), Gaps = 16/211 (8%)
 Frame = +3

Query  225  IKFGSHGAEEPI-------------KEDVKKAPAINLPKDAVVEDWPAPQQIHSFYLVKY  365
            I FGSH  E P+             K+ V   P  NLPKDAV ++WPAP QIHSFY+VKY
Sbjct  24   ISFGSHSGEAPVEGELNKQTEPDVPKDVVDDWPEPNLPKDAV-DEWPAPSQIHSFYIVKY  82

Query  366  RTFEDqklkakleqaekelhkkNQARSVMIDNLRAKRAARSELINERKSLSAERQQFRSQ  545
            R  EDQ L+AKL+ AE +L KKNQAR  + + L+ KRA R+++  E  SLS E +QFR+ 
Sbjct  83   RALEDQNLRAKLDMAENDLQKKNQARFQIFEKLKIKRAERAQIRTEIHSLSVENKQFRTA  142

Query  546  MDEKRKVMEPLQQALGKLRGNNAGGRDQRSVIFSSEAELNDYIKSLQYRIQHESITLNEE  725
            MDEKRK MEPLQQALGK+RG    G      + SSEAELN  IKS +YRIQHESI L+EE
Sbjct  143  MDEKRKEMEPLQQALGKMRG--PSGEKGSVQLCSSEAELNRLIKSYEYRIQHESIPLSEE  200

Query  726  KQILREIKQFEGTRDKVIAHAAERAKIQESL  818
            KQILREIKQ E TRDKVIA+AAE A++Q+SL
Sbjct  201  KQILREIKQLEATRDKVIANAAEVARLQDSL  231



>ref|XP_007021491.1| Proton pump interactor 1 isoform 1 [Theobroma cacao]
 gb|EOY13016.1| Proton pump interactor 1 isoform 1 [Theobroma cacao]
Length=636

 Score =   203 bits (516),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 137/241 (57%), Positives = 177/241 (73%), Gaps = 13/241 (5%)
 Frame = +3

Query  123  MGVDVE-SKLAHVSVETGSENGGSL---KENG-----TVPNEPIKFGSHGAEEPIKEDVK  275
            MGV+V  S +A VSV+  +E   S    KENG      V +EPIK GS G EEP K +  
Sbjct  1    MGVEVVGSDMAQVSVDKVAEVEKSFLHDKENGKLDKDPVHDEPIKLGSLG-EEPDKGEEI  59

Query  276  KAPAINLPKDAVVEDWPAPQQIHSFYLVKYRTFEDqklkakleqaekelhkkNQARSVMI  455
             A   N PKDAV ++WPAP+QIHSFY V+YR ++D K+KAK++QA+KE+ K N+AR  + 
Sbjct  60   NASDANFPKDAV-DEWPAPKQIHSFYFVRYRPYDDPKIKAKIDQADKEIQKWNKARFQLT  118

Query  456  DNLRAKRAARSELINERKSLSAERQQFRSQMDEKRKVMEPLQQALGKLRGNNAGGRDQRS  635
            ++L+ KR+ R+EL+++ K+L+ + +QF++ + EK+K MEPLQQALGKLR NN  G   R 
Sbjct  119  EDLKVKRSDRAELLSQVKALNIDFEQFKAILGEKKKEMEPLQQALGKLRNNNNAG--GRG  176

Query  636  VIFSSEAELNDYIKSLQYRIQHESITLNEEKQILREIKQFEGTRDKVIAHAAERAKIQES  815
             I SSE ELND I SLQYRIQHESI L+EEKQ+LREIKQ EGTR+KVIA+AA RAKIQ+S
Sbjct  177  GICSSEEELNDIIHSLQYRIQHESIPLSEEKQLLREIKQLEGTREKVIANAAMRAKIQDS  236

Query  816  L  818
            L
Sbjct  237  L  237



>ref|XP_007021492.1| Proton pump interactor 1 isoform 2 [Theobroma cacao]
 gb|EOY13017.1| Proton pump interactor 1 isoform 2 [Theobroma cacao]
Length=627

 Score =   203 bits (516),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 137/241 (57%), Positives = 177/241 (73%), Gaps = 13/241 (5%)
 Frame = +3

Query  123  MGVDVE-SKLAHVSVETGSENGGSL---KENG-----TVPNEPIKFGSHGAEEPIKEDVK  275
            MGV+V  S +A VSV+  +E   S    KENG      V +EPIK GS G EEP K +  
Sbjct  1    MGVEVVGSDMAQVSVDKVAEVEKSFLHDKENGKLDKDPVHDEPIKLGSLG-EEPDKGEEI  59

Query  276  KAPAINLPKDAVVEDWPAPQQIHSFYLVKYRTFEDqklkakleqaekelhkkNQARSVMI  455
             A   N PKDAV ++WPAP+QIHSFY V+YR ++D K+KAK++QA+KE+ K N+AR  + 
Sbjct  60   NASDANFPKDAV-DEWPAPKQIHSFYFVRYRPYDDPKIKAKIDQADKEIQKWNKARFQLT  118

Query  456  DNLRAKRAARSELINERKSLSAERQQFRSQMDEKRKVMEPLQQALGKLRGNNAGGRDQRS  635
            ++L+ KR+ R+EL+++ K+L+ + +QF++ + EK+K MEPLQQALGKLR NN  G   R 
Sbjct  119  EDLKVKRSDRAELLSQVKALNIDFEQFKAILGEKKKEMEPLQQALGKLRNNNNAG--GRG  176

Query  636  VIFSSEAELNDYIKSLQYRIQHESITLNEEKQILREIKQFEGTRDKVIAHAAERAKIQES  815
             I SSE ELND I SLQYRIQHESI L+EEKQ+LREIKQ EGTR+KVIA+AA RAKIQ+S
Sbjct  177  GICSSEEELNDIIHSLQYRIQHESIPLSEEKQLLREIKQLEGTREKVIANAAMRAKIQDS  236

Query  816  L  818
            L
Sbjct  237  L  237



>ref|XP_010537017.1| PREDICTED: proton pump-interactor 1 isoform X2 [Tarenaya hassleriana]
Length=618

 Score =   202 bits (515),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 130/237 (55%), Positives = 166/237 (70%), Gaps = 9/237 (4%)
 Frame = +3

Query  123  MGVDVES----KLAHVSVETGSENGGSLKENGTVPNEPIKFGSHGAEEPIKEDVKKAPAI  290
            MGV+V      ++A    E   E  G   ++G      IKFGSH       E++    + 
Sbjct  1    MGVEVGKSDGFEVAPAPFEGKPEQNGKF-DHGKGDKVSIKFGSHDETSKGDENISSVFSS  59

Query  291  NLPKDAVVEDWPAPQQIHSFYLVKYRTFEDqklkakleqaekelhkkNQARSVMIDNLRA  470
            + PKDA  E+WPA ++IH++Y V+YR +ED K+KAKLEQA+KEL K N+AR+ ++D L++
Sbjct  60   DAPKDAA-EEWPADKRIHTYYFVRYRPYEDPKIKAKLEQADKELQKLNRARAGIVDELKS  118

Query  471  KRAARSELINERKSLSAERQQFRSQMDEKRKVMEPLQQALGKLRGNNAGGRDQRSV-IFS  647
            KRAARSEL ++ + L  ER+ F +  DEKRK MEPLQQALGKLR N   G   R V + S
Sbjct  119  KRAARSELFDQLEPLKNERKGFNTIFDEKRKEMEPLQQALGKLRSNEGSG--ARGVGLCS  176

Query  648  SEAELNDYIKSLQYRIQHESITLNEEKQILREIKQFEGTRDKVIAHAAERAKIQESL  818
            SE ELN+ I SLQYRIQHESI+LNEEKQIL+EIKQFEGTR+KVIA+AA RAKI+ESL
Sbjct  177  SEGELNNMIYSLQYRIQHESISLNEEKQILKEIKQFEGTREKVIANAAMRAKIKESL  233



>ref|XP_008812164.1| PREDICTED: LOW QUALITY PROTEIN: proton pump-interactor 1-like 
[Phoenix dactylifera]
Length=534

 Score =   201 bits (510),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 130/244 (53%), Positives = 170/244 (70%), Gaps = 12/244 (5%)
 Frame = +3

Query  114  IEIMGVDVESKLAHVSVETG----SENGGSLKEN-GTVPNEPIKFG----SHGAEEPIKE  266
            +E++G DV S      +ET     +E  G  K N G    EPIK G    SHGA+E  KE
Sbjct  3    VEVLGADVTSGQVK-GIETNDTFLAEMDGKTKANLGQEAGEPIKSGLGDNSHGAKEETKE  61

Query  267  DVKKAPAINLPKDAVVEDWPAPQQIHSFYLVKYRTFEDqklkakleqaekelhkkNQARS  446
                  A N PKDAV ++WPAP+QIH FY VK+R++ED KLKAK+EQA+K++ KKNQAR 
Sbjct  62   GDHVTNA-NFPKDAV-DEWPAPKQIHYFYFVKFRSYEDPKLKAKIEQADKDIQKKNQARF  119

Query  447  VMIDNLRAKRAARSELINERKSLSAERQQFRSQMDEKRKVMEPLQQALGKLRGNNAGGRD  626
             + + L+ KR+ R+ +I++ K L+AE +Q+R+ MDEKRK ++PLQ ALGKL       R+
Sbjct  120  QITEALKVKRSERANVISQLKPLTAEDKQYRAVMDEKRKEIKPLQTALGKLNNAKNAVRE  179

Query  627  QRSVIFSSEAELNDYIKSLQYRIQHESITLNEEKQILREIKQFEGTRDKVIAHAAERAKI  806
            +   + SSE ELND IKSLQY I HESI+L+EEKQ++REIKQ EGTR KVIA+AA RAKI
Sbjct  180  KGMGLCSSEEELNDLIKSLQYHISHESISLDEEKQLMREIKQLEGTRGKVIANAAMRAKI  239

Query  807  QESL  818
            Q++L
Sbjct  240  QDTL  243



>ref|XP_006582166.1| PREDICTED: proton pump-interactor 1-like isoform X2 [Glycine 
max]
 ref|XP_006582167.1| PREDICTED: proton pump-interactor 1-like isoform X3 [Glycine 
max]
 ref|XP_006582168.1| PREDICTED: proton pump-interactor 1-like isoform X4 [Glycine 
max]
Length=621

 Score =   201 bits (512),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 124/222 (56%), Positives = 159/222 (72%), Gaps = 10/222 (5%)
 Frame = +3

Query  159  SVETGSENGGSLKENGTVPNEPIKFGSHGAEEPIKEDVKKAPAINLPKDAVVEDWPAPQQ  338
            S+   +ENG   ++ G    EP KFGSHG +E  K +       N+PKDAV +DWPAP+Q
Sbjct  24   SISEKTENGKLEQDTGVA--EPTKFGSHG-DESAKPEANVVSDANVPKDAV-DDWPAPRQ  79

Query  339  IHSFYLVKYRTFEDqklkakleqaekelhkkNQARSVMIDNLRAKRAARSELINERKSLS  518
            IHSFY V++R ++D  +KAKLE+ +KE+ ++NQAR  + D LRAKR  R+  I++ KSL 
Sbjct  80   IHSFYFVRFRPYDDPNIKAKLEKYDKEISQENQARIQVTDALRAKRTERAGCISQIKSLK  139

Query  519  AERQQFRSQMDEKRKVMEPLQQALGKLR-GNNAGGRDQRSV-IFSSEAELNDYIKSLQYR  692
             + +QF+S +DEK K +EPLQQALGKLR  NNAG    R V + SSE ELN+ I SL YR
Sbjct  140  GDNRQFQSIVDEKIKEIEPLQQALGKLRTANNAG----RGVGLCSSEEELNNLINSLHYR  195

Query  693  IQHESITLNEEKQILREIKQFEGTRDKVIAHAAERAKIQESL  818
            IQHESI   EEKQILREIKQ EGTR+KVIA+AA RAK+Q+S+
Sbjct  196  IQHESIPFAEEKQILREIKQLEGTREKVIANAAMRAKVQDSM  237



>ref|XP_003543239.1| PREDICTED: proton pump-interactor 1-like isoform X1 [Glycine 
max]
 ref|XP_006594761.1| PREDICTED: proton pump-interactor 1-like isoform X2 [Glycine 
max]
 gb|KHN36826.1| hypothetical protein glysoja_001557 [Glycine soja]
Length=616

 Score =   201 bits (510),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 125/240 (52%), Positives = 165/240 (69%), Gaps = 12/240 (5%)
 Frame = +3

Query  114  IEIMGVD-----VESKLAHVSVETGSENGGSLKENGTVPNEPIKFGSHGAEEPIKEDVKK  278
            +E++G +     VE+      V    ENG   K+ G    + IKFG+HG EE  K +   
Sbjct  3    VEVVGFEMVQGPVENGTGGKPVLNEKENGKLEKDVGAA--DAIKFGTHG-EESAKTEGID  59

Query  279  APAINLPKDAVVEDWPAPQQIHSFYLVKYRTFEDqklkakleqaekelhkkNQARSVMID  458
               +N PKDA  EDWPAP+QIHSFY V++R ++D  +K+K++ ++K++ KKNQAR  + +
Sbjct  60   VSDVNAPKDAA-EDWPAPKQIHSFYFVRWRPYDDPTIKSKIDLSDKDISKKNQARFQITE  118

Query  459  NLRAKRAARSELINERKSLSAERQQFRSQMDEKRKVMEPLQQALGKLRGNNAGGRDQRSV  638
             L+AKR+ R+ELI++ KSL  + +QF+S +DEK K + PLQQALGKLR  N  GR     
Sbjct  119  ALKAKRSERAELISQVKSLRGDSRQFQSIVDEKLKEIGPLQQALGKLRTTNNAGR---GG  175

Query  639  IFSSEAELNDYIKSLQYRIQHESITLNEEKQILREIKQFEGTRDKVIAHAAERAKIQESL  818
            + SSE ELN  I SLQYRIQHESI L EEKQILREIKQ EGTR+KVIA+AA RAK+QES+
Sbjct  176  LCSSEDELNSVIYSLQYRIQHESIPLTEEKQILREIKQLEGTREKVIANAAMRAKLQESM  235



>ref|XP_006413068.1| hypothetical protein EUTSA_v10027051mg [Eutrema salsugineum]
 gb|ESQ54521.1| hypothetical protein EUTSA_v10027051mg [Eutrema salsugineum]
Length=597

 Score =   200 bits (509),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 120/199 (60%), Positives = 144/199 (72%), Gaps = 3/199 (2%)
 Frame = +3

Query  225  IKFGSHGAEEPIK-EDVKKAPAINLPKDAVVEDWPAPQQIHSFYLVKYRTFEDqklkakl  401
            IKFGS G E P K ED       ++PKDA  E+WPA +QIHSFY VKYR ++D K KAKL
Sbjct  38   IKFGSLGGEPPKKGEDNNNVLISDVPKDAA-EEWPAAKQIHSFYFVKYRHYDDPKTKAKL  96

Query  402  eqaekelhkkNQARSVMIDNLRAKRAARSELINERKSLSAERQQFRSQMDEKRKVMEPLQ  581
            + A+KEL K N+AR  ++D L+ KR  RS+L +    L +ERQ F +  DEKRK MEPLQ
Sbjct  97   DVADKELEKLNKARGAVLDKLKEKRTERSKLFDLLDPLKSERQGFNTMFDEKRKEMEPLQ  156

Query  582  QALGKLRGNNAGGRDQRSVIFSSEAELNDYIKSLQYRIQHESITLNEEKQILREIKQFEG  761
            QALGKLRGN+ GG  +   I SSE ELN+ I SLQYRIQHESI L EEKQ+L+EI+  EG
Sbjct  157  QALGKLRGND-GGSARGPAICSSEEELNNMIYSLQYRIQHESIPLTEEKQLLKEIRLLEG  215

Query  762  TRDKVIAHAAERAKIQESL  818
            TRDKVIAH A RAKI+ES+
Sbjct  216  TRDKVIAHEAVRAKIKESM  234



>ref|XP_003527243.1| PREDICTED: proton pump-interactor 1-like isoform X1 [Glycine 
max]
Length=665

 Score =   201 bits (512),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 124/222 (56%), Positives = 159/222 (72%), Gaps = 10/222 (5%)
 Frame = +3

Query  159  SVETGSENGGSLKENGTVPNEPIKFGSHGAEEPIKEDVKKAPAINLPKDAVVEDWPAPQQ  338
            S+   +ENG   ++ G    EP KFGSHG +E  K +       N+PKDAV +DWPAP+Q
Sbjct  68   SISEKTENGKLEQDTGVA--EPTKFGSHG-DESAKPEANVVSDANVPKDAV-DDWPAPRQ  123

Query  339  IHSFYLVKYRTFEDqklkakleqaekelhkkNQARSVMIDNLRAKRAARSELINERKSLS  518
            IHSFY V++R ++D  +KAKLE+ +KE+ ++NQAR  + D LRAKR  R+  I++ KSL 
Sbjct  124  IHSFYFVRFRPYDDPNIKAKLEKYDKEISQENQARIQVTDALRAKRTERAGCISQIKSLK  183

Query  519  AERQQFRSQMDEKRKVMEPLQQALGKLR-GNNAGGRDQRSV-IFSSEAELNDYIKSLQYR  692
             + +QF+S +DEK K +EPLQQALGKLR  NNAG    R V + SSE ELN+ I SL YR
Sbjct  184  GDNRQFQSIVDEKIKEIEPLQQALGKLRTANNAG----RGVGLCSSEEELNNLINSLHYR  239

Query  693  IQHESITLNEEKQILREIKQFEGTRDKVIAHAAERAKIQESL  818
            IQHESI   EEKQILREIKQ EGTR+KVIA+AA RAK+Q+S+
Sbjct  240  IQHESIPFAEEKQILREIKQLEGTREKVIANAAMRAKVQDSM  281



>gb|KHG29389.1| Uncharacterized protein F383_11608 [Gossypium arboreum]
Length=561

 Score =   199 bits (507),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 124/239 (52%), Positives = 175/239 (73%), Gaps = 11/239 (5%)
 Frame = +3

Query  123  MGVD-VESKLAHVSVETGSENGGS-LKENGTVP-----NEPIKFGSHGAEEPIKEDVKKA  281
            MGV+ V+S LA +S++  +E   S L ENG +      N PI+  SH +EEP KE+   A
Sbjct  1    MGVEIVDSDLAQLSIDKVTEVDKSFLHENGKLDKDPTYNNPIEVDSH-SEEPDKEEENGA  59

Query  282  PAINLPKDAVVEDWPAPQQIHSFYLVKYRTFEDqklkakleqaekelhkkNQARSVMIDN  461
               + PKD VV++WPAP+QIHSF+ ++YR +ED  +K KL+QA+KE+ K N+AR  + D 
Sbjct  60   FDPHFPKD-VVDEWPAPKQIHSFHFIRYRFYEDPAIKTKLDQADKEIQKWNKARFKLTDE  118

Query  462  LRAKRAARSELINERKSLSAERQQFRSQMDEKRKVMEPLQQALGKLRGNNAGGRDQRSVI  641
            L+AKRA RSE++++ ++L+ + +QF++ +DEK++ +EPLQQALGKLR N     D R  +
Sbjct  119  LKAKRAERSEMLSQVRALNVDFEQFKTILDEKKREIEPLQQALGKLRNNK--DVDNRLSL  176

Query  642  FSSEAELNDYIKSLQYRIQHESITLNEEKQILREIKQFEGTRDKVIAHAAERAKIQESL  818
             +SE EL+  I SLQYRIQHESI+L+EEK+IL+EIK  EGTR+KVIA+AA R+KIQ+SL
Sbjct  177  CASEEELDFIIHSLQYRIQHESISLSEEKRILKEIKHLEGTREKVIANAAMRSKIQDSL  235



>ref|XP_010062861.1| PREDICTED: LOW QUALITY PROTEIN: proton pump-interactor 1 [Eucalyptus 
grandis]
Length=449

 Score =   197 bits (501),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 119/235 (51%), Positives = 164/235 (70%), Gaps = 8/235 (3%)
 Frame = +3

Query  114  IEIMGVDVESKLAHVSVETGSENGGSLKENGTVPNEPIKFGSHGAEEPIKEDVKKAPAIN  293
            IEI G +    +A   +ET  E      + GT   E + FGSH  E+PI  +  +   +N
Sbjct  3    IEIAGFE----MAPAPMETPYEKDNGQFDKGTKLGEAVTFGSH-EEKPILGEGNQVSEVN  57

Query  294  LPKDAVVEDWPAPQQIHSFYLVKYRTFEDqklkakleqaekelhkkNQARSVMIDNLRAK  473
             PKDAV ++WPAP++IH+FY++K+R++ED  +K K+EQA+KE+ ++NQA+  + D LR K
Sbjct  58   FPKDAV-DEWPAPKRIHTFYIMKFRSYEDPSIKVKIEQADKEIQRRNQAKFQITDALREK  116

Query  474  RAARSELINERKSLSAERQQFRSQMDEKRKVMEPLQQALGKLRGNNAGGRDQRSVIFSSE  653
            R+ RS+LI + ++L  E + F S +DEK+K MEPL +ALGKLR  N GGR   S + SSE
Sbjct  117  RSERSDLIAQLRALGEENRTFHSILDEKKKDMEPLHEALGKLRHANTGGRG--SGLCSSE  174

Query  654  AELNDYIKSLQYRIQHESITLNEEKQILREIKQFEGTRDKVIAHAAERAKIQESL  818
             ELN  I+SL Y IQHESI L EEKQILREIKQ EGTR+KVIA+AA +A++Q+S+
Sbjct  175  EELNQLIQSLNYHIQHESIPLTEEKQILREIKQLEGTREKVIANAAMKAEVQKSV  229



>gb|KHN40945.1| hypothetical protein glysoja_038513 [Glycine soja]
Length=724

 Score =   201 bits (512),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 123/222 (55%), Positives = 159/222 (72%), Gaps = 10/222 (5%)
 Frame = +3

Query  159  SVETGSENGGSLKENGTVPNEPIKFGSHGAEEPIKEDVKKAPAINLPKDAVVEDWPAPQQ  338
            S+   +ENG   ++ G    EP KFGSHG +E  K +       N+PKDAV +DWPAP+Q
Sbjct  128  SISEKTENGKLEQDTGVA--EPTKFGSHG-DESAKPEANVVSDANVPKDAV-DDWPAPRQ  183

Query  339  IHSFYLVKYRTFEDqklkakleqaekelhkkNQARSVMIDNLRAKRAARSELINERKSLS  518
            IHSFY V++R ++D  +KAKL++ +KE+ ++NQAR  + D LRAKR  R+  I++ KSL 
Sbjct  184  IHSFYFVRFRPYDDPNIKAKLDKYDKEISQENQARIQVTDALRAKRTERAGCISQIKSLK  243

Query  519  AERQQFRSQMDEKRKVMEPLQQALGKLR-GNNAGGRDQRSV-IFSSEAELNDYIKSLQYR  692
             + +QF+S +DEK K +EPLQQALGKLR  NNAG    R V + SSE ELN+ I SL YR
Sbjct  244  GDNRQFQSIVDEKIKEIEPLQQALGKLRTANNAG----RGVGLCSSEEELNNLINSLHYR  299

Query  693  IQHESITLNEEKQILREIKQFEGTRDKVIAHAAERAKIQESL  818
            IQHESI   EEKQILREIKQ EGTR+KVIA+AA RAK+Q+S+
Sbjct  300  IQHESIPFAEEKQILREIKQLEGTREKVIANAAMRAKVQDSM  341



>gb|KHG29388.1| Uncharacterized protein F383_11608 [Gossypium arboreum]
Length=627

 Score =   200 bits (508),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 124/239 (52%), Positives = 175/239 (73%), Gaps = 11/239 (5%)
 Frame = +3

Query  123  MGVD-VESKLAHVSVETGSENGGS-LKENGTVP-----NEPIKFGSHGAEEPIKEDVKKA  281
            MGV+ V+S LA +S++  +E   S L ENG +      N PI+  SH +EEP KE+   A
Sbjct  1    MGVEIVDSDLAQLSIDKVTEVDKSFLHENGKLDKDPTYNNPIEVDSH-SEEPDKEEENGA  59

Query  282  PAINLPKDAVVEDWPAPQQIHSFYLVKYRTFEDqklkakleqaekelhkkNQARSVMIDN  461
               + PKD VV++WPAP+QIHSF+ ++YR +ED  +K KL+QA+KE+ K N+AR  + D 
Sbjct  60   FDPHFPKD-VVDEWPAPKQIHSFHFIRYRFYEDPAIKTKLDQADKEIQKWNKARFKLTDE  118

Query  462  LRAKRAARSELINERKSLSAERQQFRSQMDEKRKVMEPLQQALGKLRGNNAGGRDQRSVI  641
            L+AKRA RSE++++ ++L+ + +QF++ +DEK++ +EPLQQALGKLR N     D R  +
Sbjct  119  LKAKRAERSEMLSQVRALNVDFEQFKTILDEKKREIEPLQQALGKLRNNK--DVDNRLSL  176

Query  642  FSSEAELNDYIKSLQYRIQHESITLNEEKQILREIKQFEGTRDKVIAHAAERAKIQESL  818
             +SE EL+  I SLQYRIQHESI+L+EEK+IL+EIK  EGTR+KVIA+AA R+KIQ+SL
Sbjct  177  CASEEELDFIIHSLQYRIQHESISLSEEKRILKEIKHLEGTREKVIANAAMRSKIQDSL  235



>ref|XP_010539250.1| PREDICTED: proton pump-interactor 1-like [Tarenaya hassleriana]
Length=620

 Score =   199 bits (507),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 130/237 (55%), Positives = 167/237 (70%), Gaps = 11/237 (5%)
 Frame = +3

Query  123  MGVDVES----KLAHVSVETGSENGGSLKENGTVPNEPIKFGSHGAEEPIK-EDVKKAPA  287
            MGV+V      ++A    E  +E  G L  +G      IKFGSH  +EP K E+      
Sbjct  1    MGVEVGKSDGFEVASSPFEGKAEQNGKLV-HGKGEKVSIKFGSH--DEPSKGEENNNVFG  57

Query  288  INLPKDAVVEDWPAPQQIHSFYLVKYRTFEDqklkakleqaekelhkkNQARSVMIDNLR  467
             + PKD ++E+WPA +Q+HSF+ V+YR FED K+KAKL+QA+KEL K N+AR+ +++ L+
Sbjct  58   SDTPKD-IIEEWPAAKQVHSFFFVRYRPFEDPKIKAKLDQADKELQKLNRARAGVVEELK  116

Query  468  AKRAARSELINERKSLSAERQQFRSQMDEKRKVMEPLQQALGKLRGNNAGGRDQRSVIFS  647
            AKRA RSEL +  + L  ER+ F +  DEKRK MEPLQQALGKLR N+ GGR     + S
Sbjct  117  AKRAERSELFDILEPLKNERKGFNTIFDEKRKEMEPLQQALGKLRSNDGGGRG--IALCS  174

Query  648  SEAELNDYIKSLQYRIQHESITLNEEKQILREIKQFEGTRDKVIAHAAERAKIQESL  818
            SE ELND I SLQY IQHESI+LNEEKQIL+EIKQ EGTR+KVIA+AA RAKI+E++
Sbjct  175  SEEELNDTIYSLQYHIQHESISLNEEKQILKEIKQLEGTREKVIANAAMRAKIKEAM  231



>emb|CDX89242.1| BnaA01g16510D [Brassica napus]
Length=429

 Score =   195 bits (496),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 128/233 (55%), Positives = 158/233 (68%), Gaps = 5/233 (2%)
 Frame = +3

Query  123  MGVDVESKLAHVSVETGSENGGSLKENGTVPNEPIKFGSHGAEEPIKEDVKKAPAI-NLP  299
            MGV+V        V    E+     + G      IKFGS G  EP K+ ++    I ++P
Sbjct  1    MGVEVLHSGGFEVVPAPFEDTNGKMDQGKGDKVSIKFGSLG--EPPKKSLENNVLISDVP  58

Query  300  KDAVVEDWPAPQQIHSFYLVKYRTFEDqklkakleqaekelhkkNQARSVMIDNLRAKRA  479
            KDA  E+WPA +QIHSFY VK+R F+D K+KAKL+ AEKEL K N+AR+ + D L+AKRA
Sbjct  59   KDAA-EEWPAEKQIHSFYFVKHRHFDDPKIKAKLDLAEKELEKFNKARAAVFDQLKAKRA  117

Query  480  ARSELINERKSLSAERQQFRSQMDEKRKVMEPLQQALGKLRGNNAGGRDQRSVIFSSEAE  659
             RSEL +    L  ERQ F ++ DEKRK MEPLQQALGKLRGN+ GG  +   I SSE E
Sbjct  118  ERSELFDLLDPLKTERQGFNAKFDEKRKEMEPLQQALGKLRGND-GGSGRGPAICSSEEE  176

Query  660  LNDYIKSLQYRIQHESITLNEEKQILREIKQFEGTRDKVIAHAAERAKIQESL  818
            LN+ I S QYRIQHESI L EEKQ+L+EI+  EGTRDKVIA+ A RAKI+ES+
Sbjct  177  LNNMIYSYQYRIQHESIPLTEEKQLLKEIRMLEGTRDKVIANEAVRAKIKESM  229



>dbj|BAH19433.1| AT4G27500 [Arabidopsis thaliana]
Length=510

 Score =   195 bits (495),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 130/238 (55%), Positives = 162/238 (68%), Gaps = 10/238 (4%)
 Frame = +3

Query  123  MGVDVES----KLAHVSVETGSENGGSLKENGTVPNEPIKFGSHGAEEP--IKEDVKKAP  284
            MGV+V +    ++A    E   E  G L + G   + PI FGS G E P   +E+  K  
Sbjct  1    MGVEVVNSGGFEVAPAPFEGKPEKNGKL-DQGKGDDAPINFGSVG-ELPKNAEENNNKVV  58

Query  285  AINLPKDAVVEDWPAPQQIHSFYLVKYRTFEDqklkakleqaekelhkkNQARSVMIDNL  464
              + PK+A  E+WP  +QIHSFYLVKYR++ D K+KAKL+ A+KEL K N+AR+ ++D L
Sbjct  59   NSDAPKNAA-EEWPVAKQIHSFYLVKYRSYADPKIKAKLDLADKELEKLNKARTGVLDKL  117

Query  465  RAKRAARSELINERKSLSAERQQFRSQMDEKRKVMEPLQQALGKLRGNNAGGRDQRSVIF  644
            RAKRA RSEL +    L +ER+ F +  DEKRK MEPLQQALGKLR N+ GG  +   I 
Sbjct  118  RAKRAERSELFDLLDPLKSERKGFNTMFDEKRKEMEPLQQALGKLRSND-GGSARGPAIC  176

Query  645  SSEAELNDYIKSLQYRIQHESITLNEEKQILREIKQFEGTRDKVIAHAAERAKIQESL  818
            SSE ELN  I S QYRIQHESI L EEKQIL+EI+  EGTRDKVIA+AA RAKI+ES+
Sbjct  177  SSEEELNSMIYSYQYRIQHESIPLTEEKQILKEIRLLEGTRDKVIANAAMRAKIKESM  234



>ref|XP_002869559.1| hypothetical protein ARALYDRAFT_328945 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45818.1| hypothetical protein ARALYDRAFT_328945 [Arabidopsis lyrata subsp. 
lyrata]
Length=617

 Score =   197 bits (500),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 127/215 (59%), Positives = 154/215 (72%), Gaps = 8/215 (4%)
 Frame = +3

Query  186  GSLKENGTVPNE-PIKFGSHGAEEPIK---EDVKKAPAINLPKDAVVEDWPAPQQIHSFY  353
            G  ++NG   +E  IKFGSHG  EP K   E++ K    + PK+A  E+WPA +QI SFY
Sbjct  20   GKPEKNGGKGDEVSIKFGSHG--EPPKKAEENINKVLNSDAPKNAA-EEWPAAKQIRSFY  76

Query  354  LVKYRTFEDqklkakleqaekelhkkNQARSVMIDNLRAKRAARSELINERKSLSAERQQ  533
             VKYR++ D K+KAKLE A+KEL K N+ARS ++D LRAKRA RSEL +    L +ER+ 
Sbjct  77   FVKYRSYTDPKMKAKLELADKELEKLNKARSGVLDKLRAKRAERSELFDLLDPLKSERKG  136

Query  534  FRSQMDEKRKVMEPLQQALGKLRGNNAGGRDQRSVIFSSEAELNDYIKSLQYRIQHESIT  713
            F +  DEKRK MEPLQQALGKLR N+ GG  +   I SSE ELN  I S QYRIQHESI 
Sbjct  137  FNTMFDEKRKEMEPLQQALGKLRSND-GGSARGPAICSSEEELNSMIYSYQYRIQHESIP  195

Query  714  LNEEKQILREIKQFEGTRDKVIAHAAERAKIQESL  818
            L EEKQIL+EI+  EGTRDKVIA+AA RAKI+ES+
Sbjct  196  LTEEKQILKEIRLLEGTRDKVIANAAMRAKIKESM  230



>ref|XP_010438598.1| PREDICTED: proton pump-interactor 1-like isoform X1 [Camelina 
sativa]
 ref|XP_010438599.1| PREDICTED: proton pump-interactor 1-like isoform X1 [Camelina 
sativa]
 ref|XP_010438600.1| PREDICTED: proton pump-interactor 1-like isoform X2 [Camelina 
sativa]
Length=622

 Score =   196 bits (499),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 120/200 (60%), Positives = 146/200 (73%), Gaps = 5/200 (3%)
 Frame = +3

Query  225  IKFGSHGAEEPIKEDVKKAPAIN--LPKDAVVEDWPAPQQIHSFYLVKYRTFEDqklkak  398
            IKFGSHG E P K +      +N  +PKDA  E+WP  +QIHSFY +KYR FED K+KAK
Sbjct  37   IKFGSHG-EPPKKAEETNNKVLNADVPKDAA-EEWPVARQIHSFYFIKYRPFEDPKMKAK  94

Query  399  leqaekelhkkNQARSVMIDNLRAKRAARSELINERKSLSAERQQFRSQMDEKRKVMEPL  578
            L+ AEKEL K N+AR  ++++LRAKR  RS+L +    L +ER+ F +  DEKRK MEPL
Sbjct  95   LDAAEKELKKLNEARGAVLNDLRAKRTERSKLFDLLDPLKSERKGFNTMFDEKRKEMEPL  154

Query  579  QQALGKLRGNNAGGRDQRSVIFSSEAELNDYIKSLQYRIQHESITLNEEKQILREIKQFE  758
            QQALGKLR NN GG  +   I SSE ELN+ I S QYRIQHESI L EEKQ+L+EI+  E
Sbjct  155  QQALGKLR-NNDGGSARGPAICSSEEELNNMIYSYQYRIQHESIPLTEEKQLLKEIRLLE  213

Query  759  GTRDKVIAHAAERAKIQESL  818
            GTRDKVIA+AA RAKI+ES+
Sbjct  214  GTRDKVIANAAMRAKIKESM  233



>ref|XP_010916059.1| PREDICTED: proton pump-interactor 1-like [Elaeis guineensis]
Length=632

 Score =   196 bits (498),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 125/245 (51%), Positives = 168/245 (69%), Gaps = 14/245 (6%)
 Frame = +3

Query  114  IEIMGVDVESKLAHVSVETGSENGGSLKENGTVPN------EPIKFG----SHGAEEPIK  263
            +E++G DV S    V    G++   +  ++ T  N      EPIK G    SHG +E  K
Sbjct  3    VEVVGADVTS--GQVKGIEGNDTFLAEMDSKTETNLGQEAGEPIKSGLGDNSHGTKEETK  60

Query  264  EDVKKAPAINLPKDAVVEDWPAPQQIHSFYLVKYRTFEDqklkakleqaekelhkkNQAR  443
            E        N PKDAV ++WPAPQQ H+FY VK+R++ED KLKAK+EQ +K++ KKNQ R
Sbjct  61   E-ADHVTNANFPKDAV-DEWPAPQQFHTFYFVKFRSYEDPKLKAKIEQTDKDIQKKNQTR  118

Query  444  SVMIDNLRAKRAARSELINERKSLSAERQQFRSQMDEKRKVMEPLQQALGKLRGNNAGGR  623
              + + L+AKR+ R+ +I++ K L+ E +Q+R+ MDEKRK ++PLQ ALGKL   N   R
Sbjct  119  FQITEALKAKRSERANVISQLKPLTTEDKQYRAVMDEKRKEIKPLQTALGKLNSANNVVR  178

Query  624  DQRSVIFSSEAELNDYIKSLQYRIQHESITLNEEKQILREIKQFEGTRDKVIAHAAERAK  803
            ++   + SSE ELND IKSLQYRI HESI+L+EEKQ++REIKQ EGTR KVIA+AA RAK
Sbjct  179  EKGLGLCSSEEELNDLIKSLQYRISHESISLDEEKQLMREIKQLEGTRGKVIANAAMRAK  238

Query  804  IQESL  818
            IQ++L
Sbjct  239  IQDTL  243



>gb|KDO62511.1| hypothetical protein CISIN_1g009998mg [Citrus sinensis]
Length=518

 Score =   194 bits (492),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 119/236 (50%), Positives = 162/236 (69%), Gaps = 17/236 (7%)
 Frame = +3

Query  141  SKLAHVSVETGSENGGSL-KENGTVPNEPIK-----FGSHGA-EEPIKEDVKKAPAINLP  299
            +++A   VE+ +E   SL +ENG +   P+K     FGSHG   E +          NLP
Sbjct  3    AEMAQSPVESVAEVHNSLAQENGKLDKGPVKDESIIFGSHGGVGELVNGKESNVSNANLP  62

Query  300  KDAVVEDWPAPQQIHSFYLVKYRTFEDqklkakleqaekelhkkNQARSVMIDNLRAKRA  479
            KD V E+WP P+ IH+FY +++R ++D K++AK++  ++E+ ++NQAR  ++D LRAKR 
Sbjct  63   KD-VGEEWPEPRVIHNFYFIRHRQYDDPKIRAKIDLTDREIQRRNQARMQLMDELRAKRG  121

Query  480  ARSELINERKSLSAERQQFRSQMDEKRKVMEPLQQALGKLRGNN---AGGRDQRSVIFSS  650
             R +L  + +SL  E +Q++S MD+KRK MEPL QALGKLR  N   +GG      I SS
Sbjct  122  VRGDLAAQLRSLKTEGRQYKSVMDDKRKEMEPLHQALGKLRTTNNARSGG------ICSS  175

Query  651  EAELNDYIKSLQYRIQHESITLNEEKQILREIKQFEGTRDKVIAHAAERAKIQESL  818
            E EL+D I+SLQYRIQHE I L+EEKQILREIKQ EGTR+KV+A+AA RAKIQES+
Sbjct  176  EEELDDLIRSLQYRIQHEIIPLSEEKQILREIKQLEGTREKVMANAAMRAKIQESM  231



>ref|XP_006451833.1| hypothetical protein CICLE_v10008004mg [Citrus clementina]
 ref|XP_006451834.1| hypothetical protein CICLE_v10008004mg [Citrus clementina]
 gb|ESR65073.1| hypothetical protein CICLE_v10008004mg [Citrus clementina]
 gb|ESR65074.1| hypothetical protein CICLE_v10008004mg [Citrus clementina]
Length=520

 Score =   194 bits (492),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 119/236 (50%), Positives = 162/236 (69%), Gaps = 17/236 (7%)
 Frame = +3

Query  141  SKLAHVSVETGSENGGSL-KENGTVPNEPIK-----FGSHGAE-EPIKEDVKKAPAINLP  299
            +++A   VE+ +E   SL +ENG +   P+K     FGSHG   E +          NLP
Sbjct  3    AEMAQSPVESVAEVHNSLAQENGKLDKGPVKDESIIFGSHGGGGELVNGKESNVSNANLP  62

Query  300  KDAVVEDWPAPQQIHSFYLVKYRTFEDqklkakleqaekelhkkNQARSVMIDNLRAKRA  479
            KD V E+WP P+ IH+FY +++R ++D K++AK++  ++E+ ++NQAR  ++D LRAKR 
Sbjct  63   KD-VGEEWPEPRVIHNFYFIRHRQYDDPKIRAKIDLTDREIQRRNQARMQLMDELRAKRG  121

Query  480  ARSELINERKSLSAERQQFRSQMDEKRKVMEPLQQALGKLRGNN---AGGRDQRSVIFSS  650
             R +L  + +SL  E +Q++S MD+KRK MEPL QALGKLR  N   +GG      I SS
Sbjct  122  VRGDLAAQLRSLKTEGRQYKSVMDDKRKEMEPLHQALGKLRTTNNARSGG------ICSS  175

Query  651  EAELNDYIKSLQYRIQHESITLNEEKQILREIKQFEGTRDKVIAHAAERAKIQESL  818
            E EL+D I+SLQYRIQHE I L+EEKQILREIKQ EGTR+KV+A+AA RAKIQES+
Sbjct  176  EEELDDLIRSLQYRIQHEIIPLSEEKQILREIKQLEGTREKVMANAAMRAKIQESM  231



>gb|KDO62508.1| hypothetical protein CISIN_1g009998mg [Citrus sinensis]
 gb|KDO62509.1| hypothetical protein CISIN_1g009998mg [Citrus sinensis]
 gb|KDO62510.1| hypothetical protein CISIN_1g009998mg [Citrus sinensis]
Length=520

 Score =   194 bits (492),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 119/236 (50%), Positives = 162/236 (69%), Gaps = 17/236 (7%)
 Frame = +3

Query  141  SKLAHVSVETGSENGGSL-KENGTVPNEPIK-----FGSHGA-EEPIKEDVKKAPAINLP  299
            +++A   VE+ +E   SL +ENG +   P+K     FGSHG   E +          NLP
Sbjct  3    AEMAQSPVESVAEVHNSLAQENGKLDKGPVKDESIIFGSHGGVGELVNGKESNVSNANLP  62

Query  300  KDAVVEDWPAPQQIHSFYLVKYRTFEDqklkakleqaekelhkkNQARSVMIDNLRAKRA  479
            KD V E+WP P+ IH+FY +++R ++D K++AK++  ++E+ ++NQAR  ++D LRAKR 
Sbjct  63   KD-VGEEWPEPRVIHNFYFIRHRQYDDPKIRAKIDLTDREIQRRNQARMQLMDELRAKRG  121

Query  480  ARSELINERKSLSAERQQFRSQMDEKRKVMEPLQQALGKLRGNN---AGGRDQRSVIFSS  650
             R +L  + +SL  E +Q++S MD+KRK MEPL QALGKLR  N   +GG      I SS
Sbjct  122  VRGDLAAQLRSLKTEGRQYKSVMDDKRKEMEPLHQALGKLRTTNNARSGG------ICSS  175

Query  651  EAELNDYIKSLQYRIQHESITLNEEKQILREIKQFEGTRDKVIAHAAERAKIQESL  818
            E EL+D I+SLQYRIQHE I L+EEKQILREIKQ EGTR+KV+A+AA RAKIQES+
Sbjct  176  EEELDDLIRSLQYRIQHEIIPLSEEKQILREIKQLEGTREKVMANAAMRAKIQESM  231



>ref|NP_194480.2| proton pump interactor 1 [Arabidopsis thaliana]
 sp|O23144.2|PPI1_ARATH RecName: Full=Proton pump-interactor 1 [Arabidopsis thaliana]
 emb|CAA05145.2| proton pump interactor [Arabidopsis thaliana]
 gb|AAK91382.1| AT4g27500/F27G19_100 [Arabidopsis thaliana]
 gb|AAN28853.1| At4g27500/F27G19_100 [Arabidopsis thaliana]
 gb|AEE85350.1| proton pump interactor 1 [Arabidopsis thaliana]
Length=612

 Score =   195 bits (495),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 130/238 (55%), Positives = 162/238 (68%), Gaps = 10/238 (4%)
 Frame = +3

Query  123  MGVDVES----KLAHVSVETGSENGGSLKENGTVPNEPIKFGSHGAEEP--IKEDVKKAP  284
            MGV+V +    ++A    E   E  G L + G   + PI FGS G E P   +E+  K  
Sbjct  1    MGVEVVNSGGFEVAPAPFEGKPEKNGKL-DQGKGDDAPINFGSVG-ELPKNAEENNNKVV  58

Query  285  AINLPKDAVVEDWPAPQQIHSFYLVKYRTFEDqklkakleqaekelhkkNQARSVMIDNL  464
              + PK+A  E+WP  +QIHSFYLVKYR++ D K+KAKL+ A+KEL K N+AR+ ++D L
Sbjct  59   NSDAPKNAA-EEWPVAKQIHSFYLVKYRSYADPKIKAKLDLADKELEKLNKARTGVLDKL  117

Query  465  RAKRAARSELINERKSLSAERQQFRSQMDEKRKVMEPLQQALGKLRGNNAGGRDQRSVIF  644
            RAKRA RSEL +    L +ER+ F +  DEKRK MEPLQQALGKLR N+ GG  +   I 
Sbjct  118  RAKRAERSELFDLLDPLKSERKGFNTMFDEKRKEMEPLQQALGKLRSND-GGSARGPAIC  176

Query  645  SSEAELNDYIKSLQYRIQHESITLNEEKQILREIKQFEGTRDKVIAHAAERAKIQESL  818
            SSE ELN  I S QYRIQHESI L EEKQIL+EI+  EGTRDKVIA+AA RAKI+ES+
Sbjct  177  SSEEELNSMIYSYQYRIQHESIPLTEEKQILKEIRLLEGTRDKVIANAAMRAKIKESM  234



>gb|KDO62507.1| hypothetical protein CISIN_1g009998mg [Citrus sinensis]
Length=520

 Score =   193 bits (490),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 119/236 (50%), Positives = 162/236 (69%), Gaps = 17/236 (7%)
 Frame = +3

Query  141  SKLAHVSVETGSENGGSL-KENGTVPNEPIK-----FGSHGA-EEPIKEDVKKAPAINLP  299
            +++A   VE+ +E   SL +ENG +   P+K     FGSHG   E +          NLP
Sbjct  3    AEMAQSPVESVAEVHNSLAQENGKLDKGPVKDESIIFGSHGGVGELVNGKESNVSNANLP  62

Query  300  KDAVVEDWPAPQQIHSFYLVKYRTFEDqklkakleqaekelhkkNQARSVMIDNLRAKRA  479
            KD V E+WP P+ IH+FY +++R ++D K++AK++  ++E+ ++NQAR  ++D LRAKR 
Sbjct  63   KD-VGEEWPEPRVIHNFYFIRHRQYDDPKIRAKIDLTDREIQRRNQARMQLMDELRAKRV  121

Query  480  ARSELINERKSLSAERQQFRSQMDEKRKVMEPLQQALGKLRGNN---AGGRDQRSVIFSS  650
             R +L  + +SL  E +Q++S MD+KRK MEPL QALGKLR  N   +GG      I SS
Sbjct  122  IRGDLAAQLRSLKTEGRQYKSVMDDKRKEMEPLHQALGKLRTTNNARSGG------ICSS  175

Query  651  EAELNDYIKSLQYRIQHESITLNEEKQILREIKQFEGTRDKVIAHAAERAKIQESL  818
            E EL+D I+SLQYRIQHE I L+EEKQILREIKQ EGTR+KV+A+AA RAKIQES+
Sbjct  176  EEELDDLIRSLQYRIQHEIIPLSEEKQILREIKQLEGTREKVMANAAMRAKIQESM  231



>ref|XP_006464761.1| PREDICTED: proton pump-interactor 1-like isoform X1 [Citrus sinensis]
 ref|XP_006464762.1| PREDICTED: proton pump-interactor 1-like isoform X2 [Citrus sinensis]
 ref|XP_006464763.1| PREDICTED: proton pump-interactor 1-like isoform X3 [Citrus sinensis]
Length=607

 Score =   194 bits (494),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 119/236 (50%), Positives = 162/236 (69%), Gaps = 17/236 (7%)
 Frame = +3

Query  141  SKLAHVSVETGSENGGSL-KENGTVPNEPIK-----FGSHGA-EEPIKEDVKKAPAINLP  299
            +++A   VE+ +E   SL +ENG +   P+K     FGSHG   E +          NLP
Sbjct  3    AEMAQAPVESVAEVHNSLAQENGKLDKGPVKDESIIFGSHGGVGELVNGKESNVSNANLP  62

Query  300  KDAVVEDWPAPQQIHSFYLVKYRTFEDqklkakleqaekelhkkNQARSVMIDNLRAKRA  479
            KD V E+WP P+ IH+FY +++R ++D K++AK++  ++E+ ++NQAR  ++D LRAKR 
Sbjct  63   KD-VGEEWPEPRVIHNFYFIRHRQYDDPKIRAKIDLTDREIQRRNQARMQLMDELRAKRG  121

Query  480  ARSELINERKSLSAERQQFRSQMDEKRKVMEPLQQALGKLRGNN---AGGRDQRSVIFSS  650
             R +L  + +SL  E +Q++S MD+KRK MEPL QALGKLR  N   +GG      I SS
Sbjct  122  VRGDLAAQLRSLKTEGRQYKSVMDDKRKEMEPLHQALGKLRTTNNARSGG------ICSS  175

Query  651  EAELNDYIKSLQYRIQHESITLNEEKQILREIKQFEGTRDKVIAHAAERAKIQESL  818
            E EL+D I+SLQYRIQHE I L+EEKQILREIKQ EGTR+KV+A+AA RAKIQES+
Sbjct  176  EEELDDLIRSLQYRIQHEIIPLSEEKQILREIKQLEGTREKVMANAAMRAKIQESM  231



>ref|XP_010448122.1| PREDICTED: proton pump-interactor 1-like [Camelina sativa]
 ref|XP_010448123.1| PREDICTED: proton pump-interactor 1-like [Camelina sativa]
Length=612

 Score =   194 bits (494),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 116/200 (58%), Positives = 145/200 (73%), Gaps = 4/200 (2%)
 Frame = +3

Query  225  IKFGSHGAEEPIKEDVKKAPAIN--LPKDAVVEDWPAPQQIHSFYLVKYRTFEDqklkak  398
            IKFGSHG      E+      +N  +PKDA  E+WPA +QIHSFY +KY +F+D K+KAK
Sbjct  32   IKFGSHGEPPKKAEETNNNKVLNADVPKDAA-EEWPAARQIHSFYFIKYHSFKDPKMKAK  90

Query  399  leqaekelhkkNQARSVMIDNLRAKRAARSELINERKSLSAERQQFRSQMDEKRKVMEPL  578
            L+ A+K+L K N+AR V++++LRAKR  RS+L +    L +ER+ F S  DEKRK MEPL
Sbjct  91   LDAADKDLEKWNKARGVVLNDLRAKRTERSKLFDLLDPLKSERKGFNSMFDEKRKEMEPL  150

Query  579  QQALGKLRGNNAGGRDQRSVIFSSEAELNDYIKSLQYRIQHESITLNEEKQILREIKQFE  758
            QQALGKL+ NN GG  +   I SSE ELN  I S QYRIQHESI L EEKQ+L+EI+  E
Sbjct  151  QQALGKLK-NNDGGSARGPAICSSEEELNTMIYSYQYRIQHESIPLTEEKQLLKEIRLLE  209

Query  759  GTRDKVIAHAAERAKIQESL  818
            GTRDKVIA+AA RAKI+ES+
Sbjct  210  GTRDKVIANAAMRAKIKESM  229



>gb|KGN55124.1| hypothetical protein Csa_4G637150 [Cucumis sativus]
Length=639

 Score =   194 bits (494),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 119/238 (50%), Positives = 167/238 (70%), Gaps = 10/238 (4%)
 Frame = +3

Query  123  MGVDVES-KLAHVSVETGSENGGSLKENGTVPNEP-----IKFGSHGAEEPIKEDVKKAP  284
            MGV+V   ++ +  +++   +    KENG +   P     IKFGSH  +EP+KE    + 
Sbjct  1    MGVEVVGFEMVNGPMDSADNSVLKSKENGDLDQLPEKNATIKFGSH-EDEPVKEQADGSS  59

Query  285  AINLPKDAVVEDWPAPQQIHSFYLVKYRTFEDqklkakleqaekelhkkNQARSVMIDNL  464
              N+PKDA  ++WPAP+QIH+FY V++R ++D  +KAK++ A+KE+ K++QAR  + + L
Sbjct  60   TTNVPKDAA-DEWPAPKQIHTFYFVRHRAYDDPNVKAKIDLADKEIQKRSQARFQITEAL  118

Query  465  RAKRAARSELINERKSLSAERQQFRSQMDEKRKVMEPLQQALGKLRGNNAGGRDQRSVIF  644
            + KR  R+ELI + K+L  + +QF+S +DEK K +EPL QALGKLR  N  GR+    + 
Sbjct  119  KGKRGERAELITQMKALRDDNRQFKSIVDEKIKEIEPLNQALGKLRNANNAGRN--GGLC  176

Query  645  SSEAELNDYIKSLQYRIQHESITLNEEKQILREIKQFEGTRDKVIAHAAERAKIQESL  818
            SSE ELN  I+SLQY IQHESI L+EEKQILREIKQ EGTR+KVIA+AA RAK+Q+S+
Sbjct  177  SSEEELNAVIQSLQYHIQHESIPLSEEKQILREIKQLEGTREKVIANAAMRAKLQDSM  234



>ref|XP_004487714.1| PREDICTED: proton pump-interactor 1-like [Cicer arietinum]
Length=615

 Score =   194 bits (493),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 124/244 (51%), Positives = 163/244 (67%), Gaps = 19/244 (8%)
 Frame = +3

Query  114  IEIMGVDVESKLAHVSVETGSENGGSL---KENGTV-----PNEPIKFGSHGAEEPIKED  269
            +EI+G +    +    +E G E G  +   KENG +       E IKFGSHG +E  K +
Sbjct  3    VEIVGFE----MVQGPLENGVEGGKPVALEKENGKLEQDSGAGETIKFGSHG-DESAKGE  57

Query  270  VKKAPAINLPKDAVVEDWPAPQQIHSFYLVKYRTFEDqklkakleqaekelhkkNQARSV  449
                   N P +A  E+WPAP+QIHSFY V+ R ++D  +K K++  +KE+ KKNQAR  
Sbjct  58   ANDVSDSNSPTNAA-EEWPAPKQIHSFYFVRCRPYDDPSIKTKIDLLDKEISKKNQARFQ  116

Query  450  MIDNLRAKRAARSELINERKSLSAERQQFRSQMDEKRKVMEPLQQALGKLR-GNNAGGRD  626
            + + L+AKR+ R+ELI++ K L  + +QF+S  DEK K +EPLQQALGKLR  NNAG   
Sbjct  117  ITEALKAKRSERAELISQIKILRGDSKQFQSIFDEKMKEIEPLQQALGKLRNANNAG---  173

Query  627  QRSVIFSSEAELNDYIKSLQYRIQHESITLNEEKQILREIKQFEGTRDKVIAHAAERAKI  806
             R  + SSE ELND I SLQYRIQHESI L EEKQ+LREIKQ EGTR+KVIA+AA R K+
Sbjct  174  -RGGLCSSEEELNDVIYSLQYRIQHESIPLTEEKQLLREIKQLEGTREKVIANAAMRTKL  232

Query  807  QESL  818
            Q+++
Sbjct  233  QDTI  236



>ref|XP_004141360.1| PREDICTED: proton pump-interactor 1-like [Cucumis sativus]
 ref|XP_004160615.1| PREDICTED: proton pump-interactor 1-like [Cucumis sativus]
Length=639

 Score =   194 bits (494),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 119/238 (50%), Positives = 167/238 (70%), Gaps = 10/238 (4%)
 Frame = +3

Query  123  MGVDVES-KLAHVSVETGSENGGSLKENGTVPNEP-----IKFGSHGAEEPIKEDVKKAP  284
            MGV+V   ++ +  +++   +    KENG +   P     IKFGSH  +EP+KE    + 
Sbjct  1    MGVEVVGFEMVNGPMDSADNSVLKSKENGDLDQLPEKNATIKFGSH-EDEPVKEQADGSS  59

Query  285  AINLPKDAVVEDWPAPQQIHSFYLVKYRTFEDqklkakleqaekelhkkNQARSVMIDNL  464
              N+PKDA  ++WPAP+QIH+FY V++R ++D  +KAK++ A+KE+ K++QAR  + + L
Sbjct  60   TTNVPKDAA-DEWPAPKQIHTFYFVRHRAYDDPNVKAKIDLADKEIQKRSQARFQITEAL  118

Query  465  RAKRAARSELINERKSLSAERQQFRSQMDEKRKVMEPLQQALGKLRGNNAGGRDQRSVIF  644
            + KR  R+ELI + K+L  + +QF+S +DEK K +EPL QALGKLR  N  GR+    + 
Sbjct  119  KGKRGERAELITQMKALRDDNRQFKSIVDEKIKEIEPLNQALGKLRNANNAGRN--GGLC  176

Query  645  SSEAELNDYIKSLQYRIQHESITLNEEKQILREIKQFEGTRDKVIAHAAERAKIQESL  818
            SSE ELN  I+SLQY IQHESI L+EEKQILREIKQ EGTR+KVIA+AA RAK+Q+S+
Sbjct  177  SSEEELNAVIQSLQYHIQHESIPLSEEKQILREIKQLEGTREKVIANAAMRAKLQDSM  234



>ref|XP_008452453.1| PREDICTED: proton pump-interactor 1 isoform X1 [Cucumis melo]
 ref|XP_008452454.1| PREDICTED: proton pump-interactor 1 isoform X2 [Cucumis melo]
Length=630

 Score =   193 bits (491),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 115/213 (54%), Positives = 155/213 (73%), Gaps = 9/213 (4%)
 Frame = +3

Query  195  KENGTVPNEP-----IKFGSHGAEEPIKEDVKKAPAINLPKDAVVEDWPAPQQIHSFYLV  359
            KENG +   P     IKFGSH  +EP+KE V  +   N+PKDA  ++WPAP+QIH+FY V
Sbjct  26   KENGNLDQLPEKNATIKFGSH-EDEPVKEQVDGSSTTNVPKDAA-DEWPAPKQIHTFYFV  83

Query  360  KYRTFEDqklkakleqaekelhkkNQARSVMIDNLRAKRAARSELINERKSLSAERQQFR  539
            ++R ++D  +KAK++ A+KE+ K++QAR  + + L+ KR  R+ELI + K+L  + +QF+
Sbjct  84   RHRAYDDPNVKAKIDLADKEIQKRSQARFQITEALKGKRGERAELITQMKALRDDNRQFK  143

Query  540  SQMDEKRKVMEPLQQALGKLRGNNAGGRDQRSVIFSSEAELNDYIKSLQYRIQHESITLN  719
            S +DEK K +EPL QALGKLR  N  GR+    + SSE ELN  I+SLQY IQHESI L+
Sbjct  144  SIVDEKIKEIEPLNQALGKLRNANNAGRN--GGLCSSEEELNAVIQSLQYHIQHESIPLS  201

Query  720  EEKQILREIKQFEGTRDKVIAHAAERAKIQESL  818
            EEKQ LREIKQ EGTR+KVIA+AA RAK+Q+S+
Sbjct  202  EEKQNLREIKQLEGTREKVIANAAMRAKLQDSM  234



>ref|XP_008791753.1| PREDICTED: proton pump-interactor 1-like isoform X1 [Phoenix 
dactylifera]
 ref|XP_008791805.1| PREDICTED: proton pump-interactor 1-like isoform X1 [Phoenix 
dactylifera]
Length=658

 Score =   192 bits (488),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 128/264 (48%), Positives = 179/264 (68%), Gaps = 17/264 (6%)
 Frame = +3

Query  69   TRLKTTP*GSLYFAFIEIMGVDVE-SKLAHVSVETGSENGG---SLKENGTVPNE-----  221
            T  K  P GS+     EIMG++ + + +    V+ G +      +  ++ T PN+     
Sbjct  10   TAAKVLPFGSVSL-LTEIMGMEADGANITPSQVKEGIKGDNIFLAEMDSKTKPNQGQRLD  68

Query  222  -PIKF----GSHGAEEPIKEDVKKAPAINLPKDAVVEDWPAPQQIHSFYLVKYRTFEDqk  386
             P KF    GSHG     KE    A  +N PKDAV ++WPAP+QIH+FY VKYR++ED K
Sbjct  69   GPNKFESVNGSHGVNGESKEGGHLA-NVNFPKDAV-DEWPAPKQIHTFYFVKYRSYEDPK  126

Query  387  lkakleqaekelhkkNQARSVMIDNLRAKRAARSELINERKSLSAERQQFRSQMDEKRKV  566
            LKA +EQA+KE+ KKNQAR  + + L+AKR+ R+++I++ K L+AE +Q+R  MDEKRK 
Sbjct  127  LKAMIEQADKEIQKKNQARFQITEALKAKRSERAQVISQLKPLTAEDKQYRMIMDEKRKE  186

Query  567  MEPLQQALGKLRGNNAGGRDQRSVIFSSEAELNDYIKSLQYRIQHESITLNEEKQILREI  746
            M+P Q+ALGKLR  N   R++   + SSE ELN+ I+SL YR+QHES+TL EEKQ+++EI
Sbjct  187  MKPFQEALGKLRTANNDVREKGMGLCSSEGELNELIQSLHYRMQHESLTLVEEKQLIKEI  246

Query  747  KQFEGTRDKVIAHAAERAKIQESL  818
            K  EGTR+KVIA+AA +AKIQ++L
Sbjct  247  KLLEGTREKVIANAAMKAKIQDTL  270



>ref|XP_007133182.1| hypothetical protein PHAVU_011G158400g [Phaseolus vulgaris]
 gb|ESW05176.1| hypothetical protein PHAVU_011G158400g [Phaseolus vulgaris]
Length=632

 Score =   191 bits (486),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 115/218 (53%), Positives = 155/218 (71%), Gaps = 8/218 (4%)
 Frame = +3

Query  183  GGSLKENGTVPNEPIKFGSHGAEEP-----IKEDVKKAPAINLPKDAVVEDWPAPQQIHS  347
             G L++   V +  I FGS G E       +  D   AP  ++PKDAV EDWPAP+QIHS
Sbjct  31   NGKLEQKAEVAD-AIIFGSEGDESAKPEAEVAPDSNAAPDADVPKDAV-EDWPAPKQIHS  88

Query  348  FYLVKYRTFEDqklkakleqaekelhkkNQARSVMIDNLRAKRAARSELINERKSLSAER  527
            FY V++R ++D  +KA L++ +K++ +KNQAR  + D LRAKR+ R+ELI++ KSL  + 
Sbjct  89   FYFVRFRPYDDPIIKANLDKLDKDMSQKNQARIQVTDALRAKRSERAELISQIKSLRDDN  148

Query  528  QQFRSQMDEKRKVMEPLQQALGKLRG-NNAGGRDQRSVIFSSEAELNDYIKSLQYRIQHE  704
            +Q++S +DEK K +EPLQQALGKLR  NN+G       + +SE ELN+ I SLQY IQHE
Sbjct  149  KQYQSIVDEKIKEIEPLQQALGKLRSTNNSGSGRGGGGLCASEEELNNLISSLQYHIQHE  208

Query  705  SITLNEEKQILREIKQFEGTRDKVIAHAAERAKIQESL  818
            SI L EEKQI+REIKQ EGTR+KV+A+A+ RAK+Q+SL
Sbjct  209  SIPLAEEKQIIREIKQLEGTREKVLANASMRAKVQDSL  246



>ref|XP_006283362.1| hypothetical protein CARUB_v10004404mg [Capsella rubella]
 gb|EOA16260.1| hypothetical protein CARUB_v10004404mg [Capsella rubella]
Length=609

 Score =   191 bits (485),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 121/200 (61%), Positives = 145/200 (73%), Gaps = 6/200 (3%)
 Frame = +3

Query  225  IKFGSHGAEEPIK--EDVKKAPAINLPKDAVVEDWPAPQQIHSFYLVKYRTFEDqklkak  398
            IKFGSH  +EP K  E+  KA   ++PKDA  E+WPA +QIHSFY VK+R  ED K+KAK
Sbjct  31   IKFGSH--DEPPKKAEENNKALNADVPKDAA-EEWPAVRQIHSFYFVKFRHHEDPKMKAK  87

Query  399  leqaekelhkkNQARSVMIDNLRAKRAARSELINERKSLSAERQQFRSQMDEKRKVMEPL  578
            L+ A+KEL K N AR+ ++D LR KRA RS+L      L +ER+ F +  DEKRK MEPL
Sbjct  88   LDVADKELKKLNTARAAVLDELRNKRAERSKLFELLDPLKSERKGFNTMFDEKRKEMEPL  147

Query  579  QQALGKLRGNNAGGRDQRSVIFSSEAELNDYIKSLQYRIQHESITLNEEKQILREIKQFE  758
            QQALGKLR NN GG  +   I SSE ELN  I S QYRIQHESI L EEKQ+L+EI+  E
Sbjct  148  QQALGKLR-NNDGGSARGPAICSSEDELNSMIYSYQYRIQHESIPLTEEKQLLKEIRLLE  206

Query  759  GTRDKVIAHAAERAKIQESL  818
            GTRDKVIA+AA RAKI+ES+
Sbjct  207  GTRDKVIANAAMRAKIKESM  226



>gb|KJB61861.1| hypothetical protein B456_009G386800 [Gossypium raimondii]
Length=554

 Score =   190 bits (482),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 124/239 (52%), Positives = 171/239 (72%), Gaps = 11/239 (5%)
 Frame = +3

Query  123  MGV-DVESKLAHVSVETGSENGGS-LKENGT-----VPNEPIKFGSHGAEEPIKEDVKKA  281
            MGV DV+S LA +S++  +E   S L ENG      V N PI+  SH +EEP KE+   A
Sbjct  1    MGVKDVDSDLAQLSIDKVTEVDKSFLHENGKLDKDPVYNNPIQVDSH-SEEPDKEEENGA  59

Query  282  PAINLPKDAVVEDWPAPQQIHSFYLVKYRTFEDqklkakleqaekelhkkNQARSVMIDN  461
               +  KDAV ++WPAP+QI SF+ ++YR +ED  +KAKL+QA+KE+ K N+AR  + D 
Sbjct  60   SDPDFLKDAV-DEWPAPKQIRSFHFIRYRFYEDPAIKAKLDQADKEIQKWNKARFKLTDE  118

Query  462  LRAKRAARSELINERKSLSAERQQFRSQMDEKRKVMEPLQQALGKLRGNNAGGRDQRSVI  641
            L+AKRA RSE +++ ++L+ + +QF++ +DEK++ +EPLQQALGKLR N     D R  +
Sbjct  119  LKAKRAERSERLSQVRALNVDFEQFKTILDEKKREIEPLQQALGKLRNNK--DVDNRLSL  176

Query  642  FSSEAELNDYIKSLQYRIQHESITLNEEKQILREIKQFEGTRDKVIAHAAERAKIQESL  818
             +SE EL+  I SL YRIQHESI+L+EEK+IL EIK  EGTR+KVIA+AA R+KIQ+SL
Sbjct  177  CASEEELDFIIHSLPYRIQHESISLSEEKRILEEIKHLEGTREKVIANAAMRSKIQDSL  235



>ref|XP_009405605.1| PREDICTED: proton pump-interactor 1 [Musa acuminata subsp. malaccensis]
Length=626

 Score =   190 bits (483),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 113/208 (54%), Positives = 151/208 (73%), Gaps = 6/208 (3%)
 Frame = +3

Query  204  GTVPNEPIKFG----SHGAEEPIKEDVKKAPAINLPKDAVVEDWPAPQQIHSFYLVKYRT  371
            G  P EP+ FG    S+GA   +KE      A NLPKDAV ++WPA ++IH+FY ++YRT
Sbjct  25   GQGPEEPVSFGLVDNSNGANGDVKEGDHLTDA-NLPKDAV-DEWPAAKKIHTFYFIRYRT  82

Query  372  FEDqklkakleqaekelhkkNQARSVMIDNLRAKRAARSELINERKSLSAERQQFRSQMD  551
             ED KLKAK++ A+KE+ K  Q+R  + + L+AKR+ RS +I++ K L+AE +Q+R  MD
Sbjct  83   IEDPKLKAKIDHADKEITKSTQSRLQITEALKAKRSERSNVISQLKPLTAEDKQYRMIMD  142

Query  552  EKRKVMEPLQQALGKLRGNNAGGRDQRSVIFSSEAELNDYIKSLQYRIQHESITLNEEKQ  731
            EKRK MEPLQ ALGKLR  N   R++   + SSE ELND I SL YR+QHE++TL EEKQ
Sbjct  143  EKRKSMEPLQDALGKLRSANIAVREKGVGLCSSEEELNDLIYSLHYRMQHETLTLVEEKQ  202

Query  732  ILREIKQFEGTRDKVIAHAAERAKIQES  815
            +++EIK  EGTR+KVIA+A E+AKIQ+S
Sbjct  203  LIKEIKLLEGTREKVIANATEKAKIQDS  230



>ref|XP_002533906.1| DNA double-strand break repair rad50 ATPase, putative [Ricinus 
communis]
 gb|EEF28480.1| DNA double-strand break repair rad50 ATPase, putative [Ricinus 
communis]
Length=616

 Score =   190 bits (482),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 122/241 (51%), Positives = 164/241 (68%), Gaps = 16/241 (7%)
 Frame = +3

Query  123  MGVDV-ESKLAHVSVETGSENGGSL---KENGTVPN-----EPIKFGSHGAEEPIKEDVK  275
            MGV+V  S++A V VE  +E  GS    KENG +       E IKFGSH  EE +K +  
Sbjct  1    MGVEVVGSEMAQVPVEKVAEVDGSFLHEKENGKLDKDSGMKETIKFGSH-EEEHVKGEGN  59

Query  276  KAPAINLPKDAVVEDWPAPQQIHSFYLVKYRTFEDqklkakleqaekelhkkNQARSVMI  455
                   PKDA  ++WP   QIH+FY V++R F+D K+K K++QA++E+ + N+AR  + 
Sbjct  60   DVAGAKFPKDAA-DEWPV-TQIHTFYFVRFRPFDDPKIKVKIDQADREIQRNNKARFHIT  117

Query  456  DNLRAKRAARSELINERKSLSAERQQFRSQMDEKRKVMEPLQQALGKLRGNNAGGRDQRS  635
            + L+AKR+ R E+  + ++L  E  Q+++  DEKRK MEPLQQALGKLR NNA     R 
Sbjct  118  EELKAKRSERKEIAEQLRTLRNENDQYKTIFDEKRKEMEPLQQALGKLRTNNAA----RG  173

Query  636  VIFSSEAELNDYIKSLQYRIQHESITLNEEKQILREIKQFEGTRDKVIAHAAERAKIQES  815
             + SSE ELND I SLQ+ +QHESI+L EEK+ILREIKQ EGTR+KVIA++A RAKIQ+S
Sbjct  174  GLCSSEEELNDIIHSLQFHMQHESISLTEEKKILREIKQLEGTREKVIANSAMRAKIQDS  233

Query  816  L  818
            +
Sbjct  234  M  234



>gb|KCW67362.1| hypothetical protein EUGRSUZ_F01145, partial [Eucalyptus grandis]
Length=612

 Score =   189 bits (481),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 118/221 (53%), Positives = 151/221 (68%), Gaps = 8/221 (4%)
 Frame = +3

Query  150  AHVSVETGSENGGSLKENGTVPNEPIKFGSHGAEEPIKEDVKKAPAINLPKDAVVEDWPA  329
            A  S+   +ENG    E G  PN  IKFGSHG +     +  K    NLPKDA  ++WPA
Sbjct  21   ADRSLLIKNENGKL--EQGLTPNADIKFGSHG-DGLANSEANKVSDANLPKDAA-DEWPA  76

Query  330  PQQIHSFYLVKYRTFEDqklkakleqaekelhkkNQARSVMIDNLRAKRAARSELINERK  509
            P +IHSFY+ K R+ +D ++K K++ A++E+ + NQAR  + D LRAKR+ RS++I + K
Sbjct  77   PDKIHSFYIPKCRSHDDPQIKVKIDLADREIQRMNQARFQITDKLRAKRSQRSDIITQLK  136

Query  510  SLSAERQQFRSQMDEKRKVMEPLQQALGKLR-GNNAGGRDQRSVIFSSEAELNDYIKSLQ  686
            +L  E +QF    +EKRK MEPL  ALGKLR GNNAG     S I SSE ELN+ I+SL 
Sbjct  137  ALGNENKQFNMIAEEKRKEMEPLHDALGKLRNGNNAG---HGSGICSSEEELNELIQSLN  193

Query  687  YRIQHESITLNEEKQILREIKQFEGTRDKVIAHAAERAKIQ  809
            YRIQHESI L EEKQ+LRE+KQ EGTR+KVIA+AA RA +Q
Sbjct  194  YRIQHESIPLAEEKQLLRELKQLEGTREKVIANAALRADVQ  234



>ref|XP_010060584.1| PREDICTED: proton pump-interactor 1 [Eucalyptus grandis]
Length=641

 Score =   189 bits (481),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 118/221 (53%), Positives = 151/221 (68%), Gaps = 8/221 (4%)
 Frame = +3

Query  150  AHVSVETGSENGGSLKENGTVPNEPIKFGSHGAEEPIKEDVKKAPAINLPKDAVVEDWPA  329
            A  S+   +ENG    E G  PN  IKFGSHG +     +  K    NLPKDA  ++WPA
Sbjct  21   ADRSLLIKNENGKL--EQGLTPNADIKFGSHG-DGLANSEANKVSDANLPKDAA-DEWPA  76

Query  330  PQQIHSFYLVKYRTFEDqklkakleqaekelhkkNQARSVMIDNLRAKRAARSELINERK  509
            P +IHSFY+ K R+ +D ++K K++ A++E+ + NQAR  + D LRAKR+ RS++I + K
Sbjct  77   PDKIHSFYIPKCRSHDDPQIKVKIDLADREIQRMNQARFQITDKLRAKRSQRSDIITQLK  136

Query  510  SLSAERQQFRSQMDEKRKVMEPLQQALGKLR-GNNAGGRDQRSVIFSSEAELNDYIKSLQ  686
            +L  E +QF    +EKRK MEPL  ALGKLR GNNAG     S I SSE ELN+ I+SL 
Sbjct  137  ALGNENKQFNMIAEEKRKEMEPLHDALGKLRNGNNAG---HGSGICSSEEELNELIQSLN  193

Query  687  YRIQHESITLNEEKQILREIKQFEGTRDKVIAHAAERAKIQ  809
            YRIQHESI L EEKQ+LRE+KQ EGTR+KVIA+AA RA +Q
Sbjct  194  YRIQHESIPLAEEKQLLRELKQLEGTREKVIANAALRADVQ  234



>ref|XP_006401659.1| hypothetical protein EUTSA_v10013033mg [Eutrema salsugineum]
 gb|ESQ43112.1| hypothetical protein EUTSA_v10013033mg [Eutrema salsugineum]
Length=597

 Score =   189 bits (479),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 119/211 (56%), Positives = 149/211 (71%), Gaps = 12/211 (6%)
 Frame = +3

Query  198  ENGTVPNEPIKFGSHGAEEPIKED----VKKAPAINLPKDAVVEDWPAPQQIHSFYLVKY  365
            +NG      IKFGSH   EP K      V K+   ++PKD V EDWPA +++H+FY VK 
Sbjct  21   QNGKGDKVSIKFGSHN--EPSKSSEETGVSKS---DVPKD-VSEDWPAEKKLHAFYFVKQ  74

Query  366  RTFEDqklkakleqaekelhkkNQARSVMIDNLRAKRAARSELINERKSLSAERQQFRSQ  545
            R++ED K+KAKL+Q ++E  K N AR+ +   L+AKR  +SEL +  + L +ER+ F S 
Sbjct  75   RSYEDPKIKAKLDQLDQEYQKLNSARAGVFKKLKAKRDEKSELFDLLEPLKSERKGFNSM  134

Query  546  MDEKRKVMEPLQQALGKLRGNNAGGRDQRSVIFSSEAELNDYIKSLQYRIQHESITLNEE  725
             DEKRK MEPLQQALGKLR N+ G R     I SSE ELND I+ L+YRIQHES TLNEE
Sbjct  135  FDEKRKEMEPLQQALGKLRSNDGGTRG--PGICSSEQELNDMIRGLEYRIQHESNTLNEE  192

Query  726  KQILREIKQFEGTRDKVIAHAAERAKIQESL  818
            KQ+L+EI+Q EGTRDKVIA+AA RAKI+ESL
Sbjct  193  KQLLKEIRQLEGTRDKVIANAALRAKIKESL  223



>ref|XP_008791762.1| PREDICTED: proton pump-interactor 1-like isoform X2 [Phoenix 
dactylifera]
 ref|XP_008791771.1| PREDICTED: proton pump-interactor 1-like isoform X2 [Phoenix 
dactylifera]
 ref|XP_008791780.1| PREDICTED: proton pump-interactor 1-like isoform X2 [Phoenix 
dactylifera]
 ref|XP_008791789.1| PREDICTED: proton pump-interactor 1-like isoform X2 [Phoenix 
dactylifera]
Length=637

 Score =   189 bits (480),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 117/214 (55%), Positives = 157/214 (73%), Gaps = 12/214 (6%)
 Frame = +3

Query  207  TVPNE------PIKF----GSHGAEEPIKEDVKKAPAINLPKDAVVEDWPAPQQIHSFYL  356
            T PN+      P KF    GSHG     KE    A  +N PKDAV ++WPAP+QIH+FY 
Sbjct  38   TKPNQGQRLDGPNKFESVNGSHGVNGESKEGGHLA-NVNFPKDAV-DEWPAPKQIHTFYF  95

Query  357  VKYRTFEDqklkakleqaekelhkkNQARSVMIDNLRAKRAARSELINERKSLSAERQQF  536
            VKYR++ED KLKA +EQA+KE+ KKNQAR  + + L+AKR+ R+++I++ K L+AE +Q+
Sbjct  96   VKYRSYEDPKLKAMIEQADKEIQKKNQARFQITEALKAKRSERAQVISQLKPLTAEDKQY  155

Query  537  RSQMDEKRKVMEPLQQALGKLRGNNAGGRDQRSVIFSSEAELNDYIKSLQYRIQHESITL  716
            R  MDEKRK M+P Q+ALGKLR  N   R++   + SSE ELN+ I+SL YR+QHES+TL
Sbjct  156  RMIMDEKRKEMKPFQEALGKLRTANNDVREKGMGLCSSEGELNELIQSLHYRMQHESLTL  215

Query  717  NEEKQILREIKQFEGTRDKVIAHAAERAKIQESL  818
             EEKQ+++EIK  EGTR+KVIA+AA +AKIQ++L
Sbjct  216  VEEKQLIKEIKLLEGTREKVIANAAMKAKIQDTL  249



>ref|XP_008226621.1| PREDICTED: proton pump-interactor 1 [Prunus mume]
 ref|XP_008226622.1| PREDICTED: proton pump-interactor 1 [Prunus mume]
Length=619

 Score =   189 bits (479),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 117/232 (50%), Positives = 159/232 (69%), Gaps = 7/232 (3%)
 Frame = +3

Query  123  MGVDVES-KLAHVSVETGSENGGSLKENGTVP--NEPIKFGSHGAEEPIKEDVKKAPAIN  293
            MGV+V   +     V   +E G S  ENG +   NEPIKFGSHG +E +K++V +    N
Sbjct  1    MGVEVVGFEAVQGPVGAMTEGGHSANENGKLDQGNEPIKFGSHG-DESVKKEVNEVSVAN  59

Query  294  LPKDAVVEDWPAPQQIHSFYLVKYRTFEDqklkakleqaekelhkkNQARSVMIDNLRAK  473
             PKDAV ++WPAP+Q HSFY V+Y+T++D K+KAK++Q  +E+  +N ARS +ID LRAK
Sbjct  60   FPKDAV-DEWPAPKQTHSFYFVRYQTYDDPKIKAKVDQVSREVETRNNARSQIIDALRAK  118

Query  474  RAARSELINERKSLSAERQQFRSQMDEKRKVMEPLQQALGKLRGNNAGGRDQRSVIFSSE  653
            R  R EL+ + K+L  + +Q RS +DEK K ++PLQQALG+LR  +   R+    + SSE
Sbjct  119  RTDRGELVEQIKALRDDNRQIRSIVDEKFKDLQPLQQALGQLRSADHASRN--GGLCSSE  176

Query  654  AELNDYIKSLQYRIQHESITLNEEKQILREIKQFEGTRDKVIAHAAERAKIQ  809
             ELN  I+ LQY IQHESI L EEK+IL+EI+  E TR +VIA+AA  AKI+
Sbjct  177  EELNSRIQGLQYIIQHESIELKEEKKILKEIRTLESTRAQVIANAAMIAKIE  228



>ref|XP_008791798.1| PREDICTED: proton pump-interactor 1-like isoform X3 [Phoenix 
dactylifera]
Length=632

 Score =   189 bits (479),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 117/214 (55%), Positives = 157/214 (73%), Gaps = 12/214 (6%)
 Frame = +3

Query  207  TVPNE------PIKF----GSHGAEEPIKEDVKKAPAINLPKDAVVEDWPAPQQIHSFYL  356
            T PN+      P KF    GSHG     KE    A  +N PKDAV ++WPAP+QIH+FY 
Sbjct  33   TKPNQGQRLDGPNKFESVNGSHGVNGESKEGGHLA-NVNFPKDAV-DEWPAPKQIHTFYF  90

Query  357  VKYRTFEDqklkakleqaekelhkkNQARSVMIDNLRAKRAARSELINERKSLSAERQQF  536
            VKYR++ED KLKA +EQA+KE+ KKNQAR  + + L+AKR+ R+++I++ K L+AE +Q+
Sbjct  91   VKYRSYEDPKLKAMIEQADKEIQKKNQARFQITEALKAKRSERAQVISQLKPLTAEDKQY  150

Query  537  RSQMDEKRKVMEPLQQALGKLRGNNAGGRDQRSVIFSSEAELNDYIKSLQYRIQHESITL  716
            R  MDEKRK M+P Q+ALGKLR  N   R++   + SSE ELN+ I+SL YR+QHES+TL
Sbjct  151  RMIMDEKRKEMKPFQEALGKLRTANNDVREKGMGLCSSEGELNELIQSLHYRMQHESLTL  210

Query  717  NEEKQILREIKQFEGTRDKVIAHAAERAKIQESL  818
             EEKQ+++EIK  EGTR+KVIA+AA +AKIQ++L
Sbjct  211  VEEKQLIKEIKLLEGTREKVIANAAMKAKIQDTL  244



>ref|XP_007213590.1| hypothetical protein PRUPE_ppa002743mg [Prunus persica]
 gb|EMJ14789.1| hypothetical protein PRUPE_ppa002743mg [Prunus persica]
Length=638

 Score =   187 bits (476),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 111/214 (52%), Positives = 152/214 (71%), Gaps = 6/214 (3%)
 Frame = +3

Query  174  SENGGSLKENGTVP--NEPIKFGSHGAEEPIKEDVKKAPAINLPKDAVVEDWPAPQQIHS  347
            +E G S  ENG +   NEPIKFGSHG +E +K++V +    N PKDAV ++WPAP+Q HS
Sbjct  19   TEGGHSANENGKLDQGNEPIKFGSHG-DESVKKEVNEVSVANFPKDAV-DEWPAPKQTHS  76

Query  348  FYLVKYRTFEDqklkakleqaekelhkkNQARSVMIDNLRAKRAARSELINERKSLSAER  527
            FY V+Y+T++D K+KAK++Q  +E+  +N ARS +ID L+AKR  R EL+ + K+L  + 
Sbjct  77   FYFVRYQTYDDPKIKAKVDQVSREVETRNNARSQIIDALKAKRTDRGELVEQIKALRDDN  136

Query  528  QQFRSQMDEKRKVMEPLQQALGKLRGNNAGGRDQRSVIFSSEAELNDYIKSLQYRIQHES  707
            +Q RS +DEK K ++PLQQALG+LR  +   R+    + SSE ELN  I+ LQY IQHES
Sbjct  137  RQIRSIVDEKFKDLQPLQQALGQLRSADHASRN--GGLCSSEEELNSRIQGLQYIIQHES  194

Query  708  ITLNEEKQILREIKQFEGTRDKVIAHAAERAKIQ  809
            I L EEK+IL+EI+  E TR +VIA+AA  AKI+
Sbjct  195  IELKEEKKILKEIRTLESTRTQVIANAAMIAKIE  228



>gb|ACJ85701.1| unknown [Medicago truncatula]
Length=577

 Score =   186 bits (473),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 115/214 (54%), Positives = 149/214 (70%), Gaps = 7/214 (3%)
 Frame = +3

Query  177  ENGGSLKENGTVPNEPIKFGSHGAEEPIKEDVKKAPAINLPKDAVVEDWPAPQQIHSFYL  356
            ENG   K+ G    E IKFGSHG +E  K +V      N PKDA  E+WPAP+QIH FY 
Sbjct  30   ENGKLEKDVGA--GETIKFGSHG-DESAKVEVNDVADSNTPKDAA-EEWPAPKQIHYFYF  85

Query  357  VKYRTFEDqklkakleqaekelhkkNQARSVMIDNLRAKRAARSELINERKSLSAERQQF  536
            V+ R ++D  +KAK++  +KE+ KKNQAR  + + L+AKR+ +SELI++ K L  + +Q+
Sbjct  86   VRCRPYDDPSIKAKIDLLDKEISKKNQARFQITEALKAKRSEKSELISQIKILREDNRQY  145

Query  537  RSQMDEKRKVMEPLQQALGKLRGNNAGGRDQRSVIFSSEAELNDYIKSLQYRIQHESITL  716
            +S  DEK K +EPLQQALGKLR +N  GR     I  SE ELN +I  LQYRIQHESI L
Sbjct  146  QSLFDEKMKEIEPLQQALGKLRNSNNAGR---GGICQSEEELNKFINGLQYRIQHESIPL  202

Query  717  NEEKQILREIKQFEGTRDKVIAHAAERAKIQESL  818
             EEKQILREIKQ EGTR+KVIA++A R K+ +++
Sbjct  203  TEEKQILREIKQLEGTREKVIANSAMRTKLHDTI  236



>ref|XP_003596759.1| hypothetical protein MTR_2g085330 [Medicago truncatula]
 gb|AES67010.1| proton pump interactor, putative [Medicago truncatula]
Length=609

 Score =   187 bits (474),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 115/214 (54%), Positives = 149/214 (70%), Gaps = 7/214 (3%)
 Frame = +3

Query  177  ENGGSLKENGTVPNEPIKFGSHGAEEPIKEDVKKAPAINLPKDAVVEDWPAPQQIHSFYL  356
            ENG   K+ G    E IKFGSHG +E  K +V      N PKDA  E+WPAP+QIH FY 
Sbjct  30   ENGKLEKDVGA--GETIKFGSHG-DESAKVEVNDVADSNTPKDAA-EEWPAPKQIHYFYF  85

Query  357  VKYRTFEDqklkakleqaekelhkkNQARSVMIDNLRAKRAARSELINERKSLSAERQQF  536
            V+ R ++D  +KAK++  +KE+ KKNQAR  + + L+AKR+ +SELI++ K L  + +Q+
Sbjct  86   VRCRPYDDPSIKAKIDLLDKEISKKNQARFQITEALKAKRSEKSELISQIKILREDNRQY  145

Query  537  RSQMDEKRKVMEPLQQALGKLRGNNAGGRDQRSVIFSSEAELNDYIKSLQYRIQHESITL  716
            +S  DEK K +EPLQQALGKLR +N  GR     I  SE ELN +I  LQYRIQHESI L
Sbjct  146  QSLFDEKMKEIEPLQQALGKLRNSNNAGR---GGICQSEEELNKFINGLQYRIQHESIPL  202

Query  717  NEEKQILREIKQFEGTRDKVIAHAAERAKIQESL  818
             EEKQILREIKQ EGTR+KVIA++A R K+ +++
Sbjct  203  TEEKQILREIKQLEGTREKVIANSAMRTKLHDTI  236



>ref|XP_010537014.1| PREDICTED: proton pump-interactor 1 isoform X1 [Tarenaya hassleriana]
 ref|XP_010537015.1| PREDICTED: proton pump-interactor 1 isoform X1 [Tarenaya hassleriana]
 ref|XP_010537016.1| PREDICTED: proton pump-interactor 1 isoform X1 [Tarenaya hassleriana]
Length=649

 Score =   187 bits (475),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 129/268 (48%), Positives = 167/268 (62%), Gaps = 40/268 (15%)
 Frame = +3

Query  123  MGVDVES----KLAHVSVETGSENGGSLKENGTVPNEPIKFGSHGAEEPIKEDVKKAPAI  290
            MGV+V      ++A    E   E  G   ++G      IKFGSH       E++    + 
Sbjct  1    MGVEVGKSDGFEVAPAPFEGKPEQNGKF-DHGKGDKVSIKFGSHDETSKGDENISSVFSS  59

Query  291  NLPKDAVVEDWPAPQQIHSFYLVKYRTFEDqklkakleqaekelhkkNQARSVMIDNLRA  470
            + PKDA  E+WPA ++IH++Y V+YR +ED K+KAKLEQA+KEL K N+AR+ ++D L++
Sbjct  60   DAPKDAA-EEWPADKRIHTYYFVRYRPYEDPKIKAKLEQADKELQKLNRARAGIVDELKS  118

Query  471  KRAARSELINERKSLSAERQQFRSQMDEKRKVMEPLQQALGKLRGNNAGGRDQRSV-IFS  647
            KRAARSEL ++ + L  ER+ F +  DEKRK MEPLQQALGKLR N   G   R V + S
Sbjct  119  KRAARSELFDQLEPLKNERKGFNTIFDEKRKEMEPLQQALGKLRSNEGSG--ARGVGLCS  176

Query  648  SEAELNDYIK-------------------------------SLQYRIQHESITLNEEKQI  734
            SE ELN+ ++                               SLQYRIQHESI+LNEEKQI
Sbjct  177  SEGELNNMVRSYFKPQIRTRICFIILSLYHHELTGKKMQIYSLQYRIQHESISLNEEKQI  236

Query  735  LREIKQFEGTRDKVIAHAAERAKIQESL  818
            L+EIKQFEGTR+KVIA+AA RAKI+ESL
Sbjct  237  LKEIKQFEGTREKVIANAAMRAKIKESL  264



>ref|XP_003596760.1| hypothetical protein MTR_2g085330 [Medicago truncatula]
Length=600

 Score =   186 bits (473),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 115/214 (54%), Positives = 149/214 (70%), Gaps = 7/214 (3%)
 Frame = +3

Query  177  ENGGSLKENGTVPNEPIKFGSHGAEEPIKEDVKKAPAINLPKDAVVEDWPAPQQIHSFYL  356
            ENG   K+ G    E IKFGSHG +E  K +V      N PKDA  E+WPAP+QIH FY 
Sbjct  21   ENGKLEKDVGA--GETIKFGSHG-DESAKVEVNDVADSNTPKDAA-EEWPAPKQIHYFYF  76

Query  357  VKYRTFEDqklkakleqaekelhkkNQARSVMIDNLRAKRAARSELINERKSLSAERQQF  536
            V+ R ++D  +KAK++  +KE+ KKNQAR  + + L+AKR+ +SELI++ K L  + +Q+
Sbjct  77   VRCRPYDDPSIKAKIDLLDKEISKKNQARFQITEALKAKRSEKSELISQIKILREDNRQY  136

Query  537  RSQMDEKRKVMEPLQQALGKLRGNNAGGRDQRSVIFSSEAELNDYIKSLQYRIQHESITL  716
            +S  DEK K +EPLQQALGKLR +N  GR     I  SE ELN +I  LQYRIQHESI L
Sbjct  137  QSLFDEKMKEIEPLQQALGKLRNSNNAGR---GGICQSEEELNKFINGLQYRIQHESIPL  193

Query  717  NEEKQILREIKQFEGTRDKVIAHAAERAKIQESL  818
             EEKQILREIKQ EGTR+KVIA++A R K+ +++
Sbjct  194  TEEKQILREIKQLEGTREKVIANSAMRTKLHDTI  227



>emb|CDY14276.1| BnaA08g14070D [Brassica napus]
Length=622

 Score =   187 bits (474),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 110/176 (63%), Positives = 137/176 (78%), Gaps = 2/176 (1%)
 Frame = +3

Query  291  NLPKDAVVEDWPAPQQIHSFYLVKYRTFEDqklkakleqaekelhkkNQARSVMIDNLRA  470
            ++PKDA  E+WPA +QI SFY VKYR F+D K+KAKLE A+KEL K N+ARSV+I+ LRA
Sbjct  56   DVPKDAA-EEWPAAKQIRSFYFVKYRHFDDPKIKAKLEVADKELEKLNKARSVVIEGLRA  114

Query  471  KRAARSELINERKSLSAERQQFRSQMDEKRKVMEPLQQALGKLRGNNAGGRDQRSVIFSS  650
            K+A RS+L +    L +ERQ F ++ DEKRK MEPLQQALGKLRGN+ GG  +  VI SS
Sbjct  115  KKAERSKLFDMLDPLKSERQGFNNKFDEKRKEMEPLQQALGKLRGND-GGSSRGPVICSS  173

Query  651  EAELNDYIKSLQYRIQHESITLNEEKQILREIKQFEGTRDKVIAHAAERAKIQESL  818
            + ELN  I S +YRIQHESI L EEKQ+L+EI+  EGTRDKVIA+ A RAKI+E++
Sbjct  174  QEELNSMIYSYEYRIQHESIPLTEEKQLLKEIRLLEGTRDKVIANEAMRAKIKEAM  229



>ref|XP_010433357.1| PREDICTED: proton pump-interactor 1 isoform X1 [Camelina sativa]
 ref|XP_010433358.1| PREDICTED: proton pump-interactor 1 isoform X2 [Camelina sativa]
Length=617

 Score =   186 bits (473),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 115/200 (58%), Positives = 145/200 (73%), Gaps = 5/200 (3%)
 Frame = +3

Query  225  IKFGSHGAEEPIKEDVKKAPAIN--LPKDAVVEDWPAPQQIHSFYLVKYRTFEDqklkak  398
            IKFGSHG E P K +      +N  +PKDA  E+WPA +QIHSFY ++Y + +D K+KAK
Sbjct  37   IKFGSHG-EPPKKAEETNNKVLNADVPKDAA-EEWPAARQIHSFYFIRYHSLKDPKMKAK  94

Query  399  leqaekelhkkNQARSVMIDNLRAKRAARSELINERKSLSAERQQFRSQMDEKRKVMEPL  578
            LE AEKEL K N+AR  ++++LRAKR  RS+L +    L +ER+ F +  DEKRK MEPL
Sbjct  95   LEAAEKELEKLNKARGAVLNDLRAKRTERSKLFDLLDPLKSERKGFNTMFDEKRKEMEPL  154

Query  579  QQALGKLRGNNAGGRDQRSVIFSSEAELNDYIKSLQYRIQHESITLNEEKQILREIKQFE  758
            QQALGKLR NN GG  +   I SSE EL++ I S +YRIQHESI L EEKQ+L+EI+  E
Sbjct  155  QQALGKLR-NNDGGSARGPAICSSEEELDNMIYSYKYRIQHESIPLTEEKQLLKEIRLLE  213

Query  759  GTRDKVIAHAAERAKIQESL  818
            GTRDKVIA+ A RAKI+ES+
Sbjct  214  GTRDKVIANVAMRAKIKESM  233



>ref|XP_009109131.1| PREDICTED: proton pump-interactor 1-like isoform X1 [Brassica 
rapa]
 ref|XP_009109132.1| PREDICTED: proton pump-interactor 1-like isoform X1 [Brassica 
rapa]
 ref|XP_009109133.1| PREDICTED: proton pump-interactor 1-like isoform X1 [Brassica 
rapa]
Length=625

 Score =   186 bits (473),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 110/176 (63%), Positives = 137/176 (78%), Gaps = 2/176 (1%)
 Frame = +3

Query  291  NLPKDAVVEDWPAPQQIHSFYLVKYRTFEDqklkakleqaekelhkkNQARSVMIDNLRA  470
            ++PKDA  E+WPA +QI SFY VKYR F+D K+KAKLE A+KEL K N+ARSV+I+ LRA
Sbjct  55   DVPKDAA-EEWPAAKQIRSFYFVKYRHFDDPKIKAKLEVADKELEKLNKARSVVIEGLRA  113

Query  471  KRAARSELINERKSLSAERQQFRSQMDEKRKVMEPLQQALGKLRGNNAGGRDQRSVIFSS  650
            K+A RS+L +    L +ERQ F ++ DEKRK MEPLQQALGKLRGN+ GG  +  VI SS
Sbjct  114  KKAERSKLFDMLDPLKSERQGFNNKFDEKRKEMEPLQQALGKLRGND-GGSSRGPVICSS  172

Query  651  EAELNDYIKSLQYRIQHESITLNEEKQILREIKQFEGTRDKVIAHAAERAKIQESL  818
            + ELN  I S +YRIQHESI L EEKQ+L+EI+  EGTRDKVIA+ A RAKI+E++
Sbjct  173  QEELNSMIYSYEYRIQHESIPLTEEKQLLKEIRLLEGTRDKVIANEAMRAKIKEAM  228



>ref|XP_009143539.1| PREDICTED: proton pump-interactor 1 [Brassica rapa]
Length=610

 Score =   186 bits (472),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 120/204 (59%), Positives = 146/204 (72%), Gaps = 9/204 (4%)
 Frame = +3

Query  225  IKFGSHGAEEPIKEDVKKAPAI------NLPKDAVVEDWPAPQQIHSFYLVKYRTFEDqk  386
            IKFGS G E P K + K           ++PKDA  E+WPA +QIHSFY VK+R F+D K
Sbjct  35   IKFGSLG-EPPKKAEEKNNNNKNNVLISDVPKDAA-EEWPAAKQIHSFYFVKHRHFDDPK  92

Query  387  lkakleqaekelhkkNQARSVMIDNLRAKRAARSELINERKSLSAERQQFRSQMDEKRKV  566
            +KAKL+ AEKEL K N+AR+ + D L+AKRA RSEL +    L  ERQ F ++ +EKRK 
Sbjct  93   IKAKLDLAEKELEKFNKARAAVFDQLKAKRAERSELFDLLDPLKTERQGFNAKFEEKRKE  152

Query  567  MEPLQQALGKLRGNNAGGRDQRSVIFSSEAELNDYIKSLQYRIQHESITLNEEKQILREI  746
            MEPLQQALGKLRGN+ GG  +   I SSE ELN+ I S QYRIQHESI L EEKQ+L+EI
Sbjct  153  MEPLQQALGKLRGND-GGTGRGPAICSSEEELNNMIYSYQYRIQHESIPLTEEKQLLKEI  211

Query  747  KQFEGTRDKVIAHAAERAKIQESL  818
            +  EGTRDKVIA+ A RAKI+ES+
Sbjct  212  RLLEGTRDKVIANEAMRAKIKESM  235



>ref|XP_009109134.1| PREDICTED: proton pump-interactor 1-like isoform X2 [Brassica 
rapa]
Length=625

 Score =   186 bits (473),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 110/176 (63%), Positives = 137/176 (78%), Gaps = 2/176 (1%)
 Frame = +3

Query  291  NLPKDAVVEDWPAPQQIHSFYLVKYRTFEDqklkakleqaekelhkkNQARSVMIDNLRA  470
            ++PKDA  E+WPA +QI SFY VKYR F+D K+KAKLE A+KEL K N+ARSV+I+ LRA
Sbjct  55   DVPKDAA-EEWPAAKQIRSFYFVKYRHFDDPKIKAKLEVADKELEKLNKARSVVIEGLRA  113

Query  471  KRAARSELINERKSLSAERQQFRSQMDEKRKVMEPLQQALGKLRGNNAGGRDQRSVIFSS  650
            K+A RS+L +    L +ERQ F ++ DEKRK MEPLQQALGKLRGN+ GG  +  VI SS
Sbjct  114  KKAERSKLFDMLDPLKSERQGFNNKFDEKRKEMEPLQQALGKLRGND-GGSSRGPVICSS  172

Query  651  EAELNDYIKSLQYRIQHESITLNEEKQILREIKQFEGTRDKVIAHAAERAKIQESL  818
            + ELN  I S +YRIQHESI L EEKQ+L+EI+  EGTRDKVIA+ A RAKI+E++
Sbjct  173  QEELNSMIYSYEYRIQHESIPLTEEKQLLKEIRLLEGTRDKVIANEAMRAKIKEAM  228



>gb|AES67011.2| proton pump interactor, putative [Medicago truncatula]
Length=674

 Score =   186 bits (473),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 115/214 (54%), Positives = 149/214 (70%), Gaps = 7/214 (3%)
 Frame = +3

Query  177  ENGGSLKENGTVPNEPIKFGSHGAEEPIKEDVKKAPAINLPKDAVVEDWPAPQQIHSFYL  356
            ENG   K+ G    E IKFGSHG +E  K +V      N PKDA  E+WPAP+QIH FY 
Sbjct  95   ENGKLEKDVGA--GETIKFGSHG-DESAKVEVNDVADSNTPKDAA-EEWPAPKQIHYFYF  150

Query  357  VKYRTFEDqklkakleqaekelhkkNQARSVMIDNLRAKRAARSELINERKSLSAERQQF  536
            V+ R ++D  +KAK++  +KE+ KKNQAR  + + L+AKR+ +SELI++ K L  + +Q+
Sbjct  151  VRCRPYDDPSIKAKIDLLDKEISKKNQARFQITEALKAKRSEKSELISQIKILREDNRQY  210

Query  537  RSQMDEKRKVMEPLQQALGKLRGNNAGGRDQRSVIFSSEAELNDYIKSLQYRIQHESITL  716
            +S  DEK K +EPLQQALGKLR +N  GR     I  SE ELN +I  LQYRIQHESI L
Sbjct  211  QSLFDEKMKEIEPLQQALGKLRNSNNAGR---GGICQSEEELNKFINGLQYRIQHESIPL  267

Query  717  NEEKQILREIKQFEGTRDKVIAHAAERAKIQESL  818
             EEKQILREIKQ EGTR+KVIA++A R K+ +++
Sbjct  268  TEEKQILREIKQLEGTREKVIANSAMRTKLHDTI  301



>gb|KHG17422.1| Translation initiation factor IF-2 [Gossypium arboreum]
Length=480

 Score =   183 bits (464),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 113/231 (49%), Positives = 160/231 (69%), Gaps = 11/231 (5%)
 Frame = +3

Query  147  LAHVSVETGSENGGSL---KENGTVPNEPIKFGS----HGAEEPIKEDVKKAPAINLPKD  305
            +A VSV+  +E   S    KENG +  +P+   +      +EEP K D   A   N P D
Sbjct  1    MAQVSVDKVAEVDQSFLLDKENGKLDKDPVHNETIPVIPRSEEPSKGDGNNASNDNFPTD  60

Query  306  AVVEDWPAPQQIHSFYLVKYRTFEDqklkakleqaekelhkkNQARSVMIDNLRAKRAAR  485
            AV ++WPA +Q+HSFY V+YR +ED ++KAK+++A+KEL K ++ R  + D L+AKR+ R
Sbjct  61   AV-DEWPAAKQVHSFYFVRYRLYEDPRIKAKIDEADKELQKWSKTRFKITDELKAKRSDR  119

Query  486  SELINERKSLSAERQQFRSQMDEKRKVMEPLQQALGKLRGNNAGGRDQRSVIFSSEAELN  665
            +EL+ + ++L+ + +Q++  +DEK+K +EPLQQALGKLR N+  GR     + SSE ELN
Sbjct  120  AELLAQVRALNVDFEQYKEILDEKKKEIEPLQQALGKLRTNSYTGR---GSMCSSEEELN  176

Query  666  DYIKSLQYRIQHESITLNEEKQILREIKQFEGTRDKVIAHAAERAKIQESL  818
            D I  LQYRIQHESI L EEKQ+L+EIK+ EGTR+ VI +AA RAKIQ+S+
Sbjct  177  DVIHCLQYRIQHESIPLAEEKQLLKEIKRLEGTREAVITNAAMRAKIQDSM  227



>emb|CAB43882.1| proton pump interactor [Arabidopsis thaliana]
 emb|CAB81400.1| proton pump interactor [Arabidopsis thaliana]
Length=628

 Score =   185 bits (469),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 130/254 (51%), Positives = 162/254 (64%), Gaps = 26/254 (10%)
 Frame = +3

Query  123  MGVDVES----KLAHVSVETGSENGGSLKENGTVPNEPIKFGSHGAEEP--IKEDVKKAP  284
            MGV+V +    ++A    E   E  G L + G   + PI FGS G E P   +E+  K  
Sbjct  1    MGVEVVNSGGFEVAPAPFEGKPEKNGKL-DQGKGDDAPINFGSVG-ELPKNAEENNNKVV  58

Query  285  AINLPKDAVVEDWPAPQQIHSFYLVKYRTFEDqklkakleqaekelhkkNQARSVMIDNL  464
              + PK+A  E+WP  +QIHSFYLVKYR++ D K+KAKL+ A+KEL K N+AR+ ++D L
Sbjct  59   NSDAPKNAA-EEWPVAKQIHSFYLVKYRSYADPKIKAKLDLADKELEKLNKARTGVLDKL  117

Query  465  RAKRAARSELINERKSLSAERQQFRSQMDEKRKVMEPLQQALGKLRGNNAGGRDQRSVIF  644
            RAKRA RSEL +    L +ER+ F +  DEKRK MEPLQQALGKLR N+ GG  +   I 
Sbjct  118  RAKRAERSELFDLLDPLKSERKGFNTMFDEKRKEMEPLQQALGKLRSND-GGSARGPAIC  176

Query  645  SSEAELNDY----------------IKSLQYRIQHESITLNEEKQILREIKQFEGTRDKV  776
            SSE ELN                  I S QYRIQHESI L EEKQIL+EI+  EGTRDKV
Sbjct  177  SSEEELNTLVSLFGILICLSLWKMKIYSYQYRIQHESIPLTEEKQILKEIRLLEGTRDKV  236

Query  777  IAHAAERAKIQESL  818
            IA+AA RAKI+ES+
Sbjct  237  IANAAMRAKIKESM  250



>emb|CDY56314.1| BnaC07g50300D [Brassica napus]
Length=465

 Score =   182 bits (461),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 108/176 (61%), Positives = 134/176 (76%), Gaps = 2/176 (1%)
 Frame = +3

Query  291  NLPKDAVVEDWPAPQQIHSFYLVKYRTFEDqklkakleqaekelhkkNQARSVMIDNLRA  470
            ++PKDA  E+WPA +QI SFY VKYR F+D K+KAKL+ A+KEL K ++ARS + + L+A
Sbjct  53   DVPKDAA-EEWPAAKQIRSFYFVKYRHFDDPKIKAKLDVADKELEKLSKARSAVYEQLKA  111

Query  471  KRAARSELINERKSLSAERQQFRSQMDEKRKVMEPLQQALGKLRGNNAGGRDQRSVIFSS  650
            KRA RSEL +    L  ERQ + ++ DEKRK MEPLQQALGKLRGN+ GG  +   I SS
Sbjct  112  KRAERSELFDLLDPLKTERQGYNTKFDEKRKEMEPLQQALGKLRGND-GGNARGPAICSS  170

Query  651  EAELNDYIKSLQYRIQHESITLNEEKQILREIKQFEGTRDKVIAHAAERAKIQESL  818
            E ELN+ I S QYRIQHESI L EEKQ+L+EI+  EGTRDKVIA+ A RAKI+ES+
Sbjct  171  EEELNNMIYSYQYRIQHESIPLTEEKQLLKEIRLLEGTRDKVIANEAVRAKIKESM  226



>ref|XP_009137666.1| PREDICTED: proton pump-interactor 1-like [Brassica rapa]
Length=605

 Score =   182 bits (462),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 108/176 (61%), Positives = 134/176 (76%), Gaps = 2/176 (1%)
 Frame = +3

Query  291  NLPKDAVVEDWPAPQQIHSFYLVKYRTFEDqklkakleqaekelhkkNQARSVMIDNLRA  470
            ++PKDA  E+WPA +QI SFY VKYR F+D K+KAKL+ A+KEL K ++ARS + + L+A
Sbjct  56   DVPKDAA-EEWPAAKQIRSFYFVKYRHFDDPKIKAKLDVADKELEKLSKARSAVYEQLKA  114

Query  471  KRAARSELINERKSLSAERQQFRSQMDEKRKVMEPLQQALGKLRGNNAGGRDQRSVIFSS  650
            KRA RSEL +    L  ERQ + ++ DEKRK MEPLQQALGKLRGN+ GG  +   I SS
Sbjct  115  KRAERSELFDLLDPLKTERQGYNTKFDEKRKEMEPLQQALGKLRGND-GGSARGPAICSS  173

Query  651  EAELNDYIKSLQYRIQHESITLNEEKQILREIKQFEGTRDKVIAHAAERAKIQESL  818
            E ELN+ I S QYRIQHESI L EEKQ+L+EI+  EGTRDKVIA+ A RAKI+ES+
Sbjct  174  EEELNNMIYSYQYRIQHESIPLTEEKQLLKEIRLLEGTRDKVIANEAVRAKIKESM  229



>emb|CDY29843.1| BnaA03g48640D [Brassica napus]
Length=600

 Score =   182 bits (461),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 108/176 (61%), Positives = 134/176 (76%), Gaps = 2/176 (1%)
 Frame = +3

Query  291  NLPKDAVVEDWPAPQQIHSFYLVKYRTFEDqklkakleqaekelhkkNQARSVMIDNLRA  470
            ++PKDA  E+WPA +QI SFY VKYR F+D K+KAKL+ A+KEL K ++ARS + + L+A
Sbjct  56   DVPKDAA-EEWPAAKQIRSFYFVKYRHFDDPKIKAKLDVADKELEKLSKARSAVYEQLKA  114

Query  471  KRAARSELINERKSLSAERQQFRSQMDEKRKVMEPLQQALGKLRGNNAGGRDQRSVIFSS  650
            KRA RSEL +    L  ERQ + ++ DEKRK MEPLQQALGKLRGN+ GG  +   I SS
Sbjct  115  KRAERSELFDLLDPLKTERQGYNTKFDEKRKEMEPLQQALGKLRGND-GGSARGPAICSS  173

Query  651  EAELNDYIKSLQYRIQHESITLNEEKQILREIKQFEGTRDKVIAHAAERAKIQESL  818
            E ELN+ I S QYRIQHESI L EEKQ+L+EI+  EGTRDKVIA+ A RAKI+ES+
Sbjct  174  EEELNNMIYSYQYRIQHESIPLTEEKQLLKEIRLLEGTRDKVIANEAVRAKIKESM  229



>gb|KJB13348.1| hypothetical protein B456_002G069700 [Gossypium raimondii]
Length=630

 Score =   182 bits (461),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 114/231 (49%), Positives = 160/231 (69%), Gaps = 11/231 (5%)
 Frame = +3

Query  147  LAHVSVETGSENGGSL---KENGTVPNEPIKFGS----HGAEEPIKEDVKKAPAINLPKD  305
            +A VSV+  +E   S    KENG +  +P+   +       EEP K D   A   N P D
Sbjct  1    MAQVSVDKVAEVDQSFLLDKENGKLDEDPVHNETIPVVPRCEEPSKGDGNNASNDNFPTD  60

Query  306  AVVEDWPAPQQIHSFYLVKYRTFEDqklkakleqaekelhkkNQARSVMIDNLRAKRAAR  485
            AV ++WPA +Q+HSF+ V+YR +ED K+KAK+++A+KEL K ++ R  + D L+AKR+ R
Sbjct  61   AV-DEWPAAKQVHSFHFVRYRLYEDPKIKAKIDEADKELQKWSKTRFKITDELKAKRSDR  119

Query  486  SELINERKSLSAERQQFRSQMDEKRKVMEPLQQALGKLRGNNAGGRDQRSVIFSSEAELN  665
            +EL+ + ++L+ + +Q++  +DEK+K +EPLQQALGKLR N+  GR     + SSE ELN
Sbjct  120  AELLAQVRALNVDFEQYKEILDEKKKEIEPLQQALGKLRTNSYTGR---GSMCSSEEELN  176

Query  666  DYIKSLQYRIQHESITLNEEKQILREIKQFEGTRDKVIAHAAERAKIQESL  818
            D I SLQYRIQHESI L EEKQ+L+EIK+ EGTR+ VI +AA RAKIQ+S+
Sbjct  177  DVIHSLQYRIQHESIPLAEEKQLLKEIKRLEGTREAVITNAAMRAKIQDSM  227



>ref|XP_010925566.1| PREDICTED: proton pump-interactor 1-like [Elaeis guineensis]
 ref|XP_010925567.1| PREDICTED: proton pump-interactor 1-like [Elaeis guineensis]
Length=631

 Score =   181 bits (459),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 104/177 (59%), Positives = 141/177 (80%), Gaps = 1/177 (1%)
 Frame = +3

Query  288  INLPKDAVVEDWPAPQQIHSFYLVKYRTFEDqklkakleqaekelhkkNQARSVMIDNLR  467
            +N PKDAV ++WPAP+QIH+   VKYR++ED KL+AK+EQA+KE+ KKNQAR  + + LR
Sbjct  69   LNFPKDAV-DEWPAPKQIHTLCFVKYRSYEDPKLRAKIEQADKEIQKKNQARFQITEALR  127

Query  468  AKRAARSELINERKSLSAERQQFRSQMDEKRKVMEPLQQALGKLRGNNAGGRDQRSVIFS  647
            AKR+ R+++I++ K L+AE +Q+R  MDEKRK M+P Q+ALGKLR  N   R++   + S
Sbjct  128  AKRSERAQVISQLKPLTAEDKQYRMIMDEKRKEMKPFQEALGKLRSANNDVREKGMGLCS  187

Query  648  SEAELNDYIKSLQYRIQHESITLNEEKQILREIKQFEGTRDKVIAHAAERAKIQESL  818
            SE ELN+ I+SL YR+QHES+TL EEKQ+++EIKQ EGTR+KV  +AA RAKIQ+SL
Sbjct  188  SEEELNELIQSLHYRMQHESLTLVEEKQLMKEIKQLEGTREKVSINAAMRAKIQDSL  244



>emb|CDX97389.1| BnaC08g12540D [Brassica napus]
Length=616

 Score =   181 bits (458),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 107/176 (61%), Positives = 135/176 (77%), Gaps = 2/176 (1%)
 Frame = +3

Query  291  NLPKDAVVEDWPAPQQIHSFYLVKYRTFEDqklkakleqaekelhkkNQARSVMIDNLRA  470
            ++PKDA  E+WPA +QI SFY VKYR  +D K+KAKLE A+KE+ K N+ARS +I+ LRA
Sbjct  52   DVPKDAA-EEWPAAKQIRSFYFVKYRRNDDPKIKAKLEVADKEVEKLNKARSAVIEELRA  110

Query  471  KRAARSELINERKSLSAERQQFRSQMDEKRKVMEPLQQALGKLRGNNAGGRDQRSVIFSS  650
            K+A RS+L +    L +ERQ F ++ DEKRK MEPLQQALGKLRGN+ GG  +  VI SS
Sbjct  111  KKAERSKLFDMLDPLKSERQGFNNKFDEKRKEMEPLQQALGKLRGND-GGSSRGPVICSS  169

Query  651  EAELNDYIKSLQYRIQHESITLNEEKQILREIKQFEGTRDKVIAHAAERAKIQESL  818
            + ELN  I S +YRIQHESI L EEKQ+L+EI+  EGTRDKVIA+ A RAKI+E++
Sbjct  170  QEELNSMIYSYEYRIQHESIPLTEEKQLLKEIRLLEGTRDKVIANEAMRAKIKEAM  225



>ref|XP_008386183.1| PREDICTED: proton pump-interactor 1-like [Malus domestica]
Length=609

 Score =   179 bits (455),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 112/236 (47%), Positives = 160/236 (68%), Gaps = 13/236 (6%)
 Frame = +3

Query  114  IEIMGVDVESKLAHVSVETGSENGGSLKENGTVP-----NEPIKFGSHGAEEPIKEDVKK  278
            +E++G +V        V   +E G S KENG +      NEPI+FGSHG +E  K++V +
Sbjct  3    VEVVGFEV----IQGPVGAVTEGGNSAKENGKLDQGPGGNEPIQFGSHG-DESDKKEVNE  57

Query  279  APAINLPKDAVVEDWPAPQQIHSFYLVKYRTFEDqklkakleqaekelhkkNQARSVMID  458
                N PKDAV ++WPAP+QIHSFY V++RT +D K+K +++ A KE++++N+AR  +I+
Sbjct  58   VSVPNFPKDAV-DEWPAPKQIHSFYFVRHRTIDDPKIKVRIDHASKEVNERNKARQDIIE  116

Query  459  NLRAKRAARSELINERKSLSAERQQFRSQMDEKRKVMEPLQQALGKLRGNNAGGRDQRSV  638
             LRAKR  RSELI + K+L  + +Q RS +DEK K ++PL+QALG++R  +   R     
Sbjct  117  ALRAKRTERSELIEKIKALRNDNRQIRSIVDEKFKDLQPLRQALGEIRSADTASRS--GG  174

Query  639  IFSSEAELNDYIKSLQYRIQHESITLNEEKQILREIKQFEGTRDKVIAHAAERAKI  806
            + SSE ELN  I+ LQY +QHESI L+EEK+IL+E+K  E TR +VIA  AE AK+
Sbjct  175  LCSSEEELNSRIQGLQYYMQHESIPLSEEKKILKEMKALENTRGQVIAREAELAKL  230



>ref|XP_009356802.1| PREDICTED: proton pump-interactor 1 [Pyrus x bretschneideri]
Length=608

 Score =   179 bits (454),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 109/216 (50%), Positives = 153/216 (71%), Gaps = 9/216 (4%)
 Frame = +3

Query  174  SENGGSLKENGTVP-----NEPIKFGSHGAEEPIKEDVKKAPAINLPKDAVVEDWPAPQQ  338
            +E G S+ ENG +      NEPI+FGSHG +E  K++V +    N PKDAV ++WPAP+Q
Sbjct  19   TEGGNSVMENGKLDQGPGGNEPIQFGSHG-DESDKKEVNEVSVSNFPKDAV-DEWPAPKQ  76

Query  339  IHSFYLVKYRTFEDqklkakleqaekelhkkNQARSVMIDNLRAKRAARSELINERKSLS  518
            IH FY V++RT +D K+KA+++ A KE +++N+AR  +I+ LRAKR  RSELI + K+L 
Sbjct  77   IHYFYFVRHRTIDDPKIKARIDHASKEANERNKARQDIIEELRAKRIERSELIEKIKALR  136

Query  519  AERQQFRSQMDEKRKVMEPLQQALGKLRGNNAGGRDQRSVIFSSEAELNDYIKSLQYRIQ  698
            ++ +Q RS +DEK K ++PL+QALG+LR  +   R+    + SSE ELN  I+ LQY IQ
Sbjct  137  SDNRQIRSIVDEKFKDLQPLRQALGELRSADTASRN--GGLCSSEEELNSRIQGLQYYIQ  194

Query  699  HESITLNEEKQILREIKQFEGTRDKVIAHAAERAKI  806
            HESI L+EEK+IL+E+K  E TR +VIA  AE AK+
Sbjct  195  HESIPLSEEKKILKEMKALENTRGQVIAREAELAKL  230



>ref|XP_008794130.1| PREDICTED: proton pump-interactor 1-like isoform X2 [Phoenix 
dactylifera]
 ref|XP_008794131.1| PREDICTED: proton pump-interactor 1-like isoform X2 [Phoenix 
dactylifera]
Length=632

 Score =   177 bits (449),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 110/201 (55%), Positives = 150/201 (75%), Gaps = 6/201 (3%)
 Frame = +3

Query  228  KFGS----HGAEEPIKEDVKKAPAINLPKDAVVEDWPAPQQIHSFYLVKYRTFEDqklka  395
            KFGS    HG     KE  + A  +N PKDAV ++WPAP+Q H+FY VK+R++ED KLKA
Sbjct  46   KFGSVDDSHGVNGEGKEGDRVA-NVNFPKDAV-DEWPAPKQFHTFYFVKHRSYEDPKLKA  103

Query  396  kleqaekelhkkNQARSVMIDNLRAKRAARSELINERKSLSAERQQFRSQMDEKRKVMEP  575
            K+EQA+KE+ KKN+ R  + + L+AKR+ R+++I++ K L+AE +Q+R  MDEKRK M+P
Sbjct  104  KIEQADKEIRKKNEHRFQITEALKAKRSERAQVISQLKPLTAEDKQYRMIMDEKRKEMKP  163

Query  576  LQQALGKLRGNNAGGRDQRSVIFSSEAELNDYIKSLQYRIQHESITLNEEKQILREIKQF  755
              +ALGKLR  N   R++   + SSE ELN+ I+S  Y +QHES+TL EEKQ+++EIKQ 
Sbjct  164  FHEALGKLRSANNDVREKGMGLCSSEEELNELIESRHYHMQHESLTLVEEKQLIKEIKQL  223

Query  756  EGTRDKVIAHAAERAKIQESL  818
            EGTR+KVIA+AA RAKIQ+SL
Sbjct  224  EGTREKVIANAAMRAKIQDSL  244



>ref|XP_008794129.1| PREDICTED: proton pump-interactor 1-like isoform X1 [Phoenix 
dactylifera]
Length=637

 Score =   177 bits (449),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 110/201 (55%), Positives = 150/201 (75%), Gaps = 6/201 (3%)
 Frame = +3

Query  228  KFGS----HGAEEPIKEDVKKAPAINLPKDAVVEDWPAPQQIHSFYLVKYRTFEDqklka  395
            KFGS    HG     KE  + A  +N PKDAV ++WPAP+Q H+FY VK+R++ED KLKA
Sbjct  51   KFGSVDDSHGVNGEGKEGDRVA-NVNFPKDAV-DEWPAPKQFHTFYFVKHRSYEDPKLKA  108

Query  396  kleqaekelhkkNQARSVMIDNLRAKRAARSELINERKSLSAERQQFRSQMDEKRKVMEP  575
            K+EQA+KE+ KKN+ R  + + L+AKR+ R+++I++ K L+AE +Q+R  MDEKRK M+P
Sbjct  109  KIEQADKEIRKKNEHRFQITEALKAKRSERAQVISQLKPLTAEDKQYRMIMDEKRKEMKP  168

Query  576  LQQALGKLRGNNAGGRDQRSVIFSSEAELNDYIKSLQYRIQHESITLNEEKQILREIKQF  755
              +ALGKLR  N   R++   + SSE ELN+ I+S  Y +QHES+TL EEKQ+++EIKQ 
Sbjct  169  FHEALGKLRSANNDVREKGMGLCSSEEELNELIESRHYHMQHESLTLVEEKQLIKEIKQL  228

Query  756  EGTRDKVIAHAAERAKIQESL  818
            EGTR+KVIA+AA RAKIQ+SL
Sbjct  229  EGTREKVIANAAMRAKIQDSL  249



>ref|XP_008367008.1| PREDICTED: proton pump-interactor 1-like [Malus domestica]
Length=608

 Score =   177 bits (448),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 109/216 (50%), Positives = 152/216 (70%), Gaps = 9/216 (4%)
 Frame = +3

Query  174  SENGGSLKENGTVP-----NEPIKFGSHGAEEPIKEDVKKAPAINLPKDAVVEDWPAPQQ  338
            +E G S KENG +      NEPI+FGSHG +E  K++V +    N PKDAV ++WPAP+Q
Sbjct  19   TEGGNSAKENGKLDQGPGGNEPIQFGSHG-DESDKKEVNEVSVSNFPKDAV-DEWPAPKQ  76

Query  339  IHSFYLVKYRTFEDqklkakleqaekelhkkNQARSVMIDNLRAKRAARSELINERKSLS  518
            IH FY V++RT +D K+KA+++ A KE++++N+AR  +I+ LRAKR  RSELI + K+L 
Sbjct  77   IHYFYFVRHRTIDDPKIKARIDHASKEVNERNKARQDIIEELRAKRIERSELIEKIKALR  136

Query  519  AERQQFRSQMDEKRKVMEPLQQALGKLRGNNAGGRDQRSVIFSSEAELNDYIKSLQYRIQ  698
             + +Q RS +DEK K ++PL+ ALG+LR  +   R+    + SSE ELN  I+ LQY IQ
Sbjct  137  NDNRQIRSIVDEKFKDLQPLRHALGELRSADTASRN--GGLCSSEEELNSRIQGLQYYIQ  194

Query  699  HESITLNEEKQILREIKQFEGTRDKVIAHAAERAKI  806
            HESI L+EEK+IL+E+K  E TR +VIA  AE AK+
Sbjct  195  HESIPLSEEKKILKEMKALENTRGQVIAREAELAKL  230



>ref|XP_004296510.1| PREDICTED: proton pump-interactor 1 [Fragaria vesca subsp. vesca]
 ref|XP_011462389.1| PREDICTED: proton pump-interactor 1 [Fragaria vesca subsp. vesca]
Length=610

 Score =   176 bits (445),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 118/225 (52%), Positives = 155/225 (69%), Gaps = 16/225 (7%)
 Frame = +3

Query  168  TGSENGGSLKENGTVP-----NEPIKFGSHGAEEPIKEDVKKAPAINLPKDAVVEDWPAP  332
            T SE   S KENG +       EPIKFGSHG +E +K++     A N PKDAV ++WPAP
Sbjct  17   TASEGENSAKENGKLGEGPGHKEPIKFGSHG-DEMVKKEGNGVVAPNFPKDAV-DEWPAP  74

Query  333  QQIHSFYLVKYRTFEDqklkakleqaekelhkkNQARSVMIDNLRAKRAARSELINERKS  512
            +QIHSFY V++RT++D KLKAK+EQA  E+ KKNQARS +++ L AKR+ RSELI + K+
Sbjct  75   RQIHSFYFVRHRTYDDPKLKAKIEQANVEVQKKNQARSRVLETLNAKRSERSELIEQIKA  134

Query  513  LSAERQQFRSQMDEKRKVMEPLQQALGKLR---GNNAGGRDQRSVIFSSEAELNDYIKSL  683
            L ++  +    + EK K + PL+Q L K+R    N+ GG      + SSE EL+  IK L
Sbjct  135  LRSDNYEISKIVGEKFKEIAPLRQDLKKVRSAHANHNGG------LCSSEVELDARIKGL  188

Query  684  QYRIQHESITLNEEKQILREIKQFEGTRDKVIAHAAERAKIQESL  818
            QY IQHESI L+EEK+IL+EIKQ E TR +VIA+A  RAKIQ+S+
Sbjct  189  QYIIQHESIPLSEEKKILKEIKQLENTRGEVIANAVVRAKIQDSV  233



>ref|XP_009340981.1| PREDICTED: proton pump-interactor 1-like [Pyrus x bretschneideri]
 ref|XP_009340988.1| PREDICTED: proton pump-interactor 1-like [Pyrus x bretschneideri]
 ref|XP_009340994.1| PREDICTED: proton pump-interactor 1-like [Pyrus x bretschneideri]
 ref|XP_009341003.1| PREDICTED: proton pump-interactor 1-like [Pyrus x bretschneideri]
 ref|XP_009341010.1| PREDICTED: proton pump-interactor 1-like [Pyrus x bretschneideri]
Length=609

 Score =   172 bits (436),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 110/236 (47%), Positives = 158/236 (67%), Gaps = 13/236 (6%)
 Frame = +3

Query  114  IEIMGVDVESKLAHVSVETGSENGGSLKENGTVP-----NEPIKFGSHGAEEPIKEDVKK  278
            +E++G +V        V   +E G S KENG +      NEPI+FGSHG +E  K++  +
Sbjct  3    VEVVGFEV----IQGPVGAVTEGGNSAKENGKLDQGPGGNEPIQFGSHG-DESDKKEANE  57

Query  279  APAINLPKDAVVEDWPAPQQIHSFYLVKYRTFEDqklkakleqaekelhkkNQARSVMID  458
                N PKDAV ++WPAP+QIH FY V++RT +D K+KA+++ A KE++++N+AR  +I+
Sbjct  58   VSVPNFPKDAV-DEWPAPKQIHYFYFVRHRTIDDPKIKARIDHASKEVNERNKARQDIIE  116

Query  459  NLRAKRAARSELINERKSLSAERQQFRSQMDEKRKVMEPLQQALGKLRGNNAGGRDQRSV  638
             LRAKR  RSELI + K+L  + +Q RS + EK K ++PL+QALG++R  +   R     
Sbjct  117  ALRAKRIERSELIEKIKALRNDNRQIRSIVGEKFKDLQPLRQALGEIRSADTASRS--GG  174

Query  639  IFSSEAELNDYIKSLQYRIQHESITLNEEKQILREIKQFEGTRDKVIAHAAERAKI  806
            + SSE ELN  I+ LQY +QHESI L+EEK+IL+E+K  E TR +VIA  AE AK+
Sbjct  175  LCSSEEELNSRIQGLQYYMQHESIPLSEEKKILKEMKALENTRGQVIAREAELAKL  230



>ref|XP_010091118.1| hypothetical protein L484_011324 [Morus notabilis]
 gb|EXB42553.1| hypothetical protein L484_011324 [Morus notabilis]
Length=686

 Score =   171 bits (434),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 126/296 (43%), Positives = 170/296 (57%), Gaps = 70/296 (24%)
 Frame = +3

Query  123  MGVDVES-KLAHVSVETGSENGGSL---KENGTV-----PNEPIKFGSHGAEEPIKEDVK  275
            MGV+V   ++    VET +    S+   KENG +      +EPI+FGSHG EEP+KE+  
Sbjct  1    MGVEVAGFEMVQGPVETATVGDNSVLHEKENGKLDQGMRSHEPIQFGSHG-EEPVKEEQN  59

Query  276  KAPAINLPKDAVVEDWPAPQQIHSFYLVKYRTFEDqklkakleqaekelhkkNQAR----  443
                + LPKDAV ++WPAP+QIH FY ++ R ++D K+KAK++QA  E+ K+ QAR    
Sbjct  60   GVSEVKLPKDAV-DEWPAPKQIHYFYFIRCRPYDDPKIKAKIDQAAIEIEKRTQARIKIT  118

Query  444  ------------SVMIDNLRA----------------KR---------------------  476
                        S+ ++ L+A                KR                     
Sbjct  119  DQLKAKRLCDRCSIRVEALKAVFKIAQSIACLEVRLSKRRSQLKIRLKPHKGDKKCTPLS  178

Query  477  --AARSELINERKSLSAERQQFRSQMDEKRKVMEPLQQALGKLRGNNAGGRDQRSVIFSS  650
              + R+ELI++ ++L  + +Q R+ +DEK K +EPL QALGKLR  N   R     + SS
Sbjct  179  TESDRAELISQIRALKDDNRQIRTIVDEKIKEIEPLHQALGKLRNANNATRG----VCSS  234

Query  651  EAELNDYIKSLQYRIQHESITLNEEKQILREIKQFEGTRDKVIAHAAERAKIQESL  818
            E ELN  I SLQYRIQHESI L+EEKQILREIKQ E TR+KV+A+AA RAKIQES+
Sbjct  235  EEELNSLIHSLQYRIQHESIPLSEEKQILREIKQLESTREKVVANAAMRAKIQESM  290



>emb|CDY19058.1| BnaC01g20100D, partial [Brassica napus]
Length=609

 Score =   170 bits (430),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 107/212 (50%), Positives = 132/212 (62%), Gaps = 32/212 (15%)
 Frame = +3

Query  225  IKFGSHG-----AEEPIKEDVKKAPAI---NLPKDAVVEDWPAPQQIHSFYLVKYRTFED  380
            IKFGS G     A+E    +      +   ++PKDA  E+WPA +QIHSFY VK+   E 
Sbjct  69   IKFGSLGEPPKKAQENNNNNNNNNNNVLISDVPKDAA-EEWPAGKQIHSFYFVKHPELE-  126

Query  381  qklkakleqaekelhkkNQARSVMIDNLRAKR------AARSELINERKSLSAERQQFRS  542
                           K N+AR+ + D L+AKR      A RSEL +    L AERQ F +
Sbjct  127  ---------------KLNKARAAVFDQLKAKRFLFDALAERSELFDLLDPLKAERQGFNT  171

Query  543  QMDEKRKVMEPLQQALGKLRGNNAGGRDQRSVIFSSEAELNDYIKSLQYRIQHESITLNE  722
            + +EKRK MEPLQQALGKLRGN+ GG  +   I SSE ELN+ I S QYRIQHESI L E
Sbjct  172  KFEEKRKEMEPLQQALGKLRGND-GGSARGPAICSSEEELNNMIYSYQYRIQHESIPLTE  230

Query  723  EKQILREIKQFEGTRDKVIAHAAERAKIQESL  818
            EKQ+L+EI+  EGTRDKVIA+ A RAKI+ES+
Sbjct  231  EKQLLKEIRLLEGTRDKVIANEAVRAKIKESM  262



>ref|XP_006859020.1| hypothetical protein AMTR_s00068p00168490 [Amborella trichopoda]
 gb|ERN20487.1| hypothetical protein AMTR_s00068p00168490 [Amborella trichopoda]
Length=640

 Score =   170 bits (430),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 113/235 (48%), Positives = 161/235 (69%), Gaps = 13/235 (6%)
 Frame = +3

Query  126  GVDVESKLAHVSVETGSENGGSLKENGTVPNEPIKF----GSHGAEEPIKEDVKKAPAIN  293
            G +VE+ L+H      +E G  ++ +   P   +KF    GSHGA   IK   +    I+
Sbjct  35   GKEVENTLSH-----ETEGGKPVQSSEAEPA--MKFDVLDGSHGANGSIKGGAEGVGDIS  87

Query  294  LPKDAVVEDWPAPQQIHSFYLVKYRTFEDqklkakleqaekelhkkNQARSVMIDNLRAK  473
             PKDA  ++WP   ++H+FY +++R++ED KLK K+EQA+KEL KKNQ R  + + L+AK
Sbjct  88   FPKDAS-DEWPE-TKVHTFYFIRFRSYEDPKLKIKIEQADKELQKKNQDRYQITEALKAK  145

Query  474  RAARSELINERKSLSAERQQFRSQMDEKRKVMEPLQQALGKLRGNNAGGRDQRSVIFSSE  653
            RA R ++I + K L+++++++R  +DEK+K +EPL+ ALGKLR  N   R++   + SSE
Sbjct  146  RAERVQVIEKLKPLTSQQKEYRKALDEKKKELEPLRAALGKLRNANNPNRERGMGLCSSE  205

Query  654  AELNDYIKSLQYRIQHESITLNEEKQILREIKQFEGTRDKVIAHAAERAKIQESL  818
             ELN+ I+SLQY IQHES TL EEKQ+LR+IKQ EGTR+KVIAH A + KIQESL
Sbjct  206  RELNERIQSLQYCIQHESNTLVEEKQMLRDIKQLEGTREKVIAHEAMQTKIQESL  260



>ref|XP_003610440.1| hypothetical protein MTR_4g132200 [Medicago truncatula]
 gb|AES92637.1| proton pump interactor, putative [Medicago truncatula]
Length=606

 Score =   157 bits (398),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 107/220 (49%), Positives = 152/220 (69%), Gaps = 14/220 (6%)
 Frame = +3

Query  171  GSENGGSLKENGTVPNEPIKFGSHG---AEEPIKEDVKKAPAINLPKDAVVEDWPAPQQI  341
            G +NG   K++G    + I FGS G    E    +DV  +   N PK+ V E++PAP QI
Sbjct  15   GKDNGKLEKDSGA--GDTIIFGSFGDGFVEGDANDDVADS---NTPKN-VAEEFPAPMQI  68

Query  342  HSFYLVKYRTFEDqklkakleqaekelhkkNQARSVMIDNLRAKRAARSELINERKSLSA  521
            HSFY  ++R ++D  +KAK++Q +KE++KKN+AR  + + L AK + RSELI++ K L  
Sbjct  69   HSFYFFRWRPYDDPSIKAKIDQLDKEINKKNEARFQITEALNAKWSKRSELISQIKILRG  128

Query  522  ERQQFRSQMDEKRKVMEPLQQALGKLRG-NNAGGRDQRSVIFSSEAELNDYIKSLQYRIQ  698
            + +Q +S ++EK + ++PLQQAL KLR  NNAG    R  I SSE ELND I SLQYRIQ
Sbjct  129  DNKQLQSIINEKMEEIQPLQQALRKLRNLNNAG----RRRICSSEEELNDTIYSLQYRIQ  184

Query  699  HESITLNEEKQILREIKQFEGTRDKVIAHAAERAKIQESL  818
            HESI LNEE+QI+REIK+ E TR+KVIA++A + K+++++
Sbjct  185  HESIPLNEERQIVREIKKLEDTREKVIANSAMKTKLEDTI  224



>gb|KJB61847.1| hypothetical protein B456_009G3861001, partial [Gossypium raimondii]
Length=339

 Score =   149 bits (377),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 97/236 (41%), Positives = 139/236 (59%), Gaps = 47/236 (20%)
 Frame = +3

Query  123  MGVDV-ESKLAHVSVETGSENGGS-LKENGTVPNEPIKFG--SHGAEEPIKEDVKKAPAI  290
            MGV+V +S LA +S++  +E   S L ENG +  +P+      +GA +P           
Sbjct  1    MGVEVVDSDLAQLSIDKVTEVDKSFLHENGKLDKDPVYNNPIENGASDP-----------  49

Query  291  NLPKDAVVEDWPAPQQIHSFYLVKYRTFEDqklkakleqaekelhkkNQARSVMIDNLRA  470
            + PKDAVVE WPAP+QIHSF+ +                          +R  + D L+A
Sbjct  50   DFPKDAVVE-WPAPKQIHSFHFI--------------------------SRFKLTDELKA  82

Query  471  KRAARSELINERKSLSAERQQFRSQMDEKRKVMEPLQQALGKLRGNNAGGRDQRSVIFSS  650
            KRA RS+++++ ++L+ + +QF++ +DEK+  +EPLQQALGKLR       D   V    
Sbjct  83   KRAERSDMLSQVRALNVDFEQFKTILDEKKMEIEPLQQALGKLRKIKMLIIDLVYVHLRK  142

Query  651  EAELNDYIKSLQYRIQHESITLNEEKQILREIKQFEGTRDKVIAHAAERAKIQESL  818
             +     I  LQYRIQHE I+L+EEK+IL+EIK  EGTR+KVIA+AA R+KIQ+SL
Sbjct  143  SS-----ILFLQYRIQHEGISLSEEKRILKEIKHLEGTREKVIANAAMRSKIQDSL  193



>ref|XP_006665154.1| PREDICTED: proton pump-interactor 1-like, partial [Oryza brachyantha]
Length=308

 Score =   147 bits (370),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 100/227 (44%), Positives = 140/227 (62%), Gaps = 1/227 (0%)
 Frame = +3

Query  138  ESKLAHVSVETGSENGGSLKENGTVPNEPIKFGSHGAEEPIKEDVKKAPAINLPKDAVVE  317
            E+ L+ V    G +N    KE+     E  +    G E            +  PKDAV +
Sbjct  7    EATLSQVKAVDGEDNIFQDKESRATAKERGEAALFGLENTAPNGAINPADLAPPKDAV-D  65

Query  318  DWPAPQQIHSFYLVKYRTFEDqklkakleqaekelhkkNQARSVMIDNLRAKRAARSELI  497
            +WP P+Q HSF+ VK R +ED  LK KL+QA+KE  KK QARS + + LR KR  RS +I
Sbjct  66   EWPEPKQTHSFFFVKVRPYEDPNLKMKLDQADKECQKKIQARSHIFEALRTKRNERSNII  125

Query  498  NERKSLSAERQQFRSQMDEKRKVMEPLQQALGKLRGNNAGGRDQRSVIFSSEAELNDYIK  677
            +E K L+AE +Q+   +  K K +EPLQ++LGK R  N   R Q + + SS  EL+  IK
Sbjct  126  SELKPLTAENKQYNVVVSGKLKEIEPLQKSLGKFRSENNAMRAQGAGLCSSIEELDQLIK  185

Query  678  SLQYRIQHESITLNEEKQILREIKQFEGTRDKVIAHAAERAKIQESL  818
            SL  RI HESI+L+EEK++++EIKQ  GTR KV+ +AA+RAK+Q+++
Sbjct  186  SLNDRICHESISLDEEKRLVKEIKQLNGTRSKVVENAAKRAKMQDTV  232



>gb|EEC83520.1| hypothetical protein OsI_29109 [Oryza sativa Indica Group]
Length=624

 Score =   150 bits (380),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 100/228 (44%), Positives = 145/228 (64%), Gaps = 0/228 (0%)
 Frame = +3

Query  135  VESKLAHVSVETGSENGGSLKENGTVPNEPIKFGSHGAEEPIKEDVKKAPAINLPKDAVV  314
             E+ L+ V+   G +N    KE+     E  +    G E  +  +   + A   P   VV
Sbjct  6    AEATLSQVTAVDGEDNLFQDKESRATAKERGEAAVFGLENIVTANGATSAADLAPPKDVV  65

Query  315  EDWPAPQQIHSFYLVKYRTFEDqklkakleqaekelhkkNQARSVMIDNLRAKRAARSEL  494
            ++WP P+Q H+F+ V+ R++ED  LKAKLEQA+KE  KK QARS + + LR KR+ RS +
Sbjct  66   DEWPEPKQTHTFFFVRIRSYEDPSLKAKLEQADKECQKKIQARSHIFEALRTKRSERSNI  125

Query  495  INERKSLSAERQQFRSQMDEKRKVMEPLQQALGKLRGNNAGGRDQRSVIFSSEAELNDYI  674
            I+E K L+AE +Q+   +  K K +EPLQ++LGK R  N   R Q + + SS  EL+  I
Sbjct  126  ISELKPLAAENKQYNEVVSGKLKEIEPLQKSLGKFRSENNAMRAQGAGLCSSIEELDQLI  185

Query  675  KSLQYRIQHESITLNEEKQILREIKQFEGTRDKVIAHAAERAKIQESL  818
            KSL  RI HESI+L+EEK++++EIKQ  GTR KVI +AA+RAK+Q+++
Sbjct  186  KSLNDRISHESISLDEEKRLVKEIKQLNGTRSKVIENAAKRAKMQDTV  233



>ref|NP_001061721.1| Os08g0390000 [Oryza sativa Japonica Group]
 dbj|BAD05346.1| putative proton pump interactor [Oryza sativa Japonica Group]
 dbj|BAD11329.1| BRI1-KD interacting protein 131 [Oryza sativa Japonica Group]
 dbj|BAF23635.1| Os08g0390000 [Oryza sativa Japonica Group]
 gb|EAZ42613.1| hypothetical protein OsJ_27178 [Oryza sativa Japonica Group]
 dbj|BAG90456.1| unnamed protein product [Oryza sativa Japonica Group]
Length=621

 Score =   148 bits (373),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 99/228 (43%), Positives = 144/228 (63%), Gaps = 0/228 (0%)
 Frame = +3

Query  135  VESKLAHVSVETGSENGGSLKENGTVPNEPIKFGSHGAEEPIKEDVKKAPAINLPKDAVV  314
             E+ L+ V+   G +N    KE+     E  +    G E  +  +   + A   P   VV
Sbjct  6    AEATLSQVTAVDGEDNLFQDKESRATAKERGEAAVFGLENIVTANGATSAADLAPPKDVV  65

Query  315  EDWPAPQQIHSFYLVKYRTFEDqklkakleqaekelhkkNQARSVMIDNLRAKRAARSEL  494
            ++WP P+Q H+F+ V+  ++ED  LKAKLEQA+KE  KK QARS + + LR KR+ RS +
Sbjct  66   DEWPEPKQTHTFFFVRICSYEDPSLKAKLEQADKECQKKIQARSHIFEALRTKRSERSNI  125

Query  495  INERKSLSAERQQFRSQMDEKRKVMEPLQQALGKLRGNNAGGRDQRSVIFSSEAELNDYI  674
            I+E K L+AE +Q+   +  K K +EPLQ++LGK R  N   R Q + + SS  EL+  I
Sbjct  126  ISELKPLAAENKQYNEVVSGKLKEIEPLQKSLGKFRSENNAMRAQGAGLCSSIEELDQLI  185

Query  675  KSLQYRIQHESITLNEEKQILREIKQFEGTRDKVIAHAAERAKIQESL  818
            KSL  RI HESI+L+EEK++++EIKQ  GTR KVI +AA+RAK+Q+++
Sbjct  186  KSLNDRISHESISLDEEKRLVKEIKQLNGTRSKVIENAAKRAKMQDTV  233



>ref|XP_006659373.1| PREDICTED: proton pump-interactor 1-like [Oryza brachyantha]
Length=629

 Score =   147 bits (371),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 90/174 (52%), Positives = 124/174 (71%), Gaps = 1/174 (1%)
 Frame = +3

Query  297  PKDAVVEDWPAPQQIHSFYLVKYRTFEDqklkakleqaekelhkkNQARSVMIDNLRAKR  476
            PKDAV ++WP P+Q HSF+ VK R +ED  LK KL+QA+KE  KK QARS + + LR KR
Sbjct  60   PKDAV-DEWPEPKQTHSFFFVKVRPYEDPNLKMKLDQADKECQKKIQARSHIFEALRTKR  118

Query  477  AARSELINERKSLSAERQQFRSQMDEKRKVMEPLQQALGKLRGNNAGGRDQRSVIFSSEA  656
              RS +I+E K L+AE +Q+   +  K K +EPLQ++LGK R  N   R Q + + SS  
Sbjct  119  NERSNIISELKPLTAENKQYNVVVSGKLKEIEPLQKSLGKFRSENNAMRAQGAGLCSSIE  178

Query  657  ELNDYIKSLQYRIQHESITLNEEKQILREIKQFEGTRDKVIAHAAERAKIQESL  818
            EL+  IKSL  RI HESI+L+EEK++++EIKQ  GTR KV+ +AA+RAK+Q+++
Sbjct  179  ELDQLIKSLNDRICHESISLDEEKRLVKEIKQLNGTRSKVVENAAKRAKMQDTV  232



>ref|XP_010675523.1| PREDICTED: proton pump-interactor 1-like [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010696061.1| PREDICTED: proton pump-interactor 1-like [Beta vulgaris subsp. 
vulgaris]
Length=616

 Score =   147 bits (371),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 100/211 (47%), Positives = 143/211 (68%), Gaps = 7/211 (3%)
 Frame = +3

Query  195  KENGTVP-NEPIKFGSHGAEE--PIKEDVKKAPAINLPKDAVVEDWPAPQQIHSFYLVKY  365
            +ENG +   E I FGSHG +E  P  E      ++N+ K+AV ++WP   Q H FY VK+
Sbjct  24   QENGKINFAEVITFGSHGVDEVKPGGE-ANDVSSVNIAKNAV-DEWPEEAQTHHFYFVKH  81

Query  366  RTFEDqklkakleqaekelhkkNQARSVMIDNLRAKRAARSELINERKSLSAERQQFRSQ  545
            R ++D KLKA+ E  EKE+ KKN     +I+ LRAK++ + EL++E K+ + E  Q+ + 
Sbjct  82   RQWDDPKLKAEFELTEKEIQKKNVQIGQIIEELRAKKSEKFELLDEVKAFNDENAQYWAF  141

Query  546  MDEKRKVMEPLQQALGKLRGNNAGGRDQRSVIFSSEAELNDYIKSLQYRIQHESITLNEE  725
            ++EKR+ ++PLQ ALG LRG      ++ S I SSE ELN  I+S++YR+QHES+ L EE
Sbjct  142  INEKREEIKPLQTALGSLRGGGG--GEKGSSICSSEEELNQLIRSIEYRMQHESMPLKEE  199

Query  726  KQILREIKQFEGTRDKVIAHAAERAKIQESL  818
            KQ++RE+K+ E TR KVIA +A RAKIQES+
Sbjct  200  KQLMRELKELEATRPKVIAKSAMRAKIQESM  230



>ref|XP_006659372.1| PREDICTED: proton pump-interactor 1-like [Oryza brachyantha]
Length=629

 Score =   147 bits (371),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 90/174 (52%), Positives = 124/174 (71%), Gaps = 1/174 (1%)
 Frame = +3

Query  297  PKDAVVEDWPAPQQIHSFYLVKYRTFEDqklkakleqaekelhkkNQARSVMIDNLRAKR  476
            PKDAV ++WP P+Q HSF+ VK R +ED  LK KL+QA+KE  KK QARS + + LR KR
Sbjct  60   PKDAV-DEWPEPKQTHSFFFVKVRPYEDPNLKMKLDQADKECQKKIQARSHIFEALRTKR  118

Query  477  AARSELINERKSLSAERQQFRSQMDEKRKVMEPLQQALGKLRGNNAGGRDQRSVIFSSEA  656
              RS +I+E K L+AE +Q+   +  K K +EPLQ++LGK R  N   R Q + + SS  
Sbjct  119  NERSNIISELKPLTAENKQYNVVVSGKLKEIEPLQKSLGKFRSENNAMRAQGAGLCSSIE  178

Query  657  ELNDYIKSLQYRIQHESITLNEEKQILREIKQFEGTRDKVIAHAAERAKIQESL  818
            EL+  IKSL  RI HESI+L+EEK++++EIKQ  GTR KV+ +AA+RAK+Q+++
Sbjct  179  ELDQLIKSLNDRICHESISLDEEKRLVKEIKQLNGTRSKVVENAAKRAKMQDTV  232



>emb|CDP19179.1| unnamed protein product [Coffea canephora]
Length=191

 Score =   137 bits (346),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 87/150 (58%), Positives = 107/150 (71%), Gaps = 5/150 (3%)
 Frame = +3

Query  216  NEPIKFGSHGAEEPIKEDVKKAPAINLPKDAVVEDWPAPQQIHSFYLVKYRTFEDqklka  395
            +EPI FGSHG +EP K +  KA  +N PKDAV ++WPAP+QIHSFY VKYR  EDQKLK 
Sbjct  4    SEPITFGSHGMDEPAKGEKNKAAEVNFPKDAV-DEWPAPKQIHSFYFVKYRLHEDQKLKV  62

Query  396  kleqaekelhkkNQARSVMIDNLRAKRAARSELINERKSLSAERQQFRSQMDEKRKVMEP  575
            KL+QA+  L KKNQARS +I+ LR  +A R++ I   K L+ E +Q+R  +DEK+K  EP
Sbjct  63   KLDQADTGLQKKNQARSQLIEKLRKLKADRAQKIGFLKGLNKENKQYRDLIDEKKKEREP  122

Query  576  LQQALGKLRGNNAGGRDQRSVIFSSEAELN  665
            LQQALG+L     GGRD  S I SSE ELN
Sbjct  123  LQQALGQLH----GGRDTGSGICSSEEELN  148



>ref|XP_010545836.1| PREDICTED: proton pump-interactor 2 [Tarenaya hassleriana]
 ref|XP_010545837.1| PREDICTED: proton pump-interactor 2 [Tarenaya hassleriana]
Length=607

 Score =   143 bits (361),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 88/217 (41%), Positives = 139/217 (64%), Gaps = 6/217 (3%)
 Frame = +3

Query  171  GSENGGSLKENGTVPNEPIKFGSHGAEEPIK-EDVKKAPAINLPKDAVVEDWPAPQQIHS  347
            G E    L+ +  +P+E  +  S+G E  +  ED     + + P     ++WP+P+   S
Sbjct  10   GFEVAPPLELDELLPSENYQSDSNGDESTVTTEDDDAVFSGDSPPSDAADEWPSPKSFRS  69

Query  348  FYLVKYRTFEDqklkakleqaekelhkkNQARSVMIDNLRAKRAARSELINERKSLSAER  527
            FY VK    +D ++ AK+++A+KE+++ N  R  + ++LRAKRA RS L ++ + L +ER
Sbjct  70   FYFVKQHPCDDSEIAAKIDEADKEIYRCNVTRIQISESLRAKRAERSALFSQMECLKSER  129

Query  528  QQFRSQMDEKRKVMEPLQQALGKLRGNNAGGRDQRSVIFSSEAELNDYIKSLQYRIQHES  707
              + +  DE+++ ++PLQ+AL KL GN  GG+     + SSE EL+D I  + YRI+HES
Sbjct  130  DGYDAIFDERKRELQPLQEALRKLHGNGGGGQ-----LCSSEKELDDLIYRMNYRIEHES  184

Query  708  ITLNEEKQILREIKQFEGTRDKVIAHAAERAKIQESL  818
            ITL EEKQ+L+EIKQ E TR K+IA++A +A+IQ+S 
Sbjct  185  ITLTEEKQLLKEIKQLEATRGKIIANSAIKAQIQDSF  221



>ref|XP_004956633.1| PREDICTED: proton pump-interactor 1-like isoform X1 [Setaria 
italica]
 ref|XP_004956634.1| PREDICTED: proton pump-interactor 1-like isoform X2 [Setaria 
italica]
Length=620

 Score =   143 bits (361),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 90/174 (52%), Positives = 122/174 (70%), Gaps = 1/174 (1%)
 Frame = +3

Query  297  PKDAVVEDWPAPQQIHSFYLVKYRTFEDqklkakleqaekelhkkNQARSVMIDNLRAKR  476
            PKDA  ++WP P+Q H+FY VK R+FED KL+AKLE A+KE  KK QARS +ID +R K+
Sbjct  57   PKDAK-DEWPEPKQTHAFYFVKVRSFEDPKLRAKLELADKEFQKKIQARSKLIDAVRNKK  115

Query  477  AARSELINERKSLSAERQQFRSQMDEKRKVMEPLQQALGKLRGNNAGGRDQRSVIFSSEA  656
            A RS +I E K L+ E +++   ++EK K MEPL+ +LGK R  N   R Q + + SS  
Sbjct  116  AKRSNIITELKPLTVENKRYNEVVNEKIKAMEPLRNSLGKFREENNAMRAQGAGLCSSIE  175

Query  657  ELNDYIKSLQYRIQHESITLNEEKQILREIKQFEGTRDKVIAHAAERAKIQESL  818
            EL   IK L  R+ HESI+L EEKQ+++EIK  E TR KVI++AA RAK+Q+++
Sbjct  176  ELEQTIKMLNDRMVHESISLAEEKQLVKEIKDLEKTRSKVISNAANRAKLQDTV  229



>ref|XP_002460089.1| hypothetical protein SORBIDRAFT_02g022580 [Sorghum bicolor]
 gb|EER96610.1| hypothetical protein SORBIDRAFT_02g022580 [Sorghum bicolor]
Length=617

 Score =   143 bits (360),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 107/235 (46%), Positives = 145/235 (62%), Gaps = 15/235 (6%)
 Frame = +3

Query  123  MGVDV---ESKLAHVSVETGSENGGSLKENGTVPNE---PIKFGSHGAEEPIKEDVKKAP  284
            MG++V   E+  A V V  G  N    KE+     E    + FGS        E      
Sbjct  1    MGMEVVGAEAAPAEVKVSDGEVNLFQEKESKATAKEREEAVVFGS--------ETTTNIA  52

Query  285  AINLPKDAVVEDWPAPQQIHSFYLVKYRTFEDqklkakleqaekelhkkNQARSVMIDNL  464
             +  PKDA  ++WP P+Q ++FY +K R+FED KL+AKLEQA+KE  KK QARS +I+ +
Sbjct  53   DLAPPKDAK-DEWPEPKQTYAFYFIKIRSFEDPKLRAKLEQADKEFQKKIQARSKLIEAV  111

Query  465  RAKRAARSELINERKSLSAERQQFRSQMDEKRKVMEPLQQALGKLRGNNAGGRDQRSVIF  644
            RAK+A RS +I E K LSAE +Q+   ++EK K MEPL+ +LGK R  N   R Q + + 
Sbjct  112  RAKKAERSSIIAELKPLSAENKQYNEVVNEKIKEMEPLRNSLGKFRDENNAMRAQSAGLC  171

Query  645  SSEAELNDYIKSLQYRIQHESITLNEEKQILREIKQFEGTRDKVIAHAAERAKIQ  809
            SS  EL+  IK L  R+ HESI L+EEK++++EIK  E TR KVI++AA RAK+Q
Sbjct  172  SSIEELDLTIKMLNDRMVHESIPLSEEKRLVKEIKDLEKTRSKVISNAANRAKLQ  226



>ref|XP_008652588.1| PREDICTED: proton pump-interactor 1-like [Zea mays]
 ref|XP_008652589.1| PREDICTED: proton pump-interactor 1-like [Zea mays]
 tpg|DAA61115.1| TPA: hypothetical protein ZEAMMB73_369709 [Zea mays]
 tpg|DAA61116.1| TPA: hypothetical protein ZEAMMB73_369709 [Zea mays]
Length=615

 Score =   139 bits (351),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 103/232 (44%), Positives = 142/232 (61%), Gaps = 9/232 (4%)
 Frame = +3

Query  123  MGVDV---ESKLAHVSVETGSENGGSLKENGTVPNEPIKFGSHGAEEPIKEDVKKAPAIN  293
            MG++V   E+  A V +  G  N    KE+     E  +    G+E            + 
Sbjct  1    MGMEVVGAEAAPAEVKISDGEVNLFQEKESKATAKEREEAAVFGSE-----TTANVTDLA  55

Query  294  LPKDAVVEDWPAPQQIHSFYLVKYRTFEDqklkakleqaekelhkkNQARSVMIDNLRAK  473
             PKDA  ++WP P+Q + FY +K R+FED KL+ KLEQA+KE  KK QARS +I+ +RAK
Sbjct  56   PPKDAK-DEWPEPKQTYVFYFIKIRSFEDPKLRVKLEQADKEFQKKIQARSKLIEAVRAK  114

Query  474  RAARSELINERKSLSAERQQFRSQMDEKRKVMEPLQQALGKLRGNNAGGRDQRSVIFSSE  653
            +A RS +I E K LSAE +Q+   ++EK K MEPL+ +LGK R  N   R Q + + SS 
Sbjct  115  KAERSSIIAELKPLSAENKQYNEVVNEKIKEMEPLRNSLGKFREENNAMRAQSAGLCSSI  174

Query  654  AELNDYIKSLQYRIQHESITLNEEKQILREIKQFEGTRDKVIAHAAERAKIQ  809
             EL+  IK L  R+ HESI L+EEK++++EIK  E TR KVI++AA RAK+Q
Sbjct  175  EELDLTIKMLNDRMVHESIPLSEEKRLVKEIKDLEKTRSKVISNAANRAKLQ  226



>ref|XP_008670143.1| PREDICTED: proton pump-interactor 1-like [Zea mays]
 ref|XP_008670144.1| PREDICTED: proton pump-interactor 1-like [Zea mays]
 tpg|DAA39931.1| TPA: hypothetical protein ZEAMMB73_461326 [Zea mays]
 tpg|DAA39932.1| TPA: hypothetical protein ZEAMMB73_461326 [Zea mays]
Length=617

 Score =   139 bits (350),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 89/171 (52%), Positives = 121/171 (71%), Gaps = 0/171 (0%)
 Frame = +3

Query  297  PKDAVVEDWPAPQQIHSFYLVKYRTFEDqklkakleqaekelhkkNQARSVMIDNLRAKR  476
            P   V ++WP P+Q ++FY +K R+FED KL+AKLEQA+KE  KK QARS +I+ +RAK+
Sbjct  55   PPTDVKDEWPEPKQTYAFYFIKVRSFEDPKLRAKLEQADKEFQKKIQARSKLIEAVRAKK  114

Query  477  AARSELINERKSLSAERQQFRSQMDEKRKVMEPLQQALGKLRGNNAGGRDQRSVIFSSEA  656
            A RS +I E K LSAE +Q+   ++EK K MEPL+ +LGK R  N   R Q + + SS  
Sbjct  115  AERSSIIAELKPLSAENKQYNGVVNEKIKEMEPLRNSLGKFREENNAMRAQSAGLCSSIE  174

Query  657  ELNDYIKSLQYRIQHESITLNEEKQILREIKQFEGTRDKVIAHAAERAKIQ  809
            +L+  IK L  RI HESI L+EEK++++EIK  E TR KVI++AA RAK+Q
Sbjct  175  DLDLTIKMLNDRIVHESIPLSEEKRLVKEIKDLEKTRSKVISNAANRAKLQ  225



>gb|EMT01136.1| hypothetical protein F775_28527 [Aegilops tauschii]
Length=632

 Score =   133 bits (335),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 83/174 (48%), Positives = 122/174 (70%), Gaps = 1/174 (1%)
 Frame = +3

Query  297  PKDAVVEDWPAPQQIHSFYLVKYRTFEDqklkakleqaekelhkkNQARSVMIDNLRAKR  476
            PKDA  E+WP P+Q ++FY VK R+FED KL+AKLEQAEK+   K QAR+ +ID ++AK+
Sbjct  68   PKDAA-EEWPEPKQTYTFYFVKVRSFEDPKLRAKLEQAEKDFQNKIQARAKIIDAIKAKK  126

Query  477  AARSELINERKSLSAERQQFRSQMDEKRKVMEPLQQALGKLRGNNAGGRDQRSVIFSSEA  656
              R+ ++ E + LSAE +Q+    +EK + M+P +  LGK R  N   R + + + SS  
Sbjct  127  TERAAVLAELRPLSAENRQYNEAFNEKLEEMKPYRNRLGKFRDENNAMRAESAGLCSSLE  186

Query  657  ELNDYIKSLQYRIQHESITLNEEKQILREIKQFEGTRDKVIAHAAERAKIQESL  818
            EL   IK L +RI HESI+L+EEK++++EIK  E TR KV ++AA+RAK+Q+++
Sbjct  187  ELEHEIKRLNHRISHESISLDEEKRLIKEIKTLEKTRPKVSSNAAKRAKMQDTV  240



>gb|EMS53935.1| hypothetical protein TRIUR3_33747 [Triticum urartu]
Length=743

 Score =   133 bits (335),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 83/174 (48%), Positives = 122/174 (70%), Gaps = 1/174 (1%)
 Frame = +3

Query  297  PKDAVVEDWPAPQQIHSFYLVKYRTFEDqklkakleqaekelhkkNQARSVMIDNLRAKR  476
            PKDA  E+WP P+Q ++FY VK R+FED KL+AKLEQAEK+   K QAR+ +ID ++AK+
Sbjct  92   PKDAA-EEWPEPKQTYTFYFVKIRSFEDPKLRAKLEQAEKDFQNKIQARAKIIDAIKAKK  150

Query  477  AARSELINERKSLSAERQQFRSQMDEKRKVMEPLQQALGKLRGNNAGGRDQRSVIFSSEA  656
              R+ ++ E + LSAE +Q+    +EK + M+P +  LGK R  N   R + + + SS  
Sbjct  151  TERAAVLAELRPLSAENRQYNEAFNEKLEEMKPYRNRLGKFRDENNAMRAESAGLCSSLE  210

Query  657  ELNDYIKSLQYRIQHESITLNEEKQILREIKQFEGTRDKVIAHAAERAKIQESL  818
            EL   IK L +RI HESI+L+EEK++++EIK  E TR KV ++AA+RAK+Q+++
Sbjct  211  ELEHEIKRLNHRISHESISLDEEKRLIKEIKTLEKTRPKVSSNAAKRAKMQDTV  264



>ref|XP_003578006.1| PREDICTED: proton pump-interactor 1-like [Brachypodium distachyon]
Length=624

 Score =   130 bits (327),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 97/238 (41%), Positives = 136/238 (57%), Gaps = 11/238 (5%)
 Frame = +3

Query  123  MGVDV---ESKLAHVSVETGSENGGSLKENGTVPNE---PIKFGSHGAEEPIKEDVKKAP  284
            MG++V   E   A V V  G  N    KE+     E      FGS   +         AP
Sbjct  1    MGMEVVGAEPAPAQVKVADGEVNLFQDKESKATAKEREEAAVFGSDNGKAAANATNDMAP  60

Query  285  AINLPKDAVVEDWPAPQQIHSFYLVKYRTFEDqklkakleqaekelhkkNQARSVMIDNL  464
                PKDAV ++WP P+Q H+ Y +K R+FED KL+AKLEQA+K    + Q R  + + +
Sbjct  61   ----PKDAV-DEWPEPKQTHTLYFIKVRSFEDPKLRAKLEQADKVFQNEIQVRGKIFEAI  115

Query  465  RAKRAARSELINERKSLSAERQQFRSQMDEKRKVMEPLQQALGKLRGNNAGGRDQRSVIF  644
            +AK+  RS +I E K LSAE +Q+     EK + M+P    LGK R  N   R + + + 
Sbjct  116  KAKKVERSSIITELKPLSAENRQYNKAFTEKVEEMKPFTNRLGKFRDENNAMRAEGAGLC  175

Query  645  SSEAELNDYIKSLQYRIQHESITLNEEKQILREIKQFEGTRDKVIAHAAERAKIQESL  818
            SS  EL   IK L  RI HESI+L+EEK++++EIK  E TR KV ++AA+RAK+Q+++
Sbjct  176  SSIEELEQTIKKLNDRICHESISLDEEKKLIKEIKILEKTRPKVTSNAAKRAKMQDAV  233



>ref|XP_008463002.1| PREDICTED: proton pump-interactor 1-like [Cucumis melo]
Length=126

 Score =   117 bits (294),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 65/104 (63%), Positives = 80/104 (77%), Gaps = 2/104 (2%)
 Frame = +3

Query  507  KSLSAERQQFRSQMDEKRKVMEPLQQALGKLRGNNAGGRDQRSVIFSSEAELNDYIKSLQ  686
            K+L  + +QF+S +DEK K +EPL QALGKLR  N  GR+    + SSE ELN  I+SLQ
Sbjct  2    KALRDDNRQFKSIIDEKIKEIEPLNQALGKLRNANNVGRN--GGLCSSEEELNAVIQSLQ  59

Query  687  YRIQHESITLNEEKQILREIKQFEGTRDKVIAHAAERAKIQESL  818
            Y IQHESI L+EEKQILREIKQ EGTR+KVIA+AA R K+Q+S+
Sbjct  60   YHIQHESIPLSEEKQILREIKQLEGTREKVIANAAMRTKLQDSM  103



>ref|NP_001062938.1| Os09g0346400 [Oryza sativa Japonica Group]
 dbj|BAD11328.1| BRI1-KD interacting protein 103 [Oryza sativa Japonica Group]
 dbj|BAD28467.1| BRI1-KD interacting protein 103 [Oryza sativa Japonica Group]
 dbj|BAD29113.1| BRI1-KD interacting protein 103 [Oryza sativa Japonica Group]
 dbj|BAF24852.1| Os09g0346400 [Oryza sativa Japonica Group]
 dbj|BAG94642.1| unnamed protein product [Oryza sativa Japonica Group]
Length=627

 Score =   125 bits (314),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 83/174 (48%), Positives = 117/174 (67%), Gaps = 1/174 (1%)
 Frame = +3

Query  297  PKDAVVEDWPAPQQIHSFYLVKYRTFEDqklkakleqaekelhkkNQARSVMIDNLRAKR  476
            PKDA  EDWP  ++ HSF+ VK R  ED KLK K++QAEK+  KK QARS + + ++AK+
Sbjct  64   PKDAE-EDWPEARKTHSFFFVKIRLLEDPKLKMKIDQAEKDFQKKIQARSQIFEAIKAKK  122

Query  477  AARSELINERKSLSAERQQFRSQMDEKRKVMEPLQQALGKLRGNNAGGRDQRSVIFSSEA  656
              R  +I+E K L+AE +Q+   + EK K +EPL+  LGK R  N   R Q + I SS  
Sbjct  123  NERFGIISELKPLAAENKQYNEAVSEKLKAIEPLRNRLGKFRDENNAIRAQGAGICSSIE  182

Query  657  ELNDYIKSLQYRIQHESITLNEEKQILREIKQFEGTRDKVIAHAAERAKIQESL  818
            EL   IK L  RI HESI L+EEK+++++I++ E TR KVI+ +A RA+IQ+++
Sbjct  183  ELEKSIKRLNDRISHESIPLDEEKRLIKQIRELEKTRPKVISTSANRAQIQDTV  236



>gb|EEE69525.1| hypothetical protein OsJ_28988 [Oryza sativa Japonica Group]
Length=619

 Score =   125 bits (314),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 83/174 (48%), Positives = 117/174 (67%), Gaps = 1/174 (1%)
 Frame = +3

Query  297  PKDAVVEDWPAPQQIHSFYLVKYRTFEDqklkakleqaekelhkkNQARSVMIDNLRAKR  476
            PKDA  EDWP  ++ HSF+ VK R  ED KLK K++QAEK+  KK QARS + + ++AK+
Sbjct  64   PKDAE-EDWPEARKTHSFFFVKIRLLEDPKLKMKIDQAEKDFQKKIQARSQIFEAIKAKK  122

Query  477  AARSELINERKSLSAERQQFRSQMDEKRKVMEPLQQALGKLRGNNAGGRDQRSVIFSSEA  656
              R  +I+E K L+AE +Q+   + EK K +EPL+  LGK R  N   R Q + I SS  
Sbjct  123  NERFGIISELKPLAAENKQYNEAVSEKLKAIEPLRNRLGKFRDENNAIRAQGAGICSSIE  182

Query  657  ELNDYIKSLQYRIQHESITLNEEKQILREIKQFEGTRDKVIAHAAERAKIQESL  818
            EL   IK L  RI HESI L+EEK+++++I++ E TR KVI+ +A RA+IQ+++
Sbjct  183  ELEKSIKRLNDRISHESIPLDEEKRLIKQIRELEKTRPKVISTSANRAQIQDTV  236



>gb|EAZ08718.1| hypothetical protein OsI_30986 [Oryza sativa Indica Group]
Length=627

 Score =   125 bits (314),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 83/174 (48%), Positives = 117/174 (67%), Gaps = 1/174 (1%)
 Frame = +3

Query  297  PKDAVVEDWPAPQQIHSFYLVKYRTFEDqklkakleqaekelhkkNQARSVMIDNLRAKR  476
            PKDA  EDWP  ++ HSF+ VK R  ED KLK K++QAEK+  KK QARS + + ++AK+
Sbjct  64   PKDAE-EDWPEARKTHSFFFVKIRLLEDPKLKMKIDQAEKDFQKKIQARSQIFEAIKAKK  122

Query  477  AARSELINERKSLSAERQQFRSQMDEKRKVMEPLQQALGKLRGNNAGGRDQRSVIFSSEA  656
              R  +I+E K L+AE +Q+   + EK K +EPL+  LGK R  N   R Q + I SS  
Sbjct  123  NERFGIISELKPLAAENKQYNEAVSEKLKAIEPLRNRLGKFRDENNAIRAQGAGICSSIE  182

Query  657  ELNDYIKSLQYRIQHESITLNEEKQILREIKQFEGTRDKVIAHAAERAKIQESL  818
            EL   IK L  RI HESI L+EEK+++++I++ E TR KVI+ +A RA+IQ+++
Sbjct  183  ELEKSIKRLNDRISHESIPLDEEKRLIKQIRELEKTRPKVISTSANRAQIQDTV  236



>gb|KDO62512.1| hypothetical protein CISIN_1g009998mg [Citrus sinensis]
Length=377

 Score =   119 bits (298),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 65/94 (69%), Positives = 74/94 (79%), Gaps = 9/94 (10%)
 Frame = +3

Query  546  MDEKRKVMEPLQQALGKLRGNN---AGGRDQRSVIFSSEAELNDYIKSLQYRIQHESITL  716
            MD+KRK MEPL QALGKLR  N   +GG      I SSE EL+D I+SLQYRIQHE I L
Sbjct  1    MDDKRKEMEPLHQALGKLRTTNNARSGG------ICSSEEELDDLIRSLQYRIQHEIIPL  54

Query  717  NEEKQILREIKQFEGTRDKVIAHAAERAKIQESL  818
            +EEKQILREIKQ EGTR+KV+A+AA RAKIQES+
Sbjct  55   SEEKQILREIKQLEGTREKVMANAAMRAKIQESM  88



>gb|KJB61875.1| hypothetical protein B456_009G387800 [Gossypium raimondii]
Length=399

 Score =   119 bits (297),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 62/109 (57%), Positives = 87/109 (80%), Gaps = 2/109 (2%)
 Frame = +3

Query  492  LINERKSLSAERQQFRSQMDEKRKVMEPLQQALGKLRGNNAGGRDQRSVIFSSEAELNDY  671
            ++++ ++L+ + +QF++ +DEK+K +EPLQQALGKLR N     D R  + +SE EL+  
Sbjct  1    MLSQVRALNVDFEQFKTILDEKKKEIEPLQQALGKLRNNK--DVDNRLSLCASEEELDFI  58

Query  672  IKSLQYRIQHESITLNEEKQILREIKQFEGTRDKVIAHAAERAKIQESL  818
            I SLQYRIQHESI+L+EEK+IL+EIK  EGTR+KVIA+AA R+KIQ+SL
Sbjct  59   IHSLQYRIQHESISLSEEKRILKEIKHLEGTREKVIANAAMRSKIQDSL  107



>gb|KHG29104.1| Uncharacterized protein F383_15123 [Gossypium arboreum]
Length=433

 Score =   118 bits (295),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 61/109 (56%), Positives = 87/109 (80%), Gaps = 2/109 (2%)
 Frame = +3

Query  492  LINERKSLSAERQQFRSQMDEKRKVMEPLQQALGKLRGNNAGGRDQRSVIFSSEAELNDY  671
            ++++ ++L+ + +QF++ +DEK++ +EPLQQALGKLR N     D R  + +SE EL+  
Sbjct  1    MLSQVRALNVDFEQFKTILDEKKREIEPLQQALGKLRNNK--DVDNRLSLCASEEELDFI  58

Query  672  IKSLQYRIQHESITLNEEKQILREIKQFEGTRDKVIAHAAERAKIQESL  818
            I SLQYRIQHESI+L+EEK+IL+EIK  EGTR+KVIA+AA R+KIQ+SL
Sbjct  59   IHSLQYRIQHESISLSEEKRILKEIKHLEGTREKVIANAAMRSKIQDSL  107



>gb|KHG29103.1| Uncharacterized protein F383_15123 [Gossypium arboreum]
Length=499

 Score =   118 bits (295),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 61/109 (56%), Positives = 87/109 (80%), Gaps = 2/109 (2%)
 Frame = +3

Query  492  LINERKSLSAERQQFRSQMDEKRKVMEPLQQALGKLRGNNAGGRDQRSVIFSSEAELNDY  671
            ++++ ++L+ + +QF++ +DEK++ +EPLQQALGKLR N     D R  + +SE EL+  
Sbjct  1    MLSQVRALNVDFEQFKTILDEKKREIEPLQQALGKLRNNK--DVDNRLSLCASEEELDFI  58

Query  672  IKSLQYRIQHESITLNEEKQILREIKQFEGTRDKVIAHAAERAKIQESL  818
            I SLQYRIQHESI+L+EEK+IL+EIK  EGTR+KVIA+AA R+KIQ+SL
Sbjct  59   IHSLQYRIQHESISLSEEKRILKEIKHLEGTREKVIANAAMRSKIQDSL  107



>gb|AFK48950.1| unknown [Lotus japonicus]
Length=146

 Score = 90.5 bits (223),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 61/137 (45%), Positives = 86/137 (63%), Gaps = 9/137 (7%)
 Frame = +3

Query  162  VETGSENGGSL---KENGTVPNE-----PIKFGSHGAEEPIKEDVKKAPAINLPKDAVVE  317
             E G+E G S+   KENG +  +     PIKFGSHG E   K +       N+PKD V E
Sbjct  8    FENGAEGGKSVLHEKENGELDQDVGAGKPIKFGSHGDESAAKGEGNDVSDSNVPKD-VGE  66

Query  318  DWPAPQQIHSFYLVKYRTFEDqklkakleqaekelhkkNQARSVMIDNLRAKRAARSELI  497
            +WPAP+QIHSFY V  R ++D  +K K++Q +KE+ K NQ R  + + L+AKR+ R+ELI
Sbjct  67   EWPAPKQIHSFYFVGCRPYDDPTIKTKIDQFDKEISKVNQGRFQITEALKAKRSDRAELI  126

Query  498  NERKSLSAERQQFRSQM  548
            ++ KSL    +QF+S +
Sbjct  127  SQIKSLRDNSRQFQSMV  143



>ref|XP_002460088.1| hypothetical protein SORBIDRAFT_02g022570 [Sorghum bicolor]
 gb|EER96609.1| hypothetical protein SORBIDRAFT_02g022570 [Sorghum bicolor]
Length=319

 Score = 89.0 bits (219),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 65/163 (40%), Positives = 98/163 (60%), Gaps = 1/163 (1%)
 Frame = +3

Query  330  PQQIHSFYLVKYRTFEDqklkakleqaekelhkkNQARSVMIDNLRAKRAARSELINERK  509
            P+  ++FY VK R+FED +L+ K   A+ +  K+ QARS +I+ +RAK+  RS +I+E K
Sbjct  11   PKSTYAFYFVKIRSFEDPQLREKFMDAQNKFEKEIQARSKIIEAVRAKKMERSTIISELK  70

Query  510  SLSAERQQFRSQMDEKRKVMEPLQQALGKLRGNNAGGRDQRSVIFSSEAELNDYIKSLQY  689
             L+A+ +++   + EK K ME  Q  LG    N+   + QR+   SS  EL   IK    
Sbjct  71   PLTAQNKRYNEVVAEKLKEMELPQNRLGMFLKND-DMQAQRAGFCSSVEELEQTIKMSND  129

Query  690  RIQHESITLNEEKQILREIKQFEGTRDKVIAHAAERAKIQESL  818
            RI H+SI+L EEK +  EIK  E    KVI ++  RAK+Q+++
Sbjct  130  RIAHKSISLREEKCLANEIKNLEKNISKVIYNSTIRAKLQDTV  172



>ref|XP_010535087.1| PREDICTED: proton pump-interactor 2 isoform X3 [Tarenaya hassleriana]
Length=579

 Score = 91.3 bits (225),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 67/176 (38%), Positives = 104/176 (59%), Gaps = 16/176 (9%)
 Frame = +3

Query  234  GSHGAEEPIK-EDVKKAPAINLPKDAVVEDWPAPQQIHSFYLVKYRTFEDqklkakleqa  410
            GS+  E  +  ED     + + P     E+WP P+ I SFY+VK     +  ++AKL++A
Sbjct  46   GSNADESTVTTEDYDAVFSGDSPPSDAAEEWPLPKVIRSFYVVKQHPCNNPLIRAKLDEA  105

Query  411  ekelhkkNQARSVMIDNLRAKRAARSELINERKSLSAERQQFRSQMDEKRKVMEPLQQAL  590
            +KE+++ N AR  + D L+AKRA RS L+ + + L++E   + +  DEK++ ME L++ L
Sbjct  106  DKEIYQCNVARIQISDALKAKRAERSALLAQMECLNSELDGYDAMFDEKKREMESLREGL  165

Query  591  GKLRGNNAGGRDQRSVIFSSEAELNDYIKSLQYRIQHESITLNEEKQILREIKQFE  758
            GKLRG               E EL+D + S+ Y I++E+ T  EEKQIL++IKQ E
Sbjct  166  GKLRG---------------EKELDDLMNSINYGIEYENNTPTEEKQILKKIKQPE  206



>ref|XP_010535085.1| PREDICTED: proton pump-interactor 2 isoform X2 [Tarenaya hassleriana]
 ref|XP_010535086.1| PREDICTED: proton pump-interactor 2 isoform X2 [Tarenaya hassleriana]
Length=583

 Score = 91.3 bits (225),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 67/176 (38%), Positives = 104/176 (59%), Gaps = 16/176 (9%)
 Frame = +3

Query  234  GSHGAEEPIK-EDVKKAPAINLPKDAVVEDWPAPQQIHSFYLVKYRTFEDqklkakleqa  410
            GS+  E  +  ED     + + P     E+WP P+ I SFY+VK     +  ++AKL++A
Sbjct  31   GSNADESTVTTEDYDAVFSGDSPPSDAAEEWPLPKVIRSFYVVKQHPCNNPLIRAKLDEA  90

Query  411  ekelhkkNQARSVMIDNLRAKRAARSELINERKSLSAERQQFRSQMDEKRKVMEPLQQAL  590
            +KE+++ N AR  + D L+AKRA RS L+ + + L++E   + +  DEK++ ME L++ L
Sbjct  91   DKEIYQCNVARIQISDALKAKRAERSALLAQMECLNSELDGYDAMFDEKKREMESLREGL  150

Query  591  GKLRGNNAGGRDQRSVIFSSEAELNDYIKSLQYRIQHESITLNEEKQILREIKQFE  758
            GKLRG               E EL+D + S+ Y I++E+ T  EEKQIL++IKQ E
Sbjct  151  GKLRG---------------EKELDDLMNSINYGIEYENNTPTEEKQILKKIKQPE  191



>ref|XP_010535084.1| PREDICTED: proton pump-interactor 2 isoform X1 [Tarenaya hassleriana]
Length=598

 Score = 90.9 bits (224),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 67/176 (38%), Positives = 104/176 (59%), Gaps = 16/176 (9%)
 Frame = +3

Query  234  GSHGAEEPIK-EDVKKAPAINLPKDAVVEDWPAPQQIHSFYLVKYRTFEDqklkakleqa  410
            GS+  E  +  ED     + + P     E+WP P+ I SFY+VK     +  ++AKL++A
Sbjct  46   GSNADESTVTTEDYDAVFSGDSPPSDAAEEWPLPKVIRSFYVVKQHPCNNPLIRAKLDEA  105

Query  411  ekelhkkNQARSVMIDNLRAKRAARSELINERKSLSAERQQFRSQMDEKRKVMEPLQQAL  590
            +KE+++ N AR  + D L+AKRA RS L+ + + L++E   + +  DEK++ ME L++ L
Sbjct  106  DKEIYQCNVARIQISDALKAKRAERSALLAQMECLNSELDGYDAMFDEKKREMESLREGL  165

Query  591  GKLRGNNAGGRDQRSVIFSSEAELNDYIKSLQYRIQHESITLNEEKQILREIKQFE  758
            GKLRG               E EL+D + S+ Y I++E+ T  EEKQIL++IKQ E
Sbjct  166  GKLRG---------------EKELDDLMNSINYGIEYENNTPTEEKQILKKIKQPE  206



>ref|XP_008452455.1| PREDICTED: proton pump-interactor 1 isoform X3 [Cucumis melo]
Length=516

 Score = 89.0 bits (219),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 48/76 (63%), Positives = 57/76 (75%), Gaps = 3/76 (4%)
 Frame = +3

Query  591  GKLRGNNAGGRDQRSVIFSSEAELNDYIKSLQYRIQHESITLNEEKQILREIKQFEGTRD  770
             K+  NNAG       + SSE ELN  I+SLQY IQHESI L+EEKQ LREIKQ EGTR+
Sbjct  48   SKINANNAG---HNGGLCSSEEELNAVIQSLQYHIQHESIPLSEEKQNLREIKQLEGTRE  104

Query  771  KVIAHAAERAKIQESL  818
            KVIA+AA RAK+Q+S+
Sbjct  105  KVIANAAMRAKLQDSM  120



>ref|XP_004959394.1| PREDICTED: uncharacterized protein LOC101765357 [Setaria italica]
Length=999

 Score = 88.6 bits (218),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 74/175 (42%), Positives = 103/175 (59%), Gaps = 15/175 (9%)
 Frame = +3

Query  297  PKDAVVEDWPAPQQIHSFYLVKYRTFEDqklkakleqaekelhkkNQARSVMIDNLRAKR  476
            P+D V E WP  ++ ++FY VK R+F+D  L+ KL +AE E  KK +AR+ +I+  RAK+
Sbjct  682  PQDRVKE-WP--ERTNAFYFVKIRSFKDPDLRRKLMEAENEFQKKIEARNKIIEVARAKK  738

Query  477  AARSELINERKSLSAERQQFRSQMDEKRKVMEPLQQALGKLR-GNNAGGRDQRSVIFSSE  653
              RS +I+E KSL AE +Q+         V+E LQ  LGK R GNN       SV+    
Sbjct  739  EERSNIISELKSLYAENKQYHV-------VVEVLQNHLGKFRNGNNTMQAQGCSVV----  787

Query  654  AELNDYIKSLQYRIQHESITLNEEKQILREIKQFEGTRDKVIAHAAERAKIQESL  818
             EL   IK L  RI HE I++ EEK++  EIK  E  R KVI  +  R K+Q+++
Sbjct  788  EELEQTIKMLSDRIVHECISILEEKRLYTEIKDIEKARSKVIYLSTNRPKLQDTV  842



>gb|KJB61862.1| hypothetical protein B456_009G386900, partial [Gossypium raimondii]
Length=421

 Score = 84.7 bits (208),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 46/75 (61%), Positives = 57/75 (76%), Gaps = 2/75 (3%)
 Frame = +3

Query  594  KLRGNNAGGRDQRSVIFSSEAELNDYIKSLQYRIQHESITLNEEKQILREIKQFEGTRDK  773
            KLR N     D R    +SE EL+  I SLQYRIQHESI+L++EK+IL+EIK FEGTR+K
Sbjct  1    KLRNNK--DVDNRLSFCASEEELDFIIHSLQYRIQHESISLSDEKRILKEIKHFEGTREK  58

Query  774  VIAHAAERAKIQESL  818
            VIA+ A R+KIQ+SL
Sbjct  59   VIANVAMRSKIQDSL  73



>ref|XP_001783056.1| predicted protein [Physcomitrella patens]
 gb|EDQ52125.1| predicted protein [Physcomitrella patens]
Length=895

 Score = 85.5 bits (210),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 57/164 (35%), Positives = 102/164 (62%), Gaps = 0/164 (0%)
 Frame = +3

Query  327  APQQIHSFYLVKYRTFEDqklkakleqaekelhkkNQARSVMIDNLRAKRAARSELINER  506
            AP Q+++FY+V+     D++ + ++  AE++L  K  AR+     ++A R  R+E     
Sbjct  287  APLQVYNFYMVRVPRPADKQGRVEISSAEQQLQDKTDARNAHNSTVQAARVKRNEAFERL  346

Query  507  KSLSAERQQFRSQMDEKRKVMEPLQQALGKLRGNNAGGRDQRSVIFSSEAELNDYIKSLQ  686
            K+     + + +Q+  K++ M+PL+ +L KLR      R++   + +SE EL+  + SL+
Sbjct  347  KAARQVERDWLTQVRAKQEEMKPLRDSLRKLREAGREVREKSRDMPTSEEELDHRVASLE  406

Query  687  YRIQHESITLNEEKQILREIKQFEGTRDKVIAHAAERAKIQESL  818
            +RIQHESI L EEKQ++REIK  + +R+ V A+A+  A++Q++L
Sbjct  407  WRIQHESIPLKEEKQLMREIKALQASREAVRANASLFAQVQDAL  450



>gb|KJB61876.1| hypothetical protein B456_009G387800 [Gossypium raimondii]
Length=464

 Score = 84.0 bits (206),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 83/235 (35%), Positives = 132/235 (56%), Gaps = 35/235 (15%)
 Frame = +3

Query  123  MGVDV-ESKLAHVSVETGSENGGS-LKENGT-----VPNEPIKFGSHGAEEPIKEDVKKA  281
            MGV+V +S L  +S++  +E   S L ENG      V N PI   SH +EEP KE+   A
Sbjct  1    MGVEVVDSDLTQLSIDKVTEVDKSFLHENGKLDKDPVYNNPIDVDSH-SEEPDKEEENGA  59

Query  282  PAINLPKDAVVEDWPAPQQIHSFYLVKYRTFEDqklkakleqaekelhkkNQARSVMIDN  461
               + PKDAVVE WPAP+QIHSF+ ++YR +ED  +KAKL+QA+KE+ K N+AR  + D 
Sbjct  60   SDPDFPKDAVVE-WPAPKQIHSFHFIRYRFYEDPAIKAKLDQADKEIQKWNKARFKLTDE  118

Query  462  LRAKR--AARSELINERKSLSAER---QQFRSQMDEKRKVM------EPLQQALG-----  593
            L+AKR  + +  + +E  SLS E+   ++ +     + KV+        +Q +LG     
Sbjct  119  LKAKRIHSLQYRIQHESISLSEEKRILKEIKHLEGTREKVIANAAMRSKIQDSLGQKEDI  178

Query  594  ----KLRGNNAGG-RDQRSVIFSSEAELNDYIKSLQYRIQH-----ESITLNEEK  728
                KL G +  G R ++  ++S + ++ D +   + +I+      +++TL  +K
Sbjct  179  QDQVKLMGVDLNGVRKEQHAVWSKKKQIKDKLDETETKIESLQNELKAVTLKRDK  233


 Score = 75.5 bits (184),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 37/49 (76%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = +3

Query  672  IKSLQYRIQHESITLNEEKQILREIKQFEGTRDKVIAHAAERAKIQESL  818
            I SLQYRIQHESI+L+EEK+IL+EIK  EGTR+KVIA+AA R+KIQ+SL
Sbjct  124  IHSLQYRIQHESISLSEEKRILKEIKHLEGTREKVIANAAMRSKIQDSL  172



>ref|XP_001777574.1| predicted protein [Physcomitrella patens]
 gb|EDQ57617.1| predicted protein [Physcomitrella patens]
Length=709

 Score = 80.1 bits (196),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 55/163 (34%), Positives = 100/163 (61%), Gaps = 0/163 (0%)
 Frame = +3

Query  330  PQQIHSFYLVKYRTFEDqklkakleqaekelhkkNQARSVMIDNLRAKRAARSELINERK  509
            P Q+++FY+V+     D++ K ++  AE++L  K   R+   + ++A R  R+E   + K
Sbjct  115  PLQVYNFYMVRVPRPTDKQGKVEISSAEQQLQDKTDLRNAHNNTVQAARVRRNEAFEKLK  174

Query  510  SLSAERQQFRSQMDEKRKVMEPLQQALGKLRGNNAGGRDQRSVIFSSEAELNDYIKSLQY  689
            +     + + +Q+  K++ M+PL+ +L KL+      R++   + +SE EL+  I SL++
Sbjct  175  AARQVERDWLTQVRAKQEEMKPLRDSLRKLKEAGREVREKSRDMPTSEEELDHRIASLEW  234

Query  690  RIQHESITLNEEKQILREIKQFEGTRDKVIAHAAERAKIQESL  818
            RIQHESI L EEKQ++REIK  + +R+ V A+A   A++ ++L
Sbjct  235  RIQHESIPLKEEKQLMREIKALQASRETVRANAPLFAQVHDAL  277



>ref|XP_002517900.1| hypothetical protein RCOM_1174050 [Ricinus communis]
 gb|EEF44418.1| hypothetical protein RCOM_1174050 [Ricinus communis]
Length=297

 Score = 65.1 bits (157),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 58/186 (31%), Positives = 90/186 (48%), Gaps = 10/186 (5%)
 Frame = +3

Query  279  APAINLPKDAVVEDWPA----PQQIHSFYLVKYRTFEDqklkakleqaekelhkkNQARS  446
            +P +NL  D+V ED       P+ ++    +K+  +ED   +  ++ AEK +   N+ R 
Sbjct  32   SPDLNL--DSVAEDVIDAGHDPRNVNHSDFIKFWLWEDSTSECIIQHAEKVVECMNKKRL  89

Query  447  VMIDNLRAKRAARSELINERKSLSAERQQFRSQMDEKRKVMEPLQQALGKLRGNNAGGRD  626
             ++  +  ++  R  +I   + L    Q  R      +K MEPLQ AL KL   N    D
Sbjct  90   DIVMKIEERKLDRDNIIRRLECLMYRYQSLRYNAASHKKKMEPLQLALDKLSFTNNAYHD  149

Query  627  Q--RSVIFSSEAELNDYIKSLQYRIQHESITLNEEKQILREIKQFEGTRDKVIAHAAERA  800
            +  +S +F  E   N  I  L YR    S      KQ+L EI Q + TR++VIA+AA + 
Sbjct  150  KAIKSCLFEDEIHFN--ISCLFYRSGCYSNDEVRRKQVLEEINQLKRTREQVIANAAVKG  207

Query  801  KIQESL  818
            +I  SL
Sbjct  208  RIWNSL  213



>ref|XP_005848881.1| hypothetical protein CHLNCDRAFT_144263 [Chlorella variabilis]
 gb|EFN56779.1| hypothetical protein CHLNCDRAFT_144263 [Chlorella variabilis]
Length=591

 Score = 63.2 bits (152),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 60/97 (62%), Gaps = 9/97 (9%)
 Frame = +3

Query  486  SELINERKSLSAERQQFRSQMDEKRKVMEPLQQALGKLRGNNAGGRDQRSVIFSSEAELN  665
            +EL  + ++L A++ Q RSQ+D   K  E  + ++ +LRG         S+ F+   +++
Sbjct  95   AELRGQFQTLVAQKTQLRSQLDSASKARESARASMKELRG---------SMKFTKVEDID  145

Query  666  DYIKSLQYRIQHESITLNEEKQILREIKQFEGTRDKV  776
             +I  L+YRIQH+S++LNEEK++L +IK  + +R  +
Sbjct  146  THIAELEYRIQHDSLSLNEEKKVLEQIKALKKSRSTI  182



>ref|XP_010657116.1| PREDICTED: proton pump-interactor 1-like [Vitis vinifera]
Length=297

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 50/145 (34%), Positives = 77/145 (53%), Gaps = 5/145 (3%)
 Frame = +3

Query  315  EDWPAPQQIHSFYLVKYRTFEDqklkakleqaekelhkkNQARSVMIDNLRAKRAARSEL  494
            ++WP   QIH  YLVK+++ E Q +K  +E+ EK + K +Q    +I+ L+ K   R EL
Sbjct  13   DEWPVLGQIHQSYLVKFQSCEHQNVKTGIEETEKMIEKLDQDEDQIIEKLKKKLLDRDEL  72

Query  495  INERKSLSAERQQFRSQMDEKRKVMEPLQQALGKLRGNNAGGRDQRSVIFSSEAELNDYI  674
             +  K+L    + F   +  KR  + PLQ A  KL   N            S  ELN   
Sbjct  73   NSLLKTLRYREEDFERSIVWKRGELHPLQVARDKLCSVNKA---YEVGTICSGGELNTL-  128

Query  675  KSLQYRIQHESITLNEEKQILREIK  749
             SL +++ H++ ++ EEK++LREIK
Sbjct  129  -SLHHQMLHKTKSIAEEKKLLREIK  152



>emb|CCD74476.1| proton pump interactor 2 [Arabidopsis halleri subsp. halleri]
Length=611

 Score = 56.6 bits (135),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 53/152 (35%), Positives = 86/152 (57%), Gaps = 13/152 (9%)
 Frame = +3

Query  315  EDWPAPQQIHSFYLVKYRTFEDqklkakleqaekelhkkNQARSVMIDNLRAKRAARSE-  491
            EDW   +   SFY VK   F+D ++KAK+ +A +E+   N  R   IDN+ AK++ ++E 
Sbjct  61   EDWYGDKPF-SFYFVKQPVFDDPEIKAKIHEANQEIFHCNNLR---IDNVNAKKSEKAEI  116

Query  492  --LINERKSLSAERQQFRSQMDEKRKVMEPLQQALGKLRGNNAGGRDQRSVIFSSEAELN  665
              L  + KSL  + +Q+R   +EK++  + L +AL  LR + +   DQ  + FS E EL+
Sbjct  117  SSLFAQMKSLVPKSEQYRVVFEEKKREFDTLLEALRNLRCSTS---DQ--LCFSKE-ELD  170

Query  666  DYIKSLQYRIQHESITLNEEKQILREIKQFEG  761
              I    Y I++ SI L E+   L+E ++ +G
Sbjct  171  HLIYIAHYHIEYGSIGLEEDDWELKETEKLDG  202



>ref|XP_010539756.1| PREDICTED: uncharacterized protein LOC104813728 [Tarenaya hassleriana]
Length=1424

 Score = 56.2 bits (134),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 71/128 (55%), Gaps = 12/128 (9%)
 Frame = +3

Query  435  QARSVMIDNLRAKRAARSELINERKSLSAERQQFRSQMDEKRKVMEPLQQALGKLRGNNA  614
            Q R  +   ++  R +  EL    K+  AE +  R  +  KR+ +E LQ  + +++    
Sbjct  873  QIRDAIGPEIQKIRVSCKELDANLKAAIAEERSARKALQSKRQEIESLQSVINRVK----  928

Query  615  GGRDQRSVIFSSEAELNDYIKSLQYRIQHESITLNEEKQILREIKQFEGTRDKVIAHAAE  794
                  S +  S  ++   + S+++ IQHE++TLNEEKQ++REIKQ +  R+++ ++   
Sbjct  929  ------SAV--SVDDIGSKVHSMEHMIQHETLTLNEEKQLIREIKQLKQLREQISSNMGT  980

Query  795  RAKIQESL  818
            + ++Q++L
Sbjct  981  QDEVQQAL  988



>ref|XP_010535088.1| PREDICTED: proton pump-interactor 2 isoform X4 [Tarenaya hassleriana]
Length=462

 Score = 54.3 bits (129),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 32/81 (40%), Positives = 48/81 (59%), Gaps = 15/81 (19%)
 Frame = +3

Query  510  SLSAERQQFRSQMDEKRKVMEPLQQALGKLRGNNAGGRDQRSVIFSSEAELNDYIKSLQY  689
             L++E   + +  DEK++ ME L++ LGKLRG               E EL+D + S+ Y
Sbjct  3    CLNSELDGYDAMFDEKKREMESLREGLGKLRG---------------EKELDDLMNSINY  47

Query  690  RIQHESITLNEEKQILREIKQ  752
             I++E+ T  EEKQIL++IKQ
Sbjct  48   GIEYENNTPTEEKQILKKIKQ  68



>gb|KDO85279.1| hypothetical protein CISIN_1g000926mg [Citrus sinensis]
Length=820

 Score = 53.9 bits (128),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 38/154 (25%), Positives = 90/154 (58%), Gaps = 12/154 (8%)
 Frame = +3

Query  348  FYLVKYRTFEDqklkakleqaekelhkkNQARSVMIDNLRAKRAARSELINERKSLSAER  527
            ++LVK   ++D+ L+ +++ A+ ++ +K ++R  + D+++  RA+  E   + ++  ++ 
Sbjct  652  YFLVKVPRYDDENLREQIKAAQSKVDEKTRSRDAIRDDIQTIRASYKEYAEKLEAAISDE  711

Query  528  QQFRSQMDEKRKVMEPLQQALGKLRGNNAGGRDQRSVIFSSEAELNDYIKSLQYRIQHES  707
            +  R  +  KR+ ++ +Q  +  ++  NA   D          +++  I+++++RI HE+
Sbjct  712  RSARESLKSKRQEIDSVQSRINMMK--NAISVD----------DIDGSIRNMEHRIAHET  759

Query  708  ITLNEEKQILREIKQFEGTRDKVIAHAAERAKIQ  809
            + L EEKQI+REIKQ +  R+++ +   E  ++Q
Sbjct  760  LPLKEEKQIIREIKQLKQRREQISSSIGEHDEVQ  793



>gb|KDO85275.1| hypothetical protein CISIN_1g000926mg [Citrus sinensis]
 gb|KDO85276.1| hypothetical protein CISIN_1g000926mg [Citrus sinensis]
Length=1222

 Score = 53.9 bits (128),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 38/154 (25%), Positives = 90/154 (58%), Gaps = 12/154 (8%)
 Frame = +3

Query  348  FYLVKYRTFEDqklkakleqaekelhkkNQARSVMIDNLRAKRAARSELINERKSLSAER  527
            ++LVK   ++D+ L+ +++ A+ ++ +K ++R  + D+++  RA+  E   + ++  ++ 
Sbjct  652  YFLVKVPRYDDENLREQIKAAQSKVDEKTRSRDAIRDDIQTIRASYKEYAEKLEAAISDE  711

Query  528  QQFRSQMDEKRKVMEPLQQALGKLRGNNAGGRDQRSVIFSSEAELNDYIKSLQYRIQHES  707
            +  R  +  KR+ ++ +Q  +  ++  NA   D          +++  I+++++RI HE+
Sbjct  712  RSARESLKSKRQEIDSVQSRINMMK--NAISVD----------DIDGSIRNMEHRIAHET  759

Query  708  ITLNEEKQILREIKQFEGTRDKVIAHAAERAKIQ  809
            + L EEKQI+REIKQ +  R+++ +   E  ++Q
Sbjct  760  LPLKEEKQIIREIKQLKQRREQISSSIGEHDEVQ  793



>ref|XP_006435482.1| hypothetical protein CICLE_v10000062mg [Citrus clementina]
 gb|ESR48722.1| hypothetical protein CICLE_v10000062mg [Citrus clementina]
Length=1222

 Score = 53.9 bits (128),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 38/154 (25%), Positives = 90/154 (58%), Gaps = 12/154 (8%)
 Frame = +3

Query  348  FYLVKYRTFEDqklkakleqaekelhkkNQARSVMIDNLRAKRAARSELINERKSLSAER  527
            ++LVK   ++D+ L+ +++ A+ ++ +K ++R  + D+++  RA+  E   + ++  ++ 
Sbjct  652  YFLVKVPRYDDENLREQIKAAQSKVDEKTRSRDAIRDDIQTIRASYKEYAEKLEAAISDE  711

Query  528  QQFRSQMDEKRKVMEPLQQALGKLRGNNAGGRDQRSVIFSSEAELNDYIKSLQYRIQHES  707
            +  R  +  KR+ ++ +Q  +  ++  NA   D          +++  I+++++RI HE+
Sbjct  712  RSARESLKSKRQEIDSVQSRINMMK--NAISVD----------DIDGSIRNMEHRIAHET  759

Query  708  ITLNEEKQILREIKQFEGTRDKVIAHAAERAKIQ  809
            + L EEKQI+REIKQ +  R+++ +   E  ++Q
Sbjct  760  LPLKEEKQIIREIKQLKQRREQISSSIGEHDEVQ  793



>ref|XP_006494446.1| PREDICTED: microtubule-associated protein futsch-like [Citrus 
sinensis]
Length=1222

 Score = 53.9 bits (128),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 38/154 (25%), Positives = 90/154 (58%), Gaps = 12/154 (8%)
 Frame = +3

Query  348  FYLVKYRTFEDqklkakleqaekelhkkNQARSVMIDNLRAKRAARSELINERKSLSAER  527
            ++LVK   ++D+ L+ +++ A+ ++ +K ++R  + D+++  RA+  E   + ++  ++ 
Sbjct  652  YFLVKVPRYDDENLREQIKAAQSKVDEKTRSRDAIRDDIQTIRASYKEYAEKLEAAISDE  711

Query  528  QQFRSQMDEKRKVMEPLQQALGKLRGNNAGGRDQRSVIFSSEAELNDYIKSLQYRIQHES  707
            +  R  +  KR+ ++ +Q  +  ++  NA   D          +++  I+++++RI HE+
Sbjct  712  RSARESLKSKRQEIDSVQSRINMMK--NAISVD----------DIDGSIRNMEHRIAHET  759

Query  708  ITLNEEKQILREIKQFEGTRDKVIAHAAERAKIQ  809
            + L EEKQI+REIKQ +  R+++ +   E  ++Q
Sbjct  760  LPLKEEKQIIREIKQLKQRREQISSSIGEHDEVQ  793



>gb|KDO85278.1| hypothetical protein CISIN_1g000926mg [Citrus sinensis]
Length=913

 Score = 53.9 bits (128),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 38/154 (25%), Positives = 90/154 (58%), Gaps = 12/154 (8%)
 Frame = +3

Query  348  FYLVKYRTFEDqklkakleqaekelhkkNQARSVMIDNLRAKRAARSELINERKSLSAER  527
            ++LVK   ++D+ L+ +++ A+ ++ +K ++R  + D+++  RA+  E   + ++  ++ 
Sbjct  652  YFLVKVPRYDDENLREQIKAAQSKVDEKTRSRDAIRDDIQTIRASYKEYAEKLEAAISDE  711

Query  528  QQFRSQMDEKRKVMEPLQQALGKLRGNNAGGRDQRSVIFSSEAELNDYIKSLQYRIQHES  707
            +  R  +  KR+ ++ +Q  +  ++  NA   D          +++  I+++++RI HE+
Sbjct  712  RSARESLKSKRQEIDSVQSRINMMK--NAISVD----------DIDGSIRNMEHRIAHET  759

Query  708  ITLNEEKQILREIKQFEGTRDKVIAHAAERAKIQ  809
            + L EEKQI+REIKQ +  R+++ +   E  ++Q
Sbjct  760  LPLKEEKQIIREIKQLKQRREQISSSIGEHDEVQ  793



>gb|KDO85277.1| hypothetical protein CISIN_1g000926mg [Citrus sinensis]
Length=1113

 Score = 53.9 bits (128),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 38/154 (25%), Positives = 90/154 (58%), Gaps = 12/154 (8%)
 Frame = +3

Query  348  FYLVKYRTFEDqklkakleqaekelhkkNQARSVMIDNLRAKRAARSELINERKSLSAER  527
            ++LVK   ++D+ L+ +++ A+ ++ +K ++R  + D+++  RA+  E   + ++  ++ 
Sbjct  652  YFLVKVPRYDDENLREQIKAAQSKVDEKTRSRDAIRDDIQTIRASYKEYAEKLEAAISDE  711

Query  528  QQFRSQMDEKRKVMEPLQQALGKLRGNNAGGRDQRSVIFSSEAELNDYIKSLQYRIQHES  707
            +  R  +  KR+ ++ +Q  +  ++  NA   D          +++  I+++++RI HE+
Sbjct  712  RSARESLKSKRQEIDSVQSRINMMK--NAISVD----------DIDGSIRNMEHRIAHET  759

Query  708  ITLNEEKQILREIKQFEGTRDKVIAHAAERAKIQ  809
            + L EEKQI+REIKQ +  R+++ +   E  ++Q
Sbjct  760  LPLKEEKQIIREIKQLKQRREQISSSIGEHDEVQ  793



>ref|XP_006435481.1| hypothetical protein CICLE_v10000062mg [Citrus clementina]
 gb|ESR48721.1| hypothetical protein CICLE_v10000062mg [Citrus clementina]
Length=1113

 Score = 53.9 bits (128),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 38/154 (25%), Positives = 90/154 (58%), Gaps = 12/154 (8%)
 Frame = +3

Query  348  FYLVKYRTFEDqklkakleqaekelhkkNQARSVMIDNLRAKRAARSELINERKSLSAER  527
            ++LVK   ++D+ L+ +++ A+ ++ +K ++R  + D+++  RA+  E   + ++  ++ 
Sbjct  652  YFLVKVPRYDDENLREQIKAAQSKVDEKTRSRDAIRDDIQTIRASYKEYAEKLEAAISDE  711

Query  528  QQFRSQMDEKRKVMEPLQQALGKLRGNNAGGRDQRSVIFSSEAELNDYIKSLQYRIQHES  707
            +  R  +  KR+ ++ +Q  +  ++  NA   D          +++  I+++++RI HE+
Sbjct  712  RSARESLKSKRQEIDSVQSRINMMK--NAISVD----------DIDGSIRNMEHRIAHET  759

Query  708  ITLNEEKQILREIKQFEGTRDKVIAHAAERAKIQ  809
            + L EEKQI+REIKQ +  R+++ +   E  ++Q
Sbjct  760  LPLKEEKQIIREIKQLKQRREQISSSIGEHDEVQ  793



>ref|NP_188152.3| proton pump interactor 2 [Arabidopsis thaliana]
 sp|B3H4K7.1|PPI2_ARATH RecName: Full=Proton pump-interactor 2 [Arabidopsis thaliana]
 gb|AEE75643.1| proton pump interactor 2 [Arabidopsis thaliana]
Length=589

 Score = 53.5 bits (127),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 49/155 (32%), Positives = 90/155 (58%), Gaps = 7/155 (5%)
 Frame = +3

Query  297  PKDAVVEDWPAPQQIHSFYLVKYRTFEDqklkakleqaekelhkkNQARSVMIDNLRAKR  476
            P  A  ED+P  ++  SFY VK   ++D ++KAK+++A  E+++ N+ R V+ +   +++
Sbjct  53   PGGATEEDFP-EEKPFSFYFVKQPAYDDPEIKAKIDEAGHEINRYNKDRIVVSNAQESEK  111

Query  477  AARSELINERKSLSAERQQFRSQMDEKRKVMEPLQQALGKLRGNNAGGRDQRSVIFSSEA  656
            A    L  + KSL ++ + +R  ++EK+   + L ++L  LR + +   DQ  + FS E 
Sbjct  112  AEILSLFGQMKSLVSKSEGYRVVIEEKKMEFDALHESLRNLRCSTS---DQ--LCFSKE-  165

Query  657  ELNDYIKSLQYRIQHESITLNEEKQILREIKQFEG  761
            EL+  I    Y+I+H SI   EE  +L+E ++ +G
Sbjct  166  ELDHLIYIAHYQIEHGSIGFEEEDWVLKETEKADG  200



>ref|XP_009372666.1| PREDICTED: microtubule-associated protein 1B-like [Pyrus x bretschneideri]
Length=1411

 Score = 52.4 bits (124),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 40/157 (25%), Positives = 91/157 (58%), Gaps = 12/157 (8%)
 Frame = +3

Query  348  FYLVKYRTFEDqklkakleqaekelhkkNQARSVMIDNLRAKRAARSELINERKSLSAER  527
            ++L++   ++D+ LK +++QA+  + +K ++R  +   ++ KRA   E  ++ ++  +E 
Sbjct  844  YFLIRIPRYDDENLKEEIKQAQLHVEEKTKSRDAIRSKIQMKRATCKEYFDKFEAARSEE  903

Query  528  QQFRSQMDEKRKVMEPLQQALGKLRGNNAGGRDQRSVIFSSEAELNDYIKSLQYRIQHES  707
            +  R     KRK M+ +Q  + K++              S E +L+  I+++++ ++HE+
Sbjct  904  RAARDLFKAKRKEMDSVQLMINKVKN-----------AISIE-DLDYKIRNMEHSMEHET  951

Query  708  ITLNEEKQILREIKQFEGTRDKVIAHAAERAKIQESL  818
            + L EEKQ +REIKQ +  R+++ +   ++ ++QE+L
Sbjct  952  LPLKEEKQFIREIKQLKQLREQLSSSLGKQDEVQEAL  988



>ref|XP_008373330.1| PREDICTED: calponin homology domain-containing protein DDB_G0272472 
[Malus domestica]
Length=1349

 Score = 52.0 bits (123),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 42/157 (27%), Positives = 93/157 (59%), Gaps = 12/157 (8%)
 Frame = +3

Query  348  FYLVKYRTFEDqklkakleqaekelhkkNQARSVMIDNLRAKRAARSELINERKSLSAER  527
            ++L++   ++D+ LK +++QA+  + +K ++R  +   ++ KRA   E  ++ ++  +E 
Sbjct  782  YFLIRIPRYDDENLKEEIKQAQLHVEEKTKSRDAIRSKIQMKRATCKEYFDKFEAARSEE  841

Query  528  QQFRSQMDEKRKVMEPLQQALGKLRGNNAGGRDQRSVIFSSEAELNDYIKSLQYRIQHES  707
            +  R     KRK M+ +Q  + K++  NA          S E +L+  I+++++ ++HE+
Sbjct  842  RAARDLFKAKRKEMDSVQLMINKVK--NA---------ISIE-DLDYKIRNMEHSMEHET  889

Query  708  ITLNEEKQILREIKQFEGTRDKVIAHAAERAKIQESL  818
            + L EEKQ +REIKQ +  R+++ +   ++ ++QE+L
Sbjct  890  LPLKEEKQFIREIKQLKQLREQLSSSLGKQDEVQEAL  926



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1659957175625