BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF045C07

Length=844
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009618666.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    137   9e-33   Nicotiana tomentosiformis
ref|XP_009618667.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    137   1e-32   
ref|XP_006364269.1|  PREDICTED: serine/arginine repetitive matrix...    136   3e-32   Solanum tuberosum [potatoes]
ref|XP_011084184.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    135   7e-32   
ref|XP_009783532.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    134   2e-31   Nicotiana sylvestris
ref|XP_009783537.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    134   2e-31   Nicotiana sylvestris
ref|XP_004245196.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    134   2e-31   Solanum lycopersicum
gb|EYU29231.1|  hypothetical protein MIMGU_mgv1a002140mg                132   6e-31   Erythranthe guttata [common monkey flower]
ref|XP_002285000.2|  PREDICTED: peptidyl-prolyl cis-trans isomera...    130   2e-30   Vitis vinifera
ref|XP_010648638.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    130   2e-30   Vitis vinifera
gb|EYU29230.1|  hypothetical protein MIMGU_mgv1a002072mg                130   3e-30   Erythranthe guttata [common monkey flower]
ref|XP_010670673.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    130   4e-30   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010670670.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    129   5e-30   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002324283.2|  hypothetical protein POPTR_0018s01460g             130   5e-30   
emb|CBI21007.3|  unnamed protein product                                127   6e-30   Vitis vinifera
ref|XP_006450486.1|  hypothetical protein CICLE_v10007495mg             129   7e-30   Citrus clementina [clementine]
ref|XP_006483322.1|  PREDICTED: serine/arginine repetitive matrix...    129   7e-30   Citrus sinensis [apfelsine]
ref|XP_011026475.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    129   8e-30   Populus euphratica
ref|XP_011026473.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    129   8e-30   Populus euphratica
ref|XP_006483320.1|  PREDICTED: serine/arginine repetitive matrix...    129   8e-30   Citrus sinensis [apfelsine]
ref|XP_006450487.1|  hypothetical protein CICLE_v10007495mg             129   8e-30   Citrus clementina [clementine]
emb|CAN80313.1|  hypothetical protein VITISV_020758                     129   9e-30   Vitis vinifera
ref|XP_011019778.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    129   1e-29   Populus euphratica
ref|XP_011019781.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    129   1e-29   Populus euphratica
ref|XP_011019777.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    129   1e-29   Populus euphratica
ref|XP_011019776.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    129   1e-29   Populus euphratica
ref|XP_011019775.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    129   1e-29   Populus euphratica
gb|KDP33623.1|  hypothetical protein JCGZ_07194                         129   1e-29   Jatropha curcas
ref|XP_008445168.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    127   3e-29   Cucumis melo [Oriental melon]
ref|XP_006581365.1|  PREDICTED: serine/arginine repetitive matrix...    127   3e-29   
gb|KHN07093.1|  Peptidyl-prolyl cis-trans isomerase D                   127   3e-29   Glycine soja [wild soybean]
ref|XP_004138866.1|  PREDICTED: uncharacterized protein LOC101210345    127   4e-29   
gb|KGN62922.1|  hypothetical protein Csa_2G380020                       127   4e-29   Cucumis sativus [cucumbers]
gb|KHN08115.1|  Peptidyl-prolyl cis-trans isomerase D                   127   4e-29   Glycine soja [wild soybean]
emb|CDP04788.1|  unnamed protein product                                127   4e-29   Coffea canephora [robusta coffee]
ref|XP_004164532.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    122   4e-29   
ref|XP_003523694.1|  PREDICTED: serine/arginine repetitive matrix...    127   5e-29   
ref|XP_003526420.1|  PREDICTED: serine/arginine repetitive matrix...    127   5e-29   
ref|XP_007013820.1|  Peptidyl-prolyl cis-trans isomerase CYP19-2 ...    127   5e-29   
gb|KHG19968.1|  Peptidyl-prolyl cis-trans isomerase cyp5                126   5e-29   Gossypium arboreum [tree cotton]
ref|XP_008347718.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    116   5e-29   
ref|XP_007013817.1|  Peptidyl-prolyl cis-trans isomerase CYP19-2 ...    127   6e-29   
ref|XP_008394052.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    126   8e-29   
gb|KJB07776.1|  hypothetical protein B456_001G045000                    126   9e-29   Gossypium raimondii
gb|KJB07775.1|  hypothetical protein B456_001G045000                    126   9e-29   Gossypium raimondii
gb|KJB07784.1|  hypothetical protein B456_001G045000                    125   9e-29   Gossypium raimondii
ref|XP_011081940.1|  PREDICTED: LOW QUALITY PROTEIN: peptidyl-pro...    125   1e-28   
ref|XP_007161232.1|  hypothetical protein PHAVU_001G053000g             125   2e-28   Phaseolus vulgaris [French bean]
ref|XP_007161231.1|  hypothetical protein PHAVU_001G052900g             125   3e-28   Phaseolus vulgaris [French bean]
ref|XP_008394051.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    125   3e-28   
ref|XP_007161230.1|  hypothetical protein PHAVU_001G052800g             125   3e-28   Phaseolus vulgaris [French bean]
ref|XP_010048238.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    124   4e-28   Eucalyptus grandis [rose gum]
ref|XP_010048237.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    124   4e-28   Eucalyptus grandis [rose gum]
ref|XP_010048236.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    124   4e-28   Eucalyptus grandis [rose gum]
ref|XP_010048233.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    124   4e-28   Eucalyptus grandis [rose gum]
gb|KCW80440.1|  hypothetical protein EUGRSUZ_C01785                     123   5e-28   Eucalyptus grandis [rose gum]
gb|EPS68763.1|  hypothetical protein M569_06004                         124   5e-28   Genlisea aurea
gb|KCW80439.1|  hypothetical protein EUGRSUZ_C01785                     122   6e-28   Eucalyptus grandis [rose gum]
gb|AES58972.2|  peptidyl-prolyl cis-trans isomerase                     124   6e-28   Medicago truncatula
ref|XP_004501305.1|  PREDICTED: serine/arginine repetitive matrix...    124   6e-28   Cicer arietinum [garbanzo]
ref|XP_004498656.1|  PREDICTED: serine/arginine repetitive matrix...    122   2e-27   Cicer arietinum [garbanzo]
ref|XP_002515550.1|  peptidyl-prolyl cis-trans isomerase, putative      122   2e-27   
ref|XP_007225294.1|  hypothetical protein PRUPE_ppa001326mg             122   2e-27   Prunus persica
ref|XP_008219899.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    122   3e-27   Prunus mume [ume]
gb|KJB07770.1|  hypothetical protein B456_001G044900                    121   3e-27   Gossypium raimondii
ref|XP_009334770.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    121   5e-27   Pyrus x bretschneideri [bai li]
ref|XP_009334769.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    121   5e-27   Pyrus x bretschneideri [bai li]
ref|XP_009345297.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    121   7e-27   Pyrus x bretschneideri [bai li]
ref|XP_008378303.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    118   1e-26   
emb|CDX68845.1|  BnaC01g06080D                                          120   1e-26   
emb|CDX75243.1|  BnaA01g04590D                                          120   1e-26   
ref|XP_008378304.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    120   1e-26   
gb|KJB07786.1|  hypothetical protein B456_001G045000                    119   2e-26   Gossypium raimondii
ref|XP_009126010.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    119   2e-26   
ref|XP_010028211.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    111   4e-26   Eucalyptus grandis [rose gum]
gb|AES73684.2|  peptidyl-prolyl cis-trans isomerase                     117   1e-25   Medicago truncatula
ref|XP_006382072.1|  hypothetical protein POPTR_0006s26710g             117   1e-25   
ref|NP_001190888.1|  cyclophilin-like peptidyl-prolyl cis-trans i...    117   1e-25   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004291478.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    116   2e-25   Fragaria vesca subsp. vesca
ref|NP_194968.2|  cyclophilin-like peptidyl-prolyl cis-trans isom...    117   2e-25   Arabidopsis thaliana [mouse-ear cress]
gb|KHG30308.1|  Peptidyl-prolyl cis-trans isomerase cyp5                110   2e-25   Gossypium arboreum [tree cotton]
ref|XP_010037119.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    109   2e-25   Eucalyptus grandis [rose gum]
ref|XP_010437912.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    116   3e-25   Camelina sativa [gold-of-pleasure]
ref|XP_010437913.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    116   3e-25   Camelina sativa [gold-of-pleasure]
ref|XP_010447391.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    115   3e-25   Camelina sativa [gold-of-pleasure]
ref|XP_010447392.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    115   3e-25   Camelina sativa [gold-of-pleasure]
ref|XP_007050461.1|  Cyclophilin-like peptidyl-prolyl cis-trans i...    113   7e-25   
emb|CAA22569.1|  putative protein                                       115   7e-25   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010432723.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    114   1e-24   Camelina sativa [gold-of-pleasure]
ref|XP_010432721.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    114   1e-24   Camelina sativa [gold-of-pleasure]
ref|XP_010432722.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    114   1e-24   Camelina sativa [gold-of-pleasure]
ref|XP_007050460.1|  Cyclophilin-like peptidyl-prolyl cis-trans i...    113   1e-24   
gb|AAM13845.1|  unknown protein                                         114   2e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002867244.1|  hypothetical protein ARALYDRAFT_491484             113   2e-24   
ref|XP_010249986.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    113   2e-24   Nelumbo nucifera [Indian lotus]
ref|XP_010249988.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    113   2e-24   Nelumbo nucifera [Indian lotus]
ref|XP_002280876.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    112   3e-24   Vitis vinifera
ref|XP_010646137.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    112   3e-24   Vitis vinifera
ref|XP_002520955.1|  cyclophilin, putative                              112   5e-24   Ricinus communis
ref|XP_006412476.1|  hypothetical protein EUTSA_v10024440mg             112   6e-24   
emb|CAN75764.1|  hypothetical protein VITISV_034442                     112   6e-24   Vitis vinifera
ref|XP_010432719.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    112   6e-24   Camelina sativa [gold-of-pleasure]
ref|XP_010110347.1|  Peptidyl-prolyl cis-trans isomerase 1              111   1e-23   
ref|XP_010546569.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    110   3e-23   Tarenaya hassleriana [spider flower]
gb|KDO68605.1|  hypothetical protein CISIN_1g006162mg                   109   4e-23   Citrus sinensis [apfelsine]
ref|XP_010038051.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    109   4e-23   Eucalyptus grandis [rose gum]
ref|XP_010038050.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    109   4e-23   Eucalyptus grandis [rose gum]
ref|XP_006443959.1|  hypothetical protein CICLE_v10019230mg             108   5e-23   
ref|XP_006443960.1|  hypothetical protein CICLE_v10019230mg             108   5e-23   Citrus clementina [clementine]
gb|KDO68608.1|  hypothetical protein CISIN_1g006162mg                   108   5e-23   Citrus sinensis [apfelsine]
ref|XP_004498655.1|  PREDICTED: serine/arginine repetitive matrix...    109   6e-23   
gb|KDP21391.1|  hypothetical protein JCGZ_21862                         108   7e-23   Jatropha curcas
ref|XP_002306802.2|  hypothetical protein POPTR_0005s23730g             108   8e-23   Populus trichocarpa [western balsam poplar]
ref|XP_006838913.1|  hypothetical protein AMTR_s00002p00269760          108   9e-23   
ref|XP_010527623.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    107   1e-22   Tarenaya hassleriana [spider flower]
ref|XP_010527624.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    107   1e-22   Tarenaya hassleriana [spider flower]
ref|XP_010028212.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    100   1e-22   Eucalyptus grandis [rose gum]
ref|XP_010527622.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    107   1e-22   Tarenaya hassleriana [spider flower]
gb|AJA29688.1|  peptidyl-prolyl cis-trans isomerase                     107   1e-22   Betula luminifera [liang ye hua]
ref|XP_002302085.2|  hypothetical protein POPTR_0002s04800g             107   2e-22   
ref|XP_010527616.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    107   2e-22   Tarenaya hassleriana [spider flower]
ref|XP_010527615.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    107   2e-22   Tarenaya hassleriana [spider flower]
ref|XP_010527620.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    107   2e-22   Tarenaya hassleriana [spider flower]
ref|XP_006283087.1|  hypothetical protein CARUB_v10004106mg             107   2e-22   
ref|XP_010527617.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    107   2e-22   Tarenaya hassleriana [spider flower]
ref|XP_010527621.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    107   2e-22   Tarenaya hassleriana [spider flower]
ref|XP_010527619.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    107   2e-22   Tarenaya hassleriana [spider flower]
emb|CDP03680.1|  unnamed protein product                                107   2e-22   Coffea canephora [robusta coffee]
gb|KHG26228.1|  Peptidyl-prolyl cis-trans isomerase D                   101   3e-22   Gossypium arboreum [tree cotton]
ref|XP_010028213.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  99.8    3e-22   Eucalyptus grandis [rose gum]
ref|XP_008785212.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    107   4e-22   Phoenix dactylifera
ref|XP_010028209.1|  PREDICTED: uncharacterized protein LOC104418...    100   5e-22   Eucalyptus grandis [rose gum]
ref|XP_010925250.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    106   6e-22   Elaeis guineensis
ref|XP_007199724.1|  hypothetical protein PRUPE_ppa002435mg             105   7e-22   Prunus persica
ref|XP_008235346.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    105   7e-22   Prunus mume [ume]
ref|XP_008235345.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    105   7e-22   Prunus mume [ume]
ref|XP_010274264.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    105   7e-22   Nelumbo nucifera [Indian lotus]
ref|XP_008235347.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    105   7e-22   
ref|XP_010274266.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    105   7e-22   Nelumbo nucifera [Indian lotus]
ref|XP_010274267.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    105   7e-22   Nelumbo nucifera [Indian lotus]
ref|XP_008802286.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    105   7e-22   Phoenix dactylifera
ref|XP_010274268.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    105   7e-22   Nelumbo nucifera [Indian lotus]
ref|XP_008802283.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    105   7e-22   Phoenix dactylifera
ref|XP_008802287.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    105   8e-22   Phoenix dactylifera
ref|XP_008802285.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    105   8e-22   Phoenix dactylifera
ref|XP_009370747.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    104   8e-22   
ref|XP_009798520.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    105   1e-21   Nicotiana sylvestris
gb|KJB25951.1|  hypothetical protein B456_004G217800                    104   1e-21   Gossypium raimondii
ref|XP_008792090.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    105   1e-21   Phoenix dactylifera
ref|XP_011032623.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    105   1e-21   Populus euphratica
gb|KJB25950.1|  hypothetical protein B456_004G217800                    104   1e-21   Gossypium raimondii
gb|KJB25952.1|  hypothetical protein B456_004G217800                    104   1e-21   Gossypium raimondii
gb|KJB25953.1|  hypothetical protein B456_004G217800                    104   1e-21   Gossypium raimondii
gb|KJB25949.1|  hypothetical protein B456_004G217800                    104   2e-21   Gossypium raimondii
ref|XP_010028210.1|  PREDICTED: uncharacterized protein LOC104418...  99.0    2e-21   Eucalyptus grandis [rose gum]
ref|XP_004493727.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    104   2e-21   Cicer arietinum [garbanzo]
ref|XP_008355416.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    103   2e-21   
ref|XP_008451290.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    104   2e-21   Cucumis melo [Oriental melon]
ref|XP_004146961.1|  PREDICTED: uncharacterized protein LOC101219904    103   3e-21   Cucumis sativus [cucumbers]
ref|XP_004162194.1|  PREDICTED: uncharacterized LOC101219904            103   3e-21   
ref|XP_009601158.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    103   3e-21   Nicotiana tomentosiformis
ref|XP_009601160.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    103   3e-21   Nicotiana tomentosiformis
gb|KEH23833.1|  peptidyl-prolyl cis-trans isomerase                     103   3e-21   Medicago truncatula
ref|XP_010935780.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    103   3e-21   Elaeis guineensis
ref|XP_010914920.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    103   8e-21   Elaeis guineensis
ref|XP_007162476.1|  hypothetical protein PHAVU_001G155500g             102   9e-21   Phaseolus vulgaris [French bean]
ref|XP_006604473.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    102   1e-20   Glycine max [soybeans]
ref|XP_006349731.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    102   1e-20   Solanum tuberosum [potatoes]
ref|XP_011458604.1|  PREDICTED: LOW QUALITY PROTEIN: peptidyl-pro...    102   1e-20   Fragaria vesca subsp. vesca
ref|XP_006604472.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    102   1e-20   Glycine max [soybeans]
ref|XP_006604471.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    102   1e-20   Glycine max [soybeans]
ref|XP_006604469.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    102   1e-20   Glycine max [soybeans]
ref|XP_008366534.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    101   1e-20   
ref|XP_008366532.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    101   1e-20   
ref|NP_850740.1|  cyclophilin-like peptidyl-prolyl cis-trans isom...  99.4    1e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009419289.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    102   1e-20   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004247203.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    101   2e-20   Solanum lycopersicum
ref|XP_003603433.1|  Peptidyl-prolyl cis-trans isomerase                102   2e-20   
ref|XP_009381127.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    101   2e-20   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAS75310.1|  multidomain cyclophilin type peptidyl-prolyl cis-...  99.8    4e-20   Arabidopsis thaliana [mouse-ear cress]
ref|NP_191899.1|  cyclophilin-like peptidyl-prolyl cis-trans isom...  99.8    5e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009399354.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    100   5e-20   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAH57223.1|  AT3G63400                                            99.8    5e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009399355.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    100   5e-20   
ref|XP_010679140.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    100   5e-20   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010679138.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    100   5e-20   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010679137.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    100   5e-20   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011079927.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  99.8    7e-20   Sesamum indicum [beniseed]
ref|XP_011026088.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  99.8    9e-20   Populus euphratica
ref|XP_003521263.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  99.0    1e-19   
gb|KHN10697.1|  Peptidyl-prolyl cis-trans isomerase                   99.4    1e-19   Glycine soja [wild soybean]
ref|XP_006647052.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  99.4    1e-19   Oryza brachyantha
ref|XP_006647053.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  99.4    1e-19   Oryza brachyantha
gb|EYU46533.1|  hypothetical protein MIMGU_mgv1a002319mg              98.6    2e-19   Erythranthe guttata [common monkey flower]
emb|CDX93909.1|  BnaC04g20680D                                        98.6    2e-19   
ref|XP_006402278.1|  hypothetical protein EUTSA_v10006033mg           95.9    2e-19   
ref|XP_009388658.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  98.6    3e-19   Musa acuminata subsp. malaccensis [pisang utan]
gb|EEC72707.1|  hypothetical protein OsI_06299                        98.2    3e-19   Oryza sativa Indica Group [Indian rice]
ref|XP_006290850.1|  hypothetical protein CARUB_v10016960mg           97.4    3e-19   
ref|XP_002876720.1|  hypothetical protein ARALYDRAFT_324764           97.1    3e-19   
gb|EEE56526.1|  hypothetical protein OsJ_05815                        97.4    5e-19   Oryza sativa Japonica Group [Japonica rice]
gb|EPS61145.1|  hypothetical protein M569_13654                       96.7    6e-19   Genlisea aurea
ref|XP_010268554.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  94.4    6e-19   Nelumbo nucifera [Indian lotus]
ref|XP_010234012.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  97.1    7e-19   Brachypodium distachyon [annual false brome]
ref|XP_010234009.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  97.1    7e-19   Brachypodium distachyon [annual false brome]
ref|XP_010234010.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  97.1    7e-19   Brachypodium distachyon [annual false brome]
ref|XP_010234011.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  97.1    7e-19   Brachypodium distachyon [annual false brome]
ref|XP_456922.1|  DEHA2A13640p                                        94.4    8e-19   Debaryomyces hansenii CBS767
gb|EYU44370.1|  hypothetical protein MIMGU_mgv1a0089282mg             93.2    1e-18   Erythranthe guttata [common monkey flower]
ref|XP_010468852.1|  PREDICTED: LOW QUALITY PROTEIN: peptidyl-pro...  95.5    1e-18   Camelina sativa [gold-of-pleasure]
ref|XP_010028504.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  93.2    2e-18   Eucalyptus grandis [rose gum]
ref|XP_009138664.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  94.7    2e-18   Brassica rapa
emb|CDY53714.1|  BnaAnng12550D                                        94.7    2e-18   Brassica napus [oilseed rape]
ref|XP_010512756.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  95.1    2e-18   Camelina sativa [gold-of-pleasure]
ref|XP_008681078.1|  PREDICTED: uncharacterized protein LOC100192...  95.5    3e-18   Zea mays [maize]
ref|XP_010999957.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  92.8    3e-18   Populus euphratica
ref|XP_008681079.1|  PREDICTED: uncharacterized protein LOC100192...  95.1    3e-18   
ref|XP_008454916.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  91.7    3e-18   
gb|EWM22369.1|  Cyclophilin-like peptidyl-prolyl cis-trans isomer...  94.0    4e-18   Nannochloropsis gaditana
gb|KJB17878.1|  hypothetical protein B456_003G021400                  92.0    4e-18   Gossypium raimondii
ref|XP_010104462.1|  Peptidyl-prolyl cis-trans isomerase              88.6    5e-18   
ref|XP_001651471.1|  AAEL005799-PA                                    90.5    5e-18   
gb|AIZ68177.1|  peptidyl-prolyl cis-trans isomerase CYP40-like pr...  92.0    5e-18   Ornithogalum longebracteatum [sea-onion]
emb|CDK25020.1|  unnamed protein product                              92.0    5e-18   Kuraishia capsulata CBS 1993
ref|XP_010104463.1|  Peptidyl-prolyl cis-trans isomerase              89.4    6e-18   Morus notabilis
ref|XP_008454915.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  91.7    6e-18   Cucumis melo [Oriental melon]
gb|EDM00869.1|  rCG62684, isoform CRA_b                               87.8    6e-18   Rattus norvegicus [brown rat]
ref|NP_001232291.1|  putative peptidylprolyl isomerase D              89.7    6e-18   
ref|XP_001761081.1|  predicted protein                                91.7    6e-18   
ref|XP_002310739.2|  hypothetical protein POPTR_0007s11390g           90.9    6e-18   
dbj|BAJ98045.1|  predicted protein                                    92.4    7e-18   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KHG16182.1|  Peptidyl-prolyl cis-trans isomerase CYP40 -like p...  91.3    9e-18   Gossypium arboreum [tree cotton]
emb|CDS03415.1|  Putative Peptidyl-prolyl cis-trans isomerasecyp5     88.6    9e-18   Lichtheimia ramosa
ref|XP_005854554.1|  myosin light chain kinase                        93.6    1e-17   Nannochloropsis gaditana CCMP526
ref|XP_003436324.1|  AGAP002952-PB                                    88.2    1e-17   Anopheles gambiae str. PEST
ref|XP_004165805.1|  PREDICTED: LOW QUALITY PROTEIN: peptidyl-pro...  90.9    1e-17   
ref|XP_009350556.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  90.9    1e-17   Pyrus x bretschneideri [bai li]
ref|XP_004136993.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  90.9    1e-17   Cucumis sativus [cucumbers]
ref|XP_002521846.1|  peptidyl-prolyl cis-trans isomerase d, ppid,...  90.5    1e-17   Ricinus communis
ref|XP_003524582.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  90.5    1e-17   
ref|XP_006579808.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  90.5    2e-17   Glycine max [soybeans]
ref|XP_006657500.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  92.4    2e-17   Oryza brachyantha
ref|XP_006657499.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  92.4    2e-17   
ref|XP_010584392.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  90.1    2e-17   Haliaeetus leucocephalus
ref|XP_006798990.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  89.4    2e-17   Neolamprologus brichardi [lyretail cichlid]
ref|XP_006384447.1|  SQUINT family protein                            90.5    2e-17   
ref|XP_010584391.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  90.5    2e-17   Haliaeetus leucocephalus
gb|ACH45652.1|  putative peptidylprolyl isomerase D                   90.5    2e-17   Taeniopygia guttata
ref|XP_001487732.1|  hypothetical protein PGUG_01109                  90.9    2e-17   Meyerozyma guilliermondii ATCC 6260
ref|XP_007047186.1|  Peptidyl-prolyl cis-trans isomerase / cyclop...  89.4    2e-17   
ref|XP_005148983.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  90.1    2e-17   Melopsittacus undulatus
ref|XP_011007671.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  89.0    2e-17   Populus euphratica
ref|XP_011001198.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  90.1    2e-17   Populus euphratica
gb|ACH45651.1|  putative peptidylprolyl isomerase D                   90.1    2e-17   Taeniopygia guttata
ref|XP_011464347.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  89.4    2e-17   Fragaria vesca subsp. vesca
ref|XP_001774773.1|  predicted protein                                90.1    2e-17   
ref|XP_011007670.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  89.4    2e-17   Populus euphratica
ref|XP_005486377.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  90.1    2e-17   Zonotrichia albicollis
ref|XP_007047183.1|  Peptidyl-prolyl cis-trans isomerase / cyclop...  89.4    2e-17   
ref|XP_004509164.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  90.1    2e-17   Cicer arietinum [garbanzo]
ref|XP_003036654.1|  hypothetical protein SCHCODRAFT_80344            90.1    2e-17   Schizophyllum commune H4-8
ref|XP_011099202.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  89.7    3e-17   Sesamum indicum [beniseed]
gb|EMF14722.1|  peptidyl-prolyl cis-trans isomerase 1                 90.1    3e-17   Sphaerulina musiva SO2202
gb|KJB48523.1|  hypothetical protein B456_008G073900                  89.7    3e-17   Gossypium raimondii
ref|XP_007047178.1|  Peptidyl-prolyl cis-trans isomerase / cyclop...  89.7    3e-17   
ref|XP_007047182.1|  Peptidyl-prolyl cis-trans isomerase / cyclop...  89.7    3e-17   
ref|XP_004288060.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  89.7    3e-17   Fragaria vesca subsp. vesca
ref|XP_005517649.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  89.7    3e-17   Pseudopodoces humilis [Tibetan ground-jay]
ref|XP_011099199.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  89.7    3e-17   Sesamum indicum [beniseed]
ref|XP_003970715.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  87.0    3e-17   
ref|XP_002982010.1|  hypothetical protein SELMODRAFT_115473           87.4    3e-17   
gb|ACO07673.1|  40 kDa peptidyl-prolyl cis-trans isomerase            89.7    3e-17   Oncorhynchus mykiss
gb|ACH70718.1|  peptidylprolyl isomerase D (cyclophilin D)            89.7    3e-17   Salmo salar
ref|XP_010530877.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  89.7    3e-17   Tarenaya hassleriana [spider flower]
ref|XP_007047185.1|  Peptidyl-prolyl cis-trans isomerase / cyclop...  89.0    3e-17   
ref|XP_010548031.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  89.7    3e-17   Tarenaya hassleriana [spider flower]
ref|XP_008236639.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  89.7    3e-17   Prunus mume [ume]
emb|CDQ63777.1|  unnamed protein product                              89.7    3e-17   Oncorhynchus mykiss
gb|ACO08154.1|  40 kDa peptidyl-prolyl cis-trans isomerase            89.7    3e-17   Oncorhynchus mykiss
ref|XP_009781931.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  89.7    3e-17   
ref|XP_011007669.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  89.4    4e-17   
ref|XP_003550075.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  89.4    4e-17   
ref|XP_010413154.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  91.3    4e-17   
sp|P0C1I7.1|CYP5_RHIO9  RecName: Full=Peptidyl-prolyl cis-trans i...  87.0    4e-17   
ref|XP_010413155.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  91.3    4e-17   
ref|XP_002313093.1|  SQUINT family protein                            89.4    4e-17   
ref|XP_006412177.1|  hypothetical protein EUTSA_v10027585mg           87.0    5e-17   
gb|KHG25547.1|  Peptidyl-prolyl cis-trans isomerase CYP40 -like p...  89.0    5e-17   
emb|CDH48646.1|  cyclophilin                                          86.3    6e-17   
ref|XP_003337737.1|  peptidyl-prolyl isomerase D (cyclophilin D)      85.5    6e-17   
ref|XP_006409501.1|  hypothetical protein EUTSA_v10022753mg           89.0    6e-17   
gb|EGW00520.1|  40 kDa peptidyl-prolyl cis-trans isomerase            87.0    6e-17   
ref|XP_006121931.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  89.0    6e-17   
ref|XP_003715059.1|  peptidyl-prolyl cis-trans isomerase              89.0    6e-17   
ref|XP_006740015.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  85.1    7e-17   
gb|EMG49183.1|  Peptidyl-prolyl cis-trans isomerase D                 89.0    7e-17   
ref|XP_005076198.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  89.0    7e-17   
ref|XP_007005972.1|  hypothetical protein TREMEDRAFT_23729            85.1    7e-17   
ref|XP_010107982.1|  Peptidyl-prolyl cis-trans isomerase CYP40        88.6    7e-17   
ref|XP_008775239.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  89.0    7e-17   
ref|XP_004232050.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  88.6    7e-17   
ref|XP_004553696.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  88.6    7e-17   
ref|XP_005919457.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  88.6    7e-17   
ref|XP_006338217.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  88.6    8e-17   
emb|CEP18822.1|  hypothetical protein                                 85.9    8e-17   
gb|EMD36826.1|  hypothetical protein CERSUDRAFT_114733                88.6    8e-17   
ref|XP_003504914.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  87.4    8e-17   
ref|NP_001004279.1|  peptidyl-prolyl cis-trans isomerase D            88.6    8e-17   
ref|XP_003443392.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  88.6    8e-17   
ref|XP_311948.5|  AGAP002952-PA                                       90.9    8e-17   
emb|CEI93837.1|  Putative Peptidyl-prolyl cis-trans isomerase cyp11   88.2    9e-17   
emb|CDX71247.1|  BnaC07g05260D                                        88.2    9e-17   
ref|XP_007042358.1|  Peptidyl-prolyl cis-trans isomerase / cyclop...  88.6    9e-17   
ref|XP_008775240.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  88.6    9e-17   
ref|XP_003436323.1|  AGAP002952-PC                                    90.5    9e-17   
ref|XP_006829301.1|  hypothetical protein AMTR_s00001p00273100        88.2    1e-16   
gb|AAP44536.1|  cyclophilin-like protein                              90.1    1e-16   
ref|XP_003970636.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  88.2    1e-16   
gb|KEH30915.1|  peptidyl-prolyl cis-trans isomerase D                 87.8    1e-16   
ref|XP_004367802.1|  peptidylprolyl cis-trans isomerase, cyclophi...  89.7    1e-16   
ref|XP_009759456.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  88.2    1e-16   
ref|XP_002306460.1|  hypothetical protein POPTR_0005s14210g           87.8    1e-16   
emb|CAA69622.1|  cyclophylin                                          85.5    1e-16   
ref|XP_009593827.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  87.8    1e-16   
gb|KEH30916.1|  peptidyl-prolyl cis-trans isomerase D                 87.4    1e-16   
ref|XP_007624483.1|  PREDICTED: LOW QUALITY PROTEIN: peptidyl-pro...  88.2    1e-16   
ref|XP_005299363.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  87.8    1e-16   
gb|KHG00695.1|  Peptidyl-prolyl cis-trans isomerase CYP40             87.8    1e-16   
ref|XP_007393240.1|  hypothetical protein PHACADRAFT_251820           87.4    1e-16   
ref|XP_004366913.1|  Cyclophilin                                      89.4    1e-16   
ref|NP_001048194.1|  Os02g0761100                                     88.6    1e-16   
ref|XP_007611328.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  87.8    1e-16   
gb|ERE90429.1|  peptidyl-prolyl cis-trans isomerase D-like protein    87.8    1e-16   
ref|XP_009589624.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  87.8    1e-16   
ref|XP_004926608.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  85.9    1e-16   
ref|XP_007609920.1|  PREDICTED: LOW QUALITY PROTEIN: peptidyl-pro...  87.8    1e-16   
ref|XP_006346442.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  87.8    1e-16   
ref|XP_011092738.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  87.8    1e-16   
emb|CDQ62287.1|  unnamed protein product                              87.8    1e-16   
ref|XP_011092737.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  87.8    1e-16   
gb|ACI66097.1|  40 kDa peptidyl-prolyl cis-trans isomerase            87.8    1e-16   
tpg|DAA59762.1|  TPA: hypothetical protein ZEAMMB73_415877            87.4    2e-16   
ref|XP_003608033.1|  Peptidyl-prolyl cis-trans isomerase CYP40        87.8    2e-16   
gb|ACO07506.1|  40 kDa peptidyl-prolyl cis-trans isomerase            87.8    2e-16   
ref|XP_008796575.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  87.8    2e-16   
ref|XP_010228289.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  89.4    2e-16   
ref|XP_007201325.1|  hypothetical protein PRUPE_ppa007583mg           87.4    2e-16   
ref|XP_004230798.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  87.4    2e-16   
ref|XP_003557489.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  89.4    2e-16   
ref|XP_004324857.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  86.7    2e-16   
ref|XP_004290309.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  87.4    2e-16   
emb|CEP10276.1|  hypothetical protein                                 87.4    2e-16   
ref|XP_010381484.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  87.4    2e-16   
gb|KIW08816.1|  hypothetical protein PV09_00747                       87.4    2e-16   
ref|XP_010517185.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  87.4    2e-16   
ref|XP_665956.1|  hypothetical protein                                84.7    2e-16   
ref|XP_004195205.1|  Piso0_005752                                     87.4    2e-16   
ref|XP_010467327.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  87.0    2e-16   
ref|XP_003570584.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  87.4    2e-16   
ref|XP_010489178.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  87.0    2e-16   
ref|XP_007071343.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  87.0    2e-16   
ref|XP_001862300.1|  peptidyl-prolyl cis-trans isomerase g            86.3    2e-16   
gb|KFB52696.1|  AGAP002952-PC-like protein                            88.6    2e-16   
ref|XP_010090292.1|  Peptidyl-prolyl cis-trans isomerase              84.7    2e-16   
ref|XP_001633810.1|  predicted protein                                87.0    2e-16   
ref|XP_004289844.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  84.7    2e-16   
ref|XP_007155953.1|  hypothetical protein PHAVU_003G246400g           87.0    2e-16   
ref|XP_006647943.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  87.4    2e-16   
gb|KFA61408.1|  hypothetical protein S40285_03565                     87.4    2e-16   
ref|XP_003650848.1|  hypothetical protein THITE_2094562               87.0    3e-16   
ref|NP_565381.1|  peptidyl-prolyl cis-trans isomerase CYP40           87.0    3e-16   
ref|XP_001388285.1|  hypothetical protein                             84.3    3e-16   
ref|XP_010680438.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  87.0    3e-16   
ref|XP_002054499.1|  GJ22774                                          89.4    3e-16   
ref|XP_001386995.1|  Peptidyl-prolyl cis-trans isomerase CPR6 (PP...  87.0    3e-16   
ref|XP_007117530.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  86.7    3e-16   
ref|XP_008785095.1|  PREDICTED: peptidyl-prolyl cis-trans isomerase   84.3    3e-16   
gb|KHG00696.1|  Peptidyl-prolyl cis-trans isomerase CYP40             87.8    3e-16   
ref|XP_010691019.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  87.0    3e-16   
ref|XP_007446681.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  87.0    3e-16   
ref|XP_010953800.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  87.0    3e-16   
gb|EMP24944.1|  Peptidyl-prolyl cis-trans isomerase D                 87.0    3e-16   
ref|XP_007117529.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  87.0    3e-16   
ref|XP_010898283.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  87.0    3e-16   
ref|XP_001903954.1|  hypothetical protein                             87.0    3e-16   
ref|XP_006213657.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  87.0    3e-16   
ref|XP_004266204.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  87.0    3e-16   
ref|XP_007184203.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  87.0    3e-16   
ref|XP_008679868.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  87.0    3e-16   
ref|XP_532704.1|  PREDICTED: peptidyl-prolyl cis-trans isomerase ...  86.7    3e-16   
ref|XP_004606206.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  86.7    3e-16   
gb|EFA76366.1|  cyclophilin-type peptidylprolyl cis-trans isomerase   84.0    3e-16   
ref|XP_007998311.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  86.3    3e-16   
emb|CEF66075.1|  Peptidyl-prolyl cis-trans isomerase D                84.0    3e-16   
ref|XP_008799420.1|  PREDICTED: peptidyl-prolyl cis-trans isomerase   84.0    3e-16   
ref|XP_001955669.1|  GF18880                                          89.0    4e-16   
gb|KJB71084.1|  hypothetical protein B456_011G104900                  86.7    4e-16   
gb|KJB32424.1|  hypothetical protein B456_005G240200                  85.5    4e-16   
gb|KIW28425.1|  hypothetical protein PV07_08092                       86.7    4e-16   
ref|XP_006297983.1|  hypothetical protein CARUB_v10014032mg           86.7    4e-16   
ref|XP_007373249.1|  rotamase D                                       86.7    4e-16   
ref|XP_001780456.1|  predicted protein                                84.7    4e-16   
ref|XP_426283.3|  PREDICTED: peptidyl-prolyl cis-trans isomerase ...  86.7    4e-16   
ref|XP_010939760.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  86.7    4e-16   
ref|XP_010939761.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  86.7    4e-16   
ref|XP_010726006.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  85.1    4e-16   
ref|XP_007845898.1|  peptidyl-prolyl cis-trans isomerase              86.7    4e-16   
dbj|BAQ21277.1|  cyclophilin                                          84.0    4e-16   
gb|KFK40038.1|  hypothetical protein AALP_AA3G321900                  86.3    4e-16   
gb|EMD94092.1|  hypothetical protein COCHEDRAFT_1201904               84.0    4e-16   
ref|XP_002599120.1|  hypothetical protein BRAFLDRAFT_281480           85.5    5e-16   
gb|KHG06583.1|  Peptidyl-prolyl cis-trans isomerase CYP40 -like p...  86.7    5e-16   
ref|XP_010985159.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  86.3    5e-16   
ref|XP_006000743.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  86.7    5e-16   
gb|KDP27580.1|  hypothetical protein JCGZ_19585                       83.6    5e-16   
sp|P0C1I9.1|CYP11_RHIO9  RecName: Full=Peptidyl-prolyl cis-trans ...  85.9    5e-16   
ref|XP_002000002.1|  GI22772                                          88.6    5e-16   
gb|EHH30637.1|  hypothetical protein EGK_20384                        86.3    5e-16   
ref|XP_010268679.1|  PREDICTED: peptidyl-prolyl cis-trans isomerase   83.6    5e-16   
ref|XP_002452869.1|  hypothetical protein SORBIDRAFT_04g033940        86.7    5e-16   
ref|NP_001276071.1|  uncharacterized protein LOC102623101             83.6    5e-16   
ref|XP_005593787.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  86.3    5e-16   
ref|XP_009377655.1|  PREDICTED: peptidyl-prolyl cis-trans isomerase   83.6    5e-16   
ref|XP_011092880.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  83.6    5e-16   
ref|XP_001094929.2|  PREDICTED: peptidyl-prolyl cis-trans isomera...  86.3    5e-16   
ref|XP_006867984.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  86.3    5e-16   
ref|XP_006487422.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  83.6    5e-16   
gb|KIW43118.1|  peptidyl-prolyl cis-trans isomerase D                 86.3    5e-16   
ref|XP_009119395.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  86.3    5e-16   
gb|KFQ46673.1|  Peptidyl-prolyl cis-trans isomerase D                 82.8    5e-16   
ref|XP_006423069.1|  hypothetical protein CICLE_v10028706mg           86.3    5e-16   
gb|KFP78820.1|  Peptidyl-prolyl cis-trans isomerase D                 82.8    5e-16   
pdb|4JJM|A  Chain A, Structure Of A Cyclophilin From Citrus Sinen...  83.6    6e-16   
gb|KFP14006.1|  Peptidyl-prolyl cis-trans isomerase D                 82.4    6e-16   
gb|KFP45178.1|  Peptidyl-prolyl cis-trans isomerase D                 82.4    6e-16   
gb|KDP38235.1|  hypothetical protein JCGZ_04878                       85.9    6e-16   
ref|XP_003578523.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  84.3    6e-16   
gb|KFO07741.1|  Peptidyl-prolyl cis-trans isomerase D                 82.8    6e-16   
gb|KFP00867.1|  Peptidyl-prolyl cis-trans isomerase D                 82.8    6e-16   
gb|KFV98604.1|  Peptidyl-prolyl cis-trans isomerase D                 82.8    6e-16   
gb|KFO88271.1|  Peptidyl-prolyl cis-trans isomerase D                 82.8    6e-16   
gb|KFQ13013.1|  Peptidyl-prolyl cis-trans isomerase D                 82.8    6e-16   
gb|KFP46157.1|  Peptidyl-prolyl cis-trans isomerase D                 82.8    6e-16   
ref|XP_009399694.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  86.3    6e-16   
ref|XP_011427426.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  88.2    6e-16   
gb|KFP32657.1|  Peptidyl-prolyl cis-trans isomerase D                 82.8    6e-16   
ref|XP_008324858.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  85.9    6e-16   
gb|KJB32427.1|  hypothetical protein B456_005G240200                  85.9    7e-16   
ref|XP_009399695.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  86.3    7e-16   
ref|XP_008679866.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  87.8    7e-16   
ref|XP_008679864.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  87.8    7e-16   
ref|XP_006892841.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  85.9    7e-16   
emb|CDO76132.1|  hypothetical protein BN946_scf184332.g2              85.9    7e-16   
ref|XP_010066256.1|  PREDICTED: peptidyl-prolyl cis-trans isomerase   83.2    7e-16   
ref|XP_008683780.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  85.9    7e-16   
emb|CDS13662.1|  hypothetical protein LRAMOSA05836                    85.9    7e-16   
gb|KJB32423.1|  hypothetical protein B456_005G240200                  85.9    7e-16   
ref|XP_008679865.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  87.8    7e-16   
ref|XP_007998309.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  85.5    7e-16   
ref|XP_008584597.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  85.9    7e-16   
ref|XP_004394281.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  85.9    7e-16   
ref|NP_001271664.1|  uncharacterized protein LOC101867179             85.9    7e-16   
gb|EFB29938.1|  hypothetical protein PANDA_010618                     85.5    7e-16   
ref|XP_007998308.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  85.9    7e-16   
gb|KFU96890.1|  Peptidyl-prolyl cis-trans isomerase D                 82.4    7e-16   
emb|CDO97146.1|  unnamed protein product                              85.9    7e-16   
gb|EHH54044.1|  hypothetical protein EGM_14781                        85.9    7e-16   
gb|EHH26276.1|  hypothetical protein EGK_16197                        85.9    7e-16   
ref|XP_003529384.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  85.9    7e-16   
ref|XP_002745353.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  85.9    7e-16   
ref|XP_007530443.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  85.9    7e-16   
ref|XP_009399693.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  86.3    7e-16   
gb|KEY72096.1|  hypothetical protein S7711_00112                      85.9    7e-16   
gb|KIH50843.1|  peptidyl-prolyl cis-trans isomerase, cyclophilin-...  80.5    8e-16   
gb|KDO49144.1|  hypothetical protein CISIN_1g018089mg                 85.1    8e-16   
ref|XP_002921709.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  85.9    8e-16   
ref|NP_001252763.1|  peptidylprolyl isomerase D                       85.9    8e-16   
ref|XP_007229920.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  85.9    8e-16   
gb|KFV82477.1|  Peptidyl-prolyl cis-trans isomerase D                 82.4    8e-16   
gb|KFQ22621.1|  Peptidyl-prolyl cis-trans isomerase D                 82.4    8e-16   
ref|XP_004017329.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  85.9    8e-16   
emb|CAA69598.1|  cyclophilin                                          83.2    8e-16   
gb|KHN31054.1|  Peptidyl-prolyl cis-trans isomerase CYP40             85.5    8e-16   
ref|XP_003899367.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  85.9    8e-16   
ref|XP_003984955.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  85.9    8e-16   
gb|KFA77235.1|  hypothetical protein S40288_01249                     85.9    8e-16   
gb|KGL84249.1|  Peptidyl-prolyl cis-trans isomerase D                 82.0    8e-16   
gb|KFV40440.1|  Peptidyl-prolyl cis-trans isomerase D                 82.4    8e-16   
ref|XP_004777378.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  85.9    8e-16   
gb|KFR12601.1|  Peptidyl-prolyl cis-trans isomerase D                 82.4    8e-16   
ref|NP_776578.1|  peptidyl-prolyl cis-trans isomerase D               85.9    8e-16   
ref|XP_003418541.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  85.9    8e-16   
ref|XP_003221776.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  85.9    8e-16   
ref|XP_001500384.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  85.9    8e-16   
ref|XP_005985804.1|  PREDICTED: LOW QUALITY PROTEIN: peptidylprol...  85.9    8e-16   
ref|XP_005666719.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  85.5    8e-16   
gb|KFW75627.1|  Peptidyl-prolyl cis-trans isomerase D                 82.4    8e-16   
ref|XP_001994815.1|  GH17446                                          87.8    9e-16   
ref|XP_007925730.1|  hypothetical protein MYCFIDRAFT_36025            85.9    9e-16   
ref|XP_005909484.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...  85.5    9e-16   



>ref|XP_009618666.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X1 [Nicotiana tomentosiformis]
Length=799

 Score =   137 bits (346),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 64/77 (83%), Positives = 66/77 (86%), Gaps = 0/77 (0%)
 Frame = +3

Query  102  MSKKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKG  281
            MSKKK LVFLDV IDGDP ERMVFELFTD+APKTAENFRALCTGEKG S KTG  LHYKG
Sbjct  1    MSKKKQLVFLDVSIDGDPVERMVFELFTDIAPKTAENFRALCTGEKGVSSKTGKPLHYKG  60

Query  282  TFFHHIVKGSMAQVWSL  332
            TFFH IVKGS+AQ   L
Sbjct  61   TFFHRIVKGSVAQAGDL  77



>ref|XP_009618667.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X2 [Nicotiana tomentosiformis]
Length=797

 Score =   137 bits (346),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 64/77 (83%), Positives = 66/77 (86%), Gaps = 0/77 (0%)
 Frame = +3

Query  102  MSKKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKG  281
            MSKKK LVFLDV IDGDP ERMVFELFTD+APKTAENFRALCTGEKG S KTG  LHYKG
Sbjct  1    MSKKKQLVFLDVSIDGDPVERMVFELFTDIAPKTAENFRALCTGEKGVSSKTGKPLHYKG  60

Query  282  TFFHHIVKGSMAQVWSL  332
            TFFH IVKGS+AQ   L
Sbjct  61   TFFHRIVKGSVAQAGDL  77



>ref|XP_006364269.1| PREDICTED: serine/arginine repetitive matrix protein 2-like isoform 
X1 [Solanum tuberosum]
Length=807

 Score =   136 bits (342),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 62/77 (81%), Positives = 65/77 (84%), Gaps = 0/77 (0%)
 Frame = +3

Query  102  MSKKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKG  281
            MSKKK  VFLDV IDGDP ER+ FELFTDVAPKTAENFRALCTGEKG S KTG  LHYKG
Sbjct  1    MSKKKPQVFLDVSIDGDPVERLAFELFTDVAPKTAENFRALCTGEKGVSSKTGRPLHYKG  60

Query  282  TFFHHIVKGSMAQVWSL  332
            TFFHHI+KGS+AQ   L
Sbjct  61   TFFHHIIKGSVAQAGDL  77



>ref|XP_011084184.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 [Sesamum 
indicum]
 ref|XP_011084254.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 [Sesamum 
indicum]
 ref|XP_011084337.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 [Sesamum 
indicum]
Length=784

 Score =   135 bits (339),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 62/74 (84%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +3

Query  99   KMSKKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  278
            K++KKKVLVFLDV IDGDPFERM+FELFTDVAPKTAENFRALCTGEKG S KTG  LHYK
Sbjct  3    KINKKKVLVFLDVSIDGDPFERMIFELFTDVAPKTAENFRALCTGEKGVSLKTGKPLHYK  62

Query  279  GTFFHHIVKGSMAQ  320
            GTFFH I+KG +AQ
Sbjct  63   GTFFHRIIKGYVAQ  76



>ref|XP_009783532.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X1 [Nicotiana sylvestris]
Length=799

 Score =   134 bits (337),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 63/77 (82%), Positives = 65/77 (84%), Gaps = 0/77 (0%)
 Frame = +3

Query  102  MSKKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKG  281
            MSKKK LVFLDV IDGDP E MVFELFTD+APKTAENFRALCTGEKG S KTG  LHYKG
Sbjct  1    MSKKKQLVFLDVSIDGDPVETMVFELFTDIAPKTAENFRALCTGEKGVSSKTGKPLHYKG  60

Query  282  TFFHHIVKGSMAQVWSL  332
            TFFH IVKGS+AQ   L
Sbjct  61   TFFHRIVKGSVAQAGDL  77



>ref|XP_009783537.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X2 [Nicotiana sylvestris]
Length=797

 Score =   134 bits (337),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 63/77 (82%), Positives = 65/77 (84%), Gaps = 0/77 (0%)
 Frame = +3

Query  102  MSKKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKG  281
            MSKKK LVFLDV IDGDP E MVFELFTD+APKTAENFRALCTGEKG S KTG  LHYKG
Sbjct  1    MSKKKQLVFLDVSIDGDPVETMVFELFTDIAPKTAENFRALCTGEKGVSSKTGKPLHYKG  60

Query  282  TFFHHIVKGSMAQVWSL  332
            TFFH IVKGS+AQ   L
Sbjct  61   TFFHRIVKGSVAQAGDL  77



>ref|XP_004245196.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X1 [Solanum lycopersicum]
Length=807

 Score =   134 bits (336),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 62/77 (81%), Positives = 64/77 (83%), Gaps = 0/77 (0%)
 Frame = +3

Query  102  MSKKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKG  281
            MSKKK  VFLDV IDGDP ERM FELFTDVAPKTAENFRALCTGEKG S KTG  LHYKG
Sbjct  1    MSKKKPQVFLDVSIDGDPVERMAFELFTDVAPKTAENFRALCTGEKGVSSKTGRPLHYKG  60

Query  282  TFFHHIVKGSMAQVWSL  332
            TFFH IVKGS+AQ   +
Sbjct  61   TFFHRIVKGSVAQAGDM  77



>gb|EYU29231.1| hypothetical protein MIMGU_mgv1a002140mg [Erythranthe guttata]
Length=709

 Score =   132 bits (331),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +3

Query  99   KMSKKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  278
            K++K+K+LVFLDV +DGDPFERM+FELFTDVAPKTAENFRALCTGEKG S KTG  LHYK
Sbjct  3    KVNKRKLLVFLDVSVDGDPFERMIFELFTDVAPKTAENFRALCTGEKGVSVKTGKPLHYK  62

Query  279  GTFFHHIVKGSMAQ  320
            GTFFH I+KG +AQ
Sbjct  63   GTFFHRIIKGYLAQ  76



>ref|XP_002285000.2| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X1 [Vitis vinifera]
 ref|XP_010648637.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X1 [Vitis vinifera]
Length=796

 Score =   130 bits (328),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 57/71 (80%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = +3

Query  108  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  287
            KK  LV+LDV IDGDP ERMVFELF+DVAPKTAENFRALCTGEKG  PKTG  LHYKG+F
Sbjct  4    KKNPLVYLDVSIDGDPIERMVFELFSDVAPKTAENFRALCTGEKGIGPKTGKPLHYKGSF  63

Query  288  FHHIVKGSMAQ  320
            FH I+KGSM Q
Sbjct  64   FHRIIKGSMVQ  74



>ref|XP_010648638.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X2 [Vitis vinifera]
Length=795

 Score =   130 bits (328),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 57/71 (80%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = +3

Query  108  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  287
            KK  LV+LDV IDGDP ERMVFELF+DVAPKTAENFRALCTGEKG  PKTG  LHYKG+F
Sbjct  4    KKNPLVYLDVSIDGDPIERMVFELFSDVAPKTAENFRALCTGEKGIGPKTGKPLHYKGSF  63

Query  288  FHHIVKGSMAQ  320
            FH I+KGSM Q
Sbjct  64   FHRIIKGSMVQ  74



>gb|EYU29230.1| hypothetical protein MIMGU_mgv1a002072mg [Erythranthe guttata]
Length=719

 Score =   130 bits (326),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = +3

Query  99   KMSKKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  278
            KMSK+K LVF DV +DGDP ERMVFELFTDVAP+TAENFRALCTGEKG S KTG  LHYK
Sbjct  4    KMSKRKPLVFFDVSVDGDPLERMVFELFTDVAPRTAENFRALCTGEKGASLKTGRPLHYK  63

Query  279  GTFFHHIVKGSMAQ  320
            GTFFH I+KG +AQ
Sbjct  64   GTFFHRIIKGYVAQ  77



>ref|XP_010670673.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=765

 Score =   130 bits (326),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 59/75 (79%), Positives = 62/75 (83%), Gaps = 0/75 (0%)
 Frame = +3

Query  108  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  287
            K+  LVFLDV IDGDP+ERMVFELF+DV PKTAENFRALCTGEKG  PK G  LHYKGTF
Sbjct  4    KRNPLVFLDVSIDGDPYERMVFELFSDVVPKTAENFRALCTGEKGVGPKLGKPLHYKGTF  63

Query  288  FHHIVKGSMAQVWSL  332
            FH IVKGSMAQ   L
Sbjct  64   FHRIVKGSMAQGGDL  78



>ref|XP_010670670.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X1 [Beta vulgaris subsp. vulgaris]
 ref|XP_010670671.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X1 [Beta vulgaris subsp. vulgaris]
 ref|XP_010670672.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=768

 Score =   129 bits (325),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 59/75 (79%), Positives = 62/75 (83%), Gaps = 0/75 (0%)
 Frame = +3

Query  108  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  287
            K+  LVFLDV IDGDP+ERMVFELF+DV PKTAENFRALCTGEKG  PK G  LHYKGTF
Sbjct  4    KRNPLVFLDVSIDGDPYERMVFELFSDVVPKTAENFRALCTGEKGVGPKLGKPLHYKGTF  63

Query  288  FHHIVKGSMAQVWSL  332
            FH IVKGSMAQ   L
Sbjct  64   FHRIVKGSMAQGGDL  78



>ref|XP_002324283.2| hypothetical protein POPTR_0018s01460g [Populus trichocarpa]
 gb|EEF02848.2| hypothetical protein POPTR_0018s01460g [Populus trichocarpa]
Length=819

 Score =   130 bits (326),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 57/71 (80%), Positives = 62/71 (87%), Gaps = 0/71 (0%)
 Frame = +3

Query  108  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  287
            KK  LVF+DVCIDGDP ERMVFELF+D+APKTAENFRALCTGEKG  PK+   LHYKG+F
Sbjct  8    KKNPLVFMDVCIDGDPKERMVFELFSDIAPKTAENFRALCTGEKGIGPKSERPLHYKGSF  67

Query  288  FHHIVKGSMAQ  320
            FH IVKGSMAQ
Sbjct  68   FHRIVKGSMAQ  78



>emb|CBI21007.3| unnamed protein product [Vitis vinifera]
Length=438

 Score =   127 bits (318),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 57/71 (80%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = +3

Query  108  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  287
            KK  LV+LDV IDGDP ERMVFELF+DVAPKTAENFRALCTGEKG  PKTG  LHYKG+F
Sbjct  4    KKNPLVYLDVSIDGDPIERMVFELFSDVAPKTAENFRALCTGEKGIGPKTGKPLHYKGSF  63

Query  288  FHHIVKGSMAQ  320
            FH I+KGSM Q
Sbjct  64   FHRIIKGSMVQ  74



>ref|XP_006450486.1| hypothetical protein CICLE_v10007495mg [Citrus clementina]
 gb|ESR63726.1| hypothetical protein CICLE_v10007495mg [Citrus clementina]
Length=792

 Score =   129 bits (325),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 54/71 (76%), Positives = 63/71 (89%), Gaps = 0/71 (0%)
 Frame = +3

Query  108  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  287
            KK +LVF+DV IDGDP ERMVFELF+D+APKTAENFRALCTGEKG  P+TG  LHYKG+F
Sbjct  4    KKSLLVFMDVSIDGDPVERMVFELFSDIAPKTAENFRALCTGEKGIGPRTGKPLHYKGSF  63

Query  288  FHHIVKGSMAQ  320
            FH ++KGSMA+
Sbjct  64   FHRVIKGSMAE  74



>ref|XP_006483322.1| PREDICTED: serine/arginine repetitive matrix protein 2-like isoform 
X3 [Citrus sinensis]
Length=792

 Score =   129 bits (324),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 54/71 (76%), Positives = 63/71 (89%), Gaps = 0/71 (0%)
 Frame = +3

Query  108  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  287
            KK +LVF+DV IDGDP ERMVFELF+D+APKTAENFRALCTGEKG  P+TG  LHYKG+F
Sbjct  4    KKSLLVFMDVSIDGDPVERMVFELFSDIAPKTAENFRALCTGEKGIGPRTGKPLHYKGSF  63

Query  288  FHHIVKGSMAQ  320
            FH ++KGSMA+
Sbjct  64   FHRVIKGSMAE  74



>ref|XP_011026475.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like isoform 
X2 [Populus euphratica]
Length=794

 Score =   129 bits (324),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 56/71 (79%), Positives = 62/71 (87%), Gaps = 0/71 (0%)
 Frame = +3

Query  108  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  287
            KK  LVF+D+CIDGDP ERMVFELF+D+APKTAENFRALCTGE G  PK+G  LHYKG+F
Sbjct  8    KKNPLVFMDLCIDGDPKERMVFELFSDIAPKTAENFRALCTGETGIGPKSGRPLHYKGSF  67

Query  288  FHHIVKGSMAQ  320
            FH IVKGSMAQ
Sbjct  68   FHRIVKGSMAQ  78



>ref|XP_011026473.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like isoform 
X1 [Populus euphratica]
 ref|XP_011026474.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like isoform 
X1 [Populus euphratica]
Length=795

 Score =   129 bits (324),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 56/71 (79%), Positives = 62/71 (87%), Gaps = 0/71 (0%)
 Frame = +3

Query  108  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  287
            KK  LVF+D+CIDGDP ERMVFELF+D+APKTAENFRALCTGE G  PK+G  LHYKG+F
Sbjct  8    KKNPLVFMDLCIDGDPKERMVFELFSDIAPKTAENFRALCTGETGIGPKSGRPLHYKGSF  67

Query  288  FHHIVKGSMAQ  320
            FH IVKGSMAQ
Sbjct  68   FHRIVKGSMAQ  78



>ref|XP_006483320.1| PREDICTED: serine/arginine repetitive matrix protein 2-like isoform 
X1 [Citrus sinensis]
 ref|XP_006483321.1| PREDICTED: serine/arginine repetitive matrix protein 2-like isoform 
X2 [Citrus sinensis]
 gb|KDO61676.1| hypothetical protein CISIN_1g003708mg [Citrus sinensis]
 gb|KDO61677.1| hypothetical protein CISIN_1g003708mg [Citrus sinensis]
 gb|KDO61678.1| hypothetical protein CISIN_1g003708mg [Citrus sinensis]
Length=801

 Score =   129 bits (324),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 54/71 (76%), Positives = 63/71 (89%), Gaps = 0/71 (0%)
 Frame = +3

Query  108  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  287
            KK +LVF+DV IDGDP ERMVFELF+D+APKTAENFRALCTGEKG  P+TG  LHYKG+F
Sbjct  4    KKSLLVFMDVSIDGDPVERMVFELFSDIAPKTAENFRALCTGEKGIGPRTGKPLHYKGSF  63

Query  288  FHHIVKGSMAQ  320
            FH ++KGSMA+
Sbjct  64   FHRVIKGSMAE  74



>ref|XP_006450487.1| hypothetical protein CICLE_v10007495mg [Citrus clementina]
 ref|XP_006450488.1| hypothetical protein CICLE_v10007495mg [Citrus clementina]
 gb|ESR63727.1| hypothetical protein CICLE_v10007495mg [Citrus clementina]
 gb|ESR63728.1| hypothetical protein CICLE_v10007495mg [Citrus clementina]
Length=801

 Score =   129 bits (324),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 54/71 (76%), Positives = 63/71 (89%), Gaps = 0/71 (0%)
 Frame = +3

Query  108  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  287
            KK +LVF+DV IDGDP ERMVFELF+D+APKTAENFRALCTGEKG  P+TG  LHYKG+F
Sbjct  4    KKSLLVFMDVSIDGDPVERMVFELFSDIAPKTAENFRALCTGEKGIGPRTGKPLHYKGSF  63

Query  288  FHHIVKGSMAQ  320
            FH ++KGSMA+
Sbjct  64   FHRVIKGSMAE  74



>emb|CAN80313.1| hypothetical protein VITISV_020758 [Vitis vinifera]
Length=728

 Score =   129 bits (323),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 57/71 (80%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = +3

Query  108  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  287
            KK  LV+LDV IDGDP ERMVFELF+DVAPKTAENFRALCTGEKG  PKTG  LHYKG+F
Sbjct  4    KKNPLVYLDVSIDGDPIERMVFELFSDVAPKTAENFRALCTGEKGIGPKTGKPLHYKGSF  63

Query  288  FHHIVKGSMAQ  320
            FH I+KGSM Q
Sbjct  64   FHRIIKGSMVQ  74



>ref|XP_011019778.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like isoform 
X4 [Populus euphratica]
Length=805

 Score =   129 bits (324),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 63/74 (85%), Gaps = 0/74 (0%)
 Frame = +3

Query  99   KMSKKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  278
            KM+KK  LVF+DVCIDGDP ERMVFELF D+APKT ENFRALCTGE+G  PK+   LHYK
Sbjct  4    KMAKKNPLVFMDVCIDGDPKERMVFELFLDIAPKTVENFRALCTGERGIGPKSQRPLHYK  63

Query  279  GTFFHHIVKGSMAQ  320
            G+FFH I+KGSMAQ
Sbjct  64   GSFFHRIIKGSMAQ  77



>ref|XP_011019781.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like isoform 
X6 [Populus euphratica]
Length=810

 Score =   129 bits (324),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 63/74 (85%), Gaps = 0/74 (0%)
 Frame = +3

Query  99   KMSKKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  278
            KM+KK  LVF+DVCIDGDP ERMVFELF D+APKT ENFRALCTGE+G  PK+   LHYK
Sbjct  4    KMAKKNPLVFMDVCIDGDPKERMVFELFLDIAPKTVENFRALCTGERGIGPKSQRPLHYK  63

Query  279  GTFFHHIVKGSMAQ  320
            G+FFH I+KGSMAQ
Sbjct  64   GSFFHRIIKGSMAQ  77



>ref|XP_011019777.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like isoform 
X3 [Populus euphratica]
Length=811

 Score =   129 bits (324),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 63/74 (85%), Gaps = 0/74 (0%)
 Frame = +3

Query  99   KMSKKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  278
            KM+KK  LVF+DVCIDGDP ERMVFELF D+APKT ENFRALCTGE+G  PK+   LHYK
Sbjct  4    KMAKKNPLVFMDVCIDGDPKERMVFELFLDIAPKTVENFRALCTGERGIGPKSQRPLHYK  63

Query  279  GTFFHHIVKGSMAQ  320
            G+FFH I+KGSMAQ
Sbjct  64   GSFFHRIIKGSMAQ  77



>ref|XP_011019776.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like isoform 
X2 [Populus euphratica]
Length=815

 Score =   129 bits (323),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 63/74 (85%), Gaps = 0/74 (0%)
 Frame = +3

Query  99   KMSKKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  278
            KM+KK  LVF+DVCIDGDP ERMVFELF D+APKT ENFRALCTGE+G  PK+   LHYK
Sbjct  4    KMAKKNPLVFMDVCIDGDPKERMVFELFLDIAPKTVENFRALCTGERGIGPKSQRPLHYK  63

Query  279  GTFFHHIVKGSMAQ  320
            G+FFH I+KGSMAQ
Sbjct  64   GSFFHRIIKGSMAQ  77



>ref|XP_011019775.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like isoform 
X1 [Populus euphratica]
Length=816

 Score =   129 bits (323),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 63/74 (85%), Gaps = 0/74 (0%)
 Frame = +3

Query  99   KMSKKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  278
            KM+KK  LVF+DVCIDGDP ERMVFELF D+APKT ENFRALCTGE+G  PK+   LHYK
Sbjct  4    KMAKKNPLVFMDVCIDGDPKERMVFELFLDIAPKTVENFRALCTGERGIGPKSQRPLHYK  63

Query  279  GTFFHHIVKGSMAQ  320
            G+FFH I+KGSMAQ
Sbjct  64   GSFFHRIIKGSMAQ  77



>gb|KDP33623.1| hypothetical protein JCGZ_07194 [Jatropha curcas]
Length=789

 Score =   129 bits (323),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 57/71 (80%), Positives = 62/71 (87%), Gaps = 0/71 (0%)
 Frame = +3

Query  108  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  287
            KK  LVF+DV IDGDPFERMVFELF D+APKTAENFRALCTGEKG  PKTG  LHYKG+F
Sbjct  4    KKNPLVFIDVSIDGDPFERMVFELFYDIAPKTAENFRALCTGEKGIGPKTGRPLHYKGSF  63

Query  288  FHHIVKGSMAQ  320
            FH I++GSMAQ
Sbjct  64   FHCIIRGSMAQ  74



>ref|XP_008445168.1| PREDICTED: peptidyl-prolyl cis-trans isomerase 8 isoform X3 [Cucumis 
melo]
 ref|XP_008445170.1| PREDICTED: peptidyl-prolyl cis-trans isomerase 8 isoform X3 [Cucumis 
melo]
Length=779

 Score =   127 bits (320),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 58/71 (82%), Positives = 60/71 (85%), Gaps = 0/71 (0%)
 Frame = +3

Query  108  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  287
            KK  LVFLDV IDGDP ERMVFELF DVAPKTAENFRALCTGEKG  PKTG  LHYKG+F
Sbjct  4    KKNPLVFLDVSIDGDPRERMVFELFYDVAPKTAENFRALCTGEKGIGPKTGKPLHYKGSF  63

Query  288  FHHIVKGSMAQ  320
            FH I+ GSMAQ
Sbjct  64   FHRIIGGSMAQ  74



>ref|XP_006581365.1| PREDICTED: serine/arginine repetitive matrix protein 2-like isoform 
X3 [Glycine max]
Length=837

 Score =   127 bits (320),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 56/71 (79%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = +3

Query  108  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  287
            KK  LVF+DV IDGDP ERMVFELF DVAPKTAENFRALCTGEKG SP TG +LHYKG+F
Sbjct  4    KKNPLVFMDVSIDGDPVERMVFELFYDVAPKTAENFRALCTGEKGISPNTGKSLHYKGSF  63

Query  288  FHHIVKGSMAQ  320
            FH I+KGS+ Q
Sbjct  64   FHQIIKGSIVQ  74



>gb|KHN07093.1| Peptidyl-prolyl cis-trans isomerase D [Glycine soja]
Length=824

 Score =   127 bits (320),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 56/71 (79%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = +3

Query  108  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  287
            KK  LVF+DV IDGDP ERMVFELF DVAPKTAENFRALCTGEKG SP TG +LHYKG+F
Sbjct  4    KKNPLVFMDVSIDGDPVERMVFELFYDVAPKTAENFRALCTGEKGISPNTGKSLHYKGSF  63

Query  288  FHHIVKGSMAQ  320
            FH I+KGS+ Q
Sbjct  64   FHQIIKGSIVQ  74



>ref|XP_004138866.1| PREDICTED: uncharacterized protein LOC101210345 [Cucumis sativus]
Length=774

 Score =   127 bits (319),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 57/71 (80%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = +3

Query  108  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  287
            KK +LVFLDV IDGDP ER+VFELF DVAPKTAENFRALCTGEKG  PKTG  LHYKG+F
Sbjct  4    KKNLLVFLDVSIDGDPRERLVFELFYDVAPKTAENFRALCTGEKGIGPKTGKPLHYKGSF  63

Query  288  FHHIVKGSMAQ  320
            FH I+ GSMAQ
Sbjct  64   FHRIIGGSMAQ  74



>gb|KGN62922.1| hypothetical protein Csa_2G380020 [Cucumis sativus]
Length=784

 Score =   127 bits (319),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 57/71 (80%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = +3

Query  108  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  287
            KK +LVFLDV IDGDP ER+VFELF DVAPKTAENFRALCTGEKG  PKTG  LHYKG+F
Sbjct  4    KKNLLVFLDVSIDGDPRERLVFELFYDVAPKTAENFRALCTGEKGIGPKTGKPLHYKGSF  63

Query  288  FHHIVKGSMAQ  320
            FH I+ GSMAQ
Sbjct  64   FHRIIGGSMAQ  74



>gb|KHN08115.1| Peptidyl-prolyl cis-trans isomerase D [Glycine soja]
Length=805

 Score =   127 bits (319),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 56/71 (79%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = +3

Query  108  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  287
            KK  LVF+DV IDGDP ERMVFELF DVAPKTAENFRALCTGEKG SP TG +LHYKG+F
Sbjct  4    KKNPLVFMDVSIDGDPVERMVFELFYDVAPKTAENFRALCTGEKGISPNTGKSLHYKGSF  63

Query  288  FHHIVKGSMAQ  320
            FH I+KGS+ Q
Sbjct  64   FHQIIKGSIVQ  74



>emb|CDP04788.1| unnamed protein product [Coffea canephora]
Length=784

 Score =   127 bits (319),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 58/77 (75%), Positives = 64/77 (83%), Gaps = 0/77 (0%)
 Frame = +3

Query  102  MSKKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKG  281
            MSK+K LVFLDV IDGDPFERM+FELFTDVAPKTAENFRALCTGE+G S +    LHYKG
Sbjct  1    MSKQKPLVFLDVSIDGDPFERMIFELFTDVAPKTAENFRALCTGEEGESSRAKRPLHYKG  60

Query  282  TFFHHIVKGSMAQVWSL  332
            TFFH I+KGS A+   L
Sbjct  61   TFFHRIIKGSWAKAGDL  77



>ref|XP_004164532.1| PREDICTED: peptidyl-prolyl cis-trans isomerase cyp5-like, partial 
[Cucumis sativus]
Length=296

 Score =   122 bits (307),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 57/71 (80%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = +3

Query  108  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  287
            KK +LVFLDV IDGDP ER+VFELF DVAPKTAENFRALCTGEKG  PKTG  LHYKG+F
Sbjct  4    KKNLLVFLDVSIDGDPRERLVFELFYDVAPKTAENFRALCTGEKGIGPKTGKPLHYKGSF  63

Query  288  FHHIVKGSMAQ  320
            FH I+ GSMAQ
Sbjct  64   FHRIIGGSMAQ  74



>ref|XP_003523694.1| PREDICTED: serine/arginine repetitive matrix protein 2-like isoform 
X1 [Glycine max]
 ref|XP_006578153.1| PREDICTED: serine/arginine repetitive matrix protein 2-like isoform 
X2 [Glycine max]
Length=843

 Score =   127 bits (319),  Expect = 5e-29, Method: Composition-based stats.
 Identities = 58/74 (78%), Positives = 64/74 (86%), Gaps = 1/74 (1%)
 Frame = +3

Query  102  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  278
            M+KKK  LVF+DV IDGDP ERMVFELF DVAPKTAENFRALCTGEKG SP TG +LHYK
Sbjct  1    MTKKKNPLVFMDVSIDGDPVERMVFELFYDVAPKTAENFRALCTGEKGISPNTGKSLHYK  60

Query  279  GTFFHHIVKGSMAQ  320
            G+FFH I+KGS+ Q
Sbjct  61   GSFFHQIIKGSIVQ  74



>ref|XP_003526420.1| PREDICTED: serine/arginine repetitive matrix protein 2-like isoform 
X1 [Glycine max]
 ref|XP_006581364.1| PREDICTED: serine/arginine repetitive matrix protein 2-like isoform 
X2 [Glycine max]
Length=850

 Score =   127 bits (319),  Expect = 5e-29, Method: Composition-based stats.
 Identities = 58/74 (78%), Positives = 64/74 (86%), Gaps = 1/74 (1%)
 Frame = +3

Query  102  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  278
            M+KKK  LVF+DV IDGDP ERMVFELF DVAPKTAENFRALCTGEKG SP TG +LHYK
Sbjct  1    MTKKKNPLVFMDVSIDGDPVERMVFELFYDVAPKTAENFRALCTGEKGISPNTGKSLHYK  60

Query  279  GTFFHHIVKGSMAQ  320
            G+FFH I+KGS+ Q
Sbjct  61   GSFFHQIIKGSIVQ  74



>ref|XP_007013820.1| Peptidyl-prolyl cis-trans isomerase CYP19-2 isoform 4 [Theobroma 
cacao]
 gb|EOY31439.1| Peptidyl-prolyl cis-trans isomerase CYP19-2 isoform 4 [Theobroma 
cacao]
Length=858

 Score =   127 bits (319),  Expect = 5e-29, Method: Composition-based stats.
 Identities = 56/74 (76%), Positives = 64/74 (86%), Gaps = 1/74 (1%)
 Frame = +3

Query  102  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  278
            M+KKK  LVF+DV +DGDP ERM+FELF D+APKTAENFRALCTGEKG  PKTG  LHYK
Sbjct  16   MAKKKNPLVFMDVSVDGDPVERMIFELFPDIAPKTAENFRALCTGEKGIGPKTGKPLHYK  75

Query  279  GTFFHHIVKGSMAQ  320
            G+FFH ++KGSMAQ
Sbjct  76   GSFFHRVIKGSMAQ  89



>gb|KHG19968.1| Peptidyl-prolyl cis-trans isomerase cyp5 [Gossypium arboreum]
Length=702

 Score =   126 bits (317),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 55/71 (77%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = +3

Query  108  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  287
            KK  LVF+DV IDGDP ERMVFELF D+APKTAENFRALCTGEKG  PKTG  LHYKG+F
Sbjct  4    KKNPLVFMDVSIDGDPAERMVFELFPDIAPKTAENFRALCTGEKGIGPKTGKPLHYKGSF  63

Query  288  FHHIVKGSMAQ  320
            FH ++KGS+AQ
Sbjct  64   FHRVMKGSLAQ  74



>ref|XP_008347718.1| PREDICTED: peptidyl-prolyl cis-trans isomerase cyp5-like [Malus 
domestica]
Length=87

 Score =   116 bits (291),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 56/85 (66%), Positives = 65/85 (76%), Gaps = 1/85 (1%)
 Frame = +3

Query  108  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  287
            KK   VF+DV +DGDP+ERMVFELF+DVAPKTAENFRALCTGE+G  PK+   LHYKG+F
Sbjct  4    KKNPFVFMDVSVDGDPYERMVFELFSDVAPKTAENFRALCTGEQGIGPKSRKPLHYKGSF  63

Query  288  FHHIVKGSMAQVWSLPLCSKVFLFI  362
            FH IVKG  AQ   L + +  FL I
Sbjct  64   FHRIVKGYNAQDTGL-MVTTAFLVI  87



>ref|XP_007013817.1| Peptidyl-prolyl cis-trans isomerase CYP19-2 isoform 1 [Theobroma 
cacao]
 ref|XP_007013819.1| Peptidyl-prolyl cis-trans isomerase CYP19-2 isoform 1 [Theobroma 
cacao]
 gb|EOY31436.1| Peptidyl-prolyl cis-trans isomerase CYP19-2 isoform 1 [Theobroma 
cacao]
 gb|EOY31438.1| Peptidyl-prolyl cis-trans isomerase CYP19-2 isoform 1 [Theobroma 
cacao]
Length=843

 Score =   127 bits (318),  Expect = 6e-29, Method: Composition-based stats.
 Identities = 56/74 (76%), Positives = 64/74 (86%), Gaps = 1/74 (1%)
 Frame = +3

Query  102  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  278
            M+KKK  LVF+DV +DGDP ERM+FELF D+APKTAENFRALCTGEKG  PKTG  LHYK
Sbjct  1    MAKKKNPLVFMDVSVDGDPVERMIFELFPDIAPKTAENFRALCTGEKGIGPKTGKPLHYK  60

Query  279  GTFFHHIVKGSMAQ  320
            G+FFH ++KGSMAQ
Sbjct  61   GSFFHRVIKGSMAQ  74



>ref|XP_008394052.1| PREDICTED: peptidyl-prolyl cis-trans isomerase 8 isoform X2 [Malus 
domestica]
Length=835

 Score =   126 bits (317),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 53/71 (75%), Positives = 62/71 (87%), Gaps = 0/71 (0%)
 Frame = +3

Query  108  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  287
            KK  LVF+DV +DGDP+ERMVFELF+DV PKTAENFRALCTGE+G SPK+G  LHYKG+F
Sbjct  4    KKNPLVFMDVSVDGDPYERMVFELFSDVVPKTAENFRALCTGEQGISPKSGKPLHYKGSF  63

Query  288  FHHIVKGSMAQ  320
            FH I+KG +AQ
Sbjct  64   FHRIIKGYIAQ  74



>gb|KJB07776.1| hypothetical protein B456_001G045000 [Gossypium raimondii]
 gb|KJB07777.1| hypothetical protein B456_001G045000 [Gossypium raimondii]
 gb|KJB07787.1| hypothetical protein B456_001G045000 [Gossypium raimondii]
 gb|KJB07788.1| hypothetical protein B456_001G045000 [Gossypium raimondii]
Length=801

 Score =   126 bits (316),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 55/71 (77%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = +3

Query  108  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  287
            KK  LVF+DV IDGDP ERMVFELF D+APKTAENFRALCTGEKG  PKTG  LHYKG+F
Sbjct  4    KKNPLVFMDVSIDGDPAERMVFELFPDIAPKTAENFRALCTGEKGIGPKTGKPLHYKGSF  63

Query  288  FHHIVKGSMAQ  320
            FH ++KGS+AQ
Sbjct  64   FHRVMKGSLAQ  74



>gb|KJB07775.1| hypothetical protein B456_001G045000 [Gossypium raimondii]
 gb|KJB07778.1| hypothetical protein B456_001G045000 [Gossypium raimondii]
 gb|KJB07785.1| hypothetical protein B456_001G045000 [Gossypium raimondii]
Length=799

 Score =   126 bits (316),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 55/71 (77%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = +3

Query  108  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  287
            KK  LVF+DV IDGDP ERMVFELF D+APKTAENFRALCTGEKG  PKTG  LHYKG+F
Sbjct  4    KKNPLVFMDVSIDGDPAERMVFELFPDIAPKTAENFRALCTGEKGIGPKTGKPLHYKGSF  63

Query  288  FHHIVKGSMAQ  320
            FH ++KGS+AQ
Sbjct  64   FHRVMKGSLAQ  74



>gb|KJB07784.1| hypothetical protein B456_001G045000 [Gossypium raimondii]
Length=722

 Score =   125 bits (315),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 55/71 (77%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = +3

Query  108  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  287
            KK  LVF+DV IDGDP ERMVFELF D+APKTAENFRALCTGEKG  PKTG  LHYKG+F
Sbjct  4    KKNPLVFMDVSIDGDPAERMVFELFPDIAPKTAENFRALCTGEKGIGPKTGKPLHYKGSF  63

Query  288  FHHIVKGSMAQ  320
            FH ++KGS+AQ
Sbjct  64   FHRVMKGSLAQ  74



>ref|XP_011081940.1| PREDICTED: LOW QUALITY PROTEIN: peptidyl-prolyl cis-trans isomerase 
CYP95-like [Sesamum indicum]
Length=754

 Score =   125 bits (314),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 61/74 (82%), Gaps = 0/74 (0%)
 Frame = +3

Query  99   KMSKKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  278
            K   KK LVFLDV IDGDP ERM+FELFTDVAP+TAENFRALCTGEKG S KTG  LHYK
Sbjct  3    KTKGKKQLVFLDVSIDGDPVERMIFELFTDVAPRTAENFRALCTGEKGVSAKTGKPLHYK  62

Query  279  GTFFHHIVKGSMAQ  320
            GTFFH I KG +AQ
Sbjct  63   GTFFHRIEKGHLAQ  76



>ref|XP_007161232.1| hypothetical protein PHAVU_001G053000g [Phaseolus vulgaris]
 gb|ESW33226.1| hypothetical protein PHAVU_001G053000g [Phaseolus vulgaris]
Length=895

 Score =   125 bits (314),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 57/74 (77%), Positives = 64/74 (86%), Gaps = 1/74 (1%)
 Frame = +3

Query  102  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  278
            M+KKK  LVF+DV IDGDP ERMVFELF DVAPKTAENFRALCTGE+G  P TG +LHYK
Sbjct  1    MAKKKNCLVFMDVSIDGDPVERMVFELFYDVAPKTAENFRALCTGERGVGPSTGKSLHYK  60

Query  279  GTFFHHIVKGSMAQ  320
            G+FFH IVKGS+A+
Sbjct  61   GSFFHRIVKGSIAR  74



>ref|XP_007161231.1| hypothetical protein PHAVU_001G052900g [Phaseolus vulgaris]
 gb|ESW33225.1| hypothetical protein PHAVU_001G052900g [Phaseolus vulgaris]
Length=915

 Score =   125 bits (314),  Expect = 3e-28, Method: Composition-based stats.
 Identities = 57/74 (77%), Positives = 64/74 (86%), Gaps = 1/74 (1%)
 Frame = +3

Query  102  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  278
            M+KKK  LVF+DV IDGDP ERMVFELF DVAPKTAENFRALCTGE G SP TG +LHYK
Sbjct  1    MAKKKNSLVFMDVSIDGDPVERMVFELFYDVAPKTAENFRALCTGESGVSPNTGKSLHYK  60

Query  279  GTFFHHIVKGSMAQ  320
            G+FFH +VKGS+A+
Sbjct  61   GSFFHRVVKGSIAR  74



>ref|XP_008394051.1| PREDICTED: peptidyl-prolyl cis-trans isomerase G isoform X1 [Malus 
domestica]
Length=856

 Score =   125 bits (313),  Expect = 3e-28, Method: Composition-based stats.
 Identities = 55/74 (74%), Positives = 65/74 (88%), Gaps = 1/74 (1%)
 Frame = +3

Query  102  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  278
            M+KKK  LVF+DV +DGDP+ERMVFELF+DV PKTAENFRALCTGE+G SPK+G  LHYK
Sbjct  1    MTKKKNPLVFMDVSVDGDPYERMVFELFSDVVPKTAENFRALCTGEQGISPKSGKPLHYK  60

Query  279  GTFFHHIVKGSMAQ  320
            G+FFH I+KG +AQ
Sbjct  61   GSFFHRIIKGYIAQ  74



>ref|XP_007161230.1| hypothetical protein PHAVU_001G052800g [Phaseolus vulgaris]
 gb|ESW33224.1| hypothetical protein PHAVU_001G052800g [Phaseolus vulgaris]
Length=933

 Score =   125 bits (313),  Expect = 3e-28, Method: Composition-based stats.
 Identities = 57/74 (77%), Positives = 64/74 (86%), Gaps = 1/74 (1%)
 Frame = +3

Query  102  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  278
            M+KKK  LVF+DV IDGDP ERMVFELF DVAPKTAENFRALCTGE+G  P TG +LHYK
Sbjct  1    MAKKKNSLVFMDVSIDGDPVERMVFELFYDVAPKTAENFRALCTGERGVGPNTGKSLHYK  60

Query  279  GTFFHHIVKGSMAQ  320
            G+FFH IVKGS+A+
Sbjct  61   GSFFHRIVKGSIAR  74



>ref|XP_010048238.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X4 [Eucalyptus grandis]
Length=794

 Score =   124 bits (311),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 55/73 (75%), Positives = 62/73 (85%), Gaps = 0/73 (0%)
 Frame = +3

Query  102  MSKKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKG  281
            M KK +LVF+DV IDGDP ERMVFELF +VAPKTAENFRALCTGEKG   KTG  LH+KG
Sbjct  2    MKKKDLLVFMDVSIDGDPAERMVFELFPEVAPKTAENFRALCTGEKGIGQKTGRPLHFKG  61

Query  282  TFFHHIVKGSMAQ  320
            +FFH I++GSMAQ
Sbjct  62   SFFHRIIRGSMAQ  74



>ref|XP_010048237.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X3 [Eucalyptus grandis]
 gb|KCW80434.1| hypothetical protein EUGRSUZ_C01785 [Eucalyptus grandis]
 gb|KCW80435.1| hypothetical protein EUGRSUZ_C01785 [Eucalyptus grandis]
Length=796

 Score =   124 bits (311),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 55/73 (75%), Positives = 62/73 (85%), Gaps = 0/73 (0%)
 Frame = +3

Query  102  MSKKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKG  281
            M KK +LVF+DV IDGDP ERMVFELF +VAPKTAENFRALCTGEKG   KTG  LH+KG
Sbjct  2    MKKKDLLVFMDVSIDGDPAERMVFELFPEVAPKTAENFRALCTGEKGIGQKTGRPLHFKG  61

Query  282  TFFHHIVKGSMAQ  320
            +FFH I++GSMAQ
Sbjct  62   SFFHRIIRGSMAQ  74



>ref|XP_010048236.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X2 [Eucalyptus grandis]
Length=797

 Score =   124 bits (311),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 55/73 (75%), Positives = 62/73 (85%), Gaps = 0/73 (0%)
 Frame = +3

Query  102  MSKKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKG  281
            M KK +LVF+DV IDGDP ERMVFELF +VAPKTAENFRALCTGEKG   KTG  LH+KG
Sbjct  2    MKKKDLLVFMDVSIDGDPAERMVFELFPEVAPKTAENFRALCTGEKGIGQKTGRPLHFKG  61

Query  282  TFFHHIVKGSMAQ  320
            +FFH I++GSMAQ
Sbjct  62   SFFHRIIRGSMAQ  74



>ref|XP_010048233.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X1 [Eucalyptus grandis]
 ref|XP_010048234.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X1 [Eucalyptus grandis]
 ref|XP_010048235.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X1 [Eucalyptus grandis]
 gb|KCW80436.1| hypothetical protein EUGRSUZ_C01785 [Eucalyptus grandis]
Length=799

 Score =   124 bits (311),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 55/73 (75%), Positives = 62/73 (85%), Gaps = 0/73 (0%)
 Frame = +3

Query  102  MSKKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKG  281
            M KK +LVF+DV IDGDP ERMVFELF +VAPKTAENFRALCTGEKG   KTG  LH+KG
Sbjct  2    MKKKDLLVFMDVSIDGDPAERMVFELFPEVAPKTAENFRALCTGEKGIGQKTGRPLHFKG  61

Query  282  TFFHHIVKGSMAQ  320
            +FFH I++GSMAQ
Sbjct  62   SFFHRIIRGSMAQ  74



>gb|KCW80440.1| hypothetical protein EUGRSUZ_C01785 [Eucalyptus grandis]
 gb|KCW80441.1| hypothetical protein EUGRSUZ_C01785 [Eucalyptus grandis]
Length=695

 Score =   123 bits (309),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 55/73 (75%), Positives = 62/73 (85%), Gaps = 0/73 (0%)
 Frame = +3

Query  102  MSKKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKG  281
            M KK +LVF+DV IDGDP ERMVFELF +VAPKTAENFRALCTGEKG   KTG  LH+KG
Sbjct  2    MKKKDLLVFMDVSIDGDPAERMVFELFPEVAPKTAENFRALCTGEKGIGQKTGRPLHFKG  61

Query  282  TFFHHIVKGSMAQ  320
            +FFH I++GSMAQ
Sbjct  62   SFFHRIIRGSMAQ  74



>gb|EPS68763.1| hypothetical protein M569_06004, partial [Genlisea aurea]
Length=756

 Score =   124 bits (310),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 56/80 (70%), Positives = 64/80 (80%), Gaps = 0/80 (0%)
 Frame = +3

Query  93   ICKMSKKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLH  272
            + K+ KK+V VF DV +DGDP+ERM+FELF DVAPKTAENFRALCTGEKGTS  TG  LH
Sbjct  1    MDKIKKKRVSVFFDVSVDGDPYERMIFELFADVAPKTAENFRALCTGEKGTSVTTGKPLH  60

Query  273  YKGTFFHHIVKGSMAQVWSL  332
            YKGTFFH I+KG + Q   L
Sbjct  61   YKGTFFHRIIKGYVVQGGDL  80



>gb|KCW80439.1| hypothetical protein EUGRSUZ_C01785 [Eucalyptus grandis]
Length=614

 Score =   122 bits (307),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 55/73 (75%), Positives = 62/73 (85%), Gaps = 0/73 (0%)
 Frame = +3

Query  102  MSKKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKG  281
            M KK +LVF+DV IDGDP ERMVFELF +VAPKTAENFRALCTGEKG   KTG  LH+KG
Sbjct  2    MKKKDLLVFMDVSIDGDPAERMVFELFPEVAPKTAENFRALCTGEKGIGQKTGRPLHFKG  61

Query  282  TFFHHIVKGSMAQ  320
            +FFH I++GSMAQ
Sbjct  62   SFFHRIIRGSMAQ  74



>gb|AES58972.2| peptidyl-prolyl cis-trans isomerase [Medicago truncatula]
Length=772

 Score =   124 bits (310),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 52/71 (73%), Positives = 62/71 (87%), Gaps = 0/71 (0%)
 Frame = +3

Query  108  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  287
            KK  +VF+DV +DGDP+E+MVFELF DVAPKTAENFRALCTGEKG SP TG +LHYKG+F
Sbjct  4    KKNSMVFMDVSVDGDPYEKMVFELFYDVAPKTAENFRALCTGEKGVSPNTGKSLHYKGSF  63

Query  288  FHHIVKGSMAQ  320
            FH I+KGS+ +
Sbjct  64   FHQILKGSIVK  74



>ref|XP_004501305.1| PREDICTED: serine/arginine repetitive matrix protein 2-like isoform 
X1 [Cicer arietinum]
Length=838

 Score =   124 bits (310),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 64/74 (86%), Gaps = 1/74 (1%)
 Frame = +3

Query  102  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  278
            MSKKK  LVF+DV IDGDP E+MVFELF DVAPKTAENFRALCTGEKG SP TG +LHYK
Sbjct  4    MSKKKNPLVFMDVSIDGDPVEKMVFELFYDVAPKTAENFRALCTGEKGISPNTGKSLHYK  63

Query  279  GTFFHHIVKGSMAQ  320
            G+FFH ++KGS+ +
Sbjct  64   GSFFHQVIKGSIVK  77



>ref|XP_004498656.1| PREDICTED: serine/arginine repetitive matrix protein 2-like isoform 
X2 [Cicer arietinum]
 ref|XP_004498657.1| PREDICTED: serine/arginine repetitive matrix protein 2-like isoform 
X3 [Cicer arietinum]
Length=773

 Score =   122 bits (307),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 55/71 (77%), Positives = 60/71 (85%), Gaps = 0/71 (0%)
 Frame = +3

Query  108  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  287
            KK  +VFLDV IDGDP ERMVFELF DVAPKTAENFRALCTGEKG S  TG +LHYKG+F
Sbjct  4    KKNPMVFLDVSIDGDPAERMVFELFYDVAPKTAENFRALCTGEKGVSSNTGKSLHYKGSF  63

Query  288  FHHIVKGSMAQ  320
            FH IVKGS+ +
Sbjct  64   FHQIVKGSIVR  74



>ref|XP_002515550.1| peptidyl-prolyl cis-trans isomerase, putative [Ricinus communis]
 gb|EEF46999.1| peptidyl-prolyl cis-trans isomerase, putative [Ricinus communis]
Length=729

 Score =   122 bits (305),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 54/71 (76%), Positives = 60/71 (85%), Gaps = 0/71 (0%)
 Frame = +3

Query  108  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  287
            +K  +VF+DV IDGDPFERMVFELF + APKT ENFRALCTGEKG  PKTG  LHYKG+F
Sbjct  8    RKNPMVFMDVSIDGDPFERMVFELFPEFAPKTVENFRALCTGEKGIGPKTGRPLHYKGSF  67

Query  288  FHHIVKGSMAQ  320
            FH I+KGSMAQ
Sbjct  68   FHCIIKGSMAQ  78



>ref|XP_007225294.1| hypothetical protein PRUPE_ppa001326mg [Prunus persica]
 gb|EMJ26493.1| hypothetical protein PRUPE_ppa001326mg [Prunus persica]
Length=854

 Score =   122 bits (306),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 56/74 (76%), Positives = 64/74 (86%), Gaps = 1/74 (1%)
 Frame = +3

Query  102  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  278
            M+KKK  LVF+DV +DGDP ERMVFELF+DVAPKTAENFRALCTGEKG  PK+G  LHYK
Sbjct  1    MTKKKNPLVFMDVSVDGDPVERMVFELFSDVAPKTAENFRALCTGEKGIGPKSGRPLHYK  60

Query  279  GTFFHHIVKGSMAQ  320
            G+FFH I+KG +AQ
Sbjct  61   GSFFHRIIKGYIAQ  74



>ref|XP_008219899.1| PREDICTED: peptidyl-prolyl cis-trans isomerase 8 isoform X1 [Prunus 
mume]
 ref|XP_008219900.1| PREDICTED: peptidyl-prolyl cis-trans isomerase 8 isoform X1 [Prunus 
mume]
Length=843

 Score =   122 bits (305),  Expect = 3e-27, Method: Composition-based stats.
 Identities = 55/74 (74%), Positives = 64/74 (86%), Gaps = 1/74 (1%)
 Frame = +3

Query  102  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  278
            M+KKK  LVF+DV +DGDP ERMVFELF+DVAP+TAENFRALCTGEKG  PK+G  LHYK
Sbjct  1    MTKKKNPLVFMDVSVDGDPVERMVFELFSDVAPRTAENFRALCTGEKGIGPKSGRPLHYK  60

Query  279  GTFFHHIVKGSMAQ  320
            G+FFH I+KG +AQ
Sbjct  61   GSFFHRIIKGYIAQ  74



>gb|KJB07770.1| hypothetical protein B456_001G044900 [Gossypium raimondii]
 gb|KJB07771.1| hypothetical protein B456_001G044900 [Gossypium raimondii]
 gb|KJB07772.1| hypothetical protein B456_001G044900 [Gossypium raimondii]
 gb|KJB07773.1| hypothetical protein B456_001G044900 [Gossypium raimondii]
Length=787

 Score =   121 bits (304),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 52/71 (73%), Positives = 59/71 (83%), Gaps = 0/71 (0%)
 Frame = +3

Query  108  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  287
            KK  LVF+DV IDGDP ERMVFELF D+APKT ENFRALCTGEKG  P+TG  LHYKG+F
Sbjct  4    KKNPLVFMDVSIDGDPVERMVFELFPDIAPKTVENFRALCTGEKGIGPRTGKPLHYKGSF  63

Query  288  FHHIVKGSMAQ  320
            FH + KGS+A+
Sbjct  64   FHRVSKGSLAK  74



>ref|XP_009334770.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like isoform 
X2 [Pyrus x bretschneideri]
Length=846

 Score =   121 bits (303),  Expect = 5e-27, Method: Composition-based stats.
 Identities = 53/74 (72%), Positives = 63/74 (85%), Gaps = 1/74 (1%)
 Frame = +3

Query  102  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  278
            M+KKK   VF+DV +DGDP+ERMVFELF+DV PKTAENF ALCTGE+G SPK+G  LHYK
Sbjct  1    MTKKKNPFVFMDVSVDGDPYERMVFELFSDVVPKTAENFHALCTGEQGISPKSGKPLHYK  60

Query  279  GTFFHHIVKGSMAQ  320
            G+FFH I+KG +AQ
Sbjct  61   GSFFHRIIKGYIAQ  74



>ref|XP_009334769.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like isoform 
X1 [Pyrus x bretschneideri]
Length=854

 Score =   121 bits (303),  Expect = 5e-27, Method: Composition-based stats.
 Identities = 53/74 (72%), Positives = 63/74 (85%), Gaps = 1/74 (1%)
 Frame = +3

Query  102  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  278
            M+KKK   VF+DV +DGDP+ERMVFELF+DV PKTAENF ALCTGE+G SPK+G  LHYK
Sbjct  1    MTKKKNPFVFMDVSVDGDPYERMVFELFSDVVPKTAENFHALCTGEQGISPKSGKPLHYK  60

Query  279  GTFFHHIVKGSMAQ  320
            G+FFH I+KG +AQ
Sbjct  61   GSFFHRIIKGYIAQ  74



>ref|XP_009345297.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like [Pyrus 
x bretschneideri]
Length=1043

 Score =   121 bits (303),  Expect = 7e-27, Method: Composition-based stats.
 Identities = 53/74 (72%), Positives = 63/74 (85%), Gaps = 1/74 (1%)
 Frame = +3

Query  102  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  278
            M+KKK   VF+DV +DGDP+ERMVFELF+DV PKTAENF ALCTGE+G SPK+G  LHYK
Sbjct  1    MTKKKNPFVFMDVSVDGDPYERMVFELFSDVVPKTAENFHALCTGEQGISPKSGKPLHYK  60

Query  279  GTFFHHIVKGSMAQ  320
            G+FFH I+KG +AQ
Sbjct  61   GSFFHRIIKGYIAQ  74



>ref|XP_008378303.1| PREDICTED: peptidyl-prolyl cis-trans isomerase cyp11-like isoform 
X1 [Malus domestica]
Length=517

 Score =   118 bits (296),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 52/71 (73%), Positives = 59/71 (83%), Gaps = 0/71 (0%)
 Frame = +3

Query  108  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  287
            KK   VF+DV +DGDP+ERMVFELF+DVAPKTAENFRALCTGE+G  PK+   LHYKG+F
Sbjct  4    KKNPFVFMDVSVDGDPYERMVFELFSDVAPKTAENFRALCTGEQGIGPKSRKPLHYKGSF  63

Query  288  FHHIVKGSMAQ  320
            FH IVKG  AQ
Sbjct  64   FHRIVKGYNAQ  74



>emb|CDX68845.1| BnaC01g06080D [Brassica napus]
Length=765

 Score =   120 bits (300),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 52/72 (72%), Positives = 59/72 (82%), Gaps = 0/72 (0%)
 Frame = +3

Query  108  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  287
            KK   V++DVCIDGDP E MVFELF DVAPKT+ENFRALCTGEKG  P++G  LHYKG+F
Sbjct  4    KKNPQVYMDVCIDGDPAETMVFELFPDVAPKTSENFRALCTGEKGIGPRSGKPLHYKGSF  63

Query  288  FHHIVKGSMAQV  323
            FH I+KGS AQ 
Sbjct  64   FHRILKGSSAQA  75



>emb|CDX75243.1| BnaA01g04590D [Brassica napus]
Length=765

 Score =   120 bits (300),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 52/72 (72%), Positives = 59/72 (82%), Gaps = 0/72 (0%)
 Frame = +3

Query  108  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  287
            KK   V++DVCIDGDP E MVFELF DVAPKT+ENFRALCTGEKG  P++G  LHYKG+F
Sbjct  4    KKNPQVYMDVCIDGDPAETMVFELFPDVAPKTSENFRALCTGEKGIGPRSGKPLHYKGSF  63

Query  288  FHHIVKGSMAQV  323
            FH I+KGS AQ 
Sbjct  64   FHRILKGSSAQA  75



>ref|XP_008378304.1| PREDICTED: peptidyl-prolyl cis-trans isomerase 8-like isoform 
X2 [Malus domestica]
Length=826

 Score =   120 bits (300),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 52/71 (73%), Positives = 59/71 (83%), Gaps = 0/71 (0%)
 Frame = +3

Query  108  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  287
            KK   VF+DV +DGDP+ERMVFELF+DVAPKTAENFRALCTGE+G  PK+   LHYKG+F
Sbjct  4    KKNPFVFMDVSVDGDPYERMVFELFSDVAPKTAENFRALCTGEQGIGPKSRKPLHYKGSF  63

Query  288  FHHIVKGSMAQ  320
            FH IVKG  AQ
Sbjct  64   FHRIVKGYNAQ  74



>gb|KJB07786.1| hypothetical protein B456_001G045000 [Gossypium raimondii]
Length=807

 Score =   119 bits (299),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 55/77 (71%), Positives = 61/77 (79%), Gaps = 6/77 (8%)
 Frame = +3

Query  108  KKKVLVFLDVCIDGDPFERMVFE------LFTDVAPKTAENFRALCTGEKGTSPKTGATL  269
            KK  LVF+DV IDGDP ERMVFE      LF D+APKTAENFRALCTGEKG  PKTG  L
Sbjct  4    KKNPLVFMDVSIDGDPAERMVFEFSLILQLFPDIAPKTAENFRALCTGEKGIGPKTGKPL  63

Query  270  HYKGTFFHHIVKGSMAQ  320
            HYKG+FFH ++KGS+AQ
Sbjct  64   HYKGSFFHRVMKGSLAQ  80



>ref|XP_009126010.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X1 [Brassica rapa]
 ref|XP_009126018.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X1 [Brassica rapa]
Length=760

 Score =   119 bits (299),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 52/72 (72%), Positives = 59/72 (82%), Gaps = 0/72 (0%)
 Frame = +3

Query  108  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  287
            KK   V++DVCIDGDP E MVFELF DVAPKT+ENFRALCTGEKG  P++G  LHYKG+F
Sbjct  4    KKNPQVYMDVCIDGDPAETMVFELFPDVAPKTSENFRALCTGEKGIGPRSGKPLHYKGSF  63

Query  288  FHHIVKGSMAQV  323
            FH I+KGS AQ 
Sbjct  64   FHRILKGSSAQA  75



>ref|XP_010028211.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like isoform 
X3 [Eucalyptus grandis]
Length=155

 Score =   111 bits (277),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 61/74 (82%), Gaps = 0/74 (0%)
 Frame = +3

Query  102  MSKKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKG  281
            M+KK +LVF+DV IDGDP ERMVFELF +VAPKTAENFRAL T EKG   KTG  LH KG
Sbjct  2    MTKKNLLVFMDVSIDGDPAERMVFELFPEVAPKTAENFRALYTEEKGIGQKTGRPLHLKG  61

Query  282  TFFHHIVKGSMAQV  323
            +FFH I++GSMAQV
Sbjct  62   SFFHRIIRGSMAQV  75



>gb|AES73684.2| peptidyl-prolyl cis-trans isomerase [Medicago truncatula]
Length=895

 Score =   117 bits (293),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 54/74 (73%), Positives = 62/74 (84%), Gaps = 1/74 (1%)
 Frame = +3

Query  102  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  278
            M+KKK  LVF+DV IDGDP +RMVFELF DVAPKTAENFRALCTGE+G S  TG  LHYK
Sbjct  4    MTKKKNPLVFMDVSIDGDPVKRMVFELFHDVAPKTAENFRALCTGERGISSNTGKLLHYK  63

Query  279  GTFFHHIVKGSMAQ  320
            G+FFH I+KGS+ +
Sbjct  64   GSFFHQIMKGSIVK  77



>ref|XP_006382072.1| hypothetical protein POPTR_0006s26710g [Populus trichocarpa]
 gb|ERP59869.1| hypothetical protein POPTR_0006s26710g [Populus trichocarpa]
Length=842

 Score =   117 bits (293),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 57/91 (63%), Positives = 63/91 (69%), Gaps = 17/91 (19%)
 Frame = +3

Query  99   KMSKKKVLVFLDVCIDGDPFERMVFE-----------------LFTDVAPKTAENFRALC  227
            KM+KK  LVF+DVCIDGDP ERMVFE                 LF D+APKT ENFRALC
Sbjct  4    KMAKKNPLVFMDVCIDGDPKERMVFEVSSCFKFQPCRMDDEIPLFLDIAPKTVENFRALC  63

Query  228  TGEKGTSPKTGATLHYKGTFFHHIVKGSMAQ  320
            TGEKG  PK+   LHYKG+FFH I+KGSMAQ
Sbjct  64   TGEKGIGPKSQRPLHYKGSFFHRIIKGSMAQ  94



>ref|NP_001190888.1| cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein 
[Arabidopsis thaliana]
 gb|AEE86056.1| peptidylprolyl isomerase [Arabidopsis thaliana]
Length=820

 Score =   117 bits (292),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 51/72 (71%), Positives = 58/72 (81%), Gaps = 0/72 (0%)
 Frame = +3

Query  108  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  287
            KK   VF+DV IDGDP E MVFELF +VAPKT+ENFRALCTGEKG  P++G  LHYKG+F
Sbjct  4    KKNPQVFMDVSIDGDPAETMVFELFPEVAPKTSENFRALCTGEKGIGPRSGKPLHYKGSF  63

Query  288  FHHIVKGSMAQV  323
            FH I+KGS AQ 
Sbjct  64   FHRIMKGSSAQA  75



>ref|XP_004291478.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X1 [Fragaria vesca subsp. vesca]
 ref|XP_011459211.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X1 [Fragaria vesca subsp. vesca]
Length=761

 Score =   116 bits (291),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 51/71 (72%), Positives = 59/71 (83%), Gaps = 0/71 (0%)
 Frame = +3

Query  108  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  287
            KK  LVF+D+CIDGDP E+MVFELF D APKTA+NFRALCTGEKG  PK+G  LHYKG+F
Sbjct  4    KKNPLVFMDLCIDGDPAEKMVFELFYDRAPKTADNFRALCTGEKGIGPKSGRPLHYKGSF  63

Query  288  FHHIVKGSMAQ  320
            FH I+KG  A+
Sbjct  64   FHRILKGYYAK  74



>ref|NP_194968.2| cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein 
[Arabidopsis thaliana]
 ref|NP_001190889.1| cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein 
[Arabidopsis thaliana]
 sp|Q8RWY7.2|CYP95_ARATH RecName: Full=Peptidyl-prolyl cis-trans isomerase CYP95; Short=AtCYP95; 
Short=PPIase CYP95; AltName: Full=Cyclophilin-like 
protein CypRS92 [Arabidopsis thaliana]
 gb|AEE86054.1| peptidylprolyl isomerase [Arabidopsis thaliana]
 gb|AEE86057.1| peptidylprolyl isomerase [Arabidopsis thaliana]
Length=837

 Score =   117 bits (292),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 51/72 (71%), Positives = 58/72 (81%), Gaps = 0/72 (0%)
 Frame = +3

Query  108  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  287
            KK   VF+DV IDGDP E MVFELF +VAPKT+ENFRALCTGEKG  P++G  LHYKG+F
Sbjct  4    KKNPQVFMDVSIDGDPAETMVFELFPEVAPKTSENFRALCTGEKGIGPRSGKPLHYKGSF  63

Query  288  FHHIVKGSMAQV  323
            FH I+KGS AQ 
Sbjct  64   FHRIMKGSSAQA  75



>gb|KHG30308.1| Peptidyl-prolyl cis-trans isomerase cyp5 [Gossypium arboreum]
Length=196

 Score =   110 bits (275),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 52/71 (73%), Positives = 58/71 (82%), Gaps = 3/71 (4%)
 Frame = +3

Query  108  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  287
            KK  LVF+DV IDGDP ERM   LF D+APKTAENFRALCTGEKG  PKTG  LHYKG+F
Sbjct  4    KKNPLVFMDVSIDGDPAERM---LFPDIAPKTAENFRALCTGEKGIGPKTGKPLHYKGSF  60

Query  288  FHHIVKGSMAQ  320
            FH ++KGS+AQ
Sbjct  61   FHRVMKGSLAQ  71



>ref|XP_010037119.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like [Eucalyptus 
grandis]
Length=158

 Score =   109 bits (272),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 52/73 (71%), Positives = 59/73 (81%), Gaps = 0/73 (0%)
 Frame = +3

Query  102  MSKKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKG  281
            M KK +LVF+DV IDGDP ERM+FELF +VAPKTAENFRAL TGEKG   KTG  LH KG
Sbjct  2    MKKKDLLVFMDVSIDGDPAERMIFELFPEVAPKTAENFRALYTGEKGIGQKTGRPLHLKG  61

Query  282  TFFHHIVKGSMAQ  320
            +FFH I++G MAQ
Sbjct  62   SFFHRIIRGFMAQ  74



>ref|XP_010437912.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like isoform 
X1 [Camelina sativa]
Length=806

 Score =   116 bits (290),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 51/72 (71%), Positives = 58/72 (81%), Gaps = 0/72 (0%)
 Frame = +3

Query  108  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  287
            KK   VF+DV IDGDP E MVFELF +VAPKT+ENFRALCTGEKG  P++G  LHYKG+F
Sbjct  4    KKNPQVFMDVSIDGDPAETMVFELFPEVAPKTSENFRALCTGEKGIGPRSGKPLHYKGSF  63

Query  288  FHHIVKGSMAQV  323
            FH I+KGS AQ 
Sbjct  64   FHRILKGSSAQA  75



>ref|XP_010437913.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like isoform 
X2 [Camelina sativa]
Length=805

 Score =   116 bits (290),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 51/72 (71%), Positives = 58/72 (81%), Gaps = 0/72 (0%)
 Frame = +3

Query  108  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  287
            KK   VF+DV IDGDP E MVFELF +VAPKT+ENFRALCTGEKG  P++G  LHYKG+F
Sbjct  4    KKNPQVFMDVSIDGDPAETMVFELFPEVAPKTSENFRALCTGEKGIGPRSGKPLHYKGSF  63

Query  288  FHHIVKGSMAQV  323
            FH I+KGS AQ 
Sbjct  64   FHRILKGSSAQA  75



>ref|XP_010447391.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like isoform 
X1 [Camelina sativa]
Length=824

 Score =   115 bits (289),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 51/72 (71%), Positives = 58/72 (81%), Gaps = 0/72 (0%)
 Frame = +3

Query  108  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  287
            KK   VF+DV IDGDP E MVFELF +VAPKT+ENFRALCTGEKG  P++G  LHYKG+F
Sbjct  4    KKNPQVFMDVSIDGDPAETMVFELFPEVAPKTSENFRALCTGEKGIGPRSGKPLHYKGSF  63

Query  288  FHHIVKGSMAQV  323
            FH I+KGS AQ 
Sbjct  64   FHRILKGSSAQA  75



>ref|XP_010447392.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like isoform 
X2 [Camelina sativa]
Length=822

 Score =   115 bits (289),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 51/72 (71%), Positives = 58/72 (81%), Gaps = 0/72 (0%)
 Frame = +3

Query  108  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  287
            KK   VF+DV IDGDP E MVFELF +VAPKT+ENFRALCTGEKG  P++G  LHYKG+F
Sbjct  4    KKNPQVFMDVSIDGDPAETMVFELFPEVAPKTSENFRALCTGEKGIGPRSGKPLHYKGSF  63

Query  288  FHHIVKGSMAQV  323
            FH I+KGS AQ 
Sbjct  64   FHRILKGSSAQA  75



>ref|XP_007050461.1| Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein, 
putative isoform 2 [Theobroma cacao]
 gb|EOX94618.1| Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein, 
putative isoform 2 [Theobroma cacao]
Length=557

 Score =   113 bits (283),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 58/74 (78%), Gaps = 1/74 (1%)
 Frame = +3

Query  102  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  278
            MSKKK  LVFLDV +DGDP ER++ ELF DV PKTAENFRALCTGEKG    TG  LHYK
Sbjct  1    MSKKKNPLVFLDVSVDGDPVERIIIELFADVVPKTAENFRALCTGEKGVGKSTGKPLHYK  60

Query  279  GTFFHHIVKGSMAQ  320
            G+F H I+KG MAQ
Sbjct  61   GSFLHRIIKGFMAQ  74



>emb|CAA22569.1| putative protein [Arabidopsis thaliana]
 emb|CAB79959.1| putative protein [Arabidopsis thaliana]
Length=857

 Score =   115 bits (287),  Expect = 7e-25, Method: Composition-based stats.
 Identities = 53/74 (72%), Positives = 61/74 (82%), Gaps = 1/74 (1%)
 Frame = +3

Query  102  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  278
            M+KKK   VF+DV IDGDP E MVFELF +VAPKT+ENFRALCTGEKG  P++G  LHYK
Sbjct  1    MAKKKNPQVFMDVSIDGDPAETMVFELFPEVAPKTSENFRALCTGEKGIGPRSGKPLHYK  60

Query  279  GTFFHHIVKGSMAQ  320
            G+FFH I+KGS AQ
Sbjct  61   GSFFHRIMKGSSAQ  74



>ref|XP_010432723.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like isoform 
X4 [Camelina sativa]
Length=808

 Score =   114 bits (285),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 50/72 (69%), Positives = 58/72 (81%), Gaps = 0/72 (0%)
 Frame = +3

Query  108  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  287
            KK   VF+DV IDGDP E MVFELF +VAP+T+ENFRALCTGEKG  P++G  LHYKG+F
Sbjct  4    KKNPQVFMDVSIDGDPAETMVFELFPEVAPQTSENFRALCTGEKGIGPRSGKPLHYKGSF  63

Query  288  FHHIVKGSMAQV  323
            FH I+KGS AQ 
Sbjct  64   FHRILKGSSAQA  75



>ref|XP_010432721.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like isoform 
X2 [Camelina sativa]
Length=829

 Score =   114 bits (285),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 50/72 (69%), Positives = 58/72 (81%), Gaps = 0/72 (0%)
 Frame = +3

Query  108  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  287
            KK   VF+DV IDGDP E MVFELF +VAP+T+ENFRALCTGEKG  P++G  LHYKG+F
Sbjct  4    KKNPQVFMDVSIDGDPAETMVFELFPEVAPQTSENFRALCTGEKGIGPRSGKPLHYKGSF  63

Query  288  FHHIVKGSMAQV  323
            FH I+KGS AQ 
Sbjct  64   FHRILKGSSAQA  75



>ref|XP_010432722.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like isoform 
X3 [Camelina sativa]
Length=825

 Score =   114 bits (285),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 50/72 (69%), Positives = 58/72 (81%), Gaps = 0/72 (0%)
 Frame = +3

Query  108  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  287
            KK   VF+DV IDGDP E MVFELF +VAP+T+ENFRALCTGEKG  P++G  LHYKG+F
Sbjct  4    KKNPQVFMDVSIDGDPAETMVFELFPEVAPQTSENFRALCTGEKGIGPRSGKPLHYKGSF  63

Query  288  FHHIVKGSMAQV  323
            FH I+KGS AQ 
Sbjct  64   FHRILKGSSAQA  75



>ref|XP_007050460.1| Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein, 
putative isoform 1 [Theobroma cacao]
 gb|EOX94617.1| Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein, 
putative isoform 1 [Theobroma cacao]
Length=676

 Score =   113 bits (283),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 58/74 (78%), Gaps = 1/74 (1%)
 Frame = +3

Query  102  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  278
            MSKKK  LVFLDV +DGDP ER++ ELF DV PKTAENFRALCTGEKG    TG  LHYK
Sbjct  1    MSKKKNPLVFLDVSVDGDPVERIIIELFADVVPKTAENFRALCTGEKGVGKSTGKPLHYK  60

Query  279  GTFFHHIVKGSMAQ  320
            G+F H I+KG MAQ
Sbjct  61   GSFLHRIIKGFMAQ  74



>gb|AAM13845.1| unknown protein [Arabidopsis thaliana]
 gb|AAS75312.1| multidomain cyclophilin type peptidyl-prolyl cis-trans isomerase 
[Arabidopsis thaliana]
Length=837

 Score =   114 bits (284),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 50/72 (69%), Positives = 57/72 (79%), Gaps = 0/72 (0%)
 Frame = +3

Query  108  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  287
            KK   VF+DV IDGDP E MVFELF +VAPKT+ENFRALCTGEKG  P++   LHYKG+F
Sbjct  4    KKNPQVFMDVSIDGDPAETMVFELFPEVAPKTSENFRALCTGEKGIGPRSRKPLHYKGSF  63

Query  288  FHHIVKGSMAQV  323
            FH I+KGS AQ 
Sbjct  64   FHRIMKGSSAQA  75



>ref|XP_002867244.1| hypothetical protein ARALYDRAFT_491484 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43503.1| hypothetical protein ARALYDRAFT_491484 [Arabidopsis lyrata subsp. 
lyrata]
Length=845

 Score =   113 bits (283),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 52/74 (70%), Positives = 61/74 (82%), Gaps = 1/74 (1%)
 Frame = +3

Query  102  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  278
            M+KKK   VF+DV IDGDP E MVFELF +VAPKT+ENFRALCTGEKG  P++G  LHYK
Sbjct  1    MAKKKNPQVFMDVSIDGDPAETMVFELFPEVAPKTSENFRALCTGEKGIGPRSGKPLHYK  60

Query  279  GTFFHHIVKGSMAQ  320
            G+FFH I++GS AQ
Sbjct  61   GSFFHRILQGSSAQ  74



>ref|XP_010249986.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X1 [Nelumbo nucifera]
 ref|XP_010249987.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X1 [Nelumbo nucifera]
Length=807

 Score =   113 bits (283),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 50/71 (70%), Positives = 57/71 (80%), Gaps = 0/71 (0%)
 Frame = +3

Query  108  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  287
            +K  LVFLDV IDGDP E+M+FELF DV P+TAENFRALCTGEKG    TG  LHYKG+F
Sbjct  4    RKNPLVFLDVSIDGDPAEKMIFELFHDVVPRTAENFRALCTGEKGIGSTTGKHLHYKGSF  63

Query  288  FHHIVKGSMAQ  320
            FH I++G MAQ
Sbjct  64   FHRIIRGFMAQ  74



>ref|XP_010249988.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X2 [Nelumbo nucifera]
Length=806

 Score =   113 bits (283),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 50/71 (70%), Positives = 57/71 (80%), Gaps = 0/71 (0%)
 Frame = +3

Query  108  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  287
            +K  LVFLDV IDGDP E+M+FELF DV P+TAENFRALCTGEKG    TG  LHYKG+F
Sbjct  4    RKNPLVFLDVSIDGDPAEKMIFELFHDVVPRTAENFRALCTGEKGIGSTTGKHLHYKGSF  63

Query  288  FHHIVKGSMAQ  320
            FH I++G MAQ
Sbjct  64   FHRIIRGFMAQ  74



>ref|XP_002280876.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 isoform 
X1 [Vitis vinifera]
Length=702

 Score =   112 bits (281),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 52/71 (73%), Positives = 56/71 (79%), Gaps = 0/71 (0%)
 Frame = +3

Query  108  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  287
            KK  LVFLDV IDGDP E++V ELF DV PKTAENFRALCTGEKG    TG  LHYKG+F
Sbjct  4    KKNPLVFLDVSIDGDPVEKIVIELFADVVPKTAENFRALCTGEKGVGTSTGKPLHYKGSF  63

Query  288  FHHIVKGSMAQ  320
            FH I+KG MAQ
Sbjct  64   FHRIIKGFMAQ  74



>ref|XP_010646137.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 isoform 
X2 [Vitis vinifera]
 emb|CBI25055.3| unnamed protein product [Vitis vinifera]
Length=700

 Score =   112 bits (281),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 52/71 (73%), Positives = 56/71 (79%), Gaps = 0/71 (0%)
 Frame = +3

Query  108  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  287
            KK  LVFLDV IDGDP E++V ELF DV PKTAENFRALCTGEKG    TG  LHYKG+F
Sbjct  4    KKNPLVFLDVSIDGDPVEKIVIELFADVVPKTAENFRALCTGEKGVGTSTGKPLHYKGSF  63

Query  288  FHHIVKGSMAQ  320
            FH I+KG MAQ
Sbjct  64   FHRIIKGFMAQ  74



>ref|XP_002520955.1| cyclophilin, putative [Ricinus communis]
 gb|EEF41372.1| cyclophilin, putative [Ricinus communis]
Length=688

 Score =   112 bits (279),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 58/74 (78%), Gaps = 1/74 (1%)
 Frame = +3

Query  102  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  278
            MSKKK  LV+ DV IDGDP ER+V ELF DVAPKTAENFRALCTGE G    TG  LHYK
Sbjct  1    MSKKKNPLVYFDVSIDGDPVERIVIELFADVAPKTAENFRALCTGEMGIGKTTGKPLHYK  60

Query  279  GTFFHHIVKGSMAQ  320
            G+FFH I+KG MAQ
Sbjct  61   GSFFHRIIKGFMAQ  74



>ref|XP_006412476.1| hypothetical protein EUTSA_v10024440mg [Eutrema salsugineum]
 gb|ESQ53929.1| hypothetical protein EUTSA_v10024440mg [Eutrema salsugineum]
Length=810

 Score =   112 bits (280),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 50/72 (69%), Positives = 57/72 (79%), Gaps = 0/72 (0%)
 Frame = +3

Query  108  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  287
            KK   V++DVCIDGDP E MVFELF +VAPKT+ENFRALCTGEKG   ++G  LHYKG+F
Sbjct  4    KKNPQVYMDVCIDGDPAETMVFELFPEVAPKTSENFRALCTGEKGIGLRSGKPLHYKGSF  63

Query  288  FHHIVKGSMAQV  323
            FH IVKG  AQ 
Sbjct  64   FHRIVKGYSAQA  75



>emb|CAN75764.1| hypothetical protein VITISV_034442 [Vitis vinifera]
Length=786

 Score =   112 bits (280),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 52/71 (73%), Positives = 56/71 (79%), Gaps = 0/71 (0%)
 Frame = +3

Query  108  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  287
            KK  LVFLDV IDGDP E++V ELF DV PKTAENFRALCTGEKG    TG  LHYKG+F
Sbjct  4    KKNPLVFLDVSIDGDPVEKIVIELFADVVPKTAENFRALCTGEKGVGTSTGKPLHYKGSF  63

Query  288  FHHIVKGSMAQ  320
            FH I+KG MAQ
Sbjct  64   FHRIIKGFMAQ  74



>ref|XP_010432719.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like isoform 
X1 [Camelina sativa]
Length=846

 Score =   112 bits (280),  Expect = 6e-24, Method: Composition-based stats.
 Identities = 52/74 (70%), Positives = 61/74 (82%), Gaps = 1/74 (1%)
 Frame = +3

Query  102  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  278
            M+KKK   VF+DV IDGDP E MVFELF +VAP+T+ENFRALCTGEKG  P++G  LHYK
Sbjct  1    MAKKKNPQVFMDVSIDGDPAETMVFELFPEVAPQTSENFRALCTGEKGIGPRSGKPLHYK  60

Query  279  GTFFHHIVKGSMAQ  320
            G+FFH I+KGS AQ
Sbjct  61   GSFFHRILKGSSAQ  74



>ref|XP_010110347.1| Peptidyl-prolyl cis-trans isomerase 1 [Morus notabilis]
 gb|EXC26034.1| Peptidyl-prolyl cis-trans isomerase 1 [Morus notabilis]
Length=860

 Score =   111 bits (278),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 53/83 (64%), Positives = 63/83 (76%), Gaps = 10/83 (12%)
 Frame = +3

Query  102  MSKKK-VLVFLDVCIDGDPFERMVFEL---------FTDVAPKTAENFRALCTGEKGTSP  251
            M+K+K  +VF+DV IDGDP E+MVFEL         F D+APKTAENFRALCTGEKG  P
Sbjct  1    MAKRKNSMVFMDVSIDGDPAEKMVFELIDYSFTQQLFFDIAPKTAENFRALCTGEKGIGP  60

Query  252  KTGATLHYKGTFFHHIVKGSMAQ  320
            ++G  LHYKG+FFH I+KG MAQ
Sbjct  61   QSGRPLHYKGSFFHRIIKGFMAQ  83



>ref|XP_010546569.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X1 [Tarenaya hassleriana]
 ref|XP_010546570.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X2 [Tarenaya hassleriana]
Length=845

 Score =   110 bits (275),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 50/71 (70%), Positives = 57/71 (80%), Gaps = 0/71 (0%)
 Frame = +3

Query  108  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  287
            KK   VF+DV IDGDP E MVFELF +VAP TA+NFRALCTGEKG   ++G  LHYKG+F
Sbjct  4    KKNPQVFMDVSIDGDPAETMVFELFPEVAPNTADNFRALCTGEKGVGLRSGKPLHYKGSF  63

Query  288  FHHIVKGSMAQ  320
            FH I+KGSMAQ
Sbjct  64   FHKIIKGSMAQ  74



>gb|KDO68605.1| hypothetical protein CISIN_1g006162mg [Citrus sinensis]
Length=622

 Score =   109 bits (272),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 51/71 (72%), Positives = 54/71 (76%), Gaps = 0/71 (0%)
 Frame = +3

Query  108  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  287
            KK  LVFLDV IDGDP E++V ELF DV PKTAENFRALCTGEKG    TG  LHYKGT 
Sbjct  4    KKNPLVFLDVSIDGDPVEKIVIELFADVVPKTAENFRALCTGEKGIGKSTGKPLHYKGTM  63

Query  288  FHHIVKGSMAQ  320
            FH I+KG M Q
Sbjct  64   FHRIIKGFMIQ  74



>ref|XP_010038051.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 isoform 
X2 [Eucalyptus grandis]
Length=661

 Score =   109 bits (272),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 48/71 (68%), Positives = 55/71 (77%), Gaps = 0/71 (0%)
 Frame = +3

Query  108  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  287
            +K  LVFLDV IDGDP ER+V ELF D  P+TAENFR+LCTGEKG    TG  LHYKG++
Sbjct  4    RKNPLVFLDVSIDGDPVERIVIELFADTVPRTAENFRSLCTGEKGVGKTTGKPLHYKGSY  63

Query  288  FHHIVKGSMAQ  320
            FH I+KG MAQ
Sbjct  64   FHRIIKGFMAQ  74



>ref|XP_010038050.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 isoform 
X1 [Eucalyptus grandis]
 gb|KCW49849.1| hypothetical protein EUGRSUZ_K03321 [Eucalyptus grandis]
Length=664

 Score =   109 bits (272),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 48/71 (68%), Positives = 55/71 (77%), Gaps = 0/71 (0%)
 Frame = +3

Query  108  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  287
            +K  LVFLDV IDGDP ER+V ELF D  P+TAENFR+LCTGEKG    TG  LHYKG++
Sbjct  4    RKNPLVFLDVSIDGDPVERIVIELFADTVPRTAENFRSLCTGEKGVGKTTGKPLHYKGSY  63

Query  288  FHHIVKGSMAQ  320
            FH I+KG MAQ
Sbjct  64   FHRIIKGFMAQ  74



>ref|XP_006443959.1| hypothetical protein CICLE_v10019230mg [Citrus clementina]
 ref|XP_006479629.1| PREDICTED: peptidyl-prolyl cis-trans isomerase G-like isoform 
X3 [Citrus sinensis]
 gb|ESR57199.1| hypothetical protein CICLE_v10019230mg [Citrus clementina]
 gb|KDO68606.1| hypothetical protein CISIN_1g006162mg [Citrus sinensis]
Length=643

 Score =   108 bits (271),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 51/71 (72%), Positives = 54/71 (76%), Gaps = 0/71 (0%)
 Frame = +3

Query  108  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  287
            KK  LVFLDV IDGDP E++V ELF DV PKTAENFRALCTGEKG    TG  LHYKGT 
Sbjct  4    KKNPLVFLDVSIDGDPVEKIVIELFADVVPKTAENFRALCTGEKGIGKSTGKPLHYKGTM  63

Query  288  FHHIVKGSMAQ  320
            FH I+KG M Q
Sbjct  64   FHRIIKGFMIQ  74



>ref|XP_006443960.1| hypothetical protein CICLE_v10019230mg [Citrus clementina]
 ref|XP_006479627.1| PREDICTED: peptidyl-prolyl cis-trans isomerase G-like isoform 
X1 [Citrus sinensis]
 ref|XP_006479628.1| PREDICTED: peptidyl-prolyl cis-trans isomerase G-like isoform 
X2 [Citrus sinensis]
 gb|ESR57200.1| hypothetical protein CICLE_v10019230mg [Citrus clementina]
 gb|KDO68607.1| hypothetical protein CISIN_1g006162mg [Citrus sinensis]
Length=650

 Score =   108 bits (271),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 51/71 (72%), Positives = 54/71 (76%), Gaps = 0/71 (0%)
 Frame = +3

Query  108  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  287
            KK  LVFLDV IDGDP E++V ELF DV PKTAENFRALCTGEKG    TG  LHYKGT 
Sbjct  4    KKNPLVFLDVSIDGDPVEKIVIELFADVVPKTAENFRALCTGEKGIGKSTGKPLHYKGTM  63

Query  288  FHHIVKGSMAQ  320
            FH I+KG M Q
Sbjct  64   FHRIIKGFMIQ  74



>gb|KDO68608.1| hypothetical protein CISIN_1g006162mg [Citrus sinensis]
Length=658

 Score =   108 bits (271),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 51/71 (72%), Positives = 54/71 (76%), Gaps = 0/71 (0%)
 Frame = +3

Query  108  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  287
            KK  LVFLDV IDGDP E++V ELF DV PKTAENFRALCTGEKG    TG  LHYKGT 
Sbjct  4    KKNPLVFLDVSIDGDPVEKIVIELFADVVPKTAENFRALCTGEKGIGKSTGKPLHYKGTM  63

Query  288  FHHIVKGSMAQ  320
            FH I+KG M Q
Sbjct  64   FHRIIKGFMIQ  74



>ref|XP_004498655.1| PREDICTED: serine/arginine repetitive matrix protein 2-like isoform 
X1 [Cicer arietinum]
Length=812

 Score =   109 bits (272),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 55/93 (59%), Positives = 60/93 (65%), Gaps = 22/93 (24%)
 Frame = +3

Query  108  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCT-------------------  230
            KK  +VFLDV IDGDP ERMVFELF DVAPKTAENFRALCT                   
Sbjct  4    KKNPMVFLDVSIDGDPAERMVFELFYDVAPKTAENFRALCTGNITFDLHGTFLFLLKSVI  63

Query  231  ---GEKGTSPKTGATLHYKGTFFHHIVKGSMAQ  320
               GEKG S  TG +LHYKG+FFH IVKGS+ +
Sbjct  64   LHSGEKGVSSNTGKSLHYKGSFFHQIVKGSIVR  96



>gb|KDP21391.1| hypothetical protein JCGZ_21862 [Jatropha curcas]
Length=716

 Score =   108 bits (271),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 51/74 (69%), Positives = 57/74 (77%), Gaps = 1/74 (1%)
 Frame = +3

Query  102  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  278
            MSK+K  LVF DV IDGDP ER+ FELF +  PKTAENFRALCTGEKG    TG  LHYK
Sbjct  1    MSKRKNPLVFFDVSIDGDPVERIAFELFANFVPKTAENFRALCTGEKGIGKTTGKPLHYK  60

Query  279  GTFFHHIVKGSMAQ  320
            G+FFH I++G MAQ
Sbjct  61   GSFFHRIIRGFMAQ  74



>ref|XP_002306802.2| hypothetical protein POPTR_0005s23730g [Populus trichocarpa]
 gb|EEE93798.2| hypothetical protein POPTR_0005s23730g [Populus trichocarpa]
Length=673

 Score =   108 bits (270),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 57/74 (77%), Gaps = 1/74 (1%)
 Frame = +3

Query  102  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  278
            MSKKK  LVFLDV IDGDP ER+  ELF DV P+TAENFRALCTGEKGT   TG  LHYK
Sbjct  1    MSKKKNPLVFLDVSIDGDPAERIFIELFADVVPRTAENFRALCTGEKGTGKTTGKPLHYK  60

Query  279  GTFFHHIVKGSMAQ  320
            G+ FH I+K  MAQ
Sbjct  61   GSSFHRIIKEFMAQ  74



>ref|XP_006838913.1| hypothetical protein AMTR_s00002p00269760 [Amborella trichopoda]
 gb|ERN01482.1| hypothetical protein AMTR_s00002p00269760 [Amborella trichopoda]
Length=795

 Score =   108 bits (271),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 51/71 (72%), Positives = 55/71 (77%), Gaps = 0/71 (0%)
 Frame = +3

Query  108  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  287
            KK  LVFLDV I GDP  +MVFELF+DV PKTAENFRALCTGEKG    TG  LHYKG+ 
Sbjct  4    KKNSLVFLDVSIGGDPAGKMVFELFSDVVPKTAENFRALCTGEKGIGQVTGKPLHYKGSI  63

Query  288  FHHIVKGSMAQ  320
            FH I+KG MAQ
Sbjct  64   FHRIIKGFMAQ  74



>ref|XP_010527623.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 isoform 
X8 [Tarenaya hassleriana]
Length=538

 Score =   107 bits (266),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 52/74 (70%), Positives = 57/74 (77%), Gaps = 1/74 (1%)
 Frame = +3

Query  102  MSKKKVL-VFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  278
            MSKKK   VFLDV I GDP ER+V +LF DV PKTAENFRALCTGEKG    TG  LH+K
Sbjct  1    MSKKKNPNVFLDVSIGGDPVERIVIQLFADVVPKTAENFRALCTGEKGIGETTGKPLHFK  60

Query  279  GTFFHHIVKGSMAQ  320
            G+FFH I+KG MAQ
Sbjct  61   GSFFHRIIKGFMAQ  74



>ref|XP_010527624.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 isoform 
X9 [Tarenaya hassleriana]
Length=536

 Score =   107 bits (266),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 52/74 (70%), Positives = 57/74 (77%), Gaps = 1/74 (1%)
 Frame = +3

Query  102  MSKKKVL-VFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  278
            MSKKK   VFLDV I GDP ER+V +LF DV PKTAENFRALCTGEKG    TG  LH+K
Sbjct  1    MSKKKNPNVFLDVSIGGDPVERIVIQLFADVVPKTAENFRALCTGEKGIGETTGKPLHFK  60

Query  279  GTFFHHIVKGSMAQ  320
            G+FFH I+KG MAQ
Sbjct  61   GSFFHRIIKGFMAQ  74



>ref|XP_010028212.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like isoform 
X4 [Eucalyptus grandis]
Length=135

 Score =   100 bits (250),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 54/92 (59%), Positives = 61/92 (66%), Gaps = 18/92 (20%)
 Frame = +3

Query  102  MSKKKVLVFLDVCIDGDPFERMVFE------------------LFTDVAPKTAENFRALC  227
            M+KK +LVF+DV IDGDP ERMVFE                  LF +VAPKTAENFRAL 
Sbjct  2    MTKKNLLVFMDVSIDGDPAERMVFEILHNPYLLISFLVNPIQQLFPEVAPKTAENFRALY  61

Query  228  TGEKGTSPKTGATLHYKGTFFHHIVKGSMAQV  323
            T EKG   KTG  LH KG+FFH I++GSMAQV
Sbjct  62   TEEKGIGQKTGRPLHLKGSFFHRIIRGSMAQV  93



>ref|XP_010527622.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 isoform 
X7 [Tarenaya hassleriana]
Length=541

 Score =   107 bits (266),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 52/74 (70%), Positives = 57/74 (77%), Gaps = 1/74 (1%)
 Frame = +3

Query  102  MSKKKV-LVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  278
            MSKKK   VFLDV I GDP ER+V +LF DV PKTAENFRALCTGEKG    TG  LH+K
Sbjct  1    MSKKKNPNVFLDVSIGGDPVERIVIQLFADVVPKTAENFRALCTGEKGIGETTGKPLHFK  60

Query  279  GTFFHHIVKGSMAQ  320
            G+FFH I+KG MAQ
Sbjct  61   GSFFHRIIKGFMAQ  74



>gb|AJA29688.1| peptidyl-prolyl cis-trans isomerase [Betula luminifera]
Length=695

 Score =   107 bits (268),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 48/71 (68%), Positives = 54/71 (76%), Gaps = 0/71 (0%)
 Frame = +3

Query  108  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  287
            KK   VFLD+ IDGDP ER+V ELF DV PKTAENFRALCTGEKG    TG  LHY+G++
Sbjct  4    KKNPFVFLDLSIDGDPVERIVIELFADVVPKTAENFRALCTGEKGIGKSTGKPLHYRGSY  63

Query  288  FHHIVKGSMAQ  320
             H I+KG MAQ
Sbjct  64   LHRIIKGFMAQ  74



>ref|XP_002302085.2| hypothetical protein POPTR_0002s04800g [Populus trichocarpa]
 gb|EEE81358.2| hypothetical protein POPTR_0002s04800g [Populus trichocarpa]
Length=688

 Score =   107 bits (267),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 51/73 (70%), Positives = 54/73 (74%), Gaps = 0/73 (0%)
 Frame = +3

Query  102  MSKKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKG  281
            + KK  LVFLDV IDGDP ER+  ELF DV PKTAENFRALCTGEKG    TG  LHYKG
Sbjct  2    IKKKNPLVFLDVSIDGDPAERIFIELFADVVPKTAENFRALCTGEKGIGKTTGKPLHYKG  61

Query  282  TFFHHIVKGSMAQ  320
              FH I+KG MAQ
Sbjct  62   CSFHRIIKGFMAQ  74



>ref|XP_010527616.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 isoform 
X2 [Tarenaya hassleriana]
Length=634

 Score =   107 bits (267),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 52/74 (70%), Positives = 57/74 (77%), Gaps = 1/74 (1%)
 Frame = +3

Query  102  MSKKKVL-VFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  278
            MSKKK   VFLDV I GDP ER+V +LF DV PKTAENFRALCTGEKG    TG  LH+K
Sbjct  1    MSKKKNPNVFLDVSIGGDPVERIVIQLFADVVPKTAENFRALCTGEKGIGETTGKPLHFK  60

Query  279  GTFFHHIVKGSMAQ  320
            G+FFH I+KG MAQ
Sbjct  61   GSFFHRIIKGFMAQ  74



>ref|XP_010527615.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 isoform 
X1 [Tarenaya hassleriana]
Length=636

 Score =   107 bits (267),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 52/74 (70%), Positives = 57/74 (77%), Gaps = 1/74 (1%)
 Frame = +3

Query  102  MSKKKVL-VFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  278
            MSKKK   VFLDV I GDP ER+V +LF DV PKTAENFRALCTGEKG    TG  LH+K
Sbjct  1    MSKKKNPNVFLDVSIGGDPVERIVIQLFADVVPKTAENFRALCTGEKGIGETTGKPLHFK  60

Query  279  GTFFHHIVKGSMAQ  320
            G+FFH I+KG MAQ
Sbjct  61   GSFFHRIIKGFMAQ  74



>ref|XP_010527620.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 isoform 
X5 [Tarenaya hassleriana]
Length=631

 Score =   107 bits (266),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 52/74 (70%), Positives = 57/74 (77%), Gaps = 1/74 (1%)
 Frame = +3

Query  102  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  278
            MSKKK   VFLDV I GDP ER+V +LF DV PKTAENFRALCTGEKG    TG  LH+K
Sbjct  1    MSKKKNPNVFLDVSIGGDPVERIVIQLFADVVPKTAENFRALCTGEKGIGETTGKPLHFK  60

Query  279  GTFFHHIVKGSMAQ  320
            G+FFH I+KG MAQ
Sbjct  61   GSFFHRIIKGFMAQ  74



>ref|XP_006283087.1| hypothetical protein CARUB_v10004106mg [Capsella rubella]
 gb|EOA15985.1| hypothetical protein CARUB_v10004106mg [Capsella rubella]
Length=879

 Score =   107 bits (268),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 47/64 (73%), Positives = 54/64 (84%), Gaps = 0/64 (0%)
 Frame = +3

Query  129  LDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTFFHHIVKG  308
            +DV IDGDP E MVFELF +VAPKT+ENFRALCTGEKG  P++G  LHYKG+FFH I+KG
Sbjct  1    MDVSIDGDPAETMVFELFPEVAPKTSENFRALCTGEKGIGPRSGKPLHYKGSFFHRILKG  60

Query  309  SMAQ  320
            S AQ
Sbjct  61   SSAQ  64



>ref|XP_010527617.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 isoform 
X3 [Tarenaya hassleriana]
Length=633

 Score =   107 bits (266),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 52/74 (70%), Positives = 57/74 (77%), Gaps = 1/74 (1%)
 Frame = +3

Query  102  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  278
            MSKKK   VFLDV I GDP ER+V +LF DV PKTAENFRALCTGEKG    TG  LH+K
Sbjct  1    MSKKKNPNVFLDVSIGGDPVERIVIQLFADVVPKTAENFRALCTGEKGIGETTGKPLHFK  60

Query  279  GTFFHHIVKGSMAQ  320
            G+FFH I+KG MAQ
Sbjct  61   GSFFHRIIKGFMAQ  74



>ref|XP_010527621.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 isoform 
X6 [Tarenaya hassleriana]
Length=629

 Score =   107 bits (266),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 52/74 (70%), Positives = 57/74 (77%), Gaps = 1/74 (1%)
 Frame = +3

Query  102  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  278
            MSKKK   VFLDV I GDP ER+V +LF DV PKTAENFRALCTGEKG    TG  LH+K
Sbjct  1    MSKKKNPNVFLDVSIGGDPVERIVIQLFADVVPKTAENFRALCTGEKGIGETTGKPLHFK  60

Query  279  GTFFHHIVKGSMAQ  320
            G+FFH I+KG MAQ
Sbjct  61   GSFFHRIIKGFMAQ  74



>ref|XP_010527619.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 isoform 
X4 [Tarenaya hassleriana]
Length=631

 Score =   107 bits (266),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 52/74 (70%), Positives = 57/74 (77%), Gaps = 1/74 (1%)
 Frame = +3

Query  102  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  278
            MSKKK   VFLDV I GDP ER+V +LF DV PKTAENFRALCTGEKG    TG  LH+K
Sbjct  1    MSKKKNPNVFLDVSIGGDPVERIVIQLFADVVPKTAENFRALCTGEKGIGETTGKPLHFK  60

Query  279  GTFFHHIVKGSMAQ  320
            G+FFH I+KG MAQ
Sbjct  61   GSFFHRIIKGFMAQ  74



>emb|CDP03680.1| unnamed protein product [Coffea canephora]
Length=664

 Score =   107 bits (266),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 52/74 (70%), Positives = 55/74 (74%), Gaps = 1/74 (1%)
 Frame = +3

Query  102  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  278
            MSKKK  LVF DV IDG P ER+  ELF DV PKTAENFRALCTGEKG    TG  LHYK
Sbjct  1    MSKKKNPLVFFDVSIDGSPAERITIELFADVVPKTAENFRALCTGEKGIGSSTGKPLHYK  60

Query  279  GTFFHHIVKGSMAQ  320
            G+ FH I+KG MAQ
Sbjct  61   GSSFHRIIKGFMAQ  74



>gb|KHG26228.1| Peptidyl-prolyl cis-trans isomerase D [Gossypium arboreum]
Length=177

 Score =   101 bits (251),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 51/74 (69%), Positives = 55/74 (74%), Gaps = 1/74 (1%)
 Frame = +3

Query  102  MSKKKV-LVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  278
            MSKKK  +VF DV I GD  ER++ ELF DV PKTAENFRALCTGEKG    TG  LHYK
Sbjct  1    MSKKKNPMVFFDVSIGGDLVERIIIELFADVVPKTAENFRALCTGEKGIGKSTGKPLHYK  60

Query  279  GTFFHHIVKGSMAQ  320
            GTF H I+KG MAQ
Sbjct  61   GTFLHRIIKGFMAQ  74



>ref|XP_010028213.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like isoform 
X5 [Eucalyptus grandis]
Length=129

 Score = 99.8 bits (247),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 53/91 (58%), Positives = 60/91 (66%), Gaps = 18/91 (20%)
 Frame = +3

Query  102  MSKKKVLVFLDVCIDGDPFERMVFE------------------LFTDVAPKTAENFRALC  227
            M+KK +LVF+DV IDGDP ERMVFE                  LF +VAPKTAENFRAL 
Sbjct  2    MTKKNLLVFMDVSIDGDPAERMVFEILHNPYLLISFLVNPIQQLFPEVAPKTAENFRALY  61

Query  228  TGEKGTSPKTGATLHYKGTFFHHIVKGSMAQ  320
            T EKG   KTG  LH KG+FFH I++GSMAQ
Sbjct  62   TEEKGIGQKTGRPLHLKGSFFHRIIRGSMAQ  92



>ref|XP_008785212.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like isoform 
X1 [Phoenix dactylifera]
Length=818

 Score =   107 bits (266),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 48/70 (69%), Positives = 52/70 (74%), Gaps = 0/70 (0%)
 Frame = +3

Query  111  KKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTFF  290
            K   VFLDV I   P ERMVFELF D+ PKTAENFRALCTGEKG  P TG  LHY+G+ F
Sbjct  5    KNPTVFLDVAIGRGPAERMVFELFADIVPKTAENFRALCTGEKGVGPSTGKPLHYRGSIF  64

Query  291  HHIVKGSMAQ  320
            H I+KG MAQ
Sbjct  65   HRIIKGFMAQ  74



>ref|XP_010028209.1| PREDICTED: uncharacterized protein LOC104418535 isoform X1 [Eucalyptus 
grandis]
Length=173

 Score =   100 bits (249),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 54/92 (59%), Positives = 61/92 (66%), Gaps = 18/92 (20%)
 Frame = +3

Query  102  MSKKKVLVFLDVCIDGDPFERMVFE------------------LFTDVAPKTAENFRALC  227
            M+KK +LVF+DV IDGDP ERMVFE                  LF +VAPKTAENFRAL 
Sbjct  2    MTKKNLLVFMDVSIDGDPAERMVFEILHNPYLLISFLVNPIQQLFPEVAPKTAENFRALY  61

Query  228  TGEKGTSPKTGATLHYKGTFFHHIVKGSMAQV  323
            T EKG   KTG  LH KG+FFH I++GSMAQV
Sbjct  62   TEEKGIGQKTGRPLHLKGSFFHRIIRGSMAQV  93



>ref|XP_010925250.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like [Elaeis 
guineensis]
 ref|XP_010925251.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like [Elaeis 
guineensis]
 ref|XP_010925252.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like [Elaeis 
guineensis]
Length=842

 Score =   106 bits (264),  Expect = 6e-22, Method: Composition-based stats.
 Identities = 48/70 (69%), Positives = 52/70 (74%), Gaps = 0/70 (0%)
 Frame = +3

Query  111  KKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTFF  290
            K   VFLDV I G P ERMVFELF D+ PKTAENFRALCTGEKG    TG  LHY+G+ F
Sbjct  5    KNPTVFLDVAIGGGPAERMVFELFADIVPKTAENFRALCTGEKGVGSTTGKPLHYRGSIF  64

Query  291  HHIVKGSMAQ  320
            H I+KG MAQ
Sbjct  65   HRIIKGFMAQ  74



>ref|XP_007199724.1| hypothetical protein PRUPE_ppa002435mg [Prunus persica]
 gb|EMJ00923.1| hypothetical protein PRUPE_ppa002435mg [Prunus persica]
Length=673

 Score =   105 bits (263),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 49/71 (69%), Positives = 53/71 (75%), Gaps = 0/71 (0%)
 Frame = +3

Query  108  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  287
            KK   VFLDV  DGDP ER+V ELF DV PKTAENFRALCTG+KG    TG  LHYKG+ 
Sbjct  4    KKNPCVFLDVSTDGDPMERVVIELFADVVPKTAENFRALCTGDKGIGKSTGKPLHYKGSQ  63

Query  288  FHHIVKGSMAQ  320
            FH I+KG MAQ
Sbjct  64   FHRIIKGFMAQ  74



>ref|XP_008235346.1| PREDICTED: peptidyl-prolyl cis-trans isomerase G isoform X2 [Prunus 
mume]
Length=669

 Score =   105 bits (263),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 49/71 (69%), Positives = 53/71 (75%), Gaps = 0/71 (0%)
 Frame = +3

Query  108  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  287
            KK   VFLDV  DGDP ER+V ELF DV PKTAENFRALCTG+KG    TG  LHYKG+ 
Sbjct  4    KKNPCVFLDVSTDGDPMERVVIELFADVVPKTAENFRALCTGDKGIGKSTGKPLHYKGSQ  63

Query  288  FHHIVKGSMAQ  320
            FH I+KG MAQ
Sbjct  64   FHRIIKGFMAQ  74



>ref|XP_008235345.1| PREDICTED: peptidyl-prolyl cis-trans isomerase 8 isoform X1 [Prunus 
mume]
Length=670

 Score =   105 bits (263),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 49/71 (69%), Positives = 53/71 (75%), Gaps = 0/71 (0%)
 Frame = +3

Query  108  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  287
            KK   VFLDV  DGDP ER+V ELF DV PKTAENFRALCTG+KG    TG  LHYKG+ 
Sbjct  4    KKNPCVFLDVSTDGDPMERVVIELFADVVPKTAENFRALCTGDKGIGKSTGKPLHYKGSQ  63

Query  288  FHHIVKGSMAQ  320
            FH I+KG MAQ
Sbjct  64   FHRIIKGFMAQ  74



>ref|XP_010274264.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63-like isoform 
X1 [Nelumbo nucifera]
 ref|XP_010274265.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63-like isoform 
X1 [Nelumbo nucifera]
Length=696

 Score =   105 bits (263),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 46/67 (69%), Positives = 53/67 (79%), Gaps = 0/67 (0%)
 Frame = +3

Query  120  LVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTFFHHI  299
            LVFLD+ IDG+P E++V ELF D+ PKTAENFRALCTGEKG    TG  LHYKG+ FH I
Sbjct  8    LVFLDISIDGNPAEKVVIELFADIVPKTAENFRALCTGEKGIGASTGKPLHYKGSIFHRI  67

Query  300  VKGSMAQ  320
            +KG MAQ
Sbjct  68   IKGFMAQ  74



>ref|XP_008235347.1| PREDICTED: peptidyl-prolyl cis-trans isomerase 8 isoform X3 [Prunus 
mume]
Length=665

 Score =   105 bits (262),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 49/71 (69%), Positives = 53/71 (75%), Gaps = 0/71 (0%)
 Frame = +3

Query  108  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  287
            KK   VFLDV  DGDP ER+V ELF DV PKTAENFRALCTG+KG    TG  LHYKG+ 
Sbjct  4    KKNPCVFLDVSTDGDPMERVVIELFADVVPKTAENFRALCTGDKGIGKSTGKPLHYKGSQ  63

Query  288  FHHIVKGSMAQ  320
            FH I+KG MAQ
Sbjct  64   FHRIIKGFMAQ  74



>ref|XP_010274266.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63-like isoform 
X2 [Nelumbo nucifera]
Length=695

 Score =   105 bits (263),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 46/67 (69%), Positives = 53/67 (79%), Gaps = 0/67 (0%)
 Frame = +3

Query  120  LVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTFFHHI  299
            LVFLD+ IDG+P E++V ELF D+ PKTAENFRALCTGEKG    TG  LHYKG+ FH I
Sbjct  8    LVFLDISIDGNPAEKVVIELFADIVPKTAENFRALCTGEKGIGASTGKPLHYKGSIFHRI  67

Query  300  VKGSMAQ  320
            +KG MAQ
Sbjct  68   IKGFMAQ  74



>ref|XP_010274267.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63-like isoform 
X3 [Nelumbo nucifera]
Length=693

 Score =   105 bits (263),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 46/67 (69%), Positives = 53/67 (79%), Gaps = 0/67 (0%)
 Frame = +3

Query  120  LVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTFFHHI  299
            LVFLD+ IDG+P E++V ELF D+ PKTAENFRALCTGEKG    TG  LHYKG+ FH I
Sbjct  8    LVFLDISIDGNPAEKVVIELFADIVPKTAENFRALCTGEKGIGASTGKPLHYKGSIFHRI  67

Query  300  VKGSMAQ  320
            +KG MAQ
Sbjct  68   IKGFMAQ  74



>ref|XP_008802286.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 isoform 
X3 [Phoenix dactylifera]
Length=682

 Score =   105 bits (262),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 49/71 (69%), Positives = 54/71 (76%), Gaps = 0/71 (0%)
 Frame = +3

Query  108  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  287
            KK  LVFLD+ +DGD  ERMV ELF+DV PKTAENFRALCTGEKG    TG +LHYKG+ 
Sbjct  4    KKNPLVFLDISVDGDRAERMVIELFSDVVPKTAENFRALCTGEKGIGASTGKSLHYKGSI  63

Query  288  FHHIVKGSMAQ  320
            FH IVK   AQ
Sbjct  64   FHRIVKRLGAQ  74



>ref|XP_010274268.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63-like isoform 
X4 [Nelumbo nucifera]
Length=691

 Score =   105 bits (263),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 46/67 (69%), Positives = 53/67 (79%), Gaps = 0/67 (0%)
 Frame = +3

Query  120  LVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTFFHHI  299
            LVFLD+ IDG+P E++V ELF D+ PKTAENFRALCTGEKG    TG  LHYKG+ FH I
Sbjct  8    LVFLDISIDGNPAEKVVIELFADIVPKTAENFRALCTGEKGIGASTGKPLHYKGSIFHRI  67

Query  300  VKGSMAQ  320
            +KG MAQ
Sbjct  68   IKGFMAQ  74



>ref|XP_008802283.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 isoform 
X1 [Phoenix dactylifera]
 ref|XP_008802284.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 isoform 
X1 [Phoenix dactylifera]
Length=685

 Score =   105 bits (262),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 49/71 (69%), Positives = 54/71 (76%), Gaps = 0/71 (0%)
 Frame = +3

Query  108  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  287
            KK  LVFLD+ +DGD  ERMV ELF+DV PKTAENFRALCTGEKG    TG +LHYKG+ 
Sbjct  4    KKNPLVFLDISVDGDRAERMVIELFSDVVPKTAENFRALCTGEKGIGASTGKSLHYKGSI  63

Query  288  FHHIVKGSMAQ  320
            FH IVK   AQ
Sbjct  64   FHRIVKRLGAQ  74



>ref|XP_008802287.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 isoform 
X4 [Phoenix dactylifera]
Length=681

 Score =   105 bits (262),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 49/71 (69%), Positives = 54/71 (76%), Gaps = 0/71 (0%)
 Frame = +3

Query  108  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  287
            KK  LVFLD+ +DGD  ERMV ELF+DV PKTAENFRALCTGEKG    TG +LHYKG+ 
Sbjct  4    KKNPLVFLDISVDGDRAERMVIELFSDVVPKTAENFRALCTGEKGIGASTGKSLHYKGSI  63

Query  288  FHHIVKGSMAQ  320
            FH IVK   AQ
Sbjct  64   FHRIVKRLGAQ  74



>ref|XP_008802285.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 isoform 
X2 [Phoenix dactylifera]
Length=684

 Score =   105 bits (262),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 49/71 (69%), Positives = 54/71 (76%), Gaps = 0/71 (0%)
 Frame = +3

Query  108  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  287
            KK  LVFLD+ +DGD  ERMV ELF+DV PKTAENFRALCTGEKG    TG +LHYKG+ 
Sbjct  4    KKNPLVFLDISVDGDRAERMVIELFSDVVPKTAENFRALCTGEKGIGASTGKSLHYKGSI  63

Query  288  FHHIVKGSMAQ  320
            FH IVK   AQ
Sbjct  64   FHRIVKRLGAQ  74



>ref|XP_009370747.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 [Pyrus x 
bretschneideri]
Length=535

 Score =   104 bits (260),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 51/74 (69%), Positives = 56/74 (76%), Gaps = 1/74 (1%)
 Frame = +3

Query  102  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  278
            MSKKK   VFLDV ID DP E++V ELF DV PKTAENFRALCTGEKG    TG  LHYK
Sbjct  1    MSKKKNPRVFLDVSIDRDPVEQIVIELFADVVPKTAENFRALCTGEKGIGKSTGKPLHYK  60

Query  279  GTFFHHIVKGSMAQ  320
            G+ FH ++KG MAQ
Sbjct  61   GSTFHRVIKGFMAQ  74



>ref|XP_009798520.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 isoform 
X1 [Nicotiana sylvestris]
 ref|XP_009798521.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 isoform 
X1 [Nicotiana sylvestris]
 ref|XP_009798522.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 isoform 
X1 [Nicotiana sylvestris]
Length=660

 Score =   105 bits (261),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 47/71 (66%), Positives = 54/71 (76%), Gaps = 0/71 (0%)
 Frame = +3

Query  108  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  287
            KK  LVFLDV IDG+P ER+V ELF D+ P+TAENFR+LCTGEKG    TG  LHYKG  
Sbjct  4    KKNPLVFLDVSIDGNPAERIVIELFADIVPRTAENFRSLCTGEKGVGVSTGKPLHYKGCL  63

Query  288  FHHIVKGSMAQ  320
            FH ++KG MAQ
Sbjct  64   FHRVIKGFMAQ  74



>gb|KJB25951.1| hypothetical protein B456_004G217800 [Gossypium raimondii]
Length=602

 Score =   104 bits (260),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 52/74 (70%), Positives = 56/74 (76%), Gaps = 1/74 (1%)
 Frame = +3

Query  102  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  278
            MSKKK  +VF DV I GD  ER++ ELF DV PKTAENFRALCTGEKG    TG  LHYK
Sbjct  1    MSKKKNPMVFFDVSIGGDLVERIIIELFADVVPKTAENFRALCTGEKGIGKCTGKPLHYK  60

Query  279  GTFFHHIVKGSMAQ  320
            GTFFH I+KG MAQ
Sbjct  61   GTFFHRIIKGFMAQ  74



>ref|XP_008792090.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like isoform 
X1 [Phoenix dactylifera]
 ref|XP_008792091.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like isoform 
X1 [Phoenix dactylifera]
Length=845

 Score =   105 bits (262),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 48/70 (69%), Positives = 51/70 (73%), Gaps = 0/70 (0%)
 Frame = +3

Query  111  KKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTFF  290
            K   VFLDV I G P  RMVFELF D+ PKTAENFRALCTGEKG  P T   LHYKG+ F
Sbjct  5    KNPTVFLDVAIGGGPSRRMVFELFADIVPKTAENFRALCTGEKGIGPTTRKPLHYKGSIF  64

Query  291  HHIVKGSMAQ  320
            H I+KG MAQ
Sbjct  65   HRIIKGFMAQ  74



>ref|XP_011032623.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 [Populus 
euphratica]
 ref|XP_011032624.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 [Populus 
euphratica]
Length=680

 Score =   105 bits (261),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 49/71 (69%), Positives = 53/71 (75%), Gaps = 0/71 (0%)
 Frame = +3

Query  108  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  287
            KK  LVFLDV IDGDP ER+  ELF DV P+TAENFRALCTGEKG    TG  LHYKG+ 
Sbjct  4    KKNPLVFLDVSIDGDPAERIFIELFADVVPRTAENFRALCTGEKGIGKTTGKPLHYKGSS  63

Query  288  FHHIVKGSMAQ  320
            FH I+K  MAQ
Sbjct  64   FHRIIKEFMAQ  74



>gb|KJB25950.1| hypothetical protein B456_004G217800 [Gossypium raimondii]
Length=599

 Score =   104 bits (260),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 52/74 (70%), Positives = 56/74 (76%), Gaps = 1/74 (1%)
 Frame = +3

Query  102  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  278
            MSKKK  +VF DV I GD  ER++ ELF DV PKTAENFRALCTGEKG    TG  LHYK
Sbjct  1    MSKKKNPMVFFDVSIGGDLVERIIIELFADVVPKTAENFRALCTGEKGIGKCTGKPLHYK  60

Query  279  GTFFHHIVKGSMAQ  320
            GTFFH I+KG MAQ
Sbjct  61   GTFFHRIIKGFMAQ  74



>gb|KJB25952.1| hypothetical protein B456_004G217800 [Gossypium raimondii]
Length=626

 Score =   104 bits (260),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 52/74 (70%), Positives = 56/74 (76%), Gaps = 1/74 (1%)
 Frame = +3

Query  102  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  278
            MSKKK  +VF DV I GD  ER++ ELF DV PKTAENFRALCTGEKG    TG  LHYK
Sbjct  1    MSKKKNPMVFFDVSIGGDLVERIIIELFADVVPKTAENFRALCTGEKGIGKCTGKPLHYK  60

Query  279  GTFFHHIVKGSMAQ  320
            GTFFH I+KG MAQ
Sbjct  61   GTFFHRIIKGFMAQ  74



>gb|KJB25953.1| hypothetical protein B456_004G217800 [Gossypium raimondii]
Length=634

 Score =   104 bits (260),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 52/74 (70%), Positives = 56/74 (76%), Gaps = 1/74 (1%)
 Frame = +3

Query  102  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  278
            MSKKK  +VF DV I GD  ER++ ELF DV PKTAENFRALCTGEKG    TG  LHYK
Sbjct  1    MSKKKNPMVFFDVSIGGDLVERIIIELFADVVPKTAENFRALCTGEKGIGKCTGKPLHYK  60

Query  279  GTFFHHIVKGSMAQ  320
            GTFFH I+KG MAQ
Sbjct  61   GTFFHRIIKGFMAQ  74



>gb|KJB25949.1| hypothetical protein B456_004G217800 [Gossypium raimondii]
Length=661

 Score =   104 bits (260),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 52/74 (70%), Positives = 56/74 (76%), Gaps = 1/74 (1%)
 Frame = +3

Query  102  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  278
            MSKKK  +VF DV I GD  ER++ ELF DV PKTAENFRALCTGEKG    TG  LHYK
Sbjct  1    MSKKKNPMVFFDVSIGGDLVERIIIELFADVVPKTAENFRALCTGEKGIGKCTGKPLHYK  60

Query  279  GTFFHHIVKGSMAQ  320
            GTFFH I+KG MAQ
Sbjct  61   GTFFHRIIKGFMAQ  74



>ref|XP_010028210.1| PREDICTED: uncharacterized protein LOC104418535 isoform X2 [Eucalyptus 
grandis]
Length=167

 Score = 99.0 bits (245),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 53/91 (58%), Positives = 60/91 (66%), Gaps = 18/91 (20%)
 Frame = +3

Query  102  MSKKKVLVFLDVCIDGDPFERMVFE------------------LFTDVAPKTAENFRALC  227
            M+KK +LVF+DV IDGDP ERMVFE                  LF +VAPKTAENFRAL 
Sbjct  2    MTKKNLLVFMDVSIDGDPAERMVFEILHNPYLLISFLVNPIQQLFPEVAPKTAENFRALY  61

Query  228  TGEKGTSPKTGATLHYKGTFFHHIVKGSMAQ  320
            T EKG   KTG  LH KG+FFH I++GSMAQ
Sbjct  62   TEEKGIGQKTGRPLHLKGSFFHRIIRGSMAQ  92



>ref|XP_004493727.1| PREDICTED: peptidyl-prolyl cis-trans isomerase G-like isoform 
X1 [Cicer arietinum]
Length=665

 Score =   104 bits (260),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 47/70 (67%), Positives = 53/70 (76%), Gaps = 0/70 (0%)
 Frame = +3

Query  111  KKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTFF  290
            K   VFLDV +DGDP ER+V ELF+ + PKTAENFRALCTGEKG    TG  LHYKGT F
Sbjct  5    KNPCVFLDVSVDGDPVERIVIELFSSIVPKTAENFRALCTGEKGIGESTGKPLHYKGTCF  64

Query  291  HHIVKGSMAQ  320
            H ++KG MAQ
Sbjct  65   HRVIKGFMAQ  74



>ref|XP_008355416.1| PREDICTED: peptidyl-prolyl cis-trans isomerase cyp11-like [Malus 
domestica]
 ref|XP_008355417.1| PREDICTED: peptidyl-prolyl cis-trans isomerase cyp11-like [Malus 
domestica]
Length=595

 Score =   103 bits (258),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 51/74 (69%), Positives = 56/74 (76%), Gaps = 1/74 (1%)
 Frame = +3

Query  102  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  278
            MSKKK   VFLDV ID DP E++V ELF DV PKTAENFRALCTGEKG    TG  LHYK
Sbjct  1    MSKKKNPCVFLDVSIDRDPVEQIVIELFADVVPKTAENFRALCTGEKGIGKSTGKLLHYK  60

Query  279  GTFFHHIVKGSMAQ  320
            G+ FH ++KG MAQ
Sbjct  61   GSTFHRVIKGFMAQ  74



>ref|XP_008451290.1| PREDICTED: peptidyl-prolyl cis-trans isomerase 8 [Cucumis melo]
Length=669

 Score =   104 bits (259),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 50/74 (68%), Positives = 57/74 (77%), Gaps = 1/74 (1%)
 Frame = +3

Query  102  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  278
            MSKKK  LVFLDV I G+P +R++ ELF +V PKTA+NFRALCTGEKG    T   LHYK
Sbjct  1    MSKKKNPLVFLDVSIGGEPVQRIIIELFANVVPKTADNFRALCTGEKGIGKTTEKPLHYK  60

Query  279  GTFFHHIVKGSMAQ  320
            GTFFH I+KG MAQ
Sbjct  61   GTFFHRIIKGFMAQ  74



>ref|XP_004146961.1| PREDICTED: uncharacterized protein LOC101219904 [Cucumis sativus]
 gb|KGN44769.1| hypothetical protein Csa_7G378580 [Cucumis sativus]
Length=668

 Score =   103 bits (258),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 50/74 (68%), Positives = 57/74 (77%), Gaps = 1/74 (1%)
 Frame = +3

Query  102  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  278
            MSKKK  LVFLDV I G+P +R++ ELF +V PKTA+NFRALCTGEKG    T   LHYK
Sbjct  1    MSKKKNPLVFLDVSIGGEPVQRIIIELFANVVPKTADNFRALCTGEKGIGKTTEKPLHYK  60

Query  279  GTFFHHIVKGSMAQ  320
            GTFFH I+KG MAQ
Sbjct  61   GTFFHRIIKGFMAQ  74



>ref|XP_004162194.1| PREDICTED: uncharacterized LOC101219904 [Cucumis sativus]
Length=655

 Score =   103 bits (258),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 50/74 (68%), Positives = 57/74 (77%), Gaps = 1/74 (1%)
 Frame = +3

Query  102  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  278
            MSKKK  LVFLDV I G+P +R++ ELF +V PKTA+NFRALCTGEKG    T   LHYK
Sbjct  1    MSKKKNPLVFLDVSIGGEPVQRIIIELFANVVPKTADNFRALCTGEKGIGKTTEKPLHYK  60

Query  279  GTFFHHIVKGSMAQ  320
            GTFFH I+KG MAQ
Sbjct  61   GTFFHRIIKGFMAQ  74



>ref|XP_009601158.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 isoform 
X1 [Nicotiana tomentosiformis]
Length=662

 Score =   103 bits (258),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 46/71 (65%), Positives = 54/71 (76%), Gaps = 0/71 (0%)
 Frame = +3

Query  108  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  287
            KK  LVFLDV +DG+P ER+V ELF D+ P+TAENFR+LCTGEKG    TG  LHYKG  
Sbjct  4    KKNPLVFLDVSMDGNPAERIVIELFADIVPRTAENFRSLCTGEKGVGVSTGKPLHYKGCL  63

Query  288  FHHIVKGSMAQ  320
            FH ++KG MAQ
Sbjct  64   FHRVIKGFMAQ  74



>ref|XP_009601160.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 isoform 
X2 [Nicotiana tomentosiformis]
Length=661

 Score =   103 bits (258),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 46/71 (65%), Positives = 54/71 (76%), Gaps = 0/71 (0%)
 Frame = +3

Query  108  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  287
            KK  LVFLDV +DG+P ER+V ELF D+ P+TAENFR+LCTGEKG    TG  LHYKG  
Sbjct  4    KKNPLVFLDVSMDGNPAERIVIELFADIVPRTAENFRSLCTGEKGVGVSTGKPLHYKGCL  63

Query  288  FHHIVKGSMAQ  320
            FH ++KG MAQ
Sbjct  64   FHRVIKGFMAQ  74



>gb|KEH23833.1| peptidyl-prolyl cis-trans isomerase [Medicago truncatula]
Length=651

 Score =   103 bits (258),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 48/70 (69%), Positives = 52/70 (74%), Gaps = 0/70 (0%)
 Frame = +3

Query  111  KKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTFF  290
            K   VF DV +DGDP ER+V ELF+ V PKTAENFRALCTGEKG    TG  LHYKGT F
Sbjct  5    KNPCVFFDVSVDGDPVERIVIELFSSVVPKTAENFRALCTGEKGIGEATGKPLHYKGTSF  64

Query  291  HHIVKGSMAQ  320
            H I+KG MAQ
Sbjct  65   HRIIKGFMAQ  74



>ref|XP_010935780.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63-like [Elaeis 
guineensis]
Length=703

 Score =   103 bits (257),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 51/75 (68%), Positives = 58/75 (77%), Gaps = 1/75 (1%)
 Frame = +3

Query  99   KMSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHY  275
            KM+KKK  LVFLD+ IDG+  ER+V ELF+DV PKTAENFRALCTGEKG    TG +LHY
Sbjct  6    KMAKKKNPLVFLDISIDGNRAERIVIELFSDVVPKTAENFRALCTGEKGIGASTGKSLHY  65

Query  276  KGTFFHHIVKGSMAQ  320
            KG+ FH IVK   AQ
Sbjct  66   KGSIFHRIVKRFGAQ  80



>ref|XP_010914920.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like isoform 
X1 [Elaeis guineensis]
Length=836

 Score =   103 bits (256),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 47/70 (67%), Positives = 52/70 (74%), Gaps = 0/70 (0%)
 Frame = +3

Query  111  KKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTFF  290
            K+  VFLDV I G P  RMVFELF D+ PKTAENFRALCTGEKG    TG  LHY+G+ F
Sbjct  5    KRPTVFLDVAIGGRPSGRMVFELFADIVPKTAENFRALCTGEKGIGHTTGKPLHYRGSIF  64

Query  291  HHIVKGSMAQ  320
            H I+KG MAQ
Sbjct  65   HRIIKGFMAQ  74



>ref|XP_007162476.1| hypothetical protein PHAVU_001G155500g [Phaseolus vulgaris]
 ref|XP_007162477.1| hypothetical protein PHAVU_001G155500g [Phaseolus vulgaris]
 gb|ESW34470.1| hypothetical protein PHAVU_001G155500g [Phaseolus vulgaris]
 gb|ESW34471.1| hypothetical protein PHAVU_001G155500g [Phaseolus vulgaris]
Length=663

 Score =   102 bits (254),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 47/71 (66%), Positives = 52/71 (73%), Gaps = 0/71 (0%)
 Frame = +3

Query  108  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  287
            +K V VF DV ID DP ER+V +LF  + PKTAENFRALCTGEKG    TG  LHYKGT 
Sbjct  4    EKNVRVFFDVSIDADPVERIVIQLFDSIVPKTAENFRALCTGEKGIGESTGKPLHYKGTS  63

Query  288  FHHIVKGSMAQ  320
            FH I+KG MAQ
Sbjct  64   FHRIIKGFMAQ  74



>ref|XP_006604473.1| PREDICTED: peptidyl-prolyl cis-trans isomerase G-like isoform 
X5 [Glycine max]
Length=635

 Score =   102 bits (253),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 46/71 (65%), Positives = 53/71 (75%), Gaps = 0/71 (0%)
 Frame = +3

Query  108  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  287
            +K  LVF DV IDGDP ER+V +LF  + P+TAENFRALCTGEKG    TG  LHYKGT 
Sbjct  4    EKNPLVFFDVSIDGDPVERIVIQLFASIVPRTAENFRALCTGEKGIGELTGKPLHYKGTS  63

Query  288  FHHIVKGSMAQ  320
            FH I++G MAQ
Sbjct  64   FHRIIRGFMAQ  74



>ref|XP_006349731.1| PREDICTED: peptidyl-prolyl cis-trans isomerase G-like [Solanum 
tuberosum]
Length=658

 Score =   102 bits (253),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 55/74 (74%), Gaps = 1/74 (1%)
 Frame = +3

Query  102  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  278
            MSKKK  LVFLDV IDGD  E++V ELF D  P+TAENFR+LCTGEKG    TG  LHYK
Sbjct  1    MSKKKNPLVFLDVSIDGDTAEKIVIELFADTVPRTAENFRSLCTGEKGVGVSTGKPLHYK  60

Query  279  GTFFHHIVKGSMAQ  320
            G  FH ++KG MAQ
Sbjct  61   GCLFHRVIKGFMAQ  74



>ref|XP_011458604.1| PREDICTED: LOW QUALITY PROTEIN: peptidyl-prolyl cis-trans isomerase 
CYP63 [Fragaria vesca subsp. vesca]
Length=652

 Score =   102 bits (253),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 51/74 (69%), Positives = 55/74 (74%), Gaps = 1/74 (1%)
 Frame = +3

Query  102  MSKK-KVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  278
            MSKK    VFLDV I+  P ER+V ELF DVAPKTAENFRALCTGEKG    TG  LHYK
Sbjct  1    MSKKANPCVFLDVSINEAPTERIVIELFADVAPKTAENFRALCTGEKGIGKSTGKPLHYK  60

Query  279  GTFFHHIVKGSMAQ  320
            G+ FH I+KG MAQ
Sbjct  61   GSQFHRIIKGFMAQ  74



>ref|XP_006604472.1| PREDICTED: peptidyl-prolyl cis-trans isomerase G-like isoform 
X4 [Glycine max]
Length=640

 Score =   102 bits (253),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 46/71 (65%), Positives = 53/71 (75%), Gaps = 0/71 (0%)
 Frame = +3

Query  108  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  287
            +K  LVF DV IDGDP ER+V +LF  + P+TAENFRALCTGEKG    TG  LHYKGT 
Sbjct  4    EKNPLVFFDVSIDGDPVERIVIQLFASIVPRTAENFRALCTGEKGIGELTGKPLHYKGTS  63

Query  288  FHHIVKGSMAQ  320
            FH I++G MAQ
Sbjct  64   FHRIIRGFMAQ  74



>ref|XP_006604471.1| PREDICTED: peptidyl-prolyl cis-trans isomerase G-like isoform 
X3 [Glycine max]
 gb|KHN02546.1| Peptidyl-prolyl cis-trans isomerase [Glycine soja]
Length=659

 Score =   102 bits (253),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 46/71 (65%), Positives = 53/71 (75%), Gaps = 0/71 (0%)
 Frame = +3

Query  108  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  287
            +K  LVF DV IDGDP ER+V +LF  + P+TAENFRALCTGEKG    TG  LHYKGT 
Sbjct  4    EKNPLVFFDVSIDGDPVERIVIQLFASIVPRTAENFRALCTGEKGIGELTGKPLHYKGTS  63

Query  288  FHHIVKGSMAQ  320
            FH I++G MAQ
Sbjct  64   FHRIIRGFMAQ  74



>ref|XP_006604469.1| PREDICTED: peptidyl-prolyl cis-trans isomerase G-like isoform 
X1 [Glycine max]
 ref|XP_006604470.1| PREDICTED: peptidyl-prolyl cis-trans isomerase G-like isoform 
X2 [Glycine max]
Length=664

 Score =   102 bits (253),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 46/71 (65%), Positives = 53/71 (75%), Gaps = 0/71 (0%)
 Frame = +3

Query  108  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  287
            +K  LVF DV IDGDP ER+V +LF  + P+TAENFRALCTGEKG    TG  LHYKGT 
Sbjct  4    EKNPLVFFDVSIDGDPVERIVIQLFASIVPRTAENFRALCTGEKGIGELTGKPLHYKGTS  63

Query  288  FHHIVKGSMAQ  320
            FH I++G MAQ
Sbjct  64   FHRIIRGFMAQ  74



>ref|XP_008366534.1| PREDICTED: peptidyl-prolyl cis-trans isomerase cyp11-like isoform 
X2 [Malus domestica]
Length=533

 Score =   101 bits (251),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 50/74 (68%), Positives = 55/74 (74%), Gaps = 1/74 (1%)
 Frame = +3

Query  102  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  278
            MSKKK   VFLDV ID  P E++V ELF DV PKTAENFRALCTGEKG    TG  LHYK
Sbjct  1    MSKKKNPRVFLDVSIDRAPVEQIVIELFADVVPKTAENFRALCTGEKGIGKSTGKPLHYK  60

Query  279  GTFFHHIVKGSMAQ  320
            G+ FH ++KG MAQ
Sbjct  61   GSTFHRVIKGFMAQ  74



>ref|XP_008366532.1| PREDICTED: peptidyl-prolyl cis-trans isomerase cyp11-like isoform 
X1 [Malus domestica]
 ref|XP_008366533.1| PREDICTED: peptidyl-prolyl cis-trans isomerase cyp11-like isoform 
X1 [Malus domestica]
Length=534

 Score =   101 bits (251),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 50/74 (68%), Positives = 55/74 (74%), Gaps = 1/74 (1%)
 Frame = +3

Query  102  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  278
            MSKKK   VFLDV ID  P E++V ELF DV PKTAENFRALCTGEKG    TG  LHYK
Sbjct  1    MSKKKNPRVFLDVSIDRAPVEQIVIELFADVVPKTAENFRALCTGEKGIGKSTGKPLHYK  60

Query  279  GTFFHHIVKGSMAQ  320
            G+ FH ++KG MAQ
Sbjct  61   GSTFHRVIKGFMAQ  74



>ref|NP_850740.1| cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein 
[Arabidopsis thaliana]
 gb|AEE80476.1| cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein 
[Arabidopsis thaliana]
Length=387

 Score = 99.4 bits (246),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 46/71 (65%), Positives = 52/71 (73%), Gaps = 0/71 (0%)
 Frame = +3

Query  108  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  287
            KK   VFLDV I GDP +R+V ELF DV PKTAENFRALCTGE G    TG  LH+KG+ 
Sbjct  4    KKNPNVFLDVSIGGDPVQRIVIELFADVVPKTAENFRALCTGEAGVGKSTGKPLHFKGSS  63

Query  288  FHHIVKGSMAQ  320
            FH ++KG MAQ
Sbjct  64   FHRVIKGFMAQ  74



>ref|XP_009419289.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009419290.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like [Musa 
acuminata subsp. malaccensis]
Length=819

 Score =   102 bits (253),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 46/73 (63%), Positives = 55/73 (75%), Gaps = 0/73 (0%)
 Frame = +3

Query  102  MSKKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKG  281
            M+K+  +VFLDV IDG+   R++FELF D+ PKTAENFRALCTGE G  P T   LHYKG
Sbjct  1    MAKRNPIVFLDVAIDGNAAGRLMFELFADIVPKTAENFRALCTGEMGFGPMTKKPLHYKG  60

Query  282  TFFHHIVKGSMAQ  320
            + FH I+KG MAQ
Sbjct  61   SIFHRIIKGFMAQ  73



>ref|XP_004247203.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 isoform 
X1 [Solanum lycopersicum]
Length=660

 Score =   101 bits (252),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 48/74 (65%), Positives = 55/74 (74%), Gaps = 1/74 (1%)
 Frame = +3

Query  102  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  278
            MSKKK  LVFLDV +DGD  E++V ELF D  P+TAENFR+LCTGEKG    TG  LHYK
Sbjct  1    MSKKKNPLVFLDVSVDGDAAEKIVIELFADTVPRTAENFRSLCTGEKGVGVSTGKPLHYK  60

Query  279  GTFFHHIVKGSMAQ  320
            G  FH ++KG MAQ
Sbjct  61   GCLFHRVIKGFMAQ  74



>ref|XP_003603433.1| Peptidyl-prolyl cis-trans isomerase [Medicago truncatula]
Length=943

 Score =   102 bits (253),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 54/103 (52%), Positives = 62/103 (60%), Gaps = 30/103 (29%)
 Frame = +3

Query  102  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTG---------------  233
            M+KKK  LVF+DV IDGDP +RMVFELF DVAPKTAENFRALCTG               
Sbjct  4    MTKKKNPLVFMDVSIDGDPVKRMVFELFHDVAPKTAENFRALCTGILNFNLFADYSFLLS  63

Query  234  --------------EKGTSPKTGATLHYKGTFFHHIVKGSMAQ  320
                          E+G S  TG  LHYKG+FFH I+KGS+ +
Sbjct  64   KVAFSSIPVFYYPRERGISSNTGKLLHYKGSFFHQIMKGSIVK  106



>ref|XP_009381127.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like [Musa 
acuminata subsp. malaccensis]
Length=832

 Score =   101 bits (252),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 47/71 (66%), Positives = 51/71 (72%), Gaps = 0/71 (0%)
 Frame = +3

Query  108  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  287
            K   +VFLDV IDG    RMVFELF D+ PKTAENFRALCTGE G  P T   LHYKG+ 
Sbjct  4    KNNPIVFLDVAIDGKAAGRMVFELFADIVPKTAENFRALCTGEMGIGPTTKKPLHYKGSV  63

Query  288  FHHIVKGSMAQ  320
            FH I+KG MAQ
Sbjct  64   FHRIIKGFMAQ  74



>gb|AAS75310.1| multidomain cyclophilin type peptidyl-prolyl cis-trans isomerase 
[Arabidopsis thaliana]
Length=566

 Score = 99.8 bits (247),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 46/71 (65%), Positives = 52/71 (73%), Gaps = 0/71 (0%)
 Frame = +3

Query  108  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  287
            KK   VFLDV I GDP +R+V ELF DV PKTAENFRALCTGE G    TG  LH+KG+ 
Sbjct  4    KKNPNVFLDVSIGGDPVQRIVIELFADVVPKTAENFRALCTGEAGVGKSTGKPLHFKGSS  63

Query  288  FHHIVKGSMAQ  320
            FH ++KG MAQ
Sbjct  64   FHRVIKGFMAQ  74



>ref|NP_191899.1| cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein 
[Arabidopsis thaliana]
 ref|NP_001190169.1| cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein 
[Arabidopsis thaliana]
 sp|Q9LY75.1|CYP63_ARATH RecName: Full=Peptidyl-prolyl cis-trans isomerase CYP63; Short=AtCYP63; 
Short=PPIase CYP63; AltName: Full=Cyclophilin-63; 
AltName: Full=Cyclophilin-like protein CypRS64 [Arabidopsis 
thaliana]
 emb|CAB87793.1| cyclophylin-like protein [Arabidopsis thaliana]
 gb|AAN41315.1| putative cyclophylin protein [Arabidopsis thaliana]
 gb|AEE80475.1| cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein 
[Arabidopsis thaliana]
 gb|AEE80477.1| cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein 
[Arabidopsis thaliana]
Length=570

 Score = 99.8 bits (247),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 46/71 (65%), Positives = 52/71 (73%), Gaps = 0/71 (0%)
 Frame = +3

Query  108  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  287
            KK   VFLDV I GDP +R+V ELF DV PKTAENFRALCTGE G    TG  LH+KG+ 
Sbjct  4    KKNPNVFLDVSIGGDPVQRIVIELFADVVPKTAENFRALCTGEAGVGKSTGKPLHFKGSS  63

Query  288  FHHIVKGSMAQ  320
            FH ++KG MAQ
Sbjct  64   FHRVIKGFMAQ  74



>ref|XP_009399354.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=694

 Score =   100 bits (249),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 47/72 (65%), Positives = 53/72 (74%), Gaps = 0/72 (0%)
 Frame = +3

Query  105  SKKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGT  284
            +KK   VFLD+ +D +P ERM  ELF DV PKTAENFRALCTGEKG    T   LHYKG+
Sbjct  3    TKKNPTVFLDISVDRNPAERMEIELFADVVPKTAENFRALCTGEKGIGDSTRLPLHYKGS  62

Query  285  FFHHIVKGSMAQ  320
            FFH IVKG +AQ
Sbjct  63   FFHRIVKGFVAQ  74



>dbj|BAH57223.1| AT3G63400 [Arabidopsis thaliana]
Length=570

 Score = 99.8 bits (247),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 46/71 (65%), Positives = 52/71 (73%), Gaps = 0/71 (0%)
 Frame = +3

Query  108  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  287
            KK   VFLDV I GDP +R+V ELF DV PKTAENFRALCTGE G    TG  LH+KG+ 
Sbjct  4    KKNPNVFLDVSIGGDPVQRIVIELFADVVPKTAENFRALCTGEAGVGKSTGKPLHFKGSS  63

Query  288  FHHIVKGSMAQ  320
            FH ++KG MAQ
Sbjct  64   FHRVIKGFMAQ  74



>ref|XP_009399355.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=691

 Score =   100 bits (249),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 47/72 (65%), Positives = 53/72 (74%), Gaps = 0/72 (0%)
 Frame = +3

Query  105  SKKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGT  284
            +KK   VFLD+ +D +P ERM  ELF DV PKTAENFRALCTGEKG    T   LHYKG+
Sbjct  3    TKKNPTVFLDISVDRNPAERMEIELFADVVPKTAENFRALCTGEKGIGDSTRLPLHYKGS  62

Query  285  FFHHIVKGSMAQ  320
            FFH IVKG +AQ
Sbjct  63   FFHRIVKGFVAQ  74



>ref|XP_010679140.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 isoform 
X3 [Beta vulgaris subsp. vulgaris]
Length=658

 Score =   100 bits (248),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 50/74 (68%), Positives = 54/74 (73%), Gaps = 1/74 (1%)
 Frame = +3

Query  102  MSKKKVL-VFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  278
            MSKKK   VFLDV I GDP +R+V ELF DV PKTAENFR LCTG KG    TG  LH+K
Sbjct  1    MSKKKNPHVFLDVSIGGDPVQRIVIELFADVVPKTAENFRVLCTGGKGVGATTGKPLHFK  60

Query  279  GTFFHHIVKGSMAQ  320
            GT FH I+KG MAQ
Sbjct  61   GTNFHRIIKGFMAQ  74



>ref|XP_010679138.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=659

 Score =   100 bits (248),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 50/74 (68%), Positives = 54/74 (73%), Gaps = 1/74 (1%)
 Frame = +3

Query  102  MSKKKVL-VFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  278
            MSKKK   VFLDV I GDP +R+V ELF DV PKTAENFR LCTG KG    TG  LH+K
Sbjct  1    MSKKKNPHVFLDVSIGGDPVQRIVIELFADVVPKTAENFRVLCTGGKGVGATTGKPLHFK  60

Query  279  GTFFHHIVKGSMAQ  320
            GT FH I+KG MAQ
Sbjct  61   GTNFHRIIKGFMAQ  74



>ref|XP_010679137.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=661

 Score =   100 bits (248),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 50/74 (68%), Positives = 54/74 (73%), Gaps = 1/74 (1%)
 Frame = +3

Query  102  MSKKKVL-VFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  278
            MSKKK   VFLDV I GDP +R+V ELF DV PKTAENFR LCTG KG    TG  LH+K
Sbjct  1    MSKKKNPHVFLDVSIGGDPVQRIVIELFADVVPKTAENFRVLCTGGKGVGATTGKPLHFK  60

Query  279  GTFFHHIVKGSMAQ  320
            GT FH I+KG MAQ
Sbjct  61   GTNFHRIIKGFMAQ  74



>ref|XP_011079927.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 [Sesamum 
indicum]
Length=696

 Score = 99.8 bits (247),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 48/72 (67%), Positives = 52/72 (72%), Gaps = 0/72 (0%)
 Frame = +3

Query  105  SKKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGT  284
            S K   VFLDV ID D  +R+V ELF DV PKTAENFRALCTGEKG    TG  LHYKG+
Sbjct  3    STKNPSVFLDVSIDSDTTQRIVIELFADVVPKTAENFRALCTGEKGVGSLTGKPLHYKGS  62

Query  285  FFHHIVKGSMAQ  320
             FH I+KG MAQ
Sbjct  63   TFHRIIKGFMAQ  74



>ref|XP_011026088.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63-like [Populus 
euphratica]
Length=694

 Score = 99.8 bits (247),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 51/74 (69%), Positives = 53/74 (72%), Gaps = 1/74 (1%)
 Frame = +3

Query  102  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  278
            MSKKK  LVFLDV IDGDP   +  ELF DV PKTAENFRALCTGEKG    TG  L YK
Sbjct  1    MSKKKNPLVFLDVSIDGDPAASIFIELFADVVPKTAENFRALCTGEKGIGKTTGKPLRYK  60

Query  279  GTFFHHIVKGSMAQ  320
            G  FH I+KG MAQ
Sbjct  61   GCSFHRIIKGFMAQ  74



>ref|XP_003521263.1| PREDICTED: peptidyl-prolyl cis-trans isomerase G-like [Glycine 
max]
Length=668

 Score = 99.0 bits (245),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 44/71 (62%), Positives = 51/71 (72%), Gaps = 0/71 (0%)
 Frame = +3

Query  108  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  287
            +K   VF DV IDGDP ER+V +LF  + P+TAENFRALCTGEKG    TG  LHYKGT 
Sbjct  4    EKNPRVFFDVSIDGDPVERIVIQLFASIVPRTAENFRALCTGEKGIGESTGKPLHYKGTS  63

Query  288  FHHIVKGSMAQ  320
             H I++G MAQ
Sbjct  64   LHRIIRGFMAQ  74



>gb|KHN10697.1| Peptidyl-prolyl cis-trans isomerase [Glycine soja]
Length=727

 Score = 99.4 bits (246),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 47/81 (58%), Positives = 55/81 (68%), Gaps = 5/81 (6%)
 Frame = +3

Query  93   ICKMSK-----KKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKT  257
            +C +SK     K   VF DV IDGDP ER+V +LF  + P+TAENFRALCTGEKG    T
Sbjct  53   MCLLSKVMGLEKNPRVFFDVSIDGDPVERIVIQLFASIVPRTAENFRALCTGEKGIGEST  112

Query  258  GATLHYKGTFFHHIVKGSMAQ  320
            G  LHYKGT  H I++G MAQ
Sbjct  113  GKPLHYKGTSLHRIIRGFMAQ  133



>ref|XP_006647052.1| PREDICTED: peptidyl-prolyl cis-trans isomerase G-like isoform 
X1 [Oryza brachyantha]
Length=847

 Score = 99.4 bits (246),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 46/74 (62%), Positives = 56/74 (76%), Gaps = 1/74 (1%)
 Frame = +3

Query  102  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  278
            M+KKK  +VF+DV I  +P ERM+FELF DVAP+TAENFRALCTGE G    T   L+YK
Sbjct  1    MAKKKNPIVFMDVAIGDEPDERMIFELFADVAPRTAENFRALCTGEMGIGQTTKKPLYYK  60

Query  279  GTFFHHIVKGSMAQ  320
            G+ FH ++KG MAQ
Sbjct  61   GSLFHRVIKGFMAQ  74



>ref|XP_006647053.1| PREDICTED: peptidyl-prolyl cis-trans isomerase G-like isoform 
X2 [Oryza brachyantha]
Length=845

 Score = 99.4 bits (246),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 46/74 (62%), Positives = 56/74 (76%), Gaps = 1/74 (1%)
 Frame = +3

Query  102  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  278
            M+KKK  +VF+DV I  +P ERM+FELF DVAP+TAENFRALCTGE G    T   L+YK
Sbjct  1    MAKKKNPIVFMDVAIGDEPDERMIFELFADVAPRTAENFRALCTGEMGIGQTTKKPLYYK  60

Query  279  GTFFHHIVKGSMAQ  320
            G+ FH ++KG MAQ
Sbjct  61   GSLFHRVIKGFMAQ  74



>gb|EYU46533.1| hypothetical protein MIMGU_mgv1a002319mg [Erythranthe guttata]
Length=688

 Score = 98.6 bits (244),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 47/70 (67%), Positives = 51/70 (73%), Gaps = 0/70 (0%)
 Frame = +3

Query  111  KKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTFF  290
            K  LVFL+V I+GD  ER+V ELF D  PKTAENFRALCTGEKG    TG  LHYKG  F
Sbjct  5    KNPLVFLEVSIEGDTAERIVIELFADTVPKTAENFRALCTGEKGVGTSTGKPLHYKGCTF  64

Query  291  HHIVKGSMAQ  320
            H I+KG MAQ
Sbjct  65   HRIIKGFMAQ  74



>emb|CDX93909.1| BnaC04g20680D [Brassica napus]
Length=612

 Score = 98.6 bits (244),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 46/71 (65%), Positives = 51/71 (72%), Gaps = 0/71 (0%)
 Frame = +3

Query  108  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  287
            KK   VFLDV I GDP ER+V ELF  V PKTAENFRALCTGE G    TG  LH+KG+ 
Sbjct  80   KKNPTVFLDVSIGGDPLERIVIELFAHVVPKTAENFRALCTGEAGLGKTTGKPLHFKGSS  139

Query  288  FHHIVKGSMAQ  320
            FH ++KG MAQ
Sbjct  140  FHRVIKGFMAQ  150



>ref|XP_006402278.1| hypothetical protein EUTSA_v10006033mg [Eutrema salsugineum]
 ref|XP_006402279.1| hypothetical protein EUTSA_v10006033mg [Eutrema salsugineum]
 gb|ESQ43731.1| hypothetical protein EUTSA_v10006033mg [Eutrema salsugineum]
 gb|ESQ43732.1| hypothetical protein EUTSA_v10006033mg [Eutrema salsugineum]
Length=384

 Score = 95.9 bits (237),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 47/74 (64%), Positives = 53/74 (72%), Gaps = 1/74 (1%)
 Frame = +3

Query  102  MSKKKVL-VFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  278
            MSKK    VFLDV + GDP ER+V ELF DV PKTAENFRALCTGE G    TG  L +K
Sbjct  1    MSKKNNPNVFLDVSLGGDPVERIVIELFADVVPKTAENFRALCTGEAGIGKTTGKPLQFK  60

Query  279  GTFFHHIVKGSMAQ  320
            G+ FH ++KG MAQ
Sbjct  61   GSSFHRVIKGFMAQ  74



>ref|XP_009388658.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009388659.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009388660.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like [Musa 
acuminata subsp. malaccensis]
Length=814

 Score = 98.6 bits (244),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 46/71 (65%), Positives = 52/71 (73%), Gaps = 0/71 (0%)
 Frame = +3

Query  108  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  287
            KK  +VFLDV +DG+   RMVFELF D+ PKTAENFRALCTGE G    T   LHYKG+ 
Sbjct  6    KKNPIVFLDVSVDGNAARRMVFELFADIVPKTAENFRALCTGEIGFGLMTRKPLHYKGSI  65

Query  288  FHHIVKGSMAQ  320
            FH I+KG MAQ
Sbjct  66   FHRIIKGFMAQ  76



>gb|EEC72707.1| hypothetical protein OsI_06299 [Oryza sativa Indica Group]
Length=787

 Score = 98.2 bits (243),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 44/71 (62%), Positives = 53/71 (75%), Gaps = 0/71 (0%)
 Frame = +3

Query  108  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  287
            KK  +VF+DV I  +P ERMVFELF DVAP+TAENFRALCTGE G    +   L+YKG+ 
Sbjct  4    KKNPIVFMDVSIGDEPDERMVFELFADVAPRTAENFRALCTGEMGIGQTSKKPLYYKGSL  63

Query  288  FHHIVKGSMAQ  320
            FH ++KG MAQ
Sbjct  64   FHRVIKGFMAQ  74



>ref|XP_006290850.1| hypothetical protein CARUB_v10016960mg [Capsella rubella]
 gb|EOA23748.1| hypothetical protein CARUB_v10016960mg [Capsella rubella]
Length=551

 Score = 97.4 bits (241),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 46/71 (65%), Positives = 51/71 (72%), Gaps = 0/71 (0%)
 Frame = +3

Query  108  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  287
            KK   VFLDV I GDP ER+V ELF DV PKTAENFRALCTGE G    T   LH+KG+ 
Sbjct  4    KKNPHVFLDVSIGGDPVERIVIELFADVVPKTAENFRALCTGEAGVGKTTTKPLHFKGSS  63

Query  288  FHHIVKGSMAQ  320
            FH ++KG MAQ
Sbjct  64   FHRVIKGFMAQ  74



>ref|XP_002876720.1| hypothetical protein ARALYDRAFT_324764 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52979.1| hypothetical protein ARALYDRAFT_324764 [Arabidopsis lyrata subsp. 
lyrata]
Length=543

 Score = 97.1 bits (240),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 48/74 (65%), Positives = 54/74 (73%), Gaps = 1/74 (1%)
 Frame = +3

Query  102  MSKKKVL-VFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  278
            MSKKK   VFLDV I GDP +R+V ELF DV PKTAENFRALCTGE G    T   LH+K
Sbjct  1    MSKKKNPNVFLDVSIGGDPVQRIVIELFADVVPKTAENFRALCTGEAGVGKTTRKPLHFK  60

Query  279  GTFFHHIVKGSMAQ  320
            G+ FH ++KG MAQ
Sbjct  61   GSSFHRVIKGFMAQ  74



>gb|EEE56526.1| hypothetical protein OsJ_05815 [Oryza sativa Japonica Group]
Length=670

 Score = 97.4 bits (241),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 44/71 (62%), Positives = 53/71 (75%), Gaps = 0/71 (0%)
 Frame = +3

Query  108  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  287
            KK  +VF+DV I  +P ERMVFELF DVAP+TAENFRALCTGE G    +   L+YKG+ 
Sbjct  4    KKNPIVFMDVSIGDEPDERMVFELFADVAPRTAENFRALCTGEMGIGQTSKKPLYYKGSL  63

Query  288  FHHIVKGSMAQ  320
            FH ++KG MAQ
Sbjct  64   FHRVIKGFMAQ  74



>gb|EPS61145.1| hypothetical protein M569_13654 [Genlisea aurea]
Length=565

 Score = 96.7 bits (239),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 44/70 (63%), Positives = 50/70 (71%), Gaps = 0/70 (0%)
 Frame = +3

Query  111  KKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTFF  290
            K   VFLD+ +DG+  ER+V ELF D  PKTAENFRALCTGEKG    TG  LHYKG  F
Sbjct  5    KNPFVFLDISVDGNAAERIVIELFADAVPKTAENFRALCTGEKGVGVSTGKPLHYKGITF  64

Query  291  HHIVKGSMAQ  320
            H I++G MAQ
Sbjct  65   HRIIRGFMAQ  74



>ref|XP_010268554.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP40 [Nelumbo 
nucifera]
Length=361

 Score = 94.4 bits (233),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 45/65 (69%), Positives = 49/65 (75%), Gaps = 0/65 (0%)
 Frame = +3

Query  126  FLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTFFHHIVK  305
            FLDV I G+   R+V EL+ DV PKTAENFRALCTGEKG  PKTGA LHYKG  FH I+K
Sbjct  7    FLDVSIGGELEGRIVVELYKDVVPKTAENFRALCTGEKGIGPKTGAPLHYKGVRFHRIIK  66

Query  306  GSMAQ  320
            G M Q
Sbjct  67   GFMIQ  71



>ref|XP_010234012.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X4 [Brachypodium distachyon]
Length=829

 Score = 97.1 bits (240),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 48/74 (65%), Positives = 54/74 (73%), Gaps = 1/74 (1%)
 Frame = +3

Query  102  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  278
            MSKKK  +VFLDV I   P ERM+FELF DVAP TAENFRALCTGE G    T   L+YK
Sbjct  1    MSKKKNPIVFLDVSIGDGPDERMIFELFADVAPLTAENFRALCTGEMGIGQTTKKPLYYK  60

Query  279  GTFFHHIVKGSMAQ  320
            G+ FH ++KG MAQ
Sbjct  61   GSIFHRVIKGFMAQ  74



>ref|XP_010234009.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X1 [Brachypodium distachyon]
Length=834

 Score = 97.1 bits (240),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 48/74 (65%), Positives = 54/74 (73%), Gaps = 1/74 (1%)
 Frame = +3

Query  102  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  278
            MSKKK  +VFLDV I   P ERM+FELF DVAP TAENFRALCTGE G    T   L+YK
Sbjct  1    MSKKKNPIVFLDVSIGDGPDERMIFELFADVAPLTAENFRALCTGEMGIGQTTKKPLYYK  60

Query  279  GTFFHHIVKGSMAQ  320
            G+ FH ++KG MAQ
Sbjct  61   GSIFHRVIKGFMAQ  74



>ref|XP_010234010.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X2 [Brachypodium distachyon]
Length=831

 Score = 97.1 bits (240),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 48/74 (65%), Positives = 54/74 (73%), Gaps = 1/74 (1%)
 Frame = +3

Query  102  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  278
            MSKKK  +VFLDV I   P ERM+FELF DVAP TAENFRALCTGE G    T   L+YK
Sbjct  1    MSKKKNPIVFLDVSIGDGPDERMIFELFADVAPLTAENFRALCTGEMGIGQTTKKPLYYK  60

Query  279  GTFFHHIVKGSMAQ  320
            G+ FH ++KG MAQ
Sbjct  61   GSIFHRVIKGFMAQ  74



>ref|XP_010234011.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X3 [Brachypodium distachyon]
Length=830

 Score = 97.1 bits (240),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 48/74 (65%), Positives = 54/74 (73%), Gaps = 1/74 (1%)
 Frame = +3

Query  102  MSKKK-VLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYK  278
            MSKKK  +VFLDV I   P ERM+FELF DVAP TAENFRALCTGE G    T   L+YK
Sbjct  1    MSKKKNPIVFLDVSIGDGPDERMIFELFADVAPLTAENFRALCTGEMGIGQTTKKPLYYK  60

Query  279  GTFFHHIVKGSMAQ  320
            G+ FH ++KG MAQ
Sbjct  61   GSIFHRVIKGFMAQ  74



>ref|XP_456922.1| DEHA2A13640p [Debaryomyces hansenii CBS767]
 sp|Q6BXZ7.1|PPID_DEBHA RecName: Full=Peptidyl-prolyl cis-trans isomerase D; Short=PPIase 
D; AltName: Full=Rotamase D [Debaryomyces hansenii CBS767]
 emb|CAG84900.1| DEHA2A13640p [Debaryomyces hansenii CBS767]
Length=370

 Score = 94.4 bits (233),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 42/66 (64%), Positives = 48/66 (73%), Gaps = 0/66 (0%)
 Frame = +3

Query  123  VFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTFFHHIV  302
            VF D+  DG P  R+VFEL+ DV PKTAENFRALCTGEKG S  +G  LHYKG+ FH I+
Sbjct  10   VFFDISADGKPKGRVVFELYNDVVPKTAENFRALCTGEKGASESSGKQLHYKGSIFHRII  69

Query  303  KGSMAQ  320
            K  M Q
Sbjct  70   KDFMCQ  75



>gb|EYU44370.1| hypothetical protein MIMGU_mgv1a0089282mg, partial [Erythranthe 
guttata]
Length=268

 Score = 93.2 bits (230),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 39/65 (60%), Positives = 52/65 (80%), Gaps = 0/65 (0%)
 Frame = +3

Query  126  FLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTFFHHIVK  305
            +LD+ IDG+   R+V EL++DV P+TAENFRALCTGEKG SP++G  LHYKG+ F+ I++
Sbjct  7    YLDISIDGEMEGRIVVELYSDVVPRTAENFRALCTGEKGISPRSGVPLHYKGSHFNSIIR  66

Query  306  GSMAQ  320
            G M Q
Sbjct  67   GLMVQ  71



>ref|XP_010468852.1| PREDICTED: LOW QUALITY PROTEIN: peptidyl-prolyl cis-trans isomerase 
CYP63-like [Camelina sativa]
Length=591

 Score = 95.5 bits (236),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 45/71 (63%), Positives = 50/71 (70%), Gaps = 0/71 (0%)
 Frame = +3

Query  108  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  287
            KK   VFLDV I  DP ER+V ELF DV PKTAENFRALCTGE G    T   LH+KG+ 
Sbjct  4    KKNPFVFLDVSIGEDPVERIVIELFADVVPKTAENFRALCTGEAGVGKTTAKPLHFKGSS  63

Query  288  FHHIVKGSMAQ  320
            FH ++KG MAQ
Sbjct  64   FHRVIKGFMAQ  74



>ref|XP_010028504.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP40 [Eucalyptus 
grandis]
 gb|KCW55241.1| hypothetical protein EUGRSUZ_I01174 [Eucalyptus grandis]
 gb|KCW55242.1| hypothetical protein EUGRSUZ_I01174 [Eucalyptus grandis]
Length=361

 Score = 93.2 bits (230),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 50/65 (77%), Gaps = 0/65 (0%)
 Frame = +3

Query  126  FLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTFFHHIVK  305
            F+D+ I G+   R+V EL+TDVAPKTAENFRALCTGEKG  P TGA LHYKG  FH ++K
Sbjct  7    FMDISIGGELEGRIVGELYTDVAPKTAENFRALCTGEKGIGPHTGAPLHYKGVRFHRVIK  66

Query  306  GSMAQ  320
            G M Q
Sbjct  67   GFMVQ  71



>ref|XP_009138664.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 [Brassica 
rapa]
Length=556

 Score = 94.7 bits (234),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 51/76 (67%), Gaps = 0/76 (0%)
 Frame = +3

Query  93   ICKMSKKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLH  272
            +    KK   VFLDV I GDP ER+V ELF  + PKTAENFRALCTGE G    T   LH
Sbjct  1    MSSSKKKNPTVFLDVSIGGDPLERIVIELFAHLVPKTAENFRALCTGEAGLGKTTSKPLH  60

Query  273  YKGTFFHHIVKGSMAQ  320
            +KG+ FH ++KG MAQ
Sbjct  61   FKGSSFHRVIKGFMAQ  76



>emb|CDY53714.1| BnaAnng12550D [Brassica napus]
Length=556

 Score = 94.7 bits (234),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 51/76 (67%), Gaps = 0/76 (0%)
 Frame = +3

Query  93   ICKMSKKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLH  272
            +    KK   VFLDV I GDP ER+V ELF  + PKTAENFRALCTGE G    T   LH
Sbjct  1    MSSSKKKNPTVFLDVSIGGDPLERIVIELFAHLVPKTAENFRALCTGEAGLGKTTSKPLH  60

Query  273  YKGTFFHHIVKGSMAQ  320
            +KG+ FH ++KG MAQ
Sbjct  61   FKGSSFHRVIKGFMAQ  76



>ref|XP_010512756.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63-like [Camelina 
sativa]
Length=658

 Score = 95.1 bits (235),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 51/76 (67%), Gaps = 0/76 (0%)
 Frame = +3

Query  93   ICKMSKKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLH  272
            +     K  LVFLDV I  DP +R+V ELF DV PKTAENFRALCTGE G    T   LH
Sbjct  73   VAMTKNKNPLVFLDVSIGEDPVQRIVIELFADVVPKTAENFRALCTGEAGVGKTTAKPLH  132

Query  273  YKGTFFHHIVKGSMAQ  320
            +KG+ FH ++KG MAQ
Sbjct  133  FKGSSFHRVIKGFMAQ  148



>ref|XP_008681078.1| PREDICTED: uncharacterized protein LOC100192934 isoform X1 [Zea 
mays]
 gb|AFW70621.1| hypothetical protein ZEAMMB73_258859 [Zea mays]
Length=832

 Score = 95.5 bits (236),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 45/71 (63%), Positives = 51/71 (72%), Gaps = 0/71 (0%)
 Frame = +3

Query  108  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  287
            KK  +VFLDV +  +P ERM+FELF DVAP T ENFRALCTGE G   KT   L YKGT 
Sbjct  4    KKNPIVFLDVSVGDEPDERMIFELFADVAPLTTENFRALCTGELGIGQKTKKPLCYKGTL  63

Query  288  FHHIVKGSMAQ  320
            FH ++KG MAQ
Sbjct  64   FHRVIKGFMAQ  74



>ref|XP_010999957.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP40 isoform 
X1 [Populus euphratica]
Length=370

 Score = 92.8 bits (229),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 50/70 (71%), Gaps = 0/70 (0%)
 Frame = +3

Query  111  KKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTFF  290
            ++   FLD+ I G+   R+V EL+ DV PKTAENFRALCTGEKG  P TGA LHYKG  F
Sbjct  2    RRSRCFLDISIGGELEGRIVIELYNDVVPKTAENFRALCTGEKGVGPNTGAPLHYKGCCF  61

Query  291  HHIVKGSMAQ  320
            H ++KG M Q
Sbjct  62   HRVIKGFMVQ  71



>ref|XP_008681079.1| PREDICTED: uncharacterized protein LOC100192934 isoform X2 [Zea 
mays]
 gb|AFW70622.1| hypothetical protein ZEAMMB73_258859 [Zea mays]
Length=829

 Score = 95.1 bits (235),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 45/71 (63%), Positives = 51/71 (72%), Gaps = 0/71 (0%)
 Frame = +3

Query  108  KKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTF  287
            KK  +VFLDV +  +P ERM+FELF DVAP T ENFRALCTGE G   KT   L YKGT 
Sbjct  4    KKNPIVFLDVSVGDEPDERMIFELFADVAPLTTENFRALCTGELGIGQKTKKPLCYKGTL  63

Query  288  FHHIVKGSMAQ  320
            FH ++KG MAQ
Sbjct  64   FHRVIKGFMAQ  74



>ref|XP_008454916.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP40-like isoform 
X2 [Cucumis melo]
Length=269

 Score = 91.7 bits (226),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 42/69 (61%), Positives = 50/69 (72%), Gaps = 0/69 (0%)
 Frame = +3

Query  114  KVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTFFH  293
            ++  FLD+ I GD   R+V ELF DV PKTAENFRALCTGEKG  P TG  LH+KG+ FH
Sbjct  3    RIRCFLDISIGGDLEGRIVVELFEDVVPKTAENFRALCTGEKGIGPHTGVPLHFKGSCFH  62

Query  294  HIVKGSMAQ  320
             ++KG M Q
Sbjct  63   RVIKGFMVQ  71



>gb|EWM22369.1| Cyclophilin-like peptidyl-prolyl cis-trans isomerase domain protein 
[Nannochloropsis gaditana]
Length=530

 Score = 94.0 bits (232),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 43/72 (60%), Positives = 54/72 (75%), Gaps = 0/72 (0%)
 Frame = +3

Query  105  SKKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGT  284
            +KK V V++D+ I      RMVFELFT+  P+TAENFRALCTGE+G SP +G  LHYKG+
Sbjct  66   TKKSVQVYMDIKIGPRFAGRMVFELFTEQTPRTAENFRALCTGERGISPLSGHPLHYKGS  125

Query  285  FFHHIVKGSMAQ  320
             FH ++KG MAQ
Sbjct  126  IFHRVIKGFMAQ  137



>gb|KJB17878.1| hypothetical protein B456_003G021400 [Gossypium raimondii]
 gb|KJB17879.1| hypothetical protein B456_003G021400 [Gossypium raimondii]
Length=361

 Score = 92.0 bits (227),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 39/65 (60%), Positives = 49/65 (75%), Gaps = 0/65 (0%)
 Frame = +3

Query  126  FLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTFFHHIVK  305
            ++D+ I G+P  R+V EL+ D+ PKTAENFRALCTGEKG  P TGA+LHYK   FH I++
Sbjct  7    YMDISIGGEPEGRVVIELYKDIVPKTAENFRALCTGEKGIGPNTGASLHYKDVRFHRIIR  66

Query  306  GSMAQ  320
            G M Q
Sbjct  67   GFMIQ  71



>ref|XP_010104462.1| Peptidyl-prolyl cis-trans isomerase [Morus notabilis]
 gb|EXC00995.1| Peptidyl-prolyl cis-trans isomerase [Morus notabilis]
Length=145

 Score = 88.6 bits (218),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 43/73 (59%), Positives = 52/73 (71%), Gaps = 3/73 (4%)
 Frame = +3

Query  102  MSKKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKG  281
            MSK KV  F D+ I G P  R+V EL+ D+ P+TAENFRALCTGEKGT  ++G  LHYKG
Sbjct  1    MSKSKV--FFDIAIGGSPAGRIVMELYADMTPRTAENFRALCTGEKGTG-RSGKPLHYKG  57

Query  282  TFFHHIVKGSMAQ  320
            + FH I+ G M Q
Sbjct  58   STFHRIIPGFMCQ  70



>ref|XP_001651471.1| AAEL005799-PA, partial [Aedes aegypti]
 gb|EAT42690.1| AAEL005799-PA, partial [Aedes aegypti]
Length=218

 Score = 90.5 bits (223),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 49/70 (70%), Gaps = 0/70 (0%)
 Frame = +3

Query  111  KKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTFF  290
             K+  F D+ + G P  R+VFELF D+APKT ENFR+LCTGEKGT  KTG  LHYKG  F
Sbjct  14   NKIRCFFDITLGGLPAGRIVFELFPDIAPKTCENFRSLCTGEKGTGQKTGKPLHYKGIIF  73

Query  291  HHIVKGSMAQ  320
            H +VK  M Q
Sbjct  74   HRVVKDFMIQ  83



>gb|AIZ68177.1| peptidyl-prolyl cis-trans isomerase CYP40-like protein [Ornithogalum 
saundersiae]
Length=367

 Score = 92.0 bits (227),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 48/65 (74%), Gaps = 0/65 (0%)
 Frame = +3

Query  126  FLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTFFHHIVK  305
            +LD+ I G+   R+V EL+ DV PKTAENFRALCTGEKGT P TGA LHYKG  FH I K
Sbjct  13   YLDISIGGELDGRIVVELYADVVPKTAENFRALCTGEKGTGPTTGAPLHYKGVRFHRITK  72

Query  306  GSMAQ  320
            G M Q
Sbjct  73   GFMIQ  77



>emb|CDK25020.1| unnamed protein product [Kuraishia capsulata CBS 1993]
Length=363

 Score = 92.0 bits (227),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 43/73 (59%), Positives = 53/73 (73%), Gaps = 1/73 (1%)
 Frame = +3

Query  102  MSKKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKG  281
            MS+ +  VF DV I G+P  R+VFELF DV PKTAENFRALCTGEKG   ++G  LHYKG
Sbjct  1    MSEVRPRVFFDVSIGGEPTRRIVFELFADVVPKTAENFRALCTGEKGVG-QSGKPLHYKG  59

Query  282  TFFHHIVKGSMAQ  320
            + FH +++  M Q
Sbjct  60   SIFHRVIESFMCQ  72



>ref|XP_010104463.1| Peptidyl-prolyl cis-trans isomerase [Morus notabilis]
 gb|EXC00996.1| Peptidyl-prolyl cis-trans isomerase [Morus notabilis]
Length=172

 Score = 89.4 bits (220),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 44/73 (60%), Positives = 52/73 (71%), Gaps = 3/73 (4%)
 Frame = +3

Query  102  MSKKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKG  281
            MSK KV  F D+ I G P  R+V EL+ DV P+TAENFRALCTGEKGT  ++G  LHYKG
Sbjct  1    MSKSKV--FFDIAIGGSPAGRIVMELYADVTPRTAENFRALCTGEKGTG-RSGKPLHYKG  57

Query  282  TFFHHIVKGSMAQ  320
            + FH I+ G M Q
Sbjct  58   STFHRIIPGFMCQ  70



>ref|XP_008454915.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP40-like isoform 
X1 [Cucumis melo]
Length=361

 Score = 91.7 bits (226),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 42/69 (61%), Positives = 50/69 (72%), Gaps = 0/69 (0%)
 Frame = +3

Query  114  KVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTFFH  293
            ++  FLD+ I GD   R+V ELF DV PKTAENFRALCTGEKG  P TG  LH+KG+ FH
Sbjct  3    RIRCFLDISIGGDLEGRIVVELFEDVVPKTAENFRALCTGEKGIGPHTGVPLHFKGSCFH  62

Query  294  HIVKGSMAQ  320
             ++KG M Q
Sbjct  63   RVIKGFMVQ  71



>gb|EDM00869.1| rCG62684, isoform CRA_b [Rattus norvegicus]
Length=116

 Score = 87.8 bits (216),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 43/72 (60%), Positives = 49/72 (68%), Gaps = 0/72 (0%)
 Frame = +3

Query  105  SKKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGT  284
            + K   VF DV I G+   R+V ELF D+ PKTAENFRALCTGEKGT P TG  LH+KG 
Sbjct  12   NSKNPRVFFDVDIGGERVGRIVLELFADIVPKTAENFRALCTGEKGTGPTTGKPLHFKGC  71

Query  285  FFHHIVKGSMAQ  320
             FH I+K  M Q
Sbjct  72   PFHRIIKKFMIQ  83



>ref|NP_001232291.1| putative peptidylprolyl isomerase D [Taeniopygia guttata]
 gb|ACH46307.1| putative peptidylprolyl isomerase D [Taeniopygia guttata]
Length=206

 Score = 89.7 bits (221),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 44/66 (67%), Positives = 47/66 (71%), Gaps = 0/66 (0%)
 Frame = +3

Query  123  VFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTFFHHIV  302
             F DV I G+   R+VFELF DV PKTAENFRALCTGEKGT P TG  LHYKG  FH I+
Sbjct  18   AFFDVDIGGERVGRIVFELFADVVPKTAENFRALCTGEKGTGPTTGKPLHYKGCPFHRII  77

Query  303  KGSMAQ  320
            K  M Q
Sbjct  78   KQFMVQ  83



>ref|XP_001761081.1| predicted protein [Physcomitrella patens]
 gb|EDQ74148.1| predicted protein [Physcomitrella patens]
Length=371

 Score = 91.7 bits (226),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 43/73 (59%), Positives = 49/73 (67%), Gaps = 0/73 (0%)
 Frame = +3

Query  102  MSKKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKG  281
            M  +   VF D+ I GD   R+VFELF DV PKTAENFRALCTGEKG    +G  LHYKG
Sbjct  8    MESRNPKVFFDISIGGDMEGRIVFELFADVVPKTAENFRALCTGEKGIGKISGRPLHYKG  67

Query  282  TFFHHIVKGSMAQ  320
              FH ++KG M Q
Sbjct  68   AVFHRVIKGFMIQ  80



>ref|XP_002310739.2| hypothetical protein POPTR_0007s11390g [Populus trichocarpa]
 gb|EEE91189.2| hypothetical protein POPTR_0007s11390g [Populus trichocarpa]
Length=279

 Score = 90.9 bits (224),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 43/73 (59%), Positives = 53/73 (73%), Gaps = 2/73 (3%)
 Frame = +3

Query  102  MSKKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKG  281
            M+K++   FLD+ I G+   R+V EL+ DV PKTAENFRALCTGEKG  P +G  LHYKG
Sbjct  1    MAKQRC--FLDISIGGELEGRIVVELYKDVVPKTAENFRALCTGEKGIGPNSGVPLHYKG  58

Query  282  TFFHHIVKGSMAQ  320
            + FH +VKG M Q
Sbjct  59   SRFHRVVKGFMVQ  71



>dbj|BAJ98045.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=440

 Score = 92.4 bits (228),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 47/77 (61%), Positives = 55/77 (71%), Gaps = 1/77 (1%)
 Frame = +3

Query  93   ICKMSKKKV-LVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATL  269
            I KM +KK  +VFLDV I   P ERM+FELF +VAP TAENFRALCTGE G    T   L
Sbjct  3    IEKMGRKKNPIVFLDVSIGDGPDERMIFELFANVAPLTAENFRALCTGEMGIGQTTKKPL  62

Query  270  HYKGTFFHHIVKGSMAQ  320
            +YKG+ FH ++KG MAQ
Sbjct  63   YYKGSTFHRVIKGFMAQ  79



>gb|KHG16182.1| Peptidyl-prolyl cis-trans isomerase CYP40 -like protein [Gossypium 
arboreum]
Length=361

 Score = 91.3 bits (225),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 39/65 (60%), Positives = 49/65 (75%), Gaps = 0/65 (0%)
 Frame = +3

Query  126  FLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTFFHHIVK  305
            ++D+ I G+   R+V EL+ D+ PKTAENFRALCTGEKG  P TGA+LHYKG  FH I++
Sbjct  7    YMDISIGGELEGRIVIELYKDIVPKTAENFRALCTGEKGIGPNTGASLHYKGVRFHRIIR  66

Query  306  GSMAQ  320
            G M Q
Sbjct  67   GFMIQ  71



>emb|CDS03415.1| Putative Peptidyl-prolyl cis-trans isomerasecyp5 [Absidia idahoensis 
var. thermophila]
Length=177

 Score = 88.6 bits (218),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 49/66 (74%), Gaps = 1/66 (2%)
 Frame = +3

Query  123  VFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTFFHHIV  302
            VF DV ++G P  RMVF+LF+D  PKTAENFRALCTGEKG   + G  LHYK ++FH I+
Sbjct  9    VFFDVAVNGKPSGRMVFKLFSDTVPKTAENFRALCTGEKGVG-QAGKPLHYKNSYFHRII  67

Query  303  KGSMAQ  320
             G MAQ
Sbjct  68   PGFMAQ  73



>ref|XP_005854554.1| myosin light chain kinase [Nannochloropsis gaditana CCMP526]
 gb|EKU21801.1| myosin light chain kinase [Nannochloropsis gaditana CCMP526]
Length=807

 Score = 93.6 bits (231),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 43/72 (60%), Positives = 54/72 (75%), Gaps = 0/72 (0%)
 Frame = +3

Query  105  SKKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGT  284
            +KK V V++D+ I      RMVFELFT+  P+TAENFRALCTGE+G SP +G  LHYKG+
Sbjct  343  TKKSVQVYMDIKIGPRFAGRMVFELFTEQTPRTAENFRALCTGERGISPLSGHPLHYKGS  402

Query  285  FFHHIVKGSMAQ  320
             FH ++KG MAQ
Sbjct  403  IFHRVIKGFMAQ  414



>ref|XP_003436324.1| AGAP002952-PB [Anopheles gambiae str. PEST]
 gb|EGK96689.1| AGAP002952-PB [Anopheles gambiae str. PEST]
Length=158

 Score = 88.2 bits (217),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 43/72 (60%), Positives = 49/72 (68%), Gaps = 0/72 (0%)
 Frame = +3

Query  105  SKKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGT  284
             ++K+  F DV + G P  R+VFELF  VAPKT ENFRALCTGEKG   KTG  LHYKG 
Sbjct  18   QQEKIRCFFDVSLGGLPAGRIVFELFPAVAPKTCENFRALCTGEKGIGQKTGKPLHYKGI  77

Query  285  FFHHIVKGSMAQ  320
             FH +VK  M Q
Sbjct  78   IFHRVVKDFMIQ  89



>ref|XP_004165805.1| PREDICTED: LOW QUALITY PROTEIN: peptidyl-prolyl cis-trans isomerase 
CYP40-like [Cucumis sativus]
Length=361

 Score = 90.9 bits (224),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/69 (59%), Positives = 50/69 (72%), Gaps = 0/69 (0%)
 Frame = +3

Query  114  KVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTFFH  293
            ++  FLD+ I GD   R+V EL+ DV PKTAENFRALCTGEKG  P TG  LH+KG+ FH
Sbjct  3    RIRCFLDISIGGDLEGRIVVELYDDVVPKTAENFRALCTGEKGIGPHTGVPLHFKGSCFH  62

Query  294  HIVKGSMAQ  320
             ++KG M Q
Sbjct  63   RVIKGFMVQ  71



>ref|XP_009350556.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP40 [Pyrus x 
bretschneideri]
 ref|XP_009350557.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP40 [Pyrus x 
bretschneideri]
Length=362

 Score = 90.9 bits (224),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 47/65 (72%), Gaps = 0/65 (0%)
 Frame = +3

Query  126  FLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTFFHHIVK  305
            FLD+ I G+   R+V ELF DV PKTAENFRALCTGEKG  P TG  LHYKG  FH ++K
Sbjct  7    FLDISIGGELEGRIVVELFDDVVPKTAENFRALCTGEKGIGPNTGVPLHYKGVRFHRVIK  66

Query  306  GSMAQ  320
            G M Q
Sbjct  67   GFMIQ  71



>ref|XP_004136993.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP40-like [Cucumis 
sativus]
 gb|KGN43950.1| hypothetical protein Csa_7G074830 [Cucumis sativus]
Length=361

 Score = 90.9 bits (224),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/69 (59%), Positives = 50/69 (72%), Gaps = 0/69 (0%)
 Frame = +3

Query  114  KVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTFFH  293
            ++  FLD+ I GD   R+V EL+ DV PKTAENFRALCTGEKG  P TG  LH+KG+ FH
Sbjct  3    RIRCFLDISIGGDLEGRIVVELYDDVVPKTAENFRALCTGEKGIGPHTGVPLHFKGSCFH  62

Query  294  HIVKGSMAQ  320
             ++KG M Q
Sbjct  63   RVIKGFMVQ  71



>ref|XP_002521846.1| peptidyl-prolyl cis-trans isomerase d, ppid, putative [Ricinus 
communis]
 gb|EEF40482.1| peptidyl-prolyl cis-trans isomerase d, ppid, putative [Ricinus 
communis]
Length=361

 Score = 90.5 bits (223),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 47/65 (72%), Gaps = 0/65 (0%)
 Frame = +3

Query  126  FLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTFFHHIVK  305
            FLD+ I G+   R+V EL+ DV PKTAENFRALCTGEKG  P TG  LHYKG  FH I+K
Sbjct  7    FLDISIGGELEGRIVIELYNDVVPKTAENFRALCTGEKGIGPNTGVPLHYKGCPFHRIIK  66

Query  306  GSMAQ  320
            G M Q
Sbjct  67   GFMVQ  71



>ref|XP_003524582.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP40-like isoform 
X1 [Glycine max]
Length=360

 Score = 90.5 bits (223),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 47/65 (72%), Gaps = 0/65 (0%)
 Frame = +3

Query  126  FLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTFFHHIVK  305
            FLDV I G+   R+V ELF DV PKTAENFRALCTGEKG  P TG  LHYKG  FH ++K
Sbjct  7    FLDVSIGGELEGRIVVELFHDVVPKTAENFRALCTGEKGIGPNTGVPLHYKGVCFHRVIK  66

Query  306  GSMAQ  320
            G M Q
Sbjct  67   GFMIQ  71



>ref|XP_006579808.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP40-like isoform 
X2 [Glycine max]
Length=363

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 47/65 (72%), Gaps = 0/65 (0%)
 Frame = +3

Query  126  FLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTFFHHIVK  305
            FLDV I G+   R+V ELF DV PKTAENFRALCTGEKG  P TG  LHYKG  FH ++K
Sbjct  7    FLDVSIGGELEGRIVVELFHDVVPKTAENFRALCTGEKGIGPNTGVPLHYKGVCFHRVIK  66

Query  306  GSMAQ  320
            G M Q
Sbjct  67   GFMIQ  71



>ref|XP_006657500.1| PREDICTED: peptidyl-prolyl cis-trans isomerase G-like isoform 
X2 [Oryza brachyantha]
Length=626

 Score = 92.4 bits (228),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 51/72 (71%), Gaps = 0/72 (0%)
 Frame = +3

Query  105  SKKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGT  284
            +KK   VFLD+ I G   ER+ FELF+DV PKTAENFRALCTGE+G    T   LHYKGT
Sbjct  4    AKKNPHVFLDISIGGRAAERITFELFSDVVPKTAENFRALCTGERGLGISTQKPLHYKGT  63

Query  285  FFHHIVKGSMAQ  320
              H I+KG MAQ
Sbjct  64   TMHRILKGFMAQ  75



>ref|XP_006657499.1| PREDICTED: peptidyl-prolyl cis-trans isomerase G-like isoform 
X1 [Oryza brachyantha]
Length=627

 Score = 92.4 bits (228),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 51/72 (71%), Gaps = 0/72 (0%)
 Frame = +3

Query  105  SKKKVLVFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGT  284
            +KK   VFLD+ I G   ER+ FELF+DV PKTAENFRALCTGE+G    T   LHYKGT
Sbjct  4    AKKNPHVFLDISIGGRAAERITFELFSDVVPKTAENFRALCTGERGLGISTQKPLHYKGT  63

Query  285  FFHHIVKGSMAQ  320
              H I+KG MAQ
Sbjct  64   TMHRILKGFMAQ  75



>ref|XP_010584392.1| PREDICTED: peptidyl-prolyl cis-trans isomerase D isoform X2 [Haliaeetus 
leucocephalus]
Length=341

 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 44/66 (67%), Positives = 47/66 (71%), Gaps = 0/66 (0%)
 Frame = +3

Query  123  VFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTFFHHIV  302
             F DV I G+   R+VFELF DV PKTAENFRALCTGEKGT P TG  LHYKG  FH I+
Sbjct  18   AFFDVDIGGERVGRIVFELFADVVPKTAENFRALCTGEKGTGPTTGKPLHYKGCPFHRII  77

Query  303  KGSMAQ  320
            K  M Q
Sbjct  78   KQFMVQ  83



>ref|XP_006798990.1| PREDICTED: peptidyl-prolyl cis-trans isomerase D-like [Neolamprologus 
brichardi]
Length=266

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 43/66 (65%), Positives = 48/66 (73%), Gaps = 0/66 (0%)
 Frame = +3

Query  123  VFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTFFHHIV  302
            VFLDV IDG+   R+V ELF D+ PKTAENFRALCTGEKGT   TG  LH+KG  FH I+
Sbjct  18   VFLDVDIDGERAGRIVLELFADITPKTAENFRALCTGEKGTGKSTGKPLHFKGCPFHRII  77

Query  303  KGSMAQ  320
            K  M Q
Sbjct  78   KKFMIQ  83



>ref|XP_006384447.1| SQUINT family protein [Populus trichocarpa]
 gb|ERP62244.1| SQUINT family protein [Populus trichocarpa]
Length=370

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 47/65 (72%), Gaps = 0/65 (0%)
 Frame = +3

Query  126  FLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTFFHHIVK  305
            FLD+ I G+   R+V EL+ DV PKTAENFRALCTGEKG  P TG  LHYKG  FH ++K
Sbjct  7    FLDISIGGELEGRIVVELYNDVVPKTAENFRALCTGEKGIGPNTGVPLHYKGCRFHRVIK  66

Query  306  GSMAQ  320
            G M Q
Sbjct  67   GFMVQ  71



>ref|XP_010584391.1| PREDICTED: peptidyl-prolyl cis-trans isomerase D isoform X1 [Haliaeetus 
leucocephalus]
Length=370

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 44/66 (67%), Positives = 47/66 (71%), Gaps = 0/66 (0%)
 Frame = +3

Query  123  VFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTFFHHIV  302
             F DV I G+   R+VFELF DV PKTAENFRALCTGEKGT P TG  LHYKG  FH I+
Sbjct  18   AFFDVDIGGERVGRIVFELFADVVPKTAENFRALCTGEKGTGPTTGKPLHYKGCPFHRII  77

Query  303  KGSMAQ  320
            K  M Q
Sbjct  78   KQFMVQ  83



>gb|ACH45652.1| putative peptidylprolyl isomerase D [Taeniopygia guttata]
 gb|ACH45653.1| putative peptidylprolyl isomerase D [Taeniopygia guttata]
Length=370

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 44/66 (67%), Positives = 47/66 (71%), Gaps = 0/66 (0%)
 Frame = +3

Query  123  VFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTFFHHIV  302
             F DV I G+   R+VFELF DV PKTAENFRALCTGEKGT P TG  LHYKG  FH I+
Sbjct  18   AFFDVDIGGERVGRIVFELFADVVPKTAENFRALCTGEKGTGPTTGKPLHYKGCPFHRII  77

Query  303  KGSMAQ  320
            K  M Q
Sbjct  78   KQFMVQ  83



>ref|XP_001487732.1| hypothetical protein PGUG_01109 [Meyerozyma guilliermondii ATCC 
6260]
 gb|EDK37011.1| hypothetical protein PGUG_01109 [Meyerozyma guilliermondii ATCC 
6260]
Length=403

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/66 (64%), Positives = 48/66 (73%), Gaps = 0/66 (0%)
 Frame = +3

Query  123  VFLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTFFHHIV  302
            VF D+  DG    R+VFELF DV PKTAENFRALCTGEKG S K+G  LHYKG+ FH ++
Sbjct  43   VFFDISCDGVKKGRVVFELFNDVVPKTAENFRALCTGEKGVSEKSGKPLHYKGSIFHRVI  102

Query  303  KGSMAQ  320
            K  M Q
Sbjct  103  KDFMCQ  108



>ref|XP_007047186.1| Peptidyl-prolyl cis-trans isomerase / cyclophilin-40 (CYP40) 
/ rotamase isoform 9 [Theobroma cacao]
 gb|EOX91343.1| Peptidyl-prolyl cis-trans isomerase / cyclophilin-40 (CYP40) 
/ rotamase isoform 9 [Theobroma cacao]
Length=260

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/65 (62%), Positives = 48/65 (74%), Gaps = 0/65 (0%)
 Frame = +3

Query  126  FLDVCIDGDPFERMVFELFTDVAPKTAENFRALCTGEKGTSPKTGATLHYKGTFFHHIVK  305
            +LD+ I G+   R+V EL+ DV PKTAENFRALCTGEKG  P T A+LHYKG  FH I++
Sbjct  7    YLDISIGGELEGRIVVELYKDVVPKTAENFRALCTGEKGIGPSTAASLHYKGVRFHRIIR  66

Query  306  GSMAQ  320
            G M Q
Sbjct  67   GFMIQ  71



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1779474092270