BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF045D04

Length=808
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009623841.1|  PREDICTED: AP-1 complex subunit mu-2               384   9e-129   Nicotiana tomentosiformis
ref|XP_009774686.1|  PREDICTED: AP-1 complex subunit mu-2-like          384   1e-128   Nicotiana sylvestris
ref|XP_010319601.1|  PREDICTED: AP-1 complex subunit mu-2 isoform X2    383   2e-128   
ref|XP_007044746.1|  Clathrin adaptor complexes medium subunit fa...    379   2e-128   
ref|XP_009604122.1|  PREDICTED: AP-1 complex subunit mu-2               383   2e-128   Nicotiana tomentosiformis
ref|XP_009763320.1|  PREDICTED: AP-1 complex subunit mu-2               383   2e-128   Nicotiana sylvestris
ref|XP_004237270.1|  PREDICTED: AP-1 complex subunit mu-2 isoform X1    383   4e-128   Solanum lycopersicum
ref|XP_006366366.1|  PREDICTED: AP-1 complex subunit mu-2-like          382   4e-128   Solanum tuberosum [potatoes]
ref|XP_004239119.1|  PREDICTED: AP-1 complex subunit mu-2               382   5e-128   Solanum lycopersicum
gb|KJB31188.1|  hypothetical protein B456_005G180000                    377   6e-127   Gossypium raimondii
ref|XP_007044744.1|  Clathrin adaptor complexes medium subunit fa...    379   8e-127   Theobroma cacao [chocolate]
gb|KJB31187.1|  hypothetical protein B456_005G180000                    376   1e-126   Gossypium raimondii
gb|KHG12319.1|  AP-1 complex subunit mu-1                               377   5e-126   Gossypium arboreum [tree cotton]
gb|KHG01625.1|  AP-1 complex subunit mu-1-I                             377   5e-126   Gossypium arboreum [tree cotton]
gb|EYU22519.1|  hypothetical protein MIMGU_mgv1a006868mg                377   8e-126   Erythranthe guttata [common monkey flower]
gb|KJB50247.1|  hypothetical protein B456_008G160500                    377   1e-125   Gossypium raimondii
emb|CAN71032.1|  hypothetical protein VITISV_035320                     369   2e-125   Vitis vinifera
ref|XP_004135264.1|  PREDICTED: AP-1 complex subunit mu-1-like          376   2e-125   Cucumis sativus [cucumbers]
ref|XP_011086615.1|  PREDICTED: AP-1 complex subunit mu-2               375   3e-125   Sesamum indicum [beniseed]
emb|CDP13203.1|  unnamed protein product                                375   3e-125   Coffea canephora [robusta coffee]
ref|XP_010102500.1|  AP-1 complex subunit mu-1                          375   4e-125   Morus notabilis
ref|XP_006847624.1|  hypothetical protein AMTR_s00014p00250090          374   6e-125   Amborella trichopoda
ref|XP_010533915.1|  PREDICTED: AP-1 complex subunit mu-2-like          374   6e-125   Tarenaya hassleriana [spider flower]
ref|XP_008446174.1|  PREDICTED: AP-1 complex subunit mu-2               374   7e-125   Cucumis melo [Oriental melon]
gb|KDO69519.1|  hypothetical protein CISIN_1g014251mg                   370   7e-125   Citrus sinensis [apfelsine]
gb|KDO69518.1|  hypothetical protein CISIN_1g014251mg                   370   9e-125   Citrus sinensis [apfelsine]
ref|XP_010547708.1|  PREDICTED: AP-1 complex subunit mu-2-like          374   1e-124   Tarenaya hassleriana [spider flower]
ref|XP_010251124.1|  PREDICTED: AP-1 complex subunit mu-2               374   1e-124   Nelumbo nucifera [Indian lotus]
ref|XP_008239309.1|  PREDICTED: AP-1 complex subunit mu-2-like          373   2e-124   Prunus mume [ume]
ref|XP_007209161.1|  hypothetical protein PRUPE_ppa006082mg             373   2e-124   Prunus persica
ref|XP_002511345.1|  clathrin coat assembly protein ap-1, putative      373   3e-124   Ricinus communis
ref|XP_010682420.1|  PREDICTED: AP-1 complex subunit mu-2               373   3e-124   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011071132.1|  PREDICTED: AP-1 complex subunit mu-2               372   4e-124   Sesamum indicum [beniseed]
gb|EYU28424.1|  hypothetical protein MIMGU_mgv1a006870mg                372   4e-124   Erythranthe guttata [common monkey flower]
ref|XP_004155408.1|  PREDICTED: AP-1 complex subunit mu-1-like          372   7e-124   
gb|ABR18420.1|  unknown                                                 372   7e-124   Picea sitchensis
ref|NP_176277.1|  protein HAPLESS 13                                    372   9e-124   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004509658.1|  PREDICTED: AP-1 complex subunit mu-1-like          371   1e-123   Cicer arietinum [garbanzo]
ref|XP_003531990.1|  PREDICTED: AP-1 complex subunit mu-2-like          371   2e-123   Glycine max [soybeans]
ref|XP_010044585.1|  PREDICTED: AP-1 complex subunit mu-2               371   2e-123   Eucalyptus grandis [rose gum]
ref|XP_003552037.1|  PREDICTED: AP-1 complex subunit mu-2-like          371   2e-123   Glycine max [soybeans]
ref|XP_002886592.1|  clathrin adaptor complexes medium subunit fa...    371   2e-123   
ref|XP_008374401.1|  PREDICTED: AP-1 complex subunit mu-2-like          371   2e-123   
ref|XP_006439891.1|  hypothetical protein CICLE_v10023962mg             370   2e-123   Citrus clementina [clementine]
gb|KFK40761.1|  hypothetical protein AALP_AA2G037600                    370   2e-123   Arabis alpina [alpine rockcress]
ref|XP_010510910.1|  PREDICTED: AP-1 complex subunit mu-2               370   3e-123   Camelina sativa [gold-of-pleasure]
ref|XP_006392117.1|  hypothetical protein EUTSA_v10023468mg             370   3e-123   Eutrema salsugineum [saltwater cress]
ref|XP_002274463.1|  PREDICTED: AP-1 complex subunit mu-2               370   4e-123   Vitis vinifera
ref|XP_010553612.1|  PREDICTED: AP-1 complex subunit mu-2               370   4e-123   Tarenaya hassleriana [spider flower]
ref|XP_010923038.1|  PREDICTED: AP-1 complex subunit mu-2               370   4e-123   Elaeis guineensis
ref|XP_006300485.1|  hypothetical protein CARUB_v10020333mg             370   4e-123   Capsella rubella
ref|XP_002311769.2|  hypothetical protein POPTR_0008s19180g             367   5e-123   
ref|XP_008392998.1|  PREDICTED: AP-1 complex subunit mu-2               369   6e-123   
gb|KHN25155.1|  AP-1 complex subunit mu-1-I                             369   6e-123   Glycine soja [wild soybean]
ref|XP_010248608.1|  PREDICTED: AP-1 complex subunit mu-2-like          369   7e-123   Nelumbo nucifera [Indian lotus]
ref|XP_006307589.1|  hypothetical protein CARUB_v10009212mg             369   7e-123   Capsella rubella
ref|XP_010458434.1|  PREDICTED: AP-1 complex subunit mu-2-like          369   9e-123   Camelina sativa [gold-of-pleasure]
gb|KFK43365.1|  hypothetical protein AALP_AA1G116700                    369   9e-123   Arabis alpina [alpine rockcress]
ref|XP_006417426.1|  hypothetical protein EUTSA_v10007700mg             369   1e-122   Eutrema salsugineum [saltwater cress]
ref|XP_002889832.1|  clathrin adaptor complexes medium subunit fa...    369   1e-122   Arabidopsis lyrata subsp. lyrata
ref|XP_008791180.1|  PREDICTED: AP-1 complex subunit mu-2               369   1e-122   Phoenix dactylifera
ref|XP_010475954.1|  PREDICTED: AP-1 complex subunit mu-2-like          369   1e-122   Camelina sativa [gold-of-pleasure]
ref|NP_172543.1|  clathrin adaptor complexes medium subunit famil...    368   2e-122   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003517576.1|  PREDICTED: AP-1 complex subunit mu-2-like          368   2e-122   
gb|KCW86678.1|  hypothetical protein EUGRSUZ_B03301                     375   2e-122   Eucalyptus grandis [rose gum]
emb|CDY54239.1|  BnaC08g49960D                                          368   2e-122   Brassica napus [oilseed rape]
ref|XP_011034097.1|  PREDICTED: AP-1 complex subunit mu-2-like          368   2e-122   Populus euphratica
ref|XP_011045271.1|  PREDICTED: AP-1 complex subunit mu-2               368   3e-122   Populus euphratica
ref|XP_002314604.1|  clathrin adaptor complexes medium subunit fa...    368   3e-122   Populus trichocarpa [western balsam poplar]
emb|CDY61312.1|  BnaAnng17500D                                          367   4e-122   Brassica napus [oilseed rape]
ref|XP_009103973.1|  PREDICTED: AP-1 complex subunit mu-2               367   4e-122   Brassica rapa
emb|CDY63680.1|  BnaA01g35650D                                          367   4e-122   Brassica napus [oilseed rape]
gb|KEH20175.1|  clathrin assembly protein AP47, putative                366   1e-121   Medicago truncatula
emb|CDY63681.1|  BnaA01g35660D                                          366   1e-121   Brassica napus [oilseed rape]
emb|CDY46183.1|  BnaA01g23050D                                          366   1e-121   Brassica napus [oilseed rape]
ref|XP_010491832.1|  PREDICTED: AP-1 complex subunit mu-2-like          366   1e-121   Camelina sativa [gold-of-pleasure]
emb|CDY19316.1|  BnaC05g08250D                                          366   1e-121   Brassica napus [oilseed rape]
ref|XP_003519692.1|  PREDICTED: AP-1 complex subunit mu-2-like          366   2e-121   Glycine max [soybeans]
gb|EPS71689.1|  hypothetical protein M569_03066                         366   2e-121   Genlisea aurea
ref|XP_007153766.1|  hypothetical protein PHAVU_003G063300g             361   3e-121   Phaseolus vulgaris [French bean]
gb|KDP31052.1|  hypothetical protein JCGZ_11428                         365   3e-121   Jatropha curcas
gb|KDP26640.1|  hypothetical protein JCGZ_17798                         365   3e-121   Jatropha curcas
ref|XP_007157311.1|  hypothetical protein PHAVU_002G059300g             365   4e-121   Phaseolus vulgaris [French bean]
ref|XP_010100380.1|  AP-1 complex subunit mu-1-I                        364   5e-121   Morus notabilis
gb|KDO82238.1|  hypothetical protein CISIN_1g014235mg                   360   8e-121   Citrus sinensis [apfelsine]
ref|XP_004298980.1|  PREDICTED: AP-1 complex subunit mu-2-like          363   1e-120   Fragaria vesca subsp. vesca
ref|XP_007036353.1|  Clathrin adaptor complexes medium subunit fa...    363   1e-120   
ref|XP_008389705.1|  PREDICTED: AP-1 complex subunit mu-2               363   1e-120   Malus domestica [apple tree]
ref|XP_009359189.1|  PREDICTED: AP-1 complex subunit mu-2               363   2e-120   Pyrus x bretschneideri [bai li]
ref|XP_007225645.1|  hypothetical protein PRUPE_ppa006083mg             363   2e-120   Prunus persica
ref|XP_008221881.1|  PREDICTED: AP-1 complex subunit mu-2               363   2e-120   Prunus mume [ume]
ref|XP_009148415.1|  PREDICTED: AP-1 complex subunit mu-2-like          363   2e-120   Brassica rapa
ref|XP_008340089.1|  PREDICTED: AP-1 complex subunit mu-2-like          363   2e-120   Malus domestica [apple tree]
emb|CDX97909.1|  BnaA06g06600D                                          363   2e-120   
gb|KEH27749.1|  clathrin assembly protein AP47, putative                359   6e-120   Medicago truncatula
ref|XP_007153765.1|  hypothetical protein PHAVU_003G063300g             362   7e-120   Phaseolus vulgaris [French bean]
dbj|BAD81570.1|  clathrin-associated protein unc-101-like               358   1e-119   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009409953.1|  PREDICTED: AP-1 complex subunit mu-2               360   2e-119   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003613166.1|  AP-1 complex subunit mu                            360   2e-119   Medicago truncatula
ref|XP_006438266.1|  hypothetical protein CICLE_v10031619mg             360   3e-119   Citrus clementina [clementine]
ref|XP_004489791.1|  PREDICTED: AP-1 complex subunit mu-1-like          358   9e-119   Cicer arietinum [garbanzo]
ref|NP_001044001.1|  Os01g0703600                                       358   1e-118   
ref|XP_010924114.1|  PREDICTED: AP-1 complex subunit mu-2-like          358   1e-118   Elaeis guineensis
gb|EAY75520.1|  hypothetical protein OsI_03424                          358   1e-118   Oryza sativa Indica Group [Indian rice]
gb|EPS68502.1|  hypothetical protein M569_06266                         358   1e-118   Genlisea aurea
ref|NP_001288528.1|  AP-1 complex subunit mu-2                          358   1e-118   Zea mays [maize]
ref|XP_003569636.1|  PREDICTED: AP-1 complex subunit mu-2               357   3e-118   Brachypodium distachyon [annual false brome]
ref|NP_001140632.1|  hypothetical protein                               357   4e-118   Zea mays [maize]
ref|XP_004969676.1|  PREDICTED: AP-1 complex subunit mu-1-like          357   4e-118   Setaria italica
gb|AFW83685.1|  hypothetical protein ZEAMMB73_283352                    362   1e-117   
ref|XP_002968864.1|  hypothetical protein SELMODRAFT_91068              355   2e-117   
ref|XP_009386436.1|  PREDICTED: AP-1 complex subunit mu-2-like          355   3e-117   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004298991.1|  PREDICTED: AP-1 complex subunit mu-2               354   5e-117   Fragaria vesca subsp. vesca
emb|CDM83667.1|  unnamed protein product                                354   5e-117   Triticum aestivum [Canadian hard winter wheat]
ref|XP_009417102.1|  PREDICTED: AP-1 complex subunit mu-2-like          354   7e-117   
ref|XP_006646248.1|  PREDICTED: AP-1 complex subunit mu-2-like          353   1e-116   
ref|XP_003567979.1|  PREDICTED: AP-1 complex subunit mu-2-like          353   2e-116   Brachypodium distachyon [annual false brome]
ref|NP_001056201.1|  Os05g0543100                                       349   4e-115   
dbj|BAJ97229.1|  predicted protein                                      348   9e-115   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_001782369.1|  predicted protein                                  348   1e-114   
ref|XP_001781339.1|  predicted protein                                  347   3e-114   
ref|XP_009609074.1|  PREDICTED: AP-1 complex subunit mu-2-like is...    334   5e-109   Nicotiana tomentosiformis
ref|XP_011071915.1|  PREDICTED: AP-1 complex subunit mu-2-like is...    333   7e-109   Sesamum indicum [beniseed]
ref|XP_009772291.1|  PREDICTED: AP-1 complex subunit mu-2-like is...    332   3e-108   Nicotiana sylvestris
ref|XP_010678835.1|  PREDICTED: AP-1 complex subunit mu-2-like          329   4e-107   Beta vulgaris subsp. vulgaris [field beet]
gb|KHN14546.1|  AP-1 complex subunit mu-1-I                             324   2e-105   Glycine soja [wild soybean]
gb|KJB31189.1|  hypothetical protein B456_005G180000                    323   4e-105   Gossypium raimondii
ref|XP_006347435.1|  PREDICTED: AP-1 complex subunit mu-2-like          323   5e-105   Solanum tuberosum [potatoes]
gb|EMT29153.1|  AP-1 complex subunit mu-1                               325   7e-105   
gb|EMS46923.1|  AP-1 complex subunit mu-1                               324   9e-104   Triticum urartu
ref|XP_009609076.1|  PREDICTED: AP-1 complex subunit mu-2-like is...    319   2e-103   Nicotiana tomentosiformis
ref|XP_004241506.1|  PREDICTED: AP-1 complex subunit mu-2-like          319   3e-103   
ref|XP_009772293.1|  PREDICTED: AP-1 complex subunit mu-2-like is...    317   1e-102   Nicotiana sylvestris
gb|AAF17661.1|AC009398_10  F20B24.16                                    314   1e-101   Arabidopsis thaliana [mouse-ear cress]
ref|XP_005646699.1|  Mu1-adaptin                                        285   3e-90    Coccomyxa subellipsoidea C-169
gb|KFK43362.1|  hypothetical protein AALP_AA1G116200                    278   1e-89    Arabis alpina [alpine rockcress]
gb|EPS63543.1|  hypothetical protein M569_11241                         275   1e-89    Genlisea aurea
ref|XP_001696311.1|  Mu1-Adaptin                                        283   4e-89    Chlamydomonas reinhardtii
ref|XP_002945806.1|  hypothetical protein VOLCADRAFT_108841             282   7e-89    Volvox carteri f. nagariensis
gb|KIZ03697.1|  AP-1 complex subunit mu-1                               280   3e-88    Monoraphidium neglectum
ref|XP_008792874.1|  PREDICTED: AP-1 complex subunit mu-2-like          285   8e-87    
gb|KJB50248.1|  hypothetical protein B456_008G160500                    269   1e-84    Gossypium raimondii
gb|KFH62196.1|  AP-1 complex subunit mu-1                               261   2e-80    Mortierella verticillata NRRL 6337
ref|XP_011397983.1|  AP-1 complex subunit mu-1-I                        260   2e-80    Auxenochlorella protothecoides
ref|XP_011071917.1|  PREDICTED: AP-1 complex subunit mu-2-like is...    258   4e-80    Sesamum indicum [beniseed]
gb|EPB91853.1|  hypothetical protein HMPREF1544_01362                   252   7e-80    Mucor circinelloides f. circinelloides 1006PhL
gb|EMT15970.1|  AP-1 complex subunit mu-1                               256   3e-79    
gb|EMS61432.1|  AP-1 complex subunit mu-1                               254   4e-78    Triticum urartu
ref|XP_006680441.1|  hypothetical protein BATDEDRAFT_37174              254   5e-78    Batrachochytrium dendrobatidis JAM81
emb|CDS06625.1|  Putative AP-1 complex subunit mu-1                     251   9e-77    Lichtheimia ramosa
emb|CDH59177.1|  ap-1 complex subunit mu-1                              251   9e-77    Lichtheimia corymbifera JMRC:FSU:9682
dbj|GAN07517.1|  clathrin adaptor, mu subunit                           251   9e-77    Mucor ambiguus
emb|CCG83138.1|  putative AP-1 adaptor complex subunit mu               249   3e-76    Taphrina deformans PYCC 5710
gb|EXX50896.1|  Apm1p                                                   250   3e-76    Rhizophagus irregularis DAOM 197198w
emb|CEG74228.1|  Putative Clathrin adaptor, mu subunit                  249   3e-76    Rhizopus microsporus
gb|KDD76988.1|  adaptor complexes medium subunit domain-containin...    258   6e-76    Helicosporidium sp. ATCC 50920
gb|KDO82239.1|  hypothetical protein CISIN_1g014235mg                   243   1e-75    Citrus sinensis [apfelsine]
emb|CDS07968.1|  Putative AP-1 complex subunit mu-1                     248   1e-75    Lichtheimia ramosa
emb|CDH49035.1|  clathrin adaptor mu subunit                            248   1e-75    Lichtheimia corymbifera JMRC:FSU:9682
gb|KFY73324.1|  hypothetical protein V499_06584                         243   8e-75    Pseudogymnoascus sp. VKM F-103
ref|XP_011112119.1|  hypothetical protein H072_6322                     245   1e-74    
emb|CCX32771.1|  Similar to AP-1 complex subunit mu-1; acc. no. Q...    245   1e-74    Pyronema omphalodes CBS 100304
gb|KFZ12382.1|  hypothetical protein V501_04258                         243   1e-74    Pseudogymnoascus sp. VKM F-4519 (FW-2642)
gb|EWC47439.1|  AP-1 complex subunit mu-1                               245   2e-74    Drechslerella stenobrocha 248
gb|ESZ98585.1|  putative AP-1 adaptor complex subunit mu                245   2e-74    Sclerotinia borealis F-4128
ref|XP_006438265.1|  hypothetical protein CICLE_v10031619mg             243   2e-74    
ref|XP_011119774.1|  hypothetical protein AOL_s00054g156                244   2e-74    Arthrobotrys oligospora ATCC 24927
emb|CCD49882.1|  similar to AP-1 complex subunit mu                     245   3e-74    Botrytis cinerea T4
gb|KFX91818.1|  hypothetical protein V490_05711                         243   3e-74    Pseudogymnoascus sp. VKM F-3557
gb|KFY59837.1|  hypothetical protein V497_04048                         243   3e-74    Pseudogymnoascus sp. VKM F-4516 (FW-969)
gb|KEF54928.1|  AP-1 complex subunit mu-1                               244   5e-74    Exophiala aquamarina CBS 119918
ref|XP_007728691.1|  AP-1 complex subunit mu-1                          244   5e-74    Capronia epimyces CBS 606.96
ref|XP_002841338.1|  hypothetical protein                               243   9e-74    Tuber melanosporum Mel28
gb|KIX94120.1|  hypothetical protein Z520_10146                         244   1e-73    Fonsecaea multimorphosa CBS 102226
ref|XP_003195223.1|  clathrin assembly protein AP47                     243   1e-73    Cryptococcus gattii WM276
gb|KIM99512.1|  hypothetical protein OIDMADRAFT_200539                  243   1e-73    Oidiodendron maius Zn
ref|XP_007586768.1|  putative ap-1 complex subunit mu-1 protein         243   1e-73    
gb|KIR49235.1|  AP-1 complex subunit mu-1                               243   1e-73    Cryptococcus gattii CA1280
gb|KFY21972.1|  hypothetical protein V493_06939                         243   1e-73    Pseudogymnoascus sp. VKM F-4281 (FW-2241)
emb|CCU79052.1|  AP-1 adaptor complex subunit mu                        243   1e-73    Blumeria graminis f. sp. hordei DH14
gb|KFY05714.1|  hypothetical protein V492_08342                         243   1e-73    Pseudogymnoascus sp. VKM F-4246
ref|XP_009155670.1|  AP-1 complex subunit mu-1                          243   1e-73    Exophiala dermatitidis NIH/UT8656
gb|KIW92487.1|  hypothetical protein Z519_06334                         243   1e-73    Cladophialophora bantiana CBS 173.52
gb|KIW57950.1|  hypothetical protein PV05_02505                         243   1e-73    Exophiala xenobiotica
gb|EKG19131.1|  Clathrin adaptor mu subunit                             243   1e-73    Macrophomina phaseolina MS6
gb|KFY57133.1|  hypothetical protein V496_06523                         243   2e-73    Pseudogymnoascus sp. VKM F-4515 (FW-2607)
ref|XP_007745946.1|  AP-1 complex subunit mu-1                          243   2e-73    Cladophialophora psammophila CBS 110553
gb|KIW46049.1|  hypothetical protein PV06_01742                         243   2e-73    Exophiala oligosperma
gb|KIW29396.1|  hypothetical protein PV07_05214                         243   2e-73    Cladophialophora immunda
ref|XP_007720993.1|  AP-1 complex subunit mu-1                          243   2e-73    Capronia coronata CBS 617.96
ref|XP_011328827.1|  AP-1 complex subunit mu                            242   2e-73    Fusarium graminearum PH-1
gb|KHJ35758.1|  putative ap-1 complex subunit mu-1                      243   2e-73    Erysiphe necator
gb|KIW18278.1|  hypothetical protein PV08_02566                         243   2e-73    Exophiala spinifera
gb|KIV92853.1|  hypothetical protein PV10_04117                         243   2e-73    Exophiala mesophila
ref|XP_007805622.1|  hypothetical protein EPUS_07140                    243   3e-73    Endocarpon pusillum Z07020
ref|XP_003046939.1|  predicted protein                                  242   3e-73    [Nectria] haematococca mpVI 77-13-4
gb|KIW68394.1|  AP-1 complex subunit mu-1                               242   3e-73    Phialophora americana
gb|KGB76445.1|  clathrin assembly protein AP47                          242   3e-73    Cryptococcus gattii VGII R265
gb|EGC47112.1|  AP-1 complex subunit mu                                 242   3e-73    Histoplasma capsulatum H88
ref|XP_009258514.1|  hypothetical protein FPSE_07121                    242   3e-73    Fusarium pseudograminearum CS3096
ref|XP_008726361.1|  hypothetical protein G647_03794                    242   4e-73    Cladophialophora carrionii CBS 160.54
ref|XP_008713084.1|  hypothetical protein HMPREF1541_10191              242   4e-73    Cyphellophora europaea CBS 101466
ref|XP_002628381.1|  clathrin assembly protein                          242   5e-73    Blastomyces gilchristii SLH14081
gb|EGU82568.1|  hypothetical protein FOXB_06934                         242   5e-73    Fusarium oxysporum Fo5176
ref|XP_572014.1|  clathrin assembly protein AP47                        241   5e-73    Cryptococcus neoformans var. neoformans JEC21
gb|ELR03617.1|  AP-1 complex subunit mu                                 242   5e-73    Pseudogymnoascus destructans 20631-21
gb|KEQ94894.1|  hypothetical protein AUEXF2481DRAFT_65833               242   5e-73    Aureobasidium subglaciale EXF-2481
gb|EEH05458.1|  AP-1 complex subunit mu-1                               242   6e-73    Histoplasma capsulatum G186AR
gb|EQK97616.1|  adaptor complexes medium subunit family protein         242   6e-73    Ophiocordyceps sinensis CO18
gb|KEQ61137.1|  putative AP-1 adaptor complex subunit MU                241   6e-73    Aureobasidium melanogenum CBS 110374
gb|KEQ74689.1|  clathrin adaptor, mu subunit                            241   6e-73    Aureobasidium namibiae CBS 147.97
ref|XP_007915060.1|  putative ap-1 complex subunit mu-1 protein         242   7e-73    Phaeoacremonium minimum UCRPA7
ref|XP_007778245.1|  AP-1 complex subunit mu-1                          241   7e-73    Coniosporium apollinis CBS 100218
ref|XP_006964712.1|  adaptor protein complex AP-1 medium subunit        241   7e-73    Trichoderma reesei QM6a
ref|XP_005785717.1|  Apm1, medium subunit of the adaptin 1 complex      241   8e-73    Emiliania huxleyi CCMP1516
gb|EHK41969.1|  hypothetical protein TRIATDRAFT_229300                  241   9e-73    Trichoderma atroviride IMI 206040
gb|KIL95550.1|  hypothetical protein FAVG1_00287                        241   9e-73    Fusarium avenaceum
gb|KEQ79897.1|  clathrin adaptor, mu subunit                            241   9e-73    Aureobasidium pullulans EXF-150
ref|XP_003710726.1|  AP-1 complex subunit mu-1                          241   9e-73    Magnaporthe oryzae 70-15
gb|KIX09719.1|  hypothetical protein Z518_00800                         241   9e-73    Rhinocladiella mackenziei CBS 650.93
ref|XP_002793958.1|  AP-1 complex subunit mu-1                          241   1e-72    
gb|KIH92376.1|  AP-1 complex subunit mu                                 241   1e-72    Sporothrix brasiliensis 5110
gb|EEH33177.2|  AP-1 complex subunit mu-1                               241   1e-72    Paracoccidioides lutzii Pb01
ref|XP_008028649.1|  hypothetical protein SETTUDRAFT_164506             241   1e-72    Exserohilum turcica Et28A
ref|XP_010762749.1|  hypothetical protein PADG_07468                    241   1e-72    Paracoccidioides brasiliensis Pb18
ref|XP_007757075.1|  AP-1 complex subunit mu-1                          241   1e-72    Cladophialophora yegresii CBS 114405
gb|KIV86062.1|  hypothetical protein PV11_01701                         241   1e-72    Exophiala sideris
gb|EFX00496.1|  ap-1 adaptor complex subunit                            241   1e-72    Grosmannia clavigera kw1407
emb|CEJ92846.1|  Putative AP-2 complex subunit mu                       241   1e-72    Torrubiella hemipterigena
gb|EPE02850.1|  ap-1 adaptor complex subunit mu                         241   1e-72    Ophiostoma piceae UAMH 11346
ref|XP_007813674.1|  AP-1 complex subunit mu                            240   2e-72    Metarhizium acridum CQMa 102
gb|EHK25934.1|  hypothetical protein TRIVIDRAFT_55386                   240   2e-72    Trichoderma virens Gv29-8
emb|CCV00015.1|  unnamed protein product                                240   2e-72    Malassezia sympodialis ATCC 42132
ref|XP_006695406.1|  AP-1 complex subunit mu-1-like protein             240   2e-72    Chaetomium thermophilum var. thermophilum DSM 1495
ref|XP_004356672.1|  adaptorrelated protein complex 1, mu 1 subun...    239   2e-72    Acanthamoeba castellanii str. Neff
gb|AFR96538.2|  AP-1 complex subunit mu-1                               239   2e-72    Cryptococcus neoformans var. grubii H99
emb|CCF38390.1|  AP-1 complex subunit mu-1                              239   3e-72    Colletotrichum higginsianum
ref|XP_008079408.1|  Second of Mu2 adaptin subunit (ap50) of ap2 ...    240   3e-72    Glarea lozoyensis ATCC 20868
dbj|GAM36154.1|  AP-1 adaptor complex subunit                           240   3e-72    Talaromyces cellulolyticus
gb|KFX43324.1|  AP-1 complex subunit mu-1                               240   3e-72    Talaromyces marneffei PM1
ref|XP_003069890.1|  Adaptor complexes medium subunit family protein    240   3e-72    Coccidioides posadasii C735 delta SOWgp
gb|KID63649.1|  adaptor complexes medium subunit family protein         240   3e-72    Metarhizium brunneum ARSEF 3297
ref|XP_007394620.1|  hypothetical protein PHACADRAFT_254106             239   3e-72    Phanerochaete carnosa HHB-10118-sp
ref|XP_007296379.1|  AP-1 complex subunit mu                            239   3e-72    Marssonina brunnea f. sp. 'multigermtubi' MB_m1
ref|XP_003843632.1|  similar to AP-1 adaptor complex subunit mu         239   3e-72    Leptosphaeria maculans JN3
emb|CDO76121.1|  hypothetical protein BN946_scf184876.g14               239   3e-72    Trametes cinnabarina
gb|EFQ34890.1|  adaptor complexes medium subunit family protein         239   3e-72    Colletotrichum graminicola M1.001
ref|XP_007926969.1|  hypothetical protein MYCFIDRAFT_32847              239   4e-72    Pseudocercospora fijiensis CIRAD86
ref|XP_009223445.1|  AP-1 complex subunit mu-1                          239   4e-72    Gaeumannomyces tritici R3-111a-1
ref|XP_008599511.1|  adaptor complexes medium subunit family protein    239   4e-72    Beauveria bassiana ARSEF 2860
gb|KFH42124.1|  hypothetical protein ACRE_071520                        239   5e-72    Acremonium chrysogenum ATCC 11550
emb|CAD70726.1|  probable clathrin assembly protein AP47                239   5e-72    Neurospora crassa
gb|EGZ74455.1|  putative clathrin assembly protein AP47                 239   5e-72    Neurospora tetrasperma FGSC 2509
ref|XP_009550586.1|  hypothetical protein HETIRDRAFT_388600             239   5e-72    Heterobasidion irregulare TC 32-1
gb|KIW07295.1|  hypothetical protein PV09_02145                         239   5e-72    Verruconis gallopava
gb|KEZ39767.1|  AP-1 complex subunit mu-1                               239   5e-72    Scedosporium apiospermum
dbj|GAD91832.1|  clathrin assembly protein                              240   6e-72    Byssochlamys spectabilis No. 5
gb|KDN67825.1|  putative adaptor complexes medium subunit family ...    239   6e-72    Colletotrichum sublineola
ref|XP_007593895.1|  adaptor complexes medium subunit family protein    239   6e-72    
gb|ENH82248.1|  ap-1 adaptor complex subunit                            239   6e-72    
ref|XP_007274937.1|  ap-1 adaptor complex subunit                       239   6e-72    
ref|XP_001903166.1|  hypothetical protein                               239   6e-72    Podospora anserina S mat+
emb|CCJ28520.1|  unnamed protein product                                238   6e-72    Pneumocystis jirovecii
gb|KEY67870.1|  hypothetical protein S7711_05008                        239   6e-72    Stachybotrys chartarum IBT 7711
ref|XP_960620.2|  AP-1 complex subunit mu                               239   6e-72    Neurospora crassa OR74A
ref|XP_003346800.1|  hypothetical protein SMAC_05058                    239   6e-72    Sordaria macrospora k-hell
ref|XP_001242723.1|  hypothetical protein CIMG_06619                    240   7e-72    
gb|KIY52202.1|  clathrin adaptor, mu subunit                            238   7e-72    Fistulina hepatica ATCC 64428
ref|XP_008043916.1|  clathrin adaptor mu subunit                        238   7e-72    Trametes versicolor FP-101664 SS1
ref|XP_007367606.1|  clathrin adaptor mu subunit                        238   8e-72    Dichomitus squalens LYAD-421 SS1
ref|XP_007825916.2|  adaptor complexes medium subunit family protein    239   8e-72    Metarhizium robertsii ARSEF 23
ref|XP_003648540.1|  hypothetical protein THITE_2040152                 238   9e-72    Thielavia terrestris NRRL 8126
gb|KIM62843.1|  hypothetical protein SCLCIDRAFT_1214632                 238   9e-72    Scleroderma citrinum Foug A
gb|EMF11613.1|  AP-1 adaptor complex subunit MU                         238   1e-71    Sphaerulina musiva SO2202
gb|EMD37178.1|  hypothetical protein CERSUDRAFT_115088                  238   1e-71    Gelatoporia subvermispora B
ref|XP_007303298.1|  clathrin adaptor mu subunit                        238   1e-71    Stereum hirsutum FP-91666 SS1
ref|XP_007316774.1|  hypothetical protein SERLADRAFT_463796             238   1e-71    Serpula lacrymans var. lacrymans S7.9
ref|XP_009653016.1|  AP-1 complex subunit mu-1                          238   2e-71    Verticillium dahliae VdLs.17
gb|KII91526.1|  hypothetical protein PLICRDRAFT_156675                  238   2e-71    Plicaturopsis crispa FD-325 SS-3
ref|XP_003661027.1|  hypothetical protein MYCTH_2299965                 238   2e-71    
ref|XP_007834465.1|  AP-1 complex subunit mu-1                          238   2e-71    
ref|XP_001801294.1|  hypothetical protein SNOG_11041                    238   2e-71    
ref|XP_006667724.1|  AP-1 complex subunit mu                            238   2e-71    
ref|XP_003002884.1|  AP-1 complex subunit mu-1-I                        237   2e-71    
gb|KDQ54108.1|  hypothetical protein JAAARDRAFT_38721                   237   2e-71    
gb|EUC56083.1|  clathrin assembly protein AP47, putative                237   2e-71    
gb|KIP05432.1|  hypothetical protein PHLGIDRAFT_128873                  237   2e-71    
ref|XP_007869845.1|  clathrin adaptor, mu subunit                       237   3e-71    
gb|KEP50397.1|  putative clathrin assembly protein AP47                 237   3e-71    
ref|XP_001884733.1|  predicted protein                                  237   3e-71    
gb|EPS93225.1|  clathrin adaptor mu subunit                             237   3e-71    
dbj|GAA97543.1|  hypothetical protein E5Q_04221                         237   3e-71    
ref|XP_007769768.1|  clathrin adaptor mu subunit                        237   3e-71    
ref|XP_007267419.1|  clathrin adaptor, mu subunit                       237   3e-71    
ref|XP_007379348.1|  clathrin adaptor mu subunit                        237   3e-71    
ref|XP_001732521.1|  hypothetical protein MGL_0296                      237   3e-71    
gb|KDQ12407.1|  hypothetical protein BOTBODRAFT_34380                   236   4e-71    
gb|KDQ32677.1|  hypothetical protein PLEOSDRAFT_1051618                 236   4e-71    
gb|KIJ16315.1|  hypothetical protein PAXINDRAFT_168461                  236   4e-71    
gb|KDB24974.1|  hypothetical protein H109_03184                         237   5e-71    
gb|KDE04565.1|  AP-1 complex subunit mu-1                               236   5e-71    
gb|KDR74723.1|  hypothetical protein GALMADRAFT_141070                  236   5e-71    
ref|XP_007873506.1|  hypothetical protein PNEG_01557                    236   5e-71    
gb|EME43110.1|  hypothetical protein DOTSEDRAFT_72479                   236   5e-71    
ref|XP_003173722.1|  amidophosphoribosyltransferase                     236   5e-71    
gb|AAG11391.1|  clathrin-adaptor medium chain apm 1                     236   5e-71    
gb|KIM92453.1|  hypothetical protein PILCRDRAFT_810502                  236   5e-71    
ref|XP_007688703.1|  hypothetical protein COCMIDRAFT_97276              236   6e-71    
ref|XP_001941394.1|  AP-2 complex subunit mu                            236   7e-71    
gb|KIL68374.1|  hypothetical protein M378DRAFT_184851                   236   8e-71    
ref|XP_636252.1|  hypothetical protein DDB_G0289247                     236   8e-71    
gb|KIK77619.1|  hypothetical protein PAXRUDRAFT_834940                  236   9e-71    
gb|EMS21813.1|  clathrin assembly protein ap47                          236   9e-71    
gb|KIO22081.1|  hypothetical protein M407DRAFT_79554                    236   9e-71    
ref|XP_004354891.1|  mu1                                                236   1e-70    
ref|XP_003235176.1|  AP-1 adaptor complex subunit mu                    237   1e-70    
ref|XP_007005756.1|  hypothetical protein TREMEDRAFT_63376              235   1e-70    
gb|KDB10821.1|  AP-1 complex subunit mu                                 236   1e-70    
gb|KIJ59909.1|  hypothetical protein HYDPIDRAFT_118028                  235   1e-70    
ref|XP_002910963.1|  clathrin assembly protein AP47                     235   1e-70    
gb|KIO11201.1|  hypothetical protein M404DRAFT_836492                   235   1e-70    
gb|EPS34861.1|  hypothetical protein PDE_09825                          235   2e-70    
ref|XP_007791837.1|  putative ap-1 complex subunit mu-1 protein         235   2e-70    
gb|KJA18695.1|  hypothetical protein HYPSUDRAFT_144678                  234   2e-70    
emb|CEL58788.1|  AP-1 complex subunit mu-1 OS=Homo sapiens GN=AP1...    234   2e-70    
ref|XP_003026772.1|  hypothetical protein SCHCODRAFT_71017              234   2e-70    
gb|ERT00933.1|  hypothetical protein HMPREF1624_02167                   240   3e-70    
gb|KIM44993.1|  hypothetical protein M413DRAFT_442952                   234   3e-70    
gb|KIK44711.1|  hypothetical protein CY34DRAFT_802396                   234   3e-70    
ref|XP_003372804.1|  AP-1 complex subunit mu-1-I                        234   3e-70    
gb|ABB29860.1|  AP-1 mu subunit                                         234   4e-70    
ref|XP_007339880.1|  clathrin adaptor, mu subunit                       234   4e-70    
emb|CCE29172.1|  probable clathrin assembly protein AP47                234   4e-70    
gb|EWM27656.1|  ap-1 complex subunit mu-1-like isoform 1                234   5e-70    
gb|ELQ39429.1|  AP-1 complex subunit mu-1                               242   5e-70    
gb|EJU01282.1|  clathrin assembly protein AP47                          234   5e-70    
ref|XP_006455468.1|  hypothetical protein AGABI2DRAFT_194990            233   6e-70    
ref|XP_003850253.1|  hypothetical protein MYCGRDRAFT_75112              234   7e-70    
emb|CDM35875.1|  Clathrin adaptor, mu subunit                           234   7e-70    
ref|XP_007410099.1|  hypothetical protein MELLADRAFT_48387              233   7e-70    
ref|XP_002741221.1|  PREDICTED: AP-1 complex subunit mu-1               233   8e-70    
gb|KGO43296.1|  Clathrin adaptor, mu subunit, C-terminal                233   8e-70    
ref|XP_002565348.1|  Pc22g14240                                         233   9e-70    
ref|XP_007678823.1|  hypothetical protein BAUCODRAFT_75401              233   1e-69    
emb|CAL00254.1|  unnamed protein product                                232   1e-69    
gb|KIK55340.1|  hypothetical protein GYMLUDRAFT_231068                  233   1e-69    
ref|XP_002383699.1|  AP-1 adaptor complex subunit mu, putative          233   1e-69    
ref|XP_001637219.1|  predicted protein                                  232   1e-69    
ref|XP_001215660.1|  AP-1 complex subunit mu-1                          232   2e-69    
gb|EYE90314.1|  Adaptor complexes medium subunit family protein         233   2e-69    
ref|XP_009079676.1|  PREDICTED: AP-1 complex subunit mu-1               227   2e-69    
ref|XP_001259722.1|  AP-1 adaptor complex subunit mu, putative          232   2e-69    
gb|EFX86177.1|  hypothetical protein DAPPUDRAFT_222170                  231   2e-69    
ref|XP_001391403.2|  AP-1 complex subunit mu-1                          232   3e-69    
ref|XP_002147830.1|  AP-1 adaptor complex subunit mu, putative          241   3e-69    
ref|XP_753673.1|  AP-1 adaptor complex subunit mu                       232   3e-69    
tpe|CBF78005.1|  TPA: hypothetical protein similar to clathrin as...    232   3e-69    
ref|XP_001274087.1|  AP-1 adaptor complex subunit mu, putative          232   3e-69    
ref|XP_003014419.1|  hypothetical protein ARB_06981                     231   3e-69    
gb|EIE83851.1|  AP-1 complex subunit mu-1                               230   3e-69    
gb|KHJ93136.1|  adaptor complexe medium subunit family protein          231   3e-69    
gb|AAI05478.1|  Adaptor-related protein complex 1, mu 1 subunit         228   3e-69    
ref|XP_002482038.1|  AP-1 adaptor complex subunit mu, putative          240   4e-69    
ref|XP_005110316.1|  PREDICTED: AP-1 complex subunit mu-1-like is...    231   5e-69    
ref|XP_003748057.1|  PREDICTED: AP-1 complex subunit mu-1-like          231   5e-69    
ref|XP_005830353.1|  Adaptor protein complex 1 subunit MU               231   6e-69    
ref|XP_010178417.1|  PREDICTED: AP-1 complex subunit mu-1               228   6e-69    
gb|EHA23878.1|  hypothetical protein ASPNIDRAFT_53311                   231   7e-69    
ref|XP_789616.3|  PREDICTED: AP-1 complex subunit mu-1-like             230   8e-69    
emb|CDJ88728.1|  S-adenosyl-L-homocysteine hydrolase and Clathrin...    239   8e-69    
emb|CCA17153.1|  Clathrin assembly complex putative                     230   1e-68    
ref|XP_011414129.1|  PREDICTED: AP-1 complex subunit mu-1               230   1e-68    
gb|EYC03836.1|  hypothetical protein Y032_0091g2449                     229   2e-68    
emb|CCM05385.1|  predicted protein                                      239   2e-68    
ref|XP_005850786.1|  hypothetical protein CHLNCDRAFT_29685              229   2e-68    
gb|KDR09702.1|  AP-1 complex subunit mu-1                               226   2e-68    
ref|XP_007847908.1|  clathrin assembly protein ap47                     229   2e-68    
ref|XP_003796569.1|  PREDICTED: AP-1 complex subunit mu-1 isoform 2     227   3e-68    
ref|XP_006957672.1|  clathrin adaptor, mu subunit                       229   3e-68    
dbj|BAG60161.1|  unnamed protein product                                227   3e-68    
ref|XP_008704612.1|  PREDICTED: AP-1 complex subunit mu-1 isoform X2    227   4e-68    
ref|XP_003294356.1|  clathrin-adaptor medium chain apm1                 229   4e-68    
ref|XP_011220106.1|  PREDICTED: AP-1 complex subunit mu-1 isoform X3    227   5e-68    
ref|XP_009043800.1|  hypothetical protein LOTGIDRAFT_205544             228   6e-68    
ref|XP_004616726.1|  PREDICTED: AP-1 complex subunit mu-1 isoform X2    226   6e-68    
ref|XP_005087142.1|  PREDICTED: AP-1 complex subunit mu-1 isoform X3    226   7e-68    
ref|XP_004089340.1|  PREDICTED: AP-1 complex subunit mu-1               226   1e-67    
ref|XP_003975436.1|  PREDICTED: AP-1 complex subunit mu-1-like          227   1e-67    
ref|NP_989033.1|  adaptor-related protein complex 1, mu 1 subunit       227   1e-67    
ref|XP_001226033.1|  hypothetical protein CHGG_10766                    228   1e-67    
ref|XP_003363865.1|  PREDICTED: AP-1 complex subunit mu-1 isoform X2    227   1e-67    
ref|NP_001230846.1|  adaptor-related protein complex 1, mu 1 subunit    227   1e-67    
ref|XP_007433200.1|  PREDICTED: AP-1 complex subunit mu-1-like is...    227   1e-67    
ref|XP_003761052.1|  PREDICTED: AP-1 complex subunit mu-1               229   1e-67    
ref|NP_115882.1|  AP-1 complex subunit mu-1 isoform 2                   227   1e-67    
ref|XP_004715516.1|  PREDICTED: AP-1 complex subunit mu-1 isoform X3    226   1e-67    
ref|XP_008072171.1|  PREDICTED: AP-1 complex subunit mu-1 isoform X2    227   1e-67    
pdb|1W63|M  Chain M, Ap1 Clathrin Adaptor Core                          227   1e-67    
ref|XP_007072084.1|  PREDICTED: LOW QUALITY PROTEIN: AP-1 complex...    227   1e-67    
ref|NP_001007887.1|  AP-1 complex subunit mu-1                          227   1e-67    
ref|XP_008704610.1|  PREDICTED: AP-1 complex subunit mu-1 isoform X1    227   1e-67    
dbj|BAG51337.1|  unnamed protein product                                227   1e-67    
emb|CBJ29677.1|  Clathrin assembly complex, medium subunit              227   1e-67    
ref|XP_009097580.1|  PREDICTED: AP-1 complex subunit mu-1 isoform X1    227   1e-67    
ref|XP_007183650.1|  PREDICTED: AP-1 complex subunit mu-1 isoform X2    227   1e-67    
ref|XP_002912752.1|  PREDICTED: AP-1 complex subunit mu-1 isoform X1    227   1e-67    
ref|XP_004873351.1|  PREDICTED: AP-1 complex subunit mu-1 isoform X6    227   1e-67    
ref|XP_005333099.1|  PREDICTED: AP-1 complex subunit mu-1 isoform X3    227   1e-67    
ref|XP_004873353.1|  PREDICTED: AP-1 complex subunit mu-1 isoform X8    227   1e-67    
ref|XP_003230562.2|  PREDICTED: AP-1 complex subunit mu-1               227   1e-67    
gb|KFD56950.1|  hypothetical protein M513_02207                         227   1e-67    
gb|EFA83905.1|  mu1                                                     231   1e-67    
ref|XP_010642614.1|  PREDICTED: AP-1 complex subunit mu-1               226   1e-67    
ref|XP_009893473.1|  PREDICTED: AP-1 complex subunit mu-1 isoform X1    227   1e-67    
ref|NP_001089449.1|  adaptor-related protein complex 1, mu 1 subunit    227   1e-67    
ref|XP_004595611.1|  PREDICTED: AP-1 complex subunit mu-1               227   1e-67    
emb|CDW55306.1|  clathrin coat assembly protein ap 1                    227   2e-67    
ref|XP_009470168.1|  PREDICTED: LOW QUALITY PROTEIN: AP-1 complex...    227   2e-67    
ref|XP_004873350.1|  PREDICTED: AP-1 complex subunit mu-1 isoform X5    228   2e-67    
ref|XP_004365235.1|  AP-1 complex subunit mu-1                          227   2e-67    
ref|XP_011498712.1|  PREDICTED: AP-1 complex subunit mu-1               226   2e-67    
ref|XP_008332791.1|  PREDICTED: AP-1 complex subunit mu-1               226   2e-67    
ref|XP_003448533.1|  PREDICTED: AP-1 complex subunit mu-1               226   2e-67    
ref|XP_002423855.1|  clathrin coat assembly protein ap-1, putative      227   2e-67    
ref|XP_005359191.1|  PREDICTED: AP-1 complex subunit mu-1 isoform X1    226   2e-67    
ref|XP_003464289.1|  PREDICTED: AP-1 complex subunit mu-1 isoform X1    226   2e-67    
emb|CDJ83045.1|  Clathrin adaptor domain containing protein             226   3e-67    
ref|XP_005001206.1|  PREDICTED: AP-1 complex subunit mu-1 isoform X2    226   3e-67    
ref|XP_002844776.1|  AP-1 complex subunit mu-1                          227   3e-67    
ref|XP_003428199.1|  PREDICTED: AP-1 complex subunit mu-1               226   3e-67    
ref|XP_005806343.1|  PREDICTED: AP-1 complex subunit mu-1-like is...    226   3e-67    
ref|XP_008486041.1|  PREDICTED: AP-1 complex subunit mu-1               226   3e-67    
ref|XP_005087141.1|  PREDICTED: AP-1 complex subunit mu-1 isoform X2    226   3e-67    
ref|XP_005087140.1|  PREDICTED: AP-1 complex subunit mu-1 isoform X1    226   3e-67    
ref|NP_031482.1|  AP-1 complex subunit mu-1                             226   4e-67    
gb|KFO24684.1|  AP-1 complex subunit mu-1                               226   4e-67    
ref|NP_001037704.1|  AP-1 complex subunit mu-1                          226   4e-67    
ref|XP_004715515.1|  PREDICTED: AP-1 complex subunit mu-1 isoform X2    226   4e-67    
ref|XP_007088690.1|  PREDICTED: AP-1 complex subunit mu-1               228   4e-67    
ref|XP_009292424.1|  PREDICTED: AP-1 complex subunit mu-1               226   4e-67    
ref|XP_003275992.1|  PREDICTED: AP-1 complex subunit mu-1 isoform 1     226   5e-67    
ref|XP_003494936.1|  PREDICTED: AP-1 complex subunit mu-1-like          222   5e-67    
ref|XP_004905175.1|  PREDICTED: AP-1 complex subunit mu-1               227   5e-67    
ref|XP_007627286.1|  PREDICTED: AP-1 complex subunit mu-1               225   5e-67    
ref|XP_003499129.1|  PREDICTED: AP-1 complex subunit mu-1               225   5e-67    
gb|ETN70109.1|  adaptor complexe medium subunit family protein          225   6e-67    
ref|XP_009039824.1|  hypothetical protein AURANDRAFT_72236              225   6e-67    
ref|XP_007899257.1|  PREDICTED: AP-1 complex subunit mu-1               225   7e-67    
gb|ELK19124.1|  AP-1 complex subunit mu-1                               228   8e-67    
ref|XP_011485438.1|  PREDICTED: AP-1 complex subunit mu-1               226   8e-67    
gb|KFG84326.1|  AP-1 complex subunit mu                                 226   8e-67    
gb|EYB89248.1|  hypothetical protein Y032_0234g3148                     225   8e-67    
gb|EGV97518.1|  AP-1 complex subunit mu-1                               225   9e-67    
ref|XP_002602503.1|  hypothetical protein BRAFLDRAFT_266579             225   9e-67    
ref|XP_007238473.1|  PREDICTED: AP-1 complex subunit mu-1-like          226   9e-67    
gb|ELT98131.1|  hypothetical protein CAPTEDRAFT_178783                  224   1e-66    
ref|XP_004873348.1|  PREDICTED: AP-1 complex subunit mu-1 isoform X3    228   2e-66    
emb|CDI96742.1|  clathrin coat assembly protein ap 1                    224   2e-66    
ref|XP_003056598.1|  predicted protein                                  224   2e-66    
ref|XP_004873347.1|  PREDICTED: AP-1 complex subunit mu-1 isoform X2    228   2e-66    
gb|ERE90450.1|  AP-1 complex subunit mu-1-like protein                  225   2e-66    
ref|XP_004873349.1|  PREDICTED: AP-1 complex subunit mu-1 isoform X4    227   2e-66    
ref|XP_003881160.1|  hypothetical protein NCLIV_042020                  224   2e-66    
ref|XP_009015103.1|  hypothetical protein HELRODRAFT_98900              224   3e-66    
ref|XP_002158238.1|  PREDICTED: AP-1 complex subunit mu-1-like          224   3e-66    
ref|XP_009835574.1|  hypothetical protein H257_10669                    222   3e-66    
ref|XP_005962957.1|  PREDICTED: AP-1 complex subunit mu-1 isoform X3    224   3e-66    
ref|XP_004873346.1|  PREDICTED: AP-1 complex subunit mu-1 isoform X1    228   3e-66    
emb|CDS23924.1|  clathrin coat assembly protein ap 1                    223   3e-66    
ref|XP_004988551.1|  clathrin associated protein AP47                   223   3e-66    
ref|XP_007877975.1|  hypothetical protein PFL1_02271                    224   4e-66    
ref|XP_011169377.1|  PREDICTED: AP-1 complex subunit mu-1-like          223   4e-66    
gb|KIJ99062.1|  hypothetical protein K443DRAFT_8658                     223   5e-66    
ref|XP_002113923.1|  hypothetical protein TRIADDRAFT_50452              223   5e-66    
gb|ERE90449.1|  AP-1 complex subunit mu-1-like protein                  225   5e-66    
ref|XP_003097680.1|  CRE-UNC-101 protein                                223   5e-66    
ref|XP_002640613.1|  Hypothetical protein CBG08724                      223   5e-66    
ref|XP_008275536.1|  PREDICTED: AP-1 complex subunit mu-1               223   6e-66    
gb|KFP71226.1|  AP-1 complex subunit mu-1                               219   7e-66    
ref|XP_003136033.1|  AP-1 complex subunit mu-1                          223   7e-66    
gb|EGT35242.1|  hypothetical protein CAEBREN_14107                      223   7e-66    
ref|XP_008889148.1|  mu1 adaptin                                        223   7e-66    
ref|XP_008875643.1|  hypothetical protein H310_10930                    223   8e-66    
ref|XP_011064332.1|  PREDICTED: LOW QUALITY PROTEIN: AP-1 complex...    223   8e-66    
ref|XP_011141637.1|  PREDICTED: AP-1 complex subunit mu-1               222   8e-66    
gb|KDN38638.1|  putative clathrin assembly protein AP47                 223   8e-66    
gb|KFQ31531.1|  AP-1 complex subunit mu-1                               219   8e-66    
ref|XP_008560877.1|  PREDICTED: AP-1 complex subunit mu-1               222   9e-66    
ref|XP_002368402.1|  mu1 adaptin                                        223   9e-66    
dbj|BAF63024.1|  adaptor-related protein complex 1 mu 1 subunit         222   1e-65    
ref|XP_011332351.1|  PREDICTED: AP-1 complex subunit mu-1               222   1e-65    
ref|XP_010869805.1|  PREDICTED: AP-1 complex subunit mu-1               222   1e-65    
emb|CDI87053.1|  mu1 adaptin, putative                                  222   1e-65    
ref|XP_005429537.1|  PREDICTED: AP-1 complex subunit mu-1               224   1e-65    
gb|ETN64452.1|  clathrin coat assembly protein ap-1                     222   1e-65    
ref|XP_003484470.1|  PREDICTED: AP-1 complex subunit mu-1-like          222   1e-65    
ref|XP_003484471.1|  PREDICTED: AP-1 complex subunit mu-1-like          222   1e-65    
ref|XP_003398021.1|  PREDICTED: AP-1 complex subunit mu-1-like          222   1e-65    
ref|XP_003249906.1|  PREDICTED: AP-1 complex subunit mu-1-like is...    222   1e-65    
gb|KFR04824.1|  AP-1 complex subunit mu-1                               222   2e-65    



>ref|XP_009623841.1| PREDICTED: AP-1 complex subunit mu-2 [Nicotiana tomentosiformis]
Length=426

 Score =   384 bits (987),  Expect = 9e-129, Method: Compositional matrix adjust.
 Identities = 182/192 (95%), Positives = 188/192 (98%), Gaps = 0/192 (0%)
 Frame = +1

Query  232  MAGAASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGDPQDPVAYDSGVTYMF  411
            MAGAASALFLLD+KGRVLVWRDYRGDVS+ QAERFFTKL+E EGDPQDPVAYD+GVTYMF
Sbjct  1    MAGAASALFLLDIKGRVLVWRDYRGDVSSVQAERFFTKLIEKEGDPQDPVAYDNGVTYMF  60

Query  412  IQHNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEIMD  591
            IQHNNVYLM ASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDE+MD
Sbjct  61   IQHNNVYLMTASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEMMD  120

Query  592  FGYPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVESVN  771
            FGYPQ+TEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGI YKKNEVFLDVVESVN
Sbjct  121  FGYPQYTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGIRYKKNEVFLDVVESVN  180

Query  772  ILVNSNGQIVRS  807
            ILVNSNGQIVRS
Sbjct  181  ILVNSNGQIVRS  192



>ref|XP_009774686.1| PREDICTED: AP-1 complex subunit mu-2-like [Nicotiana sylvestris]
Length=426

 Score =   384 bits (986),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 182/192 (95%), Positives = 188/192 (98%), Gaps = 0/192 (0%)
 Frame = +1

Query  232  MAGAASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGDPQDPVAYDSGVTYMF  411
            MAGAASALFLLD+KGRVLVWRDYRGDVS+ QAERFFTKL+E EGDPQDPVAYD+GVTYMF
Sbjct  1    MAGAASALFLLDIKGRVLVWRDYRGDVSSVQAERFFTKLIEKEGDPQDPVAYDNGVTYMF  60

Query  412  IQHNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEIMD  591
            IQHNNVYLM ASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDE+MD
Sbjct  61   IQHNNVYLMTASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEMMD  120

Query  592  FGYPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVESVN  771
            FGYPQ+TEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGI YKKNEVFLDVVESVN
Sbjct  121  FGYPQYTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGIRYKKNEVFLDVVESVN  180

Query  772  ILVNSNGQIVRS  807
            ILVNSNGQIVRS
Sbjct  181  ILVNSNGQIVRS  192



>ref|XP_010319601.1| PREDICTED: AP-1 complex subunit mu-2 isoform X2 [Solanum lycopersicum]
Length=404

 Score =   383 bits (983),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 181/192 (94%), Positives = 188/192 (98%), Gaps = 0/192 (0%)
 Frame = +1

Query  232  MAGAASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGDPQDPVAYDSGVTYMF  411
            MAGAASALFLLD+KGRVLVWRD+RGDVS+ QAERFFTKLLE EGDPQDPVAYD+GVTYMF
Sbjct  1    MAGAASALFLLDIKGRVLVWRDFRGDVSSVQAERFFTKLLEKEGDPQDPVAYDNGVTYMF  60

Query  412  IQHNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEIMD  591
            IQHNNVYLM ASRQNCNAAS+LLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDE+MD
Sbjct  61   IQHNNVYLMTASRQNCNAASILLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEMMD  120

Query  592  FGYPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVESVN  771
            FGYPQ+TEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGI YKKNEVFLDVVESVN
Sbjct  121  FGYPQYTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGIQYKKNEVFLDVVESVN  180

Query  772  ILVNSNGQIVRS  807
            ILVNSNGQIVRS
Sbjct  181  ILVNSNGQIVRS  192



>ref|XP_007044746.1| Clathrin adaptor complexes medium subunit family protein isoform 
3 [Theobroma cacao]
 gb|EOY00578.1| Clathrin adaptor complexes medium subunit family protein isoform 
3 [Theobroma cacao]
Length=297

 Score =   379 bits (972),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 181/194 (93%), Positives = 188/194 (97%), Gaps = 2/194 (1%)
 Frame = +1

Query  232  MAGAASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGDPQ--DPVAYDSGVTY  405
            MAGAASALFLLD+KGRVLVWRDYRGDVSATQAERFFTKL+E EGDPQ  DPV YD+GVTY
Sbjct  1    MAGAASALFLLDIKGRVLVWRDYRGDVSATQAERFFTKLIEKEGDPQSQDPVVYDNGVTY  60

Query  406  MFIQHNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEI  585
            MFIQH+NVYLM A+RQNCNAASLL FLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEI
Sbjct  61   MFIQHSNVYLMTATRQNCNAASLLFFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEI  120

Query  586  MDFGYPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVES  765
            MDFGYPQ+TEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVES
Sbjct  121  MDFGYPQYTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVES  180

Query  766  VNILVNSNGQIVRS  807
            VNILVNSNGQI+RS
Sbjct  181  VNILVNSNGQIIRS  194



>ref|XP_009604122.1| PREDICTED: AP-1 complex subunit mu-2 [Nicotiana tomentosiformis]
Length=426

 Score =   383 bits (984),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 182/192 (95%), Positives = 188/192 (98%), Gaps = 0/192 (0%)
 Frame = +1

Query  232  MAGAASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGDPQDPVAYDSGVTYMF  411
            MAGAASALFLLD+KGRVLVWRD+RGDVS+ QAERFFTKLLE EGDPQDPVAYD+GVTYMF
Sbjct  1    MAGAASALFLLDIKGRVLVWRDFRGDVSSVQAERFFTKLLEKEGDPQDPVAYDNGVTYMF  60

Query  412  IQHNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEIMD  591
            IQHNNVYLM ASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDE+MD
Sbjct  61   IQHNNVYLMTASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEMMD  120

Query  592  FGYPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVESVN  771
            FGYPQ+TEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGI YKKNEVFLDVVESVN
Sbjct  121  FGYPQYTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGIQYKKNEVFLDVVESVN  180

Query  772  ILVNSNGQIVRS  807
            ILVNSNGQIVRS
Sbjct  181  ILVNSNGQIVRS  192



>ref|XP_009763320.1| PREDICTED: AP-1 complex subunit mu-2 [Nicotiana sylvestris]
Length=426

 Score =   383 bits (984),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 182/192 (95%), Positives = 188/192 (98%), Gaps = 0/192 (0%)
 Frame = +1

Query  232  MAGAASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGDPQDPVAYDSGVTYMF  411
            MAGAASALFLLD+KGRVLVWRD+RGDVS+ QAERFFTKLLE EGDPQDPVAYD+GVTYMF
Sbjct  1    MAGAASALFLLDIKGRVLVWRDFRGDVSSVQAERFFTKLLEKEGDPQDPVAYDNGVTYMF  60

Query  412  IQHNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEIMD  591
            IQHNNVYLM ASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDE+MD
Sbjct  61   IQHNNVYLMTASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEMMD  120

Query  592  FGYPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVESVN  771
            FGYPQ+TEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGI YKKNEVFLDVVESVN
Sbjct  121  FGYPQYTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGIQYKKNEVFLDVVESVN  180

Query  772  ILVNSNGQIVRS  807
            ILVNSNGQIVRS
Sbjct  181  ILVNSNGQIVRS  192



>ref|XP_004237270.1| PREDICTED: AP-1 complex subunit mu-2 isoform X1 [Solanum lycopersicum]
Length=426

 Score =   383 bits (983),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 181/192 (94%), Positives = 188/192 (98%), Gaps = 0/192 (0%)
 Frame = +1

Query  232  MAGAASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGDPQDPVAYDSGVTYMF  411
            MAGAASALFLLD+KGRVLVWRD+RGDVS+ QAERFFTKLLE EGDPQDPVAYD+GVTYMF
Sbjct  1    MAGAASALFLLDIKGRVLVWRDFRGDVSSVQAERFFTKLLEKEGDPQDPVAYDNGVTYMF  60

Query  412  IQHNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEIMD  591
            IQHNNVYLM ASRQNCNAAS+LLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDE+MD
Sbjct  61   IQHNNVYLMTASRQNCNAASILLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEMMD  120

Query  592  FGYPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVESVN  771
            FGYPQ+TEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGI YKKNEVFLDVVESVN
Sbjct  121  FGYPQYTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGIQYKKNEVFLDVVESVN  180

Query  772  ILVNSNGQIVRS  807
            ILVNSNGQIVRS
Sbjct  181  ILVNSNGQIVRS  192



>ref|XP_006366366.1| PREDICTED: AP-1 complex subunit mu-2-like [Solanum tuberosum]
Length=426

 Score =   382 bits (982),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 181/192 (94%), Positives = 188/192 (98%), Gaps = 0/192 (0%)
 Frame = +1

Query  232  MAGAASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGDPQDPVAYDSGVTYMF  411
            MAGAASALFLLD+KGRVLVWRD+RGDVS+ QAERFFTKLLE EGDPQDPVAYD+GVTYMF
Sbjct  1    MAGAASALFLLDIKGRVLVWRDFRGDVSSVQAERFFTKLLEKEGDPQDPVAYDNGVTYMF  60

Query  412  IQHNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEIMD  591
            IQHNNVYLM ASRQNCNAAS+LLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDE+MD
Sbjct  61   IQHNNVYLMTASRQNCNAASILLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEMMD  120

Query  592  FGYPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVESVN  771
            FGYPQ+TEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGI YKKNEVFLDVVESVN
Sbjct  121  FGYPQYTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGIQYKKNEVFLDVVESVN  180

Query  772  ILVNSNGQIVRS  807
            ILVNSNGQIVRS
Sbjct  181  ILVNSNGQIVRS  192



>ref|XP_004239119.1| PREDICTED: AP-1 complex subunit mu-2 [Solanum lycopersicum]
 ref|XP_006357615.1| PREDICTED: AP-1 complex subunit mu-2-like [Solanum tuberosum]
Length=426

 Score =   382 bits (982),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 181/192 (94%), Positives = 188/192 (98%), Gaps = 0/192 (0%)
 Frame = +1

Query  232  MAGAASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGDPQDPVAYDSGVTYMF  411
            MAGAASALFLLD+KGRVLVWRDYRGDV++ QAERFFTKL+E EGDP DPVAYD+GVTYMF
Sbjct  1    MAGAASALFLLDIKGRVLVWRDYRGDVTSVQAERFFTKLIEKEGDPLDPVAYDNGVTYMF  60

Query  412  IQHNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEIMD  591
            IQHNNVYLM ASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDE+MD
Sbjct  61   IQHNNVYLMTASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEMMD  120

Query  592  FGYPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVESVN  771
            FGYPQ+TEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVESVN
Sbjct  121  FGYPQYTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVESVN  180

Query  772  ILVNSNGQIVRS  807
            ILVNSNGQIVRS
Sbjct  181  ILVNSNGQIVRS  192



>gb|KJB31188.1| hypothetical protein B456_005G180000 [Gossypium raimondii]
Length=368

 Score =   377 bits (969),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 180/194 (93%), Positives = 187/194 (96%), Gaps = 2/194 (1%)
 Frame = +1

Query  232  MAGAASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGDPQ--DPVAYDSGVTY  405
            MAGAASALFLLD+KGRVLVWRDYRGDVSA QAERFFTKL+E EGDPQ  DPV YD+GVTY
Sbjct  1    MAGAASALFLLDIKGRVLVWRDYRGDVSAAQAERFFTKLIEKEGDPQSQDPVVYDNGVTY  60

Query  406  MFIQHNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEI  585
            MFIQH+NVYLM A+RQNCNAASLL FLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEI
Sbjct  61   MFIQHSNVYLMTATRQNCNAASLLFFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEI  120

Query  586  MDFGYPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVES  765
            MDFGYPQ+TEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVES
Sbjct  121  MDFGYPQYTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVES  180

Query  766  VNILVNSNGQIVRS  807
            VNILVNSNGQI+RS
Sbjct  181  VNILVNSNGQIIRS  194



>ref|XP_007044744.1| Clathrin adaptor complexes medium subunit family protein isoform 
1 [Theobroma cacao]
 gb|EOY00576.1| Clathrin adaptor complexes medium subunit family protein isoform 
1 [Theobroma cacao]
Length=428

 Score =   379 bits (974),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 181/194 (93%), Positives = 188/194 (97%), Gaps = 2/194 (1%)
 Frame = +1

Query  232  MAGAASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGDPQ--DPVAYDSGVTY  405
            MAGAASALFLLD+KGRVLVWRDYRGDVSATQAERFFTKL+E EGDPQ  DPV YD+GVTY
Sbjct  1    MAGAASALFLLDIKGRVLVWRDYRGDVSATQAERFFTKLIEKEGDPQSQDPVVYDNGVTY  60

Query  406  MFIQHNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEI  585
            MFIQH+NVYLM A+RQNCNAASLL FLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEI
Sbjct  61   MFIQHSNVYLMTATRQNCNAASLLFFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEI  120

Query  586  MDFGYPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVES  765
            MDFGYPQ+TEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVES
Sbjct  121  MDFGYPQYTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVES  180

Query  766  VNILVNSNGQIVRS  807
            VNILVNSNGQI+RS
Sbjct  181  VNILVNSNGQIIRS  194



>gb|KJB31187.1| hypothetical protein B456_005G180000 [Gossypium raimondii]
Length=346

 Score =   376 bits (965),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 180/194 (93%), Positives = 187/194 (96%), Gaps = 2/194 (1%)
 Frame = +1

Query  232  MAGAASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGDPQ--DPVAYDSGVTY  405
            MAGAASALFLLD+KGRVLVWRDYRGDVSA QAERFFTKL+E EGDPQ  DPV YD+GVTY
Sbjct  1    MAGAASALFLLDIKGRVLVWRDYRGDVSAAQAERFFTKLIEKEGDPQSQDPVVYDNGVTY  60

Query  406  MFIQHNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEI  585
            MFIQH+NVYLM A+RQNCNAASLL FLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEI
Sbjct  61   MFIQHSNVYLMTATRQNCNAASLLFFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEI  120

Query  586  MDFGYPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVES  765
            MDFGYPQ+TEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVES
Sbjct  121  MDFGYPQYTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVES  180

Query  766  VNILVNSNGQIVRS  807
            VNILVNSNGQI+RS
Sbjct  181  VNILVNSNGQIIRS  194



>gb|KHG12319.1| AP-1 complex subunit mu-1 [Gossypium arboreum]
 gb|KJB31186.1| hypothetical protein B456_005G180000 [Gossypium raimondii]
Length=428

 Score =   377 bits (969),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 180/194 (93%), Positives = 187/194 (96%), Gaps = 2/194 (1%)
 Frame = +1

Query  232  MAGAASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGDPQ--DPVAYDSGVTY  405
            MAGAASALFLLD+KGRVLVWRDYRGDVSA QAERFFTKL+E EGDPQ  DPV YD+GVTY
Sbjct  1    MAGAASALFLLDIKGRVLVWRDYRGDVSAAQAERFFTKLIEKEGDPQSQDPVVYDNGVTY  60

Query  406  MFIQHNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEI  585
            MFIQH+NVYLM A+RQNCNAASLL FLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEI
Sbjct  61   MFIQHSNVYLMTATRQNCNAASLLFFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEI  120

Query  586  MDFGYPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVES  765
            MDFGYPQ+TEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVES
Sbjct  121  MDFGYPQYTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVES  180

Query  766  VNILVNSNGQIVRS  807
            VNILVNSNGQI+RS
Sbjct  181  VNILVNSNGQIIRS  194



>gb|KHG01625.1| AP-1 complex subunit mu-1-I [Gossypium arboreum]
Length=417

 Score =   377 bits (967),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 179/194 (92%), Positives = 187/194 (96%), Gaps = 2/194 (1%)
 Frame = +1

Query  232  MAGAASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGDPQ--DPVAYDSGVTY  405
            MAGAASALFLLD+KGRVLVWRDYRGDVSA QAERFFTKL+E EGDPQ  DPV YD+GVTY
Sbjct  1    MAGAASALFLLDIKGRVLVWRDYRGDVSAAQAERFFTKLIEKEGDPQSQDPVVYDNGVTY  60

Query  406  MFIQHNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEI  585
            MF+QH+NVYLM A+RQNCNAASLL FLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEI
Sbjct  61   MFVQHSNVYLMTATRQNCNAASLLFFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEI  120

Query  586  MDFGYPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVES  765
            MDFGYPQ+TEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVES
Sbjct  121  MDFGYPQYTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVES  180

Query  766  VNILVNSNGQIVRS  807
            VNILVNSNGQI+RS
Sbjct  181  VNILVNSNGQIIRS  194



>gb|EYU22519.1| hypothetical protein MIMGU_mgv1a006868mg [Erythranthe guttata]
Length=428

 Score =   377 bits (967),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 180/194 (93%), Positives = 187/194 (96%), Gaps = 2/194 (1%)
 Frame = +1

Query  232  MAGAASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGDP--QDPVAYDSGVTY  405
            MAGAASALFLLD+KG+VLVWRDYRGDVS+ QAERFFTKL+E +GDP  QDPV YD+GVTY
Sbjct  1    MAGAASALFLLDIKGKVLVWRDYRGDVSSAQAERFFTKLIEKDGDPETQDPVVYDNGVTY  60

Query  406  MFIQHNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEI  585
            MFIQHNNVYLM ASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEI
Sbjct  61   MFIQHNNVYLMTASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEI  120

Query  586  MDFGYPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVES  765
            MDFGYPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGI YKKNEVFLDVVES
Sbjct  121  MDFGYPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGIRYKKNEVFLDVVES  180

Query  766  VNILVNSNGQIVRS  807
            VNILVNSNGQI+RS
Sbjct  181  VNILVNSNGQIIRS  194



>gb|KJB50247.1| hypothetical protein B456_008G160500 [Gossypium raimondii]
Length=428

 Score =   377 bits (967),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 179/194 (92%), Positives = 187/194 (96%), Gaps = 2/194 (1%)
 Frame = +1

Query  232  MAGAASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGDPQ--DPVAYDSGVTY  405
            MAGAASALFLLD+KGRVLVWRDYRGDVSA QAERFFTKL+E EGDPQ  DPV YD+GVTY
Sbjct  1    MAGAASALFLLDIKGRVLVWRDYRGDVSAAQAERFFTKLIEKEGDPQSQDPVVYDNGVTY  60

Query  406  MFIQHNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEI  585
            MF+QH+NVYLM A+RQNCNAASLL FLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEI
Sbjct  61   MFVQHSNVYLMTATRQNCNAASLLFFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEI  120

Query  586  MDFGYPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVES  765
            MDFGYPQ+TEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVES
Sbjct  121  MDFGYPQYTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVES  180

Query  766  VNILVNSNGQIVRS  807
            VNILVNSNGQI+RS
Sbjct  181  VNILVNSNGQIIRS  194



>emb|CAN71032.1| hypothetical protein VITISV_035320 [Vitis vinifera]
Length=230

 Score =   369 bits (946),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 177/194 (91%), Positives = 185/194 (95%), Gaps = 2/194 (1%)
 Frame = +1

Query  232  MAGAASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGDP--QDPVAYDSGVTY  405
            MAGAASALFLLD+KGRVLVWRDYRGDVSA QAERFF KL+E EGDP  QDPV YD+GVTY
Sbjct  1    MAGAASALFLLDIKGRVLVWRDYRGDVSAVQAERFFAKLMEKEGDPESQDPVVYDNGVTY  60

Query  406  MFIQHNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEI  585
            MFIQHNNV+LM ASRQNCNAAS LLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDE+
Sbjct  61   MFIQHNNVFLMTASRQNCNAASHLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEM  120

Query  586  MDFGYPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVES  765
            MDFGYPQ+TEAKILSEFIKTDAYRMEV+QRPPMAVTNAVSWRSEGI YKKNEVFLDVVES
Sbjct  121  MDFGYPQYTEAKILSEFIKTDAYRMEVSQRPPMAVTNAVSWRSEGIRYKKNEVFLDVVES  180

Query  766  VNILVNSNGQIVRS  807
            VNILVNSNGQI+RS
Sbjct  181  VNILVNSNGQIIRS  194



>ref|XP_004135264.1| PREDICTED: AP-1 complex subunit mu-1-like [Cucumis sativus]
 gb|KGN51772.1| hypothetical protein Csa_5G599290 [Cucumis sativus]
Length=428

 Score =   376 bits (965),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 178/194 (92%), Positives = 187/194 (96%), Gaps = 2/194 (1%)
 Frame = +1

Query  232  MAGAASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGDPQ--DPVAYDSGVTY  405
            MAGAASALFLLD+KGRVL+WRDYRGDVSA QAERFFTKL+E EGDPQ  DPV YDSG++Y
Sbjct  1    MAGAASALFLLDIKGRVLIWRDYRGDVSAVQAERFFTKLIEKEGDPQSQDPVVYDSGISY  60

Query  406  MFIQHNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEI  585
            MFIQHNNVYLM+A+RQNCNAASLL FLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEI
Sbjct  61   MFIQHNNVYLMVAARQNCNAASLLSFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEI  120

Query  586  MDFGYPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVES  765
            MDFGYPQ+TEAKILSEFIKTDAYRMEV QRPPMAVTNAVSWRSEGINYKKNEVFLDVVES
Sbjct  121  MDFGYPQYTEAKILSEFIKTDAYRMEVAQRPPMAVTNAVSWRSEGINYKKNEVFLDVVES  180

Query  766  VNILVNSNGQIVRS  807
            VNILVNSNGQI+RS
Sbjct  181  VNILVNSNGQIIRS  194



>ref|XP_011086615.1| PREDICTED: AP-1 complex subunit mu-2 [Sesamum indicum]
Length=428

 Score =   375 bits (963),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 180/194 (93%), Positives = 185/194 (95%), Gaps = 2/194 (1%)
 Frame = +1

Query  232  MAGAASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGDP--QDPVAYDSGVTY  405
            MAGAASALFLLD+KGRVLVWRDYRGDVSA QAERFFTKL+E EGDP  QDPV +D GVTY
Sbjct  1    MAGAASALFLLDIKGRVLVWRDYRGDVSAVQAERFFTKLIEKEGDPASQDPVVFDDGVTY  60

Query  406  MFIQHNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEI  585
            MFIQHNNVYLM ASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEI
Sbjct  61   MFIQHNNVYLMTASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEI  120

Query  586  MDFGYPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVES  765
            MDFGYPQ+TEAKILSEFIKTDAYRMEV QRPPMAVTNAVSWRSEGI YKKNEVFLDVVES
Sbjct  121  MDFGYPQYTEAKILSEFIKTDAYRMEVAQRPPMAVTNAVSWRSEGIRYKKNEVFLDVVES  180

Query  766  VNILVNSNGQIVRS  807
            VNILVNSNGQI+RS
Sbjct  181  VNILVNSNGQIIRS  194



>emb|CDP13203.1| unnamed protein product [Coffea canephora]
Length=428

 Score =   375 bits (963),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 181/194 (93%), Positives = 185/194 (95%), Gaps = 2/194 (1%)
 Frame = +1

Query  232  MAGAASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGDPQ--DPVAYDSGVTY  405
            MAGAASALFLLD+KGRVLVWRDYRGDVSA QAER FTKL+E EGDPQ  DPV YD GVTY
Sbjct  1    MAGAASALFLLDIKGRVLVWRDYRGDVSAAQAERCFTKLIEKEGDPQSQDPVVYDDGVTY  60

Query  406  MFIQHNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEI  585
            M+IQHNNVYLM ASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEI
Sbjct  61   MYIQHNNVYLMTASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEI  120

Query  586  MDFGYPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVES  765
            MDFGYPQ+TEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGI YKKNEVFLDVVES
Sbjct  121  MDFGYPQYTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGIRYKKNEVFLDVVES  180

Query  766  VNILVNSNGQIVRS  807
            VNILVNSNGQIVRS
Sbjct  181  VNILVNSNGQIVRS  194



>ref|XP_010102500.1| AP-1 complex subunit mu-1 [Morus notabilis]
 gb|EXB93564.1| AP-1 complex subunit mu-1 [Morus notabilis]
Length=428

 Score =   375 bits (962),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 179/194 (92%), Positives = 187/194 (96%), Gaps = 2/194 (1%)
 Frame = +1

Query  232  MAGAASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGDP--QDPVAYDSGVTY  405
            MAGAASALFLLD+KGRVL+WRDYRGDVSA QAERFFTKL+E EGD   QDPV YD+GVTY
Sbjct  1    MAGAASALFLLDIKGRVLIWRDYRGDVSAAQAERFFTKLIEKEGDSESQDPVVYDNGVTY  60

Query  406  MFIQHNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEI  585
            MF+QHNNVYLMIASRQNCNAASLLLFLHR+VDVFKHYFEELEEESLRDNFVVVYELLDEI
Sbjct  61   MFVQHNNVYLMIASRQNCNAASLLLFLHRLVDVFKHYFEELEEESLRDNFVVVYELLDEI  120

Query  586  MDFGYPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVES  765
            MDFG+PQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGI YKKNEVFLDVVES
Sbjct  121  MDFGFPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGIRYKKNEVFLDVVES  180

Query  766  VNILVNSNGQIVRS  807
            VNILVNSNGQI+RS
Sbjct  181  VNILVNSNGQIIRS  194



>ref|XP_006847624.1| hypothetical protein AMTR_s00014p00250090 [Amborella trichopoda]
 gb|ERN09205.1| hypothetical protein AMTR_s00014p00250090 [Amborella trichopoda]
Length=428

 Score =   374 bits (961),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 179/194 (92%), Positives = 187/194 (96%), Gaps = 2/194 (1%)
 Frame = +1

Query  232  MAGAASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGDPQ--DPVAYDSGVTY  405
            MAGAASALFLLD+KGRVLVWRDYRGDVSA QAE+FFTKL+E EGDP+  DPV YD+GVTY
Sbjct  1    MAGAASALFLLDIKGRVLVWRDYRGDVSALQAEKFFTKLIEKEGDPESHDPVVYDNGVTY  60

Query  406  MFIQHNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEI  585
            MFIQHNNVYLM ASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDE+
Sbjct  61   MFIQHNNVYLMTASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEM  120

Query  586  MDFGYPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVES  765
            MDFGYPQ+TEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGI YKKNEVFLDVVES
Sbjct  121  MDFGYPQYTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGIRYKKNEVFLDVVES  180

Query  766  VNILVNSNGQIVRS  807
            VNILVNSNGQI+RS
Sbjct  181  VNILVNSNGQIIRS  194



>ref|XP_010533915.1| PREDICTED: AP-1 complex subunit mu-2-like [Tarenaya hassleriana]
Length=428

 Score =   374 bits (961),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 177/194 (91%), Positives = 188/194 (97%), Gaps = 2/194 (1%)
 Frame = +1

Query  232  MAGAASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGDPQ--DPVAYDSGVTY  405
            MAGAASA+FLLD+KGRVLVWRDYRGDVSA QAERFFTKL+E EGDPQ  DPVAYD+GVTY
Sbjct  1    MAGAASAIFLLDIKGRVLVWRDYRGDVSAVQAERFFTKLIEKEGDPQSKDPVAYDNGVTY  60

Query  406  MFIQHNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEI  585
            MF+QH+NVYLMIASRQNCNAASL+ FLHRV+DVFKHYFEELEEESLRDNFVVVYELLDE+
Sbjct  61   MFVQHSNVYLMIASRQNCNAASLIFFLHRVIDVFKHYFEELEEESLRDNFVVVYELLDEM  120

Query  586  MDFGYPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVES  765
            MDFGYPQ+TEA+ILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGI YKKNEVFLDVVES
Sbjct  121  MDFGYPQYTEARILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGIQYKKNEVFLDVVES  180

Query  766  VNILVNSNGQIVRS  807
            VNILVNSNGQIVRS
Sbjct  181  VNILVNSNGQIVRS  194



>ref|XP_008446174.1| PREDICTED: AP-1 complex subunit mu-2 [Cucumis melo]
Length=428

 Score =   374 bits (961),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 177/194 (91%), Positives = 187/194 (96%), Gaps = 2/194 (1%)
 Frame = +1

Query  232  MAGAASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGDPQ--DPVAYDSGVTY  405
            MAGAASALFLLD+KGRVL+WRDYRGDVSA QAERFFTKL+E EGDPQ  DPV YD+G++Y
Sbjct  1    MAGAASALFLLDIKGRVLIWRDYRGDVSAVQAERFFTKLIEKEGDPQSQDPVVYDNGISY  60

Query  406  MFIQHNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEI  585
            MFIQHNNVYLM+A+RQNCNAASLL FLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEI
Sbjct  61   MFIQHNNVYLMVAARQNCNAASLLSFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEI  120

Query  586  MDFGYPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVES  765
            MDFGYPQ+TEAKILSEFIKTDAYRMEV QRPPMAVTNAVSWRSEGINYKKNEVFLDVVES
Sbjct  121  MDFGYPQYTEAKILSEFIKTDAYRMEVAQRPPMAVTNAVSWRSEGINYKKNEVFLDVVES  180

Query  766  VNILVNSNGQIVRS  807
            VNILVNSNGQI+RS
Sbjct  181  VNILVNSNGQIIRS  194



>gb|KDO69519.1| hypothetical protein CISIN_1g014251mg [Citrus sinensis]
Length=308

 Score =   370 bits (950),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 177/194 (91%), Positives = 185/194 (95%), Gaps = 2/194 (1%)
 Frame = +1

Query  232  MAGAASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGDPQ--DPVAYDSGVTY  405
            MAGAASALFLLD+KGRVL+WRDYRGDVSA QAERFFTK +E EGDPQ  +PV +D+GVTY
Sbjct  1    MAGAASALFLLDIKGRVLIWRDYRGDVSAIQAERFFTKFIEKEGDPQSQNPVVFDNGVTY  60

Query  406  MFIQHNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEI  585
            MFIQHNNVYLM ASRQNCNAAS+LLFLHRV DVFKHYFEELEEESLRDNFVVVYELLDEI
Sbjct  61   MFIQHNNVYLMAASRQNCNAASILLFLHRVADVFKHYFEELEEESLRDNFVVVYELLDEI  120

Query  586  MDFGYPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVES  765
            MDFG+PQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGI YKKNEVFLDVVES
Sbjct  121  MDFGFPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGIRYKKNEVFLDVVES  180

Query  766  VNILVNSNGQIVRS  807
            VNILVNSNGQIVRS
Sbjct  181  VNILVNSNGQIVRS  194



>gb|KDO69518.1| hypothetical protein CISIN_1g014251mg [Citrus sinensis]
Length=318

 Score =   370 bits (950),  Expect = 9e-125, Method: Compositional matrix adjust.
 Identities = 177/194 (91%), Positives = 185/194 (95%), Gaps = 2/194 (1%)
 Frame = +1

Query  232  MAGAASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGDPQ--DPVAYDSGVTY  405
            MAGAASALFLLD+KGRVL+WRDYRGDVSA QAERFFTK +E EGDPQ  +PV +D+GVTY
Sbjct  1    MAGAASALFLLDIKGRVLIWRDYRGDVSAIQAERFFTKFIEKEGDPQSQNPVVFDNGVTY  60

Query  406  MFIQHNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEI  585
            MFIQHNNVYLM ASRQNCNAAS+LLFLHRV DVFKHYFEELEEESLRDNFVVVYELLDEI
Sbjct  61   MFIQHNNVYLMAASRQNCNAASILLFLHRVADVFKHYFEELEEESLRDNFVVVYELLDEI  120

Query  586  MDFGYPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVES  765
            MDFG+PQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGI YKKNEVFLDVVES
Sbjct  121  MDFGFPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGIRYKKNEVFLDVVES  180

Query  766  VNILVNSNGQIVRS  807
            VNILVNSNGQIVRS
Sbjct  181  VNILVNSNGQIVRS  194



>ref|XP_010547708.1| PREDICTED: AP-1 complex subunit mu-2-like [Tarenaya hassleriana]
Length=428

 Score =   374 bits (960),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 178/194 (92%), Positives = 187/194 (96%), Gaps = 2/194 (1%)
 Frame = +1

Query  232  MAGAASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGDPQ--DPVAYDSGVTY  405
            MAGAASALFLLD+KGRVLVWRDYRGDVSA QAERFFTKL+E EGDP   DPVAYD+GVTY
Sbjct  1    MAGAASALFLLDIKGRVLVWRDYRGDVSAVQAERFFTKLIEKEGDPHSNDPVAYDNGVTY  60

Query  406  MFIQHNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEI  585
            MF+QH+NVYLMIASRQNCNAASLL FLHRVVDVFKHYFEELEEESLRDNFVVVYELLDE+
Sbjct  61   MFVQHSNVYLMIASRQNCNAASLLFFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEM  120

Query  586  MDFGYPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVES  765
            MDFGYPQ+TEA+ILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGI YKKNEVFLDV+ES
Sbjct  121  MDFGYPQYTEARILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGIQYKKNEVFLDVIES  180

Query  766  VNILVNSNGQIVRS  807
            VNILVNSNGQIVRS
Sbjct  181  VNILVNSNGQIVRS  194



>ref|XP_010251124.1| PREDICTED: AP-1 complex subunit mu-2 [Nelumbo nucifera]
Length=428

 Score =   374 bits (960),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 179/194 (92%), Positives = 186/194 (96%), Gaps = 2/194 (1%)
 Frame = +1

Query  232  MAGAASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGDP--QDPVAYDSGVTY  405
            MAGA SALFLLD+KGRVLVWRDYRGDVSA QAERFFTKL+E EGDP  QDPV YD+GVTY
Sbjct  1    MAGAVSALFLLDIKGRVLVWRDYRGDVSAVQAERFFTKLIEKEGDPESQDPVVYDNGVTY  60

Query  406  MFIQHNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEI  585
            MFIQHNNV+LM ASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDE+
Sbjct  61   MFIQHNNVFLMTASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEM  120

Query  586  MDFGYPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVES  765
            MDFGYPQ+TEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGI YKKNEVFLDVVES
Sbjct  121  MDFGYPQYTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGIRYKKNEVFLDVVES  180

Query  766  VNILVNSNGQIVRS  807
            VNILVNSNGQI+RS
Sbjct  181  VNILVNSNGQIIRS  194



>ref|XP_008239309.1| PREDICTED: AP-1 complex subunit mu-2-like [Prunus mume]
Length=428

 Score =   373 bits (958),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 178/194 (92%), Positives = 186/194 (96%), Gaps = 2/194 (1%)
 Frame = +1

Query  232  MAGAASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGDP--QDPVAYDSGVTY  405
            MAGAASALFLLD+KGRVL+WRDYRGDVSA QAERFFTK +E E DP  QDPV YD+GV+Y
Sbjct  1    MAGAASALFLLDIKGRVLIWRDYRGDVSAAQAERFFTKFIEKEVDPYSQDPVVYDNGVSY  60

Query  406  MFIQHNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEI  585
            MFIQHNNVYLMIASRQNCNAASLLLFLHRV+DVFKHYFEELEEESLRDNFVVVYELLDEI
Sbjct  61   MFIQHNNVYLMIASRQNCNAASLLLFLHRVIDVFKHYFEELEEESLRDNFVVVYELLDEI  120

Query  586  MDFGYPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVES  765
            MDFG+PQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGI YKKNEVFLDVVES
Sbjct  121  MDFGFPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGIRYKKNEVFLDVVES  180

Query  766  VNILVNSNGQIVRS  807
            VNILVNSNGQI+RS
Sbjct  181  VNILVNSNGQIIRS  194



>ref|XP_007209161.1| hypothetical protein PRUPE_ppa006082mg [Prunus persica]
 gb|EMJ10360.1| hypothetical protein PRUPE_ppa006082mg [Prunus persica]
Length=428

 Score =   373 bits (958),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 178/194 (92%), Positives = 186/194 (96%), Gaps = 2/194 (1%)
 Frame = +1

Query  232  MAGAASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGDP--QDPVAYDSGVTY  405
            MAGAASALFLLD+KGRVL+WRDYRGDVSA QAERFFTK +E E DP  QDPV YD+GV+Y
Sbjct  1    MAGAASALFLLDIKGRVLIWRDYRGDVSAAQAERFFTKFIEKEVDPYSQDPVVYDNGVSY  60

Query  406  MFIQHNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEI  585
            MFIQHNNVYLMIASRQNCNAASLLLFLHRV+DVFKHYFEELEEESLRDNFVVVYELLDEI
Sbjct  61   MFIQHNNVYLMIASRQNCNAASLLLFLHRVIDVFKHYFEELEEESLRDNFVVVYELLDEI  120

Query  586  MDFGYPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVES  765
            MDFG+PQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGI YKKNEVFLDVVES
Sbjct  121  MDFGFPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGIRYKKNEVFLDVVES  180

Query  766  VNILVNSNGQIVRS  807
            VNILVNSNGQI+RS
Sbjct  181  VNILVNSNGQIIRS  194



>ref|XP_002511345.1| clathrin coat assembly protein ap-1, putative [Ricinus communis]
 gb|EEF51947.1| clathrin coat assembly protein ap-1, putative [Ricinus communis]
Length=428

 Score =   373 bits (957),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 177/194 (91%), Positives = 187/194 (96%), Gaps = 2/194 (1%)
 Frame = +1

Query  232  MAGAASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGDPQ--DPVAYDSGVTY  405
            MAGAASALFLLD+KGRVL+WRDYRGDVSA QAERFFTKL+E EGDPQ  DPV YD+GVTY
Sbjct  1    MAGAASALFLLDIKGRVLIWRDYRGDVSAVQAERFFTKLIEKEGDPQSQDPVVYDNGVTY  60

Query  406  MFIQHNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEI  585
            MFIQH+N+YLM ASRQNCNAAS+LLFLHR+VDVFKHYFEELEEESLRDNFVVVYELLDEI
Sbjct  61   MFIQHSNIYLMSASRQNCNAASILLFLHRLVDVFKHYFEELEEESLRDNFVVVYELLDEI  120

Query  586  MDFGYPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVES  765
            MDFG+PQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGI YKKNEVFLDVVES
Sbjct  121  MDFGFPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGIRYKKNEVFLDVVES  180

Query  766  VNILVNSNGQIVRS  807
            VNILVNSNGQI+RS
Sbjct  181  VNILVNSNGQIIRS  194



>ref|XP_010682420.1| PREDICTED: AP-1 complex subunit mu-2 [Beta vulgaris subsp. vulgaris]
Length=428

 Score =   373 bits (957),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 176/194 (91%), Positives = 187/194 (96%), Gaps = 2/194 (1%)
 Frame = +1

Query  232  MAGAASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGDPQ--DPVAYDSGVTY  405
            M+GAASALFLLD+KGRVL+WRDYRGDVSA QAERFFTK +E EGDPQ  DPV +D+G+TY
Sbjct  1    MSGAASALFLLDIKGRVLIWRDYRGDVSAVQAERFFTKFIEKEGDPQSQDPVVHDNGITY  60

Query  406  MFIQHNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEI  585
            MFIQHNNVYL+IA+RQNCNAASLLLFLHR+VDVFKHYFEELEEESLRDNFVVVYELLDEI
Sbjct  61   MFIQHNNVYLLIAARQNCNAASLLLFLHRLVDVFKHYFEELEEESLRDNFVVVYELLDEI  120

Query  586  MDFGYPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVES  765
            MDFGYPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGI YKKNEVFLDVVES
Sbjct  121  MDFGYPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGIAYKKNEVFLDVVES  180

Query  766  VNILVNSNGQIVRS  807
            VNILVNSNGQI+RS
Sbjct  181  VNILVNSNGQIIRS  194



>ref|XP_011071132.1| PREDICTED: AP-1 complex subunit mu-2 [Sesamum indicum]
Length=428

 Score =   372 bits (956),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 179/194 (92%), Positives = 185/194 (95%), Gaps = 2/194 (1%)
 Frame = +1

Query  232  MAGAASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGDP--QDPVAYDSGVTY  405
            MAGAASALFLLD+KGRVLVWRDYRGDVSA QAERFFTKL+E EGDP  QDPV YD+G+TY
Sbjct  1    MAGAASALFLLDIKGRVLVWRDYRGDVSAVQAERFFTKLIEKEGDPESQDPVVYDNGITY  60

Query  406  MFIQHNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEI  585
            MFIQHNNVYLM ASRQN NAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEI
Sbjct  61   MFIQHNNVYLMTASRQNSNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEI  120

Query  586  MDFGYPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVES  765
            MDFGYPQ+TEAKILSEFIKTDAYRMEV QRPPMAVTNAVSWRSEGI YKKNEVFLDVVES
Sbjct  121  MDFGYPQYTEAKILSEFIKTDAYRMEVAQRPPMAVTNAVSWRSEGIRYKKNEVFLDVVES  180

Query  766  VNILVNSNGQIVRS  807
            VNILVNSNGQI+RS
Sbjct  181  VNILVNSNGQIIRS  194



>gb|EYU28424.1| hypothetical protein MIMGU_mgv1a006870mg [Erythranthe guttata]
Length=428

 Score =   372 bits (956),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 179/194 (92%), Positives = 186/194 (96%), Gaps = 2/194 (1%)
 Frame = +1

Query  232  MAGAASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGDP--QDPVAYDSGVTY  405
            MAGAASALFLLD+KGRVLVWRDYRGDV+A QAERFFTKL+E +GDP  QDPV  D+GVTY
Sbjct  1    MAGAASALFLLDIKGRVLVWRDYRGDVTAVQAERFFTKLIEKDGDPETQDPVVNDNGVTY  60

Query  406  MFIQHNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEI  585
            MFIQHNNVYLM ASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEI
Sbjct  61   MFIQHNNVYLMTASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEI  120

Query  586  MDFGYPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVES  765
            MDFGYPQ+TEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGI YKKNEVFLDVVES
Sbjct  121  MDFGYPQYTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGIRYKKNEVFLDVVES  180

Query  766  VNILVNSNGQIVRS  807
            VNILVNSNGQI+RS
Sbjct  181  VNILVNSNGQIIRS  194



>ref|XP_004155408.1| PREDICTED: AP-1 complex subunit mu-1-like, partial [Cucumis sativus]
Length=428

 Score =   372 bits (955),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 176/193 (91%), Positives = 185/193 (96%), Gaps = 2/193 (1%)
 Frame = +1

Query  235  AGAASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGDPQ--DPVAYDSGVTYM  408
             GAASALFLLD+KGRVL+WRDYRGDVSA QAERFFTKL+E EGDPQ  DPV YDSG++YM
Sbjct  2    GGAASALFLLDIKGRVLIWRDYRGDVSAVQAERFFTKLIEKEGDPQSQDPVVYDSGISYM  61

Query  409  FIQHNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEIM  588
            FIQHNNVYLM+A+RQNCNAASLL FLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEIM
Sbjct  62   FIQHNNVYLMVAARQNCNAASLLSFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEIM  121

Query  589  DFGYPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVESV  768
            DFGYPQ+TEAKILSEFIKTDAYRMEV QRPPMAVTNAVSWRSEGINYKKNEVFLDVVESV
Sbjct  122  DFGYPQYTEAKILSEFIKTDAYRMEVAQRPPMAVTNAVSWRSEGINYKKNEVFLDVVESV  181

Query  769  NILVNSNGQIVRS  807
            NILVNSNGQI+RS
Sbjct  182  NILVNSNGQIIRS  194



>gb|ABR18420.1| unknown [Picea sitchensis]
Length=428

 Score =   372 bits (954),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 177/194 (91%), Positives = 187/194 (96%), Gaps = 2/194 (1%)
 Frame = +1

Query  232  MAGAASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGDP--QDPVAYDSGVTY  405
            MAGAASALF LD+KGRVLVWRDYRGDVS++QAERFF+KL+E EGDP   DPV +DSG+TY
Sbjct  1    MAGAASALFFLDLKGRVLVWRDYRGDVSSSQAERFFSKLIEKEGDPGSHDPVVHDSGITY  60

Query  406  MFIQHNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEI  585
            MFIQHNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDE+
Sbjct  61   MFIQHNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEM  120

Query  586  MDFGYPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVES  765
            MDFGYPQ+TEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGI YKKNEVFLDVVE+
Sbjct  121  MDFGYPQYTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGIRYKKNEVFLDVVEN  180

Query  766  VNILVNSNGQIVRS  807
            VNILVNSNGQIVRS
Sbjct  181  VNILVNSNGQIVRS  194



>ref|NP_176277.1| protein HAPLESS 13 [Arabidopsis thaliana]
 sp|O22715.1|AP1M2_ARATH RecName: Full=AP-1 complex subunit mu-2; AltName: Full=Adaptor 
protein complex AP-1 subunit mu-2; AltName: Full=Adaptor protein-1 
mu-adaptin 2; AltName: Full=Adaptor-related protein 
complex 1 subunit mu-2; AltName: Full=At-muB2-Ad; AltName: 
Full=Clathrin assembly protein complex 1 mu-2 medium chain; 
AltName: Full=Mu1-adaptin 2; AltName: Full=Protein HAPLESS 13 
[Arabidopsis thaliana]
 gb|AAB71967.1| putative Clathrin Coat Assembly protein [Arabidopsis thaliana]
 gb|AAM20503.1| clathrin adaptor medium chain protein MU1B, putative [Arabidopsis 
thaliana]
 gb|AAN72155.1| clathrin adaptor medium chain protein MU1B, putative [Arabidopsis 
thaliana]
 gb|AEE33731.1| protein HAPLESS 13 [Arabidopsis thaliana]
Length=428

 Score =   372 bits (954),  Expect = 9e-124, Method: Compositional matrix adjust.
 Identities = 177/194 (91%), Positives = 187/194 (96%), Gaps = 2/194 (1%)
 Frame = +1

Query  232  MAGAASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGDPQ--DPVAYDSGVTY  405
            MAGAASALFLLD+KGRVLVWRDYRGDVSA QAERFFTKL+E EGD Q  DPVAYD+GVTY
Sbjct  1    MAGAASALFLLDIKGRVLVWRDYRGDVSAAQAERFFTKLIEKEGDSQSNDPVAYDNGVTY  60

Query  406  MFIQHNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEI  585
            MF+QH+NVYLMIASRQNCNAASLL FLHRVVDVFKHYFEELEEESLRDNFVVVYELLDE+
Sbjct  61   MFVQHSNVYLMIASRQNCNAASLLFFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEM  120

Query  586  MDFGYPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVES  765
            MDFGYPQ+TEA+ILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGI YKKNEVFLDV+E+
Sbjct  121  MDFGYPQYTEARILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGIQYKKNEVFLDVIEN  180

Query  766  VNILVNSNGQIVRS  807
            VNILVNSNGQIVRS
Sbjct  181  VNILVNSNGQIVRS  194



>ref|XP_004509658.1| PREDICTED: AP-1 complex subunit mu-1-like [Cicer arietinum]
Length=428

 Score =   371 bits (952),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 173/194 (89%), Positives = 188/194 (97%), Gaps = 2/194 (1%)
 Frame = +1

Query  232  MAGAASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGDPQ--DPVAYDSGVTY  405
            M+GAASALFLLD+KGRVL+WRDYRGDV+A +AERFFTKL+E EGDPQ  DPV YD+GV+Y
Sbjct  1    MSGAASALFLLDIKGRVLIWRDYRGDVTAVEAERFFTKLIEKEGDPQSQDPVVYDNGVSY  60

Query  406  MFIQHNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEI  585
            MF+QH+NVYLMIA+RQNCNAASL+ FLHR+VDVFKHYFEELEEESLRDNFVVVYELLDEI
Sbjct  61   MFVQHSNVYLMIATRQNCNAASLIFFLHRIVDVFKHYFEELEEESLRDNFVVVYELLDEI  120

Query  586  MDFGYPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVES  765
            MDFGYPQ+TEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVES
Sbjct  121  MDFGYPQYTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVES  180

Query  766  VNILVNSNGQIVRS  807
            VNILVNSNGQI+RS
Sbjct  181  VNILVNSNGQIIRS  194



>ref|XP_003531990.1| PREDICTED: AP-1 complex subunit mu-2-like [Glycine max]
Length=428

 Score =   371 bits (952),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 174/194 (90%), Positives = 188/194 (97%), Gaps = 2/194 (1%)
 Frame = +1

Query  232  MAGAASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGDPQ--DPVAYDSGVTY  405
            MAGAASALFLLD+KGRVL+WRDYRGDV+A +AERFFTKL+E EGDPQ  DPV YD+GVTY
Sbjct  1    MAGAASALFLLDIKGRVLIWRDYRGDVTAVEAERFFTKLIEKEGDPQSQDPVVYDNGVTY  60

Query  406  MFIQHNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEI  585
            +FIQH+NV+LM+A+RQNCNAASLL FLHR+VDVFKHYFEELEEESLRDNFVVVYELLDEI
Sbjct  61   LFIQHSNVFLMMATRQNCNAASLLFFLHRIVDVFKHYFEELEEESLRDNFVVVYELLDEI  120

Query  586  MDFGYPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVES  765
            MDFGYPQ+TEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVES
Sbjct  121  MDFGYPQYTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVES  180

Query  766  VNILVNSNGQIVRS  807
            VNILVNSNGQI+RS
Sbjct  181  VNILVNSNGQIIRS  194



>ref|XP_010044585.1| PREDICTED: AP-1 complex subunit mu-2 [Eucalyptus grandis]
Length=428

 Score =   371 bits (952),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 176/194 (91%), Positives = 186/194 (96%), Gaps = 2/194 (1%)
 Frame = +1

Query  232  MAGAASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGDPQ--DPVAYDSGVTY  405
            MAGA SALFLLD+KGRVLVWRDYRGDVSA QAERFFTKL+E EGDPQ  DPV YD+GVTY
Sbjct  1    MAGAVSALFLLDIKGRVLVWRDYRGDVSAVQAERFFTKLIEKEGDPQSQDPVVYDNGVTY  60

Query  406  MFIQHNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEI  585
            MFIQH+NVYLM+A+RQNCNAASLL FLHRVVDVFKHYFEELEEESLRDNFVVVYELLDE+
Sbjct  61   MFIQHSNVYLMVAARQNCNAASLLFFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEM  120

Query  586  MDFGYPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVES  765
            MDFGYPQ+TEAKILSEFIKTDAYRMEV+QRPPMAVTNAVSWRSEGI YKKNEVFLDVVES
Sbjct  121  MDFGYPQYTEAKILSEFIKTDAYRMEVSQRPPMAVTNAVSWRSEGIRYKKNEVFLDVVES  180

Query  766  VNILVNSNGQIVRS  807
            VNILVNSNGQI+RS
Sbjct  181  VNILVNSNGQIIRS  194



>ref|XP_003552037.1| PREDICTED: AP-1 complex subunit mu-2-like [Glycine max]
Length=428

 Score =   371 bits (952),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 174/194 (90%), Positives = 188/194 (97%), Gaps = 2/194 (1%)
 Frame = +1

Query  232  MAGAASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGDPQ--DPVAYDSGVTY  405
            MAGAASALFLLD+KGRVL+WRDYRGDV+A +AERFFTKL+E EGDPQ  DPV YD+GVTY
Sbjct  1    MAGAASALFLLDIKGRVLIWRDYRGDVTAVEAERFFTKLIEKEGDPQSQDPVVYDNGVTY  60

Query  406  MFIQHNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEI  585
            +FIQH+NV+LM+A+RQNCNAASLL FLHR+VDVFKHYFEELEEESLRDNFVVVYELLDEI
Sbjct  61   LFIQHSNVFLMMATRQNCNAASLLFFLHRIVDVFKHYFEELEEESLRDNFVVVYELLDEI  120

Query  586  MDFGYPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVES  765
            MDFGYPQ+TEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVES
Sbjct  121  MDFGYPQYTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVES  180

Query  766  VNILVNSNGQIVRS  807
            VNILVNSNGQI+RS
Sbjct  181  VNILVNSNGQIIRS  194



>ref|XP_002886592.1| clathrin adaptor complexes medium subunit family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH62851.1| clathrin adaptor complexes medium subunit family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=428

 Score =   371 bits (952),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 176/194 (91%), Positives = 187/194 (96%), Gaps = 2/194 (1%)
 Frame = +1

Query  232  MAGAASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGDPQ--DPVAYDSGVTY  405
            MAGAASALFLLD+KGR+LVWRDYRGDVSA QAERFFTKL+E EGD Q  DPVAYD+GVTY
Sbjct  1    MAGAASALFLLDIKGRILVWRDYRGDVSAAQAERFFTKLIEKEGDSQSNDPVAYDNGVTY  60

Query  406  MFIQHNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEI  585
            MF+QH+NVYLMIASRQNCNAASLL FLHRVVDVFKHYFEELEEESLRDNFVVVYELLDE+
Sbjct  61   MFVQHSNVYLMIASRQNCNAASLLFFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEM  120

Query  586  MDFGYPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVES  765
            MDFGYPQ+TEA+ILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGI YKKNEVFLDV+E+
Sbjct  121  MDFGYPQYTEARILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGIQYKKNEVFLDVIEN  180

Query  766  VNILVNSNGQIVRS  807
            VNILVNSNGQIVRS
Sbjct  181  VNILVNSNGQIVRS  194



>ref|XP_008374401.1| PREDICTED: AP-1 complex subunit mu-2-like [Malus domestica]
Length=428

 Score =   371 bits (952),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 176/194 (91%), Positives = 185/194 (95%), Gaps = 2/194 (1%)
 Frame = +1

Query  232  MAGAASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGDPQ--DPVAYDSGVTY  405
            MAGAASALFLLD+KGRVL+WRDYRGDV A QAERFFTK +E EGDPQ  DPV YD+GV+Y
Sbjct  1    MAGAASALFLLDIKGRVLIWRDYRGDVPAAQAERFFTKFIEKEGDPQSQDPVVYDNGVSY  60

Query  406  MFIQHNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEI  585
            MFIQHNN+YLMIASRQNCNAASLLLFLHRV+DVFKHYFEELEEESLRDNFVVVYELLDEI
Sbjct  61   MFIQHNNIYLMIASRQNCNAASLLLFLHRVIDVFKHYFEELEEESLRDNFVVVYELLDEI  120

Query  586  MDFGYPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVES  765
            MDFG+PQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGI YKKNEVFLDVVES
Sbjct  121  MDFGFPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGIRYKKNEVFLDVVES  180

Query  766  VNILVNSNGQIVRS  807
            VNILVNS GQI+RS
Sbjct  181  VNILVNSIGQIIRS  194



>ref|XP_006439891.1| hypothetical protein CICLE_v10023962mg [Citrus clementina]
 ref|XP_006476855.1| PREDICTED: AP-1 complex subunit mu-2-like [Citrus sinensis]
 gb|ESR53131.1| hypothetical protein CICLE_v10023962mg [Citrus clementina]
 gb|KDO69517.1| hypothetical protein CISIN_1g014251mg [Citrus sinensis]
Length=428

 Score =   370 bits (951),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 177/194 (91%), Positives = 185/194 (95%), Gaps = 2/194 (1%)
 Frame = +1

Query  232  MAGAASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGDPQ--DPVAYDSGVTY  405
            MAGAASALFLLD+KGRVL+WRDYRGDVSA QAERFFTK +E EGDPQ  +PV +D+GVTY
Sbjct  1    MAGAASALFLLDIKGRVLIWRDYRGDVSAIQAERFFTKFIEKEGDPQSQNPVVFDNGVTY  60

Query  406  MFIQHNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEI  585
            MFIQHNNVYLM ASRQNCNAAS+LLFLHRV DVFKHYFEELEEESLRDNFVVVYELLDEI
Sbjct  61   MFIQHNNVYLMAASRQNCNAASILLFLHRVADVFKHYFEELEEESLRDNFVVVYELLDEI  120

Query  586  MDFGYPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVES  765
            MDFG+PQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGI YKKNEVFLDVVES
Sbjct  121  MDFGFPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGIRYKKNEVFLDVVES  180

Query  766  VNILVNSNGQIVRS  807
            VNILVNSNGQIVRS
Sbjct  181  VNILVNSNGQIVRS  194



>gb|KFK40761.1| hypothetical protein AALP_AA2G037600 [Arabis alpina]
Length=428

 Score =   370 bits (951),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 177/194 (91%), Positives = 187/194 (96%), Gaps = 2/194 (1%)
 Frame = +1

Query  232  MAGAASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGDPQ--DPVAYDSGVTY  405
            MAGAASALFLLD+KGRVLVWRDYRGDVSA+QAERFFTKL+E EGD Q  DPVAYD+GVTY
Sbjct  1    MAGAASALFLLDIKGRVLVWRDYRGDVSASQAERFFTKLIEKEGDSQSNDPVAYDNGVTY  60

Query  406  MFIQHNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEI  585
            MF+QH+NVYLMIASRQNCNAASLL FLHRVVDVFKHYFEELEEESLRDNFVVVYELLDE+
Sbjct  61   MFVQHSNVYLMIASRQNCNAASLLFFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEM  120

Query  586  MDFGYPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVES  765
            MDFGYPQ+TEA ILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGI YKKNEVFLDV+E+
Sbjct  121  MDFGYPQYTEANILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGIQYKKNEVFLDVIEN  180

Query  766  VNILVNSNGQIVRS  807
            VNILVNSNGQIVRS
Sbjct  181  VNILVNSNGQIVRS  194



>ref|XP_010510910.1| PREDICTED: AP-1 complex subunit mu-2 [Camelina sativa]
 ref|XP_010418020.1| PREDICTED: AP-1 complex subunit mu-2 [Camelina sativa]
 ref|XP_010473257.1| PREDICTED: AP-1 complex subunit mu-2 [Camelina sativa]
Length=428

 Score =   370 bits (951),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 176/194 (91%), Positives = 187/194 (96%), Gaps = 2/194 (1%)
 Frame = +1

Query  232  MAGAASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGDPQ--DPVAYDSGVTY  405
            MAGAASALFLLD+KGRVLVWRDYRGDVSA QAERFFTKL+E EGD Q  DPVAYD+GVTY
Sbjct  1    MAGAASALFLLDIKGRVLVWRDYRGDVSAAQAERFFTKLIEKEGDSQSNDPVAYDNGVTY  60

Query  406  MFIQHNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEI  585
            MF+QH+NVYLMIASRQNCNAASL+ FLHRVVDVFKHYFEELEEESLRDNFVVVYELLDE+
Sbjct  61   MFVQHSNVYLMIASRQNCNAASLIFFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEM  120

Query  586  MDFGYPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVES  765
            MDFGYPQ+TEA+ILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGI YKKNEVFLDV+E+
Sbjct  121  MDFGYPQYTEARILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGIQYKKNEVFLDVIEN  180

Query  766  VNILVNSNGQIVRS  807
            VNILVNSNGQIVRS
Sbjct  181  VNILVNSNGQIVRS  194



>ref|XP_006392117.1| hypothetical protein EUTSA_v10023468mg [Eutrema salsugineum]
 gb|ESQ29403.1| hypothetical protein EUTSA_v10023468mg [Eutrema salsugineum]
Length=428

 Score =   370 bits (950),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 176/194 (91%), Positives = 187/194 (96%), Gaps = 2/194 (1%)
 Frame = +1

Query  232  MAGAASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGDPQ--DPVAYDSGVTY  405
            MAGAASALFLLD+KGRVLVWRDYRGDVSA QAERFFTKL+E EGD Q  DPVAYD+GVTY
Sbjct  1    MAGAASALFLLDIKGRVLVWRDYRGDVSAAQAERFFTKLIEKEGDSQSNDPVAYDNGVTY  60

Query  406  MFIQHNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEI  585
            MF+QH+NVYLMIASR+NCNAASLL FLHRVVDVFKHYFEELEEESLRDNFVVVYELLDE+
Sbjct  61   MFVQHSNVYLMIASRKNCNAASLLFFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEM  120

Query  586  MDFGYPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVES  765
            MDFGYPQ+TEA+ILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGI YKKNEVFLDV+E+
Sbjct  121  MDFGYPQYTEARILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGIQYKKNEVFLDVIEN  180

Query  766  VNILVNSNGQIVRS  807
            VNILVNSNGQIVRS
Sbjct  181  VNILVNSNGQIVRS  194



>ref|XP_002274463.1| PREDICTED: AP-1 complex subunit mu-2 [Vitis vinifera]
 emb|CBI23375.3| unnamed protein product [Vitis vinifera]
Length=428

 Score =   370 bits (950),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 177/194 (91%), Positives = 185/194 (95%), Gaps = 2/194 (1%)
 Frame = +1

Query  232  MAGAASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGDP--QDPVAYDSGVTY  405
            MAGAASALFLLD+KGRVLVWRDYRGDVSA QAERFF KL+E EGDP  QDPV YD+GVTY
Sbjct  1    MAGAASALFLLDIKGRVLVWRDYRGDVSAVQAERFFAKLMEKEGDPESQDPVVYDNGVTY  60

Query  406  MFIQHNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEI  585
            MFIQHNNV+LM ASRQNCNAAS LLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDE+
Sbjct  61   MFIQHNNVFLMTASRQNCNAASHLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEM  120

Query  586  MDFGYPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVES  765
            MDFGYPQ+TEAKILSEFIKTDAYRMEV+QRPPMAVTNAVSWRSEGI YKKNEVFLDVVES
Sbjct  121  MDFGYPQYTEAKILSEFIKTDAYRMEVSQRPPMAVTNAVSWRSEGIRYKKNEVFLDVVES  180

Query  766  VNILVNSNGQIVRS  807
            VNILVNSNGQI+RS
Sbjct  181  VNILVNSNGQIIRS  194



>ref|XP_010553612.1| PREDICTED: AP-1 complex subunit mu-2 [Tarenaya hassleriana]
Length=428

 Score =   370 bits (950),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 176/194 (91%), Positives = 186/194 (96%), Gaps = 2/194 (1%)
 Frame = +1

Query  232  MAGAASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGDPQ--DPVAYDSGVTY  405
            M GAASALFLLD+KGRVLVWRDYRGDVSA QAERFFTKL+E EGD Q  DPVAYD+GVTY
Sbjct  1    MVGAASALFLLDIKGRVLVWRDYRGDVSAVQAERFFTKLIEKEGDSQSNDPVAYDNGVTY  60

Query  406  MFIQHNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEI  585
            MF+QH+N+YLMIASRQNCNAASLL FLHRVVDVFKHYFEELEEESLRDNFVVVYELLDE+
Sbjct  61   MFVQHSNIYLMIASRQNCNAASLLFFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEM  120

Query  586  MDFGYPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVES  765
            MDFGYPQ+TEA+ILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGI YKKNEVFLDV+ES
Sbjct  121  MDFGYPQYTEARILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGIQYKKNEVFLDVIES  180

Query  766  VNILVNSNGQIVRS  807
            VNILVNSNGQIVRS
Sbjct  181  VNILVNSNGQIVRS  194



>ref|XP_010923038.1| PREDICTED: AP-1 complex subunit mu-2 [Elaeis guineensis]
Length=428

 Score =   370 bits (950),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 176/194 (91%), Positives = 186/194 (96%), Gaps = 2/194 (1%)
 Frame = +1

Query  232  MAGAASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGDPQD--PVAYDSGVTY  405
            MAGA SALFLLD+KGRVLVWRDYRGDVSA QAERFFTKL+E EGDP+   PVAYD+GVTY
Sbjct  1    MAGAVSALFLLDIKGRVLVWRDYRGDVSALQAERFFTKLIEKEGDPESHSPVAYDNGVTY  60

Query  406  MFIQHNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEI  585
            MFIQHNNV+LM A+RQNCNAAS+LLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDE+
Sbjct  61   MFIQHNNVFLMTAARQNCNAASILLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEM  120

Query  586  MDFGYPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVES  765
            MDFGYPQ+TEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGI YKKNEVFLDVVES
Sbjct  121  MDFGYPQYTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGIRYKKNEVFLDVVES  180

Query  766  VNILVNSNGQIVRS  807
            VNILVNSNGQI+RS
Sbjct  181  VNILVNSNGQIIRS  194



>ref|XP_006300485.1| hypothetical protein CARUB_v10020333mg [Capsella rubella]
 gb|EOA33383.1| hypothetical protein CARUB_v10020333mg [Capsella rubella]
Length=428

 Score =   370 bits (950),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 176/194 (91%), Positives = 187/194 (96%), Gaps = 2/194 (1%)
 Frame = +1

Query  232  MAGAASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGDPQ--DPVAYDSGVTY  405
            MAGAASALFLLD+KGRVLVWRDYRGDVSA QAERFFTKL++ EGD Q  DPVAYD+GVTY
Sbjct  1    MAGAASALFLLDIKGRVLVWRDYRGDVSAAQAERFFTKLIDKEGDSQSNDPVAYDNGVTY  60

Query  406  MFIQHNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEI  585
            MF+QH+NVYLMIASRQNCNAASLL FLHRVVDVFKHYFEELEEESLRDNFVVVYELLDE+
Sbjct  61   MFVQHSNVYLMIASRQNCNAASLLFFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEM  120

Query  586  MDFGYPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVES  765
            MDFGYPQ+TEA+ILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGI YKKNEVFLDV+E+
Sbjct  121  MDFGYPQYTEARILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGIQYKKNEVFLDVIEN  180

Query  766  VNILVNSNGQIVRS  807
            VNILVNSNGQIVRS
Sbjct  181  VNILVNSNGQIVRS  194



>ref|XP_002311769.2| hypothetical protein POPTR_0008s19180g [Populus trichocarpa]
 gb|EEE89136.2| hypothetical protein POPTR_0008s19180g [Populus trichocarpa]
Length=362

 Score =   367 bits (943),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 173/194 (89%), Positives = 185/194 (95%), Gaps = 2/194 (1%)
 Frame = +1

Query  232  MAGAASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGDPQ--DPVAYDSGVTY  405
            MAGAASALFLLD+KGRVLVWRDYRGDVSA QAERFFTK +E EGDPQ  DPV YD+GV+Y
Sbjct  1    MAGAASALFLLDIKGRVLVWRDYRGDVSAVQAERFFTKFIEKEGDPQSQDPVVYDNGVSY  60

Query  406  MFIQHNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEI  585
            MFIQH+NVYLM ASRQNCNAASL+ FLHRVVDVFKHYFEELEEESLRDNFVVVYELLDE+
Sbjct  61   MFIQHSNVYLMAASRQNCNAASLISFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEM  120

Query  586  MDFGYPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVES  765
            MDFGYPQ+TEAKILSEFIKTDAYRME +QRPPMAVTNAVSWRSEGINYKKNEVFLDVVES
Sbjct  121  MDFGYPQYTEAKILSEFIKTDAYRMETSQRPPMAVTNAVSWRSEGINYKKNEVFLDVVES  180

Query  766  VNILVNSNGQIVRS  807
            VNILVN+NGQ++RS
Sbjct  181  VNILVNTNGQVIRS  194



>ref|XP_008392998.1| PREDICTED: AP-1 complex subunit mu-2 [Malus domestica]
Length=428

 Score =   369 bits (948),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 174/194 (90%), Positives = 185/194 (95%), Gaps = 2/194 (1%)
 Frame = +1

Query  232  MAGAASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGDPQ--DPVAYDSGVTY  405
            MAGAASALFLLD+KGRVL+WRDYRGDVSA QAERFFTK +E EGDPQ  DPV YD+GV+Y
Sbjct  1    MAGAASALFLLDIKGRVLIWRDYRGDVSAVQAERFFTKFIEKEGDPQSQDPVVYDNGVSY  60

Query  406  MFIQHNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEI  585
            MF+QHNN+YLMIASRQNCNAASLLLFLHRV+DVFKHYFE LEEESLRDNFVVVYELLDEI
Sbjct  61   MFVQHNNIYLMIASRQNCNAASLLLFLHRVIDVFKHYFEXLEEESLRDNFVVVYELLDEI  120

Query  586  MDFGYPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVES  765
            MDFG+PQFTEAKIL EFIKTDAYRMEVTQRPPMAVTNAVSWRSEGI +KKNEVFLDVVES
Sbjct  121  MDFGFPQFTEAKILXEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGIQFKKNEVFLDVVES  180

Query  766  VNILVNSNGQIVRS  807
            VNILVNSNGQI+RS
Sbjct  181  VNILVNSNGQIIRS  194



>gb|KHN25155.1| AP-1 complex subunit mu-1-I [Glycine soja]
Length=428

 Score =   369 bits (948),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 173/194 (89%), Positives = 187/194 (96%), Gaps = 2/194 (1%)
 Frame = +1

Query  232  MAGAASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGDPQ--DPVAYDSGVTY  405
            M GAASALFLLD+KGRVL+WRDYRGDV+A +AERFFTKL+E EGDPQ  DPV YD+GVTY
Sbjct  1    MGGAASALFLLDIKGRVLIWRDYRGDVTAVEAERFFTKLIEKEGDPQSQDPVVYDNGVTY  60

Query  406  MFIQHNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEI  585
            +FIQH+NV+LM+A+RQNCNAASLL FLHR+VDVFKHYFEELEEESLRDNFVVVYELLDEI
Sbjct  61   LFIQHSNVFLMMATRQNCNAASLLFFLHRIVDVFKHYFEELEEESLRDNFVVVYELLDEI  120

Query  586  MDFGYPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVES  765
            MDFGYPQ+TEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVES
Sbjct  121  MDFGYPQYTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVES  180

Query  766  VNILVNSNGQIVRS  807
            VNILVNSNGQI+RS
Sbjct  181  VNILVNSNGQIIRS  194



>ref|XP_010248608.1| PREDICTED: AP-1 complex subunit mu-2-like [Nelumbo nucifera]
Length=428

 Score =   369 bits (948),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 178/194 (92%), Positives = 184/194 (95%), Gaps = 2/194 (1%)
 Frame = +1

Query  232  MAGAASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGDP--QDPVAYDSGVTY  405
            MAGA SALF LD+KGRVLVWRDYRGDVSA QAERFFTKL+E EGDP  QDPV YD+GVTY
Sbjct  1    MAGAVSALFFLDIKGRVLVWRDYRGDVSAIQAERFFTKLIEKEGDPESQDPVVYDNGVTY  60

Query  406  MFIQHNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEI  585
            MFIQHNNVYLM ASRQN NAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDE+
Sbjct  61   MFIQHNNVYLMTASRQNSNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEM  120

Query  586  MDFGYPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVES  765
            MDFGYPQ+TEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGI YKKNEVFLDVVES
Sbjct  121  MDFGYPQYTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGIRYKKNEVFLDVVES  180

Query  766  VNILVNSNGQIVRS  807
            VNILVNSNGQI+RS
Sbjct  181  VNILVNSNGQIIRS  194



>ref|XP_006307589.1| hypothetical protein CARUB_v10009212mg [Capsella rubella]
 ref|XP_006307590.1| hypothetical protein CARUB_v10009212mg [Capsella rubella]
 gb|EOA40487.1| hypothetical protein CARUB_v10009212mg [Capsella rubella]
 gb|EOA40488.1| hypothetical protein CARUB_v10009212mg [Capsella rubella]
Length=428

 Score =   369 bits (948),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 175/194 (90%), Positives = 187/194 (96%), Gaps = 2/194 (1%)
 Frame = +1

Query  232  MAGAASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGDPQ--DPVAYDSGVTY  405
            MAGAASALFLLD+KGRVLVWRDYRGDV+A QAERFFTKL+E EGD Q  DPVAYD+GVTY
Sbjct  1    MAGAASALFLLDIKGRVLVWRDYRGDVTAAQAERFFTKLIEKEGDSQSNDPVAYDNGVTY  60

Query  406  MFIQHNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEI  585
            MF+QH+N+YLMIASRQNCNAASLL FLHRVVDVFKHYFEELEEESLRDNFVVVYELLDE+
Sbjct  61   MFVQHSNIYLMIASRQNCNAASLLFFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEM  120

Query  586  MDFGYPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVES  765
            MDFGYPQ+TEA+ILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEG+ +KKNEVFLDVVES
Sbjct  121  MDFGYPQYTEARILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGLQFKKNEVFLDVVES  180

Query  766  VNILVNSNGQIVRS  807
            VNILVNSNGQIVRS
Sbjct  181  VNILVNSNGQIVRS  194



>ref|XP_010458434.1| PREDICTED: AP-1 complex subunit mu-2-like [Camelina sativa]
Length=428

 Score =   369 bits (947),  Expect = 9e-123, Method: Compositional matrix adjust.
 Identities = 174/194 (90%), Positives = 187/194 (96%), Gaps = 2/194 (1%)
 Frame = +1

Query  232  MAGAASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGDPQ--DPVAYDSGVTY  405
            MAGAASALFLLD+KGRVLVWRDYRGDV+A QAERFFTKL+E EGD Q  DPVAYD+GVTY
Sbjct  1    MAGAASALFLLDIKGRVLVWRDYRGDVTAAQAERFFTKLIEKEGDSQSNDPVAYDNGVTY  60

Query  406  MFIQHNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEI  585
            MF+QH+N+YLMIASRQNCNAASLL FLHRVVDVFKHYFEELEEESLRDNFVVVYELLDE+
Sbjct  61   MFVQHSNIYLMIASRQNCNAASLLFFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEM  120

Query  586  MDFGYPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVES  765
            MDFGYPQ+TEA+ILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEG+ +KKNEVFLDV+ES
Sbjct  121  MDFGYPQYTEARILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGLQFKKNEVFLDVIES  180

Query  766  VNILVNSNGQIVRS  807
            VNILVNSNGQIVRS
Sbjct  181  VNILVNSNGQIVRS  194



>gb|KFK43365.1| hypothetical protein AALP_AA1G116700 [Arabis alpina]
Length=428

 Score =   369 bits (947),  Expect = 9e-123, Method: Compositional matrix adjust.
 Identities = 174/194 (90%), Positives = 187/194 (96%), Gaps = 2/194 (1%)
 Frame = +1

Query  232  MAGAASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGDPQ--DPVAYDSGVTY  405
            MAGAASALFLLD+KGRVLVWRDYRGDV+A QAERFFTKL+E EGD Q  DPVAYD+GVTY
Sbjct  1    MAGAASALFLLDIKGRVLVWRDYRGDVTAAQAERFFTKLIEKEGDSQSNDPVAYDNGVTY  60

Query  406  MFIQHNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEI  585
            MF+QH+N+YLMIASRQNCNAASLL FLHRVVDVFKHYFEELEEESLRDNFVVVYELLDE+
Sbjct  61   MFVQHSNIYLMIASRQNCNAASLLFFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEM  120

Query  586  MDFGYPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVES  765
            MDFGYPQ+TEA+ILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEG+ +KKNEVFLDV+ES
Sbjct  121  MDFGYPQYTEARILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGLQFKKNEVFLDVIES  180

Query  766  VNILVNSNGQIVRS  807
            VNILVNSNGQIVRS
Sbjct  181  VNILVNSNGQIVRS  194



>ref|XP_006417426.1| hypothetical protein EUTSA_v10007700mg [Eutrema salsugineum]
 gb|ESQ35779.1| hypothetical protein EUTSA_v10007700mg [Eutrema salsugineum]
Length=428

 Score =   369 bits (947),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 174/194 (90%), Positives = 187/194 (96%), Gaps = 2/194 (1%)
 Frame = +1

Query  232  MAGAASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGDPQ--DPVAYDSGVTY  405
            MAGAASALFLLD+KGRVLVWRDYRGDV+A QAERFFTKL+E EGD Q  DPVAYD+GVTY
Sbjct  1    MAGAASALFLLDIKGRVLVWRDYRGDVTAAQAERFFTKLIEKEGDSQSNDPVAYDNGVTY  60

Query  406  MFIQHNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEI  585
            MF+QH+N+YLMIASRQNCNAASLL FLHRVVDVFKHYFEELEEESLRDNFVVVYELLDE+
Sbjct  61   MFVQHSNIYLMIASRQNCNAASLLFFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEM  120

Query  586  MDFGYPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVES  765
            MDFGYPQ+TEA+ILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEG+ +KKNEVFLDV+ES
Sbjct  121  MDFGYPQYTEARILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGLQFKKNEVFLDVIES  180

Query  766  VNILVNSNGQIVRS  807
            VNILVNSNGQIVRS
Sbjct  181  VNILVNSNGQIVRS  194



>ref|XP_002889832.1| clathrin adaptor complexes medium subunit family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH66091.1| clathrin adaptor complexes medium subunit family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=428

 Score =   369 bits (947),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 174/194 (90%), Positives = 187/194 (96%), Gaps = 2/194 (1%)
 Frame = +1

Query  232  MAGAASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGDPQ--DPVAYDSGVTY  405
            MAGAASALFLLD+KGRVLVWRDYRGDV+A QAERFFTKL+E EGD Q  DPVAYD+GVTY
Sbjct  1    MAGAASALFLLDIKGRVLVWRDYRGDVTAAQAERFFTKLIEKEGDSQSNDPVAYDNGVTY  60

Query  406  MFIQHNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEI  585
            MF+QH+N+YLMIASRQNCNAASLL FLHRVVDVFKHYFEELEEESLRDNFVVVYELLDE+
Sbjct  61   MFVQHSNIYLMIASRQNCNAASLLFFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEM  120

Query  586  MDFGYPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVES  765
            MDFGYPQ+TEA+ILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEG+ +KKNEVFLDV+ES
Sbjct  121  MDFGYPQYTEARILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGLQFKKNEVFLDVIES  180

Query  766  VNILVNSNGQIVRS  807
            VNILVNSNGQIVRS
Sbjct  181  VNILVNSNGQIVRS  194



>ref|XP_008791180.1| PREDICTED: AP-1 complex subunit mu-2 [Phoenix dactylifera]
Length=428

 Score =   369 bits (946),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 175/194 (90%), Positives = 185/194 (95%), Gaps = 2/194 (1%)
 Frame = +1

Query  232  MAGAASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGDPQD--PVAYDSGVTY  405
            MAGA SALFLLD+KGRVLVWRDYRGDVSA QAERFFTKL+E EGDP+   PVA+D GVTY
Sbjct  1    MAGAVSALFLLDIKGRVLVWRDYRGDVSALQAERFFTKLIEKEGDPESHSPVAFDKGVTY  60

Query  406  MFIQHNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEI  585
            MFIQHNNV+LM A+RQNCNAAS+LLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDE+
Sbjct  61   MFIQHNNVFLMTAARQNCNAASILLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEM  120

Query  586  MDFGYPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVES  765
            MDFGYPQ+TEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGI YKKNEVFLDVVES
Sbjct  121  MDFGYPQYTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGIRYKKNEVFLDVVES  180

Query  766  VNILVNSNGQIVRS  807
            VNILVNSNGQI+RS
Sbjct  181  VNILVNSNGQIIRS  194



>ref|XP_010475954.1| PREDICTED: AP-1 complex subunit mu-2-like [Camelina sativa]
Length=428

 Score =   369 bits (946),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 174/194 (90%), Positives = 187/194 (96%), Gaps = 2/194 (1%)
 Frame = +1

Query  232  MAGAASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGDPQ--DPVAYDSGVTY  405
            MAGAASALFLLD+KGRVLVWRDYRGDV+A QAERFFTKL+E EGD Q  DPVAYD+GVTY
Sbjct  1    MAGAASALFLLDIKGRVLVWRDYRGDVTAAQAERFFTKLIEKEGDSQSNDPVAYDNGVTY  60

Query  406  MFIQHNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEI  585
            MF+QH+N+YLMIASRQNCNAASLL FLHRVVDVFKHYFEELEEESLRDNFVVVYELLDE+
Sbjct  61   MFVQHSNIYLMIASRQNCNAASLLFFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEM  120

Query  586  MDFGYPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVES  765
            MDFGYPQ+TEA+ILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEG+ +KKNEVFLDV+ES
Sbjct  121  MDFGYPQYTEARILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGLQFKKNEVFLDVIES  180

Query  766  VNILVNSNGQIVRS  807
            VNILVNSNGQIVRS
Sbjct  181  VNILVNSNGQIVRS  194



>ref|NP_172543.1| clathrin adaptor complexes medium subunit family protein [Arabidopsis 
thaliana]
 sp|Q9SAC9.1|AP1M1_ARATH RecName: Full=AP-1 complex subunit mu-1; AltName: Full=Adaptor 
protein complex AP-1 subunit mu-1; AltName: Full=Adaptor protein-1 
mu-adaptin 1; AltName: Full=Adaptor-related protein 
complex 1 subunit mu-1; AltName: Full=At-muB1-Ad; AltName: 
Full=Clathrin assembly protein complex 1 mu-1 medium chain; 
AltName: Full=Mu1-adaptin 1 [Arabidopsis thaliana]
 gb|AAD31340.1|AC007354_13 Similar to gb|L26291 clathrin-associated protein unc-101 from 
Caenorhabditis elegans and is a member of the PF|00928 Adapter 
complexes medium subunit family [Arabidopsis thaliana]
 gb|AEE28635.1| clathrin adaptor complexes medium subunit family protein [Arabidopsis 
thaliana]
Length=428

 Score =   368 bits (945),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 174/194 (90%), Positives = 187/194 (96%), Gaps = 2/194 (1%)
 Frame = +1

Query  232  MAGAASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGDPQ--DPVAYDSGVTY  405
            MAGAASALFLLD+KGRVLVWRDYRGDV+A QAERFFTKL+E EGD Q  DPVAYD+GVTY
Sbjct  1    MAGAASALFLLDIKGRVLVWRDYRGDVTAAQAERFFTKLIETEGDSQSNDPVAYDNGVTY  60

Query  406  MFIQHNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEI  585
            MF+QH+N+YLMIASRQNCNAASLL FLHRVVDVFKHYFEELEEESLRDNFVVVYELLDE+
Sbjct  61   MFVQHSNIYLMIASRQNCNAASLLFFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEM  120

Query  586  MDFGYPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVES  765
            MDFGYPQFTEA+ILSEFIKTDAYRMEVTQRPPMAVTN+VSWRSEG+ +KKNEVFLDV+ES
Sbjct  121  MDFGYPQFTEARILSEFIKTDAYRMEVTQRPPMAVTNSVSWRSEGLKFKKNEVFLDVIES  180

Query  766  VNILVNSNGQIVRS  807
            VNILVNSNGQIVRS
Sbjct  181  VNILVNSNGQIVRS  194



>ref|XP_003517576.1| PREDICTED: AP-1 complex subunit mu-2-like [Glycine max]
Length=428

 Score =   368 bits (945),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 174/194 (90%), Positives = 186/194 (96%), Gaps = 2/194 (1%)
 Frame = +1

Query  232  MAGAASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGDPQ--DPVAYDSGVTY  405
            MAGAASALFLLD+KGRVL+WRDYRGDVSA  AERFFTKL+E + DPQ  DPV +D+GVTY
Sbjct  1    MAGAASALFLLDIKGRVLIWRDYRGDVSALDAERFFTKLIEKQADPQAQDPVVHDNGVTY  60

Query  406  MFIQHNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEI  585
            MFIQH+NVYLMIA+RQNCNAASLL FLHR+VDVFKHYFEELEEESLRDNFVVVYELLDEI
Sbjct  61   MFIQHSNVYLMIATRQNCNAASLLFFLHRIVDVFKHYFEELEEESLRDNFVVVYELLDEI  120

Query  586  MDFGYPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVES  765
            MDFGYPQ+TEA+ILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVES
Sbjct  121  MDFGYPQYTEAQILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVES  180

Query  766  VNILVNSNGQIVRS  807
            VNILVNSNGQI+RS
Sbjct  181  VNILVNSNGQIIRS  194



>gb|KCW86678.1| hypothetical protein EUGRSUZ_B03301 [Eucalyptus grandis]
Length=628

 Score =   375 bits (962),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 180/217 (83%), Positives = 192/217 (88%), Gaps = 15/217 (7%)
 Frame = +1

Query  202  PADFQIQPPI-------------MAGAASALFLLDVKGRVLVWRDYRGDVSATQAERFFT  342
            P   + +PPI             MAGA SALFLLD+KGRVLVWRDYRGDVSA QAERFFT
Sbjct  178  PIPIRSRPPIRSRTERASERGRGMAGAVSALFLLDIKGRVLVWRDYRGDVSAVQAERFFT  237

Query  343  KLLENEGDPQ--DPVAYDSGVTYMFIQHNNVYLMIASRQNCNAASLLLFLHRVVDVFKHY  516
            KL+E EGDPQ  DPV YD+GVTYMFIQH+NVYLM+A+RQNCNAASLL FLHRVVDVFKHY
Sbjct  238  KLIEKEGDPQSQDPVVYDNGVTYMFIQHSNVYLMVAARQNCNAASLLFFLHRVVDVFKHY  297

Query  517  FEELEEESLRDNFVVVYELLDEIMDFGYPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTN  696
            FEELEEESLRDNFVVVYELLDE+MDFGYPQ+TEAKILSEFIKTDAYRMEV+QRPPMAVTN
Sbjct  298  FEELEEESLRDNFVVVYELLDEMMDFGYPQYTEAKILSEFIKTDAYRMEVSQRPPMAVTN  357

Query  697  AVSWRSEGINYKKNEVFLDVVESVNILVNSNGQIVRS  807
            AVSWRSEGI YKKNEVFLDVVESVNILVNSNGQI+RS
Sbjct  358  AVSWRSEGIRYKKNEVFLDVVESVNILVNSNGQIIRS  394



>emb|CDY54239.1| BnaC08g49960D [Brassica napus]
Length=428

 Score =   368 bits (944),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 174/194 (90%), Positives = 187/194 (96%), Gaps = 2/194 (1%)
 Frame = +1

Query  232  MAGAASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGDPQ--DPVAYDSGVTY  405
            MAGAASALFLLD+KGRVLVWRDYRGDV+A QAERFFTKL+E EGD Q  DPVAYD+GVTY
Sbjct  1    MAGAASALFLLDIKGRVLVWRDYRGDVTAAQAERFFTKLIEKEGDSQSNDPVAYDNGVTY  60

Query  406  MFIQHNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEI  585
            MF+QH+NVYLMIASRQNCNAASL+ FLHRVVDVFKHYFEELEEESLRDNFVVVYELLDE+
Sbjct  61   MFVQHSNVYLMIASRQNCNAASLISFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEM  120

Query  586  MDFGYPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVES  765
            MDFGYPQ+TEA+ILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEG+ +KKNEVFLDV+ES
Sbjct  121  MDFGYPQYTEARILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGLQFKKNEVFLDVIES  180

Query  766  VNILVNSNGQIVRS  807
            VNILVNSNGQIVRS
Sbjct  181  VNILVNSNGQIVRS  194



>ref|XP_011034097.1| PREDICTED: AP-1 complex subunit mu-2-like [Populus euphratica]
Length=428

 Score =   368 bits (944),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 173/194 (89%), Positives = 185/194 (95%), Gaps = 2/194 (1%)
 Frame = +1

Query  232  MAGAASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGDPQ--DPVAYDSGVTY  405
            MAGAASALFLLD+KGRVLVWRDYRGDVSA QAERFFTK +E EGDPQ  DPV YD+GV+Y
Sbjct  1    MAGAASALFLLDIKGRVLVWRDYRGDVSAVQAERFFTKFIEKEGDPQSQDPVVYDNGVSY  60

Query  406  MFIQHNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEI  585
            MFIQH+NVYLM ASRQNCNAASL+ FLHRVVDVFKHYFEELEEESLRDNFVVVYELLDE+
Sbjct  61   MFIQHSNVYLMAASRQNCNAASLISFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEM  120

Query  586  MDFGYPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVES  765
            MDFGYPQ+TEAKILSEFIKTDAYRME +QRPPMAVTNAVSWRSEGINYKKNEVFLDVVES
Sbjct  121  MDFGYPQYTEAKILSEFIKTDAYRMETSQRPPMAVTNAVSWRSEGINYKKNEVFLDVVES  180

Query  766  VNILVNSNGQIVRS  807
            VNILVN+NGQ++RS
Sbjct  181  VNILVNTNGQVIRS  194



>ref|XP_011045271.1| PREDICTED: AP-1 complex subunit mu-2 [Populus euphratica]
 ref|XP_011045272.1| PREDICTED: AP-1 complex subunit mu-2 [Populus euphratica]
Length=428

 Score =   368 bits (944),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 174/194 (90%), Positives = 186/194 (96%), Gaps = 2/194 (1%)
 Frame = +1

Query  232  MAGAASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGDPQ--DPVAYDSGVTY  405
            MAGAASALFLLD+KGRVLVWRDYRGDVSA QAERFFTKL+E EGDPQ  DPV YD+GV+Y
Sbjct  1    MAGAASALFLLDIKGRVLVWRDYRGDVSAVQAERFFTKLIEKEGDPQSQDPVVYDNGVSY  60

Query  406  MFIQHNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEI  585
            M+IQH+NVYLM ASRQNCNAASLL FLHRVVDVFKHYFEELEEESLRDNFVVVYELLDE+
Sbjct  61   MYIQHSNVYLMTASRQNCNAASLLSFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEM  120

Query  586  MDFGYPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVES  765
            MDFGYPQ+TEAKILSEFIKT+AYRME +QRPPMAVTNAVSWRSEGINYKKNEVFLDVVES
Sbjct  121  MDFGYPQYTEAKILSEFIKTNAYRMETSQRPPMAVTNAVSWRSEGINYKKNEVFLDVVES  180

Query  766  VNILVNSNGQIVRS  807
            VNILVNSNGQ++RS
Sbjct  181  VNILVNSNGQVIRS  194



>ref|XP_002314604.1| clathrin adaptor complexes medium subunit family protein [Populus 
trichocarpa]
 gb|EEF00775.1| clathrin adaptor complexes medium subunit family protein [Populus 
trichocarpa]
Length=428

 Score =   368 bits (944),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 174/194 (90%), Positives = 186/194 (96%), Gaps = 2/194 (1%)
 Frame = +1

Query  232  MAGAASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGDPQ--DPVAYDSGVTY  405
            MAGAASALFLLD+KGRVLVWRDYRGDVSA QAERFFTKL+E EGDPQ  DPV YD+GV+Y
Sbjct  1    MAGAASALFLLDIKGRVLVWRDYRGDVSAVQAERFFTKLIEKEGDPQSQDPVVYDNGVSY  60

Query  406  MFIQHNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEI  585
            M+IQH+NVYLM ASRQNCNAASLL FLHRVVDVFKHYFEELEEESLRDNFVVVYELLDE+
Sbjct  61   MYIQHSNVYLMTASRQNCNAASLLSFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEM  120

Query  586  MDFGYPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVES  765
            MDFGYPQ+TEAKILSEFIKT+AYRME +QRPPMAVTNAVSWRSEGINYKKNEVFLDVVES
Sbjct  121  MDFGYPQYTEAKILSEFIKTNAYRMETSQRPPMAVTNAVSWRSEGINYKKNEVFLDVVES  180

Query  766  VNILVNSNGQIVRS  807
            VNILVNSNGQ++RS
Sbjct  181  VNILVNSNGQVIRS  194



>emb|CDY61312.1| BnaAnng17500D [Brassica napus]
Length=428

 Score =   367 bits (943),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 173/194 (89%), Positives = 187/194 (96%), Gaps = 2/194 (1%)
 Frame = +1

Query  232  MAGAASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGDPQ--DPVAYDSGVTY  405
            MAGAASALFLLD+KGRVLVWRDYRGDV+A QAERFFTKL+E EGD Q  DPVAYD+GVTY
Sbjct  1    MAGAASALFLLDIKGRVLVWRDYRGDVTAAQAERFFTKLIEKEGDSQSNDPVAYDNGVTY  60

Query  406  MFIQHNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEI  585
            MF+QH+N+YLMIASRQNCNAASL+ FLHRVVDVFKHYFEELEEESLRDNFVVVYELLDE+
Sbjct  61   MFVQHSNIYLMIASRQNCNAASLISFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEM  120

Query  586  MDFGYPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVES  765
            MDFGYPQ+TEA+ILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEG+ +KKNEVFLDV+ES
Sbjct  121  MDFGYPQYTEARILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGLQFKKNEVFLDVIES  180

Query  766  VNILVNSNGQIVRS  807
            VNILVNSNGQIVRS
Sbjct  181  VNILVNSNGQIVRS  194



>ref|XP_009103973.1| PREDICTED: AP-1 complex subunit mu-2 [Brassica rapa]
Length=428

 Score =   367 bits (943),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 173/194 (89%), Positives = 187/194 (96%), Gaps = 2/194 (1%)
 Frame = +1

Query  232  MAGAASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGDPQ--DPVAYDSGVTY  405
            MAGAASALFLLD+KGRVLVWRDYRGDVSA QAERFF+KL+E EGD Q  DPVAYD+GVTY
Sbjct  1    MAGAASALFLLDIKGRVLVWRDYRGDVSAAQAERFFSKLIEKEGDSQSNDPVAYDNGVTY  60

Query  406  MFIQHNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEI  585
            MF+QH+NVYLMIASRQNCNAASLL FLHRV+DVFKHYFEELEEESLRDNFVVVYELLDE+
Sbjct  61   MFVQHSNVYLMIASRQNCNAASLLSFLHRVIDVFKHYFEELEEESLRDNFVVVYELLDEM  120

Query  586  MDFGYPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVES  765
            MDFGYPQ+TEA+ILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEG+ YKKNEVFLDV+E+
Sbjct  121  MDFGYPQYTEARILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGLQYKKNEVFLDVIEN  180

Query  766  VNILVNSNGQIVRS  807
            VNILVNSNGQI+RS
Sbjct  181  VNILVNSNGQIIRS  194



>emb|CDY63680.1| BnaA01g35650D [Brassica napus]
Length=433

 Score =   367 bits (943),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 173/194 (89%), Positives = 187/194 (96%), Gaps = 2/194 (1%)
 Frame = +1

Query  232  MAGAASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGDPQ--DPVAYDSGVTY  405
            MAGAASALFLLD+KGRVLVWRDYRGDVSA QAERFF+KL+E EGD Q  DPVAYD+GVTY
Sbjct  1    MAGAASALFLLDIKGRVLVWRDYRGDVSAAQAERFFSKLIEKEGDSQSNDPVAYDNGVTY  60

Query  406  MFIQHNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEI  585
            MF+QH+NVYLMIASRQNCNAASLL FLHRV+DVFKHYFEELEEESLRDNFVVVYELLDE+
Sbjct  61   MFVQHSNVYLMIASRQNCNAASLLSFLHRVIDVFKHYFEELEEESLRDNFVVVYELLDEM  120

Query  586  MDFGYPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVES  765
            MDFGYPQ+TEA+ILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEG+ YKKNEVFLDV+E+
Sbjct  121  MDFGYPQYTEARILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGLQYKKNEVFLDVIEN  180

Query  766  VNILVNSNGQIVRS  807
            VNILVNSNGQI+RS
Sbjct  181  VNILVNSNGQIIRS  194



>gb|KEH20175.1| clathrin assembly protein AP47, putative [Medicago truncatula]
Length=428

 Score =   366 bits (940),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 172/194 (89%), Positives = 186/194 (96%), Gaps = 2/194 (1%)
 Frame = +1

Query  232  MAGAASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGD--PQDPVAYDSGVTY  405
            M+GAASALFLLD+KGRVL+WRDYRGDVSA +AERFFTKL+E EGD   QDPV YD+GV+Y
Sbjct  1    MSGAASALFLLDIKGRVLIWRDYRGDVSAVEAERFFTKLIEKEGDQQSQDPVVYDNGVSY  60

Query  406  MFIQHNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEI  585
            MF+QH+NVYLM A+RQNCNAASLL FLHR+VDVFKHYFEELEEESLRDNFVVVYELLDEI
Sbjct  61   MFVQHSNVYLMTATRQNCNAASLLFFLHRIVDVFKHYFEELEEESLRDNFVVVYELLDEI  120

Query  586  MDFGYPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVES  765
            MDFGYPQ+TEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEG+NYKKNEVFLDVVES
Sbjct  121  MDFGYPQYTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGLNYKKNEVFLDVVES  180

Query  766  VNILVNSNGQIVRS  807
            VNILVNSNGQI+RS
Sbjct  181  VNILVNSNGQIIRS  194



>emb|CDY63681.1| BnaA01g35660D [Brassica napus]
Length=428

 Score =   366 bits (939),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 172/194 (89%), Positives = 187/194 (96%), Gaps = 2/194 (1%)
 Frame = +1

Query  232  MAGAASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGDPQ--DPVAYDSGVTY  405
            MAGAASALFLLD+KGRVLVWRDYRGDVSA QAERFF+KL+E EGD Q  DPVAYD+GVTY
Sbjct  1    MAGAASALFLLDIKGRVLVWRDYRGDVSAAQAERFFSKLIEKEGDSQSNDPVAYDNGVTY  60

Query  406  MFIQHNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEI  585
            MF+QH+NVYLMIASRQNCNAASLL FLHRV+DVFKHYFEELEEESLRDNFVVVYELLDE+
Sbjct  61   MFVQHSNVYLMIASRQNCNAASLLSFLHRVIDVFKHYFEELEEESLRDNFVVVYELLDEM  120

Query  586  MDFGYPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVES  765
            MDFGYPQ+TEA+ILSEFIKTDAYR+EVTQRPPMAVTNAVSWRSEG+ YKKNEVFLDV+E+
Sbjct  121  MDFGYPQYTEARILSEFIKTDAYRLEVTQRPPMAVTNAVSWRSEGLQYKKNEVFLDVIEN  180

Query  766  VNILVNSNGQIVRS  807
            VNILVNSNGQI+RS
Sbjct  181  VNILVNSNGQIIRS  194



>emb|CDY46183.1| BnaA01g23050D [Brassica napus]
Length=428

 Score =   366 bits (939),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 172/194 (89%), Positives = 187/194 (96%), Gaps = 2/194 (1%)
 Frame = +1

Query  232  MAGAASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGDPQ--DPVAYDSGVTY  405
            MAGAASALFLLD+KGRVLVWRDYRGDVSA QAERFF+KL+E EGD Q  DPVAYD+GVTY
Sbjct  1    MAGAASALFLLDIKGRVLVWRDYRGDVSAAQAERFFSKLIEKEGDSQSNDPVAYDNGVTY  60

Query  406  MFIQHNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEI  585
            MF+QH+NVYLMIASRQNCNAASLL FLHRV+DVFKHYFEELEEESLRDNFVVVYELLDE+
Sbjct  61   MFVQHSNVYLMIASRQNCNAASLLSFLHRVIDVFKHYFEELEEESLRDNFVVVYELLDEM  120

Query  586  MDFGYPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVES  765
            MDFGYPQ+TEA+ILSEFIKTDAYR+EVTQRPPMAVTNAVSWRSEG+ YKKNEVFLDV+E+
Sbjct  121  MDFGYPQYTEARILSEFIKTDAYRLEVTQRPPMAVTNAVSWRSEGLQYKKNEVFLDVIEN  180

Query  766  VNILVNSNGQIVRS  807
            VNILVNSNGQI+RS
Sbjct  181  VNILVNSNGQIIRS  194



>ref|XP_010491832.1| PREDICTED: AP-1 complex subunit mu-2-like [Camelina sativa]
Length=428

 Score =   366 bits (939),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 173/194 (89%), Positives = 186/194 (96%), Gaps = 2/194 (1%)
 Frame = +1

Query  232  MAGAASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGDPQ--DPVAYDSGVTY  405
            MAGAASALFLLD+KGRVLVWRDYRGDV+A QAERFFTKL+E EGD Q  DPVAYD+GVTY
Sbjct  1    MAGAASALFLLDIKGRVLVWRDYRGDVTAAQAERFFTKLIEKEGDSQSNDPVAYDNGVTY  60

Query  406  MFIQHNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEI  585
            MF+QH+N+YLMIASRQNCNAASLL FLHRVVDVFKHYFEELEEESLRDNFVVVYELLDE+
Sbjct  61   MFVQHSNIYLMIASRQNCNAASLLFFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEM  120

Query  586  MDFGYPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVES  765
            MDFGYPQ+TEA+ILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEG+ +KKNEVFLD +ES
Sbjct  121  MDFGYPQYTEARILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGLQFKKNEVFLDGIES  180

Query  766  VNILVNSNGQIVRS  807
            VNILVNSNGQIVRS
Sbjct  181  VNILVNSNGQIVRS  194



>emb|CDY19316.1| BnaC05g08250D [Brassica napus]
Length=428

 Score =   366 bits (939),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 173/194 (89%), Positives = 186/194 (96%), Gaps = 2/194 (1%)
 Frame = +1

Query  232  MAGAASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGDPQ--DPVAYDSGVTY  405
            MAGAASALFLLD+KGRVLVWRDYRGDV+A QAERFFTKL+E EGD +  DPV YD+GVTY
Sbjct  1    MAGAASALFLLDIKGRVLVWRDYRGDVTAAQAERFFTKLIEKEGDSESNDPVVYDNGVTY  60

Query  406  MFIQHNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEI  585
            MF+QH+NVYLMIASRQNCNAASLL FLHRV+DVFKHYFEELEEESLRDNFVVVYELLDE+
Sbjct  61   MFVQHSNVYLMIASRQNCNAASLLFFLHRVIDVFKHYFEELEEESLRDNFVVVYELLDEM  120

Query  586  MDFGYPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVES  765
            MDFGYPQ+TEA+ILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEG+ +KKNEVFLDVVES
Sbjct  121  MDFGYPQYTEARILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGLQFKKNEVFLDVVES  180

Query  766  VNILVNSNGQIVRS  807
            VNILVNSNGQIVRS
Sbjct  181  VNILVNSNGQIVRS  194



>ref|XP_003519692.1| PREDICTED: AP-1 complex subunit mu-2-like [Glycine max]
 gb|KHN00382.1| AP-1 complex subunit mu-1-I [Glycine soja]
Length=428

 Score =   366 bits (939),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 173/194 (89%), Positives = 185/194 (95%), Gaps = 2/194 (1%)
 Frame = +1

Query  232  MAGAASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGDPQ--DPVAYDSGVTY  405
            MAGAASALFLLD+KGRVL+WRDYRGDVSA  AERFFTKL+E + DPQ  DPV +D+GVTY
Sbjct  1    MAGAASALFLLDIKGRVLIWRDYRGDVSALDAERFFTKLIEKQADPQAQDPVVHDNGVTY  60

Query  406  MFIQHNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEI  585
            MFIQH+NVYLMIA+R NCNAASLL FLHR+VDVFKHYFEELEEESLRDNFVVVYELLDEI
Sbjct  61   MFIQHSNVYLMIATRHNCNAASLLFFLHRIVDVFKHYFEELEEESLRDNFVVVYELLDEI  120

Query  586  MDFGYPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVES  765
            MDFGYPQ+TEA+ILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVES
Sbjct  121  MDFGYPQYTEAQILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVES  180

Query  766  VNILVNSNGQIVRS  807
            VNILVNSNGQI+RS
Sbjct  181  VNILVNSNGQIIRS  194



>gb|EPS71689.1| hypothetical protein M569_03066, partial [Genlisea aurea]
Length=430

 Score =   366 bits (939),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 175/194 (90%), Positives = 182/194 (94%), Gaps = 2/194 (1%)
 Frame = +1

Query  232  MAGAASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGD--PQDPVAYDSGVTY  405
            MAGAASALFLLD+KGRVLVWRDYRGDVSATQAERFFTKLLE EGD    DPV YD G+TY
Sbjct  3    MAGAASALFLLDIKGRVLVWRDYRGDVSATQAERFFTKLLEKEGDLESHDPVEYDDGITY  62

Query  406  MFIQHNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEI  585
            +FIQHNNVYLM ASRQNCNAASLL FLHR VDVFK+YFEELEEESLRDNFV+VYELLDEI
Sbjct  63   LFIQHNNVYLMTASRQNCNAASLLFFLHRAVDVFKYYFEELEEESLRDNFVIVYELLDEI  122

Query  586  MDFGYPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVES  765
            MDFGYPQ+TEAKILSEFIKTDAYRME TQRPPMAVTNAVSWRSEGI YKKNEVFLDVVES
Sbjct  123  MDFGYPQYTEAKILSEFIKTDAYRMESTQRPPMAVTNAVSWRSEGIQYKKNEVFLDVVES  182

Query  766  VNILVNSNGQIVRS  807
            VNILVNSNGQI+RS
Sbjct  183  VNILVNSNGQIIRS  196



>ref|XP_007153766.1| hypothetical protein PHAVU_003G063300g [Phaseolus vulgaris]
 gb|ESW25760.1| hypothetical protein PHAVU_003G063300g [Phaseolus vulgaris]
Length=325

 Score =   361 bits (927),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 167/194 (86%), Positives = 186/194 (96%), Gaps = 2/194 (1%)
 Frame = +1

Query  232  MAGAASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGDPQ--DPVAYDSGVTY  405
            M+GA SALFLLD+KGRVL+WRDYRGDV+A +AERFFTKL+E EGDPQ  DPV YD+GVTY
Sbjct  1    MSGAVSALFLLDIKGRVLIWRDYRGDVTAVEAERFFTKLIEKEGDPQSQDPVVYDNGVTY  60

Query  406  MFIQHNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEI  585
            +FIQH+N++LM A+RQNCNAASLL FLHR+VDVFKHYFEELEEESLRDNFVVVYELLDEI
Sbjct  61   LFIQHSNIFLMTATRQNCNAASLLFFLHRIVDVFKHYFEELEEESLRDNFVVVYELLDEI  120

Query  586  MDFGYPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVES  765
            MDFGYPQ+TEAKILSEFIKTDAY+MEVTQRPPMAVTNAVSWRSEG++YKKNEVFLDVVES
Sbjct  121  MDFGYPQYTEAKILSEFIKTDAYKMEVTQRPPMAVTNAVSWRSEGVSYKKNEVFLDVVES  180

Query  766  VNILVNSNGQIVRS  807
            VN+LVNSNGQI+RS
Sbjct  181  VNMLVNSNGQIIRS  194



>gb|KDP31052.1| hypothetical protein JCGZ_11428 [Jatropha curcas]
Length=428

 Score =   365 bits (937),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 171/194 (88%), Positives = 185/194 (95%), Gaps = 2/194 (1%)
 Frame = +1

Query  232  MAGAASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGDPQ--DPVAYDSGVTY  405
            MAGAASALFLLD+KGR+L+WRDYRGDVS+ QAERFFTKL+E EGDPQ  +PV YD+GVTY
Sbjct  1    MAGAASALFLLDIKGRILIWRDYRGDVSSVQAERFFTKLIEKEGDPQSQNPVVYDNGVTY  60

Query  406  MFIQHNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEI  585
            +FIQHNN+YLM A+RQNCNAASLLLFLHRVVDVF+HYFEELEEESLRDNFVVVYELLDEI
Sbjct  61   LFIQHNNIYLMTATRQNCNAASLLLFLHRVVDVFRHYFEELEEESLRDNFVVVYELLDEI  120

Query  586  MDFGYPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVES  765
            MDFG+PQ+TEAKILSEFIKTDAYRMEV  RPPMAVTNAVSWRSEGI YKKNEVFLDVVES
Sbjct  121  MDFGFPQYTEAKILSEFIKTDAYRMEVAARPPMAVTNAVSWRSEGIRYKKNEVFLDVVES  180

Query  766  VNILVNSNGQIVRS  807
            VNILVNSNGQI+RS
Sbjct  181  VNILVNSNGQIIRS  194



>gb|KDP26640.1| hypothetical protein JCGZ_17798 [Jatropha curcas]
Length=428

 Score =   365 bits (937),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 174/194 (90%), Positives = 183/194 (94%), Gaps = 2/194 (1%)
 Frame = +1

Query  232  MAGAASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGDPQ--DPVAYDSGVTY  405
            MAGA SALFLLD+KGRVLVWRDYRGDVSA QAERFFTKL+E EGDPQ  DPV YD+GVTY
Sbjct  1    MAGAVSALFLLDIKGRVLVWRDYRGDVSAVQAERFFTKLIEKEGDPQSHDPVVYDNGVTY  60

Query  406  MFIQHNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEI  585
            MFIQH+NVYLM ASRQNCNAA L+ FLHRVVDVFKHYFEELEEESLRDNFVVVYELLDE+
Sbjct  61   MFIQHSNVYLMTASRQNCNAAGLISFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEM  120

Query  586  MDFGYPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVES  765
            MDFGYPQ+TEAKILSEFIKTDAYRME TQRPPMAVTNAVSWRSEGI YKKNEVFLDVVES
Sbjct  121  MDFGYPQYTEAKILSEFIKTDAYRMETTQRPPMAVTNAVSWRSEGIFYKKNEVFLDVVES  180

Query  766  VNILVNSNGQIVRS  807
            VNILVNSNGQ++RS
Sbjct  181  VNILVNSNGQVIRS  194



>ref|XP_007157311.1| hypothetical protein PHAVU_002G059300g [Phaseolus vulgaris]
 gb|ESW29305.1| hypothetical protein PHAVU_002G059300g [Phaseolus vulgaris]
Length=428

 Score =   365 bits (936),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 173/194 (89%), Positives = 185/194 (95%), Gaps = 2/194 (1%)
 Frame = +1

Query  232  MAGAASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGDPQ--DPVAYDSGVTY  405
            MAGAASALFLLD+KGRVL+WRDYRGDVSA  AERFFTKL+E + DPQ  DPV  D+GVTY
Sbjct  1    MAGAASALFLLDIKGRVLIWRDYRGDVSALDAERFFTKLIEKQADPQSQDPVVLDNGVTY  60

Query  406  MFIQHNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEI  585
            MFIQH+NVY+MIA+RQNCNAASLL FLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEI
Sbjct  61   MFIQHSNVYIMIATRQNCNAASLLFFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEI  120

Query  586  MDFGYPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVES  765
            MDFGYPQ+TEA+ILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVE+
Sbjct  121  MDFGYPQYTEAQILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVEN  180

Query  766  VNILVNSNGQIVRS  807
            VNILVNSNGQI+RS
Sbjct  181  VNILVNSNGQIIRS  194



>ref|XP_010100380.1| AP-1 complex subunit mu-1-I [Morus notabilis]
 gb|EXB82514.1| AP-1 complex subunit mu-1-I [Morus notabilis]
Length=428

 Score =   364 bits (935),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 173/194 (89%), Positives = 184/194 (95%), Gaps = 2/194 (1%)
 Frame = +1

Query  232  MAGAASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGDPQ--DPVAYDSGVTY  405
            MAGA SALFLLD+KGRVL+WRDYRGDVSA QAE+FFTKL+E EGDP+  DPV YD+GV+Y
Sbjct  1    MAGAVSALFLLDIKGRVLIWRDYRGDVSAVQAEKFFTKLIEKEGDPESHDPVLYDNGVSY  60

Query  406  MFIQHNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEI  585
            +FIQHNNV+ M A+RQNCNAAS+L FLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEI
Sbjct  61   LFIQHNNVFFMAAARQNCNAASILFFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEI  120

Query  586  MDFGYPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVES  765
            MDFGYPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGI YKKNEVFLDVVES
Sbjct  121  MDFGYPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGIRYKKNEVFLDVVES  180

Query  766  VNILVNSNGQIVRS  807
            VNILVNSNGQIVRS
Sbjct  181  VNILVNSNGQIVRS  194



>gb|KDO82238.1| hypothetical protein CISIN_1g014235mg [Citrus sinensis]
Length=320

 Score =   360 bits (924),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 172/194 (89%), Positives = 182/194 (94%), Gaps = 2/194 (1%)
 Frame = +1

Query  232  MAGAASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGDPQ--DPVAYDSGVTY  405
            MAGA SALFLLD+KGRVLVWRDYRGDVSA QAERFFTKL+E +GD Q  DPV YD+GV+Y
Sbjct  1    MAGAVSALFLLDIKGRVLVWRDYRGDVSAKQAERFFTKLIEKDGDAQSQDPVVYDNGVSY  60

Query  406  MFIQHNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEI  585
            +FIQH+NVYLM ASRQNCNAASLL FLHRVVDVFKHYFEELEEESLRDNFVVVYELLDE+
Sbjct  61   LFIQHSNVYLMTASRQNCNAASLLFFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEM  120

Query  586  MDFGYPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVES  765
            MDFGYPQ+TEA ILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGI YKKNEVFLDVVE 
Sbjct  121  MDFGYPQYTEANILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGIQYKKNEVFLDVVEH  180

Query  766  VNILVNSNGQIVRS  807
            VNILVNSNGQI+RS
Sbjct  181  VNILVNSNGQIIRS  194



>ref|XP_004298980.1| PREDICTED: AP-1 complex subunit mu-2-like [Fragaria vesca subsp. 
vesca]
Length=428

 Score =   363 bits (933),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 173/194 (89%), Positives = 183/194 (94%), Gaps = 2/194 (1%)
 Frame = +1

Query  232  MAGAASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGD--PQDPVAYDSGVTY  405
            MAGAASALFLLD+KGRVL+WRDYRGDVSA QAERFFTK +E E D   QDPV YD+GV+Y
Sbjct  1    MAGAASALFLLDIKGRVLIWRDYRGDVSAAQAERFFTKFIEKESDQQSQDPVVYDNGVSY  60

Query  406  MFIQHNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEI  585
            MFIQHNN+YLMIASRQNCNAASL+LFLHR+VDVFKHYFE LEEESLRDNFVVVYELLDEI
Sbjct  61   MFIQHNNIYLMIASRQNCNAASLVLFLHRLVDVFKHYFEVLEEESLRDNFVVVYELLDEI  120

Query  586  MDFGYPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVES  765
            MDFG+PQFTEAKILSEFIKTDAYRME TQRPPMAVTNAVSWRSEGI YKKNEVFLDVVES
Sbjct  121  MDFGFPQFTEAKILSEFIKTDAYRMETTQRPPMAVTNAVSWRSEGIRYKKNEVFLDVVES  180

Query  766  VNILVNSNGQIVRS  807
            VNILVNSNGQI+RS
Sbjct  181  VNILVNSNGQIIRS  194



>ref|XP_007036353.1| Clathrin adaptor complexes medium subunit family protein [Theobroma 
cacao]
 gb|EOY20854.1| Clathrin adaptor complexes medium subunit family protein [Theobroma 
cacao]
Length=429

 Score =   363 bits (933),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 173/195 (89%), Positives = 186/195 (95%), Gaps = 3/195 (2%)
 Frame = +1

Query  232  MAGAASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEG-DPQ--DPVAYDSGVT  402
            MAGAASALFLLD+KGRVL+WRDYRGDV A +AERFFTKL+E +G DPQ  DPV YD+GVT
Sbjct  1    MAGAASALFLLDIKGRVLIWRDYRGDVPAAEAERFFTKLIEKQGGDPQSQDPVVYDNGVT  60

Query  403  YMFIQHNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDE  582
            Y+FIQHNNVYL+ ASRQNCNAASLLLFLHR+VDVFKHYFEELEEESLRDNFVVVYELLDE
Sbjct  61   YLFIQHNNVYLLTASRQNCNAASLLLFLHRIVDVFKHYFEELEEESLRDNFVVVYELLDE  120

Query  583  IMDFGYPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVE  762
            +MDFG+PQ+TEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGI YKKNEVFLDVVE
Sbjct  121  MMDFGFPQYTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGIRYKKNEVFLDVVE  180

Query  763  SVNILVNSNGQIVRS  807
            SVNILVNSNGQI+RS
Sbjct  181  SVNILVNSNGQIIRS  195



>ref|XP_008389705.1| PREDICTED: AP-1 complex subunit mu-2 [Malus domestica]
Length=428

 Score =   363 bits (933),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 172/194 (89%), Positives = 184/194 (95%), Gaps = 2/194 (1%)
 Frame = +1

Query  232  MAGAASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGDPQ--DPVAYDSGVTY  405
            MAGA SALFLLD+KGRVL+WRDYRGDVSA QAERFFTKL+E E DP+  DPV +D+GV+Y
Sbjct  1    MAGAVSALFLLDIKGRVLIWRDYRGDVSAAQAERFFTKLIEKEVDPESHDPVVHDNGVSY  60

Query  406  MFIQHNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEI  585
            +FIQHNNVYLM ASRQNCNAASLL FLHR+VDVFKHYFEELEEESLRDNFVVVYELLDE+
Sbjct  61   LFIQHNNVYLMTASRQNCNAASLLFFLHRIVDVFKHYFEELEEESLRDNFVVVYELLDEM  120

Query  586  MDFGYPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVES  765
            MDFGYPQ+TEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGI YKKNEVFLDVVES
Sbjct  121  MDFGYPQYTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGIRYKKNEVFLDVVES  180

Query  766  VNILVNSNGQIVRS  807
            VNILVNSNGQI+RS
Sbjct  181  VNILVNSNGQIIRS  194



>ref|XP_009359189.1| PREDICTED: AP-1 complex subunit mu-2 [Pyrus x bretschneideri]
Length=428

 Score =   363 bits (932),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 172/194 (89%), Positives = 184/194 (95%), Gaps = 2/194 (1%)
 Frame = +1

Query  232  MAGAASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGDPQ--DPVAYDSGVTY  405
            MAGA SALFLLD+KGRVL+WRDYRGDVSA QAERFFTKL+E E DP+  DPV +D+GV+Y
Sbjct  1    MAGAVSALFLLDIKGRVLIWRDYRGDVSAAQAERFFTKLIEKEVDPESHDPVVHDNGVSY  60

Query  406  MFIQHNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEI  585
            +FIQHNNVYLM ASRQNCNAASLL FLHR+VDVFKHYFEELEEESLRDNFVVVYELLDE+
Sbjct  61   LFIQHNNVYLMTASRQNCNAASLLFFLHRIVDVFKHYFEELEEESLRDNFVVVYELLDEM  120

Query  586  MDFGYPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVES  765
            MDFGYPQ+TEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGI YKKNEVFLDVVES
Sbjct  121  MDFGYPQYTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGIRYKKNEVFLDVVES  180

Query  766  VNILVNSNGQIVRS  807
            VNILVNSNGQI+RS
Sbjct  181  VNILVNSNGQIIRS  194



>ref|XP_007225645.1| hypothetical protein PRUPE_ppa006083mg [Prunus persica]
 gb|EMJ26844.1| hypothetical protein PRUPE_ppa006083mg [Prunus persica]
Length=428

 Score =   363 bits (932),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 172/194 (89%), Positives = 184/194 (95%), Gaps = 2/194 (1%)
 Frame = +1

Query  232  MAGAASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGDPQ--DPVAYDSGVTY  405
            MAGA SALFLLD+KGRVL+WRDYRGDVSA QAERFFTKL+E E DP+  DPV +D+GV+Y
Sbjct  1    MAGAVSALFLLDIKGRVLIWRDYRGDVSAVQAERFFTKLIEKEVDPESHDPVVHDNGVSY  60

Query  406  MFIQHNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEI  585
            +FIQHNNVYLM ASRQNCNAASLL FLHR+VDVFKHYFEELEEESLRDNFVVVYELLDE+
Sbjct  61   LFIQHNNVYLMTASRQNCNAASLLFFLHRIVDVFKHYFEELEEESLRDNFVVVYELLDEM  120

Query  586  MDFGYPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVES  765
            MDFGYPQ+TEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGI YKKNEVFLDVVES
Sbjct  121  MDFGYPQYTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGIRYKKNEVFLDVVES  180

Query  766  VNILVNSNGQIVRS  807
            VNILVNSNGQI+RS
Sbjct  181  VNILVNSNGQIIRS  194



>ref|XP_008221881.1| PREDICTED: AP-1 complex subunit mu-2 [Prunus mume]
Length=428

 Score =   363 bits (932),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 172/194 (89%), Positives = 184/194 (95%), Gaps = 2/194 (1%)
 Frame = +1

Query  232  MAGAASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGDPQ--DPVAYDSGVTY  405
            MAGA SALFLLD+KGRVL+WRDYRGDVSA QAERFFTKL+E E DP+  DPV +D+GV+Y
Sbjct  1    MAGAVSALFLLDIKGRVLIWRDYRGDVSAVQAERFFTKLIEKEVDPESHDPVVHDNGVSY  60

Query  406  MFIQHNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEI  585
            +FIQHNNVYLM ASRQNCNAASLL FLHR+VDVFKHYFEELEEESLRDNFVVVYELLDE+
Sbjct  61   LFIQHNNVYLMTASRQNCNAASLLFFLHRIVDVFKHYFEELEEESLRDNFVVVYELLDEM  120

Query  586  MDFGYPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVES  765
            MDFGYPQ+TEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGI YKKNEVFLDVVES
Sbjct  121  MDFGYPQYTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGIRYKKNEVFLDVVES  180

Query  766  VNILVNSNGQIVRS  807
            VNILVNSNGQI+RS
Sbjct  181  VNILVNSNGQIIRS  194



>ref|XP_009148415.1| PREDICTED: AP-1 complex subunit mu-2-like [Brassica rapa]
Length=428

 Score =   363 bits (932),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 171/194 (88%), Positives = 186/194 (96%), Gaps = 2/194 (1%)
 Frame = +1

Query  232  MAGAASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGDPQ--DPVAYDSGVTY  405
            MAGAASALFLLD+KGRVLVWRDYRGDV+A QAERFF+KL+E EGD +  +PV YD+GVTY
Sbjct  1    MAGAASALFLLDIKGRVLVWRDYRGDVTAAQAERFFSKLIEKEGDSESNEPVVYDNGVTY  60

Query  406  MFIQHNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEI  585
            MF+QH+NVYLMIASRQNCNAASLL FLHRV+DVFKHYFEELEEESLRDNFVVVYELLDE+
Sbjct  61   MFVQHSNVYLMIASRQNCNAASLLFFLHRVIDVFKHYFEELEEESLRDNFVVVYELLDEM  120

Query  586  MDFGYPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVES  765
            MDFGYPQ+TEA+ILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEG+ +KKNEVFLDVVES
Sbjct  121  MDFGYPQYTEARILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGLQFKKNEVFLDVVES  180

Query  766  VNILVNSNGQIVRS  807
            VNILVNSNGQIVRS
Sbjct  181  VNILVNSNGQIVRS  194



>ref|XP_008340089.1| PREDICTED: AP-1 complex subunit mu-2-like [Malus domestica]
Length=428

 Score =   363 bits (931),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 172/194 (89%), Positives = 184/194 (95%), Gaps = 2/194 (1%)
 Frame = +1

Query  232  MAGAASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGDPQ--DPVAYDSGVTY  405
            MAGA SALFLLD+KGRVL+WRDYRGDVSA QAERFFTKL+E E DP+  DPV +D+GV+Y
Sbjct  1    MAGAVSALFLLDIKGRVLIWRDYRGDVSAAQAERFFTKLIEKEVDPESHDPVVHDNGVSY  60

Query  406  MFIQHNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEI  585
            +FIQHNNVYLM ASRQNCNAASLL FLHR+VDVFKHYFEELEEESLRDNFVVVYELLDE+
Sbjct  61   LFIQHNNVYLMAASRQNCNAASLLFFLHRIVDVFKHYFEELEEESLRDNFVVVYELLDEM  120

Query  586  MDFGYPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVES  765
            MDFGYPQ+TEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGI YKKNEVFLDVVES
Sbjct  121  MDFGYPQYTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGIRYKKNEVFLDVVES  180

Query  766  VNILVNSNGQIVRS  807
            VNILVNSNGQI+RS
Sbjct  181  VNILVNSNGQIIRS  194



>emb|CDX97909.1| BnaA06g06600D [Brassica napus]
Length=428

 Score =   363 bits (931),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 171/194 (88%), Positives = 186/194 (96%), Gaps = 2/194 (1%)
 Frame = +1

Query  232  MAGAASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGDPQ--DPVAYDSGVTY  405
            MAGAASALFLLD+KGRVLVWRDYRGDV+A QAERFF+KL+E EGD +  +PV YD+GVTY
Sbjct  1    MAGAASALFLLDIKGRVLVWRDYRGDVTAAQAERFFSKLIEKEGDSESNEPVVYDNGVTY  60

Query  406  MFIQHNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEI  585
            MF+QH+NVYLMIASRQNCNAASLL FLHRV+DVFKHYFEELEEESLRDNFVVVYELLDE+
Sbjct  61   MFVQHSNVYLMIASRQNCNAASLLFFLHRVIDVFKHYFEELEEESLRDNFVVVYELLDEM  120

Query  586  MDFGYPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVES  765
            MDFGYPQ+TEA+ILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEG+ +KKNEVFLDVVES
Sbjct  121  MDFGYPQYTEARILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGLQFKKNEVFLDVVES  180

Query  766  VNILVNSNGQIVRS  807
            VNILVNSNGQIVRS
Sbjct  181  VNILVNSNGQIVRS  194



>gb|KEH27749.1| clathrin assembly protein AP47, putative [Medicago truncatula]
Length=362

 Score =   359 bits (922),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 170/194 (88%), Positives = 186/194 (96%), Gaps = 2/194 (1%)
 Frame = +1

Query  232  MAGAASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGD--PQDPVAYDSGVTY  405
            M+GAASALFLLD+KGR+LVWRDYRGDVSA +AERFFTKL++ + D   QDPV YD+GVTY
Sbjct  1    MSGAASALFLLDIKGRILVWRDYRGDVSAIEAERFFTKLIDKQADEQSQDPVVYDNGVTY  60

Query  406  MFIQHNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEI  585
            MFIQH+NVYL+IA+RQNCNAASLL FLHR+VDVFKHYFEELEEESLRDNFVVVYELLDEI
Sbjct  61   MFIQHSNVYLVIAARQNCNAASLLFFLHRLVDVFKHYFEELEEESLRDNFVVVYELLDEI  120

Query  586  MDFGYPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVES  765
            MDFGYPQ+TEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGI+YKKNEVFLDVVES
Sbjct  121  MDFGYPQYTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGISYKKNEVFLDVVES  180

Query  766  VNILVNSNGQIVRS  807
            VNILVNSNGQ++RS
Sbjct  181  VNILVNSNGQLIRS  194



>ref|XP_007153765.1| hypothetical protein PHAVU_003G063300g [Phaseolus vulgaris]
 gb|ESW25759.1| hypothetical protein PHAVU_003G063300g [Phaseolus vulgaris]
Length=428

 Score =   362 bits (928),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 167/194 (86%), Positives = 186/194 (96%), Gaps = 2/194 (1%)
 Frame = +1

Query  232  MAGAASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGDPQ--DPVAYDSGVTY  405
            M+GA SALFLLD+KGRVL+WRDYRGDV+A +AERFFTKL+E EGDPQ  DPV YD+GVTY
Sbjct  1    MSGAVSALFLLDIKGRVLIWRDYRGDVTAVEAERFFTKLIEKEGDPQSQDPVVYDNGVTY  60

Query  406  MFIQHNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEI  585
            +FIQH+N++LM A+RQNCNAASLL FLHR+VDVFKHYFEELEEESLRDNFVVVYELLDEI
Sbjct  61   LFIQHSNIFLMTATRQNCNAASLLFFLHRIVDVFKHYFEELEEESLRDNFVVVYELLDEI  120

Query  586  MDFGYPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVES  765
            MDFGYPQ+TEAKILSEFIKTDAY+MEVTQRPPMAVTNAVSWRSEG++YKKNEVFLDVVES
Sbjct  121  MDFGYPQYTEAKILSEFIKTDAYKMEVTQRPPMAVTNAVSWRSEGVSYKKNEVFLDVVES  180

Query  766  VNILVNSNGQIVRS  807
            VN+LVNSNGQI+RS
Sbjct  181  VNMLVNSNGQIIRS  194



>dbj|BAD81570.1| clathrin-associated protein unc-101-like [Oryza sativa Japonica 
Group]
 dbj|BAD81792.1| clathrin-associated protein unc-101-like [Oryza sativa Japonica 
Group]
Length=357

 Score =   358 bits (920),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 174/195 (89%), Positives = 184/195 (94%), Gaps = 3/195 (2%)
 Frame = +1

Query  232  MAGAASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGDPQ--DPVAYD-SGVT  402
            MAGA SALFLLD+KGRVLVWRDYRGDVSA QAERFFTKLL+ EGD +   PV YD +GVT
Sbjct  1    MAGAVSALFLLDIKGRVLVWRDYRGDVSALQAERFFTKLLDKEGDSEAHSPVVYDDAGVT  60

Query  403  YMFIQHNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDE  582
            YMFIQHNNV+L+ ASRQNCNAAS+LLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDE
Sbjct  61   YMFIQHNNVFLLTASRQNCNAASILLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDE  120

Query  583  IMDFGYPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVE  762
            +MDFGYPQ+TEAKILSEFIKTDAYRMEV+QRPPMAVTNAVSWRSEGI YKKNEVFLDVVE
Sbjct  121  MMDFGYPQYTEAKILSEFIKTDAYRMEVSQRPPMAVTNAVSWRSEGIRYKKNEVFLDVVE  180

Query  763  SVNILVNSNGQIVRS  807
            SVNILVNSNGQIVRS
Sbjct  181  SVNILVNSNGQIVRS  195



>ref|XP_009409953.1| PREDICTED: AP-1 complex subunit mu-2 [Musa acuminata subsp. malaccensis]
Length=428

 Score =   360 bits (925),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 169/194 (87%), Positives = 183/194 (94%), Gaps = 2/194 (1%)
 Frame = +1

Query  232  MAGAASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGDPQD--PVAYDSGVTY  405
            MAGA SALFLLD+KGRVL+WRDYRGDVSA QAERFFTKL+E E DP+   PV +D G++Y
Sbjct  1    MAGAVSALFLLDIKGRVLIWRDYRGDVSAVQAERFFTKLIEKEADPESHSPVVFDDGISY  60

Query  406  MFIQHNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEI  585
            MFIQHNNV+LM A+RQNCN+AS+LLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDE+
Sbjct  61   MFIQHNNVFLMTAARQNCNSASILLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEM  120

Query  586  MDFGYPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVES  765
            MDFGYPQ+TEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGI YKKNEVFLDVVES
Sbjct  121  MDFGYPQYTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGIRYKKNEVFLDVVES  180

Query  766  VNILVNSNGQIVRS  807
            VNILVNSNGQI+RS
Sbjct  181  VNILVNSNGQIIRS  194



>ref|XP_003613166.1| AP-1 complex subunit mu [Medicago truncatula]
 gb|AES96124.1| clathrin assembly protein AP47, putative [Medicago truncatula]
 gb|AFK41114.1| unknown [Medicago truncatula]
Length=428

 Score =   360 bits (925),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 170/194 (88%), Positives = 186/194 (96%), Gaps = 2/194 (1%)
 Frame = +1

Query  232  MAGAASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGD--PQDPVAYDSGVTY  405
            M+GAASALFLLD+KGR+LVWRDYRGDVSA +AERFFTKL++ + D   QDPV YD+GVTY
Sbjct  1    MSGAASALFLLDIKGRILVWRDYRGDVSAIEAERFFTKLIDKQADEQSQDPVVYDNGVTY  60

Query  406  MFIQHNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEI  585
            MFIQH+NVYL+IA+RQNCNAASLL FLHR+VDVFKHYFEELEEESLRDNFVVVYELLDEI
Sbjct  61   MFIQHSNVYLVIAARQNCNAASLLFFLHRLVDVFKHYFEELEEESLRDNFVVVYELLDEI  120

Query  586  MDFGYPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVES  765
            MDFGYPQ+TEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGI+YKKNEVFLDVVES
Sbjct  121  MDFGYPQYTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGISYKKNEVFLDVVES  180

Query  766  VNILVNSNGQIVRS  807
            VNILVNSNGQ++RS
Sbjct  181  VNILVNSNGQLIRS  194



>ref|XP_006438266.1| hypothetical protein CICLE_v10031619mg [Citrus clementina]
 ref|XP_006483945.1| PREDICTED: AP-1 complex subunit mu-2-like [Citrus sinensis]
 gb|ESR51506.1| hypothetical protein CICLE_v10031619mg [Citrus clementina]
 gb|KDO82234.1| hypothetical protein CISIN_1g014235mg [Citrus sinensis]
Length=428

 Score =   360 bits (924),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 172/194 (89%), Positives = 182/194 (94%), Gaps = 2/194 (1%)
 Frame = +1

Query  232  MAGAASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGDPQ--DPVAYDSGVTY  405
            MAGA SALFLLD+KGRVLVWRDYRGDVSA QAERFFTKL+E +GD Q  DPV YD+GV+Y
Sbjct  1    MAGAVSALFLLDIKGRVLVWRDYRGDVSAKQAERFFTKLIEKDGDAQSQDPVVYDNGVSY  60

Query  406  MFIQHNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEI  585
            +FIQH+NVYLM ASRQNCNAASLL FLHRVVDVFKHYFEELEEESLRDNFVVVYELLDE+
Sbjct  61   LFIQHSNVYLMTASRQNCNAASLLFFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEM  120

Query  586  MDFGYPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVES  765
            MDFGYPQ+TEA ILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGI YKKNEVFLDVVE 
Sbjct  121  MDFGYPQYTEANILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGIQYKKNEVFLDVVEH  180

Query  766  VNILVNSNGQIVRS  807
            VNILVNSNGQI+RS
Sbjct  181  VNILVNSNGQIIRS  194



>ref|XP_004489791.1| PREDICTED: AP-1 complex subunit mu-1-like [Cicer arietinum]
Length=428

 Score =   358 bits (920),  Expect = 9e-119, Method: Compositional matrix adjust.
 Identities = 169/194 (87%), Positives = 185/194 (95%), Gaps = 2/194 (1%)
 Frame = +1

Query  232  MAGAASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGD--PQDPVAYDSGVTY  405
            M+GAASALFLLD+KGR+LVWRDYRGDVSA  AERFFTK+++ + D   QDPV YD+GVTY
Sbjct  1    MSGAASALFLLDIKGRILVWRDYRGDVSAVDAERFFTKIIDKQADEQSQDPVVYDNGVTY  60

Query  406  MFIQHNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEI  585
            MFIQH+NVYL+IA+RQNCNAASLL FLHR+VDVFKHYFEELEEESLRDNFVVVYELLDEI
Sbjct  61   MFIQHSNVYLVIATRQNCNAASLLFFLHRLVDVFKHYFEELEEESLRDNFVVVYELLDEI  120

Query  586  MDFGYPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVES  765
            MDFGYPQ+TEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGI+YKKNEVFLDVVES
Sbjct  121  MDFGYPQYTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGISYKKNEVFLDVVES  180

Query  766  VNILVNSNGQIVRS  807
            VNILVNSNGQ++RS
Sbjct  181  VNILVNSNGQLIRS  194



>ref|NP_001044001.1| Os01g0703600 [Oryza sativa Japonica Group]
 dbj|BAF05915.1| Os01g0703600 [Oryza sativa Japonica Group]
 gb|EAZ13244.1| hypothetical protein OsJ_03168 [Oryza sativa Japonica Group]
Length=429

 Score =   358 bits (920),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 174/195 (89%), Positives = 184/195 (94%), Gaps = 3/195 (2%)
 Frame = +1

Query  232  MAGAASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGDPQ--DPVAYD-SGVT  402
            MAGA SALFLLD+KGRVLVWRDYRGDVSA QAERFFTKLL+ EGD +   PV YD +GVT
Sbjct  1    MAGAVSALFLLDIKGRVLVWRDYRGDVSALQAERFFTKLLDKEGDSEAHSPVVYDDAGVT  60

Query  403  YMFIQHNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDE  582
            YMFIQHNNV+L+ ASRQNCNAAS+LLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDE
Sbjct  61   YMFIQHNNVFLLTASRQNCNAASILLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDE  120

Query  583  IMDFGYPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVE  762
            +MDFGYPQ+TEAKILSEFIKTDAYRMEV+QRPPMAVTNAVSWRSEGI YKKNEVFLDVVE
Sbjct  121  MMDFGYPQYTEAKILSEFIKTDAYRMEVSQRPPMAVTNAVSWRSEGIRYKKNEVFLDVVE  180

Query  763  SVNILVNSNGQIVRS  807
            SVNILVNSNGQIVRS
Sbjct  181  SVNILVNSNGQIVRS  195



>ref|XP_010924114.1| PREDICTED: AP-1 complex subunit mu-2-like [Elaeis guineensis]
Length=428

 Score =   358 bits (920),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 170/194 (88%), Positives = 182/194 (94%), Gaps = 2/194 (1%)
 Frame = +1

Query  232  MAGAASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGDPQD--PVAYDSGVTY  405
            MAGA SALF LD+KGRVLVWRDYRGDVSA QAER FTKL+E E DP+   PV +D+GVTY
Sbjct  1    MAGAVSALFFLDIKGRVLVWRDYRGDVSALQAERVFTKLIEKEADPESHSPVVFDNGVTY  60

Query  406  MFIQHNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEI  585
            MFIQHNN++LM A+RQNCNAAS+LLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDE+
Sbjct  61   MFIQHNNLFLMTAARQNCNAASILLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEM  120

Query  586  MDFGYPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVES  765
            MDFGYPQ+TEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGI YKKNEVFLDVVES
Sbjct  121  MDFGYPQYTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGIRYKKNEVFLDVVES  180

Query  766  VNILVNSNGQIVRS  807
            VNILVNSNGQI+RS
Sbjct  181  VNILVNSNGQIIRS  194



>gb|EAY75520.1| hypothetical protein OsI_03424 [Oryza sativa Indica Group]
Length=429

 Score =   358 bits (920),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 174/195 (89%), Positives = 184/195 (94%), Gaps = 3/195 (2%)
 Frame = +1

Query  232  MAGAASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGDPQ--DPVAYD-SGVT  402
            MAGA SALFLLD+KGRVLVWRDYRGDVSA QAERFFTKLL+ EGD +   PV YD +GVT
Sbjct  1    MAGAVSALFLLDIKGRVLVWRDYRGDVSALQAERFFTKLLDKEGDSEAHSPVVYDDAGVT  60

Query  403  YMFIQHNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDE  582
            YMFIQHNNV+L+ ASRQNCNAAS+LLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDE
Sbjct  61   YMFIQHNNVFLLTASRQNCNAASILLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDE  120

Query  583  IMDFGYPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVE  762
            +MDFGYPQ+TEAKILSEFIKTDAYRMEV+QRPPMAVTNAVSWRSEGI YKKNEVFLDVVE
Sbjct  121  MMDFGYPQYTEAKILSEFIKTDAYRMEVSQRPPMAVTNAVSWRSEGIRYKKNEVFLDVVE  180

Query  763  SVNILVNSNGQIVRS  807
            SVNILVNSNGQIVRS
Sbjct  181  SVNILVNSNGQIVRS  195



>gb|EPS68502.1| hypothetical protein M569_06266, partial [Genlisea aurea]
Length=430

 Score =   358 bits (920),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 169/194 (87%), Positives = 183/194 (94%), Gaps = 2/194 (1%)
 Frame = +1

Query  232  MAGAASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGDP--QDPVAYDSGVTY  405
            M GAAS LFLLD++GR+LVWRDYRGDVSA QAERFFTKL+E EGD   QDPV Y+ G+TY
Sbjct  2    MTGAASTLFLLDMRGRILVWRDYRGDVSAAQAERFFTKLIEKEGDTETQDPVVYEDGITY  61

Query  406  MFIQHNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEI  585
            MFI+HNNVYL+ ASRQNCNAASL+LFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDE+
Sbjct  62   MFIRHNNVYLLTASRQNCNAASLILFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEM  121

Query  586  MDFGYPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVES  765
            MDFGYPQ+TEAKILSE+IKTDAYRMEVTQRPPMAVTNAVSWRSEGI +KKNEVFLDVVES
Sbjct  122  MDFGYPQYTEAKILSEYIKTDAYRMEVTQRPPMAVTNAVSWRSEGIRHKKNEVFLDVVES  181

Query  766  VNILVNSNGQIVRS  807
            VNILVNSNGQI+RS
Sbjct  182  VNILVNSNGQIIRS  195



>ref|NP_001288528.1| AP-1 complex subunit mu-2 [Zea mays]
 ref|XP_002456218.1| hypothetical protein SORBIDRAFT_03g032290 [Sorghum bicolor]
 gb|ACN34099.1| unknown [Zea mays]
 gb|EES01338.1| hypothetical protein SORBIDRAFT_03g032290 [Sorghum bicolor]
 tpg|DAA57960.1| TPA: hypothetical protein ZEAMMB73_448798 [Zea mays]
Length=429

 Score =   358 bits (920),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 174/195 (89%), Positives = 184/195 (94%), Gaps = 3/195 (2%)
 Frame = +1

Query  232  MAGAASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGDPQ--DPVAYD-SGVT  402
            MAGA SALFLLD+KGRVLVWRDYRGDVSA QAERFFTKLL+ EGD +   PV YD +GVT
Sbjct  1    MAGAVSALFLLDIKGRVLVWRDYRGDVSALQAERFFTKLLDKEGDSEVHSPVVYDDAGVT  60

Query  403  YMFIQHNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDE  582
            YMFIQHNNV+L+ A+RQNCNAAS+LLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDE
Sbjct  61   YMFIQHNNVFLLTAARQNCNAASILLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDE  120

Query  583  IMDFGYPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVE  762
            +MDFGYPQ+TEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGI YKKNEVFLDVVE
Sbjct  121  MMDFGYPQYTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGIRYKKNEVFLDVVE  180

Query  763  SVNILVNSNGQIVRS  807
            SVNILVNSNGQIVRS
Sbjct  181  SVNILVNSNGQIVRS  195



>ref|XP_003569636.1| PREDICTED: AP-1 complex subunit mu-2 [Brachypodium distachyon]
Length=429

 Score =   357 bits (917),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 173/195 (89%), Positives = 184/195 (94%), Gaps = 3/195 (2%)
 Frame = +1

Query  232  MAGAASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGDPQ--DPVAYD-SGVT  402
            MAGA SALFLLD+KGRVLVWRD+RGDV+A QAERFFTKLL+ EGD +   PV YD +GVT
Sbjct  1    MAGAVSALFLLDIKGRVLVWRDFRGDVTAVQAERFFTKLLDKEGDAEAHSPVVYDDAGVT  60

Query  403  YMFIQHNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDE  582
            YMFIQHNNV+L+ ASRQNCNAAS+LLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDE
Sbjct  61   YMFIQHNNVFLLTASRQNCNAASILLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDE  120

Query  583  IMDFGYPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVE  762
            +MDFGYPQ+TEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGI YKKNEVFLDVVE
Sbjct  121  MMDFGYPQYTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGIRYKKNEVFLDVVE  180

Query  763  SVNILVNSNGQIVRS  807
            SVNILVNSNGQIVRS
Sbjct  181  SVNILVNSNGQIVRS  195



>ref|NP_001140632.1| hypothetical protein [Zea mays]
 gb|ACF84213.1| unknown [Zea mays]
 gb|ACN28896.1| unknown [Zea mays]
 gb|ACR35886.1| unknown [Zea mays]
 gb|AFW83686.1| hypothetical protein ZEAMMB73_283352 [Zea mays]
Length=429

 Score =   357 bits (917),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 173/195 (89%), Positives = 184/195 (94%), Gaps = 3/195 (2%)
 Frame = +1

Query  232  MAGAASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGDPQ--DPVAYD-SGVT  402
            MAGA SALFLLD+KGRVLVWRDYRGDVSA QAERFFTKLL+ EGD +   PV YD +GVT
Sbjct  1    MAGAVSALFLLDMKGRVLVWRDYRGDVSALQAERFFTKLLDKEGDSEVHSPVVYDDAGVT  60

Query  403  YMFIQHNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDE  582
            YMFIQHNNV+L+ A+RQNCNAAS+LLFLHRV+DVFKHYFEELEEESLRDNFVVVYELLDE
Sbjct  61   YMFIQHNNVFLLTAARQNCNAASILLFLHRVIDVFKHYFEELEEESLRDNFVVVYELLDE  120

Query  583  IMDFGYPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVE  762
            +MDFGYPQ+TEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGI YKKNEVFLDVVE
Sbjct  121  MMDFGYPQYTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGIRYKKNEVFLDVVE  180

Query  763  SVNILVNSNGQIVRS  807
            SVNILVNSNGQIVRS
Sbjct  181  SVNILVNSNGQIVRS  195



>ref|XP_004969676.1| PREDICTED: AP-1 complex subunit mu-1-like [Setaria italica]
Length=429

 Score =   357 bits (916),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 173/195 (89%), Positives = 184/195 (94%), Gaps = 3/195 (2%)
 Frame = +1

Query  232  MAGAASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGDPQ--DPVAYD-SGVT  402
            MAGA SALFLLD+KGRVLVWRDYRGDVSA QAERFFTKLL+ EGD +   PV YD +GVT
Sbjct  1    MAGAVSALFLLDIKGRVLVWRDYRGDVSALQAERFFTKLLDKEGDAEVHSPVVYDDAGVT  60

Query  403  YMFIQHNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDE  582
            YMFIQHNNV+L+ A+RQNCNAAS+LLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDE
Sbjct  61   YMFIQHNNVFLLTAARQNCNAASILLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDE  120

Query  583  IMDFGYPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVE  762
            +MDFGYPQ+TEAKILSEFIKTDAYRMEV+QRPPMAVTNAVSWRSEGI YKKNEVFLDVVE
Sbjct  121  MMDFGYPQYTEAKILSEFIKTDAYRMEVSQRPPMAVTNAVSWRSEGIRYKKNEVFLDVVE  180

Query  763  SVNILVNSNGQIVRS  807
            SVNILVNSNGQIVRS
Sbjct  181  SVNILVNSNGQIVRS  195



>gb|AFW83685.1| hypothetical protein ZEAMMB73_283352 [Zea mays]
Length=632

 Score =   362 bits (930),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 178/209 (85%), Positives = 189/209 (90%), Gaps = 4/209 (2%)
 Frame = +1

Query  190  DPRSPADFQIQPPIMAGAASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGDP  369
            DP    D  I P  MAGA SALFLLD+KGRVLVWRDYRGDVSA QAERFFTKLL+ EGD 
Sbjct  191  DPVGGKDL-IAPTTMAGAVSALFLLDMKGRVLVWRDYRGDVSALQAERFFTKLLDKEGDS  249

Query  370  Q--DPVAYD-SGVTYMFIQHNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEES  540
            +   PV YD +GVTYMFIQHNNV+L+ A+RQNCNAAS+LLFLHRV+DVFKHYFEELEEES
Sbjct  250  EVHSPVVYDDAGVTYMFIQHNNVFLLTAARQNCNAASILLFLHRVIDVFKHYFEELEEES  309

Query  541  LRDNFVVVYELLDEIMDFGYPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEG  720
            LRDNFVVVYELLDE+MDFGYPQ+TEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEG
Sbjct  310  LRDNFVVVYELLDEMMDFGYPQYTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEG  369

Query  721  INYKKNEVFLDVVESVNILVNSNGQIVRS  807
            I YKKNEVFLDVVESVNILVNSNGQIVRS
Sbjct  370  IRYKKNEVFLDVVESVNILVNSNGQIVRS  398



>ref|XP_002968864.1| hypothetical protein SELMODRAFT_91068 [Selaginella moellendorffii]
 ref|XP_002974107.1| hypothetical protein SELMODRAFT_100170 [Selaginella moellendorffii]
 gb|EFJ25062.1| hypothetical protein SELMODRAFT_100170 [Selaginella moellendorffii]
 gb|EFJ29980.1| hypothetical protein SELMODRAFT_91068 [Selaginella moellendorffii]
Length=431

 Score =   355 bits (912),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 169/194 (87%), Positives = 181/194 (93%), Gaps = 2/194 (1%)
 Frame = +1

Query  232  MAGAASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGDP--QDPVAYDSGVTY  405
            MAGAASALFLLD+KGRVLVWRDYRGDVSA QAERFF K+ E E D   QDPV +D GVTY
Sbjct  1    MAGAASALFLLDMKGRVLVWRDYRGDVSAAQAERFFAKIQEGESDSSSQDPVVFDDGVTY  60

Query  406  MFIQHNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEI  585
            +F+QHNNVY+M ASRQNCNAASLLLFLHRV+DVFKHYFEELEEESLRDNFVVVYELLDE+
Sbjct  61   LFVQHNNVYVMTASRQNCNAASLLLFLHRVIDVFKHYFEELEEESLRDNFVVVYELLDEM  120

Query  586  MDFGYPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVES  765
            MDFGYPQFTEA ILSEFIKTDAY++E+TQRPPMAVTNAVSWRSEGI YKKNEVFLDVVES
Sbjct  121  MDFGYPQFTEANILSEFIKTDAYKIEITQRPPMAVTNAVSWRSEGIRYKKNEVFLDVVES  180

Query  766  VNILVNSNGQIVRS  807
            VNILVNSNGQ+VRS
Sbjct  181  VNILVNSNGQLVRS  194



>ref|XP_009386436.1| PREDICTED: AP-1 complex subunit mu-2-like [Musa acuminata subsp. 
malaccensis]
Length=428

 Score =   355 bits (911),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 168/194 (87%), Positives = 180/194 (93%), Gaps = 2/194 (1%)
 Frame = +1

Query  232  MAGAASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGD--PQDPVAYDSGVTY  405
            MAGA SALFLLD+KGRVL+WRDYRGDVSA QAERFFTKL+E EGD     PV +D G++Y
Sbjct  1    MAGAVSALFLLDIKGRVLIWRDYRGDVSAVQAERFFTKLIEKEGDHESHSPVVFDDGISY  60

Query  406  MFIQHNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEI  585
            MFIQHNNV+LM A+RQNCNA S+LLFLHRVVDVFKHYF ELEEESLRDNFVVVYELLDE+
Sbjct  61   MFIQHNNVFLMTAARQNCNAVSILLFLHRVVDVFKHYFVELEEESLRDNFVVVYELLDEM  120

Query  586  MDFGYPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVES  765
            MDFGYPQ+TEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGI YKKNEVFLDVVES
Sbjct  121  MDFGYPQYTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGIRYKKNEVFLDVVES  180

Query  766  VNILVNSNGQIVRS  807
            VNILVNSNGQI+RS
Sbjct  181  VNILVNSNGQIIRS  194



>ref|XP_004298991.1| PREDICTED: AP-1 complex subunit mu-2 [Fragaria vesca subsp. vesca]
Length=428

 Score =   354 bits (909),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 169/194 (87%), Positives = 181/194 (93%), Gaps = 2/194 (1%)
 Frame = +1

Query  232  MAGAASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGDPQ--DPVAYDSGVTY  405
            MAGA SALFLLD+KGRVL+WRDYRGDVSA QAERFFTKL++ E D +  DPV  D+GV+Y
Sbjct  1    MAGAVSALFLLDIKGRVLIWRDYRGDVSAVQAERFFTKLIDKEVDAESHDPVVNDNGVSY  60

Query  406  MFIQHNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEI  585
            MF+QHNNVYLM ASRQNCNAAS+L FLHR+VDVFKHYFEELEEESLRDNFVVVYELLDE+
Sbjct  61   MFLQHNNVYLMAASRQNCNAASILFFLHRIVDVFKHYFEELEEESLRDNFVVVYELLDEM  120

Query  586  MDFGYPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVES  765
            MDFGYPQFTEAKILSEFIKTDAYRMEV QRPPMAVTNAVSWRSEGI YKKNEVFLDVVES
Sbjct  121  MDFGYPQFTEAKILSEFIKTDAYRMEVNQRPPMAVTNAVSWRSEGIRYKKNEVFLDVVES  180

Query  766  VNILVNSNGQIVRS  807
            VNILVNSNGQI+RS
Sbjct  181  VNILVNSNGQIIRS  194



>emb|CDM83667.1| unnamed protein product [Triticum aestivum]
Length=429

 Score =   354 bits (909),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 170/195 (87%), Positives = 184/195 (94%), Gaps = 3/195 (2%)
 Frame = +1

Query  232  MAGAASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGDPQ--DPVAYD-SGVT  402
            MAGA SALFLLD+KGRVLVWRD+RGDV+A QAERFFTKLL+ EGD +   PV YD +GVT
Sbjct  1    MAGAVSALFLLDIKGRVLVWRDFRGDVTAVQAERFFTKLLDKEGDAEAYSPVVYDDAGVT  60

Query  403  YMFIQHNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDE  582
            YMFIQHNN++L+ ASRQNCNAAS+LLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDE
Sbjct  61   YMFIQHNNIFLLTASRQNCNAASILLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDE  120

Query  583  IMDFGYPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVE  762
            +MDFGYPQ+TEAKILSEFIKTDAY+MEV+QRPPMAVTNAVSWRSEGI YKKNEVFLDVVE
Sbjct  121  MMDFGYPQYTEAKILSEFIKTDAYKMEVSQRPPMAVTNAVSWRSEGIRYKKNEVFLDVVE  180

Query  763  SVNILVNSNGQIVRS  807
            SVNILVNSNGQIVRS
Sbjct  181  SVNILVNSNGQIVRS  195



>ref|XP_009417102.1| PREDICTED: AP-1 complex subunit mu-2-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009417110.1| PREDICTED: AP-1 complex subunit mu-2-like [Musa acuminata subsp. 
malaccensis]
Length=428

 Score =   354 bits (908),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 167/194 (86%), Positives = 181/194 (93%), Gaps = 2/194 (1%)
 Frame = +1

Query  232  MAGAASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGD--PQDPVAYDSGVTY  405
            MAGA SALFLLD+KGR+L+WRDYRGDVSA QAERFFTKL+E EGD   + PV +D G++Y
Sbjct  1    MAGAVSALFLLDIKGRILIWRDYRGDVSAVQAERFFTKLIEKEGDIESRSPVVFDDGISY  60

Query  406  MFIQHNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEI  585
            MFIQHNNV+LM A+RQNCN AS+LLFLHRVV+VFKHYFEELEEESLRDNFVVVYELLDEI
Sbjct  61   MFIQHNNVFLMTAARQNCNVASILLFLHRVVNVFKHYFEELEEESLRDNFVVVYELLDEI  120

Query  586  MDFGYPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVES  765
            MDFGYPQ+TEAKILSEFIKTDAYRMEV QRPPMAVTNAVSWRSEGI YKKNEVFLDVVES
Sbjct  121  MDFGYPQYTEAKILSEFIKTDAYRMEVVQRPPMAVTNAVSWRSEGIWYKKNEVFLDVVES  180

Query  766  VNILVNSNGQIVRS  807
            VNILVNSNGQI+RS
Sbjct  181  VNILVNSNGQIIRS  194



>ref|XP_006646248.1| PREDICTED: AP-1 complex subunit mu-2-like [Oryza brachyantha]
Length=435

 Score =   353 bits (907),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 173/201 (86%), Positives = 182/201 (91%), Gaps = 9/201 (4%)
 Frame = +1

Query  232  MAGAASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGD--------PQDPVAY  387
            MAGA SALFLLD+KGRVLVWRDYRGDVSA QAERFFTKLL+ E D           PV Y
Sbjct  1    MAGAVSALFLLDIKGRVLVWRDYRGDVSALQAERFFTKLLDKEADVNKQGDSEAHSPVVY  60

Query  388  D-SGVTYMFIQHNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVV  564
            D +GVTYMFIQHNNV+L+ ASRQNCNAAS+LLFLHRVVDVFKHYFEELEEESLRDNFVVV
Sbjct  61   DDAGVTYMFIQHNNVFLLTASRQNCNAASILLFLHRVVDVFKHYFEELEEESLRDNFVVV  120

Query  565  YELLDEIMDFGYPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEV  744
            YELLDE+MDFGYPQ+TEAKILSEFIKTDAYRMEV+QRPPMAVTNAVSWRSEGI YKKNEV
Sbjct  121  YELLDEMMDFGYPQYTEAKILSEFIKTDAYRMEVSQRPPMAVTNAVSWRSEGIRYKKNEV  180

Query  745  FLDVVESVNILVNSNGQIVRS  807
            FLDVVESVNILVNSNGQIVRS
Sbjct  181  FLDVVESVNILVNSNGQIVRS  201



>ref|XP_003567979.1| PREDICTED: AP-1 complex subunit mu-2-like [Brachypodium distachyon]
Length=429

 Score =   353 bits (905),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 170/195 (87%), Positives = 183/195 (94%), Gaps = 3/195 (2%)
 Frame = +1

Query  232  MAGAASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGDPQ--DPVAYD-SGVT  402
            MAGA SALFLLD+KGRVLVWRDYRGDVSA QAERFFTKLL+ EGD +   PV +D +GV+
Sbjct  1    MAGAVSALFLLDIKGRVLVWRDYRGDVSALQAERFFTKLLDKEGDAEVHSPVVHDDAGVS  60

Query  403  YMFIQHNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDE  582
            YMFIQHNNV+L+ ASRQNCNAAS+LLFLHR++DVFKHYFEELEEESLRDNFVVVYELLDE
Sbjct  61   YMFIQHNNVFLLTASRQNCNAASILLFLHRLIDVFKHYFEELEEESLRDNFVVVYELLDE  120

Query  583  IMDFGYPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVE  762
            +MDFGYPQ+TEA ILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGI YKKNEVFLDVVE
Sbjct  121  MMDFGYPQYTEATILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGIRYKKNEVFLDVVE  180

Query  763  SVNILVNSNGQIVRS  807
            SVNILVNSNGQIVRS
Sbjct  181  SVNILVNSNGQIVRS  195



>ref|NP_001056201.1| Os05g0543100 [Oryza sativa Japonica Group]
 gb|AAU43995.1| putative clathrin [Oryza sativa Japonica Group]
 dbj|BAF18115.1| Os05g0543100 [Oryza sativa Japonica Group]
 dbj|BAG89382.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC79627.1| hypothetical protein OsI_20841 [Oryza sativa Indica Group]
 gb|EEE64556.1| hypothetical protein OsJ_19408 [Oryza sativa Japonica Group]
Length=430

 Score =   349 bits (896),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 170/196 (87%), Positives = 182/196 (93%), Gaps = 3/196 (2%)
 Frame = +1

Query  229  IMAGAASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGDPQ--DPVAYD-SGV  399
            + AGA SALFLLD+KGRVLVWRDYRGDVSA QAERFFTKLL+ E D +   PV +D +GV
Sbjct  1    MAAGAVSALFLLDIKGRVLVWRDYRGDVSALQAERFFTKLLDKESDAEVLSPVVHDDAGV  60

Query  400  TYMFIQHNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLD  579
            +YMFIQHNNV+L+ ASRQNCNAAS+LLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLD
Sbjct  61   SYMFIQHNNVFLLTASRQNCNAASILLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLD  120

Query  580  EIMDFGYPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVV  759
            E+MDFGYPQ+TEA ILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGI YKKNEVFLDVV
Sbjct  121  EMMDFGYPQYTEAMILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGIRYKKNEVFLDVV  180

Query  760  ESVNILVNSNGQIVRS  807
            ESVNILVNSNGQIVRS
Sbjct  181  ESVNILVNSNGQIVRS  196



>dbj|BAJ97229.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=429

 Score =   348 bits (894),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 168/195 (86%), Positives = 182/195 (93%), Gaps = 3/195 (2%)
 Frame = +1

Query  232  MAGAASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGDPQ--DPVAYD-SGVT  402
            MAGA SALFLLD+KGRVLVWRDYRGDV+A QAERFFTKLL+ EGD +   PV +D +GV+
Sbjct  1    MAGAVSALFLLDIKGRVLVWRDYRGDVTALQAERFFTKLLDKEGDAEVHSPVVHDGAGVS  60

Query  403  YMFIQHNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDE  582
            Y FIQHNNV+L+ A+RQNCNAAS+LLFLHR+VDVFKHYFEELEEESLRDNFVVVYELLDE
Sbjct  61   YTFIQHNNVFLLTAARQNCNAASILLFLHRLVDVFKHYFEELEEESLRDNFVVVYELLDE  120

Query  583  IMDFGYPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVE  762
            +MDFGYPQ+TEA ILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGI YKKNEVFLDVVE
Sbjct  121  MMDFGYPQYTEATILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGIRYKKNEVFLDVVE  180

Query  763  SVNILVNSNGQIVRS  807
            SVNILVNSNGQIVRS
Sbjct  181  SVNILVNSNGQIVRS  195



>ref|XP_001782369.1| predicted protein [Physcomitrella patens]
 gb|EDQ52823.1| predicted protein [Physcomitrella patens]
Length=427

 Score =   348 bits (893),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 164/194 (85%), Positives = 180/194 (93%), Gaps = 2/194 (1%)
 Frame = +1

Query  232  MAGAASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGDP--QDPVAYDSGVTY  405
            M+GAASA+FLLD+KGRVL+WRDYRGDVS+ QAER F KL++ E DP   DP+  ++GVTY
Sbjct  1    MSGAASAIFLLDMKGRVLIWRDYRGDVSSVQAERAFAKLMDGENDPASHDPILLENGVTY  60

Query  406  MFIQHNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEI  585
            +FIQHNNVY+M ASRQNCNAASLLLFLHR+VDVFKHYFEELEEESLRDNFVVVYELLDE+
Sbjct  61   LFIQHNNVYVMTASRQNCNAASLLLFLHRIVDVFKHYFEELEEESLRDNFVVVYELLDEM  120

Query  586  MDFGYPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVES  765
            MDFGYPQ+TEAKILSEFIKTDAYRMEVT RPPMAVTNAVSWR EGI YKKNEVFLDVVES
Sbjct  121  MDFGYPQYTEAKILSEFIKTDAYRMEVTTRPPMAVTNAVSWRMEGIKYKKNEVFLDVVES  180

Query  766  VNILVNSNGQIVRS  807
            VNILVNSNGQ+VRS
Sbjct  181  VNILVNSNGQLVRS  194



>ref|XP_001781339.1| predicted protein [Physcomitrella patens]
 gb|EDQ53867.1| predicted protein [Physcomitrella patens]
Length=427

 Score =   347 bits (891),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 164/194 (85%), Positives = 180/194 (93%), Gaps = 2/194 (1%)
 Frame = +1

Query  232  MAGAASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGDPQD--PVAYDSGVTY  405
            M+GAASA+FLLD+KGRVL+WRDYRGDVSA QAER F KL++ EGDP    P+  D+GVTY
Sbjct  1    MSGAASAIFLLDMKGRVLIWRDYRGDVSAPQAERAFAKLMDGEGDPASHAPLLLDNGVTY  60

Query  406  MFIQHNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEI  585
            +FIQHNNVY+M ASRQNCNAASL+LFLHR+VDVFKHYFEELEEESLRDNFVVVYELLDE+
Sbjct  61   LFIQHNNVYVMTASRQNCNAASLVLFLHRIVDVFKHYFEELEEESLRDNFVVVYELLDEM  120

Query  586  MDFGYPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVES  765
            MDFGYPQ+TEAKILSEFIKTDAYRMEVT RPPMAVTNAVSWR +GI YKKNEVFLDVVES
Sbjct  121  MDFGYPQYTEAKILSEFIKTDAYRMEVTTRPPMAVTNAVSWRMDGIKYKKNEVFLDVVES  180

Query  766  VNILVNSNGQIVRS  807
            VNILVNSNGQ+VRS
Sbjct  181  VNILVNSNGQLVRS  194



>ref|XP_009609074.1| PREDICTED: AP-1 complex subunit mu-2-like isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009609075.1| PREDICTED: AP-1 complex subunit mu-2-like isoform X1 [Nicotiana 
tomentosiformis]
Length=428

 Score =   334 bits (856),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 160/194 (82%), Positives = 176/194 (91%), Gaps = 2/194 (1%)
 Frame = +1

Query  232  MAGAASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGDPQD--PVAYDSGVTY  405
            MAGA SALFLLD+KGR L+ RDYRGDVSA Q E+FF+KLLE EGD +   PV Y++GV Y
Sbjct  1    MAGATSALFLLDMKGRCLICRDYRGDVSAQQVEKFFSKLLEKEGDVESDGPVCYENGVNY  60

Query  406  MFIQHNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEI  585
            MFIQHNN+YLM ASRQN NAASLLLFLHRVVDVFKHYFEE+EEESLRDNFVVVYELLDE+
Sbjct  61   MFIQHNNIYLMAASRQNSNAASLLLFLHRVVDVFKHYFEEVEEESLRDNFVVVYELLDEM  120

Query  586  MDFGYPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVES  765
            MDFGYPQ+TEAKILSEFIKTDAYRMEVTQ PPMAVTNAVSWRSEG+ YK NEV+LDVVE 
Sbjct  121  MDFGYPQYTEAKILSEFIKTDAYRMEVTQHPPMAVTNAVSWRSEGVFYKNNEVYLDVVEH  180

Query  766  VNILVNSNGQIVRS  807
            VN+LVNSNGQ++RS
Sbjct  181  VNLLVNSNGQLIRS  194



>ref|XP_011071915.1| PREDICTED: AP-1 complex subunit mu-2-like isoform X1 [Sesamum 
indicum]
 ref|XP_011071916.1| PREDICTED: AP-1 complex subunit mu-2-like isoform X1 [Sesamum 
indicum]
Length=428

 Score =   333 bits (855),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 159/194 (82%), Positives = 174/194 (90%), Gaps = 2/194 (1%)
 Frame = +1

Query  232  MAGAASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGD--PQDPVAYDSGVTY  405
            MAGA SALF+LD+KGR L+ RDYRG VSA Q E+FF+KLLE E D     PV +++GV+Y
Sbjct  1    MAGATSALFILDIKGRCLISRDYRGQVSAAQVEKFFSKLLEKEDDIESHGPVCFENGVSY  60

Query  406  MFIQHNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEI  585
            MFIQH+NVYLM ASRQNCN ASLL FLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEI
Sbjct  61   MFIQHSNVYLMTASRQNCNVASLLFFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEI  120

Query  586  MDFGYPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVES  765
            MDFGYPQ+TEAKILSEFIKTDAY+ME TQRPPMAVTNAVSWRSEG+ Y+ NEVFLDVVES
Sbjct  121  MDFGYPQYTEAKILSEFIKTDAYKMEGTQRPPMAVTNAVSWRSEGVVYRTNEVFLDVVES  180

Query  766  VNILVNSNGQIVRS  807
            VNILVNSNGQI+RS
Sbjct  181  VNILVNSNGQIIRS  194



>ref|XP_009772291.1| PREDICTED: AP-1 complex subunit mu-2-like isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009772292.1| PREDICTED: AP-1 complex subunit mu-2-like isoform X1 [Nicotiana 
sylvestris]
Length=428

 Score =   332 bits (851),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 160/194 (82%), Positives = 173/194 (89%), Gaps = 2/194 (1%)
 Frame = +1

Query  232  MAGAASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGD--PQDPVAYDSGVTY  405
            MAGA SALFLLD+KGR L+ RDYRGDVSA Q E+FF+KLLE EGD     PV Y++GV Y
Sbjct  1    MAGATSALFLLDMKGRCLISRDYRGDVSAQQVEKFFSKLLEKEGDVESHGPVCYENGVNY  60

Query  406  MFIQHNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEI  585
            MFIQHNN+YLM ASRQN NAASLL FLHRVVDVFKHYFEELEEESLRDNFVVVYELLDE+
Sbjct  61   MFIQHNNIYLMAASRQNSNAASLLFFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEM  120

Query  586  MDFGYPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVES  765
            MDFGYPQ+TEAKILSEFIKTDAYRMEVTQ PPMAVTNAVSWRSEG+ YK NEV+LDVVE 
Sbjct  121  MDFGYPQYTEAKILSEFIKTDAYRMEVTQHPPMAVTNAVSWRSEGVFYKNNEVYLDVVEH  180

Query  766  VNILVNSNGQIVRS  807
            VN+LVNSNGQ +RS
Sbjct  181  VNLLVNSNGQSIRS  194



>ref|XP_010678835.1| PREDICTED: AP-1 complex subunit mu-2-like [Beta vulgaris subsp. 
vulgaris]
Length=428

 Score =   329 bits (843),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 154/194 (79%), Positives = 177/194 (91%), Gaps = 2/194 (1%)
 Frame = +1

Query  232  MAGAASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGD--PQDPVAYDSGVTY  405
            MAGAASAL+LLDVKGRVL+WRD+RGDVS  +AERFFT L+  E D   Q PV ++ GVTY
Sbjct  1    MAGAASALYLLDVKGRVLIWRDFRGDVSVIEAERFFTNLVLKEEDVISQGPVIHEKGVTY  60

Query  406  MFIQHNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEI  585
            MF+QH+N+YLM++SRQNCNAASLLLFLHR+V VFKHYFEELEEESLRDNFVVVYELLDE+
Sbjct  61   MFVQHSNLYLMVSSRQNCNAASLLLFLHRLVQVFKHYFEELEEESLRDNFVVVYELLDEM  120

Query  586  MDFGYPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVES  765
            MDFGYPQ+TEA ILSEFIKT+A++MEV QRPPMAVTNAVSWRSEG+ YK+NEVFLDV+E 
Sbjct  121  MDFGYPQYTEAIILSEFIKTNAFKMEVVQRPPMAVTNAVSWRSEGLKYKRNEVFLDVIEK  180

Query  766  VNILVNSNGQIVRS  807
            VNILVNSNGQ++RS
Sbjct  181  VNILVNSNGQVIRS  194



>gb|KHN14546.1| AP-1 complex subunit mu-1-I, partial [Glycine soja]
Length=406

 Score =   324 bits (830),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 154/172 (90%), Positives = 164/172 (95%), Gaps = 2/172 (1%)
 Frame = +1

Query  298  YRGDVSATQAERFFTKLLENEGDPQ--DPVAYDSGVTYMFIQHNNVYLMIASRQNCNAAS  471
            YRGDVSA  AERFFTKL+E + DPQ  DPV +D+GVTYMFIQH+NVYLMIA+RQNCNAAS
Sbjct  1    YRGDVSALDAERFFTKLIEKQADPQAQDPVVHDNGVTYMFIQHSNVYLMIATRQNCNAAS  60

Query  472  LLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEIMDFGYPQFTEAKILSEFIKTDA  651
            LL FLHR+VDVFKHYFEELEEESLRDNFVVVYELLDEIMDFGYPQ+TEA+ILSEFIKTDA
Sbjct  61   LLFFLHRIVDVFKHYFEELEEESLRDNFVVVYELLDEIMDFGYPQYTEAQILSEFIKTDA  120

Query  652  YRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVESVNILVNSNGQIVRS  807
            YRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVESVNILVNSNGQI+RS
Sbjct  121  YRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVESVNILVNSNGQIIRS  172



>gb|KJB31189.1| hypothetical protein B456_005G180000 [Gossypium raimondii]
Length=407

 Score =   323 bits (828),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 159/194 (82%), Positives = 166/194 (86%), Gaps = 23/194 (12%)
 Frame = +1

Query  232  MAGAASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGDPQ--DPVAYDSGVTY  405
            MAGAASALFLLD+KGRVLVWRDYRGDVSA QAERFFTKL+E EGDPQ  DPV YD+GVTY
Sbjct  1    MAGAASALFLLDIKGRVLVWRDYRGDVSAAQAERFFTKLIEKEGDPQSQDPVVYDNGVTY  60

Query  406  MFIQHNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEI  585
            MFIQH+NVYLM A+RQNCNAASLL FLHRVVD                     YELLDEI
Sbjct  61   MFIQHSNVYLMTATRQNCNAASLLFFLHRVVD---------------------YELLDEI  99

Query  586  MDFGYPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVES  765
            MDFGYPQ+TEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVES
Sbjct  100  MDFGYPQYTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVES  159

Query  766  VNILVNSNGQIVRS  807
            VNILVNSNGQI+RS
Sbjct  160  VNILVNSNGQIIRS  173



>ref|XP_006347435.1| PREDICTED: AP-1 complex subunit mu-2-like [Solanum tuberosum]
Length=428

 Score =   323 bits (829),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 155/194 (80%), Positives = 172/194 (89%), Gaps = 2/194 (1%)
 Frame = +1

Query  232  MAGAASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGDPQD--PVAYDSGVTY  405
            MAGA SA+FLLD+KGR L+ RDYRGDVSA Q E+FFTKLLE EGD +   PV +++GV Y
Sbjct  1    MAGAISAMFLLDMKGRCLISRDYRGDVSAQQVEKFFTKLLEKEGDLESDGPVCHENGVNY  60

Query  406  MFIQHNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEI  585
            MFIQH N+YLM AS+QN NAASLL FLHRVVDVFKHYFEELEEESLRDNFVVVYELLDE+
Sbjct  61   MFIQHKNIYLMAASKQNSNAASLLFFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEM  120

Query  586  MDFGYPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVES  765
            MDFGYPQ+TEAKILSEFIKTDAYRMEV Q PPMAVTNAVSWRSEG+ YK NEV+LDVVE 
Sbjct  121  MDFGYPQYTEAKILSEFIKTDAYRMEVNQHPPMAVTNAVSWRSEGVFYKNNEVYLDVVEH  180

Query  766  VNILVNSNGQIVRS  807
            VN+LVNSNGQ++ S
Sbjct  181  VNLLVNSNGQLIHS  194



>gb|EMT29153.1| AP-1 complex subunit mu-1 [Aegilops tauschii]
Length=481

 Score =   325 bits (833),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 168/234 (72%), Positives = 182/234 (78%), Gaps = 42/234 (18%)
 Frame = +1

Query  232  MAGAASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGDPQ--DPVAYD-SGVT  402
            MAGA SALFLLD+KGRVLVWRDYRGDV+A QAERFFTKLL+ EGD +   PV +D +GV+
Sbjct  1    MAGAVSALFLLDIKGRVLVWRDYRGDVTALQAERFFTKLLDKEGDAEVHSPVVHDGAGVS  60

Query  403  YMFIQHNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVV------  564
            Y FIQHNNV+L+ A+RQNCNAAS+LLFLHR+VDVFKHYFEELEEESLRDNFVVV      
Sbjct  61   YTFIQHNNVFLLTAARQNCNAASILLFLHRLVDVFKHYFEELEEESLRDNFVVVGLMDAL  120

Query  565  ----YELLDEIMDFGYPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYK  732
                YELLDE+MDFGYPQ+TEA ILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGI YK
Sbjct  121  CSAQYELLDEMMDFGYPQYTEATILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGIRYK  180

Query  733  KNE-----------------------------VFLDVVESVNILVNSNGQIVRS  807
            KNE                             VFLDVVESVNILVNSNGQIVRS
Sbjct  181  KNEVRYIIPLPLFTLVHFDGYVMGKLLTCVSQVFLDVVESVNILVNSNGQIVRS  234



>gb|EMS46923.1| AP-1 complex subunit mu-1 [Triticum urartu]
Length=539

 Score =   324 bits (830),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 167/234 (71%), Positives = 182/234 (78%), Gaps = 42/234 (18%)
 Frame = +1

Query  232  MAGAASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGDPQ--DPVAYD-SGVT  402
            +AGA SALFLLD+KGRVLVWRDYRGDV+A QAERFFTKLL+ EGD +   PV +D +GV+
Sbjct  50   VAGAVSALFLLDIKGRVLVWRDYRGDVTALQAERFFTKLLDKEGDAEVHSPVVHDGAGVS  109

Query  403  YMFIQHNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVV------  564
            Y FIQHNNV+L+ A+RQNCNAAS+LLFLHR+VDVFKHYFEELEEESLRDNFVVV      
Sbjct  110  YTFIQHNNVFLLTAARQNCNAASILLFLHRLVDVFKHYFEELEEESLRDNFVVVGLMDAL  169

Query  565  ----YELLDEIMDFGYPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYK  732
                YELLDE+MDFGYPQ+TEA ILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGI YK
Sbjct  170  CSAQYELLDEMMDFGYPQYTEATILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGIRYK  229

Query  733  KNE-----------------------------VFLDVVESVNILVNSNGQIVRS  807
            KNE                             VFLDVVESVNILVNSNGQIVRS
Sbjct  230  KNEVRYITPLPLFTLVHFDGYVMGKLLARVSQVFLDVVESVNILVNSNGQIVRS  283



>ref|XP_009609076.1| PREDICTED: AP-1 complex subunit mu-2-like isoform X2 [Nicotiana 
tomentosiformis]
Length=421

 Score =   319 bits (818),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 156/194 (80%), Positives = 171/194 (88%), Gaps = 9/194 (5%)
 Frame = +1

Query  232  MAGAASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGDPQD--PVAYDSGVTY  405
            MAGA SALFLLD+KGR L+ RDYRGDVSA Q E+FF+KLLE EGD +   PV Y++GV Y
Sbjct  1    MAGATSALFLLDMKGRCLICRDYRGDVSAQQVEKFFSKLLEKEGDVESDGPVCYENGVNY  60

Query  406  MFIQHNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEI  585
            MFIQHNN+YLM ASRQN NAASLLLFLHRVVDVFKHYFEE+EEESLRDNFVVVYELLDE+
Sbjct  61   MFIQHNNIYLMAASRQNSNAASLLLFLHRVVDVFKHYFEEVEEESLRDNFVVVYELLDEM  120

Query  586  MDFGYPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVES  765
            MDFGYPQ+TEAKILSEFIKTDAYRMEVTQ PPMAVTNAVSWRSEG       V+LDVVE 
Sbjct  121  MDFGYPQYTEAKILSEFIKTDAYRMEVTQHPPMAVTNAVSWRSEG-------VYLDVVEH  173

Query  766  VNILVNSNGQIVRS  807
            VN+LVNSNGQ++RS
Sbjct  174  VNLLVNSNGQLIRS  187



>ref|XP_004241506.1| PREDICTED: AP-1 complex subunit mu-2-like [Solanum lycopersicum]
 ref|XP_010322540.1| PREDICTED: AP-1 complex subunit mu-2-like [Solanum lycopersicum]
Length=428

 Score =   319 bits (818),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 153/194 (79%), Positives = 171/194 (88%), Gaps = 2/194 (1%)
 Frame = +1

Query  232  MAGAASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGDPQD--PVAYDSGVTY  405
            MAGA SALFLLD+KGR L+ RDYRGDVSA Q E+FFTK LE E D +   P+ +++GV Y
Sbjct  1    MAGAISALFLLDMKGRCLISRDYRGDVSAQQVEKFFTKHLEKEDDLESDGPICHENGVNY  60

Query  406  MFIQHNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEI  585
            MFIQH N+YLM AS+QN NAASLL FLHRVVDVFKHYFEELEEESLRDNFVVVYELLDE+
Sbjct  61   MFIQHKNIYLMAASKQNSNAASLLFFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEM  120

Query  586  MDFGYPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVES  765
            MDFGYPQ+TEAKILSEFIKTDAYRMEV Q PPMAVTNAVSWRSEG+ +K NEV+LDVVE 
Sbjct  121  MDFGYPQYTEAKILSEFIKTDAYRMEVNQHPPMAVTNAVSWRSEGVYHKNNEVYLDVVEH  180

Query  766  VNILVNSNGQIVRS  807
            VN+LVNSNGQ++RS
Sbjct  181  VNLLVNSNGQLIRS  194



>ref|XP_009772293.1| PREDICTED: AP-1 complex subunit mu-2-like isoform X2 [Nicotiana 
sylvestris]
Length=421

 Score =   317 bits (812),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 156/194 (80%), Positives = 168/194 (87%), Gaps = 9/194 (5%)
 Frame = +1

Query  232  MAGAASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGD--PQDPVAYDSGVTY  405
            MAGA SALFLLD+KGR L+ RDYRGDVSA Q E+FF+KLLE EGD     PV Y++GV Y
Sbjct  1    MAGATSALFLLDMKGRCLISRDYRGDVSAQQVEKFFSKLLEKEGDVESHGPVCYENGVNY  60

Query  406  MFIQHNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEI  585
            MFIQHNN+YLM ASRQN NAASLL FLHRVVDVFKHYFEELEEESLRDNFVVVYELLDE+
Sbjct  61   MFIQHNNIYLMAASRQNSNAASLLFFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEM  120

Query  586  MDFGYPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVES  765
            MDFGYPQ+TEAKILSEFIKTDAYRMEVTQ PPMAVTNAVSWRSEG       V+LDVVE 
Sbjct  121  MDFGYPQYTEAKILSEFIKTDAYRMEVTQHPPMAVTNAVSWRSEG-------VYLDVVEH  173

Query  766  VNILVNSNGQIVRS  807
            VN+LVNSNGQ +RS
Sbjct  174  VNLLVNSNGQSIRS  187



>gb|AAF17661.1|AC009398_10 F20B24.16 [Arabidopsis thaliana]
Length=411

 Score =   314 bits (805),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 153/194 (79%), Positives = 166/194 (86%), Gaps = 23/194 (12%)
 Frame = +1

Query  232  MAGAASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGDPQ--DPVAYDSGVTY  405
            MAGAASALFLLD+KGRVLVWRDYRGDV+A QAERFFTKL+E EGD Q  DPVAYD+GVTY
Sbjct  1    MAGAASALFLLDIKGRVLVWRDYRGDVTAAQAERFFTKLIETEGDSQSNDPVAYDNGVTY  60

Query  406  MFIQHNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEI  585
            MF+QH+N+YLMIASRQNCNAASLL FLHRVVD                     YELLDE+
Sbjct  61   MFVQHSNIYLMIASRQNCNAASLLFFLHRVVD---------------------YELLDEM  99

Query  586  MDFGYPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVES  765
            MDFGYPQFTEA+ILSEFIKTDAYRMEVTQRPPMAVTN+VSWRSEG+ +KKNEVFLDV+ES
Sbjct  100  MDFGYPQFTEARILSEFIKTDAYRMEVTQRPPMAVTNSVSWRSEGLKFKKNEVFLDVIES  159

Query  766  VNILVNSNGQIVRS  807
            VNILVNSNGQIVRS
Sbjct  160  VNILVNSNGQIVRS  173



>ref|XP_005646699.1| Mu1-adaptin [Coccomyxa subellipsoidea C-169]
 gb|EIE22155.1| Mu1-adaptin [Coccomyxa subellipsoidea C-169]
Length=393

 Score =   285 bits (728),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 136/190 (72%), Positives = 163/190 (86%), Gaps = 1/190 (1%)
 Frame = +1

Query  241  AASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLE-NEGDPQDPVAYDSGVTYMFIQ  417
            AASA+F+LD+KG V+++RDYRGDV    AERF TKL E  E     P+  D GV+Y+++Q
Sbjct  2    AASAVFILDLKGHVILFRDYRGDVPIKYAERFITKLNELEETGKVTPIILDEGVSYLYVQ  61

Query  418  HNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEIMDFG  597
            ++N+YL+I SR+N NAAS+LLFLH++ +VF HYF ELEEESLRDNFV+ YELLDE+MD+G
Sbjct  62   YSNLYLLIVSRENVNAASMLLFLHKLREVFVHYFNELEEESLRDNFVIAYELLDEVMDYG  121

Query  598  YPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVESVNIL  777
            YPQFTEAKILSEFIKTDA++MEV  RPPMAVTNAVSWRSEGI YKKNEVFLDVVESVN+L
Sbjct  122  YPQFTEAKILSEFIKTDAHKMEVQARPPMAVTNAVSWRSEGIRYKKNEVFLDVVESVNLL  181

Query  778  VNSNGQIVRS  807
            VNSNG +VRS
Sbjct  182  VNSNGTVVRS  191



>gb|KFK43362.1| hypothetical protein AALP_AA1G116200 [Arabis alpina]
Length=238

 Score =   278 bits (710),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 129/143 (90%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = +1

Query  379  VAYDSGVTYMFIQHNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFV  558
            +AYD+GVTYMF+QH+N+YLMIASRQNCNA SLL FLHRVVDVFKHYFEELEEESLRDNFV
Sbjct  1    MAYDNGVTYMFVQHSNIYLMIASRQNCNAVSLLFFLHRVVDVFKHYFEELEEESLRDNFV  60

Query  559  VVYELLDEIMDFGYPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKN  738
            VVYELLDE+MDFGYPQ+TEA+ILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEG+ +KKN
Sbjct  61   VVYELLDEMMDFGYPQYTEARILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGLQFKKN  120

Query  739  EVFLDVVESVNILVNSNGQIVRS  807
            EVFLDV+ESVNILVNSNGQIVRS
Sbjct  121  EVFLDVIESVNILVNSNGQIVRS  143



>gb|EPS63543.1| hypothetical protein M569_11241, partial [Genlisea aurea]
Length=174

 Score =   275 bits (704),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 132/174 (76%), Positives = 150/174 (86%), Gaps = 3/174 (2%)
 Frame = +1

Query  232  MAGAASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGDPQDP--VAYDSGVTY  405
            M GAASALF+LD+KGR L+ RDYRGDVSA++ E  F K+L+ EGD   P  V +++GV+Y
Sbjct  1    MTGAASALFVLDIKGRCLISRDYRGDVSASEVENLFAKILDKEGDSDSPGPVCHENGVSY  60

Query  406  MFIQHNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEI  585
            +FIQ  NVYL+IASRQNCNAASL+ FLHRVV+VF+HYFEELEEESLRDNFVVVYELLDEI
Sbjct  61   IFIQRKNVYLVIASRQNCNAASLIFFLHRVVEVFRHYFEELEEESLRDNFVVVYELLDEI  120

Query  586  MDFGYPQFTEAKILSEFIKTDAYRME-VTQRPPMAVTNAVSWRSEGINYKKNEV  744
            MDFGYPQ+TEAKIL EFIK DAYRME V QRPPMAVTNAVSWR EGI Y+ NEV
Sbjct  121  MDFGYPQYTEAKILGEFIKADAYRMEHVLQRPPMAVTNAVSWRGEGIFYRTNEV  174



>ref|XP_001696311.1| Mu1-Adaptin [Chlamydomonas reinhardtii]
 gb|EDP08288.1| Mu1-Adaptin [Chlamydomonas reinhardtii]
Length=425

 Score =   283 bits (723),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 132/190 (69%), Positives = 162/190 (85%), Gaps = 1/190 (1%)
 Frame = +1

Query  241  AASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLE-NEGDPQDPVAYDSGVTYMFIQ  417
            A SA+F LD+KGR++++RDYRGDVS   AE+F +K+ E  E     PV YD GVTY+++Q
Sbjct  2    AISAIFFLDIKGRIIIFRDYRGDVSPKYAEKFMSKINEMEEAGKLSPVIYDEGVTYLYLQ  61

Query  418  HNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEIMDFG  597
             +N+YL+  +R N NA S L+FLHR+VDVFKHYF+ELEEESLRDNFV+VYELLDE+MDFG
Sbjct  62   VSNLYLLAVTRTNVNACSTLVFLHRMVDVFKHYFQELEEESLRDNFVIVYELLDEVMDFG  121

Query  598  YPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVESVNIL  777
            YPQFTEAKIL+E+IKTDAY+MEV  +PPMAVTNAVSWR EGI +KKNEVFLDVVESVN+L
Sbjct  122  YPQFTEAKILAEYIKTDAYKMEVAVKPPMAVTNAVSWRMEGIRHKKNEVFLDVVESVNLL  181

Query  778  VNSNGQIVRS  807
            V+S+GQ+V S
Sbjct  182  VSSSGQVVLS  191



>ref|XP_002945806.1| hypothetical protein VOLCADRAFT_108841 [Volvox carteri f. nagariensis]
 gb|EFJ52801.1| hypothetical protein VOLCADRAFT_108841 [Volvox carteri f. nagariensis]
Length=425

 Score =   282 bits (721),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 132/190 (69%), Positives = 160/190 (84%), Gaps = 1/190 (1%)
 Frame = +1

Query  241  AASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLE-NEGDPQDPVAYDSGVTYMFIQ  417
            A SA+F LD+KGR++++RDYRGDVS   AE+F +K+ E  E     PV YD GVTY+++Q
Sbjct  2    AISAIFFLDIKGRIIIFRDYRGDVSPKYAEKFMSKINEMEEAGKLSPVIYDDGVTYLYLQ  61

Query  418  HNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEIMDFG  597
              N+YL+  +R N NA S L+FLHR+VDVF+HYF+ELEEESLRDNFV+VYELLDE+MDFG
Sbjct  62   VANLYLLAVTRTNVNACSTLVFLHRLVDVFRHYFQELEEESLRDNFVIVYELLDEVMDFG  121

Query  598  YPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVESVNIL  777
            YPQFTEAKIL+E+IKTDAYRME T +PPMAVTNAVSWR EGI +KKNEVFLDVVESVN+L
Sbjct  122  YPQFTEAKILAEYIKTDAYRMEATVKPPMAVTNAVSWRMEGIRHKKNEVFLDVVESVNLL  181

Query  778  VNSNGQIVRS  807
            V+S GQ+V S
Sbjct  182  VSSTGQVVLS  191



>gb|KIZ03697.1| AP-1 complex subunit mu-1 [Monoraphidium neglectum]
Length=426

 Score =   280 bits (717),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 136/192 (71%), Positives = 164/192 (85%), Gaps = 4/192 (2%)
 Frame = +1

Query  241  AASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKL--LENEGDPQDPVAYDSGVTYMFI  414
            + SALFLLDVKGR L++RDYRG+VS   AE+F  K+  LE+ G    P+ +D GVTY+++
Sbjct  2    SVSALFLLDVKGRPLIYRDYRGEVSTKHAEKFIMKINELEDAGK-LSPIIHDDGVTYIYL  60

Query  415  QHNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEIMDF  594
             H NVYL+  +R N NAAS+++FLHR+VDVFKHYFEELEEES+RDNFVVVYELLDE+MD+
Sbjct  61   LHVNVYLLAVTRDNVNAASIVVFLHRLVDVFKHYFEELEEESIRDNFVVVYELLDEVMDY  120

Query  595  GYPQFTEAKILSEFIKTDAYRMEVTQ-RPPMAVTNAVSWRSEGINYKKNEVFLDVVESVN  771
            GYPQFTEA+ILSE+IKTDAYRMEV   +PPMAVTNAVSWRSEGI +KKNEVFLDVVESVN
Sbjct  121  GYPQFTEARILSEYIKTDAYRMEVAAVKPPMAVTNAVSWRSEGIRHKKNEVFLDVVESVN  180

Query  772  ILVNSNGQIVRS  807
            +LV S+GQ+V S
Sbjct  181  LLVGSSGQVVSS  192



>ref|XP_008792874.1| PREDICTED: AP-1 complex subunit mu-2-like [Phoenix dactylifera]
Length=708

 Score =   285 bits (728),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 135/152 (89%), Positives = 144/152 (95%), Gaps = 2/152 (1%)
 Frame = +1

Query  358  EGDPQD--PVAYDSGVTYMFIQHNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELE  531
            + DP+   PV  D+GVTYMFIQHNNV+LM A+RQNCNAAS+LLFLHRVVDVFKHYFEELE
Sbjct  323  QADPESHSPVVLDNGVTYMFIQHNNVFLMTAARQNCNAASILLFLHRVVDVFKHYFEELE  382

Query  532  EESLRDNFVVVYELLDEIMDFGYPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWR  711
            EESLRDNFVVVYELLDE+MDFGYPQ+TEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWR
Sbjct  383  EESLRDNFVVVYELLDEMMDFGYPQYTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWR  442

Query  712  SEGINYKKNEVFLDVVESVNILVNSNGQIVRS  807
            SEGI YKKNEVFLDVVESVNILVNSNGQI+RS
Sbjct  443  SEGIRYKKNEVFLDVVESVNILVNSNGQIIRS  474



>gb|KJB50248.1| hypothetical protein B456_008G160500 [Gossypium raimondii]
Length=368

 Score =   269 bits (688),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 127/134 (95%), Positives = 132/134 (99%), Gaps = 0/134 (0%)
 Frame = +1

Query  406  MFIQHNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEI  585
            MF+QH+NVYLM A+RQNCNAASLL FLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEI
Sbjct  1    MFVQHSNVYLMTATRQNCNAASLLFFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEI  60

Query  586  MDFGYPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVES  765
            MDFGYPQ+TEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVES
Sbjct  61   MDFGYPQYTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVES  120

Query  766  VNILVNSNGQIVRS  807
            VNILVNSNGQI+RS
Sbjct  121  VNILVNSNGQIIRS  134



>gb|KFH62196.1| AP-1 complex subunit mu-1 [Mortierella verticillata NRRL 6337]
Length=439

 Score =   261 bits (666),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 118/194 (61%), Positives = 156/194 (80%), Gaps = 2/194 (1%)
 Frame = +1

Query  232  MAGAASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGDPQDPVAY--DSGVTY  405
            MA A SA+F+LD+KG+VL+ R+YRGD+  +  E+F   +LE E D Q P     D G+ Y
Sbjct  1    MASAVSAIFILDLKGKVLISRNYRGDIPMSAVEKFLPLVLEAEEDSQAPAPCFTDDGINY  60

Query  406  MFIQHNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEI  585
            ++I+HNN++L+  +R+N NA +++LFLH + +V   YF+ELEEES+RDNFV++YELLDE+
Sbjct  61   LYIRHNNLFLLAITRKNSNATTVMLFLHTIAEVLTEYFKELEEESIRDNFVIIYELLDEM  120

Query  586  MDFGYPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVES  765
            MDFGYPQ TE+KIL E+I  DAY++EV  RPPMAVTNAVSWRSEGI Y+KNEVFLDVVES
Sbjct  121  MDFGYPQTTESKILQEYITQDAYKLEVQVRPPMAVTNAVSWRSEGIRYRKNEVFLDVVES  180

Query  766  VNILVNSNGQIVRS  807
            VN+LVN+NG ++RS
Sbjct  181  VNLLVNANGNVLRS  194



>ref|XP_011397983.1| AP-1 complex subunit mu-1-I [Auxenochlorella protothecoides]
 gb|KFM25095.1| AP-1 complex subunit mu-1-I [Auxenochlorella protothecoides]
Length=422

 Score =   260 bits (664),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 120/188 (64%), Positives = 153/188 (81%), Gaps = 1/188 (1%)
 Frame = +1

Query  247  SALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLE-NEGDPQDPVAYDSGVTYMFIQHN  423
            SALFLLD KG+ ++ RDYRGD+     +RF TKL E  E     PV  D G  ++F+Q++
Sbjct  5    SALFLLDSKGKPVLSRDYRGDIPLRAVDRFITKLNEVEETGKSSPVLVDDGTCFVFVQYS  64

Query  424  NVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEIMDFGYP  603
            N+YL+  SR N NAA++L+FLH+++++FK YF ELEEESLRDNFV+ YELLDE+MD+GYP
Sbjct  65   NLYLLAMSRTNVNAAAILVFLHKLIEIFKQYFTELEEESLRDNFVIAYELLDEVMDYGYP  124

Query  604  QFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVESVNILVN  783
            QFTE KILSE+IKTDA+++ +  RPPMAVTNAVSWR+EG+ YKKNEVFLDVVE+VN+LVN
Sbjct  125  QFTEGKILSEYIKTDAHKLAIQPRPPMAVTNAVSWRTEGLVYKKNEVFLDVVEAVNLLVN  184

Query  784  SNGQIVRS  807
            SNG +VRS
Sbjct  185  SNGSVVRS  192



>ref|XP_011071917.1| PREDICTED: AP-1 complex subunit mu-2-like isoform X2 [Sesamum 
indicum]
Length=368

 Score =   258 bits (658),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 122/134 (91%), Positives = 128/134 (96%), Gaps = 0/134 (0%)
 Frame = +1

Query  406  MFIQHNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEI  585
            MFIQH+NVYLM ASRQNCN ASLL FLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEI
Sbjct  1    MFIQHSNVYLMTASRQNCNVASLLFFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEI  60

Query  586  MDFGYPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVES  765
            MDFGYPQ+TEAKILSEFIKTDAY+ME TQRPPMAVTNAVSWRSEG+ Y+ NEVFLDVVES
Sbjct  61   MDFGYPQYTEAKILSEFIKTDAYKMEGTQRPPMAVTNAVSWRSEGVVYRTNEVFLDVVES  120

Query  766  VNILVNSNGQIVRS  807
            VNILVNSNGQI+RS
Sbjct  121  VNILVNSNGQIIRS  134



>gb|EPB91853.1| hypothetical protein HMPREF1544_01362 [Mucor circinelloides f. 
circinelloides 1006PhL]
Length=225

 Score =   252 bits (644),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 116/190 (61%), Positives = 155/190 (82%), Gaps = 3/190 (2%)
 Frame = +1

Query  244  ASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGDPQDPVAY--DSGVTYMFIQ  417
            ASA+F+LD+KG+VL+ R+YRGD+  +  E+F   + E E D Q P+      G+ Y++++
Sbjct  2    ASAIFILDLKGKVLISRNYRGDIPMSAVEKFMPLISEAE-DEQIPLPCFTHEGINYLYLK  60

Query  418  HNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEIMDFG  597
            H+N+YL+  +R+N NAAS++L+LH++ +VF  YF+ELEEES+RDNFV+VYELLDE+MDFG
Sbjct  61   HSNLYLLAITRKNTNAASIMLYLHKLTEVFSEYFKELEEESIRDNFVIVYELLDEMMDFG  120

Query  598  YPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVESVNIL  777
            YPQ TE KIL E+I  DA+++EV  RPPMAVTNAVSWRSEGI YKKNEVFLDV+ESVN+L
Sbjct  121  YPQTTETKILQEYITQDAHKLEVQVRPPMAVTNAVSWRSEGIKYKKNEVFLDVIESVNLL  180

Query  778  VNSNGQIVRS  807
            VNSNG ++RS
Sbjct  181  VNSNGNVLRS  190



>gb|EMT15970.1| AP-1 complex subunit mu-1 [Aegilops tauschii]
Length=406

 Score =   256 bits (655),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 133/192 (69%), Positives = 141/192 (73%), Gaps = 47/192 (24%)
 Frame = +1

Query  232  MAGAASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGDPQDPVAYDSGVTYMF  411
            MAGA SALFLLD+KGRVLVWRD+RGDV+A QAERFFTKLL+ E                 
Sbjct  1    MAGAVSALFLLDIKGRVLVWRDFRGDVTAVQAERFFTKLLDKE-----------------  43

Query  412  IQHNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEIMD  591
                                          VFKHYFEELEEESLRDNFVVVYELLDE+MD
Sbjct  44   ------------------------------VFKHYFEELEEESLRDNFVVVYELLDEMMD  73

Query  592  FGYPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVESVN  771
            FGYPQ+TEAKILSEFIKTDAY+MEV+QRPPMAVTNAVSWRSEGI YKKNEVFLDVVESVN
Sbjct  74   FGYPQYTEAKILSEFIKTDAYKMEVSQRPPMAVTNAVSWRSEGIRYKKNEVFLDVVESVN  133

Query  772  ILVNSNGQIVRS  807
            ILVNSNGQIVRS
Sbjct  134  ILVNSNGQIVRS  145



>gb|EMS61432.1| AP-1 complex subunit mu-1 [Triticum urartu]
Length=420

 Score =   254 bits (649),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 132/192 (69%), Positives = 140/192 (73%), Gaps = 47/192 (24%)
 Frame = +1

Query  232  MAGAASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGDPQDPVAYDSGVTYMF  411
            MAGA SALFLLD+KGRVLVWRD+RGDV+A QAERFFTKLL+ E                 
Sbjct  1    MAGAVSALFLLDIKGRVLVWRDFRGDVTAVQAERFFTKLLDKE-----------------  43

Query  412  IQHNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEIMD  591
                                          VF HYFEELEEESLRDNFVVVYELLDE+MD
Sbjct  44   ------------------------------VFNHYFEELEEESLRDNFVVVYELLDEMMD  73

Query  592  FGYPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVESVN  771
            FGYPQ+TEAKILSEFIKTDAY+MEV+QRPPMAVTNAVSWRSEGI YKKNEVFLDVVESVN
Sbjct  74   FGYPQYTEAKILSEFIKTDAYKMEVSQRPPMAVTNAVSWRSEGIRYKKNEVFLDVVESVN  133

Query  772  ILVNSNGQIVRS  807
            ILVNSNGQIVRS
Sbjct  134  ILVNSNGQIVRS  145



>ref|XP_006680441.1| hypothetical protein BATDEDRAFT_37174 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF78864.1| hypothetical protein BATDEDRAFT_37174 [Batrachochytrium dendrobatidis 
JAM81]
Length=438

 Score =   254 bits (650),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 114/191 (60%), Positives = 159/191 (83%), Gaps = 3/191 (2%)
 Frame = +1

Query  244  ASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGDPQDP---VAYDSGVTYMFI  414
            ASA+F+LD+KG+VL+ R+YRGD+  T  ++F + +LE E + Q P   ++ D G+ Y++I
Sbjct  3    ASAVFILDLKGKVLISRNYRGDIPMTAIDKFMSLILEVEEEQQTPSPVISSDDGINYLYI  62

Query  415  QHNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEIMDF  594
            +HNN++L+  +++N NAA++LLFLH++ +VF  YF+ELEEES+RDNFV++YELLDE+MDF
Sbjct  63   RHNNLFLVAITKKNSNAATILLFLHKLCEVFAEYFKELEEESIRDNFVIIYELLDEMMDF  122

Query  595  GYPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVESVNI  774
            GYPQ TE+KIL E+I  ++Y++E   RPPMAVTNAVSWRSEG+ Y+KNEVFLDVVESVN+
Sbjct  123  GYPQTTESKILQEYITQESYKLEKQARPPMAVTNAVSWRSEGLKYRKNEVFLDVVESVNL  182

Query  775  LVNSNGQIVRS  807
            LVN+NG +VRS
Sbjct  183  LVNANGNVVRS  193



>emb|CDS06625.1| Putative AP-1 complex subunit mu-1 [Absidia idahoensis var. thermophila]
Length=436

 Score =   251 bits (641),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 116/190 (61%), Positives = 155/190 (82%), Gaps = 3/190 (2%)
 Frame = +1

Query  244  ASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGDPQDPVAY--DSGVTYMFIQ  417
            ASA+F+LD+KG+VL+ R+YRGD+  +  E+F   + E E D Q P+      G++Y++++
Sbjct  2    ASAVFILDLKGKVLISRNYRGDIPMSAVEKFMPLVSEAE-DEQVPLPCFTHDGISYLYLK  60

Query  418  HNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEIMDFG  597
            H+N+YL+  +R+N NAAS++L+LH++  VF  YF+ELEEES+RDNFV+VYELLDE+MDFG
Sbjct  61   HSNLYLLALTRKNTNAASIMLYLHKLTQVFSEYFKELEEESIRDNFVIVYELLDEMMDFG  120

Query  598  YPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVESVNIL  777
            YPQ TE KIL E+I  DAY++EV  RPPMAVTNAVSWRSEGI YKKNEVFLDV+ESVN+L
Sbjct  121  YPQTTETKILQEYITQDAYKLEVQVRPPMAVTNAVSWRSEGIKYKKNEVFLDVIESVNLL  180

Query  778  VNSNGQIVRS  807
            VN+NG ++RS
Sbjct  181  VNANGNVLRS  190



>emb|CDH59177.1| ap-1 complex subunit mu-1 [Lichtheimia corymbifera JMRC:FSU:9682]
Length=436

 Score =   251 bits (641),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 116/190 (61%), Positives = 155/190 (82%), Gaps = 3/190 (2%)
 Frame = +1

Query  244  ASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGDPQDPVAY--DSGVTYMFIQ  417
            ASA+F+LD+KG+VL+ R+YRGD+  +  E+F   + E E D Q P+      G++Y++++
Sbjct  2    ASAVFILDLKGKVLISRNYRGDIPMSAVEKFMPLVSEAE-DEQVPLPCFTHDGISYLYLK  60

Query  418  HNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEIMDFG  597
            H+N+YL+  +R+N NAAS++L+LH++  VF  YF+ELEEES+RDNFV+VYELLDE+MDFG
Sbjct  61   HSNLYLLALTRKNTNAASIMLYLHKLTQVFSEYFKELEEESIRDNFVIVYELLDEMMDFG  120

Query  598  YPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVESVNIL  777
            YPQ TE KIL E+I  DAY++EV  RPPMAVTNAVSWRSEGI YKKNEVFLDV+ESVN+L
Sbjct  121  YPQTTETKILQEYITQDAYKLEVQVRPPMAVTNAVSWRSEGIKYKKNEVFLDVIESVNLL  180

Query  778  VNSNGQIVRS  807
            VN+NG ++RS
Sbjct  181  VNANGNVLRS  190



>dbj|GAN07517.1| clathrin adaptor, mu subunit [Mucor ambiguus]
 emb|CEP15247.1| hypothetical protein [Parasitella parasitica]
Length=438

 Score =   251 bits (641),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 116/190 (61%), Positives = 155/190 (82%), Gaps = 3/190 (2%)
 Frame = +1

Query  244  ASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGDPQDPVAY--DSGVTYMFIQ  417
            ASA+F+LD+KG+VL+ R+YRGD+  +  E+F   + E E D Q P+      G+ Y++++
Sbjct  2    ASAIFILDLKGKVLISRNYRGDIPMSAVEKFMPLISEAE-DEQIPLPCFTHEGINYLYLK  60

Query  418  HNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEIMDFG  597
            H+N+YL+  +R+N NAAS++L+LH++ +VF  YF+ELEEES+RDNFV+VYELLDE+MDFG
Sbjct  61   HSNLYLLAITRKNTNAASIMLYLHKLTEVFSEYFKELEEESIRDNFVIVYELLDEMMDFG  120

Query  598  YPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVESVNIL  777
            YPQ TE KIL E+I  DA+++EV  RPPMAVTNAVSWRSEGI YKKNEVFLDV+ESVN+L
Sbjct  121  YPQTTETKILQEYITQDAHKLEVQVRPPMAVTNAVSWRSEGIKYKKNEVFLDVIESVNLL  180

Query  778  VNSNGQIVRS  807
            VNSNG ++RS
Sbjct  181  VNSNGNVLRS  190



>emb|CCG83138.1| putative AP-1 adaptor complex subunit mu [Taphrina deformans 
PYCC 5710]
Length=424

 Score =   249 bits (637),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 116/189 (61%), Positives = 152/189 (80%), Gaps = 1/189 (1%)
 Frame = +1

Query  244  ASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGD-PQDPVAYDSGVTYMFIQH  420
            AS+LF LD+KG+ L+ R+YRGD++ +  E+F   L E E +  Q PV  DSG+ Y++I+H
Sbjct  2    ASSLFFLDLKGKTLLSRNYRGDIAMSAVEKFMPLLAEQEEEGTQSPVFTDSGINYLYIKH  61

Query  421  NNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEIMDFGY  600
            NN+YL+  +R+N NA  +L FLH+VV VF  YF+ELEEES+RDNFVV+YELLDE+MDFG+
Sbjct  62   NNLYLLALTRRNSNAFEILQFLHKVVQVFTEYFKELEEESIRDNFVVIYELLDEMMDFGH  121

Query  601  PQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVESVNILV  780
            PQ TE KIL E+I  +++R+EV  RPP+A+TNAVSWRSEGI Y+KNEVFLDVVESVN+LV
Sbjct  122  PQTTETKILQEYITQESHRLEVQARPPIAMTNAVSWRSEGIRYRKNEVFLDVVESVNLLV  181

Query  781  NSNGQIVRS  807
            +S G +VRS
Sbjct  182  SSTGNVVRS  190



>gb|EXX50896.1| Apm1p [Rhizophagus irregularis DAOM 197198w]
Length=436

 Score =   250 bits (638),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 112/190 (59%), Positives = 154/190 (81%), Gaps = 2/190 (1%)
 Frame = +1

Query  244  ASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGDPQDPVAY--DSGVTYMFIQ  417
            ASA+F+LD+KG+VL+ R+YRGD+  +  E+F   +LE E + Q P       GV Y++I+
Sbjct  2    ASAVFVLDLKGKVLISRNYRGDIPMSAVEKFMPLVLEAEEEQQAPTPCFTHEGVNYLYIR  61

Query  418  HNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEIMDFG  597
            HNN+YL+  +++N NA ++LLFLH++ +VF  YF+ELEEES+RDNFV++YELLDE+MDFG
Sbjct  62   HNNLYLLAITKKNSNATTILLFLHKLTEVFTEYFKELEEESIRDNFVIIYELLDEMMDFG  121

Query  598  YPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVESVNIL  777
            YPQ TE KIL E+I  +++++E+  RPPMAVTNAVSWRSEGI Y+KNEVFLDV+ESVN+L
Sbjct  122  YPQTTETKILQEYITQESHKLEIQVRPPMAVTNAVSWRSEGIKYRKNEVFLDVIESVNLL  181

Query  778  VNSNGQIVRS  807
            VN+NG ++RS
Sbjct  182  VNANGNVLRS  191



>emb|CEG74228.1| Putative Clathrin adaptor, mu subunit [Rhizopus microsporus]
 emb|CEJ00993.1| Putative Clathrin adaptor, mu subunit [Rhizopus microsporus]
 emb|CEI93455.1| Putative Clathrin adaptor, mu subunit [Rhizopus microsporus]
Length=436

 Score =   249 bits (637),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 115/190 (61%), Positives = 155/190 (82%), Gaps = 3/190 (2%)
 Frame = +1

Query  244  ASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGDPQDPVAY--DSGVTYMFIQ  417
            ASA+F+LD+KG+VL+ R+YRGD+  +  E+F   + E E D Q P+      G+ Y++++
Sbjct  2    ASAIFILDLKGKVLISRNYRGDIPMSAVEKFMPLVSEAE-DEQVPLPCFTHEGINYLYLK  60

Query  418  HNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEIMDFG  597
            H+N+YL+  +R+N NAAS++L+LH++ +VF  YF+ELEEES+RDNFV+VYELLDE+MDFG
Sbjct  61   HSNLYLLALTRKNTNAASIMLYLHKLTEVFTEYFKELEEESIRDNFVIVYELLDEMMDFG  120

Query  598  YPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVESVNIL  777
            YPQ TE KIL E+I  DA+++EV  RPPMAVTNAVSWRSEGI YKKNEVFLDV+ESVN+L
Sbjct  121  YPQTTETKILQEYITQDAHKLEVQVRPPMAVTNAVSWRSEGIKYKKNEVFLDVIESVNLL  180

Query  778  VNSNGQIVRS  807
            VN+NG ++RS
Sbjct  181  VNANGNVLRS  190



>gb|KDD76988.1| adaptor complexes medium subunit domain-containing protein, partial 
[Helicosporidium sp. ATCC 50920]
Length=871

 Score =   258 bits (660),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 123/191 (64%), Positives = 151/191 (79%), Gaps = 1/191 (1%)
 Frame = +1

Query  238  GAASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGDPQ-DPVAYDSGVTYMFI  414
             A SAL LLD KG+ ++ RDYRGD+    AERF  +L E E      PV  D GV++++I
Sbjct  2    AAVSALLLLDSKGKPVLSRDYRGDIPLKTAERFIGRLNEAEESASVSPVLEDEGVSFVWI  61

Query  415  QHNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEIMDF  594
             H+N+YL+  +R N NAA++L+FLH +V +F+ YF ELEEESLRDNFV+ YELLDE+MD 
Sbjct  62   SHSNLYLVAMARTNVNAAAVLVFLHALVAIFRQYFSELEEESLRDNFVIAYELLDEVMDH  121

Query  595  GYPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVESVNI  774
            GYPQFTE +IL+E+IKTDAYR+ V  RPPMAVTNAVSWRSEGI YKKNEVFLDVVE+VN+
Sbjct  122  GYPQFTEGRILAEYIKTDAYRLAVQPRPPMAVTNAVSWRSEGIYYKKNEVFLDVVEAVNL  181

Query  775  LVNSNGQIVRS  807
            LVNSNG +VRS
Sbjct  182  LVNSNGAVVRS  192



>gb|KDO82239.1| hypothetical protein CISIN_1g014235mg [Citrus sinensis]
Length=250

 Score =   243 bits (619),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 116/124 (94%), Positives = 119/124 (96%), Gaps = 0/124 (0%)
 Frame = +1

Query  436  MIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEIMDFGYPQFTE  615
            M ASRQNCNAASLL FLHRVVDVFKHYFEELEEESLRDNFVVVYELLDE+MDFGYPQ+TE
Sbjct  1    MTASRQNCNAASLLFFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEMMDFGYPQYTE  60

Query  616  AKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVESVNILVNSNGQ  795
            A ILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGI YKKNEVFLDVVE VNILVNSNGQ
Sbjct  61   ANILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGIQYKKNEVFLDVVEHVNILVNSNGQ  120

Query  796  IVRS  807
            I+RS
Sbjct  121  IIRS  124



>emb|CDS07968.1| Putative AP-1 complex subunit mu-1 [Absidia idahoensis var. thermophila]
Length=436

 Score =   248 bits (634),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 115/190 (61%), Positives = 154/190 (81%), Gaps = 3/190 (2%)
 Frame = +1

Query  244  ASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGDPQDPVAY--DSGVTYMFIQ  417
            ASA+F+LD+KG+VL+ R+YRGD+  +  E+F   + E E D Q P+      G+ Y++++
Sbjct  2    ASAVFILDLKGKVLISRNYRGDIPMSAVEKFMPLVSEAE-DEQVPLPCFTHDGINYLYLK  60

Query  418  HNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEIMDFG  597
            H+N+YL+  SR+N NAAS++L+LH++  VF  YF+ELEEES+RDNFV+VYELLDE+MDFG
Sbjct  61   HSNLYLLALSRKNTNAASIMLYLHKLTQVFSEYFKELEEESIRDNFVIVYELLDEMMDFG  120

Query  598  YPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVESVNIL  777
            YPQ TE KIL E+I  DAY++EV  RPPMAVTNAVSWRSEGI YKKNEVFLDV+ESVN++
Sbjct  121  YPQTTETKILQEYITQDAYKLEVQVRPPMAVTNAVSWRSEGIKYKKNEVFLDVIESVNLM  180

Query  778  VNSNGQIVRS  807
            VN++G ++RS
Sbjct  181  VNASGNVLRS  190



>emb|CDH49035.1| clathrin adaptor mu subunit [Lichtheimia corymbifera JMRC:FSU:9682]
Length=436

 Score =   248 bits (633),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 115/190 (61%), Positives = 154/190 (81%), Gaps = 3/190 (2%)
 Frame = +1

Query  244  ASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGDPQDPVAY--DSGVTYMFIQ  417
            ASA+F+LD+KG+VL+ R+YRGD+  +  E+F   + E E D Q P+      G+ Y++++
Sbjct  2    ASAVFILDLKGKVLISRNYRGDIPMSAVEKFMPLVSEAE-DEQVPLPCFTHDGINYLYLK  60

Query  418  HNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEIMDFG  597
            H+N+YL+  SR+N NAAS++L+LH++  VF  YF+ELEEES+RDNFV+VYELLDE+MDFG
Sbjct  61   HSNLYLLALSRKNTNAASIMLYLHKLTQVFSEYFKELEEESIRDNFVIVYELLDEMMDFG  120

Query  598  YPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVESVNIL  777
            YPQ TE KIL E+I  DAY++EV  RPPMAVTNAVSWRSEGI YKKNEVFLDV+ESVN++
Sbjct  121  YPQTTETKILQEYITQDAYKLEVQVRPPMAVTNAVSWRSEGIKYKKNEVFLDVIESVNLM  180

Query  778  VNSNGQIVRS  807
            VN++G ++RS
Sbjct  181  VNASGNVLRS  190



>gb|KFY73324.1| hypothetical protein V499_06584 [Pseudogymnoascus pannorum VKM 
F-103]
Length=350

 Score =   243 bits (621),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 112/190 (59%), Positives = 151/190 (79%), Gaps = 2/190 (1%)
 Frame = +1

Query  244  ASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKL--LENEGDPQDPVAYDSGVTYMFIQ  417
            ASA+F LD+KG+ L+ R+YRGD+  +  E+F   L   E E     P   D G+ Y++I+
Sbjct  2    ASAVFFLDLKGKTLLARNYRGDIPMSAVEKFPILLSDAEEESSAVPPCFSDEGINYLYIR  61

Query  418  HNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEIMDFG  597
            HNN+YL+  +++N NAA +LLFLH++V+VF  YF+ELEEES+RDNFVV+YELLDE+MDFG
Sbjct  62   HNNLYLLALTKRNTNAAEILLFLHKIVEVFTEYFKELEEESIRDNFVVIYELLDEMMDFG  121

Query  598  YPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVESVNIL  777
            YPQ TE+KIL E+I  +++++EV  RPP+AVTNAVSWRSEGI Y+KNEVFLDVVES+N+L
Sbjct  122  YPQTTESKILQEYITQESHKLEVQARPPIAVTNAVSWRSEGIRYRKNEVFLDVVESLNLL  181

Query  778  VNSNGQIVRS  807
            V+S G ++RS
Sbjct  182  VSSTGNVLRS  191



>ref|XP_011112119.1| hypothetical protein H072_6322 [Dactylellina haptotyla CBS 200.50]
 gb|EPS39882.1| hypothetical protein H072_6322 [Dactylellina haptotyla CBS 200.50]
Length=430

 Score =   245 bits (626),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 112/190 (59%), Positives = 150/190 (79%), Gaps = 2/190 (1%)
 Frame = +1

Query  244  ASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGDPQ--DPVAYDSGVTYMFIQ  417
            ASA+F LD+KG+ L+ R+YRGD+  +  E+F   LLE E +     P     G+ Y++I+
Sbjct  2    ASAIFFLDLKGKTLLARNYRGDIPMSAVEKFPVLLLEAEEESSAVPPCFSHEGINYLYIK  61

Query  418  HNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEIMDFG  597
            HNN+YL+  +++N NA  +LLFLH+VV VF  YF+ELEEES+RDNFV++YELLDE+MDFG
Sbjct  62   HNNLYLLALTKRNSNATEILLFLHKVVGVFTEYFKELEEESIRDNFVIIYELLDEMMDFG  121

Query  598  YPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVESVNIL  777
            YPQ TE KIL E+I  +++++EV  RPP+A+TNAVSWRSEGI Y+KNEVFLDV+ESVN+L
Sbjct  122  YPQTTETKILQEYITQESHKLEVQARPPIALTNAVSWRSEGIRYRKNEVFLDVIESVNLL  181

Query  778  VNSNGQIVRS  807
            VNSNG ++RS
Sbjct  182  VNSNGNVLRS  191



>emb|CCX32771.1| Similar to AP-1 complex subunit mu-1; acc. no. Q9HFE5 [Pyronema 
omphalodes CBS 100304]
Length=430

 Score =   245 bits (626),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 110/190 (58%), Positives = 152/190 (80%), Gaps = 2/190 (1%)
 Frame = +1

Query  244  ASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGDPQ--DPVAYDSGVTYMFIQ  417
            ASA+F LD+KG+ L+ R+YRGD+  +  E+F   LLE E +     P     G+ Y++I+
Sbjct  2    ASAIFFLDLKGKTLLARNYRGDIPMSAVEKFPMLLLEAEEESSAVPPCFSHEGINYLYIK  61

Query  418  HNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEIMDFG  597
            HNN+Y++  +++N NAA +LLFLH++V+VF  YF+ELEEES+RDNFV++YELLDE+MDFG
Sbjct  62   HNNLYVLAITKRNSNAAEILLFLHKIVEVFTEYFKELEEESIRDNFVIIYELLDEMMDFG  121

Query  598  YPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVESVNIL  777
            YPQ TE KIL E+I  +++++E+  RPP+AVTNAVSWRSEGI Y+KNEVFLDV+ES+N+L
Sbjct  122  YPQTTETKILQEYITQESHKLEIQARPPIAVTNAVSWRSEGIRYRKNEVFLDVIESLNLL  181

Query  778  VNSNGQIVRS  807
            VNSNG ++RS
Sbjct  182  VNSNGNVLRS  191



>gb|KFZ12382.1| hypothetical protein V501_04258, partial [Pseudogymnoascus pannorum 
VKM F-4519 (FW-2642)]
Length=372

 Score =   243 bits (621),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 112/190 (59%), Positives = 151/190 (79%), Gaps = 2/190 (1%)
 Frame = +1

Query  244  ASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKL--LENEGDPQDPVAYDSGVTYMFIQ  417
            ASA+F LD+KG+ L+ R+YRGD+  +  E+F   L   E E     P   D G+ Y++I+
Sbjct  2    ASAVFFLDLKGKTLLARNYRGDIPMSAVEKFPILLSDAEEESSAVPPCFSDEGINYLYIR  61

Query  418  HNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEIMDFG  597
            HNN+YL+  +++N NAA +LLFLH++V+VF  YF+ELEEES+RDNFVV+YELLDE+MDFG
Sbjct  62   HNNLYLLALTKRNTNAAEILLFLHKIVEVFTEYFKELEEESIRDNFVVIYELLDEMMDFG  121

Query  598  YPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVESVNIL  777
            YPQ TE+KIL E+I  +++++EV  RPP+AVTNAVSWRSEGI Y+KNEVFLDVVES+N+L
Sbjct  122  YPQTTESKILQEYITQESHKLEVQARPPIAVTNAVSWRSEGIRYRKNEVFLDVVESLNLL  181

Query  778  VNSNGQIVRS  807
            V+S G ++RS
Sbjct  182  VSSTGNVLRS  191



>gb|EWC47439.1| AP-1 complex subunit mu-1 [Drechslerella stenobrocha 248]
Length=442

 Score =   245 bits (625),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 112/190 (59%), Positives = 150/190 (79%), Gaps = 2/190 (1%)
 Frame = +1

Query  244  ASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGDPQ--DPVAYDSGVTYMFIQ  417
            ASA+F LD+KG+ L+ R+YRGD+  +  E+F   LLE E +     P     G+ Y++I+
Sbjct  2    ASAIFFLDLKGKTLLARNYRGDIPMSAVEKFPVLLLEAEEESSAVPPCFSHEGINYLYIR  61

Query  418  HNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEIMDFG  597
            HNN+YL+  +++N NA  +LLFLH+VV VF  YF+ELEEES+RDNFV++YELLDE+MDFG
Sbjct  62   HNNLYLLALTKRNSNATEILLFLHKVVAVFTEYFKELEEESIRDNFVIIYELLDEMMDFG  121

Query  598  YPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVESVNIL  777
            YPQ TE KIL E+I  +++++EV  RPP+A+TNAVSWRSEGI Y+KNEVFLDV+ESVN+L
Sbjct  122  YPQTTETKILQEYITQESHKLEVQARPPIALTNAVSWRSEGIRYRKNEVFLDVIESVNLL  181

Query  778  VNSNGQIVRS  807
            VNSNG ++RS
Sbjct  182  VNSNGNVLRS  191



>gb|ESZ98585.1| putative AP-1 adaptor complex subunit mu [Sclerotinia borealis 
F-4157]
Length=447

 Score =   245 bits (626),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 111/190 (58%), Positives = 152/190 (80%), Gaps = 2/190 (1%)
 Frame = +1

Query  244  ASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKL--LENEGDPQDPVAYDSGVTYMFIQ  417
            ASA+F LD+KG+ L+ R+YRGD+  +  E+F   L   E E     P   D G+ Y++I+
Sbjct  2    ASAVFFLDLKGKTLLARNYRGDIPMSAVEKFPILLSEAEEESSAVPPCFSDEGINYLYIR  61

Query  418  HNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEIMDFG  597
            HNN+YL+  +++N NAA +LLFLH++V+VF  YF+ELEEES+RDNFV++YELLDE+MDFG
Sbjct  62   HNNLYLLALTKRNTNAAEILLFLHKIVEVFTEYFKELEEESIRDNFVIIYELLDEMMDFG  121

Query  598  YPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVESVNIL  777
            YPQ TE+KIL E+I  +++++E+  RPP+AVTNAVSWRSEGI Y+KNEVFLDVVES+N+L
Sbjct  122  YPQTTESKILQEYITQESHKLEIQARPPIAVTNAVSWRSEGIRYRKNEVFLDVVESLNLL  181

Query  778  VNSNGQIVRS  807
            V+SNG ++RS
Sbjct  182  VSSNGNVLRS  191



>ref|XP_006438265.1| hypothetical protein CICLE_v10031619mg [Citrus clementina]
 gb|ESR51505.1| hypothetical protein CICLE_v10031619mg [Citrus clementina]
 gb|KDO82235.1| hypothetical protein CISIN_1g014235mg [Citrus sinensis]
Length=358

 Score =   243 bits (619),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 116/124 (94%), Positives = 119/124 (96%), Gaps = 0/124 (0%)
 Frame = +1

Query  436  MIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEIMDFGYPQFTE  615
            M ASRQNCNAASLL FLHRVVDVFKHYFEELEEESLRDNFVVVYELLDE+MDFGYPQ+TE
Sbjct  1    MTASRQNCNAASLLFFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEMMDFGYPQYTE  60

Query  616  AKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVESVNILVNSNGQ  795
            A ILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGI YKKNEVFLDVVE VNILVNSNGQ
Sbjct  61   ANILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGIQYKKNEVFLDVVEHVNILVNSNGQ  120

Query  796  IVRS  807
            I+RS
Sbjct  121  IIRS  124



>ref|XP_011119774.1| hypothetical protein AOL_s00054g156 [Arthrobotrys oligospora 
ATCC 24927]
 gb|EGX51457.1| hypothetical protein AOL_s00054g156 [Arthrobotrys oligospora 
ATCC 24927]
Length=430

 Score =   244 bits (624),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 112/190 (59%), Positives = 150/190 (79%), Gaps = 2/190 (1%)
 Frame = +1

Query  244  ASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGDPQ--DPVAYDSGVTYMFIQ  417
            ASA+F LD+KG+ L+ R+YRGD+  +  E+F   LLE E +     P     G+ Y++I+
Sbjct  2    ASAIFFLDLKGKTLLARNYRGDIPMSAVEKFPVLLLEAEEESSAVPPCFSHEGINYLYIR  61

Query  418  HNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEIMDFG  597
            HNN+YL+  +++N NA  +LLFLH+VV VF  YF+ELEEES+RDNFV++YELLDE+MDFG
Sbjct  62   HNNLYLLALTKRNSNATEILLFLHKVVAVFTEYFKELEEESIRDNFVIIYELLDEMMDFG  121

Query  598  YPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVESVNIL  777
            YPQ TE KIL E+I  +++++EV  RPP+A+TNAVSWRSEGI Y+KNEVFLDV+ESVN+L
Sbjct  122  YPQTTETKILQEYITQESHKLEVQARPPIALTNAVSWRSEGIRYRKNEVFLDVIESVNLL  181

Query  778  VNSNGQIVRS  807
            VNSNG ++RS
Sbjct  182  VNSNGNVLRS  191



>emb|CCD49882.1| similar to AP-1 complex subunit mu [Botrytis cinerea T4]
 gb|EMR90055.1| putative ap-1 complex subunit mu-1 protein [Botrytis cinerea 
BcDW1]
Length=446

 Score =   245 bits (625),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 111/190 (58%), Positives = 152/190 (80%), Gaps = 2/190 (1%)
 Frame = +1

Query  244  ASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKL--LENEGDPQDPVAYDSGVTYMFIQ  417
            ASA+F LD+KG+ L+ R+YRGD+  +  E+F   L   E E     P   D G+ Y++I+
Sbjct  2    ASAVFFLDLKGKTLLARNYRGDIPMSAVEKFPILLSEAEEESSAVPPCFSDEGINYLYIR  61

Query  418  HNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEIMDFG  597
            HNN+YL+  +++N NAA +LLFLH++V+VF  YF+ELEEES+RDNFV++YELLDE+MDFG
Sbjct  62   HNNLYLLALTKRNTNAAEILLFLHKIVEVFTEYFKELEEESIRDNFVIIYELLDEMMDFG  121

Query  598  YPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVESVNIL  777
            YPQ TE+KIL E+I  +++++E+  RPP+AVTNAVSWRSEGI Y+KNEVFLDVVES+N+L
Sbjct  122  YPQTTESKILQEYITQESHKLEIQARPPIAVTNAVSWRSEGIRYRKNEVFLDVVESLNLL  181

Query  778  VNSNGQIVRS  807
            V+SNG ++RS
Sbjct  182  VSSNGNVLRS  191



>gb|KFX91818.1| hypothetical protein V490_05711, partial [Pseudogymnoascus pannorum 
VKM F-3557]
Length=378

 Score =   243 bits (620),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 112/190 (59%), Positives = 150/190 (79%), Gaps = 2/190 (1%)
 Frame = +1

Query  244  ASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKL--LENEGDPQDPVAYDSGVTYMFIQ  417
            ASA+F LD+KG+ L+ R+YRGD+  +  E+F   L   E E     P   D G+ Y++I+
Sbjct  2    ASAVFFLDLKGKTLLARNYRGDIPMSAVEKFPILLSDAEEESSAVPPCFSDEGINYLYIR  61

Query  418  HNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEIMDFG  597
            HNN+YL+  +++N NAA +LLFLH++V+VF  YF+ELEEES+RDNFVV+YELLDE+MDFG
Sbjct  62   HNNLYLLALTKRNTNAAEILLFLHKIVEVFTEYFKELEEESIRDNFVVIYELLDEMMDFG  121

Query  598  YPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVESVNIL  777
            YPQ TE KIL E+I  +++++EV  RPP+AVTNAVSWRSEGI Y+KNEVFLDVVES+N+L
Sbjct  122  YPQTTETKILQEYITQESHKLEVQARPPIAVTNAVSWRSEGIRYRKNEVFLDVVESLNLL  181

Query  778  VNSNGQIVRS  807
            V+S G ++RS
Sbjct  182  VSSTGNVLRS  191



>gb|KFY59837.1| hypothetical protein V497_04048, partial [Pseudogymnoascus pannorum 
VKM F-4516 (FW-969)]
Length=378

 Score =   243 bits (620),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 112/190 (59%), Positives = 150/190 (79%), Gaps = 2/190 (1%)
 Frame = +1

Query  244  ASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKL--LENEGDPQDPVAYDSGVTYMFIQ  417
            ASA+F LD+KG+ L+ R+YRGD+  +  E+F   L   E E     P   D G+ Y++I+
Sbjct  2    ASAVFFLDLKGKTLLARNYRGDIPMSAVEKFPILLSDAEEESSAVPPCFSDEGINYLYIR  61

Query  418  HNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEIMDFG  597
            HNN+YL+  +++N NAA +LLFLH++V+VF  YF+ELEEES+RDNFVV+YELLDE+MDFG
Sbjct  62   HNNLYLLALTKRNTNAAEILLFLHKIVEVFTEYFKELEEESIRDNFVVIYELLDEMMDFG  121

Query  598  YPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVESVNIL  777
            YPQ TE KIL E+I  +++++EV  RPP+AVTNAVSWRSEGI Y+KNEVFLDVVES+N+L
Sbjct  122  YPQTTETKILQEYITQESHKLEVQARPPIAVTNAVSWRSEGIRYRKNEVFLDVVESLNLL  181

Query  778  VNSNGQIVRS  807
            V+S G ++RS
Sbjct  182  VSSTGNVLRS  191



>gb|KEF54928.1| AP-1 complex subunit mu-1 [Exophiala aquamarina CBS 119918]
Length=448

 Score =   244 bits (624),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 111/190 (58%), Positives = 151/190 (79%), Gaps = 2/190 (1%)
 Frame = +1

Query  244  ASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKL--LENEGDPQDPVAYDSGVTYMFIQ  417
            ASALF LD+KG+ L+ R+YRGD+  +  E+F   L   E E     P   D G+ Y++I+
Sbjct  2    ASALFFLDLKGKTLLARNYRGDIPMSAVEKFPILLSEAEEESSAVPPCFSDEGINYLYIR  61

Query  418  HNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEIMDFG  597
            HNN+YL+  +++N NAA +LLFLH++V+VF  YF+ELEEES+RDNFV++YELLDE+MDFG
Sbjct  62   HNNLYLLALTKRNTNAAEILLFLHKIVEVFTEYFKELEEESIRDNFVIIYELLDEMMDFG  121

Query  598  YPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVESVNIL  777
            YPQ TE+KIL E+I  +++++EV  RPP+AVTNAVSWRSEGI Y+KNEVFLDV+ES+N+L
Sbjct  122  YPQTTESKILQEYITQESHKLEVQARPPIAVTNAVSWRSEGIRYRKNEVFLDVIESLNLL  181

Query  778  VNSNGQIVRS  807
            V+S G ++RS
Sbjct  182  VSSTGNVLRS  191



>ref|XP_007728691.1| AP-1 complex subunit mu-1 [Capronia epimyces CBS 606.96]
 gb|EXJ91801.1| AP-1 complex subunit mu-1 [Capronia epimyces CBS 606.96]
Length=448

 Score =   244 bits (623),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 113/190 (59%), Positives = 150/190 (79%), Gaps = 2/190 (1%)
 Frame = +1

Query  244  ASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKL--LENEGDPQDPVAYDSGVTYMFIQ  417
            ASALF LD+KG+ L+ R+YRGD+  +  E+F   L   E E     P   D G+ Y++I+
Sbjct  2    ASALFFLDLKGKTLLARNYRGDIPMSAVEKFPILLSDAEEESSAVPPCFSDEGINYLYIR  61

Query  418  HNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEIMDFG  597
            HNN+YL+  +++N NAA +LLFLH++V+VF  YF+ELEEES+RDNFVV+YELLDE+MDFG
Sbjct  62   HNNLYLLALTKRNTNAAEILLFLHKIVEVFTEYFKELEEESIRDNFVVIYELLDEMMDFG  121

Query  598  YPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVESVNIL  777
            YPQ TE KIL E+I  +++++EV  RPP+AVTNAVSWRSEGI Y+KNEVFLDVVES+N+L
Sbjct  122  YPQTTETKILQEYITQESHKLEVQARPPIAVTNAVSWRSEGIRYRKNEVFLDVVESLNLL  181

Query  778  VNSNGQIVRS  807
            V+S G ++RS
Sbjct  182  VSSTGNVLRS  191



>ref|XP_002841338.1| hypothetical protein [Tuber melanosporum Mel28]
 emb|CAZ85529.1| unnamed protein product [Tuber melanosporum]
Length=430

 Score =   243 bits (621),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 110/190 (58%), Positives = 150/190 (79%), Gaps = 2/190 (1%)
 Frame = +1

Query  244  ASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGDPQ--DPVAYDSGVTYMFIQ  417
            ASA+F LD+KG+ L+ R+YRGD+  +  E+F   LLE E +     P     G+ Y++I+
Sbjct  2    ASAVFFLDLKGKTLLARNYRGDIPMSAVEKFPILLLEAEEESSAVPPCFSHEGINYLYIR  61

Query  418  HNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEIMDFG  597
            HNN+Y++  +++N NA   LLFLHR+V+VF  YF+ELEEES+RDNFV++YELLDE+MDFG
Sbjct  62   HNNLYVLALTKRNSNATETLLFLHRIVEVFTEYFKELEEESIRDNFVIIYELLDEMMDFG  121

Query  598  YPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVESVNIL  777
            YPQ TE KIL E+I  +++++E+  RPP+AVTNAVSWRSEGI Y+KNEVFLDV+ES+N+L
Sbjct  122  YPQTTETKILQEYITQESHKLEIQARPPIAVTNAVSWRSEGIRYRKNEVFLDVIESLNLL  181

Query  778  VNSNGQIVRS  807
            VNSNG ++RS
Sbjct  182  VNSNGNVLRS  191



>gb|KIX94120.1| hypothetical protein Z520_10146 [Fonsecaea multimorphosa CBS 
102226]
Length=449

 Score =   244 bits (622),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 111/190 (58%), Positives = 151/190 (79%), Gaps = 2/190 (1%)
 Frame = +1

Query  244  ASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKL--LENEGDPQDPVAYDSGVTYMFIQ  417
            ASA+F LD+KG+ L+ R+YRGD+  +  E+F   L   E E     P   D G+ Y++I+
Sbjct  2    ASAIFFLDLKGKTLLARNYRGDIPMSAVEKFPILLSEAEEESSAVPPCFSDEGINYLYIR  61

Query  418  HNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEIMDFG  597
            HNN+YL+  +++N NAA +LLFLH++V+VF  YF+ELEEES+RDNFVV+YELLDE+MDFG
Sbjct  62   HNNLYLLALTKRNTNAAEILLFLHKIVEVFTEYFKELEEESIRDNFVVIYELLDEMMDFG  121

Query  598  YPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVESVNIL  777
            YPQ TE+KIL E+I  +++++EV  RPP+AVTNAVSWRSEGI Y+KNEVFLDV+ES+N+L
Sbjct  122  YPQTTESKILQEYITQESHKLEVQARPPIAVTNAVSWRSEGIRYRKNEVFLDVIESLNLL  181

Query  778  VNSNGQIVRS  807
            V+S G ++RS
Sbjct  182  VSSTGNVLRS  191



>ref|XP_003195223.1| clathrin assembly protein AP47 [Cryptococcus gattii WM276]
 gb|ADV23436.1| Clathrin assembly protein AP47, putative [Cryptococcus gattii 
WM276]
 gb|KIR54886.1| AP-1 complex subunit mu-1 [Cryptococcus gattii Ru294]
 gb|KIR68113.1| AP-1 complex subunit mu-1 [Cryptococcus gattii CA1873]
 gb|KIR77531.1| AP-1 complex subunit mu-1 [Cryptococcus gattii EJB2]
 gb|KIR88736.1| AP-1 complex subunit mu-1 [Cryptococcus gattii IND107]
 gb|KIY35837.1| AP-1 complex subunit mu-1 [Cryptococcus gattii E566]
 gb|KJE01510.1| AP-1 complex subunit mu-1 [Cryptococcus gattii NT-10]
Length=435

 Score =   243 bits (621),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 115/190 (61%), Positives = 147/190 (77%), Gaps = 2/190 (1%)
 Frame = +1

Query  244  ASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGD--PQDPVAYDSGVTYMFIQ  417
            AS + +LDVKG+ L+ R YR DV  +  ERF   +LE E D  P  P   D GV YM I+
Sbjct  2    ASLVAILDVKGKSLIQRSYRDDVPPSYIERFLPLILEMEEDNVPVTPCFSDEGVNYMHIR  61

Query  418  HNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEIMDFG  597
            HNN+YL+  S++N NAA ++ FLHR+  V   YF+ELEEES+RDNFV++YELLDE+MDFG
Sbjct  62   HNNLYLLALSKKNSNAAEVIFFLHRLCSVLTEYFKELEEESIRDNFVIIYELLDEMMDFG  121

Query  598  YPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVESVNIL  777
            YPQ TE+KIL E+I  +++++EV  RPPMAVTNAVSWRSEGI Y+KNEVFLDVVESVN+L
Sbjct  122  YPQTTESKILQEYITQESHKLEVQVRPPMAVTNAVSWRSEGIRYRKNEVFLDVVESVNLL  181

Query  778  VNSNGQIVRS  807
            VN++G ++RS
Sbjct  182  VNASGSVIRS  191



>gb|KIM99512.1| hypothetical protein OIDMADRAFT_200539 [Oidiodendron maius Zn]
Length=446

 Score =   243 bits (621),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 110/190 (58%), Positives = 152/190 (80%), Gaps = 2/190 (1%)
 Frame = +1

Query  244  ASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKL--LENEGDPQDPVAYDSGVTYMFIQ  417
            ASA+F LD+KG+ L+ R+YRGD+  +  ++F   L   E E     P   D G+ Y++I+
Sbjct  2    ASAVFFLDLKGKTLLARNYRGDIPMSAVDKFPILLSEAEEESSAVPPCFSDEGINYLYIR  61

Query  418  HNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEIMDFG  597
            HNN+YL+  +++N NAA +LLFLH++V+VF  YF+ELEEES+RDNFV++YELLDE+MDFG
Sbjct  62   HNNLYLLALTKRNTNAAEILLFLHKIVEVFTEYFKELEEESIRDNFVIIYELLDEMMDFG  121

Query  598  YPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVESVNIL  777
            YPQ TE+KIL E+I  +++++E+  RPP+AVTNAVSWRSEGI Y+KNEVFLDVVES+N+L
Sbjct  122  YPQTTESKILQEYITQESHKLEIQARPPIAVTNAVSWRSEGIRYRKNEVFLDVVESLNLL  181

Query  778  VNSNGQIVRS  807
            V+SNG ++RS
Sbjct  182  VSSNGNVLRS  191



>ref|XP_007586768.1| putative ap-1 complex subunit mu-1 protein [Neofusicoccum parvum 
UCRNP2]
 gb|EOD45749.1| putative ap-1 complex subunit mu-1 protein [Neofusicoccum parvum 
UCRNP2]
Length=446

 Score =   243 bits (621),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 112/190 (59%), Positives = 151/190 (79%), Gaps = 2/190 (1%)
 Frame = +1

Query  244  ASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKL--LENEGDPQDPVAYDSGVTYMFIQ  417
            ASA+F LD+KG+ L+ R+YRGD+  +  E+F   L   E E     P     G+ Y++I+
Sbjct  2    ASAVFFLDLKGKTLLARNYRGDIPMSAVEKFPVLLSEAEEESSAVPPCFSSEGINYLYIR  61

Query  418  HNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEIMDFG  597
            HNN+YL+  +++N NAA +LLFLH++V+VF  YF+ELEEES+RDNFVV+YELLDE+MDFG
Sbjct  62   HNNLYLLALTKRNTNAAEILLFLHKIVEVFTEYFKELEEESIRDNFVVIYELLDEMMDFG  121

Query  598  YPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVESVNIL  777
            YPQ TE+KIL E+I  +++++EV  RPP+AVTNAVSWRSEGI Y+KNEVFLDVVES+N+L
Sbjct  122  YPQTTESKILQEYITQESHKLEVQARPPIAVTNAVSWRSEGIRYRKNEVFLDVVESLNLL  181

Query  778  VNSNGQIVRS  807
            V+SNG ++RS
Sbjct  182  VSSNGNVLRS  191



>gb|KIR49235.1| AP-1 complex subunit mu-1 [Cryptococcus gattii CA1280]
Length=435

 Score =   243 bits (620),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 115/190 (61%), Positives = 147/190 (77%), Gaps = 2/190 (1%)
 Frame = +1

Query  244  ASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGD--PQDPVAYDSGVTYMFIQ  417
            AS + +LDVKG+ L+ R YR DV  +  ERF   +LE E D  P  P   D GV YM I+
Sbjct  2    ASLVAILDVKGKSLIQRSYRDDVPPSYIERFLPLILEMEEDNVPVTPCFSDEGVNYMHIR  61

Query  418  HNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEIMDFG  597
            HNN+YL+  S++N NAA ++ FLHR+  V   YF+ELEEES+RDNFV++YELLDE+MDFG
Sbjct  62   HNNLYLLALSKKNSNAAEVIFFLHRLCSVLTEYFKELEEESIRDNFVIIYELLDEMMDFG  121

Query  598  YPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVESVNIL  777
            YPQ TE+KIL E+I  +++++EV  RPPMAVTNAVSWRSEGI Y+KNEVFLDVVESVN+L
Sbjct  122  YPQTTESKILQEYITQESHKLEVQVRPPMAVTNAVSWRSEGIRYRKNEVFLDVVESVNLL  181

Query  778  VNSNGQIVRS  807
            VN++G ++RS
Sbjct  182  VNASGSVIRS  191



>gb|KFY21972.1| hypothetical protein V493_06939 [Pseudogymnoascus pannorum VKM 
F-4281 (FW-2241)]
 gb|KFY82444.1| hypothetical protein V500_10546 [Pseudogymnoascus pannorum VKM 
F-4518 (FW-2643)]
 gb|KFZ16314.1| hypothetical protein V502_05170 [Pseudogymnoascus pannorum VKM 
F-4520 (FW-2644)]
Length=448

 Score =   243 bits (621),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 112/190 (59%), Positives = 151/190 (79%), Gaps = 2/190 (1%)
 Frame = +1

Query  244  ASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKL--LENEGDPQDPVAYDSGVTYMFIQ  417
            ASA+F LD+KG+ L+ R+YRGD+  +  E+F   L   E E     P   D G+ Y++I+
Sbjct  2    ASAVFFLDLKGKTLLARNYRGDIPMSAVEKFPILLSDAEEESSAVPPCFSDEGINYLYIR  61

Query  418  HNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEIMDFG  597
            HNN+YL+  +++N NAA +LLFLH++V+VF  YF+ELEEES+RDNFVV+YELLDE+MDFG
Sbjct  62   HNNLYLLALTKRNTNAAEILLFLHKIVEVFTEYFKELEEESIRDNFVVIYELLDEMMDFG  121

Query  598  YPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVESVNIL  777
            YPQ TE+KIL E+I  +++++EV  RPP+AVTNAVSWRSEGI Y+KNEVFLDVVES+N+L
Sbjct  122  YPQTTESKILQEYITQESHKLEVQARPPIAVTNAVSWRSEGIRYRKNEVFLDVVESLNLL  181

Query  778  VNSNGQIVRS  807
            V+S G ++RS
Sbjct  182  VSSTGNVLRS  191



>emb|CCU79052.1| AP-1 adaptor complex subunit mu [Blumeria graminis f. sp. hordei 
DH14]
Length=446

 Score =   243 bits (621),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 110/190 (58%), Positives = 152/190 (80%), Gaps = 2/190 (1%)
 Frame = +1

Query  244  ASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKL--LENEGDPQDPVAYDSGVTYMFIQ  417
            ASA+F LD+KG+ L+ R+YRGD+  +  E+F   L   E E     P   D G+ Y++I+
Sbjct  2    ASAIFFLDLKGKTLLARNYRGDIPMSAVEKFPILLSEAEEESSAVPPCFSDEGINYLYIR  61

Query  418  HNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEIMDFG  597
            H+N+YL+  +++N NAA +LLFLH++V+VF  YF+ELEEES+RDNFV++YELLDE+MDFG
Sbjct  62   HSNLYLLALTKRNTNAAEILLFLHKIVEVFTEYFKELEEESIRDNFVIIYELLDEMMDFG  121

Query  598  YPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVESVNIL  777
            YPQ TE+KIL E+I  +++++E+  RPP+AVTNAVSWRSEGI Y+KNEVFLDVVES+N+L
Sbjct  122  YPQTTESKILQEYITQESHKLEIQARPPIAVTNAVSWRSEGIRYRKNEVFLDVVESLNLL  181

Query  778  VNSNGQIVRS  807
            V+SNG ++RS
Sbjct  182  VSSNGNVLRS  191



>gb|KFY05714.1| hypothetical protein V492_08342 [Pseudogymnoascus pannorum VKM 
F-4246]
 gb|KFY30356.1| hypothetical protein V494_08183 [Pseudogymnoascus pannorum VKM 
F-4513 (FW-928)]
Length=449

 Score =   243 bits (621),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 112/190 (59%), Positives = 151/190 (79%), Gaps = 2/190 (1%)
 Frame = +1

Query  244  ASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKL--LENEGDPQDPVAYDSGVTYMFIQ  417
            ASA+F LD+KG+ L+ R+YRGD+  +  E+F   L   E E     P   D G+ Y++I+
Sbjct  2    ASAVFFLDLKGKTLLARNYRGDIPMSAVEKFPILLSDAEEESSAVPPCFSDEGINYLYIR  61

Query  418  HNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEIMDFG  597
            HNN+YL+  +++N NAA +LLFLH++V+VF  YF+ELEEES+RDNFVV+YELLDE+MDFG
Sbjct  62   HNNLYLLALTKRNTNAAEILLFLHKIVEVFTEYFKELEEESIRDNFVVIYELLDEMMDFG  121

Query  598  YPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVESVNIL  777
            YPQ TE+KIL E+I  +++++EV  RPP+AVTNAVSWRSEGI Y+KNEVFLDVVES+N+L
Sbjct  122  YPQTTESKILQEYITQESHKLEVQARPPIAVTNAVSWRSEGIRYRKNEVFLDVVESLNLL  181

Query  778  VNSNGQIVRS  807
            V+S G ++RS
Sbjct  182  VSSTGNVLRS  191



>ref|XP_009155670.1| AP-1 complex subunit mu-1 [Exophiala dermatitidis NIH/UT8656]
 gb|EHY55209.1| AP-1 complex subunit mu-1 [Exophiala dermatitidis NIH/UT8656]
Length=448

 Score =   243 bits (621),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 111/190 (58%), Positives = 152/190 (80%), Gaps = 2/190 (1%)
 Frame = +1

Query  244  ASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKL--LENEGDPQDPVAYDSGVTYMFIQ  417
            ASA+F LD+KG+ L+ R+YRGD+  +  E+F   L   E E     P   D G+ Y++I+
Sbjct  2    ASAVFFLDLKGKTLLARNYRGDIPMSAVEKFPMLLSEAEEESSAVPPCFSDEGINYLYIR  61

Query  418  HNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEIMDFG  597
            HNN+YL+  +++N NAA +LLFLH++V+VF  YF+ELEEES+RDNFVV+YELLDE+MDFG
Sbjct  62   HNNLYLLALTKRNTNAAEILLFLHKIVEVFTEYFKELEEESIRDNFVVIYELLDEMMDFG  121

Query  598  YPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVESVNIL  777
            YPQ TE+KIL E+I  +++++EV  RPP+AVTNAVSWRSEGI Y+KNEVFLDV+ES+N+L
Sbjct  122  YPQTTESKILQEYITQESHKLEVQARPPIAVTNAVSWRSEGIRYRKNEVFLDVIESLNLL  181

Query  778  VNSNGQIVRS  807
            V+S+G ++RS
Sbjct  182  VSSSGNVLRS  191



>gb|KIW92487.1| hypothetical protein Z519_06334 [Cladophialophora bantiana CBS 
173.52]
Length=449

 Score =   243 bits (621),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 110/190 (58%), Positives = 151/190 (79%), Gaps = 2/190 (1%)
 Frame = +1

Query  244  ASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKL--LENEGDPQDPVAYDSGVTYMFIQ  417
            ASA+F LD+KG+ L+ R+YRGD+  +  E+F   L   E E     P   D G+ Y++I+
Sbjct  2    ASAVFFLDLKGKTLLARNYRGDIPMSAVEKFPILLSEAEEESSAVPPCFSDEGINYLYIR  61

Query  418  HNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEIMDFG  597
            HNN+YL+  +++N NAA +LLFLH++V+VF  YF+ELEEES+RDNFV++YELLDE+MDFG
Sbjct  62   HNNLYLLALTKRNTNAAEILLFLHKIVEVFTEYFKELEEESIRDNFVIIYELLDEMMDFG  121

Query  598  YPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVESVNIL  777
            YPQ TE+KIL E+I  +++++EV  RPP+AVTNAVSWRSEGI Y+KNEVFLDV+ES+N+L
Sbjct  122  YPQTTESKILQEYITQESHKLEVQARPPIAVTNAVSWRSEGIRYRKNEVFLDVIESINLL  181

Query  778  VNSNGQIVRS  807
            V+S G ++RS
Sbjct  182  VSSTGNVLRS  191



>gb|KIW57950.1| hypothetical protein PV05_02505 [Exophiala xenobiotica]
 gb|KIW57951.1| hypothetical protein, variant [Exophiala xenobiotica]
Length=448

 Score =   243 bits (621),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 111/190 (58%), Positives = 151/190 (79%), Gaps = 2/190 (1%)
 Frame = +1

Query  244  ASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKL--LENEGDPQDPVAYDSGVTYMFIQ  417
            ASALF LD+KG+ L+ R+YRGD+  +  E+F   L   E E     P   D G+ Y++I+
Sbjct  2    ASALFFLDLKGKTLLARNYRGDLPMSAVEKFPVLLSEAEEESSAVPPCFSDEGINYLYIR  61

Query  418  HNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEIMDFG  597
            HNN+YL+  +++N NAA +LLFLH++V+VF  YF+ELEEES+RDNFV++YELLDE+MDFG
Sbjct  62   HNNLYLLALTKRNTNAAEILLFLHKIVEVFTEYFKELEEESIRDNFVIIYELLDEMMDFG  121

Query  598  YPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVESVNIL  777
            YPQ TE+KIL E+I  +++++EV  RPP+AVTNAVSWRSEGI Y+KNEVFLDV+ES+N+L
Sbjct  122  YPQTTESKILQEYITQESHKLEVQARPPIAVTNAVSWRSEGIRYRKNEVFLDVIESLNLL  181

Query  778  VNSNGQIVRS  807
            V+S G ++RS
Sbjct  182  VSSTGNVLRS  191



>gb|EKG19131.1| Clathrin adaptor mu subunit [Macrophomina phaseolina MS6]
Length=446

 Score =   243 bits (620),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 112/190 (59%), Positives = 151/190 (79%), Gaps = 2/190 (1%)
 Frame = +1

Query  244  ASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKL--LENEGDPQDPVAYDSGVTYMFIQ  417
            ASA+F LD+KG+ L+ R+YRGD+  +  E+F   L   E E     P     G+ Y++I+
Sbjct  2    ASAVFFLDLKGKTLLARNYRGDIPMSAVEKFPILLSEAEEESSAVPPCFSSEGINYLYIR  61

Query  418  HNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEIMDFG  597
            HNN+YL+  +++N NAA +LLFLH++V+VF  YF+ELEEES+RDNFVV+YELLDE+MDFG
Sbjct  62   HNNLYLLALTKRNTNAAEILLFLHKIVEVFTEYFKELEEESIRDNFVVIYELLDEMMDFG  121

Query  598  YPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVESVNIL  777
            YPQ TE+KIL E+I  +++++EV  RPP+AVTNAVSWRSEGI Y+KNEVFLDVVES+N+L
Sbjct  122  YPQTTESKILQEYITQESHKLEVQARPPIAVTNAVSWRSEGIRYRKNEVFLDVVESLNLL  181

Query  778  VNSNGQIVRS  807
            V+SNG ++RS
Sbjct  182  VSSNGNVLRS  191



>gb|KFY57133.1| hypothetical protein V496_06523 [Pseudogymnoascus pannorum VKM 
F-4515 (FW-2607)]
Length=449

 Score =   243 bits (620),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 111/190 (58%), Positives = 151/190 (79%), Gaps = 2/190 (1%)
 Frame = +1

Query  244  ASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKL--LENEGDPQDPVAYDSGVTYMFIQ  417
            ASA+F LD+KG+ L+ R+YRGD+  +  E+F   L   E E     P   D G+ Y++I+
Sbjct  2    ASAVFFLDLKGKTLLARNYRGDIPMSAVEKFPILLSDAEEESSAVPPCFSDEGINYLYIR  61

Query  418  HNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEIMDFG  597
            HNN+YL+  +++N NAA +LLFLH++V+VF  YF+ELEEES+RDNFVV+YELLDE+MDFG
Sbjct  62   HNNLYLLALTKRNTNAAEILLFLHKIVEVFTEYFKELEEESIRDNFVVIYELLDEMMDFG  121

Query  598  YPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVESVNIL  777
            YPQ TE+KIL E+I  +++++EV  RPP+AVTNAVSWRSEGI Y+KNEVFLDV+ES+N+L
Sbjct  122  YPQTTESKILQEYITQESHKLEVQARPPIAVTNAVSWRSEGIRYRKNEVFLDVIESLNLL  181

Query  778  VNSNGQIVRS  807
            V+S G ++RS
Sbjct  182  VSSTGNVLRS  191



>ref|XP_007745946.1| AP-1 complex subunit mu-1 [Cladophialophora psammophila CBS 110553]
 gb|EXJ70094.1| AP-1 complex subunit mu-1 [Cladophialophora psammophila CBS 110553]
Length=449

 Score =   243 bits (620),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 110/190 (58%), Positives = 150/190 (79%), Gaps = 2/190 (1%)
 Frame = +1

Query  244  ASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKL--LENEGDPQDPVAYDSGVTYMFIQ  417
            ASA+F LD+KG+ L+ R+YRGD+  +  E+F   L   E E     P   D G+ Y++I+
Sbjct  2    ASAVFFLDLKGKTLLARNYRGDIPMSAVEKFPILLSEAEEESSAVPPCFSDEGINYLYIR  61

Query  418  HNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEIMDFG  597
            HNN+YL+  +++N NAA +LLFLH++V+VF  YF+ELEEES+RDNFV++YELLDE+MDFG
Sbjct  62   HNNLYLLALTKRNTNAAEILLFLHKIVEVFTEYFKELEEESIRDNFVIIYELLDEMMDFG  121

Query  598  YPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVESVNIL  777
            YPQ TE KIL E+I  +++++EV  RPP+AVTNAVSWRSEGI Y+KNEVFLDV+ES+N+L
Sbjct  122  YPQTTETKILQEYITQESHKLEVQARPPIAVTNAVSWRSEGIRYRKNEVFLDVIESINLL  181

Query  778  VNSNGQIVRS  807
            V+S G ++RS
Sbjct  182  VSSTGNVLRS  191



>gb|KIW46049.1| hypothetical protein PV06_01742 [Exophiala oligosperma]
Length=448

 Score =   243 bits (620),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 111/190 (58%), Positives = 151/190 (79%), Gaps = 2/190 (1%)
 Frame = +1

Query  244  ASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKL--LENEGDPQDPVAYDSGVTYMFIQ  417
            ASALF LD+KG+ L+ R+YRGDV  +  E+F   L   E E     P   D G+ Y++I+
Sbjct  2    ASALFFLDLKGKTLLARNYRGDVPMSAVEKFPVLLSEAEEESSAVPPCFSDEGINYLYIR  61

Query  418  HNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEIMDFG  597
            H+N+YL+  +++N NAA +LLFLH++V+VF  YF+ELEEES+RDNFV++YELLDE+MDFG
Sbjct  62   HSNLYLLALTKRNTNAAEILLFLHKIVEVFTEYFKELEEESIRDNFVIIYELLDEMMDFG  121

Query  598  YPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVESVNIL  777
            YPQ TE+KIL E+I  +++++EV  RPP+AVTNAVSWRSEGI Y+KNEVFLDV+ES+N+L
Sbjct  122  YPQTTESKILQEYITQESHKLEVQARPPIAVTNAVSWRSEGIRYRKNEVFLDVIESLNLL  181

Query  778  VNSNGQIVRS  807
            V+S G ++RS
Sbjct  182  VSSTGSVLRS  191



>gb|KIW29396.1| hypothetical protein PV07_05214 [Cladophialophora immunda]
 gb|KIW79712.1| hypothetical protein Z517_06326 [Fonsecaea pedrosoi CBS 271.37]
Length=449

 Score =   243 bits (620),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 110/190 (58%), Positives = 151/190 (79%), Gaps = 2/190 (1%)
 Frame = +1

Query  244  ASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKL--LENEGDPQDPVAYDSGVTYMFIQ  417
            ASA+F LD+KG+ L+ R+YRGD+  +  E+F   L   E E     P   D G+ Y++I+
Sbjct  2    ASAVFFLDLKGKTLLARNYRGDIPMSAVEKFPILLSEAEEESSAVPPCFSDEGINYLYIR  61

Query  418  HNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEIMDFG  597
            HNN+YL+  +++N NAA +LLFLH++V+VF  YF+ELEEES+RDNFV++YELLDE+MDFG
Sbjct  62   HNNLYLLALTKRNTNAAEILLFLHKIVEVFTEYFKELEEESIRDNFVIIYELLDEMMDFG  121

Query  598  YPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVESVNIL  777
            YPQ TE+KIL E+I  +++++EV  RPP+AVTNAVSWRSEGI Y+KNEVFLDV+ES+N+L
Sbjct  122  YPQTTESKILQEYITQESHKLEVQARPPIAVTNAVSWRSEGIRYRKNEVFLDVIESLNLL  181

Query  778  VNSNGQIVRS  807
            V+S G ++RS
Sbjct  182  VSSTGNVLRS  191



>ref|XP_007720993.1| AP-1 complex subunit mu-1 [Capronia coronata CBS 617.96]
 gb|EXJ93499.1| AP-1 complex subunit mu-1 [Capronia coronata CBS 617.96]
Length=448

 Score =   243 bits (620),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 111/190 (58%), Positives = 151/190 (79%), Gaps = 2/190 (1%)
 Frame = +1

Query  244  ASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKL--LENEGDPQDPVAYDSGVTYMFIQ  417
            ASA+F LD+KG+ L+ R+YRGDV  +  E+F   L   E E     P   D G+ Y++I+
Sbjct  2    ASAIFFLDLKGKTLLARNYRGDVPMSAVEKFPILLSEAEEESSAVPPCFSDEGINYLYIR  61

Query  418  HNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEIMDFG  597
            HNN+YL+  +++N NA+ +LLFLH++V+VF  YF+ELEEES+RDNFVV+YELLDE+MDFG
Sbjct  62   HNNLYLLALTKRNSNASEILLFLHKIVEVFTEYFKELEEESIRDNFVVIYELLDEMMDFG  121

Query  598  YPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVESVNIL  777
            YPQ TE+KIL E+I  +++++EV  RPP+AVTNAVSWRSEGI Y+KNEVFLDV+ES+N+L
Sbjct  122  YPQTTESKILQEYITQESHKLEVQARPPIAVTNAVSWRSEGIRYRKNEVFLDVIESLNLL  181

Query  778  VNSNGQIVRS  807
            V+S G ++RS
Sbjct  182  VSSTGNVLRS  191



>ref|XP_011328827.1| AP-1 complex subunit mu [Fusarium graminearum PH-1]
 gb|ESU15489.1| AP-1 complex subunit mu [Fusarium graminearum PH-1]
Length=430

 Score =   242 bits (618),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 111/190 (58%), Positives = 151/190 (79%), Gaps = 2/190 (1%)
 Frame = +1

Query  244  ASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGDPQ--DPVAYDSGVTYMFIQ  417
            ASALF LD+KG+ L+ R+YRGD+  +  E+F   L E E D     P     G+ Y++I+
Sbjct  2    ASALFFLDLKGKTLLARNYRGDIPMSAVEKFPVLLSEAEEDSSAVPPCFSHEGINYLYIR  61

Query  418  HNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEIMDFG  597
            HNN+YL+  +++N NAA +LLFLH+VV+VF  YF+ LEEES+RDNFV++YELLDE+MDFG
Sbjct  62   HNNLYLLALTKRNTNAAEILLFLHKVVEVFTEYFKALEEESIRDNFVIIYELLDEMMDFG  121

Query  598  YPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVESVNIL  777
            YPQ TE+KIL E+I  +++++E+  RPP+AVTNAVSWRSEGI Y+KNEVFLDVVES+N+L
Sbjct  122  YPQTTESKILQEYITQESHKLEIQARPPIAVTNAVSWRSEGIRYRKNEVFLDVVESLNLL  181

Query  778  VNSNGQIVRS  807
            V++NG ++RS
Sbjct  182  VSANGNVLRS  191



>gb|KHJ35758.1| putative ap-1 complex subunit mu-1 [Erysiphe necator]
Length=446

 Score =   243 bits (619),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 109/190 (57%), Positives = 152/190 (80%), Gaps = 2/190 (1%)
 Frame = +1

Query  244  ASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKL--LENEGDPQDPVAYDSGVTYMFIQ  417
            ASA+F LD+KG+ L+ R+YRGD+  +  E+F   L   E E     P   D G+ Y++I+
Sbjct  2    ASAVFFLDLKGKTLLARNYRGDIPMSAVEKFPVLLSEAEEESSAVPPCFSDEGINYLYIR  61

Query  418  HNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEIMDFG  597
            H+N+YL+  +++N NAA +LLFLH++V+VF  YF+ELEEES+RDNFV++YELLDE+MDFG
Sbjct  62   HSNLYLLALTKRNTNAAEILLFLHKIVEVFSEYFKELEEESIRDNFVIIYELLDEMMDFG  121

Query  598  YPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVESVNIL  777
            YPQ TE+KIL E+I  +++++E+  RPP+A+TNAVSWRSEGI Y+KNEVFLDVVES+N+L
Sbjct  122  YPQTTESKILQEYITQESHKLEIQARPPIAITNAVSWRSEGIRYRKNEVFLDVVESLNLL  181

Query  778  VNSNGQIVRS  807
            V+SNG ++RS
Sbjct  182  VSSNGNVLRS  191



>gb|KIW18278.1| hypothetical protein PV08_02566 [Exophiala spinifera]
Length=448

 Score =   243 bits (619),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 111/190 (58%), Positives = 151/190 (79%), Gaps = 2/190 (1%)
 Frame = +1

Query  244  ASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKL--LENEGDPQDPVAYDSGVTYMFIQ  417
            ASALF LD+KG+ L+ R+YRGDV  +  E+F   L   E E     P   D G+ Y++I+
Sbjct  2    ASALFFLDLKGKTLLARNYRGDVPMSAVEKFPILLSEAEEESSAVPPCFSDEGINYLYIR  61

Query  418  HNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEIMDFG  597
            H+N+YL+  +++N NAA +LLFLH++V+VF  YF+ELEEES+RDNFV++YELLDE+MDFG
Sbjct  62   HSNLYLLALTKRNTNAAEILLFLHKIVEVFTEYFKELEEESIRDNFVIIYELLDEMMDFG  121

Query  598  YPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVESVNIL  777
            YPQ TE+KIL E+I  +++++EV  RPP+AVTNAVSWRSEGI Y+KNEVFLDV+ES+N+L
Sbjct  122  YPQTTESKILQEYITQESHKLEVQARPPIAVTNAVSWRSEGIRYRKNEVFLDVIESLNLL  181

Query  778  VNSNGQIVRS  807
            V+S G ++RS
Sbjct  182  VSSTGSVLRS  191



>gb|KIV92853.1| hypothetical protein PV10_04117 [Exophiala mesophila]
Length=448

 Score =   243 bits (619),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 111/190 (58%), Positives = 151/190 (79%), Gaps = 2/190 (1%)
 Frame = +1

Query  244  ASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKL--LENEGDPQDPVAYDSGVTYMFIQ  417
            ASALF LD+KG+ L+ R+YRGD+  +  E+F   L   E E     P   D G+ Y++I+
Sbjct  2    ASALFFLDLKGKTLLARNYRGDIPMSAVEKFPILLSEAEEESSAVPPCFSDEGINYLYIR  61

Query  418  HNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEIMDFG  597
            H+N+YL+  +++N NAA +LLFLH++V+VF  YF+ELEEES+RDNFV++YELLDE+MDFG
Sbjct  62   HSNLYLLALTKRNTNAAEILLFLHKIVEVFTEYFKELEEESIRDNFVIIYELLDEMMDFG  121

Query  598  YPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVESVNIL  777
            YPQ TE+KIL E+I  +++++EV  RPP+AVTNAVSWRSEGI Y+KNEVFLDVVES+N+L
Sbjct  122  YPQTTESKILQEYITQESHKLEVQARPPIAVTNAVSWRSEGIRYRKNEVFLDVVESLNLL  181

Query  778  VNSNGQIVRS  807
            V+S G ++RS
Sbjct  182  VSSTGNVLRS  191



>ref|XP_007805622.1| hypothetical protein EPUS_07140 [Endocarpon pusillum Z07020]
 gb|ERF68722.1| hypothetical protein EPUS_07140 [Endocarpon pusillum Z07020]
Length=447

 Score =   243 bits (619),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 109/190 (57%), Positives = 151/190 (79%), Gaps = 2/190 (1%)
 Frame = +1

Query  244  ASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKL--LENEGDPQDPVAYDSGVTYMFIQ  417
            ASA+F LD+KG+ L+ R+YRGD+  +  E+F   L   E E     P   D G+ Y++I+
Sbjct  2    ASAVFFLDLKGKTLLARNYRGDIPMSAVEKFPILLSEAEEESSAVPPCFSDEGINYLYIR  61

Query  418  HNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEIMDFG  597
            HNN+YL+  +++N NAA +LLFLH++V+VF  YF+ELEEES+RDNFV++YELLDE+MDFG
Sbjct  62   HNNLYLLALTKRNTNAAEILLFLHKIVEVFTEYFKELEEESIRDNFVIIYELLDEMMDFG  121

Query  598  YPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVESVNIL  777
            YPQ TE+KIL E+I  +++++E+  RPP+AVTNAVSWRSEGI Y+KNEVFLDV+ES+N+L
Sbjct  122  YPQTTESKILQEYITQESHKLEIQARPPIAVTNAVSWRSEGIRYRKNEVFLDVIESLNLL  181

Query  778  VNSNGQIVRS  807
            V+S G ++RS
Sbjct  182  VSSTGSVLRS  191



>ref|XP_003046939.1| predicted protein [Nectria haematococca mpVI 77-13-4]
 gb|EEU41226.1| predicted protein [Nectria haematococca mpVI 77-13-4]
Length=431

 Score =   242 bits (617),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 110/190 (58%), Positives = 151/190 (79%), Gaps = 2/190 (1%)
 Frame = +1

Query  244  ASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGDPQ--DPVAYDSGVTYMFIQ  417
            ASALF LD+KG+ L+ R+YRGD+  +  E+F   L E E D     P     G+ Y++I+
Sbjct  2    ASALFFLDLKGKTLLARNYRGDIPMSAVEKFPVLLSEAEEDSSAVPPCFSHEGINYLYIR  61

Query  418  HNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEIMDFG  597
            HNN+YL+  +++N NAA +LLFLH++V+VF  YF+ LEEES+RDNFV++YELLDE+MDFG
Sbjct  62   HNNLYLLALTKRNTNAAEILLFLHKIVEVFTEYFKALEEESIRDNFVIIYELLDEMMDFG  121

Query  598  YPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVESVNIL  777
            YPQ TE+KIL E+I  +++++E+  RPP+AVTNAVSWRSEGI Y+KNEVFLDVVES+N+L
Sbjct  122  YPQTTESKILQEYITQESHKLEIQARPPIAVTNAVSWRSEGIRYRKNEVFLDVVESLNLL  181

Query  778  VNSNGQIVRS  807
            V++NG ++RS
Sbjct  182  VSANGNVLRS  191



>gb|KIW68394.1| AP-1 complex subunit mu-1 [Capronia semiimmersa]
Length=448

 Score =   242 bits (618),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 109/190 (57%), Positives = 152/190 (80%), Gaps = 2/190 (1%)
 Frame = +1

Query  244  ASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKL--LENEGDPQDPVAYDSGVTYMFIQ  417
            ASA+F LD+KG+ L+ R+YRGD+  +  E+F   L   E E     P   D G+ Y++I+
Sbjct  2    ASAIFFLDLKGKTLLARNYRGDIPMSAVEKFPILLSEAEEESSAVPPCFSDEGINYLYIR  61

Query  418  HNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEIMDFG  597
            HNN+YL+  +++N NAA +LLFLH++V+VF  YF+ELEEES+RDNFV++YELLDE+MDFG
Sbjct  62   HNNLYLLALTKRNTNAAEILLFLHKIVEVFTEYFKELEEESIRDNFVIIYELLDEMMDFG  121

Query  598  YPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVESVNIL  777
            YPQ TE+KIL E+I  +++++EV  RPP+AVTNAVSWRSEGI Y+KNEVFLDV+ES+N+L
Sbjct  122  YPQTTESKILQEYITQESHKLEVQARPPIAVTNAVSWRSEGIRYRKNEVFLDVIESLNLL  181

Query  778  VNSNGQIVRS  807
            V+++G ++RS
Sbjct  182  VSASGNVLRS  191



>gb|KGB76445.1| clathrin assembly protein AP47 [Cryptococcus gattii R265]
 gb|KIR27604.1| AP-1 complex subunit mu-1 [Cryptococcus gattii LA55]
 gb|KIR33310.1| AP-1 complex subunit mu-1 [Cryptococcus gattii MMRL2647]
 gb|KIR41946.1| AP-1 complex subunit mu-1 [Cryptococcus gattii Ram5]
 gb|KIR73229.1| AP-1 complex subunit mu-1 [Cryptococcus gattii CA1014]
 gb|KIR91564.1| AP-1 complex subunit mu-1 [Cryptococcus gattii CBS 10090]
 gb|KIR98985.1| AP-1 complex subunit mu-1 [Cryptococcus gattii 2001/935-1]
 gb|KIY59940.1| AP-1 complex subunit mu-1 [Cryptococcus gattii 99/473]
Length=435

 Score =   242 bits (617),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 114/190 (60%), Positives = 147/190 (77%), Gaps = 2/190 (1%)
 Frame = +1

Query  244  ASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGD--PQDPVAYDSGVTYMFIQ  417
            AS + +LDVKG+ L+ R YR DV  +  ERF   +L+ E D  P  P   D GV YM I+
Sbjct  2    ASLVAILDVKGKSLIQRSYRDDVPPSYIERFLPLILDMEEDNVPVTPCFSDEGVNYMHIR  61

Query  418  HNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEIMDFG  597
            HNN+YL+  S++N NAA ++ FLHR+  V   YF+ELEEES+RDNFV++YELLDE+MDFG
Sbjct  62   HNNLYLLALSKKNSNAAEVIFFLHRLCSVLTEYFKELEEESIRDNFVIIYELLDEMMDFG  121

Query  598  YPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVESVNIL  777
            YPQ TE+KIL E+I  +++++EV  RPPMAVTNAVSWRSEGI Y+KNEVFLDVVESVN+L
Sbjct  122  YPQTTESKILQEYITQESHKLEVQVRPPMAVTNAVSWRSEGIRYRKNEVFLDVVESVNLL  181

Query  778  VNSNGQIVRS  807
            VN++G ++RS
Sbjct  182  VNASGSVIRS  191



>gb|EGC47112.1| AP-1 complex subunit mu [Histoplasma capsulatum H88]
Length=447

 Score =   242 bits (618),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 109/190 (57%), Positives = 152/190 (80%), Gaps = 2/190 (1%)
 Frame = +1

Query  244  ASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKL--LENEGDPQDPVAYDSGVTYMFIQ  417
            ASA+F LD+KG+ L+ R+YRGD+  +  E+F   L   E E     P   D G+ Y++I+
Sbjct  2    ASAIFFLDLKGKTLLARNYRGDIPMSAVEKFPILLSEAEEESSAVPPCFSDEGINYLYIR  61

Query  418  HNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEIMDFG  597
            H+N+YL+  +++N NAA +LLFLH++V+VF  YF+ELEEES+RDNFV++YELLDE+MDFG
Sbjct  62   HSNLYLLALTKRNTNAAEILLFLHKIVEVFTEYFKELEEESIRDNFVIIYELLDEMMDFG  121

Query  598  YPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVESVNIL  777
            YPQ TE+KIL E+I  +++++E+  RPP+AVTNAVSWRSEGI Y+KNEVFLDVVES+N+L
Sbjct  122  YPQTTESKILQEYITQESHKLEIQARPPIAVTNAVSWRSEGIRYRKNEVFLDVVESLNLL  181

Query  778  VNSNGQIVRS  807
            V++NG ++RS
Sbjct  182  VSANGNVLRS  191



>ref|XP_009258514.1| hypothetical protein FPSE_07121 [Fusarium pseudograminearum CS3096]
 gb|EKJ72721.1| hypothetical protein FPSE_07121 [Fusarium pseudograminearum CS3096]
 gb|EYB30466.1| hypothetical protein FG05_08982 [Fusarium graminearum]
 emb|CEF85586.1| unnamed protein product [Fusarium graminearum]
Length=448

 Score =   242 bits (618),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 111/190 (58%), Positives = 151/190 (79%), Gaps = 2/190 (1%)
 Frame = +1

Query  244  ASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGDPQ--DPVAYDSGVTYMFIQ  417
            ASALF LD+KG+ L+ R+YRGD+  +  E+F   L E E D     P     G+ Y++I+
Sbjct  2    ASALFFLDLKGKTLLARNYRGDIPMSAVEKFPVLLSEAEEDSSAVPPCFSHEGINYLYIR  61

Query  418  HNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEIMDFG  597
            HNN+YL+  +++N NAA +LLFLH+VV+VF  YF+ LEEES+RDNFV++YELLDE+MDFG
Sbjct  62   HNNLYLLALTKRNTNAAEILLFLHKVVEVFTEYFKALEEESIRDNFVIIYELLDEMMDFG  121

Query  598  YPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVESVNIL  777
            YPQ TE+KIL E+I  +++++E+  RPP+AVTNAVSWRSEGI Y+KNEVFLDVVES+N+L
Sbjct  122  YPQTTESKILQEYITQESHKLEIQARPPIAVTNAVSWRSEGIRYRKNEVFLDVVESLNLL  181

Query  778  VNSNGQIVRS  807
            V++NG ++RS
Sbjct  182  VSANGNVLRS  191



>ref|XP_008726361.1| hypothetical protein G647_03794 [Cladophialophora carrionii CBS 
160.54]
 gb|ETI24425.1| hypothetical protein G647_03794 [Cladophialophora carrionii CBS 
160.54]
Length=448

 Score =   242 bits (618),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 109/190 (57%), Positives = 151/190 (79%), Gaps = 2/190 (1%)
 Frame = +1

Query  244  ASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKL--LENEGDPQDPVAYDSGVTYMFIQ  417
            ASA+F LD+KG+ L+ R+YRGD+  +  E+F   L   E E     P   D G+ Y++I+
Sbjct  2    ASAIFFLDLKGKTLLARNYRGDIPMSAVEKFPVLLSEAEEESSAVPPCFSDEGINYLYIR  61

Query  418  HNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEIMDFG  597
            HNN+YL+  +++N NAA +LLFLH++V+VF  YF+ELEEES+RDNFV++YELLDE+MDFG
Sbjct  62   HNNLYLLALTKRNTNAAEILLFLHKIVEVFTEYFKELEEESIRDNFVIIYELLDEMMDFG  121

Query  598  YPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVESVNIL  777
            YPQ TE+KIL E+I  +++++EV  RPP+AVTNAVSWRSEGI Y+KNEVFLDV+ES+N+L
Sbjct  122  YPQTTESKILQEYITQESHKLEVQARPPIAVTNAVSWRSEGIRYRKNEVFLDVIESLNLL  181

Query  778  VNSNGQIVRS  807
            V++ G ++RS
Sbjct  182  VSATGNVLRS  191



>ref|XP_008713084.1| hypothetical protein HMPREF1541_10191 [Cyphellophora europaea 
CBS 101466]
 gb|ETN44521.1| hypothetical protein HMPREF1541_10191 [Cyphellophora europaea 
CBS 101466]
Length=449

 Score =   242 bits (618),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 109/190 (57%), Positives = 153/190 (81%), Gaps = 2/190 (1%)
 Frame = +1

Query  244  ASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGDPQ--DPVAYDSGVTYMFIQ  417
            ASALF LD+KG+ L+ R+YRGD+  +  E+F   L E E +     P   D G+ Y++I+
Sbjct  2    ASALFFLDLKGKTLLARNYRGDIPMSAVEKFPVLLAEAEEESSAVPPCFSDEGINYLYIR  61

Query  418  HNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEIMDFG  597
            H+N+YL+  +++N NAA +LLFLH++V+VF  YF+ELEEES+RDNFV++YELLDE+MDFG
Sbjct  62   HSNLYLLALTKRNTNAAEILLFLHKIVEVFTEYFKELEEESIRDNFVIIYELLDEMMDFG  121

Query  598  YPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVESVNIL  777
            YPQ TE+KIL E+I  +++++E+  RPP+AVTNAVSWRSEGI Y+KNEVFLDVVES+N+L
Sbjct  122  YPQTTESKILQEYITQESHKLEIQARPPIAVTNAVSWRSEGIRYRKNEVFLDVVESLNLL  181

Query  778  VNSNGQIVRS  807
            V+++G ++RS
Sbjct  182  VSASGNVLRS  191



>ref|XP_002628381.1| clathrin assembly protein [Blastomyces dermatitidis SLH14081]
 gb|EEQ73059.1| clathrin assembly protein [Blastomyces dermatitidis SLH14081]
 gb|EEQ89191.1| clathrin assembly protein [Blastomyces dermatitidis ER-3]
 gb|EGE82005.1| hypothetical protein BDDG_04948 [Blastomyces dermatitidis ATCC 
18188]
 gb|EQL33329.1| AP-1 complex subunit mu-1 [Blastomyces dermatitidis ATCC 26199]
 gb|EQL33330.1| AP-1 complex subunit mu-1, variant [Blastomyces dermatitidis 
ATCC 26199]
Length=447

 Score =   242 bits (617),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 109/190 (57%), Positives = 152/190 (80%), Gaps = 2/190 (1%)
 Frame = +1

Query  244  ASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKL--LENEGDPQDPVAYDSGVTYMFIQ  417
            ASA+F LD+KG+ L+ R+YRGD+  +  E+F   L   E E     P   D G+ Y++I+
Sbjct  2    ASAVFFLDLKGKTLLARNYRGDIPMSAVEKFPILLSEAEEESSAVPPCFSDEGINYLYIR  61

Query  418  HNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEIMDFG  597
            H+N+YL+  +++N NAA +LLFLH++V+VF  YF+ELEEES+RDNFV++YELLDE+MDFG
Sbjct  62   HSNLYLLALTKRNTNAAEILLFLHKIVEVFTEYFKELEEESIRDNFVIIYELLDEMMDFG  121

Query  598  YPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVESVNIL  777
            YPQ TE+KIL E+I  +++++E+  RPP+AVTNAVSWRSEGI Y+KNEVFLDVVES+N+L
Sbjct  122  YPQTTESKILQEYITQESHKLEIQARPPIAVTNAVSWRSEGIRYRKNEVFLDVVESLNLL  181

Query  778  VNSNGQIVRS  807
            V++NG ++RS
Sbjct  182  VSANGNVLRS  191



>gb|EGU82568.1| hypothetical protein FOXB_06934 [Fusarium oxysporum Fo5176]
 gb|EMT69849.1| AP-1 complex subunit mu-1 [Fusarium oxysporum f. sp. cubense 
race 4]
 gb|ENH70387.1| AP-1 complex subunit mu-1 [Fusarium oxysporum f. sp. cubense 
race 1]
 emb|CCT70981.1| probable clathrin assembly protein AP47 [Fusarium fujikuroi IMI 
58289]
 gb|EWG46046.1| AP-1 complex subunit mu-1 [Fusarium verticillioides 7600]
 gb|EWY87389.1| AP-1 complex subunit mu-1 [Fusarium oxysporum FOSC 3-a]
 gb|EWY87390.1| AP-1 complex subunit mu-1 [Fusarium oxysporum FOSC 3-a]
 gb|EWZ34298.1| AP-1 complex subunit mu-1 [Fusarium oxysporum Fo47]
 gb|EWZ34299.1| AP-1 complex subunit mu-1 [Fusarium oxysporum Fo47]
 gb|EWZ95606.1| AP-1 complex subunit mu-1 [Fusarium oxysporum f. sp. lycopersici 
MN25]
 gb|EWZ95607.1| AP-1 complex subunit mu-1 [Fusarium oxysporum f. sp. lycopersici 
MN25]
 gb|EXA38249.1| AP-1 complex subunit mu-1 [Fusarium oxysporum f. sp. pisi HDV247]
 gb|EXA38250.1| AP-1 complex subunit mu-1 [Fusarium oxysporum f. sp. pisi HDV247]
 gb|EXK36937.1| AP-1 complex subunit mu-1 [Fusarium oxysporum f. sp. melonis 
26406]
 gb|EXK36938.1| AP-1 complex subunit mu-1 [Fusarium oxysporum f. sp. melonis 
26406]
 gb|EXK95592.1| AP-1 complex subunit mu-1 [Fusarium oxysporum f. sp. raphani 
54005]
 gb|EXK95593.1| AP-1 complex subunit mu-1 [Fusarium oxysporum f. sp. raphani 
54005]
 gb|EXL48011.1| AP-1 complex subunit mu-1 [Fusarium oxysporum f. sp. radicis-lycopersici 
26381]
 gb|EXL48012.1| AP-1 complex subunit mu-1 [Fusarium oxysporum f. sp. radicis-lycopersici 
26381]
 gb|EXL74955.1| AP-1 complex subunit mu-1 [Fusarium oxysporum f. sp. conglutinans 
race 2 54008]
 gb|EXL74956.1| AP-1 complex subunit mu-1 [Fusarium oxysporum f. sp. conglutinans 
race 2 54008]
 gb|EXM04594.1| AP-1 complex subunit mu-1 [Fusarium oxysporum f. sp. cubense 
tropical race 4 54006]
 gb|EXM04595.1| AP-1 complex subunit mu-1 [Fusarium oxysporum f. sp. cubense 
tropical race 4 54006]
 gb|EXM26288.1| AP-1 complex subunit mu-1 [Fusarium oxysporum f. sp. vasinfectum 
25433]
 gb|EXM26289.1| AP-1 complex subunit mu-1 [Fusarium oxysporum f. sp. vasinfectum 
25433]
Length=448

 Score =   242 bits (617),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 110/190 (58%), Positives = 151/190 (79%), Gaps = 2/190 (1%)
 Frame = +1

Query  244  ASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGDPQ--DPVAYDSGVTYMFIQ  417
            ASALF LD+KG+ L+ R+YRGD+  +  E+F   L E E D     P     G+ Y++I+
Sbjct  2    ASALFFLDLKGKTLLARNYRGDIPMSAVEKFPVLLSEAEEDSSAVPPCFSHEGINYLYIR  61

Query  418  HNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEIMDFG  597
            HNN+YL+  +++N NAA +LLFLH++V+VF  YF+ LEEES+RDNFV++YELLDE+MDFG
Sbjct  62   HNNLYLLALTKRNTNAAEILLFLHKIVEVFTEYFKALEEESIRDNFVIIYELLDEMMDFG  121

Query  598  YPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVESVNIL  777
            YPQ TE+KIL E+I  +++++E+  RPP+AVTNAVSWRSEGI Y+KNEVFLDVVES+N+L
Sbjct  122  YPQTTESKILQEYITQESHKLEIQARPPIAVTNAVSWRSEGIRYRKNEVFLDVVESLNLL  181

Query  778  VNSNGQIVRS  807
            V++NG ++RS
Sbjct  182  VSANGNVLRS  191



>ref|XP_572014.1| clathrin assembly protein AP47 [Cryptococcus neoformans var. 
neoformans JEC21]
 gb|AAW44707.1| clathrin assembly protein AP47, putative [Cryptococcus neoformans 
var. neoformans JEC21]
Length=435

 Score =   241 bits (616),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 114/190 (60%), Positives = 146/190 (77%), Gaps = 2/190 (1%)
 Frame = +1

Query  244  ASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGD--PQDPVAYDSGVTYMFIQ  417
            AS + +LDVKG+ L+ R YR DV  +  ERF   +LE E D  P  P   D GV YM I+
Sbjct  2    ASLVAILDVKGKSLIQRSYRDDVPTSYIERFLPLILEMEEDNVPVTPCFSDEGVNYMHIR  61

Query  418  HNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEIMDFG  597
            HNN+YL+  S++N NA  ++ FLHR+  V   YF+ELEEES+RDNFV++YELLDE+MDFG
Sbjct  62   HNNLYLLALSKKNSNAVEVIFFLHRLCSVLTEYFKELEEESIRDNFVIIYELLDEMMDFG  121

Query  598  YPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVESVNIL  777
            YPQ TE+KIL E+I  +++++EV  RPPMAVTNAVSWRSEGI Y+KNEVFLDVVESVN+L
Sbjct  122  YPQTTESKILQEYITQESHKLEVQVRPPMAVTNAVSWRSEGIRYRKNEVFLDVVESVNLL  181

Query  778  VNSNGQIVRS  807
            VN++G ++RS
Sbjct  182  VNASGNVIRS  191



>gb|ELR03617.1| AP-1 complex subunit mu [Pseudogymnoascus destructans 20631-21]
Length=448

 Score =   242 bits (617),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 110/190 (58%), Positives = 151/190 (79%), Gaps = 2/190 (1%)
 Frame = +1

Query  244  ASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKL--LENEGDPQDPVAYDSGVTYMFIQ  417
             SA+F LD+KG+ L+ R+YRGD+  +  E+F   L   E E     P   D G+ Y++I+
Sbjct  2    TSAVFFLDLKGKTLLARNYRGDIPMSAVEKFPILLSDAEEESSAVPPCFSDEGINYLYIR  61

Query  418  HNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEIMDFG  597
            HNN+YL+  +++N NAA +LLFLH++V+VF  YF+ELEEES+RDNFVV+YELLDE+MDFG
Sbjct  62   HNNLYLLALTKRNTNAAEILLFLHKIVEVFTEYFKELEEESIRDNFVVIYELLDEMMDFG  121

Query  598  YPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVESVNIL  777
            YPQ TE+KIL E+I  +++++EV  RPP+AVTNAVSWRSEGI Y+KNEVFLDV+ES+N+L
Sbjct  122  YPQTTESKILQEYITQESHKLEVQARPPIAVTNAVSWRSEGIRYRKNEVFLDVIESLNLL  181

Query  778  VNSNGQIVRS  807
            V+S+G ++RS
Sbjct  182  VSSSGNVLRS  191



>gb|KEQ94894.1| hypothetical protein AUEXF2481DRAFT_65833 [Aureobasidium subglaciale 
EXF-2481]
Length=448

 Score =   242 bits (617),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 111/190 (58%), Positives = 152/190 (80%), Gaps = 2/190 (1%)
 Frame = +1

Query  244  ASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKL--LENEGDPQDPVAYDSGVTYMFIQ  417
            ASALF LD+KG+ L+ R+YRGD+  +  ++F   L   E E     P   D G+ Y++I+
Sbjct  2    ASALFFLDLKGKTLLARNYRGDIPMSAVDKFPILLSDAEEESSAVPPCFSDEGINYLYIR  61

Query  418  HNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEIMDFG  597
            HNN+YL+  +++N NAA +LLFLH++V+VF  YF+ELEEES+RDNFVV+YELLDE+MDFG
Sbjct  62   HNNLYLLALTKRNSNAAEILLFLHKIVEVFTEYFKELEEESIRDNFVVIYELLDEMMDFG  121

Query  598  YPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVESVNIL  777
            +PQ TE+KIL E+I  +++++EV  RPP+AVTNAVSWRSEGI Y+KNEVFLDVVES+N+L
Sbjct  122  HPQTTESKILQEYITQESHKLEVQARPPIAVTNAVSWRSEGIRYRKNEVFLDVVESLNLL  181

Query  778  VNSNGQIVRS  807
            V+S+G ++RS
Sbjct  182  VSSSGSVLRS  191



>gb|EEH05458.1| AP-1 complex subunit mu-1 [Histoplasma capsulatum G186AR]
 gb|EER41226.1| AP-1 complex subunit mu [Histoplasma capsulatum H143]
Length=455

 Score =   242 bits (617),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 109/190 (57%), Positives = 152/190 (80%), Gaps = 2/190 (1%)
 Frame = +1

Query  244  ASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKL--LENEGDPQDPVAYDSGVTYMFIQ  417
            ASA+F LD+KG+ L+ R+YRGD+  +  E+F   L   E E     P   D G+ Y++I+
Sbjct  2    ASAIFFLDLKGKTLLARNYRGDIPMSAVEKFPILLSEAEEESSAVPPCFSDEGINYLYIR  61

Query  418  HNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEIMDFG  597
            H+N+YL+  +++N NAA +LLFLH++V+VF  YF+ELEEES+RDNFV++YELLDE+MDFG
Sbjct  62   HSNLYLLALTKRNTNAAEILLFLHKIVEVFTEYFKELEEESIRDNFVIIYELLDEMMDFG  121

Query  598  YPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVESVNIL  777
            YPQ TE+KIL E+I  +++++E+  RPP+AVTNAVSWRSEGI Y+KNEVFLDVVES+N+L
Sbjct  122  YPQTTESKILQEYITQESHKLEIQARPPIAVTNAVSWRSEGIRYRKNEVFLDVVESLNLL  181

Query  778  VNSNGQIVRS  807
            V++NG ++RS
Sbjct  182  VSANGNVLRS  191



>gb|EQK97616.1| adaptor complexes medium subunit family protein [Ophiocordyceps 
sinensis CO18]
Length=448

 Score =   242 bits (617),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 112/190 (59%), Positives = 149/190 (78%), Gaps = 2/190 (1%)
 Frame = +1

Query  244  ASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKL--LENEGDPQDPVAYDSGVTYMFIQ  417
            ASALF LD+KG+ L+ R+YRGD+  +  E+F   L   E E     P     G+ Y++I+
Sbjct  2    ASALFFLDLKGKTLLARNYRGDIPMSAVEKFPILLSEAEEESSAVPPCFSHEGINYLYIR  61

Query  418  HNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEIMDFG  597
            HNN+YL+  +++N NAA +LLFLH++V+VF  YF+ LEEES+RDNFVV+YELLDE+MDFG
Sbjct  62   HNNLYLLALTKRNTNAAEILLFLHKIVEVFTEYFKALEEESIRDNFVVIYELLDEMMDFG  121

Query  598  YPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVESVNIL  777
            YPQ TE KIL E+I  +++++EV  RPP+AVTNAVSWRSEGI Y+KNEVFLDVVES+N+L
Sbjct  122  YPQTTETKILQEYITQESHKLEVQARPPIAVTNAVSWRSEGIRYRKNEVFLDVVESLNLL  181

Query  778  VNSNGQIVRS  807
            V+SNG ++RS
Sbjct  182  VSSNGNVLRS  191



>gb|KEQ61137.1| putative AP-1 adaptor complex subunit MU [Aureobasidium melanogenum 
CBS 110374]
Length=448

 Score =   241 bits (616),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 110/190 (58%), Positives = 152/190 (80%), Gaps = 2/190 (1%)
 Frame = +1

Query  244  ASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKL--LENEGDPQDPVAYDSGVTYMFIQ  417
            ASALF LD+KG+ L+ R+YRGD+  +  ++F   L   E E     P   D G+ Y++I+
Sbjct  2    ASALFFLDLKGKTLLARNYRGDIPMSAVDKFPVLLSEAEEESSAVPPCFSDEGINYLYIR  61

Query  418  HNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEIMDFG  597
            HNN+YL+  +++N NAA +LLFLH++V+VF  YF+ELEEES+RDNFV++YELLDE+MDFG
Sbjct  62   HNNLYLLALTKRNSNAAEILLFLHKIVEVFTEYFKELEEESIRDNFVIIYELLDEMMDFG  121

Query  598  YPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVESVNIL  777
            +PQ TE+KIL E+I  +++++EV  RPP+AVTNAVSWRSEGI Y+KNEVFLDVVES+N+L
Sbjct  122  HPQTTESKILQEYITQESHKLEVQARPPIAVTNAVSWRSEGIRYRKNEVFLDVVESLNLL  181

Query  778  VNSNGQIVRS  807
            V+S+G ++RS
Sbjct  182  VSSSGNVLRS  191



>gb|KEQ74689.1| clathrin adaptor, mu subunit [Aureobasidium pullulans var. namibiae 
CBS 147.97]
Length=448

 Score =   241 bits (616),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 111/190 (58%), Positives = 151/190 (79%), Gaps = 2/190 (1%)
 Frame = +1

Query  244  ASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKL--LENEGDPQDPVAYDSGVTYMFIQ  417
            ASALF LD+KG+ L+ R+YRGD+  +  ++F   L   E E     P   D G+ Y++I+
Sbjct  2    ASALFFLDLKGKTLLARNYRGDIPMSAVDKFPILLSEAEEESSAVPPCFSDEGINYLYIR  61

Query  418  HNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEIMDFG  597
            HNN+YL+  +++N NAA +LLFLH++V+VF  YF+ELEEES+RDNFVV+YELLDE+MDFG
Sbjct  62   HNNLYLLALTKRNSNAAEILLFLHKIVEVFTEYFKELEEESIRDNFVVIYELLDEMMDFG  121

Query  598  YPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVESVNIL  777
            +PQ TE+KIL E+I  +++++EV  RPP+AVTNAVSWRSEGI Y+KNEVFLDVVES+N+L
Sbjct  122  HPQTTESKILQEYITQESHKLEVQARPPIAVTNAVSWRSEGIRYRKNEVFLDVVESLNLL  181

Query  778  VNSNGQIVRS  807
            V+S G ++RS
Sbjct  182  VSSTGNVLRS  191



>ref|XP_007915060.1| putative ap-1 complex subunit mu-1 protein [Togninia minima UCRPA7]
 gb|EOO00237.1| putative ap-1 complex subunit mu-1 protein [Togninia minima UCRPA7]
Length=464

 Score =   242 bits (617),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 111/190 (58%), Positives = 150/190 (79%), Gaps = 2/190 (1%)
 Frame = +1

Query  244  ASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKL--LENEGDPQDPVAYDSGVTYMFIQ  417
            ASALF LD+KG+ L+ R+YRGD+  +  E+F   L   E E     P     G+ Y++I+
Sbjct  2    ASALFFLDLKGKTLLARNYRGDIPMSAVEKFPVLLSEAEEESSAVPPCFSHEGINYLYIR  61

Query  418  HNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEIMDFG  597
            HNN+YL+  +++N NAA +LLFLH+VV+VF  YF+ LEEES+RDNFV++YELLDE+MDFG
Sbjct  62   HNNLYLLALTKRNTNAAEILLFLHKVVEVFTEYFKALEEESIRDNFVIIYELLDEMMDFG  121

Query  598  YPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVESVNIL  777
            YPQ TE+KIL E+I  ++++ME+  RPP+AVTNAVSWRSEGI Y+KNEVFLDVVES+N+L
Sbjct  122  YPQTTESKILQEYITQESHKMEIQARPPIAVTNAVSWRSEGIRYRKNEVFLDVVESLNLL  181

Query  778  VNSNGQIVRS  807
            V++NG ++RS
Sbjct  182  VSANGNVLRS  191



>ref|XP_007778245.1| AP-1 complex subunit mu-1 [Coniosporium apollinis CBS 100218]
 gb|EON62928.1| AP-1 complex subunit mu-1 [Coniosporium apollinis CBS 100218]
Length=446

 Score =   241 bits (616),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 109/190 (57%), Positives = 151/190 (79%), Gaps = 2/190 (1%)
 Frame = +1

Query  244  ASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKL--LENEGDPQDPVAYDSGVTYMFIQ  417
            ASA+F LD+KG+ L+ R+YRGD+  +  E+F   L   E E     P     G+ Y++I+
Sbjct  2    ASAVFFLDLKGKTLLARNYRGDIPMSAVEKFPILLSEAEEESSAVPPCFSSEGINYLYIR  61

Query  418  HNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEIMDFG  597
            HNN+YL+  +++N NAA +LLFLH++V+VF  YF+ELEEES+RDNFV++YELLDE+MDFG
Sbjct  62   HNNLYLLALTKRNTNAAEILLFLHKIVEVFTEYFKELEEESIRDNFVIIYELLDEMMDFG  121

Query  598  YPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVESVNIL  777
            YPQ TE+KIL E+I  +++++EV  RPP+AVTNAVSWRSEGI Y+KNEVFLDV+ES+N+L
Sbjct  122  YPQTTESKILQEYITQESHKLEVQARPPIAVTNAVSWRSEGIRYRKNEVFLDVIESLNLL  181

Query  778  VNSNGQIVRS  807
            V++NG ++RS
Sbjct  182  VSANGNVLRS  191



>ref|XP_006964712.1| adaptor protein complex AP-1 medium subunit [Trichoderma reesei 
QM6a]
 gb|EGR49584.1| adaptor protein complex AP-1 medium subunit [Trichoderma reesei 
QM6a]
 gb|ETS02923.1| putative clathrin assembly protein AP47 [Trichoderma reesei RUT 
C-30]
Length=446

 Score =   241 bits (616),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 111/190 (58%), Positives = 150/190 (79%), Gaps = 2/190 (1%)
 Frame = +1

Query  244  ASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKL--LENEGDPQDPVAYDSGVTYMFIQ  417
            ASALF LD+KG+ L+ R+YRGD+  +  E+F   L   E E     P     G+ Y++I+
Sbjct  2    ASALFFLDLKGKTLLARNYRGDIPMSAVEKFPVLLSEAEEESSAVPPCFSHEGINYLYIR  61

Query  418  HNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEIMDFG  597
            HNN+YL+  +++N NAA +LLFLH+VV+VF  YF+ LEEES+RDNFVV+YELLDE+MDFG
Sbjct  62   HNNLYLLALTKRNTNAAGILLFLHKVVEVFTEYFKALEEESIRDNFVVIYELLDEMMDFG  121

Query  598  YPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVESVNIL  777
            YPQ TE+KIL E+I  +++++E+  RPP+AVTNAVSWRSEGI Y+KNEVFLDVVES+N+L
Sbjct  122  YPQTTESKILQEYITQESHKLEIQARPPIAVTNAVSWRSEGIRYRKNEVFLDVVESLNLL  181

Query  778  VNSNGQIVRS  807
            V++NG ++RS
Sbjct  182  VSANGNVLRS  191



>ref|XP_005785717.1| Apm1, medium subunit of the adaptin 1 complex [Emiliania huxleyi 
CCMP1516]
 ref|XP_005785718.1| Adaptor protein 1 medium subunit [Emiliania huxleyi CCMP1516]
 gb|EOD33288.1| Apm1, medium subunit of the adaptin 1 complex [Emiliania huxleyi 
CCMP1516]
 gb|EOD33289.1| Adaptor protein 1 medium subunit [Emiliania huxleyi CCMP1516]
Length=428

 Score =   241 bits (614),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 110/189 (58%), Positives = 154/189 (81%), Gaps = 1/189 (1%)
 Frame = +1

Query  241  AASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGDPQDPVAYDSGVTYMFIQH  420
             ASA+F+LD+KG+V++ R+YRGDV     ERF   +LE E + + PV  + G TY++I++
Sbjct  2    TASAVFILDMKGKVIISRNYRGDVPMNCVERFSGHVLEAEANDERPVWLEHGTTYIYIKY  61

Query  421  NNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEIMDFGY  600
            NN+Y+M  +++N NAA +LLFL+R+V+VFK YF+ELEEES+RDNFV+ YEL+DE+MDFGY
Sbjct  62   NNLYIMAVTQRNSNAAMILLFLYRLVEVFKDYFKELEEESIRDNFVITYELMDEMMDFGY  121

Query  601  PQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVESVNILV  780
            PQ +E KIL E+I  +A+++EV  +PPMAVTNAVSWRSEGI ++KNE+FLDVVE +N+LV
Sbjct  122  PQVSEPKILREYITQEAHKLEVV-KPPMAVTNAVSWRSEGIKHRKNEIFLDVVERLNLLV  180

Query  781  NSNGQIVRS  807
             +NG ++RS
Sbjct  181  AANGTLLRS  189



>gb|EHK41969.1| hypothetical protein TRIATDRAFT_229300 [Trichoderma atroviride 
IMI 206040]
Length=446

 Score =   241 bits (615),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 111/190 (58%), Positives = 150/190 (79%), Gaps = 2/190 (1%)
 Frame = +1

Query  244  ASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKL--LENEGDPQDPVAYDSGVTYMFIQ  417
            ASALF LD+KG+ L+ R+YRGD+  +  E+F   L   E E     P     G+ Y++I+
Sbjct  2    ASALFFLDLKGKTLLARNYRGDIPMSAVEKFPVLLSEAEEESSAVPPCFSHEGINYLYIR  61

Query  418  HNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEIMDFG  597
            HNN+YL+  +++N NAA +LLFLH+VV+VF  YF+ LEEES+RDNFVV+YELLDE+MDFG
Sbjct  62   HNNLYLLALTKRNTNAAEILLFLHKVVEVFTEYFKALEEESIRDNFVVIYELLDEMMDFG  121

Query  598  YPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVESVNIL  777
            YPQ TE+KIL E+I  +++++E+  RPP+AVTNAVSWRSEGI Y+KNEVFLDVVES+N+L
Sbjct  122  YPQTTESKILQEYITQESHKLEIQARPPIAVTNAVSWRSEGIRYRKNEVFLDVVESLNLL  181

Query  778  VNSNGQIVRS  807
            V++NG ++RS
Sbjct  182  VSANGNVLRS  191



>gb|KIL95550.1| hypothetical protein FAVG1_00287 [Fusarium avenaceum]
Length=448

 Score =   241 bits (615),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 110/190 (58%), Positives = 151/190 (79%), Gaps = 2/190 (1%)
 Frame = +1

Query  244  ASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGDPQ--DPVAYDSGVTYMFIQ  417
            ASALF LD+KG+ L+ R+YRGD+  +  E+F   L E E D     P     G+ Y++I+
Sbjct  2    ASALFFLDLKGKTLLARNYRGDLPMSAVEKFPVLLSEAEEDSSAVPPCFSHEGINYLYIR  61

Query  418  HNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEIMDFG  597
            HNN+YL+  +++N NAA +LLFLH++V+VF  YF+ LEEES+RDNFV++YELLDE+MDFG
Sbjct  62   HNNLYLLALTKRNTNAAEILLFLHKIVEVFTEYFKALEEESIRDNFVIIYELLDEMMDFG  121

Query  598  YPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVESVNIL  777
            YPQ TE+KIL E+I  +++++E+  RPP+AVTNAVSWRSEGI Y+KNEVFLDVVES+N+L
Sbjct  122  YPQTTESKILQEYITQESHKLEIQARPPIAVTNAVSWRSEGIRYRKNEVFLDVVESLNLL  181

Query  778  VNSNGQIVRS  807
            V++NG ++RS
Sbjct  182  VSANGNVLRS  191



>gb|KEQ79897.1| clathrin adaptor, mu subunit [Aureobasidium pullulans EXF-150]
Length=448

 Score =   241 bits (615),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 110/190 (58%), Positives = 151/190 (79%), Gaps = 2/190 (1%)
 Frame = +1

Query  244  ASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKL--LENEGDPQDPVAYDSGVTYMFIQ  417
            ASALF LD+KG+ L+ R+YRGD+  +  ++F   L   E E     P   D G+ Y++I+
Sbjct  2    ASALFFLDLKGKTLLARNYRGDIPMSAVDKFPILLSDAEEESSAVPPCFSDEGINYLYIR  61

Query  418  HNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEIMDFG  597
            HNN+YL+  +++N NAA +LLFLH++V+VF  YF+ELEEES+RDNFV++YELLDE+MDFG
Sbjct  62   HNNLYLLALTKRNSNAAEILLFLHKIVEVFTEYFKELEEESIRDNFVIIYELLDEMMDFG  121

Query  598  YPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVESVNIL  777
            +PQ TE+KIL E+I  +++++EV  RPP+AVTNAVSWRSEGI Y+KNEVFLDVVES+N+L
Sbjct  122  HPQTTESKILQEYITQESHKLEVQARPPIAVTNAVSWRSEGIRYRKNEVFLDVVESLNLL  181

Query  778  VNSNGQIVRS  807
            V+S G ++RS
Sbjct  182  VSSTGSVLRS  191



>ref|XP_003710726.1| AP-1 complex subunit mu-1 [Magnaporthe oryzae 70-15]
 gb|EHA58114.1| AP-1 complex subunit mu-1 [Magnaporthe oryzae 70-15]
Length=448

 Score =   241 bits (615),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 110/190 (58%), Positives = 150/190 (79%), Gaps = 2/190 (1%)
 Frame = +1

Query  244  ASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKL--LENEGDPQDPVAYDSGVTYMFIQ  417
            ASALF LD+KG+ L+ R+YRGD+  +  E+F   L   E E     P     G+ Y++I+
Sbjct  2    ASALFFLDLKGKTLLARNYRGDIPMSAVEKFPILLSEAEEESSAVPPCFSHEGINYLYIR  61

Query  418  HNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEIMDFG  597
            HNN+YL+  +++N NAA +LLFLH++V+VF  YF+ LEEES+RDNFV++YELLDE+MDFG
Sbjct  62   HNNLYLLALTKRNTNAAEILLFLHKIVEVFTEYFKALEEESIRDNFVIIYELLDEMMDFG  121

Query  598  YPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVESVNIL  777
            YPQ TE+KIL E+I  +++++E+  RPP+AVTNAVSWRSEGI Y+KNEVFLDVVES+N+L
Sbjct  122  YPQTTESKILQEYITQESHKLEIQARPPIAVTNAVSWRSEGIRYRKNEVFLDVVESLNLL  181

Query  778  VNSNGQIVRS  807
            V+SNG ++RS
Sbjct  182  VSSNGNVLRS  191



>gb|KIX09719.1| hypothetical protein Z518_00800 [Rhinocladiella mackenziei CBS 
650.93]
Length=448

 Score =   241 bits (615),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 109/190 (57%), Positives = 151/190 (79%), Gaps = 2/190 (1%)
 Frame = +1

Query  244  ASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKL--LENEGDPQDPVAYDSGVTYMFIQ  417
            ASA+F LD+KG+ L+ R+YRGD+  +  E+F   L   E E     P   D G+ Y++I+
Sbjct  2    ASAVFFLDLKGKTLLARNYRGDIPMSAVEKFPILLSEAEEESSAVPPCFSDEGINYLYIR  61

Query  418  HNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEIMDFG  597
            HNN+YL+  +++N NAA +LLFLH++V+VF  YF+ELEEES+RDNFV++YELLDE+MDFG
Sbjct  62   HNNLYLLALTKRNTNAAEILLFLHKIVEVFTEYFKELEEESIRDNFVIIYELLDEMMDFG  121

Query  598  YPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVESVNIL  777
            YPQ TE+KIL E+I  ++++++V  RPP+AVTNAVSWRSEGI Y+KNEVFLDV+ES+N+L
Sbjct  122  YPQTTESKILQEYITQESHKLDVQARPPIAVTNAVSWRSEGIRYRKNEVFLDVIESLNLL  181

Query  778  VNSNGQIVRS  807
            V+S G ++RS
Sbjct  182  VSSTGNVLRS  191



>ref|XP_002793958.1| AP-1 complex subunit mu-1 [Paracoccidioides sp. 'lutzii' Pb01]
Length=447

 Score =   241 bits (615),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 108/190 (57%), Positives = 152/190 (80%), Gaps = 2/190 (1%)
 Frame = +1

Query  244  ASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKL--LENEGDPQDPVAYDSGVTYMFIQ  417
            ASA+F LD+KG+ L+ R+YRGD+  +  E+F   L   E E     P   D G+ Y++I+
Sbjct  2    ASAIFFLDLKGKTLLARNYRGDIPMSAVEKFPVLLSEAEEESSAVPPCFSDEGINYLYIR  61

Query  418  HNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEIMDFG  597
            H+N+Y++  +++N NAA +LLFLH++V+VF  YF+ELEEES+RDNFV++YELLDE+MDFG
Sbjct  62   HSNLYVLALTKRNTNAAEILLFLHKIVEVFTEYFKELEEESIRDNFVIIYELLDEMMDFG  121

Query  598  YPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVESVNIL  777
            YPQ TE+KIL E+I  +++++E+  RPP+AVTNAVSWRSEGI Y+KNEVFLDVVES+N+L
Sbjct  122  YPQTTESKILQEYITQESHKLEIQARPPIAVTNAVSWRSEGIRYRKNEVFLDVVESLNLL  181

Query  778  VNSNGQIVRS  807
            V++NG ++RS
Sbjct  182  VSANGNVLRS  191



>gb|KIH92376.1| AP-1 complex subunit mu [Sporothrix brasiliensis 5110]
Length=434

 Score =   241 bits (614),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 108/190 (57%), Positives = 150/190 (79%), Gaps = 2/190 (1%)
 Frame = +1

Query  244  ASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKL--LENEGDPQDPVAYDSGVTYMFIQ  417
            ASA+F LD+KG+ L+ R+YRGD+  +  E+F   L   E E     P     G+ Y++I+
Sbjct  2    ASAVFFLDLKGKTLLARNYRGDIPMSAVEKFPVLLSEAEEESSAVPPCFSHEGINYLYIR  61

Query  418  HNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEIMDFG  597
            HNN+YL+  +++N NAA +LLFLH++VDVF  YF+ LEEES+RDNFV++YELLDE+MDFG
Sbjct  62   HNNLYLLALTKRNTNAAEILLFLHKIVDVFTEYFKALEEESIRDNFVIIYELLDEMMDFG  121

Query  598  YPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVESVNIL  777
            YPQ TE+KIL E+I  +++++E+  RPP+AVTNAVSWRSEGI Y+KNEVFLDV+ES+N+L
Sbjct  122  YPQTTESKILQEYITQESHKLEIQARPPIAVTNAVSWRSEGIRYRKNEVFLDVIESLNLL  181

Query  778  VNSNGQIVRS  807
            V++NG ++RS
Sbjct  182  VSANGNVLRS  191



>gb|EEH33177.2| AP-1 complex subunit mu-1 [Paracoccidioides sp. 'lutzii' Pb01]
Length=454

 Score =   241 bits (615),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 108/190 (57%), Positives = 152/190 (80%), Gaps = 2/190 (1%)
 Frame = +1

Query  244  ASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKL--LENEGDPQDPVAYDSGVTYMFIQ  417
            ASA+F LD+KG+ L+ R+YRGD+  +  E+F   L   E E     P   D G+ Y++I+
Sbjct  2    ASAIFFLDLKGKTLLARNYRGDIPMSAVEKFPVLLSEAEEESSAVPPCFSDEGINYLYIR  61

Query  418  HNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEIMDFG  597
            H+N+Y++  +++N NAA +LLFLH++V+VF  YF+ELEEES+RDNFV++YELLDE+MDFG
Sbjct  62   HSNLYVLALTKRNTNAAEILLFLHKIVEVFTEYFKELEEESIRDNFVIIYELLDEMMDFG  121

Query  598  YPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVESVNIL  777
            YPQ TE+KIL E+I  +++++E+  RPP+AVTNAVSWRSEGI Y+KNEVFLDVVES+N+L
Sbjct  122  YPQTTESKILQEYITQESHKLEIQARPPIAVTNAVSWRSEGIRYRKNEVFLDVVESLNLL  181

Query  778  VNSNGQIVRS  807
            V++NG ++RS
Sbjct  182  VSANGNVLRS  191



>ref|XP_008028649.1| hypothetical protein SETTUDRAFT_164506 [Setosphaeria turcica 
Et28A]
 gb|EOA84318.1| hypothetical protein SETTUDRAFT_164506 [Setosphaeria turcica 
Et28A]
Length=446

 Score =   241 bits (614),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 110/190 (58%), Positives = 150/190 (79%), Gaps = 2/190 (1%)
 Frame = +1

Query  244  ASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKL--LENEGDPQDPVAYDSGVTYMFIQ  417
            ASA+F LD+KG+ L+ R+YRGD+  +  E+F   L   E+E     P     G+ Y++I+
Sbjct  2    ASAVFFLDLKGKTLLARNYRGDIPMSAVEKFPVLLSEAEDESSAVPPCFSSEGINYLYIR  61

Query  418  HNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEIMDFG  597
            HNN+YL+  +++N NAA +LLFLH+VV+VF  YF+ELEEES+RDNFVV+YELLDE+MDFG
Sbjct  62   HNNLYLLALTKRNTNAAEILLFLHKVVEVFTEYFKELEEESIRDNFVVIYELLDEMMDFG  121

Query  598  YPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVESVNIL  777
            YPQ TE KIL E+I  +++++EV  RPP+AVTNAVSWRSEGI Y+KNEVFLDV+ES+N+L
Sbjct  122  YPQTTETKILQEYITQESHKLEVQARPPIAVTNAVSWRSEGIRYRKNEVFLDVIESLNLL  181

Query  778  VNSNGQIVRS  807
            V++ G ++RS
Sbjct  182  VSATGSVLRS  191



>ref|XP_010762749.1| hypothetical protein PADG_07468 [Paracoccidioides brasiliensis 
Pb18]
 gb|EEH42648.2| hypothetical protein PADG_07468 [Paracoccidioides brasiliensis 
Pb18]
 gb|EEH21798.2| hypothetical protein PABG_04014 [Paracoccidioides brasiliensis 
Pb03]
Length=447

 Score =   241 bits (614),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 108/190 (57%), Positives = 152/190 (80%), Gaps = 2/190 (1%)
 Frame = +1

Query  244  ASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKL--LENEGDPQDPVAYDSGVTYMFIQ  417
            ASA+F LD+KG+ L+ R+YRGD+  +  E+F   L   E E     P   D G+ Y++I+
Sbjct  2    ASAIFFLDLKGKTLLARNYRGDIPMSAVEKFPILLSEAEEESSAVPPCFSDEGINYLYIR  61

Query  418  HNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEIMDFG  597
            H+N+Y++  +++N NAA +LLFLH++V+VF  YF+ELEEES+RDNFV++YELLDE+MDFG
Sbjct  62   HSNLYVLALTKRNTNAAEILLFLHKIVEVFTEYFKELEEESIRDNFVIIYELLDEMMDFG  121

Query  598  YPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVESVNIL  777
            YPQ TE+KIL E+I  +++++E+  RPP+AVTNAVSWRSEGI Y+KNEVFLDVVES+N+L
Sbjct  122  YPQTTESKILQEYITQESHKLEIQARPPIAVTNAVSWRSEGIRYRKNEVFLDVVESLNLL  181

Query  778  VNSNGQIVRS  807
            V++NG ++RS
Sbjct  182  VSANGNVLRS  191



>ref|XP_007757075.1| AP-1 complex subunit mu-1 [Cladophialophora yegresii CBS 114405]
 gb|EXJ60722.1| AP-1 complex subunit mu-1 [Cladophialophora yegresii CBS 114405]
Length=448

 Score =   241 bits (614),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 109/190 (57%), Positives = 151/190 (79%), Gaps = 2/190 (1%)
 Frame = +1

Query  244  ASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKL--LENEGDPQDPVAYDSGVTYMFIQ  417
            ASA+F LD+KG+ L+ R+YRGD+  +  E+F   L   E E     P   D G+ Y++I+
Sbjct  2    ASAIFFLDLKGKTLLARNYRGDIPMSAVEKFPVLLSEAEEESSAVPPCFSDEGINYLYIR  61

Query  418  HNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEIMDFG  597
            H+N+YL+  +++N NAA +LLFLH++V+VF  YF+ELEEES+RDNFV++YELLDE+MDFG
Sbjct  62   HSNLYLLALTKRNTNAAEILLFLHKIVEVFTEYFKELEEESIRDNFVIIYELLDEMMDFG  121

Query  598  YPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVESVNIL  777
            YPQ TE+KIL E+I  +++++EV  RPP+AVTNAVSWRSEGI Y+KNEVFLDVVES+N+L
Sbjct  122  YPQTTESKILQEYITQESHKLEVQARPPIAVTNAVSWRSEGIRYRKNEVFLDVVESLNLL  181

Query  778  VNSNGQIVRS  807
            V++ G ++RS
Sbjct  182  VSATGNVLRS  191



>gb|KIV86062.1| hypothetical protein PV11_01701 [Exophiala sideris]
Length=448

 Score =   241 bits (614),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 109/190 (57%), Positives = 150/190 (79%), Gaps = 2/190 (1%)
 Frame = +1

Query  244  ASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKL--LENEGDPQDPVAYDSGVTYMFIQ  417
            ASA+F LD+KG+ L+ R+YRGD+     E+F   L   E E     P   D G+ Y++I+
Sbjct  2    ASAVFFLDLKGKTLLARNYRGDIPMAAVEKFPILLSEAEEESSAVPPCFSDEGINYLYIR  61

Query  418  HNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEIMDFG  597
            HNN+YL+  +++N NAA +LLFLH++V+VF  YF+ELEEES+RDN+V++YELLDE+MDFG
Sbjct  62   HNNLYLLALTKRNTNAAEILLFLHKIVEVFTEYFKELEEESIRDNYVIIYELLDEMMDFG  121

Query  598  YPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVESVNIL  777
            YPQ TE+KIL E+I  +++++EV  RPP+AVTNAVSWRSEGI Y+KNEVFLDV+ES+N+L
Sbjct  122  YPQTTESKILQEYITQESHKLEVQARPPIAVTNAVSWRSEGIRYRKNEVFLDVIESLNLL  181

Query  778  VNSNGQIVRS  807
            V+S G ++RS
Sbjct  182  VSSTGNVLRS  191



>gb|EFX00496.1| ap-1 adaptor complex subunit [Grosmannia clavigera kw1407]
Length=448

 Score =   241 bits (614),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 109/190 (57%), Positives = 150/190 (79%), Gaps = 2/190 (1%)
 Frame = +1

Query  244  ASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKL--LENEGDPQDPVAYDSGVTYMFIQ  417
            ASA+F LD+KG+ L+ R+YRGD+  +  E+F   L   E E     P     GV Y++I+
Sbjct  2    ASAVFFLDLKGKTLLARNYRGDIPMSAVEKFPILLSEAEEESSAVPPCFSHEGVNYLYIR  61

Query  418  HNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEIMDFG  597
            HNN+YL+  +++N NAA +LLFLH++VDVF  YF+ LEEES+RDNFV++YELLDE+MDFG
Sbjct  62   HNNLYLLALTKRNTNAAEILLFLHKIVDVFTEYFKALEEESIRDNFVIIYELLDEMMDFG  121

Query  598  YPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVESVNIL  777
            YPQ TE+KIL E+I  +++++E+  RPP+AVTNAVSWRSEGI Y+KNEVFLDV+ES+N+L
Sbjct  122  YPQTTESKILQEYITQESHKLEIQARPPIAVTNAVSWRSEGIRYRKNEVFLDVIESLNLL  181

Query  778  VNSNGQIVRS  807
            V++NG ++RS
Sbjct  182  VSANGNVLRS  191



>emb|CEJ92846.1| Putative AP-2 complex subunit mu [Torrubiella hemipterigena]
Length=446

 Score =   241 bits (614),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 110/190 (58%), Positives = 150/190 (79%), Gaps = 2/190 (1%)
 Frame = +1

Query  244  ASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKL--LENEGDPQDPVAYDSGVTYMFIQ  417
            ASALF LD+KG+ L+ R+YRGD+  +  E+F   L   E E     P     G+ Y++I+
Sbjct  2    ASALFFLDLKGKTLLARNYRGDIPMSAVEKFPILLSEAEEESSAVPPCFSHEGINYLYIR  61

Query  418  HNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEIMDFG  597
            HNN+YL+  +++N NAA ++LFLH+VV+VF  YF+ LEEES+RDNFV++YELLDE+MDFG
Sbjct  62   HNNLYLLALTKRNTNAAEIILFLHKVVEVFTEYFKALEEESIRDNFVIIYELLDEMMDFG  121

Query  598  YPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVESVNIL  777
            YPQ TE+KIL E+I  +++++E+  RPP+AVTNAVSWRSEGI Y+KNEVFLDVVES+N+L
Sbjct  122  YPQTTESKILQEYITQESHKLEIQARPPIAVTNAVSWRSEGIRYRKNEVFLDVVESLNLL  181

Query  778  VNSNGQIVRS  807
            V+SNG ++RS
Sbjct  182  VSSNGNVLRS  191



>gb|EPE02850.1| ap-1 adaptor complex subunit mu [Ophiostoma piceae UAMH 11346]
Length=448

 Score =   241 bits (614),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 109/190 (57%), Positives = 150/190 (79%), Gaps = 2/190 (1%)
 Frame = +1

Query  244  ASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKL--LENEGDPQDPVAYDSGVTYMFIQ  417
            ASA+F LD+KG+ L+ R+YRGD+  +  E+F   L   E E     P     G+ Y++I+
Sbjct  2    ASAVFFLDLKGKTLLARNYRGDIPMSAVEKFPVLLSEAEEESSAVPPCFSHEGINYLYIR  61

Query  418  HNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEIMDFG  597
            HNN+YL+  +++N NAA +LLFLH++VDVF  YF+ LEEES+RDNFV++YELLDE+MDFG
Sbjct  62   HNNLYLLALTKRNTNAAEILLFLHKIVDVFTEYFKALEEESIRDNFVIIYELLDEMMDFG  121

Query  598  YPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVESVNIL  777
            YPQ TE+KIL E+I  +++++E+  RPP+AVTNAVSWRSEGI Y+KNEVFLDVVES+N+L
Sbjct  122  YPQTTESKILQEYITQESHKLEIQARPPIAVTNAVSWRSEGIRYRKNEVFLDVVESLNLL  181

Query  778  VNSNGQIVRS  807
            V++NG ++RS
Sbjct  182  VSANGNVLRS  191



>ref|XP_007813674.1| AP-1 complex subunit mu [Metarhizium acridum CQMa 102]
 gb|EFY86645.1| AP-1 complex subunit mu [Metarhizium acridum CQMa 102]
Length=442

 Score =   240 bits (613),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 110/190 (58%), Positives = 150/190 (79%), Gaps = 2/190 (1%)
 Frame = +1

Query  244  ASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKL--LENEGDPQDPVAYDSGVTYMFIQ  417
            ASALF LD+KG+ L+ R+YRGD+  +  E+F   L   E E     P     G+ Y++I+
Sbjct  2    ASALFFLDLKGKTLLARNYRGDIPMSAVEKFPVLLSEAEEESSAVPPCFSHEGINYLYIR  61

Query  418  HNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEIMDFG  597
            HNN+YL+  +++N NAA +LLFLH++V+VF  YF+ LEEES+RDNFV++YELLDE+MDFG
Sbjct  62   HNNLYLLALTKRNTNAAEILLFLHKIVEVFTEYFKALEEESIRDNFVIIYELLDEMMDFG  121

Query  598  YPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVESVNIL  777
            YPQ TE+KIL E+I  +++++EV  RPP+AVTNAVSWRSEGI Y+KNEVFLDVVES+N+L
Sbjct  122  YPQTTESKILQEYITQESHKLEVQARPPIAVTNAVSWRSEGIRYRKNEVFLDVVESLNLL  181

Query  778  VNSNGQIVRS  807
            V+S+G ++RS
Sbjct  182  VSSDGNVLRS  191



>gb|EHK25934.1| hypothetical protein TRIVIDRAFT_55386 [Trichoderma virens Gv29-8]
Length=446

 Score =   240 bits (613),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 110/190 (58%), Positives = 150/190 (79%), Gaps = 2/190 (1%)
 Frame = +1

Query  244  ASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKL--LENEGDPQDPVAYDSGVTYMFIQ  417
            ASA+F LD+KG+ L+ R+YRGD+  +  E+F   L   E E     P     G+ Y++I+
Sbjct  2    ASAIFFLDLKGKTLLARNYRGDIPMSAVEKFPVLLSEAEEESSAVPPCFSHEGINYLYIR  61

Query  418  HNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEIMDFG  597
            HNN+YL+  +++N NAA +LLFLH+VV+VF  YF+ LEEES+RDNFVV+YELLDE+MDFG
Sbjct  62   HNNLYLLALTKRNTNAAGILLFLHKVVEVFTEYFKALEEESIRDNFVVIYELLDEMMDFG  121

Query  598  YPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVESVNIL  777
            YPQ TE+KIL E+I  +++++E+  RPP+AVTNAVSWRSEGI Y+KNEVFLDVVES+N+L
Sbjct  122  YPQTTESKILQEYITQESHKLEIQARPPIAVTNAVSWRSEGIRYRKNEVFLDVVESLNLL  181

Query  778  VNSNGQIVRS  807
            V++NG ++RS
Sbjct  182  VSANGNVLRS  191



>emb|CCV00015.1| unnamed protein product [Malassezia sympodialis ATCC 42132]
Length=439

 Score =   240 bits (613),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 114/192 (59%), Positives = 146/192 (76%), Gaps = 4/192 (2%)
 Frame = +1

Query  244  ASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGDPQ----DPVAYDSGVTYMF  411
            AS + +LD+KG+ L+ R YR DV  T  ERF   L E E +       P     GV YM 
Sbjct  2    ASVVAILDLKGKPLIQRSYRDDVDPTAMERFLPLLTEIEEEHGTSAIQPCLSSQGVNYMH  61

Query  412  IQHNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEIMD  591
            ++HNN+YL+  SR+N NAA +LLFLH++  V + YF++LEEES+RDNFV++YELLDE+MD
Sbjct  62   VRHNNLYLLALSRRNSNAAEILLFLHKLASVLEEYFKQLEEESIRDNFVILYELLDEMMD  121

Query  592  FGYPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVESVN  771
            FGYPQ TE+KIL E+I  ++Y++EV  RPPMAVTNAVSWRSEGI Y+KNEVFLDV+ESVN
Sbjct  122  FGYPQTTESKILQEYITQESYKLEVQVRPPMAVTNAVSWRSEGIRYRKNEVFLDVIESVN  181

Query  772  ILVNSNGQIVRS  807
            +LVN+NG +VRS
Sbjct  182  LLVNANGHVVRS  193



>ref|XP_006695406.1| AP-1 complex subunit mu-1-like protein [Chaetomium thermophilum 
var. thermophilum DSM 1495]
 gb|EGS18461.1| AP-1 complex subunit mu-1-like protein [Chaetomium thermophilum 
var. thermophilum DSM 1495]
Length=434

 Score =   240 bits (612),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 108/190 (57%), Positives = 151/190 (79%), Gaps = 2/190 (1%)
 Frame = +1

Query  244  ASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKL--LENEGDPQDPVAYDSGVTYMFIQ  417
            ASA+F LD+KG+ L+ R+YRGD+  + AE+F   L   E E     P     G+ Y++I+
Sbjct  2    ASAIFFLDLKGKTLLARNYRGDIPMSAAEKFPILLSEAEEESSAVPPCFSHEGINYLYIR  61

Query  418  HNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEIMDFG  597
            HNN+YL+  +++N NAA +LLFLH++V+VF  YF+ LEEES+RDNFV++YELLDE+MDFG
Sbjct  62   HNNLYLLALTKRNTNAAEILLFLHKIVEVFTEYFKVLEEESIRDNFVIIYELLDEMMDFG  121

Query  598  YPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVESVNIL  777
            YPQ TE+KIL E+I  +++++E+  RPP+AVTNAVSWRSEGI Y+KNEVFLDV+ES+N+L
Sbjct  122  YPQTTESKILQEYITQESHKLEIQARPPIAVTNAVSWRSEGIRYRKNEVFLDVIESLNLL  181

Query  778  VNSNGQIVRS  807
            V++NG ++RS
Sbjct  182  VSANGNVLRS  191



>ref|XP_004356672.1| adaptorrelated protein complex 1, mu 1 subunit isoform 10, putative 
[Acanthamoeba castellanii str. Neff]
 gb|ELR24772.1| adaptorrelated protein complex 1, mu 1 subunit isoform 10, putative 
[Acanthamoeba castellanii str. Neff]
Length=424

 Score =   239 bits (611),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 107/189 (57%), Positives = 149/189 (79%), Gaps = 0/189 (0%)
 Frame = +1

Query  241  AASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGDPQDPVAYDSGVTYMFIQH  420
             ASA+F+LD+KG+VL+WRDYRGDV    AERF   ++  +     P+  + GVTY+++++
Sbjct  2    PASAIFVLDLKGKVLLWRDYRGDVPLNIAERFMNIIMAKDEQDVRPIFEEDGVTYIYVKY  61

Query  421  NNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEIMDFGY  600
             N+Y+M  ++ N +AA LL+FL++++ VF  YF+ELEEESL+DNFV++YELLDE+MDFGY
Sbjct  62   KNLYIMTVTKHNADAAMLLIFLYKLIQVFTAYFQELEEESLKDNFVIIYELLDEMMDFGY  121

Query  601  PQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVESVNILV  780
            PQ T+A+IL EFI  + Y+ME   RPP A+T AVSWRSEGI Y+KNEVFLDV+E+VN+LV
Sbjct  122  PQATDAQILQEFITQEFYKMEQQPRPPPALTTAVSWRSEGIKYRKNEVFLDVIENVNVLV  181

Query  781  NSNGQIVRS  807
             +NG ++RS
Sbjct  182  AANGTVLRS  190



>gb|AFR96538.2| AP-1 complex subunit mu-1 [Cryptococcus neoformans var. grubii 
H99]
Length=435

 Score =   239 bits (611),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 113/190 (59%), Positives = 146/190 (77%), Gaps = 2/190 (1%)
 Frame = +1

Query  244  ASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGD--PQDPVAYDSGVTYMFIQ  417
            AS + +LDVKG+ L+ R YR DV  +  ERF   +LE E +  P  P   D GV YM I+
Sbjct  2    ASLVAILDVKGKSLIQRSYRDDVPPSYIERFLPLILEMEEENVPVTPCFSDEGVNYMHIR  61

Query  418  HNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEIMDFG  597
            HNN+YL+  S++N NA  ++ FLHR+  V   YF+ELEEES+RDNFV++YELLDE+MDFG
Sbjct  62   HNNLYLLALSKKNSNAVEVIFFLHRLCSVLTEYFKELEEESIRDNFVIIYELLDEMMDFG  121

Query  598  YPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVESVNIL  777
            YPQ TE+KIL E+I  +++++EV  RPPMAVTNAVSWRSEGI Y+KNEVFLDVVESVN+L
Sbjct  122  YPQTTESKILQEYITQESHKLEVQVRPPMAVTNAVSWRSEGIRYRKNEVFLDVVESVNLL  181

Query  778  VNSNGQIVRS  807
            VN++G ++RS
Sbjct  182  VNASGNVIRS  191



>emb|CCF38390.1| AP-1 complex subunit mu-1, partial [Colletotrichum higginsianum]
Length=422

 Score =   239 bits (610),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 108/190 (57%), Positives = 150/190 (79%), Gaps = 2/190 (1%)
 Frame = +1

Query  244  ASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKL--LENEGDPQDPVAYDSGVTYMFIQ  417
            ASA+F LD+KG+ L+ R+YRGD+  +  E+F   L   E E     P     G+ Y++I+
Sbjct  2    ASAVFFLDLKGKTLLARNYRGDIPMSAVEKFPVLLSEAEEESSAVPPCFSHEGINYLYIR  61

Query  418  HNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEIMDFG  597
            HNN+YL+  +++N NAA +LLFLH++V+VF  YF+ LEEES+RDNFV++YELLDE+MDFG
Sbjct  62   HNNLYLLALTKRNTNAAEILLFLHKIVEVFTEYFKALEEESIRDNFVIIYELLDEMMDFG  121

Query  598  YPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVESVNIL  777
            YPQ TE+KIL E+I  +++++E+  RPP+AVTNAVSWRSEGI Y+KNEVFLDVVES+N+L
Sbjct  122  YPQTTESKILQEYITQESHKLEIQARPPIAVTNAVSWRSEGIRYRKNEVFLDVVESLNLL  181

Query  778  VNSNGQIVRS  807
            V++NG ++RS
Sbjct  182  VSANGNVLRS  191



>ref|XP_008079408.1| Second of Mu2 adaptin subunit (ap50) of ap2 adaptor [Glarea lozoyensis 
ATCC 20868]
 gb|EPE34256.1| Second of Mu2 adaptin subunit (ap50) of ap2 adaptor [Glarea lozoyensis 
ATCC 20868]
Length=445

 Score =   240 bits (612),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 112/190 (59%), Positives = 151/190 (79%), Gaps = 3/190 (2%)
 Frame = +1

Query  244  ASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKL--LENEGDPQDPVAYDSGVTYMFIQ  417
            ASALF LD+KG+ L+ R+YRGD+  +  E+F   L   E E     P   D G+ Y++I+
Sbjct  2    ASALFFLDLKGKTLLARNYRGDIPMSAVEKFPILLSEAEEESSAVPPCFSDEGINYLYIR  61

Query  418  HNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEIMDFG  597
            HNN+YL+  +++N NAA +LLFLH++V+VF  YF+ELEEES+RDNFVV+YELLDE+MDFG
Sbjct  62   HNNLYLLALTKRNTNAAEILLFLHKLVEVFTEYFKELEEESIRDNFVVIYELLDEMMDFG  121

Query  598  YPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVESVNIL  777
            YPQ TE+KIL E+I  +++++E+  RPP+AVTNAVSWRSEGI Y+KNEVFLDVVES+N+L
Sbjct  122  YPQTTESKILQEYITQESHKLEIA-RPPIAVTNAVSWRSEGIRYRKNEVFLDVVESLNLL  180

Query  778  VNSNGQIVRS  807
            V+S G ++RS
Sbjct  181  VSSTGNVLRS  190



>dbj|GAM36154.1| AP-1 adaptor complex subunit [Talaromyces cellulolyticus]
Length=447

 Score =   240 bits (612),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 109/190 (57%), Positives = 150/190 (79%), Gaps = 2/190 (1%)
 Frame = +1

Query  244  ASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKL--LENEGDPQDPVAYDSGVTYMFIQ  417
            ASA+F LD+KG+ L+ R+YRGD+  +  E+F   L   E E     P     G+ Y++I+
Sbjct  2    ASAVFFLDLKGKALLARNYRGDIPMSAVEKFPILLSEAEEESSAVPPCFSHEGINYLYIR  61

Query  418  HNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEIMDFG  597
            HNN+YL+  +++N NA  +LLFLH++V+VF  YF+ELEEES+RDNFVV+YELLDE+MDFG
Sbjct  62   HNNLYLLALTKRNTNATEILLFLHKIVEVFTEYFKELEEESIRDNFVVIYELLDEMMDFG  121

Query  598  YPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVESVNIL  777
            YPQ TE+KIL E+I  +++++EV  RPP+AVTNAVSWRSEGI Y+KNEVFLDV+ES+N+L
Sbjct  122  YPQTTESKILQEYITQESHKLEVQARPPIAVTNAVSWRSEGIRYRKNEVFLDVIESLNLL  181

Query  778  VNSNGQIVRS  807
            V++NG ++RS
Sbjct  182  VSANGNVLRS  191



>gb|KFX43324.1| AP-1 complex subunit mu-1 [Talaromyces marneffei PM1]
Length=447

 Score =   240 bits (612),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 109/190 (57%), Positives = 149/190 (78%), Gaps = 2/190 (1%)
 Frame = +1

Query  244  ASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKL--LENEGDPQDPVAYDSGVTYMFIQ  417
            ASA+F LD+KG+ L+ R+YRGD+  +  E+F   L   E E     P     G+ Y++I+
Sbjct  2    ASAIFFLDLKGKALLARNYRGDIPMSAVEKFPILLSEAEEESSAVPPCFSHEGINYLYIR  61

Query  418  HNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEIMDFG  597
            HNN+YL+  +++N NA  +LLFLH++V+VF  YF+ELEEES+RDNFVV+YELLDE+MDFG
Sbjct  62   HNNLYLLALTKRNTNATEILLFLHKIVEVFTEYFKELEEESIRDNFVVIYELLDEMMDFG  121

Query  598  YPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVESVNIL  777
            YPQ TE KIL E+I  +++++EV  RPP+AVTNAVSWRSEGI Y+KNEVFLDV+ES+N+L
Sbjct  122  YPQTTETKILQEYITQESHKLEVQARPPIAVTNAVSWRSEGIRYRKNEVFLDVIESLNLL  181

Query  778  VNSNGQIVRS  807
            V++NG ++RS
Sbjct  182  VSANGNVLRS  191



>ref|XP_003069890.1| Adaptor complexes medium subunit family protein [Coccidioides 
posadasii C735 delta SOWgp]
 gb|EER27745.1| Adaptor complexes medium subunit family protein [Coccidioides 
posadasii C735 delta SOWgp]
 gb|EFW16127.1| AP-1 complex subunit mu-1 [Coccidioides posadasii str. Silveira]
 gb|EAS31140.2| AP-1 complex subunit mu-1 [Coccidioides immitis RS]
Length=447

 Score =   240 bits (612),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 107/190 (56%), Positives = 151/190 (79%), Gaps = 2/190 (1%)
 Frame = +1

Query  244  ASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKL--LENEGDPQDPVAYDSGVTYMFIQ  417
            ASA+F LD+KG+ L+ R+YRGD+  +  E+F   L   E E     P     G+ Y++I+
Sbjct  2    ASAIFFLDLKGKTLLARNYRGDIPMSAVEKFPVLLSEAEEESSAVPPCFSSEGINYLYIR  61

Query  418  HNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEIMDFG  597
            H+N+YL+  +++N NAA +LLFLH++V+VF  YF+ELEEES+RDNFV++YELLDE+MDFG
Sbjct  62   HSNLYLLALTKRNTNAAEILLFLHKIVEVFTEYFKELEEESIRDNFVIIYELLDEMMDFG  121

Query  598  YPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVESVNIL  777
            YPQ TE+KIL E+I  +++++E+  RPP+AVTNAVSWRSEGI Y+KNEVFLDV+ES+N+L
Sbjct  122  YPQTTESKILQEYITQESHKLEIQARPPIAVTNAVSWRSEGIRYRKNEVFLDVIESLNLL  181

Query  778  VNSNGQIVRS  807
            V++NG ++RS
Sbjct  182  VSANGNVLRS  191



>gb|KID63649.1| adaptor complexes medium subunit family protein, partial [Metarhizium 
brunneum ARSEF 3297]
 gb|KID64437.1| adaptor complexes medium subunit family protein, partial [Metarhizium 
anisopliae ARSEF 549]
 gb|KID85726.1| adaptor complexes medium subunit family protein [Metarhizium 
guizhouense ARSEF 977]
 gb|KID94406.1| adaptor complexes medium subunit family protein, partial [Metarhizium 
majus ARSEF 297]
Length=448

 Score =   240 bits (612),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 110/190 (58%), Positives = 150/190 (79%), Gaps = 2/190 (1%)
 Frame = +1

Query  244  ASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKL--LENEGDPQDPVAYDSGVTYMFIQ  417
            ASALF LD+KG+ L+ R+YRGD+  +  E+F   L   E E     P     G+ Y++I+
Sbjct  2    ASALFFLDLKGKTLLARNYRGDIPMSAVEKFPILLSEAEEESSAVPPCFSHEGINYLYIR  61

Query  418  HNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEIMDFG  597
            HNN+YL+  +++N NAA +LLFLH++V+VF  YF+ LEEES+RDNFV++YELLDE+MDFG
Sbjct  62   HNNLYLLALTKRNTNAAEILLFLHKIVEVFTEYFKALEEESIRDNFVIIYELLDEMMDFG  121

Query  598  YPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVESVNIL  777
            YPQ TE+KIL E+I  +++++EV  RPP+AVTNAVSWRSEGI Y+KNEVFLDVVES+N+L
Sbjct  122  YPQTTESKILQEYITQESHKLEVQARPPIAVTNAVSWRSEGIRYRKNEVFLDVVESLNLL  181

Query  778  VNSNGQIVRS  807
            V+S+G ++RS
Sbjct  182  VSSDGNVLRS  191



>ref|XP_007394620.1| hypothetical protein PHACADRAFT_254106 [Phanerochaete carnosa 
HHB-10118-sp]
 gb|EKM56785.1| hypothetical protein PHACADRAFT_254106 [Phanerochaete carnosa 
HHB-10118-sp]
Length=437

 Score =   239 bits (611),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 113/190 (59%), Positives = 148/190 (78%), Gaps = 2/190 (1%)
 Frame = +1

Query  244  ASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLE--NEGDPQDPVAYDSGVTYMFIQ  417
            AS + +LD+KG+ L+ R YR DV AT  E+F   +LE   EG    P     G+ YM I+
Sbjct  2    ASLIAILDLKGKPLIQRSYRDDVPATYIEKFMPIILELEEEGQQVTPCFSREGINYMHIR  61

Query  418  HNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEIMDFG  597
            H+N+YL+  S++N NAA L+LFLHR+V V   YF+ELEEES+RDNFV++YEL+DE+MDFG
Sbjct  62   HSNLYLLALSKRNTNAAELILFLHRLVQVLVEYFKELEEESIRDNFVIIYELMDEMMDFG  121

Query  598  YPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVESVNIL  777
            +PQ TE+KIL E+I  ++Y++EV  RPP+AVTNAVSWRSEGI Y+KNEVFLDV+ESVN+L
Sbjct  122  FPQTTESKILQEYITQESYKLEVQVRPPVAVTNAVSWRSEGIRYRKNEVFLDVIESVNLL  181

Query  778  VNSNGQIVRS  807
            VN+NG +VRS
Sbjct  182  VNANGNVVRS  191



>ref|XP_007296379.1| AP-1 complex subunit mu [Marssonina brunnea f. sp. 'multigermtubi' 
MB_m1]
 gb|EKD13407.1| AP-1 complex subunit mu [Marssonina brunnea f. sp. 'multigermtubi' 
MB_m1]
Length=446

 Score =   239 bits (611),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 112/190 (59%), Positives = 153/190 (81%), Gaps = 2/190 (1%)
 Frame = +1

Query  244  ASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGDPQ--DPVAYDSGVTYMFIQ  417
            ASALF LD+KG+ L+ R+YRGD+  +  E+F   L E E +     P   D G+ Y++I+
Sbjct  2    ASALFFLDLKGKTLLARNYRGDIPMSAVEKFPILLSEAEEESSSVPPCFSDEGINYLYIR  61

Query  418  HNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEIMDFG  597
            HNN+YL+  +++N NAA +LLFLH++V+VF  YF+ELEEES+RDNFV++YELLDE+MDFG
Sbjct  62   HNNLYLLALTKRNTNAAEILLFLHKIVEVFTEYFKELEEESIRDNFVIIYELLDEMMDFG  121

Query  598  YPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVESVNIL  777
            +PQ TE+KIL E+I  +++++EV  RPP+AVTNAVSWRSEGI Y+KNEVFLDVVES+N+L
Sbjct  122  HPQTTESKILQEYITQESHKLEVQARPPIAVTNAVSWRSEGIRYRKNEVFLDVVESLNLL  181

Query  778  VNSNGQIVRS  807
            V+SNG ++RS
Sbjct  182  VSSNGNVLRS  191



>ref|XP_003843632.1| similar to AP-1 adaptor complex subunit mu [Leptosphaeria maculans 
JN3]
 emb|CBY00153.1| similar to AP-1 adaptor complex subunit mu [Leptosphaeria maculans 
JN3]
Length=445

 Score =   239 bits (611),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 111/190 (58%), Positives = 150/190 (79%), Gaps = 3/190 (2%)
 Frame = +1

Query  244  ASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKL--LENEGDPQDPVAYDSGVTYMFIQ  417
            ASALF LD+KG+ L+ R+YRGD+  +  E+F   L   E E     P   D G+ Y++I+
Sbjct  2    ASALFFLDLKGKTLLARNYRGDIPMSAVEKFPVLLSEAEEESSAVPPCFSDEGINYLYIR  61

Query  418  HNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEIMDFG  597
            HNN+YL+  +++N NAA +LLFLH++V+VF  YF+ELEEES+RDNFVV+YELLDE+MDFG
Sbjct  62   HNNLYLLALTKRNSNAAEILLFLHKIVEVFTEYFKELEEESIRDNFVVIYELLDEMMDFG  121

Query  598  YPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVESVNIL  777
            YPQ TE KIL E+I  +++++EV  RPP+AVTNAVSWRSEGI Y+KNEVFLDV+ES+N+L
Sbjct  122  YPQTTETKILQEYITQESHKLEVA-RPPIAVTNAVSWRSEGIRYRKNEVFLDVIESLNLL  180

Query  778  VNSNGQIVRS  807
            V++ G ++RS
Sbjct  181  VSATGSVLRS  190



>emb|CDO76121.1| hypothetical protein BN946_scf184876.g14 [Trametes cinnabarina]
Length=437

 Score =   239 bits (610),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 114/190 (60%), Positives = 147/190 (77%), Gaps = 2/190 (1%)
 Frame = +1

Query  244  ASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLL--ENEGDPQDPVAYDSGVTYMFIQ  417
            AS + +LD+KG+ L+ R YR DV  +  ERF   +L  E EG    P     GV YM I+
Sbjct  2    ASLIAILDLKGKPLIQRSYRDDVPPSYIERFLPIILDLEEEGQQVTPCFTREGVNYMHIR  61

Query  418  HNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEIMDFG  597
            H+N+YL+  S++N NAA ++LFLHR+V V   YF+ELEEES+RDNFV++YELLDE+MDFG
Sbjct  62   HSNLYLLALSKRNSNAAEIILFLHRLVQVLIEYFKELEEESIRDNFVIIYELLDEMMDFG  121

Query  598  YPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVESVNIL  777
            YPQ TE+KIL E+I  ++Y++EV  RPP+AVTNAVSWRSEGI Y+KNEVFLDV+ESVN+L
Sbjct  122  YPQTTESKILQEYITQESYKLEVQVRPPIAVTNAVSWRSEGIRYRKNEVFLDVIESVNLL  181

Query  778  VNSNGQIVRS  807
            VN+NG +VRS
Sbjct  182  VNANGNVVRS  191



>gb|EFQ34890.1| adaptor complexes medium subunit family protein [Colletotrichum 
graminicola M1.001]
Length=448

 Score =   239 bits (611),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 108/190 (57%), Positives = 150/190 (79%), Gaps = 2/190 (1%)
 Frame = +1

Query  244  ASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKL--LENEGDPQDPVAYDSGVTYMFIQ  417
            ASA+F LD+KG+ L+ R+YRGD+  +  E+F   L   E E     P     G+ Y++I+
Sbjct  2    ASAIFFLDLKGKTLLARNYRGDIPMSAVEKFPVLLSEAEEESSAVPPCFSHEGINYLYIR  61

Query  418  HNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEIMDFG  597
            HNN+YL+  +++N NAA +LLFLH++V+VF  YF+ LEEES+RDNFV++YELLDE+MDFG
Sbjct  62   HNNLYLLALTKRNTNAAEILLFLHKIVEVFTEYFKALEEESIRDNFVIIYELLDEMMDFG  121

Query  598  YPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVESVNIL  777
            YPQ TE+KIL E+I  +++++E+  RPP+AVTNAVSWRSEGI Y+KNEVFLDVVES+N+L
Sbjct  122  YPQTTESKILQEYITQESHKLEIQARPPIAVTNAVSWRSEGIRYRKNEVFLDVVESLNLL  181

Query  778  VNSNGQIVRS  807
            V++NG ++RS
Sbjct  182  VSANGNVLRS  191



>ref|XP_007926969.1| hypothetical protein MYCFIDRAFT_32847 [Pseudocercospora fijiensis 
CIRAD86]
 gb|EME81815.1| hypothetical protein MYCFIDRAFT_32847 [Pseudocercospora fijiensis 
CIRAD86]
Length=449

 Score =   239 bits (611),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 113/190 (59%), Positives = 151/190 (79%), Gaps = 2/190 (1%)
 Frame = +1

Query  244  ASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKLLENEGDPQ--DPVAYDSGVTYMFIQ  417
            ASA+F LD+KG+ L+ R+YRGD+  +  E+F   L E E +     P   D G+ Y++I+
Sbjct  2    ASAIFFLDLKGKTLLARNYRGDIPMSAVEKFPILLSEAEEESSSVPPCFTDEGINYLYIR  61

Query  418  HNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEIMDFG  597
            HNN+YL+  +++N NAA +LLFLHR+V+VF  YF+ELEEES+RDNFVV+YELLDE+MDFG
Sbjct  62   HNNLYLLALTKKNSNAAEILLFLHRIVEVFTEYFKELEEESIRDNFVVIYELLDEMMDFG  121

Query  598  YPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVESVNIL  777
            YPQ TE KIL E+I  +++++EV  RPP+AVTNAVSWRSEGI Y+KNEVFLDVVES+N+L
Sbjct  122  YPQTTETKILQEYITQESHKLEVQARPPIAVTNAVSWRSEGIRYRKNEVFLDVVESLNLL  181

Query  778  VNSNGQIVRS  807
            V+S G ++RS
Sbjct  182  VSSTGNVLRS  191



>ref|XP_009223445.1| AP-1 complex subunit mu-1 [Gaeumannomyces graminis var. tritici 
R3-111a-1]
 gb|EJT77445.1| AP-1 complex subunit mu-1 [Gaeumannomyces graminis var. tritici 
R3-111a-1]
Length=446

 Score =   239 bits (611),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 108/190 (57%), Positives = 150/190 (79%), Gaps = 2/190 (1%)
 Frame = +1

Query  244  ASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKL--LENEGDPQDPVAYDSGVTYMFIQ  417
            ASA+F LD+KG+ L+ R+YRGD+  +  E+F   L   E E     P     G+ Y++I+
Sbjct  2    ASAIFFLDLKGKTLLARNYRGDIPMSAVEKFPILLSEAEEESSAVPPCFSHEGINYLYIR  61

Query  418  HNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEIMDFG  597
            HNN+YL+  +++N NAA +LLFLH++V+VF  YF+ LEEES+RDNFV++YELLDE+MDFG
Sbjct  62   HNNLYLLALTKRNTNAAEILLFLHKIVEVFTEYFKALEEESIRDNFVIIYELLDEMMDFG  121

Query  598  YPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVESVNIL  777
            YPQ TE+KIL E+I  +++++E+  RPP+AVTNAVSWRSEGI Y+KNEVFLDVVES+N+L
Sbjct  122  YPQTTESKILQEYITQESHKLEIQARPPIAVTNAVSWRSEGIRYRKNEVFLDVVESLNLL  181

Query  778  VNSNGQIVRS  807
            V++NG ++RS
Sbjct  182  VSANGNVLRS  191



>ref|XP_008599511.1| adaptor complexes medium subunit family protein [Beauveria bassiana 
ARSEF 2860]
 gb|EJP65017.1| adaptor complexes medium subunit family protein [Beauveria bassiana 
ARSEF 2860]
 gb|KGQ03724.1| AP-1 complex subunit mu-1 [Beauveria bassiana D1-5]
Length=446

 Score =   239 bits (611),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 108/190 (57%), Positives = 149/190 (78%), Gaps = 2/190 (1%)
 Frame = +1

Query  244  ASALFLLDVKGRVLVWRDYRGDVSATQAERFFTKL--LENEGDPQDPVAYDSGVTYMFIQ  417
            ASALF LD+KG+ L+ R+YRGD+  +  E+F   L   E E     P     G+ Y++I+
Sbjct  2    ASALFFLDLKGKTLLARNYRGDIPMSAVEKFPILLSEAEEESSAVPPCFSHEGINYLYIR  61

Query  418  HNNVYLMIASRQNCNAASLLLFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEIMDFG  597
            HNN+YL+  +++N NAA ++LFLH++V+VF  YF+ LEEES+RDNFV++YELLDE+MDFG
Sbjct  62   HNNLYLLALTKRNTNAAEIILFLHKIVEVFTEYFKALEEESIRDNFVIIYELLDEMMDFG  121

Query  598  YPQFTEAKILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGINYKKNEVFLDVVESVNIL  777
            YPQ TE+KIL E+I  +++++E+  RPP+AVTNAVSWRSEGI Y+KNEVFLDVVES+N+L
Sbjct  122  YPQTTESKILQEYITQESHKLEIQARPPIAVTNAVSWRSEGIRYRKNEVFLDVVESLNLL  181

Query  778  VNSNGQIVRS  807
            + SNG ++RS
Sbjct  182  IGSNGNVLRS  191



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1620118203410