BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF045A11

Length=638
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009781696.1|  PREDICTED: uncharacterized protein LOC104230558    212   3e-60   Nicotiana sylvestris
ref|XP_009609945.1|  PREDICTED: uncharacterized protein LOC104103724    209   2e-59   Nicotiana tomentosiformis
ref|XP_011078022.1|  PREDICTED: uncharacterized protein LOC105161875    208   9e-59   Sesamum indicum [beniseed]
ref|XP_011093758.1|  PREDICTED: uncharacterized protein LOC105173636    205   1e-57   Sesamum indicum [beniseed]
ref|XP_009803262.1|  PREDICTED: uncharacterized protein LOC104248655    204   6e-57   Nicotiana sylvestris
ref|XP_010312310.1|  PREDICTED: uncharacterized protein LOC101260185    204   9e-57   Solanum lycopersicum
emb|CDP15840.1|  unnamed protein product                                204   1e-56   Coffea canephora [robusta coffee]
ref|XP_006343519.1|  PREDICTED: uncharacterized protein LOC102599...    201   2e-56   Solanum tuberosum [potatoes]
ref|XP_006347843.1|  PREDICTED: uncharacterized protein LOC102585480    203   2e-56   Solanum tuberosum [potatoes]
ref|XP_009616187.1|  PREDICTED: uncharacterized protein LOC104108774    202   4e-56   Nicotiana tomentosiformis
ref|XP_004244900.1|  PREDICTED: uncharacterized protein LOC101266847    199   2e-55   Solanum lycopersicum
gb|EPS64515.1|  hypothetical protein M569_10265                         183   5e-55   Genlisea aurea
gb|EYU28380.1|  hypothetical protein MIMGU_mgv1a002234mg                195   2e-54   Erythranthe guttata [common monkey flower]
emb|CBI34299.3|  unnamed protein product                                196   2e-54   Vitis vinifera
ref|XP_006382690.1|  hypothetical protein POPTR_0005s04470g             196   6e-54   Populus trichocarpa [western balsam poplar]
gb|KJB44643.1|  hypothetical protein B456_007G263700                    187   7e-54   Gossypium raimondii
ref|XP_002319580.2|  hypothetical protein POPTR_0013s03040g             196   8e-54   
ref|XP_011023498.1|  PREDICTED: uncharacterized protein LOC105124962    196   1e-53   Populus euphratica
ref|XP_007030109.1|  DNAJ heat shock N-terminal domain-containing...    196   1e-53   
ref|XP_002266568.2|  PREDICTED: uncharacterized protein LOC100255461    196   1e-53   Vitis vinifera
ref|XP_011048882.1|  PREDICTED: uncharacterized protein LOC105142787    195   2e-53   Populus euphratica
ref|XP_008366850.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    192   5e-53   
ref|XP_008359874.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    191   9e-53   
ref|XP_009373931.1|  PREDICTED: uncharacterized protein LOC103962880    190   2e-52   
ref|XP_009341995.1|  PREDICTED: uncharacterized protein LOC103934018    192   2e-52   Pyrus x bretschneideri [bai li]
ref|XP_009335671.1|  PREDICTED: uncharacterized protein LOC103928367    192   2e-52   Pyrus x bretschneideri [bai li]
ref|XP_006433149.1|  hypothetical protein CICLE_v10000081mg             192   2e-52   Citrus clementina [clementine]
ref|XP_008355770.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    192   2e-52   
gb|EYU27327.1|  hypothetical protein MIMGU_mgv1a001634mg                188   1e-51   Erythranthe guttata [common monkey flower]
gb|EYU23667.1|  hypothetical protein MIMGU_mgv1a001617mg                186   5e-51   Erythranthe guttata [common monkey flower]
gb|KJB19229.1|  hypothetical protein B456_003G089700                    188   5e-51   Gossypium raimondii
gb|KHG04775.1|  DnaJ subfamily B member 12                              187   9e-51   Gossypium arboreum [tree cotton]
ref|XP_008353268.1|  PREDICTED: uncharacterized protein LOC103416829    178   7e-50   
ref|XP_009352192.1|  PREDICTED: uncharacterized protein LOC103943605    182   4e-49   Pyrus x bretschneideri [bai li]
ref|XP_007207549.1|  hypothetical protein PRUPE_ppa017544mg             182   6e-49   
ref|XP_007147102.1|  hypothetical protein PHAVU_006G096300g             182   6e-49   Phaseolus vulgaris [French bean]
gb|KHN43244.1|  DnaJ like subfamily B member 14                         181   1e-48   Glycine soja [wild soybean]
ref|XP_003553743.1|  PREDICTED: uncharacterized protein LOC100819...    181   1e-48   Glycine max [soybeans]
ref|XP_006577265.1|  PREDICTED: uncharacterized protein LOC100782762    181   1e-48   Glycine max [soybeans]
ref|XP_010097335.1|  J domain-containing protein                        181   1e-48   Morus notabilis
ref|XP_010097334.1|  J domain-containing protein                        181   2e-48   Morus notabilis
ref|XP_008246552.1|  PREDICTED: uncharacterized protein LOC103344708    181   2e-48   Prunus mume [ume]
ref|XP_008390748.1|  PREDICTED: uncharacterized protein LOC103452999    180   2e-48   Malus domestica [apple tree]
ref|XP_002512302.1|  protein with unknown function                      180   3e-48   Ricinus communis
ref|XP_002520963.1|  protein with unknown function                      180   4e-48   Ricinus communis
gb|KDP23995.1|  hypothetical protein JCGZ_25383                         178   8e-48   Jatropha curcas
ref|XP_010042011.1|  PREDICTED: uncharacterized protein LOC104431009    176   2e-47   Eucalyptus grandis [rose gum]
ref|XP_008340865.1|  PREDICTED: uncharacterized protein LOC103403797    177   2e-47   
ref|XP_010240875.1|  PREDICTED: uncharacterized protein LOC104585627    177   5e-47   Nelumbo nucifera [Indian lotus]
ref|XP_008813744.1|  PREDICTED: uncharacterized protein LOC103724304    176   7e-47   
ref|XP_009369093.1|  PREDICTED: uncharacterized protein LOC103958545    176   8e-47   Pyrus x bretschneideri [bai li]
ref|XP_010667707.1|  PREDICTED: uncharacterized protein LOC104884721    175   1e-46   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010914403.1|  PREDICTED: uncharacterized protein LOC105039818    175   2e-46   Elaeis guineensis
gb|KDP23582.1|  hypothetical protein JCGZ_23415                         174   3e-46   Jatropha curcas
ref|XP_008450718.1|  PREDICTED: uncharacterized protein LOC103492216    173   3e-46   Cucumis melo [Oriental melon]
ref|XP_004157267.1|  PREDICTED: uncharacterized LOC101213491            172   6e-46   
ref|XP_004135641.1|  PREDICTED: uncharacterized protein LOC101213491    172   6e-46   
ref|XP_007225172.1|  hypothetical protein PRUPE_ppa002265mg             171   7e-46   
ref|XP_009383695.1|  PREDICTED: uncharacterized protein LOC103971406    173   8e-46   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004494655.1|  PREDICTED: uncharacterized protein LOC101488726    173   8e-46   Cicer arietinum [garbanzo]
ref|XP_008776154.1|  PREDICTED: uncharacterized protein LOC103696336    173   1e-45   Phoenix dactylifera
ref|XP_002276957.1|  PREDICTED: uncharacterized protein LOC100244334    172   2e-45   Vitis vinifera
gb|KDP23994.1|  hypothetical protein JCGZ_25382                         171   3e-45   Jatropha curcas
ref|XP_009382035.1|  PREDICTED: uncharacterized protein LOC103970110    171   5e-45   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010941769.1|  PREDICTED: uncharacterized protein LOC105059940    171   8e-45   Elaeis guineensis
gb|KDO74988.1|  hypothetical protein CISIN_1g001884mg                   170   9e-45   Citrus sinensis [apfelsine]
ref|XP_006419692.1|  hypothetical protein CICLE_v10004243mg             170   9e-45   Citrus clementina [clementine]
ref|XP_008223150.1|  PREDICTED: uncharacterized protein LOC103322971    169   1e-44   
ref|XP_011466353.1|  PREDICTED: uncharacterized protein LOC101310244    165   4e-44   Fragaria vesca subsp. vesca
ref|XP_010240852.1|  PREDICTED: uncharacterized protein LOC104585612    167   8e-44   Nelumbo nucifera [Indian lotus]
gb|KJB72559.1|  hypothetical protein B456_011G184900                    167   1e-43   Gossypium raimondii
emb|CDY41919.1|  BnaC05g46850D                                          167   1e-43   Brassica napus [oilseed rape]
gb|KJB28586.1|  hypothetical protein B456_005G056900                    166   1e-43   Gossypium raimondii
ref|XP_007144776.1|  hypothetical protein PHAVU_007G183700g             158   2e-43   Phaseolus vulgaris [French bean]
ref|XP_003626352.1|  Chaperone protein dnaJ                             166   2e-43   Medicago truncatula
gb|KHG13047.1|  DnaJ subfamily B member 12                              166   3e-43   Gossypium arboreum [tree cotton]
emb|CDY27809.1|  BnaA05g32180D                                          166   3e-43   Brassica napus [oilseed rape]
ref|XP_006606497.1|  PREDICTED: meiotically up-regulated gene 184...    164   3e-43   Glycine max [soybeans]
ref|XP_010024522.1|  PREDICTED: uncharacterized protein LOC104414985    166   3e-43   Eucalyptus grandis [rose gum]
gb|KHN20189.1|  DnaJ like subfamily B member 12                         164   3e-43   Glycine soja [wild soybean]
ref|XP_009147297.1|  PREDICTED: uncharacterized protein LOC103870872    166   3e-43   Brassica rapa
ref|NP_001068141.2|  Os11g0578100                                       164   2e-42   
ref|XP_004508319.1|  PREDICTED: uncharacterized protein LOC101508...    163   2e-42   
gb|AES91767.2|  DnaJ heat shock amino-terminal domain protein           163   2e-42   Medicago truncatula
ref|XP_010546655.1|  PREDICTED: uncharacterized protein LOC104818668    164   3e-42   Tarenaya hassleriana [spider flower]
gb|EYU28379.1|  hypothetical protein MIMGU_mgv1a019779mg                152   3e-42   Erythranthe guttata [common monkey flower]
ref|XP_004495763.1|  PREDICTED: uncharacterized protein LOC101513909    160   4e-42   Cicer arietinum [garbanzo]
gb|EMT10790.1|  DnaJ homolog subfamily B member 5                       162   4e-42   
gb|EMS59052.1|  DnaJ homolog subfamily B member 5                       162   4e-42   Triticum urartu
ref|XP_009399319.1|  PREDICTED: uncharacterized protein LOC103983771    162   4e-42   Musa acuminata subsp. malaccensis [pisang utan]
gb|ABF69988.1|  heat shock protein DnaJ N-terminal domain-contain...    162   5e-42   Musa acuminata [banana]
ref|XP_003591045.1|  DnAJ-like protein slr0093                          155   5e-42   
ref|XP_006600331.1|  PREDICTED: uncharacterized protein LOC100789...    162   6e-42   Glycine max [soybeans]
ref|XP_011009900.1|  PREDICTED: uncharacterized protein LOC105114890    162   7e-42   Populus euphratica
ref|XP_004956016.1|  PREDICTED: uncharacterized protein LOC101779...    162   9e-42   
ref|XP_003547217.1|  PREDICTED: uncharacterized protein LOC100817...    161   1e-41   Glycine max [soybeans]
dbj|BAJ94831.1|  predicted protein                                      161   1e-41   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002314476.2|  DNAJ heat shock N-terminal domain-containing...    160   1e-41   
gb|KHN47283.1|  DnaJ like subfamily B member 14                         161   2e-41   Glycine soja [wild soybean]
ref|XP_003541656.1|  PREDICTED: uncharacterized protein LOC100779...    160   2e-41   Glycine max [soybeans]
ref|XP_003550525.1|  PREDICTED: uncharacterized protein LOC100789...    160   2e-41   
gb|KHN03398.1|  Protein HLJ1                                            160   2e-41   Glycine soja [wild soybean]
ref|XP_011468427.1|  PREDICTED: dnaJ homolog subfamily B member 4...    157   2e-41   Fragaria vesca subsp. vesca
ref|XP_007035447.1|  DNAJ heat shock N-terminal domain-containing...    160   2e-41   
ref|XP_004294830.1|  PREDICTED: uncharacterized protein LOC101301565    160   2e-41   Fragaria vesca subsp. vesca
ref|XP_003609570.1|  DnaJ homolog subfamily B member                    160   2e-41   
ref|XP_010098318.1|  DnaJ homolog subfamily B member 12                 160   3e-41   Morus notabilis
ref|XP_006662997.1|  PREDICTED: uncharacterized protein LOC102709967    160   3e-41   Oryza brachyantha
gb|EMT30764.1|  Curved DNA-binding protein                              160   3e-41   
gb|EMS51154.1|  Curved DNA-binding protein                              160   5e-41   Triticum urartu
ref|XP_007144775.1|  hypothetical protein PHAVU_007G183600g             157   8e-41   Phaseolus vulgaris [French bean]
ref|XP_007147854.1|  hypothetical protein PHAVU_006G160400g             158   1e-40   Phaseolus vulgaris [French bean]
ref|XP_006644181.1|  PREDICTED: uncharacterized protein LOC102699722    158   2e-40   Oryza brachyantha
ref|XP_006356967.1|  PREDICTED: uncharacterized protein LOC102580437    157   2e-40   Solanum tuberosum [potatoes]
ref|NP_001043077.1|  Os01g0375100                                       157   2e-40   
gb|KHN03011.1|  Protein HLJ1                                            157   3e-40   Glycine soja [wild soybean]
ref|XP_003529595.1|  PREDICTED: uncharacterized protein LOC100795200    157   3e-40   Glycine max [soybeans]
emb|CDM83112.1|  unnamed protein product                                157   3e-40   Triticum aestivum [Canadian hard winter wheat]
gb|KEH43065.1|  DnaJ heat shock amino-terminal domain protein           155   3e-40   Medicago truncatula
gb|EMT22588.1|  DnaJ homolog subfamily B member 12                      157   4e-40   
emb|CDO98930.1|  unnamed protein product                                157   4e-40   Coffea canephora [robusta coffee]
ref|XP_003562154.1|  PREDICTED: uncharacterized protein LOC100835186    157   4e-40   Brachypodium distachyon [annual false brome]
gb|EAZ11958.1|  hypothetical protein OsJ_01831                          157   5e-40   Oryza sativa Japonica Group [Japonica rice]
gb|EYU28383.1|  hypothetical protein MIMGU_mgv11b017001mg               149   5e-40   Erythranthe guttata [common monkey flower]
ref|XP_006656144.1|  PREDICTED: uncharacterized protein LOC102714019    156   6e-40   Oryza brachyantha
gb|EEC80760.1|  hypothetical protein OsI_23252                          156   6e-40   Oryza sativa Indica Group [Indian rice]
ref|XP_010230889.1|  PREDICTED: uncharacterized protein LOC100842436    156   9e-40   Brachypodium distachyon [annual false brome]
emb|CDX99992.1|  BnaC09g03090D                                          155   1e-39   
ref|NP_001057790.1|  Os06g0535300                                       155   1e-39   
ref|XP_010540334.1|  PREDICTED: uncharacterized protein LOC104814147    155   1e-39   Tarenaya hassleriana [spider flower]
ref|XP_002884481.1|  DNAJ heat shock N-terminal domain-containing...    155   2e-39   
ref|XP_003563108.2|  PREDICTED: uncharacterized protein LOC100822...    155   2e-39   Brachypodium distachyon [annual false brome]
ref|XP_011466352.1|  PREDICTED: uncharacterized protein LOC101309...    155   2e-39   Fragaria vesca subsp. vesca
ref|XP_008652283.1|  PREDICTED: uncharacterized protein LOC103632245    155   2e-39   
ref|XP_002461875.1|  hypothetical protein SORBIDRAFT_02g009690          155   2e-39   Sorghum bicolor [broomcorn]
ref|XP_006408126.1|  hypothetical protein EUTSA_v10019946mg             155   2e-39   Eutrema salsugineum [saltwater cress]
ref|XP_004305041.1|  PREDICTED: uncharacterized protein LOC101309...    155   2e-39   Fragaria vesca subsp. vesca
ref|XP_004229298.1|  PREDICTED: uncharacterized protein LOC101248043    154   3e-39   Solanum lycopersicum
ref|XP_006855386.1|  hypothetical protein AMTR_s00057p00136560          154   4e-39   Amborella trichopoda
ref|NP_187149.1|  DNAJ heat shock N-terminal domain-containing pr...    154   5e-39   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006380031.1|  hypothetical protein POPTR_0008s20070g             151   7e-39   
emb|CDX74107.1|  BnaA03g29400D                                          145   9e-39   
ref|XP_004145046.1|  PREDICTED: uncharacterized protein LOC101217756    152   1e-38   
ref|XP_004163100.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    152   1e-38   
ref|XP_011468428.1|  PREDICTED: uncharacterized protein LOC101310821    150   1e-38   Fragaria vesca subsp. vesca
ref|XP_007154216.1|  hypothetical protein PHAVU_003G100000g             152   1e-38   Phaseolus vulgaris [French bean]
ref|XP_009596456.1|  PREDICTED: uncharacterized protein LOC104092542    152   2e-38   Nicotiana tomentosiformis
gb|KEH42053.1|  DnaJ heat shock amino-terminal domain protein           150   2e-38   Medicago truncatula
ref|XP_006394983.1|  hypothetical protein EUTSA_v10003562mg             152   2e-38   Eutrema salsugineum [saltwater cress]
emb|CDY19714.1|  BnaA09g03670D                                          151   3e-38   Brassica napus [oilseed rape]
ref|XP_009779333.1|  PREDICTED: uncharacterized protein LOC104228554    152   3e-38   Nicotiana sylvestris
ref|XP_009111937.1|  PREDICTED: uncharacterized protein LOC103837329    151   5e-38   
dbj|BAJ91190.1|  predicted protein                                      151   5e-38   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008674053.1|  PREDICTED: uncharacterized protein LOC103650196    150   6e-38   
emb|CDX80667.1|  BnaC07g27770D                                          149   6e-38   
ref|XP_009787122.1|  PREDICTED: uncharacterized protein LOC104235134    151   6e-38   Nicotiana sylvestris
ref|XP_009151221.1|  PREDICTED: uncharacterized protein LOC103874549    148   7e-38   Brassica rapa
ref|XP_008458690.1|  PREDICTED: uncharacterized protein LOC103498020    150   8e-38   
ref|XP_002451005.1|  hypothetical protein SORBIDRAFT_05g022460          150   1e-37   Sorghum bicolor [broomcorn]
ref|XP_004979542.1|  PREDICTED: uncharacterized protein LOC101786678    150   1e-37   Setaria italica
ref|XP_008655534.1|  PREDICTED: uncharacterized protein LOC103634728    149   2e-37   Zea mays [maize]
ref|XP_010463986.1|  PREDICTED: uncharacterized protein LOC104744610    150   2e-37   Camelina sativa [gold-of-pleasure]
ref|XP_004967967.1|  PREDICTED: uncharacterized protein LOC101785664    149   2e-37   Setaria italica
ref|XP_010494032.1|  PREDICTED: uncharacterized protein LOC104771234    149   2e-37   Camelina sativa [gold-of-pleasure]
ref|XP_010540340.1|  PREDICTED: uncharacterized protein LOC104814150    149   2e-37   Tarenaya hassleriana [spider flower]
ref|XP_002457507.1|  hypothetical protein SORBIDRAFT_03g008500          149   3e-37   
ref|XP_002455673.1|  hypothetical protein SORBIDRAFT_03g019960          149   3e-37   Sorghum bicolor [broomcorn]
ref|XP_009624052.1|  PREDICTED: uncharacterized protein LOC104115174    149   4e-37   Nicotiana tomentosiformis
ref|XP_010485887.1|  PREDICTED: uncharacterized protein LOC104764132    149   5e-37   Camelina sativa [gold-of-pleasure]
ref|XP_004980633.1|  PREDICTED: uncharacterized protein LOC101766063    148   6e-37   Setaria italica
emb|CDY08056.1|  BnaC03g34670D                                          145   6e-37   Brassica napus [oilseed rape]
ref|XP_010421375.1|  PREDICTED: uncharacterized protein LOC104706...    148   8e-37   
ref|XP_010421247.1|  PREDICTED: uncharacterized protein LOC104706...    147   9e-37   Camelina sativa [gold-of-pleasure]
ref|XP_010455145.1|  PREDICTED: uncharacterized protein LOC104736...    147   1e-36   
dbj|BAH19652.1|  AT3G06340                                              142   1e-36   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004486071.1|  PREDICTED: uncharacterized protein LOC101500...    147   1e-36   Cicer arietinum [garbanzo]
ref|XP_006289445.1|  hypothetical protein CARUB_v10002959mg             147   1e-36   Capsella rubella
ref|XP_004965985.1|  PREDICTED: uncharacterized protein LOC101779...    147   1e-36   
ref|XP_011468429.1|  PREDICTED: uncharacterized protein LOC101311114    147   1e-36   Fragaria vesca subsp. vesca
ref|NP_001068142.1|  Os11g0578500                                       144   1e-36   
ref|XP_002874391.1|  DNAJ heat shock N-terminal domain-containing...    147   2e-36   
ref|XP_010540338.1|  PREDICTED: uncharacterized protein LOC104814148    147   2e-36   Tarenaya hassleriana [spider flower]
ref|XP_004968770.1|  PREDICTED: uncharacterized protein LOC101770440    146   2e-36   Setaria italica
ref|XP_009134889.1|  PREDICTED: uncharacterized protein LOC103859153    144   2e-36   Brassica rapa
gb|KHN16161.1|  Chaperone protein DnaJ                                  140   3e-36   Glycine soja [wild soybean]
ref|XP_006296847.1|  hypothetical protein CARUB_v10012833mg             146   4e-36   Capsella rubella
gb|EMS53344.1|  Uncharacterized J domain-containing protein C17A3...    145   4e-36   Triticum urartu
gb|EMT18416.1|  Chaperone protein dnaJ                                  145   5e-36   
ref|XP_006297143.1|  hypothetical protein CARUB_v10013147mg             143   5e-36   Capsella rubella
ref|XP_003563509.1|  PREDICTED: uncharacterized protein LOC100844853    145   5e-36   Brachypodium distachyon [annual false brome]
ref|XP_010524767.1|  PREDICTED: uncharacterized protein LOC104802729    144   7e-36   Tarenaya hassleriana [spider flower]
ref|XP_002884572.1|  DNAJ heat shock N-terminal domain-containing...    143   9e-36   
gb|EAZ18827.1|  hypothetical protein OsJ_34364                          144   1e-35   Oryza sativa Japonica Group [Japonica rice]
gb|KDO81871.1|  hypothetical protein CISIN_1g003634mg                   143   1e-35   Citrus sinensis [apfelsine]
ref|XP_006484123.1|  PREDICTED: uncharacterized protein LOC102614...    143   1e-35   Citrus sinensis [apfelsine]
ref|XP_006438009.1|  hypothetical protein CICLE_v10030729mg             143   1e-35   Citrus clementina [clementine]
ref|XP_010449377.1|  PREDICTED: dnaJ homolog subfamily B member 1...    137   2e-35   
gb|ABA94405.1|  DnaJ domain containing protein                          137   2e-35   Oryza sativa Japonica Group [Japonica rice]
ref|NP_187285.1|  DnaJ domain-containing protein                        142   2e-35   Arabidopsis thaliana [mouse-ear cress]
gb|EMT13700.1|  DnaJ homolog subfamily B member 12                      143   2e-35   
ref|XP_010445272.1|  PREDICTED: dnaJ homolog subfamily C member 8...    137   3e-35   Camelina sativa [gold-of-pleasure]
ref|XP_010486141.1|  PREDICTED: uncharacterized protein LOC104764323    141   3e-35   Camelina sativa [gold-of-pleasure]
ref|XP_006407958.1|  hypothetical protein EUTSA_v10020330mg             140   3e-35   
ref|XP_004979549.1|  PREDICTED: uncharacterized protein LOC101754...    143   3e-35   Setaria italica
ref|XP_003594017.1|  DnaJ protein-like protein                          142   5e-35   Medicago truncatula
gb|KEH36710.1|  DnaJ heat shock amino-terminal domain protein           142   5e-35   Medicago truncatula
gb|EMS58140.1|  DnaJ homolog subfamily B member 14                      142   5e-35   Triticum urartu
ref|XP_008389881.1|  PREDICTED: uncharacterized protein LOC103452159    141   5e-35   Malus domestica [apple tree]
gb|EAY81410.1|  hypothetical protein OsI_36578                          142   6e-35   Oryza sativa Indica Group [Indian rice]
ref|XP_009343151.1|  PREDICTED: uncharacterized protein LOC103935122    141   6e-35   Pyrus x bretschneideri [bai li]
ref|XP_006285566.1|  hypothetical protein CARUB_v10007010mg             137   7e-35   Capsella rubella
ref|XP_010656013.1|  PREDICTED: dnaJ homolog subfamily B member 1...    135   8e-35   Vitis vinifera
ref|XP_010558494.1|  PREDICTED: uncharacterized protein LOC104827121    142   8e-35   Tarenaya hassleriana [spider flower]
ref|XP_010656024.1|  PREDICTED: uncharacterized protein LOC104877364    141   1e-34   Vitis vinifera
ref|XP_004980631.1|  PREDICTED: uncharacterized protein LOC101765238    142   1e-34   Setaria italica
ref|XP_007136553.1|  hypothetical protein PHAVU_009G054500g             139   2e-34   Phaseolus vulgaris [French bean]
gb|KFK28612.1|  hypothetical protein AALP_AA7G020900                    137   2e-34   Arabis alpina [alpine rockcress]
ref|XP_002451004.1|  hypothetical protein SORBIDRAFT_05g022450          140   2e-34   
ref|XP_010546913.1|  PREDICTED: uncharacterized protein LOC104818838    140   2e-34   Tarenaya hassleriana [spider flower]
dbj|BAJ87377.1|  predicted protein                                      139   2e-34   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010438758.1|  PREDICTED: uncharacterized protein LOC104722282    139   2e-34   
ref|XP_010250691.1|  PREDICTED: uncharacterized protein LOC104592869    140   3e-34   Nelumbo nucifera [Indian lotus]
ref|XP_003523381.2|  PREDICTED: uncharacterized protein LOC100818...    139   3e-34   Glycine max [soybeans]
ref|XP_008679574.1|  PREDICTED: uncharacterized protein LOC103654523    140   4e-34   Zea mays [maize]
ref|XP_010418015.1|  PREDICTED: uncharacterized protein LOC104703654    136   4e-34   
ref|XP_009768352.1|  PREDICTED: uncharacterized protein LOC104219370    139   5e-34   Nicotiana sylvestris
ref|XP_009372266.1|  PREDICTED: uncharacterized protein LOC103961447    139   5e-34   Pyrus x bretschneideri [bai li]
ref|XP_006581632.1|  PREDICTED: uncharacterized protein LOC100814...    138   5e-34   Glycine max [soybeans]
ref|XP_010449331.1|  PREDICTED: dnaJ homolog subfamily B member 1...    133   6e-34   
ref|NP_198076.1|  DNAJ heat shock N-terminal domain-containing pr...    139   6e-34   Arabidopsis thaliana [mouse-ear cress]
gb|KHN44226.1|  DnaJ like subfamily B member 12                         138   7e-34   Glycine soja [wild soybean]
gb|AAB61072.1|  contains similarity to a DNAJ-like domain               140   7e-34   Arabidopsis thaliana [mouse-ear cress]
gb|EYU23088.1|  hypothetical protein MIMGU_mgv11b011132mg               131   9e-34   Erythranthe guttata [common monkey flower]
emb|CDX99360.1|  BnaC01g11920D                                          134   9e-34   
ref|XP_009420330.1|  PREDICTED: uncharacterized protein LOC104000107    138   1e-33   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010445273.1|  PREDICTED: polycystic kidney disease protein...    136   1e-33   Camelina sativa [gold-of-pleasure]
ref|XP_011076021.1|  PREDICTED: meiotically up-regulated gene 184...    137   1e-33   Sesamum indicum [beniseed]
gb|KEH43064.1|  chaperone DnaJ-domain protein                           133   1e-33   Medicago truncatula
ref|XP_009629029.1|  PREDICTED: uncharacterized protein LOC104119282    137   1e-33   Nicotiana tomentosiformis
ref|XP_002438833.1|  hypothetical protein SORBIDRAFT_10g026860          138   1e-33   
gb|KJB37328.1|  hypothetical protein B456_006G200900                    137   2e-33   Gossypium raimondii
ref|XP_010066413.1|  PREDICTED: uncharacterized protein LOC104453528    137   3e-33   Eucalyptus grandis [rose gum]
ref|XP_009129660.1|  PREDICTED: dnaJ homolog subfamily C member 21      135   3e-33   Brassica rapa
gb|KHG05919.1|  DnaJ subfamily B member 14                              136   3e-33   Gossypium arboreum [tree cotton]
ref|XP_010434386.1|  PREDICTED: J domain-containing protein DDB_G...    133   3e-33   Camelina sativa [gold-of-pleasure]
ref|XP_010249039.1|  PREDICTED: uncharacterized protein LOC104591743    137   3e-33   Nelumbo nucifera [Indian lotus]
ref|XP_010434385.1|  PREDICTED: J domain-containing protein DDB_G...    133   3e-33   
ref|XP_004502621.1|  PREDICTED: uncharacterized protein LOC101501...    136   3e-33   
emb|CDY05255.1|  BnaC05g45480D                                          135   3e-33   
emb|CDY13919.1|  BnaC09g39070D                                          134   4e-33   Brassica napus [oilseed rape]
emb|CDP05084.1|  unnamed protein product                                136   4e-33   Coffea canephora [robusta coffee]
ref|XP_010434392.1|  PREDICTED: chromosome alignment-maintaining ...    134   4e-33   
ref|XP_010555718.1|  PREDICTED: uncharacterized protein LOC104825135    135   5e-33   Tarenaya hassleriana [spider flower]
ref|XP_006350572.1|  PREDICTED: uncharacterized protein LOC102583748    135   5e-33   Solanum tuberosum [potatoes]
gb|KDP29834.1|  hypothetical protein JCGZ_18409                         135   5e-33   Jatropha curcas
ref|XP_010090637.1|  Chaperone protein dnaJ 49                          136   5e-33   Morus notabilis
ref|XP_002451000.1|  hypothetical protein SORBIDRAFT_05g022430          136   6e-33   
emb|CDX78942.1|  BnaA01g10090D                                          131   6e-33   
ref|XP_002523041.1|  conserved hypothetical protein                     135   7e-33   Ricinus communis
emb|CDY24701.1|  BnaA05g31000D                                          134   8e-33   Brassica napus [oilseed rape]
ref|XP_001775573.1|  predicted protein                                  127   8e-33   
ref|XP_007043977.1|  DNAJ heat shock N-terminal domain-containing...    135   1e-32   
emb|CBI22539.3|  unnamed protein product                                133   1e-32   Vitis vinifera
ref|XP_007038973.1|  Heat shock protein binding protein, putative...    134   1e-32   
ref|XP_004152307.1|  PREDICTED: uncharacterized protein LOC101221103    135   1e-32   Cucumis sativus [cucumbers]
gb|EMT01247.1|  DnaJ homolog subfamily B member 12                      134   2e-32   
gb|EEC75429.1|  hypothetical protein OsI_11948                          134   2e-32   Oryza sativa Indica Group [Indian rice]
gb|EMS53187.1|  DnaJ homolog subfamily B member 4                       134   2e-32   Triticum urartu
ref|NP_001050318.1|  Os03g0401200                                       134   2e-32   
ref|XP_007152424.1|  hypothetical protein PHAVU_004G129100g             134   2e-32   Phaseolus vulgaris [French bean]
gb|KJB74712.1|  hypothetical protein B456_012G003700                    134   2e-32   Gossypium raimondii
ref|XP_004234172.1|  PREDICTED: uncharacterized protein LOC101250663    134   2e-32   Solanum lycopersicum
ref|XP_004975834.1|  PREDICTED: uncharacterized protein LOC101769...    134   2e-32   Setaria italica
ref|XP_008454052.1|  PREDICTED: uncharacterized protein LOC103494591    134   3e-32   Cucumis melo [Oriental melon]
emb|CDM86961.1|  unnamed protein product                                134   3e-32   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010439682.1|  PREDICTED: J domain-containing protein DDB_G...    130   3e-32   Camelina sativa [gold-of-pleasure]
ref|XP_009120944.1|  PREDICTED: uncharacterized protein LOC103845806    134   4e-32   Brassica rapa
emb|CDX92582.1|  BnaA10g16210D                                          134   4e-32   
ref|XP_006287025.1|  hypothetical protein CARUB_v10000173mg             134   4e-32   Capsella rubella
ref|XP_010439680.1|  PREDICTED: J domain-containing protein DDB_G...    130   4e-32   
ref|XP_004512598.1|  PREDICTED: uncharacterized protein LOC101496391    133   4e-32   
gb|KHG17824.1|  DnaJ subfamily B member 12                              133   4e-32   
ref|XP_011036088.1|  PREDICTED: uncharacterized protein LOC105133703    133   4e-32   
gb|EPS73083.1|  hypothetical protein M569_01674                         132   5e-32   
ref|XP_002986890.1|  hypothetical protein SELMODRAFT_124892             132   5e-32   
ref|XP_010492912.1|  PREDICTED: uncharacterized protein LOC104770218    133   6e-32   
ref|XP_009108650.1|  PREDICTED: dnaJ homolog subfamily C member 1...    129   6e-32   
gb|EYU29751.1|  hypothetical protein MIMGU_mgv1a021223mg                129   6e-32   
ref|XP_006401739.1|  hypothetical protein EUTSA_v10013529mg             130   7e-32   
ref|XP_006283631.1|  hypothetical protein CARUB_v10004689mg             130   7e-32   
ref|XP_010662575.1|  PREDICTED: uncharacterized protein LOC100263793    132   7e-32   
gb|KHN16160.1|  Chaperone protein DnaJ                                  127   1e-31   
ref|XP_009108433.1|  PREDICTED: dnaJ homolog subfamily B member 1...    125   1e-31   
ref|XP_002864226.1|  hypothetical protein ARALYDRAFT_495386             132   1e-31   
ref|XP_010449327.1|  PREDICTED: dnaJ homolog subfamily C member 1...    129   1e-31   
ref|XP_003602211.1|  Curved DNA-binding protein                         132   1e-31   
ref|XP_008222181.1|  PREDICTED: uncharacterized protein LOC103322083    132   1e-31   
gb|EYU45589.1|  hypothetical protein MIMGU_mgv1a022395mg                130   1e-31   
ref|XP_011020760.1|  PREDICTED: uncharacterized protein LOC105123019    132   1e-31   
gb|KJB30883.1|  hypothetical protein B456_005G165700                    132   1e-31   
ref|XP_002303790.2|  hypothetical protein POPTR_0003s16970g             132   1e-31   
ref|XP_007225239.1|  hypothetical protein PRUPE_ppa001843mg             132   1e-31   
emb|CAN73866.1|  hypothetical protein VITISV_001272                     132   2e-31   
ref|XP_010913011.1|  PREDICTED: uncharacterized protein LOC105038805    132   2e-31   
ref|XP_006650175.1|  PREDICTED: uncharacterized protein LOC102715926    131   2e-31   
gb|EEC70673.1|  hypothetical protein OsI_01992                          132   2e-31   
ref|XP_010682744.1|  PREDICTED: uncharacterized protein LOC104897549    131   2e-31   
gb|EYU31305.1|  hypothetical protein MIMGU_mgv1a023767mg                128   2e-31   
gb|EYU19627.1|  hypothetical protein MIMGU_mgv1a026505mg                129   2e-31   
ref|XP_006413959.1|  hypothetical protein EUTSA_v10026814mg             129   2e-31   
ref|NP_200127.2|  DNAJ heat shock N-terminal domain-containing pr...    131   2e-31   
gb|AEG76902.1|  hypothetical protein                                    130   2e-31   
ref|XP_006283791.1|  hypothetical protein CARUB_v10004882mg             128   2e-31   
dbj|BAB08418.1|  DnaJ protein-like                                      131   2e-31   
emb|CDY19683.1|  BnaC09g29390D                                          130   2e-31   
ref|XP_010663896.1|  PREDICTED: uncharacterized protein LOC100854062    132   3e-31   
ref|XP_006590156.1|  PREDICTED: uncharacterized J domain-containi...    127   3e-31   
ref|XP_002299311.2|  hypothetical protein POPTR_0001s13760g             131   3e-31   
gb|EYU19629.1|  hypothetical protein MIMGU_mgv1a019849mg                129   3e-31   
ref|XP_009119854.1|  PREDICTED: uncharacterized protein LOC103844793    130   3e-31   
ref|XP_010431643.1|  PREDICTED: dnaJ homolog subfamily B member 1...    124   3e-31   
ref|NP_198554.1|  chaperone DnaJ-domain superfamily protein             128   3e-31   
ref|XP_011457491.1|  PREDICTED: uncharacterized protein LOC101306...    127   4e-31   
ref|XP_002977771.1|  hypothetical protein SELMODRAFT_417753             130   4e-31   
ref|XP_002870522.1|  DNAJ heat shock N-terminal domain-containing...    128   4e-31   
ref|XP_004310222.1|  PREDICTED: uncharacterized protein LOC101306...    128   4e-31   
ref|XP_009783565.1|  PREDICTED: uncharacterized protein LOC104232145    130   4e-31   
ref|XP_010926821.1|  PREDICTED: uncharacterized protein LOC105048990    130   5e-31   
ref|XP_003533259.1|  PREDICTED: uncharacterized protein LOC100816712    130   5e-31   
gb|KHG16019.1|  DnaJ subfamily B member 12                              130   5e-31   
gb|KHN44039.1|  DnaJ like subfamily B member 14                         130   5e-31   
ref|XP_006596287.1|  PREDICTED: uncharacterized protein LOC100799...    130   5e-31   
gb|KHN27870.1|  DnaJ like subfamily B member 14                         130   5e-31   
ref|XP_009132938.1|  PREDICTED: putative mediator of RNA polymera...    129   5e-31   
ref|XP_010434391.1|  PREDICTED: uncharacterized protein LOC104718361    126   5e-31   
ref|XP_009412764.1|  PREDICTED: uncharacterized protein LOC103994165    130   5e-31   
gb|EYU25205.1|  hypothetical protein MIMGU_mgv1a002180mg                129   6e-31   
ref|XP_008437584.1|  PREDICTED: uncharacterized protein LOC103482955    130   6e-31   
ref|XP_006340069.1|  PREDICTED: uncharacterized protein LOC102590...    130   7e-31   
emb|CAA16934.1|  putative protein                                       128   7e-31   
ref|XP_003619591.1|  Chaperone protein dnaJ                             130   7e-31   
emb|CDX76475.1|  BnaA08g09250D                                          123   7e-31   
ref|NP_193692.2|  chaperone DnaJ-domain containing protein              128   7e-31   
ref|XP_010420651.1|  PREDICTED: uncharacterized protein LOC104706189    130   8e-31   
ref|XP_004169437.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    129   8e-31   
ref|XP_006282799.1|  hypothetical protein CARUB_v10006409mg             125   9e-31   
ref|XP_008798935.1|  PREDICTED: uncharacterized protein LOC103713704    129   1e-30   
ref|XP_010439685.1|  PREDICTED: dnaJ homolog subfamily C member 1...    122   1e-30   
ref|XP_004145984.1|  PREDICTED: uncharacterized protein LOC101216332    129   1e-30   
gb|KHN24434.1|  DnaJ like subfamily B member 14                         129   1e-30   
ref|XP_003543931.1|  PREDICTED: uncharacterized protein LOC100792...    129   1e-30   
ref|XP_003549151.1|  PREDICTED: uncharacterized protein LOC100806402    129   1e-30   
ref|XP_006400429.1|  hypothetical protein EUTSA_v10012639mg             129   1e-30   
gb|KCW89182.1|  hypothetical protein EUGRSUZ_A01493                     128   1e-30   
ref|XP_002448911.1|  hypothetical protein SORBIDRAFT_05g001350          129   1e-30   
emb|CDX99362.1|  BnaC01g11900D                                          124   1e-30   
ref|XP_010049356.1|  PREDICTED: uncharacterized protein LOC104437996    128   1e-30   
gb|EPS62181.1|  hypothetical protein M569_12612                         127   1e-30   
ref|XP_006403563.1|  hypothetical protein EUTSA_v10010173mg             128   2e-30   
ref|XP_011084494.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    129   2e-30   
ref|XP_002511171.1|  conserved hypothetical protein                     128   2e-30   
gb|AFW58461.1|  hypothetical protein ZEAMMB73_163525                    128   2e-30   
ref|XP_010430728.1|  PREDICTED: dnaJ homolog subfamily B member 1...    122   3e-30   
ref|XP_006848259.1|  hypothetical protein AMTR_s00013p00055400          128   3e-30   
ref|XP_004228961.1|  PREDICTED: uncharacterized protein LOC101261851    128   3e-30   
ref|XP_010449335.1|  PREDICTED: uncharacterized protein LOC104731610    125   3e-30   
ref|XP_010440884.1|  PREDICTED: dnaJ homolog subfamily B member 1...    121   3e-30   
ref|XP_004498402.1|  PREDICTED: uncharacterized protein LOC101505779    127   3e-30   
ref|XP_006393616.1|  hypothetical protein EUTSA_v10012020mg             124   3e-30   
ref|XP_010547062.1|  PREDICTED: uncharacterized protein LOC104818952    125   4e-30   
ref|XP_009132926.1|  PREDICTED: uncharacterized protein LOC103857485    125   4e-30   
gb|EYU23078.1|  hypothetical protein MIMGU_mgv1a027078mg                127   4e-30   
ref|XP_010434390.1|  PREDICTED: uncharacterized protein LOC104718...    125   5e-30   
emb|CDX78941.1|  BnaA01g10080D                                          125   5e-30   
ref|XP_010449333.1|  PREDICTED: uncharacterized J domain-containi...    123   5e-30   
ref|XP_010905504.1|  PREDICTED: uncharacterized protein LOC105032...    127   6e-30   
ref|XP_009623439.1|  PREDICTED: uncharacterized protein LOC104114650    127   6e-30   
ref|XP_008663253.1|  PREDICTED: uncharacterized protein LOC103641716    127   6e-30   
ref|XP_011023992.1|  PREDICTED: uncharacterized protein LOC105125300    127   7e-30   
ref|XP_008801668.1|  PREDICTED: uncharacterized protein LOC103715...    127   8e-30   
ref|XP_008801670.1|  PREDICTED: uncharacterized protein LOC103715...    127   8e-30   
ref|XP_009382887.1|  PREDICTED: uncharacterized protein LOC103970715    127   8e-30   
ref|NP_193693.5|  DNAJ heat shock N-terminal domain-containing pr...    122   9e-30   
ref|XP_008801669.1|  PREDICTED: uncharacterized protein LOC103715...    126   1e-29   
ref|XP_010695370.1|  PREDICTED: uncharacterized protein LOC104908022    126   1e-29   
ref|XP_010434389.1|  PREDICTED: uncharacterized protein LOC104718...    124   1e-29   
ref|XP_002446605.1|  hypothetical protein SORBIDRAFT_06g018790          126   1e-29   
ref|XP_008239484.1|  PREDICTED: uncharacterized protein LOC103338076    126   1e-29   
ref|XP_010451364.1|  PREDICTED: trithorax group protein osa-like        125   1e-29   
ref|XP_010252729.1|  PREDICTED: uncharacterized protein LOC104594222    126   1e-29   
ref|XP_007210212.1|  hypothetical protein PRUPE_ppa015942mg             126   1e-29   
gb|KDP22162.1|  hypothetical protein JCGZ_25993                         126   1e-29   
ref|XP_002871838.1|  DNAJ heat shock N-terminal domain-containing...    126   1e-29   
ref|XP_011086816.1|  PREDICTED: uncharacterized protein LOC105168432    125   2e-29   
ref|XP_006413957.1|  hypothetical protein EUTSA_v10026830mg             122   2e-29   
ref|XP_006413958.1|  hypothetical protein EUTSA_v10027481mg             119   3e-29   
ref|NP_197376.1|  DNAJ heat shock N-terminal domain-containing pr...    125   3e-29   
gb|KDP22610.1|  hypothetical protein JCGZ_26441                         125   3e-29   
gb|KJB08008.1|  hypothetical protein B456_001G058400                    125   3e-29   
ref|XP_010317534.1|  PREDICTED: uncharacterized protein LOC101256846    125   3e-29   
gb|KFK41766.1|  hypothetical protein AALP_AA2G169400                    121   3e-29   
gb|EEC70674.1|  hypothetical protein OsI_01993                          116   4e-29   
ref|XP_002985799.1|  hypothetical protein SELMODRAFT_122991             115   4e-29   
ref|XP_004986920.1|  PREDICTED: uncharacterized protein LOC101775819    120   4e-29   
ref|XP_008777980.1|  PREDICTED: uncharacterized protein LOC103697819    125   4e-29   
ref|XP_006413960.1|  hypothetical protein EUTSA_v10027069mg             120   4e-29   
emb|CDP15001.1|  unnamed protein product                                125   5e-29   
ref|XP_010317532.1|  PREDICTED: dnaJ homolog subfamily B member 1...    117   5e-29   
ref|XP_010450532.1|  PREDICTED: dnaJ homolog subfamily C member 1...    120   5e-29   
ref|XP_010434387.1|  PREDICTED: uncharacterized protein LOC104718...    120   6e-29   
ref|XP_006351566.1|  PREDICTED: uncharacterized protein LOC102587832    125   6e-29   
ref|XP_007218930.1|  hypothetical protein PRUPE_ppa002023mg             124   6e-29   
ref|XP_010230138.1|  PREDICTED: meiotically up-regulated gene 184...    122   6e-29   
ref|XP_002878862.1|  DNAJ heat shock N-terminal domain-containing...    124   7e-29   
gb|KCW83148.1|  hypothetical protein EUGRSUZ_B00103                     124   7e-29   
ref|XP_010026454.1|  PREDICTED: uncharacterized protein LOC104416806    124   7e-29   
ref|XP_008234769.1|  PREDICTED: uncharacterized protein LOC103333...    124   9e-29   
gb|EPS57220.1|  hypothetical protein M569_17600                         123   9e-29   
ref|XP_004302453.1|  PREDICTED: uncharacterized protein LOC101303433    124   1e-28   
ref|XP_010097851.1|  Curved DNA-binding protein                         124   1e-28   
gb|EYU23079.1|  hypothetical protein MIMGU_mgv1a019810mg                119   1e-28   
ref|XP_006304610.1|  hypothetical protein CARUB_v10011682mg             123   1e-28   
ref|XP_010472555.1|  PREDICTED: uncharacterized protein LOC104752186    123   1e-28   
ref|XP_009796507.1|  PREDICTED: uncharacterized protein LOC104243077    123   2e-28   
ref|XP_010671500.1|  PREDICTED: uncharacterized protein LOC104888282    123   2e-28   
ref|XP_002513578.1|  heat shock protein binding protein, putative       123   2e-28   
ref|XP_009352045.1|  PREDICTED: uncharacterized protein LOC103943...    123   2e-28   
emb|CDY27107.1|  BnaA08g07450D                                          119   2e-28   
ref|XP_006436852.1|  hypothetical protein CICLE_v10030731mg             123   2e-28   
ref|XP_006285464.1|  hypothetical protein CARUB_v10006882mg             119   2e-28   
ref|XP_010450494.1|  PREDICTED: dnaJ homolog subfamily B member 1...    118   3e-28   
emb|CDX99361.1|  BnaC01g11910D                                          115   3e-28   
ref|XP_010429550.1|  PREDICTED: uncharacterized protein LOC104714020    122   3e-28   
emb|CDY12382.1|  BnaC08g08230D                                          119   3e-28   
ref|XP_002322265.2|  hypothetical protein POPTR_0015s10950g             122   3e-28   
ref|XP_006413956.1|  hypothetical protein EUTSA_v10026868mg             119   3e-28   
gb|EMS54548.1|  DnaJ homolog subfamily B member 12                      122   3e-28   
gb|KDO47302.1|  hypothetical protein CISIN_1g003686mg                   122   5e-28   
ref|XP_002318382.2|  hypothetical protein POPTR_0012s01580g             121   5e-28   
ref|XP_009368675.1|  PREDICTED: uncharacterized protein LOC103958158    122   5e-28   
ref|XP_006293760.1|  hypothetical protein CARUB_v10022724mg             121   5e-28   
ref|XP_009357372.1|  PREDICTED: uncharacterized protein LOC103948100    121   6e-28   
ref|XP_006405891.1|  hypothetical protein EUTSA_v10027781mg             119   6e-28   
ref|XP_010435615.1|  PREDICTED: J protein JJJ2-like                     118   6e-28   
ref|XP_002321448.1|  hypothetical protein POPTR_0015s02180g             120   7e-28   
ref|XP_010440846.1|  PREDICTED: uncharacterized protein LOC104724098    119   8e-28   
ref|XP_010450492.1|  PREDICTED: uncharacterized protein LOC104732...    119   8e-28   
ref|XP_009404249.1|  PREDICTED: uncharacterized protein LOC103987623    121   8e-28   
ref|XP_006422145.1|  hypothetical protein CICLE_v10004367mg             121   9e-28   
ref|XP_009108080.1|  PREDICTED: uncharacterized protein LOC103833764    118   9e-28   
ref|XP_010435569.1|  PREDICTED: uncharacterized protein LOC104719354    118   1e-27   
ref|XP_010417322.1|  PREDICTED: uncharacterized protein LOC104703082    120   1e-27   
gb|EMT05451.1|  DnaJ homolog subfamily B member 12                      120   1e-27   
ref|XP_009108432.1|  PREDICTED: dnaJ homolog subfamily B member 14      114   1e-27   
emb|CDX76474.1|  BnaA08g09260D                                          115   2e-27   
emb|CAA16935.1|  putative protein                                       116   2e-27   
ref|XP_010445577.1|  PREDICTED: uncharacterized protein LOC104728270    120   2e-27   
ref|XP_011005524.1|  PREDICTED: uncharacterized protein LOC105111772    120   2e-27   
ref|XP_009390801.1|  PREDICTED: uncharacterized protein LOC103977107    120   2e-27   
ref|XP_002449677.1|  hypothetical protein SORBIDRAFT_05g021520          119   2e-27   
ref|XP_006376902.1|  hypothetical protein POPTR_0012s10060g             120   2e-27   
ref|XP_006838365.1|  hypothetical protein AMTR_s00002p00023650          119   2e-27   
ref|XP_008380669.1|  PREDICTED: uncharacterized protein LOC103443...    120   2e-27   
gb|EMT09916.1|  Chaperone protein dnaJ                                  120   3e-27   
ref|XP_009390392.1|  PREDICTED: uncharacterized protein LOC103976792    119   4e-27   
ref|XP_002318734.2|  hypothetical protein POPTR_0012s10060g             119   4e-27   
ref|XP_010446075.1|  PREDICTED: uncharacterized protein LOC104728843    117   4e-27   
ref|NP_193694.1|  chaperone DnaJ-domain containing protein              115   5e-27   
ref|XP_009602538.1|  PREDICTED: uncharacterized protein LOC104097643    119   5e-27   
ref|NP_180126.1|  DNAJ heat shock N-terminal domain-containing pr...    118   5e-27   
ref|XP_010450534.1|  PREDICTED: chaperone protein dnaJ 6-like           115   5e-27   
ref|XP_002869979.1|  hypothetical protein ARALYDRAFT_492908             114   5e-27   
ref|XP_004975415.1|  PREDICTED: uncharacterized protein LOC101772896    118   8e-27   
ref|XP_006405160.1|  hypothetical protein EUTSA_v10000169mg             115   1e-26   
gb|EMS47358.1|  Chaperone protein DnaJ                                  117   1e-26   
ref|XP_002869975.1|  hypothetical protein ARALYDRAFT_492907             114   1e-26   
emb|CDM84943.1|  unnamed protein product                                117   1e-26   
emb|CDX76473.1|  BnaA08g09270D                                          112   1e-26   
ref|XP_003522436.1|  PREDICTED: uncharacterized protein LOC100788095    117   1e-26   
gb|KHN23982.1|  DnAJ-like protein                                       117   2e-26   
gb|EMT05599.1|  Chaperone protein dnaJ                                  117   2e-26   
ref|XP_010556127.1|  PREDICTED: uncharacterized protein LOC104825495    117   2e-26   
emb|CDY35353.1|  BnaA04g14940D                                          115   3e-26   
ref|XP_010475890.1|  PREDICTED: uncharacterized protein LOC104755239    116   4e-26   
ref|XP_009140680.1|  PREDICTED: uncharacterized protein LOC103864672    115   4e-26   
ref|XP_011044129.1|  PREDICTED: uncharacterized protein LOC105139412    116   4e-26   
ref|XP_010228156.1|  PREDICTED: uncharacterized protein LOC100842613    116   5e-26   
ref|XP_008376701.1|  PREDICTED: uncharacterized protein LOC103439...    115   5e-26   
ref|XP_009375240.1|  PREDICTED: uncharacterized protein LOC103964078    116   6e-26   
ref|XP_004138256.1|  PREDICTED: uncharacterized protein LOC101223022    116   6e-26   
ref|XP_008464425.1|  PREDICTED: uncharacterized protein LOC103502316    115   7e-26   
ref|XP_006652213.1|  PREDICTED: uncharacterized protein LOC102711249    115   8e-26   
ref|XP_006405159.1|  hypothetical protein EUTSA_v10000086mg             115   8e-26   
gb|EAY93887.1|  hypothetical protein OsI_15662                          115   8e-26   
ref|XP_006393695.1|  hypothetical protein EUTSA_v10012364mg             112   9e-26   
ref|XP_003579619.1|  PREDICTED: uncharacterized protein LOC100838049    115   1e-25   
emb|CAE05535.2|  OSJNBa0053B21.9                                        115   1e-25   
ref|XP_002446305.1|  hypothetical protein SORBIDRAFT_06g013910          115   1e-25   
gb|EAY77031.1|  hypothetical protein OsI_04986                          115   1e-25   
ref|NP_001045242.1|  Os01g0923800                                       115   1e-25   



>ref|XP_009781696.1| PREDICTED: uncharacterized protein LOC104230558 [Nicotiana sylvestris]
 ref|XP_009781697.1| PREDICTED: uncharacterized protein LOC104230558 [Nicotiana sylvestris]
 ref|XP_009781698.1| PREDICTED: uncharacterized protein LOC104230558 [Nicotiana sylvestris]
Length=777

 Score =   212 bits (539),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 114/148 (77%), Positives = 131/148 (89%), Gaps = 1/148 (1%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKNM  373
            MECN+DEAL+AKELAEKKMQ+NDF GAQKVA KA+RLYP LENI+QLLAVCNVHCSA++ 
Sbjct  1    MECNRDEALRAKELAEKKMQSNDFLGAQKVALKAERLYPQLENISQLLAVCNVHCSAQSS  60

Query  374  -LGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSD  550
             +G +KDWYGILQ+D  ADEVTIKKQYR+LALVLHPDKNKFPGAEAAFKLIGEAN+LLSD
Sbjct  61   KVGSEKDWYGILQIDMMADEVTIKKQYRRLALVLHPDKNKFPGAEAAFKLIGEANMLLSD  120

Query  551  QTKRSIYDSKCRVSIRSTSMRPPPHQVN  634
              KR++YDSK R   + T+ + PPHQVN
Sbjct  121  PAKRALYDSKYRFLSKGTTAKRPPHQVN  148



>ref|XP_009609945.1| PREDICTED: uncharacterized protein LOC104103724 [Nicotiana tomentosiformis]
 ref|XP_009609946.1| PREDICTED: uncharacterized protein LOC104103724 [Nicotiana tomentosiformis]
 ref|XP_009609947.1| PREDICTED: uncharacterized protein LOC104103724 [Nicotiana tomentosiformis]
 ref|XP_009609948.1| PREDICTED: uncharacterized protein LOC104103724 [Nicotiana tomentosiformis]
Length=780

 Score =   209 bits (533),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 113/148 (76%), Positives = 131/148 (89%), Gaps = 1/148 (1%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKNM  373
            MECN+DEAL+AKELAEKKMQ+NDF GAQKVA KA+RL+P LENI+QLLAVCNVHCSA++ 
Sbjct  1    MECNRDEALRAKELAEKKMQSNDFLGAQKVALKAERLHPQLENISQLLAVCNVHCSAQSS  60

Query  374  -LGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSD  550
             +G +KDWYGILQ+D  ADEVTIKKQYR+LALVLHPDKNKFPGAEAAFKLIGEAN+LLSD
Sbjct  61   KVGSEKDWYGILQIDMMADEVTIKKQYRRLALVLHPDKNKFPGAEAAFKLIGEANMLLSD  120

Query  551  QTKRSIYDSKCRVSIRSTSMRPPPHQVN  634
              KR++YDSK R   + T+ + PPHQVN
Sbjct  121  PAKRALYDSKYRFLSKGTTAKRPPHQVN  148



>ref|XP_011078022.1| PREDICTED: uncharacterized protein LOC105161875 [Sesamum indicum]
 ref|XP_011078023.1| PREDICTED: uncharacterized protein LOC105161875 [Sesamum indicum]
Length=789

 Score =   208 bits (529),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 106/148 (72%), Positives = 129/148 (87%), Gaps = 1/148 (1%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSA-KN  370
            M+CNKDEA++AK++AE KM+NNDFEGA+KVA KAQ LYP+LENI QLL++C+VHCSA K 
Sbjct  1    MDCNKDEAIRAKQIAENKMENNDFEGARKVALKAQSLYPELENIAQLLSICDVHCSAQKR  60

Query  371  MLGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSD  550
            MLG +KDWY ILQV+  ADE+TIKKQYR+LAL LHPDKN+FPGAEAAFKLI EAN +LSD
Sbjct  61   MLGSEKDWYAILQVESLADELTIKKQYRRLALFLHPDKNRFPGAEAAFKLICEANAVLSD  120

Query  551  QTKRSIYDSKCRVSIRSTSMRPPPHQVN  634
             TK+S+YDSK RV++RS  + PPPH +N
Sbjct  121  PTKKSLYDSKIRVTVRSAFVNPPPHHMN  148



>ref|XP_011093758.1| PREDICTED: uncharacterized protein LOC105173636 [Sesamum indicum]
Length=826

 Score =   205 bits (521),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 103/145 (71%), Positives = 128/145 (88%), Gaps = 1/145 (1%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAK-N  370
            MECNKDEA++AKE+AEKKM+ NDFEGA K+A KAQ LYP+L+NI QLL++CNVHCSA+  
Sbjct  1    MECNKDEAIRAKEIAEKKMEKNDFEGALKIALKAQNLYPELDNITQLLSICNVHCSAQIR  60

Query  371  MLGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSD  550
            +LG +KDWYGILQV++ ADE+T+KKQYR+LAL+LHPDKN+FPGAE+AFKLI EAN +LSD
Sbjct  61   LLGSEKDWYGILQVEKLADELTVKKQYRRLALILHPDKNRFPGAESAFKLICEANAVLSD  120

Query  551  QTKRSIYDSKCRVSIRSTSMRPPPH  625
              K+S+YDSK RVS+RS  + PPPH
Sbjct  121  PKKKSVYDSKIRVSVRSAPVNPPPH  145



>ref|XP_009803262.1| PREDICTED: uncharacterized protein LOC104248655 [Nicotiana sylvestris]
 ref|XP_009803264.1| PREDICTED: uncharacterized protein LOC104248655 [Nicotiana sylvestris]
Length=1079

 Score =   204 bits (520),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 110/148 (74%), Positives = 130/148 (88%), Gaps = 1/148 (1%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKN-  370
            M+CNKDEALKAKELAEKK+ NNDFEGA+KVA KA+RLYP LENI+QLLAVCNVHCS++N 
Sbjct  1    MDCNKDEALKAKELAEKKLLNNDFEGAKKVAVKAERLYPQLENISQLLAVCNVHCSSQNK  60

Query  371  MLGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSD  550
            ++G ++DWYGILQ+D+ +DE TIKKQYR+LALVLHPDKNK PGAEAAFKLI EAN++LSD
Sbjct  61   IVGSERDWYGILQIDKFSDEATIKKQYRRLALVLHPDKNKLPGAEAAFKLIVEANMVLSD  120

Query  551  QTKRSIYDSKCRVSIRSTSMRPPPHQVN  634
              KRS YD+KC+V  +S   R PPHQVN
Sbjct  121  PVKRSSYDNKCKVLSKSFVARQPPHQVN  148



>ref|XP_010312310.1| PREDICTED: uncharacterized protein LOC101260185 [Solanum lycopersicum]
Length=1086

 Score =   204 bits (519),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 107/148 (72%), Positives = 129/148 (87%), Gaps = 1/148 (1%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKN-  370
            M+CNKDEA++AKE+AEKKM NNDFEGA+KVA KA++LYP LENI+QLLAVCNVHCSA+N 
Sbjct  1    MDCNKDEAMRAKEVAEKKMLNNDFEGAKKVAVKAEQLYPQLENISQLLAVCNVHCSAQNN  60

Query  371  MLGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSD  550
             +G ++DWYGILQ+DR +DE T+KKQYR+LAL+LHPDKNK PGAEAAFKLI EAN++LSD
Sbjct  61   RVGSERDWYGILQIDRLSDEATVKKQYRRLALMLHPDKNKLPGAEAAFKLIVEANMVLSD  120

Query  551  QTKRSIYDSKCRVSIRSTSMRPPPHQVN  634
            Q KRS+YDSK RV   +   +PPPH VN
Sbjct  121  QVKRSLYDSKYRVMSGAGIAKPPPHMVN  148



>emb|CDP15840.1| unnamed protein product [Coffea canephora]
Length=1135

 Score =   204 bits (520),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 109/148 (74%), Positives = 128/148 (86%), Gaps = 1/148 (1%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKN-  370
            MECNKDEA++AKE+AEKKM+NNDF GAQ++A KAQ+L+P+LENI QLLAVCNVHCSA+  
Sbjct  1    MECNKDEAIRAKEIAEKKMRNNDFVGAQRIALKAQQLFPELENITQLLAVCNVHCSAETR  60

Query  371  MLGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSD  550
            +LG +KDWY ILQV+R ADEVTIKKQYRKLALVLHPDKNK+PGAEAAFKLIGEA+V+LSD
Sbjct  61   ILGSEKDWYSILQVERLADEVTIKKQYRKLALVLHPDKNKYPGAEAAFKLIGEAHVVLSD  120

Query  551  QTKRSIYDSKCRVSIRSTSMRPPPHQVN  634
            + KRSI+D K   SI S   +PP  Q N
Sbjct  121  RGKRSIFDRKFASSITSAQAKPPTRQAN  148



>ref|XP_006343519.1| PREDICTED: uncharacterized protein LOC102599775 isoform X1 [Solanum 
tuberosum]
 ref|XP_006343520.1| PREDICTED: uncharacterized protein LOC102599775 isoform X2 [Solanum 
tuberosum]
Length=803

 Score =   201 bits (512),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 110/156 (71%), Positives = 133/156 (85%), Gaps = 4/156 (3%)
 Frame = +2

Query  170  LTYFLVLLMECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCN  349
            +  F+ ++MECNKDEAL+AKELAEKKMQ+NDF GAQKVA KA+RLYP LENI+QLLAVCN
Sbjct  9    INIFIGIVMECNKDEALRAKELAEKKMQSNDFLGAQKVAQKAERLYPQLENISQLLAVCN  68

Query  350  VHCSAKN-MLGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIG  526
            VHCSA++  +G +KDWY ILQ+D SADEVTIKKQYR+LALVLHPDKNKFPGAEAAFKLIG
Sbjct  69   VHCSAQSSTVGSEKDWYRILQIDMSADEVTIKKQYRRLALVLHPDKNKFPGAEAAFKLIG  128

Query  527  EANVLLSDQTKRSIYDSKCRVSIRSTSMRPPPHQVN  634
            E+N++LSD TKR+++DSK R   +  + +    QVN
Sbjct  129  ESNMVLSDPTKRTLFDSKYRFFSKGAAAK---RQVN  161



>ref|XP_006347843.1| PREDICTED: uncharacterized protein LOC102585480 [Solanum tuberosum]
Length=1081

 Score =   203 bits (517),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 108/148 (73%), Positives = 129/148 (87%), Gaps = 1/148 (1%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKN-  370
            M+CNKDEAL+AKE+AEKKM NNDFEGA+KVA KA++LYP LENI+QLLAVCNVHCSA+N 
Sbjct  1    MDCNKDEALRAKEVAEKKMLNNDFEGAKKVAVKAEQLYPQLENISQLLAVCNVHCSAQNN  60

Query  371  MLGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSD  550
             +G ++DWYGILQ+DR +DE TIKKQYR+LAL+LHPDKNK PGAEAAFKLI EAN++LSD
Sbjct  61   RVGSERDWYGILQIDRLSDEATIKKQYRRLALMLHPDKNKLPGAEAAFKLIVEANMVLSD  120

Query  551  QTKRSIYDSKCRVSIRSTSMRPPPHQVN  634
            Q KRS+YD+K RV   +   +PPPH VN
Sbjct  121  QVKRSLYDNKYRVMSGAGVAKPPPHMVN  148



>ref|XP_009616187.1| PREDICTED: uncharacterized protein LOC104108774 [Nicotiana tomentosiformis]
 ref|XP_009616188.1| PREDICTED: uncharacterized protein LOC104108774 [Nicotiana tomentosiformis]
Length=1079

 Score =   202 bits (515),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 109/148 (74%), Positives = 130/148 (88%), Gaps = 1/148 (1%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKN-  370
            M+CNKDEALKAKELAEKK+ NNDFEGA+KVA KA+RLYP LENI+QLLAVCNVHCS++N 
Sbjct  1    MDCNKDEALKAKELAEKKLLNNDFEGAKKVAVKAERLYPQLENISQLLAVCNVHCSSQNK  60

Query  371  MLGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSD  550
            ++G ++DWYGILQ+D+ +DE TIKKQYR+LALVLHPDKNK PGAEAAFKLI EAN++LSD
Sbjct  61   VVGSERDWYGILQIDKFSDESTIKKQYRRLALVLHPDKNKLPGAEAAFKLIVEANMVLSD  120

Query  551  QTKRSIYDSKCRVSIRSTSMRPPPHQVN  634
              KRS YD+KC+V  +S   + PPHQVN
Sbjct  121  PVKRSSYDNKCKVLSKSFVAKQPPHQVN  148



>ref|XP_004244900.1| PREDICTED: uncharacterized protein LOC101266847 [Solanum lycopersicum]
 ref|XP_004244901.1| PREDICTED: uncharacterized protein LOC101266847 [Solanum lycopersicum]
Length=789

 Score =   199 bits (505),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 109/148 (74%), Positives = 129/148 (87%), Gaps = 4/148 (3%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAK-N  370
            MECNKDEAL+AKELAEKKMQ+NDF GAQKVA KA+RLYP LENI+QLLAVCNVHCSA+ N
Sbjct  1    MECNKDEALRAKELAEKKMQSNDFLGAQKVAQKAERLYPQLENISQLLAVCNVHCSAQSN  60

Query  371  MLGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSD  550
             +G +KDWY ILQ+++SADEVTIKKQYR+LALVLHPDKNKFPGAEAAFKLIGE+N++LSD
Sbjct  61   TVGSEKDWYRILQIEQSADEVTIKKQYRRLALVLHPDKNKFPGAEAAFKLIGESNMVLSD  120

Query  551  QTKRSIYDSKCRVSIRSTSMRPPPHQVN  634
             TKR++YDSK +   +  + +    QVN
Sbjct  121  PTKRALYDSKYKFFSKGAAAK---RQVN  145



>gb|EPS64515.1| hypothetical protein M569_10265, partial [Genlisea aurea]
Length=131

 Score =   183 bits (465),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 92/131 (70%), Positives = 115/131 (88%), Gaps = 0/131 (0%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKNM  373
            M+CNKDEA++AK LA KKM NNDFEGA+K+A KAQ L+P+LENINQLL+VC+VHCSA+  
Sbjct  1    MDCNKDEAMRAKVLAAKKMSNNDFEGARKIALKAQNLFPELENINQLLSVCDVHCSAQRR  60

Query  374  LGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSDQ  553
            +G +KDWYGILQV++ +DE+ +KKQYR+LAL LHPDKN+ PGAE AFKLI EA+ +LSD+
Sbjct  61   VGSEKDWYGILQVEKLSDELAVKKQYRRLALYLHPDKNQLPGAEGAFKLISEAHNVLSDK  120

Query  554  TKRSIYDSKCR  586
            TK+SIYDSK R
Sbjct  121  TKKSIYDSKLR  131



>gb|EYU28380.1| hypothetical protein MIMGU_mgv1a002234mg [Erythranthe guttata]
Length=698

 Score =   195 bits (496),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 103/148 (70%), Positives = 126/148 (85%), Gaps = 5/148 (3%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSA-KN  370
            M+CNKDEA++AK+LAEKKM+ NDFEGA+K+  KAQ LYP+LEN+NQLL++C+VHCS+ K+
Sbjct  1    MDCNKDEAVRAKQLAEKKMETNDFEGARKIVIKAQNLYPELENVNQLLSICDVHCSSQKS  60

Query  371  MLGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSD  550
            MLG DKDWYGILQV++ ADE T+KKQYRKLAL LHPDKN+FPGAEAAFKLI EAN +LSD
Sbjct  61   MLGSDKDWYGILQVEKFADESTVKKQYRKLALFLHPDKNRFPGAEAAFKLICEANAVLSD  120

Query  551  QTKRSIYDSKCRVSIRSTSMRPPPHQVN  634
             TK+S+YD+K RV +R      P H VN
Sbjct  121  PTKKSLYDNKIRVPVRYQ----PQHHVN  144



>emb|CBI34299.3| unnamed protein product [Vitis vinifera]
Length=804

 Score =   196 bits (497),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 100/148 (68%), Positives = 129/148 (87%), Gaps = 1/148 (1%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKN-  370
            M+CNK+EAL+AK ++EKKMQ+ DF GA+++A +AQ+L+PDLENI+QLL VC+VHCSA+N 
Sbjct  1    MDCNKEEALRAKVISEKKMQSGDFIGARRIAQRAQQLFPDLENISQLLTVCDVHCSAQNK  60

Query  371  MLGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSD  550
            + G + DWYGIL+V+++AD+  IKKQYRKLAL+LHPDKNKF GAEAAFKLIGEAN +LSD
Sbjct  61   IYGTEMDWYGILKVEQAADDAIIKKQYRKLALLLHPDKNKFAGAEAAFKLIGEANRILSD  120

Query  551  QTKRSIYDSKCRVSIRSTSMRPPPHQVN  634
            Q KRS YD K RVS++ T+ +PPPHQ+N
Sbjct  121  QGKRSAYDMKYRVSLKHTAPKPPPHQLN  148



>ref|XP_006382690.1| hypothetical protein POPTR_0005s04470g [Populus trichocarpa]
 gb|ERP60487.1| hypothetical protein POPTR_0005s04470g [Populus trichocarpa]
Length=1126

 Score =   196 bits (499),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 102/148 (69%), Positives = 123/148 (83%), Gaps = 1/148 (1%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKNM  373
            MECNKDEA++AK++AE+KMQN DFEGA+K+A KA +LYPDLENI+Q+LAVC VHCSA+N 
Sbjct  1    MECNKDEAIRAKDIAERKMQNGDFEGAKKIALKALQLYPDLENISQMLAVCEVHCSAQNK  60

Query  374  L-GLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSD  550
            L G + DWYGILQ++R +DE  IKKQYRK AL LHPDKNKF GAEAAFKLIGEAN +L+D
Sbjct  61   LYGSEMDWYGILQIERFSDEAVIKKQYRKFALSLHPDKNKFSGAEAAFKLIGEANRVLTD  120

Query  551  QTKRSIYDSKCRVSIRSTSMRPPPHQVN  634
              KRS+YD KC+ S+R  + RP  HQ N
Sbjct  121  PAKRSLYDLKCKRSVRPPAPRPTSHQSN  148



>gb|KJB44643.1| hypothetical protein B456_007G263700 [Gossypium raimondii]
 gb|KJB44644.1| hypothetical protein B456_007G263700 [Gossypium raimondii]
 gb|KJB44645.1| hypothetical protein B456_007G263700 [Gossypium raimondii]
 gb|KJB44646.1| hypothetical protein B456_007G263700 [Gossypium raimondii]
Length=359

 Score =   187 bits (475),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 96/137 (70%), Positives = 117/137 (85%), Gaps = 1/137 (1%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKN-  370
            MECNK+EA++A+ +AE+KMQN DFEGA+K A KAQ+L+P+LENI QLL VCNVH  AKN 
Sbjct  1    MECNKEEAVRARRIAEQKMQNGDFEGAKKFALKAQKLFPELENIPQLLTVCNVHYCAKNK  60

Query  371  MLGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSD  550
            + G + DWYGILQ+ RSADE +IKKQYRKLAL+LHPDKNKF GAEAAFKLIGEAN +LSD
Sbjct  61   LFGSEMDWYGILQIKRSADETSIKKQYRKLALLLHPDKNKFAGAEAAFKLIGEANRVLSD  120

Query  551  QTKRSIYDSKCRVSIRS  601
            Q  RS YD KC++S+++
Sbjct  121  QMNRSQYDLKCKISVKT  137



>ref|XP_002319580.2| hypothetical protein POPTR_0013s03040g [Populus trichocarpa]
 gb|EEE95503.2| hypothetical protein POPTR_0013s03040g [Populus trichocarpa]
Length=1091

 Score =   196 bits (498),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 99/148 (67%), Positives = 124/148 (84%), Gaps = 1/148 (1%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKNM  373
            MECNKDEA++AK++A++KMQN DFEGA+K+A KA++LYP+L+NI+Q+LAVC VHCSA+N 
Sbjct  1    MECNKDEAIRAKDIADRKMQNGDFEGARKIALKARQLYPELDNISQMLAVCEVHCSAQNK  60

Query  374  L-GLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSD  550
            L G D DWYGILQ++R +DE  IKKQYRK AL LHPDKNKF GAEAAFKLIGEAN +L+D
Sbjct  61   LNGSDMDWYGILQIERFSDEAVIKKQYRKFALTLHPDKNKFAGAEAAFKLIGEANRVLTD  120

Query  551  QTKRSIYDSKCRVSIRSTSMRPPPHQVN  634
              KRS+YD KCR S+R  + +P  H+ N
Sbjct  121  PAKRSLYDMKCRGSLRPAAPKPTSHKTN  148



>ref|XP_011023498.1| PREDICTED: uncharacterized protein LOC105124962 [Populus euphratica]
 ref|XP_011023499.1| PREDICTED: uncharacterized protein LOC105124962 [Populus euphratica]
Length=1122

 Score =   196 bits (498),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 99/148 (67%), Positives = 124/148 (84%), Gaps = 1/148 (1%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKNM  373
            MECNKDEA++AK++A++KMQN DFEGA+K+A KA++LYP+L+NI+Q+LAVC VHCSA+N 
Sbjct  1    MECNKDEAIRAKDIADRKMQNGDFEGARKIALKARQLYPELDNISQMLAVCEVHCSAQNK  60

Query  374  L-GLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSD  550
            L G D DWYGILQ++R +DE  IKKQYRK AL LHPDKNKF GAEAAFKLIGEAN +L+D
Sbjct  61   LNGSDMDWYGILQIERLSDEAVIKKQYRKFALTLHPDKNKFAGAEAAFKLIGEANRVLTD  120

Query  551  QTKRSIYDSKCRVSIRSTSMRPPPHQVN  634
              KRS+YD KCR S+R  + +P  H+ N
Sbjct  121  PAKRSLYDMKCRGSLRPAAPKPTSHKTN  148



>ref|XP_007030109.1| DNAJ heat shock N-terminal domain-containing protein, putative 
[Theobroma cacao]
 gb|EOY10611.1| DNAJ heat shock N-terminal domain-containing protein, putative 
[Theobroma cacao]
Length=1029

 Score =   196 bits (497),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 101/148 (68%), Positives = 125/148 (84%), Gaps = 2/148 (1%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAK-N  370
            MECNK+EA++AK +AE+KMQN DFEGA+K A KAQ+L+P+LENI+Q L VCNVHC AK  
Sbjct  1    MECNKEEAVRAKGIAEQKMQNGDFEGAKKFALKAQKLFPELENISQFLTVCNVHCCAKCK  60

Query  371  MLGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSD  550
            + G + DWYGILQ+++SADE++IKKQYRKLAL+LHPDKNKF GAEAAFKLIGEAN +L+D
Sbjct  61   LYGSEMDWYGILQIEQSADEISIKKQYRKLALLLHPDKNKFAGAEAAFKLIGEANRILTD  120

Query  551  QTKRSIYDSKCRVSIRSTSMRPPPHQVN  634
            Q +RS YD KCR+S R T+ +P  HQ N
Sbjct  121  QMRRSQYDMKCRISAR-TAPKPTTHQSN  147



>ref|XP_002266568.2| PREDICTED: uncharacterized protein LOC100255461 [Vitis vinifera]
 ref|XP_010660003.1| PREDICTED: uncharacterized protein LOC100255461 [Vitis vinifera]
Length=1169

 Score =   196 bits (498),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 100/148 (68%), Positives = 129/148 (87%), Gaps = 1/148 (1%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKN-  370
            M+CNK+EAL+AK ++EKKMQ+ DF GA+++A +AQ+L+PDLENI+QLL VC+VHCSA+N 
Sbjct  1    MDCNKEEALRAKVISEKKMQSGDFIGARRIAQRAQQLFPDLENISQLLTVCDVHCSAQNK  60

Query  371  MLGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSD  550
            + G + DWYGIL+V+++AD+  IKKQYRKLAL+LHPDKNKF GAEAAFKLIGEAN +LSD
Sbjct  61   IYGTEMDWYGILKVEQAADDAIIKKQYRKLALLLHPDKNKFAGAEAAFKLIGEANRILSD  120

Query  551  QTKRSIYDSKCRVSIRSTSMRPPPHQVN  634
            Q KRS YD K RVS++ T+ +PPPHQ+N
Sbjct  121  QGKRSAYDMKYRVSLKHTAPKPPPHQLN  148



>ref|XP_011048882.1| PREDICTED: uncharacterized protein LOC105142787 [Populus euphratica]
 ref|XP_011048883.1| PREDICTED: uncharacterized protein LOC105142787 [Populus euphratica]
Length=1125

 Score =   195 bits (496),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 100/148 (68%), Positives = 123/148 (83%), Gaps = 1/148 (1%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKNM  373
            MECNKDEA++AK++AE+KMQN DFEGA+K+A KA +LYPDLENI+Q+LAVC VHCSA+N 
Sbjct  1    MECNKDEAIRAKDIAERKMQNGDFEGAKKIALKALQLYPDLENISQMLAVCEVHCSAQNK  60

Query  374  L-GLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSD  550
            L G + DWYGILQ++R +DE  +KKQYRK AL LHPDKNKF GAEAAFKLIGEAN +L+D
Sbjct  61   LYGSEMDWYGILQIERFSDEAVVKKQYRKFALSLHPDKNKFSGAEAAFKLIGEANRVLTD  120

Query  551  QTKRSIYDSKCRVSIRSTSMRPPPHQVN  634
              KRS+YD KC+ S+R  + +P  HQ N
Sbjct  121  PAKRSLYDMKCKGSVRPAAPKPTSHQSN  148



>ref|XP_008366850.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103430484 
[Malus domestica]
Length=837

 Score =   192 bits (487),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 98/148 (66%), Positives = 119/148 (80%), Gaps = 1/148 (1%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKN-  370
            MECNK+EA KA +L+E KMQN+DF GA+K+A KAQRL+P LENI +LL VC VHCS++N 
Sbjct  1    MECNKEEAYKAMQLSEVKMQNHDFTGAKKMAQKAQRLFPGLENIEKLLTVCEVHCSSENK  60

Query  371  MLGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSD  550
            M G + DWYGILQ+ +  D+VTIKKQYRKLAL+LHPDKNKF GAEAAFKLIGEAN +L+D
Sbjct  61   MGGFEMDWYGILQIQKCDDDVTIKKQYRKLALLLHPDKNKFAGAEAAFKLIGEANRVLTD  120

Query  551  QTKRSIYDSKCRVSIRSTSMRPPPHQVN  634
            Q KRS+YD KCR  +++ S  P  H  N
Sbjct  121  QAKRSVYDMKCRAQVKTGSSVPSAHPSN  148



>ref|XP_008359874.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103423564 
[Malus domestica]
Length=849

 Score =   191 bits (486),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 98/148 (66%), Positives = 119/148 (80%), Gaps = 1/148 (1%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKN-  370
            MECNK+EA KA +L+E KMQN+DF GA+K+A KAQRL+P LENI +LL VC VHCS++N 
Sbjct  1    MECNKEEAYKAMQLSEVKMQNHDFTGAKKMAQKAQRLFPGLENIEKLLTVCEVHCSSENK  60

Query  371  MLGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSD  550
            M G + DWYGILQ+ +  D+VTIKKQYRKLAL+LHPDKNKF GAEAAFKLIGEAN +L+D
Sbjct  61   MGGFEMDWYGILQIQKCDDDVTIKKQYRKLALLLHPDKNKFAGAEAAFKLIGEANRVLTD  120

Query  551  QTKRSIYDSKCRVSIRSTSMRPPPHQVN  634
            Q KRS+YD KCR  +++ S  P  H  N
Sbjct  121  QAKRSVYDMKCRAQVKTGSSVPSAHPSN  148



>ref|XP_009373931.1| PREDICTED: uncharacterized protein LOC103962880 [Pyrus x bretschneideri]
Length=835

 Score =   190 bits (482),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 97/148 (66%), Positives = 118/148 (80%), Gaps = 1/148 (1%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKNM  373
            MECNK+EA KA +L E KMQN+DF GA+K+A KAQRL+P LENI +LL VC VHCS++N 
Sbjct  1    MECNKEEAYKAMQLCEVKMQNHDFTGARKMAQKAQRLFPGLENIEKLLTVCEVHCSSENK  60

Query  374  L-GLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSD  550
            + G + DWYGILQ+ +  D+VTIKKQYRKLAL+LHPDKNKF GAEAAFKLIGEAN +L+D
Sbjct  61   ISGFEMDWYGILQIQKCDDDVTIKKQYRKLALLLHPDKNKFAGAEAAFKLIGEANRVLTD  120

Query  551  QTKRSIYDSKCRVSIRSTSMRPPPHQVN  634
            Q KRS+YD KCR  +++ S  P  H  N
Sbjct  121  QAKRSVYDMKCRAQVKTGSSVPSAHPSN  148



>ref|XP_009341995.1| PREDICTED: uncharacterized protein LOC103934018 [Pyrus x bretschneideri]
Length=1080

 Score =   192 bits (487),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 95/147 (65%), Positives = 119/147 (81%), Gaps = 0/147 (0%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKNM  373
            MECNK+EA KA +L+E KM+N+DF GA+K+A KAQRL+P +ENI +LL VC VHCS++N 
Sbjct  1    MECNKEEAFKAMQLSEVKMRNSDFTGARKMAQKAQRLFPGIENIEKLLTVCEVHCSSENK  60

Query  374  LGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSDQ  553
            +G + DWYGILQ+ +S D+VTIKKQYRKLAL+LHPDKNKF GAEAAFKLIGEAN +L+DQ
Sbjct  61   IGFEMDWYGILQIQKSDDDVTIKKQYRKLALLLHPDKNKFAGAEAAFKLIGEANRVLTDQ  120

Query  554  TKRSIYDSKCRVSIRSTSMRPPPHQVN  634
             KRS YD KC+  +++ S  P  H  N
Sbjct  121  AKRSTYDMKCKAQLKTGSSIPSAHPSN  147



>ref|XP_009335671.1| PREDICTED: uncharacterized protein LOC103928367 [Pyrus x bretschneideri]
Length=1080

 Score =   192 bits (487),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 95/147 (65%), Positives = 119/147 (81%), Gaps = 0/147 (0%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKNM  373
            MECNK+EA KA +L+E KM+N+DF GA+K+A KAQRL+P +ENI +LL VC VHCS++N 
Sbjct  1    MECNKEEAFKAMQLSEVKMRNSDFTGARKMAQKAQRLFPGIENIEKLLTVCEVHCSSENK  60

Query  374  LGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSDQ  553
            +G + DWYGILQ+ +S D+VTIKKQYRKLAL+LHPDKNKF GAEAAFKLIGEAN +L+DQ
Sbjct  61   IGFEMDWYGILQIQKSDDDVTIKKQYRKLALLLHPDKNKFAGAEAAFKLIGEANRVLTDQ  120

Query  554  TKRSIYDSKCRVSIRSTSMRPPPHQVN  634
             KRS YD KC+  +++ S  P  H  N
Sbjct  121  AKRSTYDMKCKAQLKTGSSIPSAHPSN  147



>ref|XP_006433149.1| hypothetical protein CICLE_v10000081mg [Citrus clementina]
 ref|XP_006471828.1| PREDICTED: uncharacterized protein LOC102610046 isoform X1 [Citrus 
sinensis]
 ref|XP_006471829.1| PREDICTED: uncharacterized protein LOC102610046 isoform X2 [Citrus 
sinensis]
 ref|XP_006471830.1| PREDICTED: uncharacterized protein LOC102610046 isoform X3 [Citrus 
sinensis]
 ref|XP_006471831.1| PREDICTED: uncharacterized protein LOC102610046 isoform X4 [Citrus 
sinensis]
 ref|XP_006471832.1| PREDICTED: uncharacterized protein LOC102610046 isoform X5 [Citrus 
sinensis]
 gb|ESR46389.1| hypothetical protein CICLE_v10000081mg [Citrus clementina]
Length=1142

 Score =   192 bits (488),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 98/145 (68%), Positives = 122/145 (84%), Gaps = 1/145 (1%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKN-  370
            MECNKDEA+KAK++AE K++  DF GA + A KAQRLYP+L+N++Q+L VC VHCSA+N 
Sbjct  1    MECNKDEAIKAKQVAENKIRTGDFAGALRFAHKAQRLYPELDNVSQILTVCEVHCSAQNQ  60

Query  371  MLGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSD  550
             LG +KDWYGILQ++RSADE TIKKQYRKLAL+LHPDKNKF GAEAAFKLIGEA+ +LSD
Sbjct  61   TLGSEKDWYGILQIERSADEATIKKQYRKLALLLHPDKNKFAGAEAAFKLIGEAHRVLSD  120

Query  551  QTKRSIYDSKCRVSIRSTSMRPPPH  625
             T+RS YD KCR ++RS++ +  P 
Sbjct  121  STRRSTYDLKCRTTVRSSAPKTQPQ  145



>ref|XP_008355770.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103419451 
[Malus domestica]
Length=1078

 Score =   192 bits (487),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 95/147 (65%), Positives = 119/147 (81%), Gaps = 0/147 (0%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKNM  373
            MECNK+EA KA +L+E KM+N+DF GA+K+A KAQ+L+P +ENI +LL VC VHCS++N 
Sbjct  1    MECNKEEAFKAMQLSEVKMRNSDFTGARKMAQKAQKLFPGIENIEKLLTVCEVHCSSENK  60

Query  374  LGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSDQ  553
            +G + DWYGILQ+ +S D+VTIKKQYRKLAL+LHPDKNKF GAEAAFKLIGEAN +L+DQ
Sbjct  61   IGFEMDWYGILQIQKSDDDVTIKKQYRKLALLLHPDKNKFAGAEAAFKLIGEANRVLTDQ  120

Query  554  TKRSIYDSKCRVSIRSTSMRPPPHQVN  634
             KRS YD KCR  +++ S  P  H  N
Sbjct  121  AKRSTYDMKCRAQVKTGSSIPSAHPSN  147



>gb|EYU27327.1| hypothetical protein MIMGU_mgv1a001634mg [Erythranthe guttata]
Length=781

 Score =   188 bits (477),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 100/148 (68%), Positives = 122/148 (82%), Gaps = 1/148 (1%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSA-KN  370
            MECNKDEA++AKELAEKKM+NNDF+GAQK+A KAQ LYP+L+NI QLL++C VHCS+ K 
Sbjct  1    MECNKDEAIRAKELAEKKMENNDFKGAQKIAMKAQALYPELDNIAQLLSICTVHCSSEKG  60

Query  371  MLGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSD  550
            +LG +KDWYGILQV++ ADE  IKKQYR+LAL LHPDKN+FPGAE+AFKLI EAN +LSD
Sbjct  61   LLGSEKDWYGILQVEKLADESMIKKQYRRLALTLHPDKNRFPGAESAFKLICEANAVLSD  120

Query  551  QTKRSIYDSKCRVSIRSTSMRPPPHQVN  634
              K+S+YD+K RV  RS       H +N
Sbjct  121  PAKKSLYDAKVRVLSRSGPANSTVHHIN  148



>gb|EYU23667.1| hypothetical protein MIMGU_mgv1a001617mg [Erythranthe guttata]
Length=784

 Score =   186 bits (472),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 100/148 (68%), Positives = 122/148 (82%), Gaps = 1/148 (1%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKN-  370
            MECNK+EA++AKELAEKKM NNDF+GAQK+A KAQ LYP+L+NI QLL++C VHCSA+N 
Sbjct  1    MECNKNEAIRAKELAEKKMVNNDFKGAQKIAMKAQALYPELDNIAQLLSICTVHCSAENG  60

Query  371  MLGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSD  550
            +LG +KDWYGILQV++ ADE  IKKQYR+LAL LHPDKN+FPGAE+AFKLI EAN +LSD
Sbjct  61   LLGSEKDWYGILQVEKLADESMIKKQYRRLALTLHPDKNRFPGAESAFKLICEANAVLSD  120

Query  551  QTKRSIYDSKCRVSIRSTSMRPPPHQVN  634
              K+S+YD+K RV  RS       H +N
Sbjct  121  PAKKSLYDAKVRVLSRSGPANSTVHHIN  148



>gb|KJB19229.1| hypothetical protein B456_003G089700 [Gossypium raimondii]
Length=1160

 Score =   188 bits (478),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 100/148 (68%), Positives = 122/148 (82%), Gaps = 2/148 (1%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVH-CSAKN  370
            MECN++EA++AK +AE+KMQN D EGA+K A KAQ+L+P+LENI QLLAVCNVH C+  N
Sbjct  1    MECNREEAIRAKGIAEQKMQNGDIEGAKKFALKAQKLFPELENITQLLAVCNVHYCAKHN  60

Query  371  MLGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSD  550
            + G +KDWYGILQ+++SADE  IKKQ+RKLAL+LHPDKNKF GAEAAFKLIGEAN +L+D
Sbjct  61   LYGSEKDWYGILQIEQSADESLIKKQFRKLALLLHPDKNKFHGAEAAFKLIGEANRVLTD  120

Query  551  QTKRSIYDSKCRVSIRSTSMRPPPHQVN  634
            QT RS YD KCRVS + T  +P  H  N
Sbjct  121  QTSRSQYDLKCRVSAK-TVPKPTSHPTN  147



>gb|KHG04775.1| DnaJ subfamily B member 12 [Gossypium arboreum]
Length=1159

 Score =   187 bits (476),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 100/145 (69%), Positives = 121/145 (83%), Gaps = 2/145 (1%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVH-CSAKN  370
            MECNK+EA++AK +AE+KMQN D EGA+K A KAQ+L+P+LENI QLLAVCNVH C+  N
Sbjct  1    MECNKEEAIRAKGIAEQKMQNGDIEGAKKFALKAQKLFPELENITQLLAVCNVHYCAKHN  60

Query  371  MLGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSD  550
            + G +KDWYGILQ+++SADE  IKKQ+RKLAL+LHPDKNKF GAEAAFKLIGEAN +L+D
Sbjct  61   LYGSEKDWYGILQIEQSADESLIKKQFRKLALLLHPDKNKFHGAEAAFKLIGEANRVLTD  120

Query  551  QTKRSIYDSKCRVSIRSTSMRPPPH  625
            QT RS YD KCRVS + T  +P  H
Sbjct  121  QTSRSQYDLKCRVSAK-TVPKPTSH  144



>ref|XP_008353268.1| PREDICTED: uncharacterized protein LOC103416829 [Malus domestica]
Length=397

 Score =   178 bits (451),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 92/145 (63%), Positives = 118/145 (81%), Gaps = 3/145 (2%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKNM  373
            M+CNK+EA++AK +AEKKMQ+ DF GA+K+A KAQ+LY DLENI+Q+L VC+VHCSA+ +
Sbjct  1    MDCNKEEAIRAKSIAEKKMQSKDFVGARKIAIKAQQLYSDLENISQMLMVCDVHCSAEKL  60

Query  374  LGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSDQ  553
             G + DWYGILQ+D++ADE+TIKKQYRK AL LHPDKNKF GAEAAFKLIGEA  +L D+
Sbjct  61   FGTEMDWYGILQIDQTADEITIKKQYRKFALQLHPDKNKFSGAEAAFKLIGEAQRVLLDR  120

Query  554  TKRSIYDSKCRVSIRSTSMRPPPHQ  628
             KRS++D K +  +  T +   PHQ
Sbjct  121  DKRSMHDLKRKTXVSKTGV---PHQ  142



>ref|XP_009352192.1| PREDICTED: uncharacterized protein LOC103943605 [Pyrus x bretschneideri]
 ref|XP_009352193.1| PREDICTED: uncharacterized protein LOC103943605 [Pyrus x bretschneideri]
 ref|XP_009352194.1| PREDICTED: uncharacterized protein LOC103943605 [Pyrus x bretschneideri]
Length=972

 Score =   182 bits (462),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 93/148 (63%), Positives = 122/148 (82%), Gaps = 1/148 (1%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKNM  373
            M+CNK+EA++AK +AEKKMQ+ DF GA+K+A KAQ+LYPDLEN++Q+L VC+VHCSA+ +
Sbjct  1    MDCNKEEAIRAKVIAEKKMQSKDFVGARKIAIKAQQLYPDLENVSQMLMVCDVHCSAEKL  60

Query  374  LGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSDQ  553
             G + DWYGILQ+D++ADE+TIKKQYRK AL LHPDKNKF GAEAAFKLIGEA  +L D+
Sbjct  61   FGTEMDWYGILQIDQTADEITIKKQYRKFALQLHPDKNKFSGAEAAFKLIGEAQRVLLDR  120

Query  554  TKRSIYDSKCRVSIRSTSM-RPPPHQVN  634
             KRS++D K + S+  T +   PPH+ +
Sbjct  121  DKRSMHDLKRKTSVSKTGVPHRPPHRAS  148



>ref|XP_007207549.1| hypothetical protein PRUPE_ppa017544mg [Prunus persica]
 gb|EMJ08748.1| hypothetical protein PRUPE_ppa017544mg [Prunus persica]
Length=1061

 Score =   182 bits (462),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 92/148 (62%), Positives = 120/148 (81%), Gaps = 1/148 (1%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKNM  373
            MECNK+EA++A +L+E K+Q+NDF GA+K+A KAQRL+P+LENI +LL VC VHCS++N 
Sbjct  1    MECNKEEAVRAMQLSEIKIQSNDFTGARKMAQKAQRLFPELENIEKLLTVCEVHCSSENK  60

Query  374  LGLDK-DWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSD  550
            +G  + DWYGILQ+ +  ++ TIKKQYRKLAL+LHPDKNKF GAEAAFKLIGEAN +L+D
Sbjct  61   IGGSEMDWYGILQIQKFDNDATIKKQYRKLALLLHPDKNKFSGAEAAFKLIGEANRVLAD  120

Query  551  QTKRSIYDSKCRVSIRSTSMRPPPHQVN  634
            Q KRS+YD KCR   ++ + +P  H  N
Sbjct  121  QAKRSVYDMKCRALAKTGAPKPSAHPSN  148



>ref|XP_007147102.1| hypothetical protein PHAVU_006G096300g [Phaseolus vulgaris]
 ref|XP_007147103.1| hypothetical protein PHAVU_006G096300g [Phaseolus vulgaris]
 gb|ESW19096.1| hypothetical protein PHAVU_006G096300g [Phaseolus vulgaris]
 gb|ESW19097.1| hypothetical protein PHAVU_006G096300g [Phaseolus vulgaris]
Length=1070

 Score =   182 bits (462),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 96/148 (65%), Positives = 118/148 (80%), Gaps = 1/148 (1%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKNM  373
            MECNKDEA++AK++AE KMQ  D+EG  K A KAQRL+PD++NI Q+LAVC+VHC+A+  
Sbjct  1    MECNKDEAVRAKQIAENKMQAGDYEGGLKFATKAQRLFPDIQNIVQILAVCDVHCAARKK  60

Query  374  LG-LDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSD  550
            L   D DWYGILQ  +SADE TIKKQYRKLAL+LHPDKNK  GAEAAFKLIGEAN +LSD
Sbjct  61   LSEFDMDWYGILQTQQSADEATIKKQYRKLALLLHPDKNKSAGAEAAFKLIGEANRMLSD  120

Query  551  QTKRSIYDSKCRVSIRSTSMRPPPHQVN  634
            Q KR++YDSK  +S+ +T+ +  P   N
Sbjct  121  QCKRALYDSKIGISVGNTAAKVAPSHPN  148



>gb|KHN43244.1| DnaJ like subfamily B member 14 [Glycine soja]
Length=1058

 Score =   181 bits (460),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 97/148 (66%), Positives = 118/148 (80%), Gaps = 1/148 (1%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSA-KN  370
            MECNKDEAL+A+++AE KMQ  DFEG  K A KAQRL+P+++NI Q+LAVC VHC+A K 
Sbjct  1    MECNKDEALRARQIAENKMQAGDFEGGLKFATKAQRLFPEIQNILQILAVCEVHCAAQKT  60

Query  371  MLGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSD  550
              G D DWYGIL+ ++SADE TIKKQYRKLAL+LHPDKNK  GAEAAFKLIGEAN +LSD
Sbjct  61   YSGSDMDWYGILKTEKSADEATIKKQYRKLALLLHPDKNKSAGAEAAFKLIGEANRVLSD  120

Query  551  QTKRSIYDSKCRVSIRSTSMRPPPHQVN  634
            QTKR++YD K  V + +T+ + PP   N
Sbjct  121  QTKRALYDLKFGVPVGNTATKVPPRHPN  148



>ref|XP_003553743.1| PREDICTED: uncharacterized protein LOC100819284 isoform X1 [Glycine 
max]
 ref|XP_006604830.1| PREDICTED: uncharacterized protein LOC100819284 isoform X2 [Glycine 
max]
Length=1058

 Score =   181 bits (460),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 97/148 (66%), Positives = 118/148 (80%), Gaps = 1/148 (1%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSA-KN  370
            MECNKDEAL+A+++AE KMQ  DFEG  K A KAQRL+P+++NI Q+LAVC VHC+A K 
Sbjct  1    MECNKDEALRARQIAENKMQAGDFEGGLKFATKAQRLFPEIQNILQILAVCEVHCAAQKT  60

Query  371  MLGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSD  550
              G D DWYGIL+ ++SADE TIKKQYRKLAL+LHPDKNK  GAEAAFKLIGEAN +LSD
Sbjct  61   YSGSDMDWYGILKTEKSADEATIKKQYRKLALLLHPDKNKSAGAEAAFKLIGEANRVLSD  120

Query  551  QTKRSIYDSKCRVSIRSTSMRPPPHQVN  634
            QTKR++YD K  V + +T+ + PP   N
Sbjct  121  QTKRALYDLKFGVPVGNTATKVPPRHPN  148



>ref|XP_006577265.1| PREDICTED: uncharacterized protein LOC100782762 [Glycine max]
 gb|KHN04034.1| DnaJ like subfamily B member 14 [Glycine soja]
Length=1067

 Score =   181 bits (460),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 96/148 (65%), Positives = 119/148 (80%), Gaps = 1/148 (1%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSA-KN  370
            MECNKDEA++A+++AE KMQ  DFEG  K A KAQRL+P+++NI Q+LAVC VHC+A K 
Sbjct  1    MECNKDEAIRARQIAENKMQAGDFEGGLKFATKAQRLFPEIQNILQILAVCEVHCAAQKK  60

Query  371  MLGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSD  550
              G D DWYGIL++++SADE TIKKQYRKLAL+LHPDKNK  GAEAAFKLIGEAN +LSD
Sbjct  61   HSGSDMDWYGILKIEKSADEATIKKQYRKLALLLHPDKNKSDGAEAAFKLIGEANRVLSD  120

Query  551  QTKRSIYDSKCRVSIRSTSMRPPPHQVN  634
            QTKR++YD K  V + +T+ + PP   N
Sbjct  121  QTKRALYDLKFGVPVGNTAAKVPPRHPN  148



>ref|XP_010097335.1| J domain-containing protein [Morus notabilis]
 gb|EXB67645.1| J domain-containing protein [Morus notabilis]
Length=1164

 Score =   181 bits (460),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 97/146 (66%), Positives = 116/146 (79%), Gaps = 1/146 (1%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAK-N  370
            MECNK+EA +A +LAEKKMQ +DF GAQK+  KAQRL+PDLENI+QLL VC VHCSA+  
Sbjct  1    MECNKEEAFRAMQLAEKKMQAHDFSGAQKIGQKAQRLFPDLENISQLLMVCEVHCSAQVK  60

Query  371  MLGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSD  550
            + G + DWY ILQ +++ D VTIKKQYRKLAL+LHPDKNKF GAEAAFKLIGEAN +LSD
Sbjct  61   IGGTEMDWYRILQTEQTVDAVTIKKQYRKLALLLHPDKNKFAGAEAAFKLIGEANRVLSD  120

Query  551  QTKRSIYDSKCRVSIRSTSMRPPPHQ  628
            Q  RS YD + R  +++ S RP  HQ
Sbjct  121  QPNRSGYDMRYRALVKTASSRPSRHQ  146



>ref|XP_010097334.1| J domain-containing protein [Morus notabilis]
 gb|EXB67644.1| J domain-containing protein [Morus notabilis]
Length=1164

 Score =   181 bits (460),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 97/146 (66%), Positives = 116/146 (79%), Gaps = 1/146 (1%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAK-N  370
            MECNK+EA +A +LAEKKMQ +DF GAQK+  KAQRL+PDLENI+QLL VC VHCSA+  
Sbjct  1    MECNKEEAFRAMQLAEKKMQAHDFSGAQKIGQKAQRLFPDLENISQLLMVCEVHCSAQVK  60

Query  371  MLGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSD  550
            + G + DWY ILQ +++ D VTIKKQYRKLAL+LHPDKNKF GAEAAFKLIGEAN +LSD
Sbjct  61   IGGTEMDWYRILQTEQTVDAVTIKKQYRKLALLLHPDKNKFAGAEAAFKLIGEANRVLSD  120

Query  551  QTKRSIYDSKCRVSIRSTSMRPPPHQ  628
            Q  RS YD + R  +++ S RP  HQ
Sbjct  121  QPNRSGYDMRYRALVKTASSRPSRHQ  146



>ref|XP_008246552.1| PREDICTED: uncharacterized protein LOC103344708 [Prunus mume]
Length=1115

 Score =   181 bits (459),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 91/148 (61%), Positives = 120/148 (81%), Gaps = 1/148 (1%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKNM  373
            MECNK+EA++A +L+E K+Q+NDF GA+K+A KAQRL+P+LEN+ +LL VC VHCS++N 
Sbjct  1    MECNKEEAVRAMQLSEIKIQSNDFTGARKMAQKAQRLFPELENVEKLLTVCEVHCSSENK  60

Query  374  LGLDK-DWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSD  550
            +G  + DWYGILQ+ +  ++ TIKKQYRKLAL+LHPDKNKF GAEAAFKLIGEAN +L+D
Sbjct  61   IGGSEMDWYGILQIQKFDNDATIKKQYRKLALLLHPDKNKFSGAEAAFKLIGEANRVLAD  120

Query  551  QTKRSIYDSKCRVSIRSTSMRPPPHQVN  634
            Q KRS+YD KCR   ++ + +P  H  N
Sbjct  121  QAKRSVYDMKCRALAKAGAPKPSTHPSN  148



>ref|XP_008390748.1| PREDICTED: uncharacterized protein LOC103452999 [Malus domestica]
 ref|XP_008390749.1| PREDICTED: uncharacterized protein LOC103452999 [Malus domestica]
Length=970

 Score =   180 bits (457),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 93/148 (63%), Positives = 121/148 (82%), Gaps = 1/148 (1%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKNM  373
            M+CNK+EA++AK +AEKKMQ+ DF GA+K+A KAQ+LYPDLEN +Q+L VC+VHCSA+ +
Sbjct  1    MDCNKEEAIRAKVIAEKKMQSKDFVGARKIAIKAQQLYPDLENASQMLMVCDVHCSAEKL  60

Query  374  LGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSDQ  553
             G + DWYGILQ+D++ADE+TIKKQYRK AL LHPDKNKF GAEAAFKLIGEA  +L D+
Sbjct  61   FGTEMDWYGILQIDQTADEITIKKQYRKFALQLHPDKNKFSGAEAAFKLIGEAQRVLLDR  120

Query  554  TKRSIYDSKCRVSIRSTSM-RPPPHQVN  634
             KRS++D K + S+  T +   PPH+ +
Sbjct  121  DKRSMHDLKRKTSVSKTGVPHRPPHRAS  148



>ref|XP_002512302.1| protein with unknown function [Ricinus communis]
 gb|EEF49754.1| protein with unknown function [Ricinus communis]
Length=1131

 Score =   180 bits (457),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 95/150 (63%), Positives = 120/150 (80%), Gaps = 1/150 (1%)
 Frame = +2

Query  188  LLMECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAK  367
            + MECNK+EA +AKELAEKKMQN D+  A+++A KA++LYPDL+NI+QLL VC VHCSA+
Sbjct  1    MTMECNKEEAFRAKELAEKKMQNGDYVAARRIALKARQLYPDLDNISQLLMVCEVHCSAQ  60

Query  368  NML-GLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLL  544
            N L G + DWYGILQ+++ +DE  IKKQ+RKLAL LHPDKNKF GAEAAFKLIGEAN +L
Sbjct  61   NKLNGSEMDWYGILQIEKFSDEAVIKKQFRKLALSLHPDKNKFSGAEAAFKLIGEANRVL  120

Query  545  SDQTKRSIYDSKCRVSIRSTSMRPPPHQVN  634
            +D +KR  YD KCR + +  + +PP  Q N
Sbjct  121  TDPSKRPAYDMKCRGTFKPVAPKPPSEQSN  150



>ref|XP_002520963.1| protein with unknown function [Ricinus communis]
 gb|EEF41380.1| protein with unknown function [Ricinus communis]
Length=1130

 Score =   180 bits (456),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 95/150 (63%), Positives = 120/150 (80%), Gaps = 1/150 (1%)
 Frame = +2

Query  188  LLMECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAK  367
            + MECNK+EA +AKELAEKKMQN D+  A+++A KA++LYPDL+NI+QLL VC VHCSA+
Sbjct  1    MTMECNKEEAFRAKELAEKKMQNGDYVAARQIALKARQLYPDLDNISQLLMVCEVHCSAQ  60

Query  368  NML-GLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLL  544
            N L G + DWYGILQ+++ +DE  IKKQ+RKLAL LHPDKNKF GAEAAFKLIGEAN +L
Sbjct  61   NKLNGSEMDWYGILQIEKFSDEAVIKKQFRKLALSLHPDKNKFSGAEAAFKLIGEANRVL  120

Query  545  SDQTKRSIYDSKCRVSIRSTSMRPPPHQVN  634
            +D +KR  YD KCR + +  + +PP  Q N
Sbjct  121  TDPSKRPAYDMKCRGTFKPVAPKPPSEQSN  150



>gb|KDP23995.1| hypothetical protein JCGZ_25383 [Jatropha curcas]
Length=956

 Score =   178 bits (452),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 94/146 (64%), Positives = 117/146 (80%), Gaps = 1/146 (1%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSA-KN  370
            MECNK+EA +AK +AE+KM+NNDF GA K+A +AQ LY DL+NI+Q+L VC VHC+A K 
Sbjct  1    MECNKEEAARAKGIAEQKMRNNDFVGAHKIALRAQHLYKDLDNISQMLMVCAVHCAADKK  60

Query  371  MLGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSD  550
            + G + DWYGILQ++ +ADE TIKKQYRK AL+LHPDKNKFPGAEAAFKLIGEA  +LSD
Sbjct  61   LFGNEMDWYGILQIEPTADEATIKKQYRKFALLLHPDKNKFPGAEAAFKLIGEAQRVLSD  120

Query  551  QTKRSIYDSKCRVSIRSTSMRPPPHQ  628
            +  RS+YD K +VSI  ++    PHQ
Sbjct  121  KGNRSLYDIKRKVSISKSAAPYMPHQ  146



>ref|XP_010042011.1| PREDICTED: uncharacterized protein LOC104431009 [Eucalyptus grandis]
 gb|KCW84950.1| hypothetical protein EUGRSUZ_B01771 [Eucalyptus grandis]
Length=770

 Score =   176 bits (446),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 90/146 (62%), Positives = 121/146 (83%), Gaps = 3/146 (2%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKNM  373
            MECNK+EA++AKE+AE +M+NNDF GA ++  KAQRL+ +LEN++++LAVC +HCSA+  
Sbjct  1    MECNKEEAVRAKEIAEVRMRNNDFAGALRLVQKAQRLFSELENVSRMLAVCEIHCSAQTK  60

Query  374  L-GLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSD  550
            + G + DWY ILQ+++SAD++TIKKQYRK AL+LHPDKNKFPGAEAAFKLI EAN +L+D
Sbjct  61   VCGSEHDWYAILQIEKSADDITIKKQYRKFALLLHPDKNKFPGAEAAFKLIVEANRVLTD  120

Query  551  QTKRSIYDSKCRVSIRSTSMRPPPHQ  628
            Q +R +YDSK R S++    +PP HQ
Sbjct  121  QLQRKLYDSKFRNSVQ--PQKPPAHQ  144



>ref|XP_008340865.1| PREDICTED: uncharacterized protein LOC103403797 [Malus domestica]
 ref|XP_008340866.1| PREDICTED: uncharacterized protein LOC103403797 [Malus domestica]
Length=956

 Score =   177 bits (449),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 92/145 (63%), Positives = 118/145 (81%), Gaps = 3/145 (2%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKNM  373
            M+CNK+EA++AK +AEKKMQ+ DF GA+K+A KAQ+LY DLENI+Q+L VC+VHCSA+ +
Sbjct  1    MDCNKEEAIRAKSIAEKKMQSKDFVGARKIAIKAQQLYSDLENISQMLMVCDVHCSAEKL  60

Query  374  LGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSDQ  553
             G + DWYGILQ+D++ADE+TIKKQYRK AL LHPDKNKF GAEAAFKLIGEA  +L D+
Sbjct  61   FGTEMDWYGILQIDQTADEITIKKQYRKFALQLHPDKNKFSGAEAAFKLIGEAQRVLLDR  120

Query  554  TKRSIYDSKCRVSIRSTSMRPPPHQ  628
             KRS++D K +  +  T +   PHQ
Sbjct  121  DKRSMHDLKRKTXVSKTGV---PHQ  142



>ref|XP_010240875.1| PREDICTED: uncharacterized protein LOC104585627 [Nelumbo nucifera]
 ref|XP_010240883.1| PREDICTED: uncharacterized protein LOC104585627 [Nelumbo nucifera]
 ref|XP_010240891.1| PREDICTED: uncharacterized protein LOC104585627 [Nelumbo nucifera]
 ref|XP_010240900.1| PREDICTED: uncharacterized protein LOC104585627 [Nelumbo nucifera]
 ref|XP_010240904.1| PREDICTED: uncharacterized protein LOC104585627 [Nelumbo nucifera]
Length=1098

 Score =   177 bits (448),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 97/149 (65%), Positives = 119/149 (80%), Gaps = 4/149 (3%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKN-  370
            M+CNK+EA++AK +AEKKMQ  DF GA+K+A +AQ+LYPDLENI+QLL VC VHCSA+  
Sbjct  1    MDCNKEEAIRAKVIAEKKMQTKDFMGARKIALRAQQLYPDLENISQLLTVCEVHCSAEQR  60

Query  371  MLGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSD  550
            + G + DWY ILQV+++ADE +IKKQYRKLAL+LHPDKNKF GAEAAFKLIGEA  +LSD
Sbjct  61   IFGSEMDWYAILQVEQTADEASIKKQYRKLALLLHPDKNKFSGAEAAFKLIGEAQRVLSD  120

Query  551  QTKRSIYDSKCRVSIRSTSMRPPPHQVNP  637
            Q KRS YD K R S+R+  +   P Q  P
Sbjct  121  QAKRSAYDMKRRNSMRTVVV---PKQPQP  146



>ref|XP_008813744.1| PREDICTED: uncharacterized protein LOC103724304 [Phoenix dactylifera]
Length=1074

 Score =   176 bits (447),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 92/147 (63%), Positives = 120/147 (82%), Gaps = 0/147 (0%)
 Frame = +2

Query  191  LMECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKN  370
            +MECNK+EA++AK++AEK+MQN DF GA+K+A KAQ+L+PDL+NI+Q+L VC VHCSA  
Sbjct  1    MMECNKEEAIRAKDIAEKRMQNKDFVGARKIALKAQQLFPDLDNISQMLTVCEVHCSAAV  60

Query  371  MLGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSD  550
             +  + DWYGILQV+ SAD+ +IKKQYRKLAL+LHPDKNKF GAEAAFKLIGEA++ LSD
Sbjct  61   KVNGEMDWYGILQVEPSADDSSIKKQYRKLALLLHPDKNKFAGAEAAFKLIGEAHMTLSD  120

Query  551  QTKRSIYDSKCRVSIRSTSMRPPPHQV  631
            + KRS++D K   +++ T  R P  Q 
Sbjct  121  RAKRSLHDIKRNANVKITPARQPSQQA  147



>ref|XP_009369093.1| PREDICTED: uncharacterized protein LOC103958545 [Pyrus x bretschneideri]
Length=954

 Score =   176 bits (445),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 92/144 (64%), Positives = 117/144 (81%), Gaps = 3/144 (2%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKNM  373
            M+CNK+EA++AK +AEKKMQ+ DF GA+K+A KAQ+LY DLENI+Q+L VC+VHCSA+  
Sbjct  1    MDCNKEEAIRAKSIAEKKMQSKDFVGARKIAIKAQQLYSDLENISQMLMVCDVHCSAEKS  60

Query  374  LGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSDQ  553
             G + DWYGILQ+D++ADE+TIKKQYRK AL LHPDKNKF GAEAAFKLIGEA  +L D+
Sbjct  61   FGTEMDWYGILQIDQTADEITIKKQYRKFALQLHPDKNKFSGAEAAFKLIGEAQRVLLDR  120

Query  554  TKRSIYDSKCRVSIRSTSMRPPPH  625
             KRS++D K + S+  T +   PH
Sbjct  121  DKRSMHDLKRKTSVSKTGV---PH  141



>ref|XP_010667707.1| PREDICTED: uncharacterized protein LOC104884721 [Beta vulgaris 
subsp. vulgaris]
Length=983

 Score =   175 bits (444),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 91/148 (61%), Positives = 117/148 (79%), Gaps = 1/148 (1%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKN-  370
            MECNK+EAL+AKE+A+KKM+  DF GA+K A KAQ+LYPD+ENI+Q++ VC+VHCS+ + 
Sbjct  1    MECNKEEALRAKEIAQKKMEAKDFSGARKFALKAQQLYPDMENISQMICVCDVHCSSDSK  60

Query  371  MLGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSD  550
            M G + DWYGILQ++R+AD++ IKKQYRK AL LHPDKNKF GAEAAFKLIGEA  +L D
Sbjct  61   MFGNELDWYGILQIERTADDILIKKQYRKFALQLHPDKNKFSGAEAAFKLIGEAQRVLLD  120

Query  551  QTKRSIYDSKCRVSIRSTSMRPPPHQVN  634
            + KRS +D +CR S +      PP Q +
Sbjct  121  KEKRSFFDMRCRTSCKPGRPNQPPQQTS  148



>ref|XP_010914403.1| PREDICTED: uncharacterized protein LOC105039818 [Elaeis guineensis]
 ref|XP_010914404.1| PREDICTED: uncharacterized protein LOC105039818 [Elaeis guineensis]
Length=1079

 Score =   175 bits (443),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 92/147 (63%), Positives = 119/147 (81%), Gaps = 0/147 (0%)
 Frame = +2

Query  191  LMECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKN  370
            +MECNK+EA++AK++AEK+MQN DF GA+K+A KA +L+PDL+NI+Q+L VC VHCSA  
Sbjct  1    MMECNKEEAVRAKDIAEKRMQNKDFVGARKIALKAHQLFPDLDNISQMLTVCEVHCSAAV  60

Query  371  MLGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSD  550
             +  + DWYGILQV+ SAD+ +IKKQYRKLAL+LHPDKNKF GAEAAFKLIGEA++ LSD
Sbjct  61   KVNGEMDWYGILQVEPSADDSSIKKQYRKLALLLHPDKNKFAGAEAAFKLIGEAHMTLSD  120

Query  551  QTKRSIYDSKCRVSIRSTSMRPPPHQV  631
            + KRS++D K  V+I+    R P  Q 
Sbjct  121  RAKRSLHDIKRNVNIKIAPSRQPSQQA  147



>gb|KDP23582.1| hypothetical protein JCGZ_23415 [Jatropha curcas]
Length=904

 Score =   174 bits (440),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 95/148 (64%), Positives = 117/148 (79%), Gaps = 1/148 (1%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKNM  373
            MECNK+EA++AKE+AEKKMQ  DF GA+++A KAQ+L PDL+NI+QLL VC VHCSA+N 
Sbjct  1    MECNKEEAIRAKEIAEKKMQAGDFIGARRIALKAQQLNPDLDNISQLLMVCEVHCSAQNK  60

Query  374  L-GLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSD  550
            L G + DWYGILQ+++ ADE  +KK YRKLAL LHPDKNK  GAEAAFKLIGEAN +L D
Sbjct  61   LNGSEMDWYGILQIEQFADESVVKKHYRKLALSLHPDKNKLAGAEAAFKLIGEANRVLMD  120

Query  551  QTKRSIYDSKCRVSIRSTSMRPPPHQVN  634
             TKR++YD KCR  +RS   +P   + N
Sbjct  121  PTKRTLYDMKCRGLLRSVGPKPTSDKSN  148



>ref|XP_008450718.1| PREDICTED: uncharacterized protein LOC103492216 [Cucumis melo]
 ref|XP_008450719.1| PREDICTED: uncharacterized protein LOC103492216 [Cucumis melo]
Length=845

 Score =   173 bits (438),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 111/130 (85%), Gaps = 1/130 (1%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKN-  370
            MECNK+EA+KA ++AEKK++ +DF GA+K+A  AQRL+P L+NI QLL VC +HCSA+N 
Sbjct  1    MECNKEEAIKAMKIAEKKLEISDFNGARKMAQTAQRLFPTLDNITQLLTVCEIHCSAQNR  60

Query  371  MLGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSD  550
            M G + DWYGILQ+++SADE  IKKQYRKLAL+LHPDKNKF GAEAAFKL+GEAN LLSD
Sbjct  61   MYGAENDWYGILQIEQSADETIIKKQYRKLALLLHPDKNKFAGAEAAFKLVGEANRLLSD  120

Query  551  QTKRSIYDSK  580
            Q+KR +YD K
Sbjct  121  QSKRKLYDLK  130



>ref|XP_004157267.1| PREDICTED: uncharacterized LOC101213491 [Cucumis sativus]
Length=847

 Score =   172 bits (437),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 90/136 (66%), Positives = 112/136 (82%), Gaps = 1/136 (1%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKN-  370
            MECNK+EA+KA ++AE K++ +DF GA+K+A  AQRL+P L+NI QLL VC +HCSA+N 
Sbjct  1    MECNKEEAIKAMKIAETKLEISDFIGARKMAQTAQRLFPTLDNITQLLTVCEIHCSAQNR  60

Query  371  MLGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSD  550
            M G + DWYGILQ+++SADE  IKKQYRKLAL+LHPDKNKF GAEAAFKL+GEAN LLSD
Sbjct  61   MYGAENDWYGILQIEQSADEAIIKKQYRKLALLLHPDKNKFAGAEAAFKLVGEANRLLSD  120

Query  551  QTKRSIYDSKCRVSIR  598
            Q+KR +YD K   + R
Sbjct  121  QSKRKLYDLKYGAARR  136



>ref|XP_004135641.1| PREDICTED: uncharacterized protein LOC101213491 [Cucumis sativus]
 gb|KGN66129.1| hypothetical protein Csa_1G572990 [Cucumis sativus]
Length=847

 Score =   172 bits (437),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 90/136 (66%), Positives = 112/136 (82%), Gaps = 1/136 (1%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKN-  370
            MECNK+EA+KA ++AE K++ +DF GA+K+A  AQRL+P L+NI QLL VC +HCSA+N 
Sbjct  1    MECNKEEAIKAMKIAETKLEISDFIGARKMAQTAQRLFPTLDNITQLLTVCEIHCSAQNR  60

Query  371  MLGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSD  550
            M G + DWYGILQ+++SADE  IKKQYRKLAL+LHPDKNKF GAEAAFKL+GEAN LLSD
Sbjct  61   MYGAENDWYGILQIEQSADEAIIKKQYRKLALLLHPDKNKFAGAEAAFKLVGEANRLLSD  120

Query  551  QTKRSIYDSKCRVSIR  598
            Q+KR +YD K   + R
Sbjct  121  QSKRKLYDLKYGAARR  136



>ref|XP_007225172.1| hypothetical protein PRUPE_ppa002265mg [Prunus persica]
 gb|EMJ26371.1| hypothetical protein PRUPE_ppa002265mg [Prunus persica]
Length=693

 Score =   171 bits (433),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 92/145 (63%), Positives = 119/145 (82%), Gaps = 3/145 (2%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKN-  370
            M+CNK+EA++AK +AEKKMQ+ DF  A+K+A KAQ+LYPDLENI+Q+L VC VHCSA+  
Sbjct  1    MDCNKEEAIRAKGIAEKKMQSKDFVAARKIAIKAQQLYPDLENISQMLMVCEVHCSAEQK  60

Query  371  MLGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSD  550
            + G + DWYGILQ+D++A+E+TIKKQYRK AL LHPDKNKF GAEAAFKLIGEA  +L D
Sbjct  61   LFGNEMDWYGILQIDQTANELTIKKQYRKFALQLHPDKNKFAGAEAAFKLIGEAQRVLLD  120

Query  551  QTKRSIYDSKCRVSIRSTSM--RPP  619
            + KRS++D K + S+R  ++  RPP
Sbjct  121  RDKRSMHDLKRKASVRKPTVPYRPP  145



>ref|XP_009383695.1| PREDICTED: uncharacterized protein LOC103971406 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009383698.1| PREDICTED: uncharacterized protein LOC103971406 [Musa acuminata 
subsp. malaccensis]
Length=1054

 Score =   173 bits (439),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 92/142 (65%), Positives = 120/142 (85%), Gaps = 1/142 (1%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKNM  373
            M+CNK+EA++AK LAEKKMQN DF GAQK+A KAQ+L+PD+ENI+Q+L VC+VHCSA   
Sbjct  1    MDCNKEEAIRAKHLAEKKMQNKDFMGAQKIALKAQQLFPDIENISQMLTVCDVHCSAGAR  60

Query  374  LGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSDQ  553
            +  + DWY ILQV+ ++D+++IKKQYRKLAL+LHPDKNKF GAEAAFKLIGEA+++LSDQ
Sbjct  61   VNGEMDWYKILQVESTSDDLSIKKQYRKLALLLHPDKNKFSGAEAAFKLIGEAHMVLSDQ  120

Query  554  TKRSIYDSKCRVSIRST-SMRP  616
             KR +YD K   +I+S  +M+P
Sbjct  121  EKRRLYDFKRNANIKSAPAMKP  142



>ref|XP_004494655.1| PREDICTED: uncharacterized protein LOC101488726 [Cicer arietinum]
Length=1091

 Score =   173 bits (439),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 94/148 (64%), Positives = 114/148 (77%), Gaps = 1/148 (1%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKNM  373
            MECNKDEAL+AK++AE +MQ  DF GA K A KAQRL+P+++NI Q+L VC VHC+A+N 
Sbjct  1    MECNKDEALRAKQIAENRMQCGDFAGALKFAMKAQRLFPEIQNITQILTVCEVHCAAQNK  60

Query  374  LGL-DKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSD  550
            L   D DWYGIL   R  DE TIKKQY+KLAL+LHPDKNK  GAEAAFKLI EAN +LSD
Sbjct  61   LSASDMDWYGILLTQRFTDEATIKKQYKKLALLLHPDKNKSAGAEAAFKLIVEANRVLSD  120

Query  551  QTKRSIYDSKCRVSIRSTSMRPPPHQVN  634
            QTKRS+Y+ K R    +T+++ PPH  N
Sbjct  121  QTKRSLYNKKIRGPAVTTALKVPPHTQN  148



>ref|XP_008776154.1| PREDICTED: uncharacterized protein LOC103696336 [Phoenix dactylifera]
Length=1078

 Score =   173 bits (438),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 90/147 (61%), Positives = 119/147 (81%), Gaps = 0/147 (0%)
 Frame = +2

Query  191  LMECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKN  370
            +MECNK+EA++AK++AEK+MQN DF GA+K+A +AQ+L+PDL+NI+Q+L VC+VHCSA  
Sbjct  1    MMECNKEEAIRAKDIAEKRMQNKDFIGARKIALRAQQLFPDLDNISQILTVCDVHCSAAV  60

Query  371  MLGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSD  550
             +  + DWYGILQV+ SAD+ +IKKQYRKLAL+LHPDKNKF GAEAAFKLIGEA++ LSD
Sbjct  61   KVNGEIDWYGILQVEPSADDSSIKKQYRKLALLLHPDKNKFAGAEAAFKLIGEAHMTLSD  120

Query  551  QTKRSIYDSKCRVSIRSTSMRPPPHQV  631
            + KRS++D K   + +    R P  Q 
Sbjct  121  RAKRSLHDIKSNANTKIAPSRQPSQQA  147



>ref|XP_002276957.1| PREDICTED: uncharacterized protein LOC100244334 [Vitis vinifera]
 ref|XP_010649800.1| PREDICTED: uncharacterized protein LOC100244334 [Vitis vinifera]
 ref|XP_010649802.1| PREDICTED: uncharacterized protein LOC100244334 [Vitis vinifera]
 ref|XP_010649803.1| PREDICTED: uncharacterized protein LOC100244334 [Vitis vinifera]
Length=1044

 Score =   172 bits (436),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 94/150 (63%), Positives = 122/150 (81%), Gaps = 7/150 (5%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKN-  370
            M+CNK+EA++AK LAEKKMQN DF GA+K+A KAQ+LYPDLENI+Q+L VC+VHCSA++ 
Sbjct  1    MDCNKEEAVRAKGLAEKKMQNKDFVGARKIAIKAQQLYPDLENISQMLTVCDVHCSAEHK  60

Query  371  MLGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSD  550
            ++G + DWYG+LQ++++ADE +IKKQYRKLAL+LHPDKNKF GAEAAFKLIGEA  +L D
Sbjct  61   LIGNEIDWYGVLQIEQTADEASIKKQYRKLALLLHPDKNKFSGAEAAFKLIGEAQRVLLD  120

Query  551  QTKRSIYDSKCRVSIRSTSMRP-PPHQVNP  637
            + KRS++D +     R   M+P   HQ  P
Sbjct  121  REKRSLHDMR-----RKACMKPKAAHQTQP  145



>gb|KDP23994.1| hypothetical protein JCGZ_25382 [Jatropha curcas]
Length=957

 Score =   171 bits (434),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 92/146 (63%), Positives = 116/146 (79%), Gaps = 4/146 (3%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSA-KN  370
            MECNK+EA++AK +AE KMQN DF GA K+A KAQ+LY DLENI+Q+L VC+VHC+A K 
Sbjct  1    MECNKEEAIRAKGIAESKMQNKDFHGAHKIALKAQQLYNDLENISQMLMVCDVHCAADKK  60

Query  371  MLGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSD  550
            + G + DWY ILQ++++ADE TIKKQYRK AL+LHPDKNKFPGAEAAFKLIGEA  +L D
Sbjct  61   LFGNEMDWYAILQIEQTADEATIKKQYRKFALLLHPDKNKFPGAEAAFKLIGEAQRVLLD  120

Query  551  QTKRSIYDSKCRVSIRSTSMRPPPHQ  628
            + KRS++D K +     TS   PP++
Sbjct  121  RGKRSLHDIKRKA---PTSKPAPPYR  143



>ref|XP_009382035.1| PREDICTED: uncharacterized protein LOC103970110 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009382043.1| PREDICTED: uncharacterized protein LOC103970110 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009382052.1| PREDICTED: uncharacterized protein LOC103970110 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009382060.1| PREDICTED: uncharacterized protein LOC103970110 [Musa acuminata 
subsp. malaccensis]
Length=1054

 Score =   171 bits (433),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 91/147 (62%), Positives = 117/147 (80%), Gaps = 0/147 (0%)
 Frame = +2

Query  191  LMECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKN  370
            +MECNK+EA++A+E+AEKKMQ+ DF GA K+A KAQ L+P+LENI+ +L VC VHCSA  
Sbjct  1    MMECNKEEAIRAREVAEKKMQSRDFIGALKIARKAQHLFPELENISHMLTVCEVHCSADA  60

Query  371  MLGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSD  550
             +  + DWYGILQV+ +AD+ +IKKQYRKLAL+LHPDKN+F GAEAAFKLIGEA+ +LSD
Sbjct  61   KINGEMDWYGILQVEPTADDSSIKKQYRKLALLLHPDKNQFAGAEAAFKLIGEAHKILSD  120

Query  551  QTKRSIYDSKCRVSIRSTSMRPPPHQV  631
            +  R  YD K  V+IR+ S R P  Q+
Sbjct  121  RLTRQHYDVKMNVNIRTASSRQPAPQM  147



>ref|XP_010941769.1| PREDICTED: uncharacterized protein LOC105059940 [Elaeis guineensis]
Length=1068

 Score =   171 bits (432),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 88/147 (60%), Positives = 118/147 (80%), Gaps = 0/147 (0%)
 Frame = +2

Query  191  LMECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKN  370
            +MECNK+EA++A+++AEK+MQ+ DF GA+K+A +AQ+L+PDL+NI+Q+L VC VHCSA  
Sbjct  1    MMECNKEEAIRARDIAEKRMQSKDFTGARKIALRAQQLFPDLDNISQILTVCEVHCSAAV  60

Query  371  MLGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSD  550
             +  + DWYGILQV+ SAD+ +IKKQYRKLAL+LHPDKNKF GAEAAFKLIGEA++ LSD
Sbjct  61   KVNGEMDWYGILQVEPSADDSSIKKQYRKLALLLHPDKNKFAGAEAAFKLIGEAHMTLSD  120

Query  551  QTKRSIYDSKCRVSIRSTSMRPPPHQV  631
            + KRS++D K   + +    R P  Q 
Sbjct  121  RAKRSLHDIKRNANTKIAPSRQPSQQA  147



>gb|KDO74988.1| hypothetical protein CISIN_1g001884mg [Citrus sinensis]
 gb|KDO74989.1| hypothetical protein CISIN_1g001884mg [Citrus sinensis]
Length=1000

 Score =   170 bits (431),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 87/136 (64%), Positives = 112/136 (82%), Gaps = 1/136 (1%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKN-  370
            M+CNKDEA++ K +AE KMQ+NDF GA+K A KAQ LY DLENI+Q++ VC+VHCSA+N 
Sbjct  1    MDCNKDEAIRVKGIAESKMQSNDFAGARKFALKAQHLYQDLENISQMIMVCDVHCSAENK  60

Query  371  MLGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSD  550
            + G + DWYG+LQ++++A+E TIKKQYRK AL LHPDKNKFPGAE AFKLIGEA  +L D
Sbjct  61   LFGNEMDWYGLLQIEQTANEATIKKQYRKFALQLHPDKNKFPGAETAFKLIGEAQRVLLD  120

Query  551  QTKRSIYDSKCRVSIR  598
            + KRS++D K + S+R
Sbjct  121  KDKRSLHDMKRKASVR  136



>ref|XP_006419692.1| hypothetical protein CICLE_v10004243mg [Citrus clementina]
 ref|XP_006419693.1| hypothetical protein CICLE_v10004243mg [Citrus clementina]
 ref|XP_006489176.1| PREDICTED: uncharacterized protein LOC102618089 isoform X1 [Citrus 
sinensis]
 ref|XP_006489177.1| PREDICTED: uncharacterized protein LOC102618089 isoform X2 [Citrus 
sinensis]
 gb|ESR32932.1| hypothetical protein CICLE_v10004243mg [Citrus clementina]
 gb|ESR32933.1| hypothetical protein CICLE_v10004243mg [Citrus clementina]
Length=1000

 Score =   170 bits (431),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 87/136 (64%), Positives = 112/136 (82%), Gaps = 1/136 (1%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKN-  370
            M+CNKDEA++ K +AE KMQ+NDF GA+K A KAQ LY DLENI+Q++ VC+VHCSA+N 
Sbjct  1    MDCNKDEAIRVKGIAESKMQSNDFAGARKFALKAQHLYQDLENISQMIMVCDVHCSAENK  60

Query  371  MLGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSD  550
            + G + DWYG+LQ++++A+E TIKKQYRK AL LHPDKNKFPGAE AFKLIGEA  +L D
Sbjct  61   LFGNEMDWYGLLQIEQTANEATIKKQYRKFALQLHPDKNKFPGAETAFKLIGEAQRVLLD  120

Query  551  QTKRSIYDSKCRVSIR  598
            + KRS++D K + S+R
Sbjct  121  KDKRSLHDMKRKASVR  136



>ref|XP_008223150.1| PREDICTED: uncharacterized protein LOC103322971 [Prunus mume]
Length=944

 Score =   169 bits (429),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 92/145 (63%), Positives = 119/145 (82%), Gaps = 3/145 (2%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKN-  370
            M+CNK+EA++AK +AEKKM + DF  A+K+A KAQ+LYPDLENI+Q+L VC VHCSA+  
Sbjct  1    MDCNKEEAIRAKGIAEKKMLSKDFVVARKIAIKAQQLYPDLENISQMLMVCEVHCSAEQK  60

Query  371  MLGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSD  550
            + G + DWYGILQ+D++A+E+TIKKQYRK AL LHPDKNKF GAEAAFKLIGEA  +L D
Sbjct  61   LFGSEMDWYGILQIDQTANELTIKKQYRKFALQLHPDKNKFAGAEAAFKLIGEAQRVLLD  120

Query  551  QTKRSIYDSKCRVSIRSTSM--RPP  619
            + KRS++D K + S+R T++  RPP
Sbjct  121  RDKRSMHDLKRKASVRKTTVPYRPP  145



>ref|XP_011466353.1| PREDICTED: uncharacterized protein LOC101310244 [Fragaria vesca 
subsp. vesca]
Length=514

 Score =   165 bits (417),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 86/148 (58%), Positives = 112/148 (76%), Gaps = 1/148 (1%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKNM  373
            M+CNK++A+KA +LAE+KMQ NDF GA+K+A KAQRL+P L NI QLLAVC+VHCSA+N 
Sbjct  1    MDCNKEDAIKAMQLAERKMQGNDFTGARKMAQKAQRLFPGLGNITQLLAVCDVHCSAENK  60

Query  374  LG-LDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSD  550
            LG  + DWYGILQV R + E  I ++++KL  +LHPD NKF GAEAAF LI EAN +L+D
Sbjct  61   LGGCEMDWYGILQVQRFSTEAIINEKFKKLMPLLHPDTNKFAGAEAAFNLIKEANAVLAD  120

Query  551  QTKRSIYDSKCRVSIRSTSMRPPPHQVN  634
              K+S+YD+KCR  + +  M+   HQ  
Sbjct  121  PGKQSVYDTKCRYLLGTGVMQSSAHQFG  148



>ref|XP_010240852.1| PREDICTED: uncharacterized protein LOC104585612 [Nelumbo nucifera]
Length=1070

 Score =   167 bits (424),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 90/137 (66%), Positives = 113/137 (82%), Gaps = 1/137 (1%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKN-  370
            M+CNK+EA++AKE+A KKM N DF GA+K+A +AQ+LYPDLENI+Q+L VC VHCSA+  
Sbjct  1    MDCNKEEAIRAKEIAVKKMINKDFMGARKIALRAQQLYPDLENISQMLTVCEVHCSAEQR  60

Query  371  MLGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSD  550
            + G + DWY ILQV+++AD+ +IKKQYRKLAL+LHPDKNKF GAEAAFKLIGEA  +L D
Sbjct  61   IFGSEVDWYAILQVEQTADDASIKKQYRKLALLLHPDKNKFSGAEAAFKLIGEAQRVLLD  120

Query  551  QTKRSIYDSKCRVSIRS  601
            Q  RS YD K R S+R+
Sbjct  121  QATRSAYDMKRRNSMRT  137



>gb|KJB72559.1| hypothetical protein B456_011G184900 [Gossypium raimondii]
Length=949

 Score =   167 bits (422),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 91/148 (61%), Positives = 119/148 (80%), Gaps = 5/148 (3%)
 Frame = +2

Query  191  LMECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSA-K  367
            +M+CNK+EA++AK++AEKKMQN DF GA +VAAKAQ+L+ DLE+I+Q++ VC+VHC+A K
Sbjct  1    MMDCNKEEAIRAKDIAEKKMQNKDFSGALRVAAKAQQLFQDLESISQMIVVCDVHCAAEK  60

Query  368  NMLGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLS  547
             + G + DWY IL+VD++ADE TIKKQYRK AL LHPDKNKFPGAEAAFKLIG+A   L 
Sbjct  61   RLYGNEMDWYAILKVDQTADEATIKKQYRKFALQLHPDKNKFPGAEAAFKLIGDAQRTLL  120

Query  548  DQTKRSIYDSKCRVSIR----STSMRPP  619
            DQ KRS +D K +V++     + + RPP
Sbjct  121  DQGKRSSHDMKRKVTVNRPSPAAACRPP  148



>emb|CDY41919.1| BnaC05g46850D [Brassica napus]
Length=1191

 Score =   167 bits (424),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 92/136 (68%), Positives = 107/136 (79%), Gaps = 2/136 (1%)
 Frame = +2

Query  182  LVLLMECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCS  361
             V  M+CNK+EA +A  LAE KM+  DF GA K+  KA+RL+P+LENI +LLAVC+VH S
Sbjct  69   FVAAMDCNKEEATRAINLAEAKMKGGDFVGAHKLIMKARRLFPELENIQKLLAVCDVHSS  128

Query  362  A-KNMLGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANV  538
            A K + GLD DWYGILQV  SAD  TIKKQYRKL L+LHPDKNKFPGAEAAFKL+GEAN 
Sbjct  129  ADKKIKGLD-DWYGILQVQPSADSDTIKKQYRKLCLLLHPDKNKFPGAEAAFKLVGEANR  187

Query  539  LLSDQTKRSIYDSKCR  586
             LSDQ+KRS YD + R
Sbjct  188  WLSDQSKRSQYDVRYR  203



>gb|KJB28586.1| hypothetical protein B456_005G056900 [Gossypium raimondii]
Length=932

 Score =   166 bits (421),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 91/135 (67%), Positives = 111/135 (82%), Gaps = 1/135 (1%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSA-KN  370
            MECNK+EAL+AK +AEKKMQN DF GA KVA KAQ+L+ +LENI+Q++ VC+VHC+A K 
Sbjct  1    MECNKEEALRAKGIAEKKMQNQDFSGALKVAIKAQQLFQELENISQMIMVCDVHCAAEKP  60

Query  371  MLGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSD  550
            + G +KDWY IL+V+ +ADE TIKKQYRK AL LHPDKNKFPGAEAAFKLIG+A   L D
Sbjct  61   LFGNEKDWYAILKVEPTADEATIKKQYRKFALQLHPDKNKFPGAEAAFKLIGDAQRTLLD  120

Query  551  QTKRSIYDSKCRVSI  595
            Q KRS +D K RV++
Sbjct  121  QGKRSAHDMKRRVTV  135



>ref|XP_007144776.1| hypothetical protein PHAVU_007G183700g [Phaseolus vulgaris]
 ref|XP_007144777.1| hypothetical protein PHAVU_007G183700g [Phaseolus vulgaris]
 gb|ESW16770.1| hypothetical protein PHAVU_007G183700g [Phaseolus vulgaris]
 gb|ESW16771.1| hypothetical protein PHAVU_007G183700g [Phaseolus vulgaris]
Length=277

 Score =   158 bits (399),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 87/151 (58%), Positives = 112/151 (74%), Gaps = 6/151 (4%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKNM  373
            MECNKDEAL+A+++AE +MQ  +F+ A K A KA+ LYPD+ +I+ +LA+C VH +AK  
Sbjct  1    MECNKDEALRARKIAEARMQRGEFQEALKFATKAKNLYPDVGSISHVLAICEVHNAAKRK  60

Query  374  LG-LDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSD  550
            L   D DWY ILQ++R ADE  IKKQYR+LAL+LHPDKNKF GAE AFKL+G+AN +LSD
Sbjct  61   LSPSDMDWYAILQIERLADETAIKKQYRRLALLLHPDKNKFSGAETAFKLVGQANGVLSD  120

Query  551  QTKRSIYDSKCRVSI-----RSTSMRPPPHQ  628
            Q KRS+YD K  VS+     +ST  +  P Q
Sbjct  121  QAKRSLYDKKFAVSVSCPVPKSTDSKKKPGQ  151



>ref|XP_003626352.1| Chaperone protein dnaJ [Medicago truncatula]
 gb|ABN08160.1| Heat shock protein DnaJ [Medicago truncatula]
 gb|AES82570.1| DnaJ heat shock amino-terminal domain protein [Medicago truncatula]
Length=1084

 Score =   166 bits (421),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 89/148 (60%), Positives = 116/148 (78%), Gaps = 1/148 (1%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKNM  373
            MECNKD+ALKAK++AE +M++ DF GA K A KAQRL+P+++NI Q+L  C VHC+A+N 
Sbjct  1    MECNKDDALKAKQIAEDRMKSGDFVGALKFAKKAQRLFPEIQNITQILTACEVHCAAQNK  60

Query  374  LGL-DKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSD  550
            L + D DWYGIL  D+  DE TIKKQY+KLAL+LHPDKNK  GAEAAFKLI +AN +LSD
Sbjct  61   LSMSDMDWYGILLTDKFTDEATIKKQYKKLALLLHPDKNKSAGAEAAFKLIVDANRVLSD  120

Query  551  QTKRSIYDSKCRVSIRSTSMRPPPHQVN  634
            QTKRS+Y++K    +  T+ + PP+Q +
Sbjct  121  QTKRSLYNAKISRLVGITAPQGPPYQAD  148



>gb|KHG13047.1| DnaJ subfamily B member 12 [Gossypium arboreum]
Length=949

 Score =   166 bits (419),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 91/147 (62%), Positives = 118/147 (80%), Gaps = 5/147 (3%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSA-KN  370
            M+CNK+EA++AK++AEKKMQN DF GA +VAAKAQ+L+ DLE+I+Q++ VC+VHC+A K 
Sbjct  1    MDCNKEEAIRAKDIAEKKMQNKDFSGALRVAAKAQQLFQDLESISQMIVVCDVHCAAEKR  60

Query  371  MLGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSD  550
            + G + DWY IL+VD++ADE TIKKQYRK AL LHPDKNKFPGAEAAFKLIG+A   L D
Sbjct  61   LYGNEMDWYAILKVDQTADEATIKKQYRKFALQLHPDKNKFPGAEAAFKLIGDAQRTLLD  120

Query  551  QTKRSIYDSKCRVSIR----STSMRPP  619
            Q KRS +D K +V++     + + RPP
Sbjct  121  QGKRSSHDMKRKVTVNRPSPAAACRPP  147



>emb|CDY27809.1| BnaA05g32180D [Brassica napus]
Length=992

 Score =   166 bits (419),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 90/132 (68%), Positives = 106/132 (80%), Gaps = 2/132 (2%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSA-KN  370
            M+CNK+EA +A  +AE+KM+  DF GAQK+  KAQRL+P+LEN+ +LLAVC+VH SA K 
Sbjct  1    MDCNKEEATRAMNVAEEKMRCGDFVGAQKLVMKAQRLFPELENVQKLLAVCDVHSSADKK  60

Query  371  MLGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSD  550
            + GLD DWYGILQV  SAD  TIKKQYRKL L+LHPDKNKFPGAEAAFK +GEAN  LSD
Sbjct  61   IKGLD-DWYGILQVQPSADSDTIKKQYRKLCLLLHPDKNKFPGAEAAFKFVGEANRWLSD  119

Query  551  QTKRSIYDSKCR  586
            Q KRS YD + R
Sbjct  120  QIKRSQYDVRYR  131



>ref|XP_006606497.1| PREDICTED: meiotically up-regulated gene 184 protein-like isoform 
X1 [Glycine max]
 ref|XP_006606498.1| PREDICTED: meiotically up-regulated gene 184 protein-like isoform 
X2 [Glycine max]
Length=709

 Score =   164 bits (414),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 85/142 (60%), Positives = 110/142 (77%), Gaps = 1/142 (1%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSA-KN  370
            MECNKDEAL+A+++AE +MQ  +F  A + A KA+RLY D+ENI Q++ VC VH +A K 
Sbjct  1    MECNKDEALRARQIAEARMQRGEFAEALRFATKAKRLYADVENIAQIITVCEVHIAAQKK  60

Query  371  MLGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSD  550
            + G D DWY ILQ++R ADE T+KKQYR+LAL+LHPDKNKF GAEAAFKLIG+AN LL D
Sbjct  61   LSGCDMDWYAILQIERLADEATVKKQYRRLALLLHPDKNKFAGAEAAFKLIGQANGLLCD  120

Query  551  QTKRSIYDSKCRVSIRSTSMRP  616
            Q KRS++D K   S++  + +P
Sbjct  121  QAKRSLFDKKFGASVKGAAPKP  142



>ref|XP_010024522.1| PREDICTED: uncharacterized protein LOC104414985 [Eucalyptus grandis]
 gb|KCW60974.1| hypothetical protein EUGRSUZ_H03712 [Eucalyptus grandis]
Length=974

 Score =   166 bits (419),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 94/154 (61%), Positives = 118/154 (77%), Gaps = 6/154 (4%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSA-KN  370
            M+CNK+EAL+A+ LAEKK+Q+ DF GA+K+A KAQ+LYP+LENI QLL VC+VHCSA K 
Sbjct  1    MDCNKEEALRARTLAEKKLQSKDFPGARKIALKAQQLYPELENIAQLLMVCDVHCSAEKK  60

Query  371  MLGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSD  550
            + G + DWYGILQ++++ADE +IKKQYRK AL LHPDKNKF GAEAAFKLIGEA  +L D
Sbjct  61   LFGDEMDWYGILQLEQAADEASIKKQYRKFALYLHPDKNKFSGAEAAFKLIGEAQRVLLD  120

Query  551  QTKRSIYDSK-----CRVSIRSTSMRPPPHQVNP  637
            + KRS++D K      R S R++  R P     P
Sbjct  121  REKRSMHDMKRHVPAPRASARASYNRQPSAPYRP  154



>gb|KHN20189.1| DnaJ like subfamily B member 12 [Glycine soja]
Length=709

 Score =   164 bits (414),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 85/142 (60%), Positives = 110/142 (77%), Gaps = 1/142 (1%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSA-KN  370
            MECNKDEAL+A+++AE +MQ  +F  A + A KA+RLY D+ENI Q++ VC VH +A K 
Sbjct  1    MECNKDEALRARQIAEARMQRGEFAEALRFATKAKRLYADVENIAQIITVCEVHIAAQKK  60

Query  371  MLGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSD  550
            + G D DWY ILQ++R ADE T+KKQYR+LAL+LHPDKNKF GAEAAFKLIG+AN LL D
Sbjct  61   LSGCDMDWYAILQIERLADEATVKKQYRRLALLLHPDKNKFAGAEAAFKLIGQANGLLCD  120

Query  551  QTKRSIYDSKCRVSIRSTSMRP  616
            Q KRS++D K   S++  + +P
Sbjct  121  QAKRSLFDKKFGASVKGAAPKP  142



>ref|XP_009147297.1| PREDICTED: uncharacterized protein LOC103870872 [Brassica rapa]
 ref|XP_009147298.1| PREDICTED: uncharacterized protein LOC103870872 [Brassica rapa]
Length=1262

 Score =   166 bits (421),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 90/132 (68%), Positives = 106/132 (80%), Gaps = 2/132 (2%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSA-KN  370
            M+CNK+EA +A  +AE+KM+  DF GAQK+  KAQRL+P+LEN+ +LLAVC+VH SA K 
Sbjct  1    MDCNKEEATRAMNVAEEKMRCGDFVGAQKLVMKAQRLFPELENVQKLLAVCDVHSSADKK  60

Query  371  MLGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSD  550
            + GLD DWYGILQV  SAD  TIKKQYRKL L+LHPDKNKFPGAEAAFK +GEAN  LSD
Sbjct  61   IKGLD-DWYGILQVQPSADSDTIKKQYRKLCLLLHPDKNKFPGAEAAFKFVGEANRWLSD  119

Query  551  QTKRSIYDSKCR  586
            Q KRS YD + R
Sbjct  120  QIKRSQYDVRYR  131



>ref|NP_001068141.2| Os11g0578100 [Oryza sativa Japonica Group]
 gb|ABA94486.1| DnaJ domain containing protein, expressed [Oryza sativa Japonica 
Group]
 gb|EAZ18825.1| hypothetical protein OsJ_34362 [Oryza sativa Japonica Group]
 dbj|BAF28504.2| Os11g0578100 [Oryza sativa Japonica Group]
Length=1052

 Score =   164 bits (414),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 82/129 (64%), Positives = 104/129 (81%), Gaps = 0/129 (0%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKNM  373
            MECN++EA +A+E+A +KM+N DF GAQK+  KAQ+L+P+LENI+QLL +C+VHC+A+  
Sbjct  1    MECNREEAFRAREIALRKMENKDFNGAQKIVLKAQKLFPELENISQLLNICHVHCAAEAT  60

Query  374  LGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSDQ  553
            +    DWYGILQV+ +ADE TI+KQYRKLA  LHPDKN F GAEAAFKL+ EA+ LL D 
Sbjct  61   VNGQTDWYGILQVEATADEATIRKQYRKLAFSLHPDKNSFAGAEAAFKLVAEAHSLLCDP  120

Query  554  TKRSIYDSK  580
            TKR IYD K
Sbjct  121  TKRPIYDIK  129



>ref|XP_004508319.1| PREDICTED: uncharacterized protein LOC101508493 isoform X1 [Cicer 
arietinum]
 ref|XP_004508320.1| PREDICTED: uncharacterized protein LOC101508493 isoform X2 [Cicer 
arietinum]
Length=973

 Score =   163 bits (413),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 89/148 (60%), Positives = 115/148 (78%), Gaps = 2/148 (1%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKNM  373
            M+CNK+EAL+AK +AEKKM+N DF GA+K A KAQ+LYP LENI Q++ VC+VHCSA+  
Sbjct  1    MDCNKEEALRAKAIAEKKMENRDFMGARKFAVKAQQLYPVLENIAQMVVVCDVHCSAEKK  60

Query  374  LGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSDQ  553
             G + DWYGILQ++ +AD+  IKKQ+RK AL+LHPDKN+F GAEAAFKLIGEA ++LSD+
Sbjct  61   FGNEIDWYGILQLEHTADDAMIKKQFRKFALLLHPDKNQFAGAEAAFKLIGEAQMVLSDR  120

Query  554  TKRSIYDSKCRVSIRSTSMRPPPHQVNP  637
             KR+ YD K +V+    +M  P  Q  P
Sbjct  121  EKRTRYDMKLKVN--KPAMPRPNQQSAP  146



>gb|AES91767.2| DnaJ heat shock amino-terminal domain protein [Medicago truncatula]
Length=995

 Score =   163 bits (413),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 95/159 (60%), Positives = 123/159 (77%), Gaps = 7/159 (4%)
 Frame = +2

Query  167  WLTYFLVL----LMECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQL  334
            ++ +F VL    LM+CNK+EAL+AKE+AEKKM+N DF GA+K A KAQRLYP LENI Q+
Sbjct  29   YIPHFTVLRFGSLMDCNKEEALRAKEIAEKKMENRDFAGARKFALKAQRLYPVLENIAQM  88

Query  335  LAVCNVHCSAKN-MLGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAA  511
            L VC+VHCSA+  + G + +WYGILQ++R+A +  IKKQ+RK AL LHPDKNKF GAEAA
Sbjct  89   LVVCDVHCSAEQKVFGDEINWYGILQLERTAGDAMIKKQFRKFALQLHPDKNKFAGAEAA  148

Query  512  FKLIGEANVLLSDQTKRSIYDSKCRVSIRSTSMRPPPHQ  628
            FKLIGEA  +LSD+ KR+ YD K  +++  T+M P  +Q
Sbjct  149  FKLIGEAQRVLSDREKRTRYDMK--LNVNKTAMPPRSNQ  185



>ref|XP_010546655.1| PREDICTED: uncharacterized protein LOC104818668 [Tarenaya hassleriana]
 ref|XP_010546657.1| PREDICTED: uncharacterized protein LOC104818668 [Tarenaya hassleriana]
Length=1205

 Score =   164 bits (414),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 91/148 (61%), Positives = 116/148 (78%), Gaps = 2/148 (1%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKNM  373
            MECNK+EA++AKELAE+KM+  DF GAQK   KAQ+L+P+LEN+  L+ +C+VHCSA+N 
Sbjct  1    MECNKEEAMRAKELAEEKMRAGDFIGAQKFVKKAQQLFPNLENLTHLVTICDVHCSAQNK  60

Query  374  L-GLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSD  550
            + GLD +WYGILQ+    D  TIKKQYRKLAL+LHPDKNKF GAEAAFKL+GEAN +L+D
Sbjct  61   ISGLD-NWYGILQLKHFVDVATIKKQYRKLALLLHPDKNKFSGAEAAFKLVGEANRVLAD  119

Query  551  QTKRSIYDSKCRVSIRSTSMRPPPHQVN  634
            QTKRS YD K R+    ++++    Q N
Sbjct  120  QTKRSQYDIKYRIFSEVSALKSGNKQPN  147



>gb|EYU28379.1| hypothetical protein MIMGU_mgv1a019779mg, partial [Erythranthe 
guttata]
Length=176

 Score =   152 bits (383),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 77/136 (57%), Positives = 106/136 (78%), Gaps = 5/136 (4%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKN-  370
            MECNK+EA++AK++AE KM+ +DFEGA+K+  KAQ+LYP LE +NQ++ +C V CSA+  
Sbjct  1    MECNKEEAMRAKQIAETKMEKHDFEGARKIVMKAQKLYPKLETLNQMVIICEVICSAQKS  60

Query  371  ----MLGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANV  538
                    D DWYGILQ+++ +DE+T++KQYR+LAL LHPDKN+FPGAEAAFKLI +A  
Sbjct  61   SSNLATESDNDWYGILQIEKLSDELTVRKQYRRLALSLHPDKNRFPGAEAAFKLISQAYE  120

Query  539  LLSDQTKRSIYDSKCR  586
            +LSD   +S+YD K +
Sbjct  121  VLSDPKSKSLYDGKIK  136



>ref|XP_004495763.1| PREDICTED: uncharacterized protein LOC101513909 [Cicer arietinum]
Length=683

 Score =   160 bits (406),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 90/148 (61%), Positives = 112/148 (76%), Gaps = 1/148 (1%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKNM  373
            MECNKDEA++AK++AE ++Q  +F  A K A KA++LYPD+ENI Q+LAVC VH +A+N 
Sbjct  1    MECNKDEAVRAKQVAESRIQRGEFVEALKFANKAKKLYPDVENIAQILAVCEVHKAAQNK  60

Query  374  L-GLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSD  550
            L G   DWYGILQ +R ++E  IKKQYRKLAL+LHPDKNKF GAEAAFKLI EAN +LSD
Sbjct  61   LSGSVMDWYGILQTERLSEEAIIKKQYRKLALLLHPDKNKFAGAEAAFKLIVEANGVLSD  120

Query  551  QTKRSIYDSKCRVSIRSTSMRPPPHQVN  634
            Q  RS+YD K +V  R+   +   HQ N
Sbjct  121  QANRSLYDMKLKVHPRTAVPKTSSHQSN  148



>gb|EMT10790.1| DnaJ homolog subfamily B member 5 [Aegilops tauschii]
Length=976

 Score =   162 bits (411),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 86/146 (59%), Positives = 115/146 (79%), Gaps = 1/146 (1%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKNM  373
            M+CNK+EA++AK LAE+K+   DF GA+K+  KAQ+L+ +++NI+Q+L VC+VHC+A   
Sbjct  1    MDCNKEEAIRAKALAERKLLEKDFVGAKKLIIKAQQLFSEIDNISQMLTVCDVHCAAGTK  60

Query  374  LGLDKDWYGILQVDR-SADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSD  550
            +  + DWYGILQV   + D+  IKKQYRKLAL+LHPDKNKF GAEAAFKL+GEAN+ L+D
Sbjct  61   VNGELDWYGILQVPAFTNDDTLIKKQYRKLALLLHPDKNKFAGAEAAFKLVGEANMTLTD  120

Query  551  QTKRSIYDSKCRVSIRSTSMRPPPHQ  628
             +KRS YD K RVS+R  + RP P+Q
Sbjct  121  SSKRSAYDMKRRVSVRVGAARPSPYQ  146



>gb|EMS59052.1| DnaJ homolog subfamily B member 5 [Triticum urartu]
Length=976

 Score =   162 bits (411),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 86/146 (59%), Positives = 115/146 (79%), Gaps = 1/146 (1%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKNM  373
            M+CNK+EA++AK LAE+K+   DF GA+K+  KAQ+L+ +++NI+Q+L VC+VHC+A   
Sbjct  1    MDCNKEEAIRAKALAERKLLEKDFVGAKKLIIKAQQLFSEIDNISQMLTVCDVHCAAGTK  60

Query  374  LGLDKDWYGILQVDR-SADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSD  550
            +  + DWYGILQV   + D+  IKKQYRKLAL+LHPDKNKF GAEAAFKL+GEAN+ L+D
Sbjct  61   VNGELDWYGILQVPAFTNDDTLIKKQYRKLALLLHPDKNKFAGAEAAFKLVGEANMTLTD  120

Query  551  QTKRSIYDSKCRVSIRSTSMRPPPHQ  628
             +KRS YD K RVS+R  + RP P+Q
Sbjct  121  SSKRSAYDMKRRVSVRVGAARPSPYQ  146



>ref|XP_009399319.1| PREDICTED: uncharacterized protein LOC103983771 [Musa acuminata 
subsp. malaccensis]
Length=1066

 Score =   162 bits (411),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 85/141 (60%), Positives = 112/141 (79%), Gaps = 5/141 (4%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKNM  373
            M+CNK+EA +A+E+AE+KMQN DF GA+K+A KAQRL+P LENI+Q+L VC VHCSA   
Sbjct  1    MDCNKEEAFRAREIAERKMQNKDFSGARKIAQKAQRLFPVLENISQMLTVCEVHCSANVK  60

Query  374  LGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSDQ  553
            +  + DWYGILQV+ +AD  +++KQYR+LAL+LHPDKN+F GAE AFKLIGEA++ LSDQ
Sbjct  61   VNGEMDWYGILQVEPTADYSSVRKQYRRLALLLHPDKNQFAGAEPAFKLIGEAHMTLSDQ  120

Query  554  TKRSIYDSKCRVSIRSTSMRP  616
             KR +YD K     R+ + +P
Sbjct  121  EKRHLYDIK-----RNATFKP  136



>gb|ABF69988.1| heat shock protein DnaJ N-terminal domain-containing protein 
[Musa acuminata]
Length=1015

 Score =   162 bits (411),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 85/141 (60%), Positives = 112/141 (79%), Gaps = 5/141 (4%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKNM  373
            M+CNK+EA +A+E+AE+KMQN DF GA+K+A KAQRL+P LENI+Q+L VC VHCSA   
Sbjct  1    MDCNKEEAFRAREIAERKMQNKDFSGARKIAQKAQRLFPVLENISQMLTVCEVHCSANVK  60

Query  374  LGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSDQ  553
            +  + DWYGILQV+ +AD  +++KQYR+LAL+LHPDKN+F GAE AFKLIGEA++ LSDQ
Sbjct  61   VNGEMDWYGILQVEPTADYSSVRKQYRRLALLLHPDKNQFAGAEPAFKLIGEAHMTLSDQ  120

Query  554  TKRSIYDSKCRVSIRSTSMRP  616
             KR +YD K     R+ + +P
Sbjct  121  EKRHLYDIK-----RNATFKP  136



>ref|XP_003591045.1| DnAJ-like protein slr0093 [Medicago truncatula]
Length=327

 Score =   155 bits (393),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 87/148 (59%), Positives = 110/148 (74%), Gaps = 1/148 (1%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKNM  373
            MECNKD+A+KAK+LAE KMQ  +F  A K A KA+RLY D+ENI Q+LAVC VH +A N 
Sbjct  1    MECNKDDAVKAKQLAETKMQRGEFVDALKFANKAKRLYADVENIAQILAVCEVHNAALNK  60

Query  374  LG-LDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSD  550
            L   D DWYG+LQ ++ ++E  IKKQY+KLAL+LHPDKNK  GAEAAFKLIGEAN +LSD
Sbjct  61   LSKYDMDWYGVLQTEKLSEEAIIKKQYKKLALLLHPDKNKSAGAEAAFKLIGEANRVLSD  120

Query  551  QTKRSIYDSKCRVSIRSTSMRPPPHQVN  634
            +  RS+YD K +  +R+ + +   H  N
Sbjct  121  KATRSLYDIKVKAHVRAAASKTSSHPSN  148



>ref|XP_006600331.1| PREDICTED: uncharacterized protein LOC100789112 isoform X2 [Glycine 
max]
Length=1023

 Score =   162 bits (410),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 90/141 (64%), Positives = 113/141 (80%), Gaps = 1/141 (1%)
 Frame = +2

Query  191  LMECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKN  370
            LM+CNK+EAL+AK++AEKKM+N DF GA+K+A KAQ+LYPDLENI Q+L VC+VHCSA+ 
Sbjct  63   LMDCNKEEALRAKDIAEKKMENRDFVGARKIALKAQQLYPDLENIAQMLVVCDVHCSAEQ  122

Query  371  ML-GLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLS  547
             L G + DWY ILQV+++A +  IKKQYRK AL LHPDKN F GAEAAFKLIGEA  +L 
Sbjct  123  KLYGNEMDWYEILQVEQTAGDAIIKKQYRKFALQLHPDKNNFAGAEAAFKLIGEAQRVLL  182

Query  548  DQTKRSIYDSKCRVSIRSTSM  610
            D+ KRS++D K RV +   +M
Sbjct  183  DREKRSLFDMKLRVPMNKPAM  203



>ref|XP_011009900.1| PREDICTED: uncharacterized protein LOC105114890 [Populus euphratica]
Length=957

 Score =   162 bits (409),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 86/145 (59%), Positives = 110/145 (76%), Gaps = 3/145 (2%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSA-KN  370
            MECNKDEA +AK +AE  M   DF  A+++  KAQ+LY DLENI+Q+L VC+VHC+A K 
Sbjct  1    MECNKDEAFRAKGVAESLMVKKDFPTARRILLKAQQLYKDLENISQMLTVCDVHCTADKK  60

Query  371  MLGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSD  550
            +LG D DWYGILQ++ +ADE TIKKQYRK AL LHPDKN+FPGAE+AFKLI +A  +L D
Sbjct  61   LLGTDMDWYGILQIEETADEATIKKQYRKFALQLHPDKNQFPGAESAFKLIKDAQTVLLD  120

Query  551  QTKRSIYDSKCRVSIRSTS--MRPP  619
            + KRS++D K + S+   +   RPP
Sbjct  121  KGKRSLHDIKRKASMSKPAPPYRPP  145



>ref|XP_004956016.1| PREDICTED: uncharacterized protein LOC101779534 isoform X1 [Setaria 
italica]
Length=1111

 Score =   162 bits (409),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 86/142 (61%), Positives = 113/142 (80%), Gaps = 1/142 (1%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKNM  373
            MECN++EA +AK+LA  K+Q  D+ GA+++A KAQ+L+P LENI+QLL VC VHC A   
Sbjct  1    MECNREEASRAKDLAVIKLQEADYAGAKRIALKAQKLFPGLENISQLLTVCEVHCCAAVK  60

Query  374  LGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSDQ  553
            +  + DWYGILQV+ +AD+V +KKQYRKLAL+LHPDKNKF GAEAAFKLIGEA+++L+DQ
Sbjct  61   INGETDWYGILQVETTADDVLLKKQYRKLALLLHPDKNKFVGAEAAFKLIGEAHMILTDQ  120

Query  554  TKRSIYDSKCRVSIRSTSMRPP  619
             KRS +D K R  + +TS+  P
Sbjct  121  VKRSSHDFK-RKQVIATSVPVP  141



>ref|XP_003547217.1| PREDICTED: uncharacterized protein LOC100817232 isoform X1 [Glycine 
max]
 ref|XP_006597546.1| PREDICTED: uncharacterized protein LOC100817232 isoform X2 [Glycine 
max]
Length=968

 Score =   161 bits (407),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 93/148 (63%), Positives = 113/148 (76%), Gaps = 1/148 (1%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKN-  370
            MECNK+EAL+AKELAEKKMQN DF GA+K A KAQ+LYP+LENI Q+L VC+VHCSA+  
Sbjct  1    MECNKEEALRAKELAEKKMQNKDFIGARKFALKAQQLYPELENITQMLIVCDVHCSAEQK  60

Query  371  MLGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSD  550
            ++G + DWY ILQ++ +A++ TIKKQYRK AL LHPDKNKF GAEAAFKLIGEA  +L D
Sbjct  61   LIGNEMDWYKILQIELTANDTTIKKQYRKFALQLHPDKNKFSGAEAAFKLIGEAQRVLLD  120

Query  551  QTKRSIYDSKCRVSIRSTSMRPPPHQVN  634
            + KRS  D   R    + +  P  HQ N
Sbjct  121  REKRSRLDMNLRRVPTNRTTMPSHHQQN  148



>dbj|BAJ94831.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1131

 Score =   161 bits (408),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 83/135 (61%), Positives = 110/135 (81%), Gaps = 0/135 (0%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKNM  373
            MECN++EA+KA+E+A KK+++ DF GA+++A KAQR++P+LEN++QLL VC VHC+A+  
Sbjct  1    MECNREEAVKAREIALKKLESKDFVGAKRIALKAQRIFPELENLSQLLTVCEVHCAAEAK  60

Query  374  LGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSDQ  553
            +    D+YGILQVD +ADE TIKKQYRKLA  LHPDKN +PGAEAAFKL+ EA+  LSD+
Sbjct  61   INELLDFYGILQVDATADEATIKKQYRKLAFSLHPDKNSYPGAEAAFKLVAEAHSTLSDR  120

Query  554  TKRSIYDSKCRVSIR  598
            TK+  YD K RV+ R
Sbjct  121  TKKPAYDIKWRVASR  135



>ref|XP_002314476.2| DNAJ heat shock N-terminal domain-containing family protein [Populus 
trichocarpa]
 gb|EEF00647.2| DNAJ heat shock N-terminal domain-containing family protein [Populus 
trichocarpa]
Length=866

 Score =   160 bits (406),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 85/145 (59%), Positives = 110/145 (76%), Gaps = 3/145 (2%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSA-KN  370
            MECNKDEA +AK +AE  M   DF  A+++  KAQ+LY DLENI+Q+L VC+VHC+A K 
Sbjct  1    MECNKDEAFRAKGVAESLMVKKDFPTARRILLKAQQLYKDLENISQMLTVCDVHCTADKK  60

Query  371  MLGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSD  550
            +LG D DWYGIL+++ +ADE TIKKQYRK AL LHPDKN+FPGAE+AFKLI +A  +L D
Sbjct  61   LLGTDMDWYGILKIEETADEATIKKQYRKFALQLHPDKNQFPGAESAFKLIKDAQTVLLD  120

Query  551  QTKRSIYDSKCRVSIRSTS--MRPP  619
            + KRS++D K + S+   +   RPP
Sbjct  121  KGKRSLHDIKRKASMSKPAPPYRPP  145



>gb|KHN47283.1| DnaJ like subfamily B member 14 [Glycine soja]
Length=968

 Score =   161 bits (407),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 95/149 (64%), Positives = 114/149 (77%), Gaps = 3/149 (2%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKN-  370
            MECNK+EA++AKELAEKKMQN DF GA+K A KAQ+LYPDLENI Q+L VC+VHCSA+  
Sbjct  1    MECNKEEAIRAKELAEKKMQNKDFNGARKFAIKAQQLYPDLENITQMLIVCDVHCSAEQK  60

Query  371  MLGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSD  550
            +   + DWY ILQ++ +A++ TIKKQYRK AL LHPDKNKF GAEAAFKLIGEA  +L D
Sbjct  61   LFSNEMDWYKILQIELTANDTTIKKQYRKFALQLHPDKNKFAGAEAAFKLIGEAQRVLLD  120

Query  551  QTKRSIYDSKC-RVSIRSTSMRPPPHQVN  634
            + KRS  D    RV +  T+M P  HQ N
Sbjct  121  REKRSRLDMNLRRVPMNRTTM-PSHHQQN  148



>ref|XP_003541656.1| PREDICTED: uncharacterized protein LOC100779228 isoform X1 [Glycine 
max]
 ref|XP_006594470.1| PREDICTED: uncharacterized protein LOC100779228 isoform X2 [Glycine 
max]
 ref|XP_006594471.1| PREDICTED: uncharacterized protein LOC100779228 isoform X3 [Glycine 
max]
 ref|XP_006594472.1| PREDICTED: uncharacterized protein LOC100779228 isoform X4 [Glycine 
max]
Length=968

 Score =   160 bits (406),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 95/149 (64%), Positives = 114/149 (77%), Gaps = 3/149 (2%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKN-  370
            MECNK+EA++AKELAEKKMQN DF GA+K A KAQ+LYPDLENI Q+L VC+VHCSA+  
Sbjct  1    MECNKEEAIRAKELAEKKMQNKDFNGARKFAIKAQQLYPDLENITQMLIVCDVHCSAEQK  60

Query  371  MLGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSD  550
            +   + DWY ILQ++ +A++ TIKKQYRK AL LHPDKNKF GAEAAFKLIGEA  +L D
Sbjct  61   LFSNEMDWYKILQIELTANDTTIKKQYRKFALQLHPDKNKFAGAEAAFKLIGEAQRVLLD  120

Query  551  QTKRSIYDSKC-RVSIRSTSMRPPPHQVN  634
            + KRS  D    RV +  T+M P  HQ N
Sbjct  121  REKRSRLDMNLRRVPMNRTTM-PSHHQQN  148



>ref|XP_003550525.1| PREDICTED: uncharacterized protein LOC100789112 isoform X1 [Glycine 
max]
 ref|XP_006600332.1| PREDICTED: uncharacterized protein LOC100789112 isoform X3 [Glycine 
max]
 ref|XP_006600333.1| PREDICTED: uncharacterized protein LOC100789112 isoform X4 [Glycine 
max]
Length=960

 Score =   160 bits (406),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 89/140 (64%), Positives = 112/140 (80%), Gaps = 1/140 (1%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKNM  373
            M+CNK+EAL+AK++AEKKM+N DF GA+K+A KAQ+LYPDLENI Q+L VC+VHCSA+  
Sbjct  1    MDCNKEEALRAKDIAEKKMENRDFVGARKIALKAQQLYPDLENIAQMLVVCDVHCSAEQK  60

Query  374  L-GLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSD  550
            L G + DWY ILQV+++A +  IKKQYRK AL LHPDKN F GAEAAFKLIGEA  +L D
Sbjct  61   LYGNEMDWYEILQVEQTAGDAIIKKQYRKFALQLHPDKNNFAGAEAAFKLIGEAQRVLLD  120

Query  551  QTKRSIYDSKCRVSIRSTSM  610
            + KRS++D K RV +   +M
Sbjct  121  REKRSLFDMKLRVPMNKPAM  140



>gb|KHN03398.1| Protein HLJ1 [Glycine soja]
Length=960

 Score =   160 bits (406),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 89/140 (64%), Positives = 112/140 (80%), Gaps = 1/140 (1%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKNM  373
            M+CNK+EAL+AK++AEKKM+N DF GA+K+A KAQ+LYPDLENI Q+L VC+VHCSA+  
Sbjct  1    MDCNKEEALRAKDIAEKKMENRDFVGARKIALKAQQLYPDLENIAQMLVVCDVHCSAEQK  60

Query  374  L-GLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSD  550
            L G + DWY ILQV+++A +  IKKQYRK AL LHPDKN F GAEAAFKLIGEA  +L D
Sbjct  61   LYGNEMDWYEILQVEQTAGDAIIKKQYRKFALQLHPDKNNFAGAEAAFKLIGEAQRVLLD  120

Query  551  QTKRSIYDSKCRVSIRSTSM  610
            + KRS++D K RV +   +M
Sbjct  121  REKRSLFDMKLRVPMNKPAM  140



>ref|XP_011468427.1| PREDICTED: dnaJ homolog subfamily B member 4-like [Fragaria vesca 
subsp. vesca]
Length=469

 Score =   157 bits (396),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 81/139 (58%), Positives = 112/139 (81%), Gaps = 1/139 (1%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKNM  373
            M+CNK+EA++A +L+++KMQ NDF GA+K+A  AQ L+P+L+NI+QLL  C VHCSA+N 
Sbjct  1    MDCNKEEAIRAMQLSQEKMQINDFAGARKMALTAQYLFPELKNISQLLTACEVHCSAENK  60

Query  374  L-GLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSD  550
            + GL+ DWYG+LQ+ +  ++ +IKKQ++KLAL+LHPDKNKFPGAEAAFKLI EAN +L+D
Sbjct  61   IAGLEMDWYGVLQIQQFDNDESIKKQFKKLALLLHPDKNKFPGAEAAFKLIVEANRVLAD  120

Query  551  QTKRSIYDSKCRVSIRSTS  607
            Q  R+ YD K R ++   S
Sbjct  121  QVTRAKYDKKYRKALAKAS  139



>ref|XP_007035447.1| DNAJ heat shock N-terminal domain-containing protein, putative 
[Theobroma cacao]
 gb|EOY06373.1| DNAJ heat shock N-terminal domain-containing protein, putative 
[Theobroma cacao]
Length=978

 Score =   160 bits (406),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 85/135 (63%), Positives = 109/135 (81%), Gaps = 1/135 (1%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSA-KN  370
            M+CNK+EA++AK++A KKMQN DF GA K+ AKAQ+L+ DLEN++Q++ VC VHC+A K 
Sbjct  1    MDCNKEEAIRAKDIAVKKMQNKDFSGALKIVAKAQQLFQDLENLSQMIMVCEVHCAAEKR  60

Query  371  MLGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSD  550
            + G + DWY IL+V+ +AD  TIKKQYRK AL LHPDKNKFPGAEAAFKLIG+A  +L D
Sbjct  61   LFGNEMDWYAILKVELTADAATIKKQYRKFALQLHPDKNKFPGAEAAFKLIGDAQRILLD  120

Query  551  QTKRSIYDSKCRVSI  595
            Q KRS +D K +V+I
Sbjct  121  QGKRSAHDMKRKVTI  135



>ref|XP_004294830.1| PREDICTED: uncharacterized protein LOC101301565 [Fragaria vesca 
subsp. vesca]
Length=949

 Score =   160 bits (405),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 87/146 (60%), Positives = 115/146 (79%), Gaps = 4/146 (3%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKNM  373
            M+CN++EA++AK +AEKKM++ DF GA+K   KAQ+LYPDLENI+Q+L VC VHCSA+  
Sbjct  1    MDCNREEAIRAKGIAEKKMESKDFAGARKFGVKAQQLYPDLENISQMLMVCEVHCSAEQK  60

Query  374  L--GLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLS  547
            L  G +KDWYGILQ+D+ ADE TIK+Q++K AL LHPDKNKF GAEAAF+LI EA  +L 
Sbjct  61   LFGGNEKDWYGILQIDQKADEQTIKRQFKKFALQLHPDKNKFSGAEAAFQLISEAQNVLL  120

Query  548  DQTKRSIYDSKCRVSIRSTSM--RPP  619
            D+ KRS++D K R  +  T++  +PP
Sbjct  121  DRDKRSLHDIKRRACVSKTNVPYQPP  146



>ref|XP_003609570.1| DnaJ homolog subfamily B member [Medicago truncatula]
Length=973

 Score =   160 bits (405),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 91/146 (62%), Positives = 116/146 (79%), Gaps = 3/146 (2%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKN-  370
            M+CNK+EAL+AKE+AEKKM+N DF GA+K A KAQRLYP LENI Q+L VC+VHCSA+  
Sbjct  1    MDCNKEEALRAKEIAEKKMENRDFAGARKFALKAQRLYPVLENIAQMLVVCDVHCSAEQK  60

Query  371  MLGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSD  550
            + G + +WYGILQ++R+A +  IKKQ+RK AL LHPDKNKF GAEAAFKLIGEA  +LSD
Sbjct  61   VFGDEINWYGILQLERTAGDAMIKKQFRKFALQLHPDKNKFAGAEAAFKLIGEAQRVLSD  120

Query  551  QTKRSIYDSKCRVSIRSTSMRPPPHQ  628
            + KR+ YD K  +++  T+M P  +Q
Sbjct  121  REKRTRYDMK--LNVNKTAMPPRSNQ  144



>ref|XP_010098318.1| DnaJ homolog subfamily B member 12 [Morus notabilis]
 gb|EXB74822.1| DnaJ homolog subfamily B member 12 [Morus notabilis]
Length=930

 Score =   160 bits (405),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 89/143 (62%), Positives = 111/143 (78%), Gaps = 2/143 (1%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSA-KN  370
            M+CNK+EAL+AK +AEKKMQ+ DF GA+K+A KAQ+LY D+ENI+Q+L VC+VHCSA K 
Sbjct  1    MDCNKEEALRAKAIAEKKMQSKDFVGARKIALKAQQLYSDVENISQMLMVCDVHCSAEKK  60

Query  371  MLGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSD  550
            + G + DWYGILQ++ SADE TIKKQYR+ AL LHPDKNKF GAE AFKLIGEA  +L D
Sbjct  61   LFGGEMDWYGILQLEMSADEATIKKQYRRFALQLHPDKNKFAGAEGAFKLIGEAQRILLD  120

Query  551  QTKRSIYDSKCRVSIR-STSMRP  616
              KR ++D +    +R S   RP
Sbjct  121  NEKRKLHDFRRGGGVRPSMQYRP  143



>ref|XP_006662997.1| PREDICTED: uncharacterized protein LOC102709967 [Oryza brachyantha]
Length=1056

 Score =   160 bits (405),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 77/130 (59%), Positives = 105/130 (81%), Gaps = 0/130 (0%)
 Frame = +2

Query  191  LMECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKN  370
            +MECN++EA +A+E+A + M+N DF GAQ++  KAQ+L+P+L+NI+QLL +C+VHC+A+ 
Sbjct  1    MMECNREEAFRAREVAVRMMENKDFNGAQRIVLKAQKLFPELDNISQLLNICHVHCAAEA  60

Query  371  MLGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSD  550
             +  D DWYGILQV+ +AD+ TI+KQYRKLA  LHPDKN F G+EAAFKL+ EA+ LL D
Sbjct  61   RVNGDTDWYGILQVEATADDATIRKQYRKLAFSLHPDKNSFVGSEAAFKLVAEAHSLLCD  120

Query  551  QTKRSIYDSK  580
             TKR +YD K
Sbjct  121  PTKRRLYDIK  130



>gb|EMT30764.1| Curved DNA-binding protein [Aegilops tauschii]
Length=1295

 Score =   160 bits (406),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 85/142 (60%), Positives = 113/142 (80%), Gaps = 1/142 (1%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKNM  373
            MECNK+EA +AK+++E+K+   DF GA+K+A KA +L+P LENI+QLLAVC VHCS+   
Sbjct  1    MECNKEEASRAKDVSERKLHEADFPGAKKMAVKAHQLFPGLENISQLLAVCEVHCSSSVK  60

Query  374  LGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSDQ  553
            +  + DWYGILQV+ +AD++ +KKQYRKLAL+LHPDKNKF GAEAAFKLIGEA + L+D 
Sbjct  61   INGETDWYGILQVEPTADDMALKKQYRKLALLLHPDKNKFAGAEAAFKLIGEAYMTLTDH  120

Query  554  TKRSIYDSKCRVSIRSTSMRPP  619
             KRS +D+K R ++ +TS   P
Sbjct  121  VKRSSHDNK-RKAVFATSAPVP  141



>gb|EMS51154.1| Curved DNA-binding protein [Triticum urartu]
Length=1190

 Score =   160 bits (404),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 85/142 (60%), Positives = 113/142 (80%), Gaps = 1/142 (1%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKNM  373
            MECNK+EA +AK+++E+K+   DF GA+K+A KA +L+P LENI+QLLAVC VHCS+   
Sbjct  1    MECNKEEASRAKDVSERKLHEADFPGAKKMALKAHQLFPGLENISQLLAVCEVHCSSSVK  60

Query  374  LGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSDQ  553
            +  + DWYGILQV+ +AD++ +KKQYRKLAL+LHPDKNKF GAEAAFKLIGEA + L+D 
Sbjct  61   INGETDWYGILQVEPTADDMVLKKQYRKLALLLHPDKNKFAGAEAAFKLIGEAYMTLTDH  120

Query  554  TKRSIYDSKCRVSIRSTSMRPP  619
             KRS +D+K R ++ +TS   P
Sbjct  121  VKRSSHDNK-RKAVFATSAPMP  141



>ref|XP_007144775.1| hypothetical protein PHAVU_007G183600g [Phaseolus vulgaris]
 gb|ESW16769.1| hypothetical protein PHAVU_007G183600g [Phaseolus vulgaris]
Length=688

 Score =   157 bits (396),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 81/139 (58%), Positives = 109/139 (78%), Gaps = 1/139 (1%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSA-KN  370
            MECNK+EA++A+++AE +MQ  +F  A + A KA++LY D+ENI Q+L VC VH +A K 
Sbjct  1    MECNKEEAVRARQMAEARMQRGEFVEALRFATKAKKLYADVENITQILTVCEVHNAAHKK  60

Query  371  MLGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSD  550
            +   D DWY +LQ++R ADE  IKKQYR+LAL+LHPDKNK+ GAEAAFKLIG+AN +LSD
Sbjct  61   VSATDMDWYALLQIERLADEAVIKKQYRRLALLLHPDKNKYAGAEAAFKLIGQANGVLSD  120

Query  551  QTKRSIYDSKCRVSIRSTS  607
            Q KRS YDS+  +S+R+ +
Sbjct  121  QAKRSSYDSQYGISVRAAA  139



>ref|XP_007147854.1| hypothetical protein PHAVU_006G160400g [Phaseolus vulgaris]
 gb|ESW19848.1| hypothetical protein PHAVU_006G160400g [Phaseolus vulgaris]
Length=963

 Score =   158 bits (400),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 86/132 (65%), Positives = 104/132 (79%), Gaps = 1/132 (1%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKN-  370
            MECNK+EA++AKE+AE++MQN DF GA+K A KAQ+LYPDLENINQ+L VC+VHC A+  
Sbjct  1    MECNKEEAVRAKEIAERRMQNKDFNGARKFALKAQQLYPDLENINQMLIVCDVHCFAEQK  60

Query  371  MLGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSD  550
            + G + DWY ILQ++  AD+ TI+KQYRK AL LHPDKNKF GAEAAFKLIGEA  +L D
Sbjct  61   LFGNEMDWYKILQIELMADDTTIRKQYRKFALQLHPDKNKFAGAEAAFKLIGEAQRVLLD  120

Query  551  QTKRSIYDSKCR  586
              KRS  D   R
Sbjct  121  GEKRSRLDMNLR  132



>ref|XP_006644181.1| PREDICTED: uncharacterized protein LOC102699722 [Oryza brachyantha]
Length=992

 Score =   158 bits (399),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 83/139 (60%), Positives = 110/139 (79%), Gaps = 0/139 (0%)
 Frame = +2

Query  191  LMECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKN  370
            +ME N++EALKA+++A KKM+N DF+GA+++A KAQR++P+ ENI+Q+L VC VHC+A+ 
Sbjct  1    MMEGNREEALKARDIAAKKMENKDFDGAKRIALKAQRIFPETENISQMLTVCEVHCAAEA  60

Query  371  MLGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSD  550
             L    D+YG+LQV+ +ADE TIK+QYRKLA  LHPDKN F GAEAAFKL+ EA+  LSD
Sbjct  61   KLNGLLDFYGVLQVEITADEATIKRQYRKLAFSLHPDKNSFAGAEAAFKLVAEAHSTLSD  120

Query  551  QTKRSIYDSKCRVSIRSTS  607
            +TKR  YD K RV+ R  S
Sbjct  121  RTKRCAYDIKWRVASRIAS  139



>ref|XP_006356967.1| PREDICTED: uncharacterized protein LOC102580437 [Solanum tuberosum]
Length=917

 Score =   157 bits (398),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 81/130 (62%), Positives = 105/130 (81%), Gaps = 1/130 (1%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKN-  370
            M+CNK+EA+KA+ +AE  M N DF GA+K A+KAQ+L+PDLENI Q++ VC VHCSA+N 
Sbjct  1    MDCNKEEAIKARGIAEVMMGNRDFVGAKKFASKAQKLFPDLENITQMVLVCEVHCSAENK  60

Query  371  MLGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSD  550
              G +KDWYGIL+V+ +AD+  I+KQYRK AL+LHPDKNKFPGA  AF LIGEA  +LSD
Sbjct  61   SFGNEKDWYGILKVEPTADDALIRKQYRKFALLLHPDKNKFPGAADAFSLIGEALSVLSD  120

Query  551  QTKRSIYDSK  580
            + KR +Y+S+
Sbjct  121  RPKRMLYNSR  130



>ref|NP_001043077.1| Os01g0375100 [Oryza sativa Japonica Group]
 dbj|BAD61384.1| DNAJ heat shock N-terminal domain-containing protein-like [Oryza 
sativa Japonica Group]
 dbj|BAD61387.1| DNAJ heat shock N-terminal domain-containing protein-like [Oryza 
sativa Japonica Group]
 dbj|BAF04991.1| Os01g0375100 [Oryza sativa Japonica Group]
 dbj|BAG95629.1| unnamed protein product [Oryza sativa Japonica Group]
Length=1008

 Score =   157 bits (398),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 82/139 (59%), Positives = 109/139 (78%), Gaps = 0/139 (0%)
 Frame = +2

Query  191  LMECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKN  370
            +MECNK+EALKA+++A KKM++ DF GA+++A KAQR++P+LENI+Q+L VC VHC+A+ 
Sbjct  1    MMECNKEEALKARDIAAKKMESKDFVGAKRIALKAQRIFPELENISQMLTVCEVHCAAEA  60

Query  371  MLGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSD  550
             +    D+YG+LQVD  ADE TIKKQ+RKLA  LHPDKN F GAEAAFKL+ EA   LSD
Sbjct  61   KMNGLLDFYGVLQVDVMADEATIKKQFRKLAFSLHPDKNGFAGAEAAFKLVAEAQSTLSD  120

Query  551  QTKRSIYDSKCRVSIRSTS  607
            +TKR  YD K R++ +  +
Sbjct  121  RTKRRAYDIKWRIASKQAT  139



>gb|KHN03011.1| Protein HLJ1 [Glycine soja]
Length=958

 Score =   157 bits (397),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 86/140 (61%), Positives = 111/140 (79%), Gaps = 1/140 (1%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKN-  370
            M+CNK+EAL+AK++AEKKM+N DF GA+K+A KAQ+LYPDLENI Q+L VC+VHCS++  
Sbjct  1    MDCNKEEALRAKDIAEKKMENRDFVGARKIALKAQQLYPDLENIAQMLVVCDVHCSSEQK  60

Query  371  MLGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSD  550
            + G + DWY ILQV+++A +  IKKQYRK AL LHPDKN F GAE+AFKLIGEA  +L D
Sbjct  61   LFGNEMDWYEILQVEQTAGDAIIKKQYRKFALQLHPDKNNFAGAESAFKLIGEAQRVLLD  120

Query  551  QTKRSIYDSKCRVSIRSTSM  610
            + KRS++D K RV     +M
Sbjct  121  REKRSLFDMKRRVPTNKPAM  140



>ref|XP_003529595.1| PREDICTED: uncharacterized protein LOC100795200 [Glycine max]
Length=958

 Score =   157 bits (397),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 86/140 (61%), Positives = 111/140 (79%), Gaps = 1/140 (1%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKN-  370
            M+CNK+EAL+AK++AEKKM+N DF GA+K+A KAQ+LYPDLENI Q+L VC+VHCS++  
Sbjct  1    MDCNKEEALRAKDIAEKKMENRDFVGARKIALKAQQLYPDLENIAQMLVVCDVHCSSEQK  60

Query  371  MLGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSD  550
            + G + DWY ILQV+++A +  IKKQYRK AL LHPDKN F GAE+AFKLIGEA  +L D
Sbjct  61   LFGNEMDWYEILQVEQTAGDAIIKKQYRKFALQLHPDKNNFAGAESAFKLIGEAQRVLLD  120

Query  551  QTKRSIYDSKCRVSIRSTSM  610
            + KRS++D K RV     +M
Sbjct  121  REKRSLFDMKRRVPTNKPAM  140



>emb|CDM83112.1| unnamed protein product [Triticum aestivum]
Length=1034

 Score =   157 bits (397),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 82/135 (61%), Positives = 109/135 (81%), Gaps = 0/135 (0%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKNM  373
            ME N++EA+KA+E+A KK+++ DF GA+++A KAQR++P+LEN++QLL VC VHC+A+  
Sbjct  1    MESNREEAVKAREIALKKLESKDFVGAKRIALKAQRIFPELENLSQLLTVCEVHCAAEAK  60

Query  374  LGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSDQ  553
            +    D+YGILQVD +ADE TIKKQYRKLA  LHPDKN +PGAEAAFKL+ EA+  LSD+
Sbjct  61   INELLDFYGILQVDVTADEATIKKQYRKLAFSLHPDKNSYPGAEAAFKLVAEAHSTLSDR  120

Query  554  TKRSIYDSKCRVSIR  598
            TK+  YD K RV+ R
Sbjct  121  TKKPAYDIKWRVASR  135



>gb|KEH43065.1| DnaJ heat shock amino-terminal domain protein [Medicago truncatula]
Length=664

 Score =   155 bits (391),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 87/148 (59%), Positives = 110/148 (74%), Gaps = 1/148 (1%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKNM  373
            MECNKD+A+KAK+LAE KMQ  +F  A K A KA+RLY D+ENI Q+LAVC VH +A N 
Sbjct  1    MECNKDDAVKAKQLAETKMQRGEFVDALKFANKAKRLYADVENIAQILAVCEVHNAALNK  60

Query  374  LG-LDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSD  550
            L   D DWYG+LQ ++ ++E  IKKQY+KLAL+LHPDKNK  GAEAAFKLIGEAN +LSD
Sbjct  61   LSKYDMDWYGVLQTEKLSEEAIIKKQYKKLALLLHPDKNKSAGAEAAFKLIGEANRVLSD  120

Query  551  QTKRSIYDSKCRVSIRSTSMRPPPHQVN  634
            +  RS+YD K +  +R+ + +   H  N
Sbjct  121  KATRSLYDIKVKAHVRAAASKTSSHPSN  148



>gb|EMT22588.1| DnaJ homolog subfamily B member 12 [Aegilops tauschii]
Length=1024

 Score =   157 bits (397),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 82/135 (61%), Positives = 109/135 (81%), Gaps = 0/135 (0%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKNM  373
            ME N++EA+KA+E+A KK+++ DF GA+++A KAQR++P+LEN++QLL VC VHC+A+  
Sbjct  1    MESNREEAVKAREIALKKLESKDFVGAKRIALKAQRIFPELENLSQLLTVCEVHCAAEAK  60

Query  374  LGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSDQ  553
            +    D+YGILQVD +ADE TIKKQYRKLA  LHPDKN +PGAEAAFKL+ EA+  LSD+
Sbjct  61   INELLDFYGILQVDVTADEATIKKQYRKLAFSLHPDKNSYPGAEAAFKLVAEAHSTLSDR  120

Query  554  TKRSIYDSKCRVSIR  598
            TK+  YD K RV+ R
Sbjct  121  TKKPAYDIKWRVASR  135



>emb|CDO98930.1| unnamed protein product [Coffea canephora]
Length=1029

 Score =   157 bits (396),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 84/146 (58%), Positives = 111/146 (76%), Gaps = 1/146 (1%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKNM  373
            MECNK+EA++A E+AEKKMQ  DF  A+K+A +AQ LYPDL NI+Q++ VC+VHC+A++ 
Sbjct  1    MECNKEEAIRAMEVAEKKMQKKDFVSARKMAGRAQHLYPDLMNISQMILVCDVHCAAESK  60

Query  374  L-GLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSD  550
            + G + DWYGILQ++ +ADEV IKKQYRK AL LHPDKNKF GA  AFKL+GEA  +L D
Sbjct  61   VNGGESDWYGILQIEPTADEVAIKKQYRKFALSLHPDKNKFAGASDAFKLVGEAQKVLLD  120

Query  551  QTKRSIYDSKCRVSIRSTSMRPPPHQ  628
              KR +YD+KC+   +  + +   HQ
Sbjct  121  PEKRFLYDNKCKALGKYQASKLATHQ  146



>ref|XP_003562154.1| PREDICTED: uncharacterized protein LOC100835186 [Brachypodium 
distachyon]
Length=976

 Score =   157 bits (396),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 82/135 (61%), Positives = 106/135 (79%), Gaps = 0/135 (0%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKNM  373
            MECN++EA KA+E+A KK++N D+ GA+++A KAQR++P+LEN++QLL VC VHC+ +  
Sbjct  1    MECNREEASKAREIALKKLENKDYVGAKRMALKAQRIFPELENLSQLLTVCEVHCAVEAK  60

Query  374  LGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSDQ  553
            +    D+YGILQV+ +AD  TIKKQYRKLA+ LHPDKN FPGAEAAF L+ EA   LSDQ
Sbjct  61   INGLLDYYGILQVEVTADGATIKKQYRKLAISLHPDKNHFPGAEAAFVLVAEAYSTLSDQ  120

Query  554  TKRSIYDSKCRVSIR  598
             KR  YD KCRV+ R
Sbjct  121  IKRPAYDIKCRVASR  135



>gb|EAZ11958.1| hypothetical protein OsJ_01831 [Oryza sativa Japonica Group]
Length=1007

 Score =   157 bits (396),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 82/138 (59%), Positives = 108/138 (78%), Gaps = 0/138 (0%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKNM  373
            MECNK+EALKA+++A KKM++ DF GA+++A KAQR++P+LENI+Q+L VC VHC+A+  
Sbjct  1    MECNKEEALKARDIAAKKMESKDFVGAKRIALKAQRIFPELENISQMLTVCEVHCAAEAK  60

Query  374  LGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSDQ  553
            +    D+YG+LQVD  ADE TIKKQ+RKLA  LHPDKN F GAEAAFKL+ EA   LSD+
Sbjct  61   MNGLLDFYGVLQVDVMADEATIKKQFRKLAFSLHPDKNGFAGAEAAFKLVAEAQSTLSDR  120

Query  554  TKRSIYDSKCRVSIRSTS  607
            TKR  YD K R++ +  +
Sbjct  121  TKRRAYDIKWRIASKQAT  138



>gb|EYU28383.1| hypothetical protein MIMGU_mgv11b017001mg [Erythranthe guttata]
Length=278

 Score =   149 bits (376),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 76/124 (61%), Positives = 97/124 (78%), Gaps = 9/124 (7%)
 Frame = +2

Query  248  MQNNDFEGAQK-VAAKAQRLYPDLEN-------INQLLAVCNVHCSAK-NMLGLDKDWYG  400
            M+ NDFEGA+K V  +AQ+L P+L++       I Q+L +C+VHCSA+  M G DKDWYG
Sbjct  21   MEANDFEGARKIVMEEAQKLSPELDDDDNNNVIIKQMLIICDVHCSAQVKMGGNDKDWYG  80

Query  401  ILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSDQTKRSIYDSK  580
            ILQ+ + ADE T+KKQY+ LAL+LHPDKN+FPGAEAAFKLI EAN +LSD  K+S+YDSK
Sbjct  81   ILQIKKFADESTVKKQYKTLALLLHPDKNRFPGAEAAFKLICEANEVLSDPQKKSLYDSK  140

Query  581  CRVS  592
             RV+
Sbjct  141  IRVA  144



>ref|XP_006656144.1| PREDICTED: uncharacterized protein LOC102714019 [Oryza brachyantha]
Length=1006

 Score =   156 bits (395),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 86/146 (59%), Positives = 112/146 (77%), Gaps = 1/146 (1%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLE-NINQLLAVCNVHCSAKN  370
            M+CNKDEA+KAK LAEKKM+  DF GA+++  KAQ L  D++ NI+Q+L VC++HC++  
Sbjct  1    MDCNKDEAIKAKALAEKKMREKDFAGAKRMIIKAQHLSKDVDSNISQMLTVCDIHCASAT  60

Query  371  MLGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSD  550
             +  + DWYGILQV  +AD+  IKKQYRKLAL+LHPDKN F GAEAAFKL+GEAN+ L+D
Sbjct  61   KVNGEIDWYGILQVPVTADDALIKKQYRKLALLLHPDKNNFAGAEAAFKLVGEANMTLTD  120

Query  551  QTKRSIYDSKCRVSIRSTSMRPPPHQ  628
            ++KRS+YD K   S+R  S R P  Q
Sbjct  121  RSKRSVYDMKRNASVRIGSARVPYQQ  146



>gb|EEC80760.1| hypothetical protein OsI_23252 [Oryza sativa Indica Group]
Length=900

 Score =   156 bits (394),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 86/146 (59%), Positives = 112/146 (77%), Gaps = 1/146 (1%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLE-NINQLLAVCNVHCSAKN  370
            M+CNKDEA+KAK LAEKKM+  DF GA+++  KAQ L  D++ NI+Q+L VC++HC++  
Sbjct  1    MDCNKDEAVKAKALAEKKMREKDFAGAKRMINKAQNLSKDVDSNISQMLTVCDIHCASAT  60

Query  371  MLGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSD  550
             +  + DWYGILQV  +AD+  IKKQYRKLAL+LHPDKN F GAEAAFKL+GEAN+ L+D
Sbjct  61   KVNGEIDWYGILQVPVTADDTLIKKQYRKLALLLHPDKNNFAGAEAAFKLVGEANMTLTD  120

Query  551  QTKRSIYDSKCRVSIRSTSMRPPPHQ  628
            ++KRS+YD K   S+R  S R P  Q
Sbjct  121  RSKRSVYDMKRNASVRIGSARVPYQQ  146



>ref|XP_010230889.1| PREDICTED: uncharacterized protein LOC100842436 [Brachypodium 
distachyon]
 ref|XP_010230890.1| PREDICTED: uncharacterized protein LOC100842436 [Brachypodium 
distachyon]
Length=1062

 Score =   156 bits (394),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 81/135 (60%), Positives = 106/135 (79%), Gaps = 0/135 (0%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKNM  373
            MECN++EA KA+E+A KK++N D+ GA+++A KAQR++P+LEN+++LL VC VHC+A+  
Sbjct  1    MECNREEASKAREIALKKLENKDYAGAKRIALKAQRIFPELENLSKLLTVCEVHCAAEAK  60

Query  374  LGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSDQ  553
            +    D+YGILQV+ +ADE TIKKQYRKLA  LHPDKN FPGA AAF L+ EA+  LSDQ
Sbjct  61   MNDLLDYYGILQVEVTADETTIKKQYRKLAFSLHPDKNNFPGAHAAFVLVAEAHSTLSDQ  120

Query  554  TKRSIYDSKCRVSIR  598
             KR  YD K RV+ R
Sbjct  121  IKRPAYDIKWRVASR  135



>emb|CDX99992.1| BnaC09g03090D [Brassica napus]
Length=941

 Score =   155 bits (393),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 84/141 (60%), Positives = 108/141 (77%), Gaps = 0/141 (0%)
 Frame = +2

Query  185  VLLMECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSA  364
            +L+MECNK+EA +AK LAE  M   DF  AQK+  KAQRL+  LE++ Q+LAVC+VHCSA
Sbjct  1    MLIMECNKEEASRAKALAENMMLRGDFPKAQKLVVKAQRLFSGLESLPQMLAVCDVHCSA  60

Query  365  KNMLGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLL  544
               +   ++WYGILQV + +D+  IKKQYRKLAL+LHPDKN+F GAEAAFKL+GEAN LL
Sbjct  61   DKKINGLENWYGILQVKQFSDDAAIKKQYRKLALLLHPDKNQFAGAEAAFKLVGEANRLL  120

Query  545  SDQTKRSIYDSKCRVSIRSTS  607
            +D+ KRS YD K R++ +  S
Sbjct  121  ADKEKRSQYDIKRRINSQVAS  141



>ref|NP_001057790.1| Os06g0535300 [Oryza sativa Japonica Group]
 dbj|BAD54615.1| putative DNAJ heat shock N-terminal domain-containing protein 
[Oryza sativa Japonica Group]
 dbj|BAF19704.1| Os06g0535300 [Oryza sativa Japonica Group]
 gb|EAZ37238.1| hypothetical protein OsJ_21576 [Oryza sativa Japonica Group]
 dbj|BAG92199.1| unnamed protein product [Oryza sativa Japonica Group]
Length=1018

 Score =   155 bits (393),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 86/146 (59%), Positives = 112/146 (77%), Gaps = 1/146 (1%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLE-NINQLLAVCNVHCSAKN  370
            M+CNKDEA+KAK LAEKKM+  DF GA+++  KAQ L  D++ NI+Q+L VC++HC++  
Sbjct  1    MDCNKDEAVKAKALAEKKMREKDFAGAKRMINKAQNLSKDVDSNISQMLTVCDIHCASAT  60

Query  371  MLGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSD  550
             +  + DWYGILQV  +AD+  IKKQYRKLAL+LHPDKN F GAEAAFKL+GEAN+ L+D
Sbjct  61   KVNGEIDWYGILQVPVTADDTLIKKQYRKLALLLHPDKNNFAGAEAAFKLVGEANMTLTD  120

Query  551  QTKRSIYDSKCRVSIRSTSMRPPPHQ  628
            ++KRS+YD K   S+R  S R P  Q
Sbjct  121  RSKRSVYDMKRNASVRIGSARVPYQQ  146



>ref|XP_010540334.1| PREDICTED: uncharacterized protein LOC104814147 [Tarenaya hassleriana]
 ref|XP_010540335.1| PREDICTED: uncharacterized protein LOC104814147 [Tarenaya hassleriana]
 ref|XP_010540336.1| PREDICTED: uncharacterized protein LOC104814147 [Tarenaya hassleriana]
 ref|XP_010540337.1| PREDICTED: uncharacterized protein LOC104814147 [Tarenaya hassleriana]
Length=1136

 Score =   155 bits (393),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 84/135 (62%), Positives = 108/135 (80%), Gaps = 0/135 (0%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKNM  373
            MECN+  A++AKELAE+K++  DF GA++ A KAQ+L+P+LEN+ +L+AVC+VHC A+N 
Sbjct  1    MECNQKMAMRAKELAEEKLRAGDFAGARQHAMKAQQLFPELENLMKLVAVCDVHCGAQNK  60

Query  374  LGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSDQ  553
            +G  ++WYGILQ++R  DE TIKKQYRKL L+LHPDKNKF GAE AFKLIGEA  LL+D 
Sbjct  61   IGGLENWYGILQLNRFPDEATIKKQYRKLVLLLHPDKNKFAGAEEAFKLIGEAYRLLADP  120

Query  554  TKRSIYDSKCRVSIR  598
            TKRS Y  K R+  R
Sbjct  121  TKRSQYAIKYRIFSR  135



>ref|XP_002884481.1| DNAJ heat shock N-terminal domain-containing protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH60740.1| DNAJ heat shock N-terminal domain-containing protein [Arabidopsis 
lyrata subsp. lyrata]
Length=1153

 Score =   155 bits (392),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 78/114 (68%), Positives = 91/114 (80%), Gaps = 2/114 (2%)
 Frame = +2

Query  248  MQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSA-KNMLGLDKDWYGILQVDRSA  424
            M+  DF GAQK   KAQRL+P+LENI Q++ +C+VH SA K + GLD DWYG+LQV   A
Sbjct  1    MEAGDFVGAQKFVTKAQRLFPNLENIVQMITICDVHSSAIKKIKGLD-DWYGVLQVQPFA  59

Query  425  DEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSDQTKRSIYDSKCR  586
            D  TIKKQYRKLAL+LHPDKNKF GAEAAFKL+GEAN LLSDQ KRS YD++ R
Sbjct  60   DADTIKKQYRKLALLLHPDKNKFAGAEAAFKLVGEANRLLSDQIKRSQYDNRYR  113



>ref|XP_003563108.2| PREDICTED: uncharacterized protein LOC100822308 isoform X1 [Brachypodium 
distachyon]
Length=976

 Score =   155 bits (391),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 88/155 (57%), Positives = 116/155 (75%), Gaps = 3/155 (2%)
 Frame = +2

Query  182  LVLLMECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCS  361
            L+++MECNKDEAL+AK LAEKKM   DF GA+K+  KAQ+L  ++ NI+Q+L VC+VHC+
Sbjct  12   LLVIMECNKDEALRAKALAEKKMLEKDFLGARKMIHKAQKLSSEVNNISQMLTVCDVHCA  71

Query  362  AKNMLGLDKDWYGILQVDR-SADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANV  538
            A   +  + DWYG+LQV   + D+  IK+QYRKLAL+LHPDKNKF GAEAAFKL+G+AN+
Sbjct  72   AGTKVNGEIDWYGVLQVPAFTNDDTLIKRQYRKLALLLHPDKNKFAGAEAAFKLVGQANM  131

Query  539  LLSDQTKRSIYDSKCRVSIRSTSMRPP--PHQVNP  637
             L+D +KRS +D K R S R +S + P  P  V P
Sbjct  132  TLTDSSKRSAFDMKRRASARPSSYQQPRRPAPVRP  166



>ref|XP_011466352.1| PREDICTED: uncharacterized protein LOC101309953 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=1089

 Score =   155 bits (391),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 86/151 (57%), Positives = 109/151 (72%), Gaps = 3/151 (2%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKNM  373
            MECNK+EA++A +L+E KMQN D+ GA K+A KAQRL+PDLENI+QLL VC +HC+A N 
Sbjct  1    MECNKEEAVRAMQLSETKMQNKDYTGAMKMAQKAQRLFPDLENISQLLTVCEIHCTAGNK  60

Query  374  LGLDK-DWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSD  550
            LG  + DWY ILQ+ +   + TI KQY+KLAL+LHPDKNKF G+E AFK I EA  +L D
Sbjct  61   LGGSEMDWYRILQIQQFDSDDTISKQYKKLALLLHPDKNKFAGSETAFKWIVEAKSVLLD  120

Query  551  QTKRSIYDSKCRVSIRSTSMRPPPH--QVNP  637
            + KRSIYD K R   R  + +   H   +NP
Sbjct  121  KQKRSIYDIKYRTLARPGAPKTTAHPAAINP  151



>ref|XP_008652283.1| PREDICTED: uncharacterized protein LOC103632245 [Zea mays]
 ref|XP_008652284.1| PREDICTED: uncharacterized protein LOC103632245 [Zea mays]
 ref|XP_008652285.1| PREDICTED: uncharacterized protein LOC103632245 [Zea mays]
Length=1116

 Score =   155 bits (392),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 79/129 (61%), Positives = 105/129 (81%), Gaps = 0/129 (0%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKNM  373
            MECNK+EA +AK+LA  K+Q  D+ GA+++A KAQ+L+  LENI+QLL VC VHC A   
Sbjct  1    MECNKEEASRAKDLALVKLQEADYAGAKRIALKAQKLFSGLENISQLLTVCEVHCCAAIK  60

Query  374  LGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSDQ  553
            +  + DWY +LQV+ +AD++ +KKQYRKLAL+LHPDKNKF GAEAAFKLIGEA+++L+D+
Sbjct  61   INGETDWYSVLQVETTADDILLKKQYRKLALLLHPDKNKFVGAEAAFKLIGEAHMILTDK  120

Query  554  TKRSIYDSK  580
             KRS +DSK
Sbjct  121  VKRSRHDSK  129



>ref|XP_002461875.1| hypothetical protein SORBIDRAFT_02g009690 [Sorghum bicolor]
 gb|EER98396.1| hypothetical protein SORBIDRAFT_02g009690 [Sorghum bicolor]
Length=1141

 Score =   155 bits (391),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 80/129 (62%), Positives = 105/129 (81%), Gaps = 0/129 (0%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKNM  373
            MECNK+EA +AK+LA  K+Q  D+ GA+++A KAQ+L+P LENI+QLL VC VH  A   
Sbjct  1    MECNKEEASRAKDLAVVKLQEADYAGAKRIALKAQKLFPGLENISQLLTVCEVHICAAVK  60

Query  374  LGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSDQ  553
            +  + DWYGILQV+ +AD++ +KKQYRKLAL+LHPDKNKF GAEAAFKLIGEA+++L+D+
Sbjct  61   INGETDWYGILQVETTADDMLLKKQYRKLALLLHPDKNKFVGAEAAFKLIGEAHMILTDK  120

Query  554  TKRSIYDSK  580
              RS +DSK
Sbjct  121  VNRSRHDSK  129



>ref|XP_006408126.1| hypothetical protein EUTSA_v10019946mg [Eutrema salsugineum]
 gb|ESQ49579.1| hypothetical protein EUTSA_v10019946mg [Eutrema salsugineum]
Length=1112

 Score =   155 bits (391),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 89/132 (67%), Positives = 106/132 (80%), Gaps = 2/132 (2%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSA-KN  370
            M+CNK+EA +AK LAEKKM   DF GAQK+  KAQ L+P+LENI ++ A+C+VH SA K 
Sbjct  1    MDCNKEEAARAKNLAEKKMSAGDFIGAQKLVTKAQILFPELENILKMTAICDVHSSASKK  60

Query  371  MLGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSD  550
            + GLD +WYGILQV  SAD +TIKKQYRKLAL+LHPDKNK  GAEAAFKL+GEAN +LSD
Sbjct  61   IKGLD-NWYGILQVQFSADALTIKKQYRKLALLLHPDKNKLAGAEAAFKLVGEANRILSD  119

Query  551  QTKRSIYDSKCR  586
            Q KRS YD + R
Sbjct  120  QIKRSQYDIRYR  131



>ref|XP_004305041.1| PREDICTED: uncharacterized protein LOC101309953 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=1117

 Score =   155 bits (391),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 86/151 (57%), Positives = 109/151 (72%), Gaps = 3/151 (2%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKNM  373
            MECNK+EA++A +L+E KMQN D+ GA K+A KAQRL+PDLENI+QLL VC +HC+A N 
Sbjct  1    MECNKEEAVRAMQLSETKMQNKDYTGAMKMAQKAQRLFPDLENISQLLTVCEIHCTAGNK  60

Query  374  LGLDK-DWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSD  550
            LG  + DWY ILQ+ +   + TI KQY+KLAL+LHPDKNKF G+E AFK I EA  +L D
Sbjct  61   LGGSEMDWYRILQIQQFDSDDTISKQYKKLALLLHPDKNKFAGSETAFKWIVEAKSVLLD  120

Query  551  QTKRSIYDSKCRVSIRSTSMRPPPH--QVNP  637
            + KRSIYD K R   R  + +   H   +NP
Sbjct  121  KQKRSIYDIKYRTLARPGAPKTTAHPAAINP  151



>ref|XP_004229298.1| PREDICTED: uncharacterized protein LOC101248043 [Solanum lycopersicum]
Length=903

 Score =   154 bits (389),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 78/130 (60%), Positives = 104/130 (80%), Gaps = 1/130 (1%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSA-KN  370
            M+CNK+EA+KA+ +AE  M+N DF GA+K A+KAQ+L+PDLENI Q++++C VHCSA K 
Sbjct  1    MDCNKEEAIKARGMAEVMMRNRDFVGAKKFASKAQKLFPDLENITQMVSICEVHCSAEKT  60

Query  371  MLGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSD  550
              G +KDWY IL+V+ +AD+  I+KQYRK AL+LHPDKNKFPGA  AF LIGEA  +L D
Sbjct  61   SFGNEKDWYSILKVEPTADDALIRKQYRKFALLLHPDKNKFPGAADAFSLIGEAISVLLD  120

Query  551  QTKRSIYDSK  580
              KR++Y+S+
Sbjct  121  GPKRTLYNSR  130



>ref|XP_006855386.1| hypothetical protein AMTR_s00057p00136560 [Amborella trichopoda]
 gb|ERN16853.1| hypothetical protein AMTR_s00057p00136560 [Amborella trichopoda]
Length=1095

 Score =   154 bits (390),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 86/133 (65%), Positives = 108/133 (81%), Gaps = 1/133 (1%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKNM  373
            MECNK+EAL+AK +AEKKM+  DF GA+K+  KAQ+L  DLEN+ Q+L+VC VHCSA+  
Sbjct  1    MECNKEEALRAKGIAEKKMEKKDFVGAKKIILKAQQLCSDLENLPQMLSVCEVHCSAEVK  60

Query  374  LGLDK-DWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSD  550
            +G  + DWYGILQV+ +AD+  IKKQYRKLAL+LHPDKNKF GAE+AFKLIGEA  +LSD
Sbjct  61   VGGSEIDWYGILQVEHTADDNLIKKQYRKLALLLHPDKNKFSGAESAFKLIGEAMRVLSD  120

Query  551  QTKRSIYDSKCRV  589
            + KRS++D K R 
Sbjct  121  RGKRSLHDMKIRA  133



>ref|NP_187149.1| DNAJ heat shock N-terminal domain-containing protein [Arabidopsis 
thaliana]
 gb|AAG51418.1|AC009465_18 hypothetical protein, contains DnaJ motif: prokaryotic heat shock 
protein motif; 22764-26261 [Arabidopsis thaliana]
 gb|AEE74171.1| DNAJ heat shock N-terminal domain-containing protein [Arabidopsis 
thaliana]
Length=1165

 Score =   154 bits (389),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 77/114 (68%), Positives = 90/114 (79%), Gaps = 2/114 (2%)
 Frame = +2

Query  248  MQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSA-KNMLGLDKDWYGILQVDRSA  424
            M+  DF GA K   KAQRL+P+LENI Q++ +C+VH SA K + GLD DWYG+LQV   A
Sbjct  1    MEAGDFVGAHKFVTKAQRLFPNLENIVQMMTICDVHSSAIKKIKGLD-DWYGVLQVQPYA  59

Query  425  DEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSDQTKRSIYDSKCR  586
            D  TIKKQYRKLAL+LHPDKNKF GAEAAFKL+GEAN LLSDQ KRS YD++ R
Sbjct  60   DADTIKKQYRKLALLLHPDKNKFAGAEAAFKLVGEANRLLSDQIKRSQYDNRYR  113



>ref|XP_006380031.1| hypothetical protein POPTR_0008s20070g [Populus trichocarpa]
 gb|ERP57828.1| hypothetical protein POPTR_0008s20070g [Populus trichocarpa]
Length=680

 Score =   151 bits (382),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 83/149 (56%), Positives = 104/149 (70%), Gaps = 6/149 (4%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSA-KN  370
            MECNK+EA + K +AE  M   DF  A++ A KAQ+LY DLEN++Q+L VC+VHC+A K 
Sbjct  1    MECNKEEAFRVKGIAESLMVKKDFPTARRTALKAQQLYNDLENVSQMLTVCDVHCAADKK  60

Query  371  MLGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSD  550
              G + DWYGILQ + +ADE TIKKQYRK AL LHPDKN+FPGAE+AFKLI +A  +L D
Sbjct  61   PFGTEMDWYGILQTEETADEATIKKQYRKFALRLHPDKNQFPGAESAFKLIMDAQKVLLD  120

Query  551  QTKRSIYDSKCRVSIRSTSMRPPPHQVNP  637
            + KRS++D K     R   M  P  Q  P
Sbjct  121  KGKRSLHDIK-----RKAFMSKPAQQYWP  144



>emb|CDX74107.1| BnaA03g29400D [Brassica napus]
Length=268

 Score =   145 bits (367),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 78/132 (59%), Positives = 103/132 (78%), Gaps = 1/132 (1%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKNM  373
            M  N+DEAL+A+ELAE  M+ +DF GA+K+A KA ++ P LENI  +  VC+VHC+A   
Sbjct  1    MNINRDEALRARELAEGLMKKSDFTGARKLALKANKMDPSLENITHMTMVCDVHCAATEK  60

Query  374  LGLDK-DWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSD  550
            L  ++ DWYGILQV+ +AD+  IKKQYR+LAL+LHPDKNK PGAE+AFKLIGEA  +L D
Sbjct  61   LFANELDWYGILQVELNADDTIIKKQYRRLALLLHPDKNKLPGAESAFKLIGEAQRILLD  120

Query  551  QTKRSIYDSKCR  586
            + KR++YD+K R
Sbjct  121  REKRTVYDTKRR  132



>ref|XP_004145046.1| PREDICTED: uncharacterized protein LOC101217756 [Cucumis sativus]
 ref|XP_004153904.1| PREDICTED: uncharacterized protein LOC101214527 [Cucumis sativus]
 gb|KGN46188.1| hypothetical protein Csa_6G067950 [Cucumis sativus]
Length=940

 Score =   152 bits (385),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 84/143 (59%), Positives = 112/143 (78%), Gaps = 4/143 (3%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSA-KN  370
            M+CNKDEA+KA+E+AEKKM+  DF GA+K+  KAQ+L PD E I+Q+L VC+VHC+A K 
Sbjct  1    MDCNKDEAIKAREIAEKKMEGKDFTGARKLVLKAQQLNPDAEYISQMLMVCDVHCAAEKK  60

Query  371  MLGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSD  550
            + G + DWYGILQ++++A+E TI+KQYRK AL+LHPDKNKF GAEAAFKL+GEA  +L D
Sbjct  61   LFGNEMDWYGILQIEQTANEATIRKQYRKYALLLHPDKNKFIGAEAAFKLVGEAQRVLLD  120

Query  551  QTKRSIYDSKCRVSIRSTSMRPP  619
              KR ++D + + +I     RPP
Sbjct  121  HEKRRMHDMRRKPAI---PFRPP  140



>ref|XP_004163100.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101229241 
[Cucumis sativus]
Length=938

 Score =   152 bits (385),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 84/143 (59%), Positives = 112/143 (78%), Gaps = 4/143 (3%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSA-KN  370
            M+CNKDEA+KA+E+AEKKM+  DF GA+K+  KAQ+L PD E I+Q+L VC+VHC+A K 
Sbjct  1    MDCNKDEAIKAREIAEKKMEGKDFTGARKLVLKAQQLNPDAEYISQMLMVCDVHCAAEKK  60

Query  371  MLGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSD  550
            + G + DWYGILQ++++A+E TI+KQYRK AL+LHPDKNKF GAEAAFKL+GEA  +L D
Sbjct  61   LFGNEMDWYGILQIEQTANEATIRKQYRKYALLLHPDKNKFIGAEAAFKLVGEAQRVLLD  120

Query  551  QTKRSIYDSKCRVSIRSTSMRPP  619
              KR ++D + + +I     RPP
Sbjct  121  HEKRRMHDMRRKPAI---PFRPP  140



>ref|XP_011468428.1| PREDICTED: uncharacterized protein LOC101310821 [Fragaria vesca 
subsp. vesca]
Length=535

 Score =   150 bits (378),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 77/130 (59%), Positives = 94/130 (72%), Gaps = 2/130 (2%)
 Frame = +2

Query  248  MQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKNMLG-LDKDWYGILQVDRSA  424
            MQ N F GA+K+A KAQ+L+P LENI+QLLAVC+V CSA+N LG  + DWY ILQV R +
Sbjct  8    MQGNAFTGARKMAHKAQQLFPGLENISQLLAVCDVLCSAENKLGGCEMDWYRILQVQRFS  67

Query  425  DEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSDQTKRSIYDSKCRVSIRST  604
             E  IKKQ RKL L+LH DKNKF GAEAA KLIGEAN +L D+ +   YD KCR  +R+ 
Sbjct  68   HEAIIKKQVRKLGLLLHSDKNKFAGAEAALKLIGEANAVLEDRGRHFRYDMKCRALLRTG  127

Query  605  SMRPPPHQVN  634
             + P  HQ +
Sbjct  128  EI-PSAHQFD  136



>ref|XP_007154216.1| hypothetical protein PHAVU_003G100000g [Phaseolus vulgaris]
 ref|XP_007154217.1| hypothetical protein PHAVU_003G100000g [Phaseolus vulgaris]
 gb|ESW26210.1| hypothetical protein PHAVU_003G100000g [Phaseolus vulgaris]
 gb|ESW26211.1| hypothetical protein PHAVU_003G100000g [Phaseolus vulgaris]
Length=1028

 Score =   152 bits (385),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 85/135 (63%), Positives = 108/135 (80%), Gaps = 1/135 (1%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSA-KN  370
            M+CNK+EAL+AK++AEKKM+N DF GA+K+A KAQ+LYPDLENI Q+L VC+VHC A K 
Sbjct  1    MDCNKEEALRAKDIAEKKMENRDFVGARKIALKAQQLYPDLENIAQMLVVCDVHCCAEKK  60

Query  371  MLGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSD  550
            + G + DWY ILQV+++A +  IKKQY+K AL LHPDKNKF GAEAAFKLIGEA  +L D
Sbjct  61   LFGNEMDWYEILQVEQTAVDALIKKQYKKFALQLHPDKNKFAGAEAAFKLIGEAQRVLLD  120

Query  551  QTKRSIYDSKCRVSI  595
            + KR  +D K  V++
Sbjct  121  REKRYHFDMKRGVTV  135



>ref|XP_009596456.1| PREDICTED: uncharacterized protein LOC104092542 [Nicotiana tomentosiformis]
Length=1063

 Score =   152 bits (385),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 80/137 (58%), Positives = 111/137 (81%), Gaps = 1/137 (1%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKN-  370
            M+C K+EA++A+ +AEKKM+N DF GA+K A+KAQ L+P+LENI Q++ VC+V+CSA+N 
Sbjct  1    MDCTKEEAIRARGIAEKKMENRDFIGAKKFASKAQELFPNLENIEQMVLVCDVYCSAENK  60

Query  371  MLGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSD  550
              G +K+WY IL+V+ +AD+  I+KQYR+LAL+LHPDKNKFPGA  AF LIGEA ++L D
Sbjct  61   TFGNEKNWYDILKVEPTADDSIIRKQYRRLALLLHPDKNKFPGAADAFTLIGEAQMVLLD  120

Query  551  QTKRSIYDSKCRVSIRS  601
            + KR +Y+S+C  S RS
Sbjct  121  RQKRMLYNSRCIPSGRS  137



>gb|KEH42053.1| DnaJ heat shock amino-terminal domain protein [Medicago truncatula]
Length=664

 Score =   150 bits (379),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 86/143 (60%), Positives = 107/143 (75%), Gaps = 1/143 (1%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSA-KN  370
            MECNKDEA++AK+LAE KMQ  +F  A K A KA+ LY  +ENI Q+LAVC VH +A K 
Sbjct  1    MECNKDEAVRAKQLAETKMQRGEFVDALKFAKKAKNLYAGVENIAQVLAVCEVHIAALKK  60

Query  371  MLGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSD  550
            +   + D+Y ILQ  R ++E  IK QYRKLAL+LHPDKNKF GAEAAFKLIGEAN +LSD
Sbjct  61   LSMFEMDYYEILQTHRFSEEAIIKTQYRKLALLLHPDKNKFSGAEAAFKLIGEANRVLSD  120

Query  551  QTKRSIYDSKCRVSIRSTSMRPP  619
            Q +RS+YD K +V +RS + + P
Sbjct  121  QAQRSLYDKKVKVHVRSAANQVP  143



>ref|XP_006394983.1| hypothetical protein EUTSA_v10003562mg [Eutrema salsugineum]
 gb|ESQ32269.1| hypothetical protein EUTSA_v10003562mg [Eutrema salsugineum]
Length=1068

 Score =   152 bits (384),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 82/140 (59%), Positives = 106/140 (76%), Gaps = 0/140 (0%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKNM  373
            M+CNKDEA +AK LAE  M+   F  AQK+  KAQ L+  L+++ Q+LAVC+VHCSA N 
Sbjct  1    MDCNKDEASRAKALAENMMRKGHFARAQKLVMKAQSLFSGLDSLPQMLAVCDVHCSADNK  60

Query  374  LGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSDQ  553
            +   ++WYGILQV   +D+ TIKKQY+KLAL+LHPDKN+FPGAEAAFKLIGEAN  L+D+
Sbjct  61   INDLENWYGILQVMHFSDDATIKKQYKKLALLLHPDKNQFPGAEAAFKLIGEANRFLADK  120

Query  554  TKRSIYDSKCRVSIRSTSMR  613
             KR+ YD K R+  R +S +
Sbjct  121  EKRTQYDIKRRIYSRVSSQQ  140



>emb|CDY19714.1| BnaA09g03670D [Brassica napus]
Length=962

 Score =   151 bits (382),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 82/138 (59%), Positives = 104/138 (75%), Gaps = 0/138 (0%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKNM  373
            MECNK+EA +AK LAE  M   DF  AQK+  KAQRL+  L+++ Q+LAVC+VHCSA   
Sbjct  1    MECNKEEASRAKALAENMMLRGDFPKAQKLVVKAQRLFSGLDSLPQMLAVCDVHCSADQK  60

Query  374  LGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSDQ  553
            +   ++WYGILQV   +D+  IKKQYRKLAL+LHPDKN+F GAEAAFKL+GEAN LL+D+
Sbjct  61   INGLENWYGILQVQHFSDDAAIKKQYRKLALLLHPDKNQFAGAEAAFKLVGEANRLLADK  120

Query  554  TKRSIYDSKCRVSIRSTS  607
             KRS YD K R++ +  S
Sbjct  121  EKRSQYDIKRRINSQVAS  138



>ref|XP_009779333.1| PREDICTED: uncharacterized protein LOC104228554 [Nicotiana sylvestris]
Length=1066

 Score =   152 bits (383),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 80/138 (58%), Positives = 113/138 (82%), Gaps = 1/138 (1%)
 Frame = +2

Query  191  LMECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKN  370
            +++CNK+EA++A+ +AEKKM+N DF GA+++A+KAQ L+P+LENI Q++ VC+VHCSA+N
Sbjct  1    MLDCNKEEAIRARGIAEKKMENRDFIGAKRLASKAQELFPNLENIVQMVLVCDVHCSAEN  60

Query  371  -MLGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLS  547
               G +++WY IL VD++AD+  I+KQYRKLAL+LHPDKNKFPGA  AF LIGEA ++L 
Sbjct  61   KTFGNERNWYDILNVDQTADDSLIRKQYRKLALLLHPDKNKFPGAADAFTLIGEAQMVLL  120

Query  548  DQTKRSIYDSKCRVSIRS  601
            D+ KR +Y+S+   S RS
Sbjct  121  DREKRMLYNSRRIPSGRS  138



>ref|XP_009111937.1| PREDICTED: uncharacterized protein LOC103837329 [Brassica rapa]
Length=1043

 Score =   151 bits (381),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 81/132 (61%), Positives = 101/132 (77%), Gaps = 0/132 (0%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKNM  373
            M+CNK+EA +AK LAE  M   DF  AQK+  KAQRL+  L+++ Q+LAVC+VHCSA   
Sbjct  1    MDCNKEEASRAKALAENMMLRGDFPKAQKLVMKAQRLFSGLDSLPQMLAVCDVHCSADQK  60

Query  374  LGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSDQ  553
            +   ++WYGILQV   +D+  IKKQYRKLAL+LHPDKNKF GAEAAFKL+GEAN LL+D+
Sbjct  61   INGLENWYGILQVKHFSDDAAIKKQYRKLALLLHPDKNKFAGAEAAFKLVGEANRLLADK  120

Query  554  TKRSIYDSKCRV  589
             KRS YD K R+
Sbjct  121  EKRSQYDIKRRI  132



>dbj|BAJ91190.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1034

 Score =   151 bits (381),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 76/128 (59%), Positives = 101/128 (79%), Gaps = 0/128 (0%)
 Frame = +2

Query  191  LMECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKN  370
            +MECN++EA +A+E+A KK++N DF GA+K+A KAQ L+P+LENI+QLL VC VHC+A+ 
Sbjct  1    MMECNREEASRAREIAVKKLENKDFVGARKIALKAQILFPELENISQLLCVCTVHCAAEA  60

Query  371  MLGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSD  550
             +  + DWY ILQV+ + D   I+KQY +LA  LHPDKN FPGA+AAFKL+ EA+ +L D
Sbjct  61   RVNGETDWYAILQVEATTDHANIRKQYLRLAFSLHPDKNCFPGADAAFKLVAEAHSILCD  120

Query  551  QTKRSIYD  574
            QTKRS YD
Sbjct  121  QTKRSHYD  128



>ref|XP_008674053.1| PREDICTED: uncharacterized protein LOC103650196 [Zea mays]
 ref|XP_008674054.1| PREDICTED: uncharacterized protein LOC103650196 [Zea mays]
Length=936

 Score =   150 bits (380),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 80/133 (60%), Positives = 105/133 (79%), Gaps = 0/133 (0%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKNM  373
            MECN++EALKA+E+A KK+++ DF GA+++A KAQR++P++ENI QLL VC VHC+A+  
Sbjct  1    MECNREEALKAREIAVKKLESRDFVGAKRIALKAQRIFPEIENIPQLLTVCEVHCAAEAK  60

Query  374  LGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSDQ  553
            +    D+YGILQV+ +ADEVTIKKQYRKL L LHPDKN + GAE+AFK + EA   LSD+
Sbjct  61   VNGMLDFYGILQVEGTADEVTIKKQYRKLVLSLHPDKNSYAGAESAFKFVAEAYSTLSDR  120

Query  554  TKRSIYDSKCRVS  592
            TKR  YD K R +
Sbjct  121  TKRYAYDVKWRAA  133



>emb|CDX80667.1| BnaC07g27770D [Brassica napus]
Length=665

 Score =   149 bits (375),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 79/138 (57%), Positives = 102/138 (74%), Gaps = 0/138 (0%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKNM  373
            MECNK+EA +AK++AE  M+  D+  A  +  KAQ L+  L+ + Q+LAVC+VHCSA+  
Sbjct  1    MECNKEEATRAKKMAEDSMRKGDYPKAHNLVMKAQSLFSGLDGLPQMLAVCDVHCSAEKK  60

Query  374  LGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSDQ  553
            L   ++WYGILQ     D+ TIKKQYRKLAL+LHPDKN+FPGAEAAFKLIGEAN LLSD+
Sbjct  61   LNGLENWYGILQAMHFCDDATIKKQYRKLALLLHPDKNQFPGAEAAFKLIGEANRLLSDK  120

Query  554  TKRSIYDSKCRVSIRSTS  607
             +R+ YD + R+  R  S
Sbjct  121  ERRTQYDIRHRIYSRVAS  138



>ref|XP_009787122.1| PREDICTED: uncharacterized protein LOC104235134 [Nicotiana sylvestris]
 ref|XP_009787130.1| PREDICTED: uncharacterized protein LOC104235134 [Nicotiana sylvestris]
 ref|XP_009787138.1| PREDICTED: uncharacterized protein LOC104235134 [Nicotiana sylvestris]
Length=1064

 Score =   151 bits (381),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 80/137 (58%), Positives = 110/137 (80%), Gaps = 1/137 (1%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKN-  370
            M+CNK+EA++A+ +AEKKM+N DF GA+K  +KAQ L+P+LENI Q++ VC+VHCSA+N 
Sbjct  1    MDCNKEEAIRARGIAEKKMENRDFIGAKKFVSKAQELFPNLENIEQMVLVCDVHCSAENK  60

Query  371  MLGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSD  550
              G +K+WY IL+V+ +AD+  I+KQYR+LAL+LHPDKNKFPGA  AF LIGEA ++L D
Sbjct  61   TFGNEKNWYNILKVEPTADDSIIRKQYRRLALLLHPDKNKFPGAADAFTLIGEAQMVLLD  120

Query  551  QTKRSIYDSKCRVSIRS  601
            + KR +Y+S+   S RS
Sbjct  121  REKRMLYNSRRIPSGRS  137



>ref|XP_009151221.1| PREDICTED: uncharacterized protein LOC103874549 [Brassica rapa]
 emb|CDX86172.1| BnaA06g28890D [Brassica napus]
Length=629

 Score =   148 bits (374),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 79/138 (57%), Positives = 102/138 (74%), Gaps = 0/138 (0%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKNM  373
            MECNK+EA +AK++AE  M+  D+  A  +  KAQ L+  L+ + Q+LAVC+VHCSA+  
Sbjct  1    MECNKEEATRAKKMAEDSMRKGDYPKAHNLVTKAQNLFSGLDGLPQMLAVCDVHCSAEKK  60

Query  374  LGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSDQ  553
            L   ++WYGILQ     D+ TIKKQYRKLAL+LHPDKN+FPGAEAAFKLIGEA+ LLSD+
Sbjct  61   LNGLENWYGILQAMHFCDDATIKKQYRKLALLLHPDKNQFPGAEAAFKLIGEASRLLSDK  120

Query  554  TKRSIYDSKCRVSIRSTS  607
             KR+ YD + R+  R  S
Sbjct  121  EKRTQYDIRHRIYSRVVS  138



>ref|XP_008458690.1| PREDICTED: uncharacterized protein LOC103498020 [Cucumis melo]
Length=921

 Score =   150 bits (379),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 84/143 (59%), Positives = 111/143 (78%), Gaps = 4/143 (3%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSA-KN  370
            M+CNKDEA+KA+E+AEKKM   DF GA+K+  KAQ+L PD E I+Q+L VC+VHC+A K 
Sbjct  1    MDCNKDEAIKAREIAEKKMAGKDFIGARKLVLKAQQLNPDAEYISQMLMVCDVHCAAEKK  60

Query  371  MLGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSD  550
            + G + DWYGILQ++++A+E TI+KQYRK AL+LHPDKNKF GAEAAFKL+GEA  +L D
Sbjct  61   LFGNEMDWYGILQIEQTANEATIRKQYRKYALLLHPDKNKFIGAEAAFKLVGEAQRVLLD  120

Query  551  QTKRSIYDSKCRVSIRSTSMRPP  619
              KR ++D + + +I     RPP
Sbjct  121  HEKRRMHDMRRKPAI---PYRPP  140



>ref|XP_002451005.1| hypothetical protein SORBIDRAFT_05g022460 [Sorghum bicolor]
 gb|EES09993.1| hypothetical protein SORBIDRAFT_05g022460 [Sorghum bicolor]
Length=1103

 Score =   150 bits (378),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 79/137 (58%), Positives = 107/137 (78%), Gaps = 0/137 (0%)
 Frame = +2

Query  191  LMECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKN  370
            ++ CN++EAL+A+E+A KKM+N +F GAQK+  KAQ+L+PDLEN++QLL++CNVHC+A+ 
Sbjct  1    MVGCNREEALRAREIAVKKMENKEFFGAQKIVLKAQKLFPDLENVSQLLSICNVHCAAEL  60

Query  371  MLGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSD  550
             +  + D+YG+LQV+  ADE  IKKQYRKLA  LHPDKN F GAEAAFKL+ EA+ +L D
Sbjct  61   RVNGEMDFYGVLQVEEGADEALIKKQYRKLAFSLHPDKNCFAGAEAAFKLVAEAHSVLCD  120

Query  551  QTKRSIYDSKCRVSIRS  601
              KR+ YD K R   R+
Sbjct  121  TAKRNDYDLKRRNGFRN  137



>ref|XP_004979542.1| PREDICTED: uncharacterized protein LOC101786678 [Setaria italica]
Length=1062

 Score =   150 bits (378),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 81/149 (54%), Positives = 110/149 (74%), Gaps = 3/149 (2%)
 Frame = +2

Query  191  LMECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKN  370
            +++CN++EA +A+E+A KKM+N DF GA+K+  KAQ+L+P+LENI++LL +CNVHC+A+ 
Sbjct  1    MIDCNREEAFRAREMAVKKMENRDFVGAEKIVLKAQKLFPELENISKLLTICNVHCAAEL  60

Query  371  MLGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSD  550
             +  + D YGILQV+  ADE  I+KQYRKLA  LHPDKN F GAEAAFKL+ EA+ +L D
Sbjct  61   RVNGEMDLYGILQVEEGADEALIRKQYRKLAFSLHPDKNCFVGAEAAFKLVAEAHSVLCD  120

Query  551  QTKRSIYDSKCRVSIRSTSMRPPPHQVNP  637
             TKRS YD K +   R+    P P +  P
Sbjct  121  PTKRSQYDLKRKSGFRNV---PKPAKQQP  146



>ref|XP_008655534.1| PREDICTED: uncharacterized protein LOC103634728 [Zea mays]
 ref|XP_008655535.1| PREDICTED: uncharacterized protein LOC103634728 [Zea mays]
 gb|AFW79771.1| hypothetical protein ZEAMMB73_161459 [Zea mays]
Length=1018

 Score =   149 bits (377),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 85/153 (56%), Positives = 114/153 (75%), Gaps = 6/153 (4%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENIN--QLLAVCNVHCSAK  367
            MECN+DEA +AK LAE+KM + DF GA+K+  K Q+L  ++E+I+  ++L VC+VHC+A 
Sbjct  1    MECNRDEAARAKVLAERKMLDKDFVGAKKLIIKVQQLLKEVEDIDIPKMLTVCDVHCAAG  60

Query  368  NMLGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLS  547
              +  + DWYGILQV  +AD+  IKKQYRKLAL+LHPDKNKF GAEAAFKL+GEAN+ L+
Sbjct  61   AKVNTEIDWYGILQVPVNADDALIKKQYRKLALLLHPDKNKFGGAEAAFKLVGEANITLT  120

Query  548  DQTKRSIYDSKCRVSIRSTSMRP---PPHQVNP  637
            D +KR ++D K R + RS + RP   PP +  P
Sbjct  121  DPSKRYVHDMK-RNTFRSVTARPNRQPPKRPAP  152



>ref|XP_010463986.1| PREDICTED: uncharacterized protein LOC104744610 [Camelina sativa]
Length=1275

 Score =   150 bits (378),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 80/132 (61%), Positives = 103/132 (78%), Gaps = 1/132 (1%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKNM  373
            MECNK++A  AK++AE+KM+  DF GA K   +AQRL+P+LEN+ Q++ +C+VH +A N 
Sbjct  1    MECNKEDAANAKQIAEEKMEAGDFVGAHKFVTRAQRLFPNLENLLQMITICDVHSAAINK  60

Query  374  LGLDKDWYGILQVDR-SADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSD  550
            +   ++WYGILQV    AD  TIKKQYRKL L+LHPDKNKFPGAEAAFKL+GEAN +LSD
Sbjct  61   IKGLENWYGILQVQPLVADADTIKKQYRKLVLLLHPDKNKFPGAEAAFKLVGEANRVLSD  120

Query  551  QTKRSIYDSKCR  586
            + KRS YD + R
Sbjct  121  RMKRSQYDVRYR  132



>ref|XP_004967967.1| PREDICTED: uncharacterized protein LOC101785664 [Setaria italica]
Length=1039

 Score =   149 bits (377),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 82/144 (57%), Positives = 109/144 (76%), Gaps = 3/144 (2%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENIN--QLLAVCNVHCSAK  367
            MECNKDEA +AK LAE+KM   DF  A++  +KAQ+L  ++++I+  ++L+VC+VHC+A 
Sbjct  1    MECNKDEAARAKALAERKMLEKDFVAAKRFISKAQKLCKEVDDIDISKMLSVCDVHCAAA  60

Query  368  NMLGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLS  547
              +  + DWYGILQV   AD+  IKKQYRKLAL+LHPDKNKF GAEAAFKL+GEAN+ L+
Sbjct  61   AKVNAEIDWYGILQVPVDADDALIKKQYRKLALLLHPDKNKFGGAEAAFKLVGEANITLT  120

Query  548  DQTKRSIYDSKCRVSIRSTSMRPP  619
            D++KR +YD K R + R    RPP
Sbjct  121  DKSKRMVYDMK-RSTFRGGPARPP  143



>ref|XP_010494032.1| PREDICTED: uncharacterized protein LOC104771234 [Camelina sativa]
Length=1077

 Score =   149 bits (377),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 81/135 (60%), Positives = 105/135 (78%), Gaps = 0/135 (0%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKNM  373
            M+CNK+EA +AK LAE KM+N DF GAQK+  KAQ L+  LE++ Q+LAVC VHCSA+  
Sbjct  1    MDCNKEEAFRAKALAEDKMKNGDFVGAQKLLLKAQGLFSGLESLPQMLAVCEVHCSAEKK  60

Query  374  LGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSDQ  553
            +   ++WYGILQV   AD+ TIKKQ RKL+L+LHPDKN+FPGAEAAFKL+ +AN  L+D+
Sbjct  61   IKGLENWYGILQVMHFADDATIKKQVRKLSLLLHPDKNQFPGAEAAFKLVWDANGFLADR  120

Query  554  TKRSIYDSKCRVSIR  598
             KRS YD + R+ +R
Sbjct  121  DKRSQYDIRRRIYLR  135



>ref|XP_010540340.1| PREDICTED: uncharacterized protein LOC104814150 [Tarenaya hassleriana]
Length=871

 Score =   149 bits (375),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 81/132 (61%), Positives = 105/132 (80%), Gaps = 0/132 (0%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKNM  373
            MECN+  A++AKELAE+K++  DF GA+++A KAQRL+P+LE + QL+AV +VHC+A N 
Sbjct  1    MECNQKMAMRAKELAEEKLRAEDFIGARRLAMKAQRLFPELEKLMQLVAVSDVHCAALNK  60

Query  374  LGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSDQ  553
            +   ++WY ILQ++R A+E  IKKQYRKL ++LHPDKNKF GAE AFKLIGEA  LL+DQ
Sbjct  61   IAGLENWYAILQLNRFANEAAIKKQYRKLVVLLHPDKNKFAGAEGAFKLIGEAYRLLADQ  120

Query  554  TKRSIYDSKCRV  589
            TKR  YD K RV
Sbjct  121  TKRLEYDIKYRV  132



>ref|XP_002457507.1| hypothetical protein SORBIDRAFT_03g008500 [Sorghum bicolor]
 gb|EES02627.1| hypothetical protein SORBIDRAFT_03g008500 [Sorghum bicolor]
Length=903

 Score =   149 bits (375),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 85/153 (56%), Positives = 115/153 (75%), Gaps = 6/153 (4%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENIN--QLLAVCNVHCSAK  367
            MECN+DEA +AK LAE+KM + DF GA+K+  +AQ+L  ++ +++  ++L VC+VHC+A 
Sbjct  1    MECNRDEAARAKALAERKMMDKDFVGAKKMIIRAQQLLKEVGDVDIPKMLTVCDVHCAAG  60

Query  368  NMLGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLS  547
              +  + DWYGILQV  +AD+  IKKQYRKLAL+LHPDKNKF GAEAAFKLIGEAN+ L+
Sbjct  61   AKVNNEIDWYGILQVPVNADDALIKKQYRKLALLLHPDKNKFGGAEAAFKLIGEANITLT  120

Query  548  DQTKRSIYDSKCRVSIRSTSMRP---PPHQVNP  637
            D++KRS++D K R + RS   RP   PP +  P
Sbjct  121  DRSKRSVHDMK-RNTFRSIITRPNHQPPKRPAP  152



>ref|XP_002455673.1| hypothetical protein SORBIDRAFT_03g019960 [Sorghum bicolor]
 gb|EES00793.1| hypothetical protein SORBIDRAFT_03g019960 [Sorghum bicolor]
Length=977

 Score =   149 bits (375),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 83/150 (55%), Positives = 108/150 (72%), Gaps = 2/150 (1%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKNM  373
            MECN++EALKA+E+A KK++N DF  A+++A KAQR++P++ENI QLL VC VHC+A+  
Sbjct  1    MECNREEALKAREIAVKKLENRDFVAAKRIALKAQRIFPEIENIPQLLTVCEVHCAAEAK  60

Query  374  LGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSDQ  553
            +    D+YGILQV+ +ADEVTIKKQYRKL L LHPDKN + GAE+AFK + EA   L+D+
Sbjct  61   VNGMLDFYGILQVEWTADEVTIKKQYRKLVLSLHPDKNSYAGAESAFKFVAEAYSTLADR  120

Query  554  TKRSIYDSKCRVS--IRSTSMRPPPHQVNP  637
            TKR  YD K R +  I     R P     P
Sbjct  121  TKRYAYDIKWRAAPKIAPKQARQPKQAAEP  150



>ref|XP_009624052.1| PREDICTED: uncharacterized protein LOC104115174 [Nicotiana tomentosiformis]
Length=1067

 Score =   149 bits (375),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 79/138 (57%), Positives = 112/138 (81%), Gaps = 1/138 (1%)
 Frame = +2

Query  191  LMECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKN  370
            +M+CNK+EA++A+ +AEKKM+N DF GA+K+ +KAQ L+P+LENI Q++ VC+VHCSA+N
Sbjct  1    MMDCNKEEAIRARGIAEKKMENRDFIGAKKLLSKAQELFPNLENIAQMVLVCDVHCSAEN  60

Query  371  -MLGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLS  547
               G +++WY IL+V+ +AD+  I+KQYRKLAL+LHPDKNKFPGA  AF LIGEA ++L 
Sbjct  61   KTFGNERNWYDILKVEPTADDSLIRKQYRKLALLLHPDKNKFPGAADAFTLIGEAQMVLL  120

Query  548  DQTKRSIYDSKCRVSIRS  601
            D+ KR +Y+++   S RS
Sbjct  121  DREKRMLYNNRRIPSGRS  138



>ref|XP_010485887.1| PREDICTED: uncharacterized protein LOC104764132 [Camelina sativa]
Length=1221

 Score =   149 bits (375),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 79/128 (62%), Positives = 102/128 (80%), Gaps = 1/128 (1%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKNM  373
            MECNK++A +AK++AE+KM+  DF GA K   +AQRL+P+LEN+ Q++ +C+VH +A N 
Sbjct  1    MECNKEDAAEAKQIAEEKMEAGDFVGAHKFVTRAQRLFPNLENLLQMITICDVHSAAINK  60

Query  374  LGLDKDWYGILQVDR-SADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSD  550
            +   ++WYGILQV    AD  TIKKQYRKL L+LHPDKNKFPGAEAAFKL+GEA+ +LSD
Sbjct  61   IKGLENWYGILQVQPLVADADTIKKQYRKLVLLLHPDKNKFPGAEAAFKLVGEAHRVLSD  120

Query  551  QTKRSIYD  574
            Q KRS YD
Sbjct  121  QMKRSQYD  128



>ref|XP_004980633.1| PREDICTED: uncharacterized protein LOC101766063 [Setaria italica]
Length=975

 Score =   148 bits (373),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 75/141 (53%), Positives = 106/141 (75%), Gaps = 0/141 (0%)
 Frame = +2

Query  191  LMECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKN  370
            +MECN++E L+A+++A  K++  DF GAQ++A KAQRLYP+LE+++QLLAVC VHC+A+ 
Sbjct  1    MMECNREEGLRARQIALLKLEKKDFWGAQRIALKAQRLYPELEDLSQLLAVCEVHCAAEA  60

Query  371  MLGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSD  550
             +  D DWYGILQV+ SAD++ I+KQY KL+  LHPDKN  PGAEAAFKL+  A+ +L D
Sbjct  61   EINGDLDWYGILQVEASADDMVIQKQYCKLSFWLHPDKNILPGAEAAFKLVSMAHKILLD  120

Query  551  QTKRSIYDSKCRVSIRSTSMR  613
               R +Y+ K +  IR  + +
Sbjct  121  PMMRFLYNIKTQFVIREVAKK  141



>emb|CDY08056.1| BnaC03g34670D [Brassica napus]
Length=628

 Score =   145 bits (367),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 78/133 (59%), Positives = 104/133 (78%), Gaps = 1/133 (1%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKNM  373
            M  N+DEAL+AK+LAE  M+ +DF GA+K+A KA ++ P LENI  +  VC+VHC+A   
Sbjct  1    MNINRDEALRAKDLAEGLMKKSDFTGARKLALKANKMDPSLENITHMTMVCDVHCAATEK  60

Query  374  LGLDK-DWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSD  550
            L  ++ DWYGILQV+ +AD++ IKKQYR+LAL+LHPDKNK PGAE+AFKLIGEA  +L D
Sbjct  61   LFANELDWYGILQVELNADDIVIKKQYRRLALLLHPDKNKLPGAESAFKLIGEAQRILLD  120

Query  551  QTKRSIYDSKCRV  589
            + KR++YD+K R 
Sbjct  121  REKRTVYDTKRRA  133



>ref|XP_010421375.1| PREDICTED: uncharacterized protein LOC104706702 isoform X2 [Camelina 
sativa]
Length=1157

 Score =   148 bits (373),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 81/129 (63%), Positives = 104/129 (81%), Gaps = 3/129 (2%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKNM  373
            MECNK++A +AK++AE+KM+  DF GA K   +AQRL+P+LEN+ Q++ +C+VH +A N 
Sbjct  1    MECNKEDAAEAKQIAEEKMEAGDFVGAHKFVTRAQRLFPNLENLLQMITICDVHSAAINK  60

Query  374  L-GLDKDWYGILQVDR-SADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLS  547
            + GLD +WYGILQV    AD  +IKKQYRKL L+LHPDKNKFPGAEAAFKL+GEA+ +LS
Sbjct  61   IKGLD-NWYGILQVQPLVADADSIKKQYRKLVLLLHPDKNKFPGAEAAFKLVGEAHRVLS  119

Query  548  DQTKRSIYD  574
            DQ KRS YD
Sbjct  120  DQKKRSQYD  128



>ref|XP_010421247.1| PREDICTED: uncharacterized protein LOC104706702 isoform X1 [Camelina 
sativa]
 ref|XP_010421313.1| PREDICTED: uncharacterized protein LOC104706702 isoform X1 [Camelina 
sativa]
Length=1216

 Score =   147 bits (372),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 81/129 (63%), Positives = 104/129 (81%), Gaps = 3/129 (2%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKNM  373
            MECNK++A +AK++AE+KM+  DF GA K   +AQRL+P+LEN+ Q++ +C+VH +A N 
Sbjct  1    MECNKEDAAEAKQIAEEKMEAGDFVGAHKFVTRAQRLFPNLENLLQMITICDVHSAAINK  60

Query  374  L-GLDKDWYGILQVDR-SADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLS  547
            + GLD +WYGILQV    AD  +IKKQYRKL L+LHPDKNKFPGAEAAFKL+GEA+ +LS
Sbjct  61   IKGLD-NWYGILQVQPLVADADSIKKQYRKLVLLLHPDKNKFPGAEAAFKLVGEAHRVLS  119

Query  548  DQTKRSIYD  574
            DQ KRS YD
Sbjct  120  DQKKRSQYD  128



>ref|XP_010455145.1| PREDICTED: uncharacterized protein LOC104736786 isoform X1 [Camelina 
sativa]
 ref|XP_010455147.1| PREDICTED: uncharacterized protein LOC104736786 isoform X2 [Camelina 
sativa]
 ref|XP_010455148.1| PREDICTED: uncharacterized protein LOC104736786 isoform X3 [Camelina 
sativa]
Length=1086

 Score =   147 bits (372),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 81/140 (58%), Positives = 105/140 (75%), Gaps = 0/140 (0%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKNM  373
            M+C K+EA +AK LAE KM+N DF GAQK+  KAQ L+  LE++ Q+LAVC VHCSA+  
Sbjct  1    MDCTKEEAFRAKALAEDKMKNADFVGAQKLLLKAQGLFSGLESLQQMLAVCEVHCSAEKK  60

Query  374  LGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSDQ  553
            +   ++WYGILQV   AD  TIKKQ RKL+L+LHPDKN FPGAEAAFKL+ +AN  L+D+
Sbjct  61   IKGLENWYGILQVMHFADNATIKKQVRKLSLLLHPDKNHFPGAEAAFKLVWDANGFLADK  120

Query  554  TKRSIYDSKCRVSIRSTSMR  613
             KRS YD + R+ +R  S++
Sbjct  121  DKRSQYDIRRRIYLRFASIQ  140



>dbj|BAH19652.1| AT3G06340 [Arabidopsis thaliana]
Length=376

 Score =   142 bits (359),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 79/149 (53%), Positives = 113/149 (76%), Gaps = 8/149 (5%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSA-KN  370
            M  N+DEAL+AK+LAE  M+  DF  A+K+A KAQ++   LENI++++ VC+VHC+A + 
Sbjct  1    MSINRDEALRAKDLAEGLMKKTDFTAARKLAMKAQKMDSSLENISRMIMVCDVHCAATEK  60

Query  371  MLGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSD  550
            + G + DWYGILQV++ A++V IKKQY++LAL+LHPDKNK PGAE+AFKLIGEA  +L D
Sbjct  61   LFGTEMDWYGILQVEQIANDVIIKKQYKRLALLLHPDKNKLPGAESAFKLIGEAQRILLD  120

Query  551  QTKRSIYDSKCRVSIRSTSMRP--PPHQV  631
            + KR+++D+K     R T  +P  PP++ 
Sbjct  121  REKRTLHDNK-----RKTWRKPAAPPYKA  144



>ref|XP_004486071.1| PREDICTED: uncharacterized protein LOC101500991 isoform X1 [Cicer 
arietinum]
Length=971

 Score =   147 bits (370),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 90/149 (60%), Positives = 111/149 (74%), Gaps = 3/149 (2%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKN-  370
            M+CNK+EAL+AK +AEKKM++ DF GA+    KA++LYPDLENI Q+L VC+VHC A+  
Sbjct  1    MDCNKEEALRAKGIAEKKMESKDFAGARTFVLKARKLYPDLENIAQMLVVCDVHCFAEQK  60

Query  371  MLGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSD  550
            +LG   D Y ILQ+DR+A+E  IKKQY+KLAL LHPDKNKF GAEAAFKLIGEA  +L D
Sbjct  61   LLGNVMDCYKILQIDRNANEAIIKKQYKKLALQLHPDKNKFAGAEAAFKLIGEAQRVLLD  120

Query  551  QTKRSIYDSK-CRVSIRSTSMRPPPHQVN  634
            + KRS  D    R S+  T+M P  HQ N
Sbjct  121  RDKRSSLDMNLSRFSMIRTAM-PSHHQRN  148



>ref|XP_006289445.1| hypothetical protein CARUB_v10002959mg [Capsella rubella]
 gb|EOA22343.1| hypothetical protein CARUB_v10002959mg [Capsella rubella]
Length=1099

 Score =   147 bits (371),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 84/138 (61%), Positives = 108/138 (78%), Gaps = 0/138 (0%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKNM  373
            MECNK+EAL+AKELAE KM+N DF GA K+  KAQ L+P LE++ Q++AVC+VH SA+  
Sbjct  1    MECNKEEALRAKELAEDKMKNGDFVGALKLLLKAQCLFPGLESLPQMIAVCDVHKSAETK  60

Query  374  LGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSDQ  553
            +   ++WYGILQV   AD+ TIKKQ RKLAL+LHPDKN+FPGAEAAFKL+ +A+  L+D+
Sbjct  61   INGLENWYGILQVMHFADDATIKKQVRKLALLLHPDKNQFPGAEAAFKLVWDASSFLADK  120

Query  554  TKRSIYDSKCRVSIRSTS  607
             KRS YD K R+ +R  S
Sbjct  121  DKRSRYDIKRRIYLRFAS  138



>ref|XP_004965985.1| PREDICTED: uncharacterized protein LOC101779344 isoform X1 [Setaria 
italica]
 ref|XP_004965986.1| PREDICTED: uncharacterized protein LOC101779344 isoform X2 [Setaria 
italica]
 ref|XP_004965987.1| PREDICTED: uncharacterized protein LOC101779344 isoform X3 [Setaria 
italica]
Length=1030

 Score =   147 bits (371),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 78/136 (57%), Positives = 106/136 (78%), Gaps = 0/136 (0%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKNM  373
            MECN++EALKA+E+A KK+++ DF GA+++A KAQR++P++ENI QLL VC V C+A+  
Sbjct  1    MECNREEALKAREIAIKKLESKDFAGAKRIALKAQRIFPEIENIPQLLTVCEVQCAAEAN  60

Query  374  LGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSDQ  553
            +    D+YGILQV+ +ADE+TIKKQYRKL L LHPDKN + GAE+AFK + EA   LSD+
Sbjct  61   INGMLDFYGILQVEVTADEMTIKKQYRKLVLSLHPDKNSYAGAESAFKFVAEAYTTLSDR  120

Query  554  TKRSIYDSKCRVSIRS  601
             KR  YD K RV+ ++
Sbjct  121  AKRYAYDIKWRVASKA  136



>ref|XP_011468429.1| PREDICTED: uncharacterized protein LOC101311114 [Fragaria vesca 
subsp. vesca]
Length=1754

 Score =   147 bits (372),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 80/130 (62%), Positives = 100/130 (77%), Gaps = 1/130 (1%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSA-KN  370
            MECNKDEA++A +L+EKK+QN DF+GA+++A KAQRLYP L+NI++L+ VC VHC+A K 
Sbjct  1    MECNKDEAVRAMQLSEKKIQNKDFKGAKEMALKAQRLYPQLDNISRLITVCEVHCAAEKK  60

Query  371  MLGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSD  550
            + G + DWYGILQV +  D  TIKKQY+KL L+LHPDK    GAE AFKLIGEA  +L D
Sbjct  61   VGGSEMDWYGILQVQQYEDRETIKKQYKKLGLLLHPDKTSLTGAEGAFKLIGEAYRVLFD  120

Query  551  QTKRSIYDSK  580
               RS YD K
Sbjct  121  PGSRSKYDIK  130



>ref|NP_001068142.1| Os11g0578500 [Oryza sativa Japonica Group]
 gb|ABA94490.2| DnaJ domain containing protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF28505.1| Os11g0578500 [Oryza sativa Japonica Group]
Length=624

 Score =   144 bits (364),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 75/149 (50%), Positives = 108/149 (72%), Gaps = 2/149 (1%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKNM  373
            MECN++EA +A+E+A KK++N DF GA+K+A KAQRL+P+LENI+QLL +C V  SA+  
Sbjct  1    MECNREEAFRAREIAVKKLENRDFVGARKIAIKAQRLFPELENISQLLIICEVLSSAEAK  60

Query  374  LGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSDQ  553
            +  + DWYG+LQVD+ ADE  I++QY  L+  LHPD N   GAEAAF+ + EA+ +LSD 
Sbjct  61   ISGELDWYGVLQVDKMADETVIRRQYNILSYRLHPDNNTLFGAEAAFRFVSEAHAILSDH  120

Query  554  TKRSIYDSKCRVSIRSTSMRP--PPHQVN  634
             KRS+YD+K + + R  +     PP++ +
Sbjct  121  VKRSLYDTKRQCASREVAKEATQPPNKTD  149



>ref|XP_002874391.1| DNAJ heat shock N-terminal domain-containing protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH50650.1| DNAJ heat shock N-terminal domain-containing protein [Arabidopsis 
lyrata subsp. lyrata]
Length=1104

 Score =   147 bits (370),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 82/140 (59%), Positives = 106/140 (76%), Gaps = 0/140 (0%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKNM  373
            M+CNK+EA +AK LAE KM+N DF GAQK+  KAQ L+  LE + Q+LAVC+VH SA+  
Sbjct  1    MDCNKEEASRAKTLAEDKMKNGDFVGAQKLLLKAQSLFSGLETLPQMLAVCDVHNSAEKK  60

Query  374  LGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSDQ  553
            L   ++WYGILQV   AD+ TIKKQ RKLAL+LHPDKN+FPGAE+AFKL+ +A+  L+D+
Sbjct  61   LNGLENWYGILQVMHFADDATIKKQVRKLALLLHPDKNQFPGAESAFKLVWDASRFLADK  120

Query  554  TKRSIYDSKCRVSIRSTSMR  613
             KRS YD K R+ +R  S +
Sbjct  121  DKRSQYDIKRRIYLRVASYQ  140



>ref|XP_010540338.1| PREDICTED: uncharacterized protein LOC104814148 [Tarenaya hassleriana]
 ref|XP_010540339.1| PREDICTED: uncharacterized protein LOC104814148 [Tarenaya hassleriana]
Length=1133

 Score =   147 bits (370),  Expect = 2e-36, Method: Composition-based stats.
 Identities = 82/132 (62%), Positives = 105/132 (80%), Gaps = 0/132 (0%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKNM  373
            MECN+  A++AKELAE+K++  DF GA+++A KAQ+L+P+LE + QL+AVC+VH +A N 
Sbjct  1    MECNRKMAMRAKELAEEKLRAEDFIGARQLAMKAQQLFPELEKLMQLVAVCDVHYAALNK  60

Query  374  LGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSDQ  553
            +   ++WY ILQ++R ADE  IKKQYRKL L+LHPDKNKF GAE AFKLIGEA  LL+DQ
Sbjct  61   IAGLENWYAILQLNRFADEAAIKKQYRKLVLLLHPDKNKFAGAEEAFKLIGEAYGLLADQ  120

Query  554  TKRSIYDSKCRV  589
            TKR  YD K RV
Sbjct  121  TKRLEYDIKYRV  132



>ref|XP_004968770.1| PREDICTED: uncharacterized protein LOC101770440 [Setaria italica]
Length=1043

 Score =   146 bits (369),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 78/135 (58%), Positives = 105/135 (78%), Gaps = 0/135 (0%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKNM  373
            MECN++EALKA+E+A KK++N DF GA+++A KAQR++P++ENI QLL VC VHC+A+  
Sbjct  1    MECNREEALKAREIAAKKLENKDFVGAKRIALKAQRIFPEVENILQLLTVCEVHCAAEAK  60

Query  374  LGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSDQ  553
            +    D+YGILQ + +ADE+TIKKQYRKL L LHPDKN + GAE+AFK + EA   LSD+
Sbjct  61   INGMLDFYGILQAEGTADEMTIKKQYRKLVLSLHPDKNSYAGAESAFKFVAEAYSTLSDR  120

Query  554  TKRSIYDSKCRVSIR  598
             KR  YD K +V+ +
Sbjct  121  AKRYAYDIKYKVASK  135



>ref|XP_009134889.1| PREDICTED: uncharacterized protein LOC103859153 [Brassica rapa]
 ref|XP_009134890.1| PREDICTED: uncharacterized protein LOC103859153 [Brassica rapa]
 ref|XP_009134892.1| PREDICTED: uncharacterized protein LOC103859153 [Brassica rapa]
 ref|XP_009134893.1| PREDICTED: uncharacterized protein LOC103859153 [Brassica rapa]
Length=660

 Score =   144 bits (364),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 79/133 (59%), Positives = 102/133 (77%), Gaps = 1/133 (1%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKNM  373
            M  N+DEAL+A+ELAE  M+ +DF GA+K+A KA ++ P LENI  +  VC+VHC+A   
Sbjct  1    MNINRDEALRARELAEGLMKKSDFTGARKLALKANKMDPSLENITHMTMVCDVHCAATEK  60

Query  374  LGLDK-DWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSD  550
            L  ++ DWYGILQVD +AD+  IKKQYR+LAL+LHPDKNK PGAE+AFKLIGEA  +L D
Sbjct  61   LFANELDWYGILQVDLNADDTIIKKQYRRLALLLHPDKNKLPGAESAFKLIGEAQRILLD  120

Query  551  QTKRSIYDSKCRV  589
            + KR+ YD+K R 
Sbjct  121  REKRTAYDTKRRA  133



>gb|KHN16161.1| Chaperone protein DnaJ [Glycine soja]
Length=318

 Score =   140 bits (352),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 75/141 (53%), Positives = 102/141 (72%), Gaps = 1/141 (1%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKNM  373
            ME NKDEA++A+++AE +MQ  +F  A K A KA++L  D+ NI  ++ +C VH +AK  
Sbjct  1    MEFNKDEAVRARQVAEARMQRGEFVEALKFATKAKKLCADVVNITHVITICEVHNAAKKK  60

Query  374  L-GLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSD  550
            L   D DWY ILQ++  ADE  IKKQYR+LAL+LHPDKNKF GAEAAFKL+G+A  +LSD
Sbjct  61   LSATDLDWYAILQIEGLADEAAIKKQYRRLALLLHPDKNKFAGAEAAFKLVGQAKGVLSD  120

Query  551  QTKRSIYDSKCRVSIRSTSMR  613
            Q KRS++D     S+R  +++
Sbjct  121  QAKRSLFDKNFGASVRGAAVK  141



>ref|XP_006296847.1| hypothetical protein CARUB_v10012833mg [Capsella rubella]
 gb|EOA29745.1| hypothetical protein CARUB_v10012833mg [Capsella rubella]
Length=1238

 Score =   146 bits (368),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 81/132 (61%), Positives = 102/132 (77%), Gaps = 2/132 (2%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKNM  373
            MECN+++A KAK++AE+KM+  DF  A K   KAQRL+P LE++ Q+  +C+VH SA N 
Sbjct  1    MECNREDATKAKKIAEEKMEAGDFVEAHKFVTKAQRLFPSLEHLLQMKTICDVHSSAINK  60

Query  374  L-GLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSD  550
            + GLD +WYGILQV   AD  TIKKQYR+L L+LHPDKNKFPG+EAAFKL+GEAN LLSD
Sbjct  61   IKGLD-NWYGILQVQPFADADTIKKQYRRLVLLLHPDKNKFPGSEAAFKLVGEANRLLSD  119

Query  551  QTKRSIYDSKCR  586
            +  RS YD + R
Sbjct  120  RITRSNYDVRYR  131



>gb|EMS53344.1| Uncharacterized J domain-containing protein C17A3.05c [Triticum 
urartu]
Length=1088

 Score =   145 bits (367),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 65/109 (60%), Positives = 85/109 (78%), Gaps = 0/109 (0%)
 Frame = +2

Query  248  MQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKNMLGLDKDWYGILQVDRSAD  427
            +++ DF GA+K+A KAQ L+P+LENI+QLL+VC VHC+A+  +  + DWY ILQV+ + D
Sbjct  10   LEDKDFAGARKIALKAQMLFPELENISQLLSVCTVHCAAEARVNGEPDWYAILQVEATTD  69

Query  428  EVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSDQTKRSIYD  574
               I+KQY +LA  LHPDKN FPGAEAAFKL+ EA+ +L DQTKRS YD
Sbjct  70   HANIRKQYLRLAFSLHPDKNCFPGAEAAFKLVAEAHTILCDQTKRSHYD  118



>gb|EMT18416.1| Chaperone protein dnaJ [Aegilops tauschii]
Length=1132

 Score =   145 bits (367),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 67/120 (56%), Positives = 90/120 (75%), Gaps = 0/120 (0%)
 Frame = +2

Query  248  MQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKNMLGLDKDWYGILQVDRSAD  427
            +++ DF GA+K+A KAQ L+P+LENI+QLL+VC VHC+A+  +  + DWY ILQV+ + D
Sbjct  10   LEDKDFAGARKIALKAQMLFPELENISQLLSVCTVHCAAEARVNGEPDWYAILQVEATTD  69

Query  428  EVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSDQTKRSIYDSKCRVSIRSTS  607
               I+KQY +LA  LHPDKN FPGAEAAFKL+ EA+ +L DQTKRS YD + + + R  S
Sbjct  70   HANIRKQYLRLAFSLHPDKNCFPGAEAAFKLVAEAHSILCDQTKRSHYDIRRQYASRKVS  129



>ref|XP_006297143.1| hypothetical protein CARUB_v10013147mg [Capsella rubella]
 ref|XP_006297144.1| hypothetical protein CARUB_v10013147mg [Capsella rubella]
 ref|XP_006297145.1| hypothetical protein CARUB_v10013147mg [Capsella rubella]
 gb|EOA30041.1| hypothetical protein CARUB_v10013147mg [Capsella rubella]
 gb|EOA30042.1| hypothetical protein CARUB_v10013147mg [Capsella rubella]
 gb|EOA30043.1| hypothetical protein CARUB_v10013147mg [Capsella rubella]
Length=667

 Score =   143 bits (361),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 79/143 (55%), Positives = 111/143 (78%), Gaps = 2/143 (1%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSA-KN  370
            M  N+DEAL+AKELAE  M+  DF  A+K+A KA+++   L+NI++++ VC+VHC+A +N
Sbjct  1    MSINRDEALRAKELAEGLMKKTDFTAARKLALKAEKMDSSLDNISRMIMVCDVHCAATQN  60

Query  371  MLGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSD  550
            + G + D YGILQVD++AD++ +KKQY++LAL+LHPDKNKFPGAE+AFKLIG+A  +L D
Sbjct  61   LFGTEMDCYGILQVDQNADDIIVKKQYKRLALLLHPDKNKFPGAESAFKLIGDAQRILLD  120

Query  551  QTKRSIYDSKCRVSIRSTSMRPP  619
              KR +YD+K R S R  +  PP
Sbjct  121  TEKRKLYDTK-RRSWRKPAPAPP  142



>ref|XP_003563509.1| PREDICTED: uncharacterized protein LOC100844853 [Brachypodium 
distachyon]
Length=1043

 Score =   145 bits (366),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 75/128 (59%), Positives = 101/128 (79%), Gaps = 0/128 (0%)
 Frame = +2

Query  191  LMECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKN  370
            +MECN++EA +A+E+A K+M+N DF GAQK+A +AQ L+P+LE+I++LL +CNVHC+A+ 
Sbjct  1    MMECNREEAFRAREIALKQMENEDFIGAQKIALQAQMLFPELEDISKLLNICNVHCAAEA  60

Query  371  MLGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSD  550
             +  + DWY ILQV+ +AD   IKKQY +LA  +HPDKN F GAEAAFKL+ EA  +L D
Sbjct  61   RVNGETDWYAILQVEPTADPDHIKKQYHRLAKSVHPDKNCFSGAEAAFKLVSEAYTVLFD  120

Query  551  QTKRSIYD  574
            QTKRS YD
Sbjct  121  QTKRSHYD  128



>ref|XP_010524767.1| PREDICTED: uncharacterized protein LOC104802729 [Tarenaya hassleriana]
 ref|XP_010524768.1| PREDICTED: uncharacterized protein LOC104802729 [Tarenaya hassleriana]
 ref|XP_010524769.1| PREDICTED: uncharacterized protein LOC104802729 [Tarenaya hassleriana]
Length=932

 Score =   144 bits (364),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 79/130 (61%), Positives = 102/130 (78%), Gaps = 1/130 (1%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSA-KN  370
            M  NKDEAL+AK++AE  M+  DF GA+K+  +AQ+L   LENI+ ++ VC+VHC+A + 
Sbjct  1    MSINKDEALRAKDMAEGLMRKADFSGARKLVLRAQKLDSSLENISHMIMVCDVHCAAAEK  60

Query  371  MLGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSD  550
            M G + +WY ILQV+R AD VTIKKQY+KLAL+LHPDKNK PGAEAAFKLIGEA  +L D
Sbjct  61   MFGNEMNWYDILQVERKADVVTIKKQYKKLALLLHPDKNKLPGAEAAFKLIGEAQRILLD  120

Query  551  QTKRSIYDSK  580
            + KRS++D K
Sbjct  121  KDKRSLFDMK  130



>ref|XP_002884572.1| DNAJ heat shock N-terminal domain-containing protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH60831.1| DNAJ heat shock N-terminal domain-containing protein [Arabidopsis 
lyrata subsp. lyrata]
Length=671

 Score =   143 bits (360),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 79/143 (55%), Positives = 110/143 (77%), Gaps = 2/143 (1%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSA-KN  370
            M  N+DEAL+AK+LAE  M+  DF  A+K+A KAQ++   LENI++++ VC+VHC+A + 
Sbjct  1    MSINRDEALRAKDLAEGLMKKTDFTAARKLALKAQKMDSSLENISRMIMVCDVHCAATEK  60

Query  371  MLGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSD  550
            + G + DWYGILQV++ A+++ IKKQY++LAL+LHPDKNK PGAEAAFKLIGEA  +L D
Sbjct  61   LFGTEMDWYGILQVEQIANDILIKKQYKRLALLLHPDKNKLPGAEAAFKLIGEAQRILLD  120

Query  551  QTKRSIYDSKCRVSIRSTSMRPP  619
            + KR ++D K R S+R  +  PP
Sbjct  121  KEKRMLHDIK-RKSLRMPAPAPP  142



>gb|EAZ18827.1| hypothetical protein OsJ_34364 [Oryza sativa Japonica Group]
Length=1043

 Score =   144 bits (363),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 75/149 (50%), Positives = 108/149 (72%), Gaps = 2/149 (1%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKNM  373
            MECN++EA +A+E+A KK++N DF GA+K+A KAQRL+P+LENI+QLL +C V  SA+  
Sbjct  1    MECNREEAFRAREIAVKKLENRDFVGARKIAIKAQRLFPELENISQLLIICEVLSSAEAK  60

Query  374  LGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSDQ  553
            +  + DWYG+LQVD+ ADE  I++QY  L+  LHPD N   GAEAAF+ + EA+ +LSD 
Sbjct  61   ISGELDWYGVLQVDKMADETVIRRQYNILSYRLHPDNNTLFGAEAAFRFVSEAHAILSDH  120

Query  554  TKRSIYDSKCRVSIRSTSMRP--PPHQVN  634
             KRS+YD+K + + R  +     PP++ +
Sbjct  121  VKRSLYDTKRQCASREVAKEATQPPNKTD  149



>gb|KDO81871.1| hypothetical protein CISIN_1g003634mg [Citrus sinensis]
 gb|KDO81872.1| hypothetical protein CISIN_1g003634mg [Citrus sinensis]
Length=806

 Score =   143 bits (361),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 77/129 (60%), Positives = 97/129 (75%), Gaps = 0/129 (0%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKNM  373
            MECNKDEA +AKE++EKK    DF GA+K A KAQ LYP LE I Q++A  +V+ SA+N 
Sbjct  1    MECNKDEATRAKEISEKKFTARDFTGAKKFAVKAQNLYPGLEGIPQMIATLDVYISAENK  60

Query  374  LGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSDQ  553
            +G + DWYGIL V   AD+ T+KKQYRKLAL+LHPDKNK  GA+ AFK + EA +LLSD+
Sbjct  61   IGGEADWYGILGVTPQADDETVKKQYRKLALMLHPDKNKSIGADGAFKFVSEAWILLSDK  120

Query  554  TKRSIYDSK  580
             KR+ YD +
Sbjct  121  AKRAEYDQR  129



>ref|XP_006484123.1| PREDICTED: uncharacterized protein LOC102614074 isoform X1 [Citrus 
sinensis]
 ref|XP_006484124.1| PREDICTED: uncharacterized protein LOC102614074 isoform X2 [Citrus 
sinensis]
 ref|XP_006484125.1| PREDICTED: uncharacterized protein LOC102614074 isoform X3 [Citrus 
sinensis]
Length=806

 Score =   143 bits (361),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 78/129 (60%), Positives = 97/129 (75%), Gaps = 0/129 (0%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKNM  373
            MECNKDEA +AKE+AEKK    DF GA+K A KAQ LYP LE I Q++A  +V+ SA+N 
Sbjct  1    MECNKDEATRAKEIAEKKFTAKDFTGAKKFAVKAQNLYPGLEGIPQMIATLDVYISAENK  60

Query  374  LGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSDQ  553
            +G + DWYGIL V   AD+ T+KKQYRKLAL+LHPDKNK  GA+ AFK + EA +LLSD+
Sbjct  61   IGGEADWYGILGVTPQADDETVKKQYRKLALMLHPDKNKSIGADGAFKFVSEAWILLSDK  120

Query  554  TKRSIYDSK  580
             KR+ YD +
Sbjct  121  AKRAEYDQR  129



>ref|XP_006438009.1| hypothetical protein CICLE_v10030729mg [Citrus clementina]
 gb|ESR51249.1| hypothetical protein CICLE_v10030729mg [Citrus clementina]
Length=806

 Score =   143 bits (361),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 78/129 (60%), Positives = 97/129 (75%), Gaps = 0/129 (0%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKNM  373
            MECNKDEA +AKE+AEKK    DF GA+K A KAQ LYP LE I Q++A  +V+ SA+N 
Sbjct  1    MECNKDEATRAKEIAEKKFTAKDFTGAKKFAVKAQNLYPGLEGIPQMIATLDVYISAENK  60

Query  374  LGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSDQ  553
            +G + DWYGIL V   AD+ T+KKQYRKLAL+LHPDKNK  GA+ AFK + EA +LLSD+
Sbjct  61   IGGEADWYGILGVTPQADDETVKKQYRKLALMLHPDKNKSIGADGAFKFVSEAWILLSDK  120

Query  554  TKRSIYDSK  580
             KR+ YD +
Sbjct  121  AKRAEYDQR  129



>ref|XP_010449377.1| PREDICTED: dnaJ homolog subfamily B member 12-like [Camelina 
sativa]
 ref|XP_010449378.1| PREDICTED: dnaJ homolog subfamily B member 12-like [Camelina 
sativa]
Length=276

 Score =   137 bits (345),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 74/133 (56%), Positives = 99/133 (74%), Gaps = 0/133 (0%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKNM  373
            MECNK+EA +A ++AEKK+  ND++GA+K+  KA+RLYP LE + Q+L   +V+ SA N 
Sbjct  1    MECNKEEARRAIDMAEKKISENDYDGAKKLVNKAERLYPQLEGLKQVLMTIDVYISASNK  60

Query  374  LGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSDQ  553
            +    DWYG+L VD SAD+  +KK+Y+KLAL+LHPDKN+F GAE AFKL+ +A  LLSD+
Sbjct  61   INGVSDWYGVLGVDPSADDEAVKKRYKKLALLLHPDKNRFHGAEGAFKLVLQACDLLSDK  120

Query  554  TKRSIYDSKCRVS  592
             KRS YD   R S
Sbjct  121  VKRSAYDDHKRKS  133



>gb|ABA94405.1| DnaJ domain containing protein [Oryza sativa Japonica Group]
Length=290

 Score =   137 bits (346),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 62/111 (56%), Positives = 83/111 (75%), Gaps = 0/111 (0%)
 Frame = +2

Query  248  MQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKNMLGLDKDWYGILQVDRSAD  427
            ++N DF GA+K+A KAQRL+P+LENI+QLL VC V  SA+  +  + DWYG+LQVD+ AD
Sbjct  114  LENRDFVGARKIAIKAQRLFPELENISQLLTVCEVLSSAEAKISGELDWYGVLQVDKMAD  173

Query  428  EVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSDQTKRSIYDSK  580
            E  I+KQY  L+  LHPD N   GAEAAF+ + EA+ +LSD  KRS+YD++
Sbjct  174  ETVIRKQYNILSYRLHPDNNTLFGAEAAFRFVSEAHAVLSDHAKRSLYDTE  224



>ref|NP_187285.1| DnaJ domain-containing protein [Arabidopsis thaliana]
 ref|NP_001030649.1| DnaJ domain-containing protein [Arabidopsis thaliana]
 ref|NP_001189825.1| DnaJ domain-containing protein [Arabidopsis thaliana]
 gb|AAF08586.1|AC011623_19 putative DnaJ protein [Arabidopsis thaliana]
 gb|AEE74378.1| DnaJ domain-containing protein [Arabidopsis thaliana]
 gb|AEE74379.1| DnaJ domain-containing protein [Arabidopsis thaliana]
 gb|AEE74380.1| DnaJ domain-containing protein [Arabidopsis thaliana]
Length=673

 Score =   142 bits (358),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 79/149 (53%), Positives = 113/149 (76%), Gaps = 8/149 (5%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSA-KN  370
            M  N+DEAL+AK+LAE  M+  DF  A+K+A KAQ++   LENI++++ VC+VHC+A + 
Sbjct  1    MSINRDEALRAKDLAEGLMKKTDFTAARKLAMKAQKMDSSLENISRMIMVCDVHCAATEK  60

Query  371  MLGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSD  550
            + G + DWYGILQV++ A++V IKKQY++LAL+LHPDKNK PGAE+AFKLIGEA  +L D
Sbjct  61   LFGTEMDWYGILQVEQIANDVIIKKQYKRLALLLHPDKNKLPGAESAFKLIGEAQRILLD  120

Query  551  QTKRSIYDSKCRVSIRSTSMRP--PPHQV  631
            + KR+++D+K     R T  +P  PP++ 
Sbjct  121  REKRTLHDNK-----RKTWRKPAAPPYKA  144



>gb|EMT13700.1| DnaJ homolog subfamily B member 12 [Aegilops tauschii]
Length=855

 Score =   143 bits (361),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 95/127 (75%), Gaps = 0/127 (0%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKNM  373
            MECN++EAL+A+E+A K ++N +F GA+++A KAQRL+P  ENI+QLL VC V C+A   
Sbjct  1    MECNREEALRAREIAAKMLENKNFLGARRIALKAQRLFPGFENIHQLLTVCEVQCAAVAK  60

Query  374  LGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSDQ  553
            +  D DWY ILQV+ +ADE  I KQY KLA  LHPDKN  PGAE A KL+ EA  +L D+
Sbjct  61   INEDLDWYSILQVEATADETVITKQYEKLAFWLHPDKNTLPGAEVALKLVSEARKILCDR  120

Query  554  TKRSIYD  574
            T+RS+YD
Sbjct  121  TERSLYD  127



>ref|XP_010445272.1| PREDICTED: dnaJ homolog subfamily C member 8-like [Camelina sativa]
Length=301

 Score =   137 bits (345),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 77/145 (53%), Positives = 102/145 (70%), Gaps = 1/145 (1%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKNM  373
            MECNKDEA +A ++AEKK+  ND++GA+K   KA+RLYP LE + Q+L   +V+ SA N 
Sbjct  1    MECNKDEARRAIDIAEKKISANDYDGAKKFVNKAERLYPQLEGLKQVLMTIDVYISASNK  60

Query  374  LGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSDQ  553
               + DWYG+L VD  AD+  +KK+Y+KLAL+LHPDKN+F GAE AFKL+ +A  LLSD+
Sbjct  61   TNGESDWYGVLGVDPLADDEAVKKRYKKLALLLHPDKNRFHGAEGAFKLVLQACDLLSDK  120

Query  554  TKRSIYDSKCRVSIRSTSMRPPPHQ  628
             KRS YD K R S +     P P +
Sbjct  121  VKRSAYDQK-RKSKQVNQKTPKPSE  144



>ref|XP_010486141.1| PREDICTED: uncharacterized protein LOC104764323 [Camelina sativa]
Length=654

 Score =   141 bits (355),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 77/143 (54%), Positives = 110/143 (77%), Gaps = 2/143 (1%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSA-KN  370
            M  N+DEAL+AK+LAE  M+  DF  A+K+A KAQ++   L+NI++++ VC+VHC+A + 
Sbjct  1    MSINRDEALRAKDLAEGLMKKTDFTAARKLALKAQKMDASLDNISRMIMVCDVHCAATEK  60

Query  371  MLGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSD  550
            + G + DWYGILQV+++AD+V +KKQY++LAL+LHPDKNK PGAE+AFKLIG+A  +L D
Sbjct  61   LFGTEMDWYGILQVEQNADDVILKKQYKRLALLLHPDKNKLPGAESAFKLIGDAQRILLD  120

Query  551  QTKRSIYDSKCRVSIRSTSMRPP  619
            + KR ++D K R S R  +  PP
Sbjct  121  KEKRKLHDVK-RRSWRKPAPGPP  142



>ref|XP_006407958.1| hypothetical protein EUTSA_v10020330mg [Eutrema salsugineum]
 gb|ESQ49411.1| hypothetical protein EUTSA_v10020330mg [Eutrema salsugineum]
Length=604

 Score =   140 bits (354),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 75/147 (51%), Positives = 110/147 (75%), Gaps = 1/147 (1%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSA-KN  370
            M  N+DEAL+AK++AE  M+  DF  A+K+A +A +L P LENI++++ VC+VHC+A + 
Sbjct  1    MNINRDEALRAKDMAEDLMKKTDFTNARKLALRAHKLEPSLENISRMIMVCDVHCAATEK  60

Query  371  MLGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSD  550
            + G + DWYGILQV+ +A+++TIKKQY++LAL+LHPDKNK PGAE+AFKLIGEA  +L D
Sbjct  61   LFGNEMDWYGILQVELNANDITIKKQYKRLALLLHPDKNKLPGAESAFKLIGEAQRILLD  120

Query  551  QTKRSIYDSKCRVSIRSTSMRPPPHQV  631
            + KR+ +D + +   +  +    P QV
Sbjct  121  KDKRAQHDIQRKTCRKPATASYKPQQV  147



>ref|XP_004979549.1| PREDICTED: uncharacterized protein LOC101754686 isoform X1 [Setaria 
italica]
 ref|XP_004979550.1| PREDICTED: uncharacterized protein LOC101754686 isoform X2 [Setaria 
italica]
Length=1196

 Score =   143 bits (361),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 76/129 (59%), Positives = 97/129 (75%), Gaps = 0/129 (0%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKNM  373
            ME NK+EAL AKE+A +K++  DF GAQ++A KAQRLYP LEN+ QLLA+C VHC+A+  
Sbjct  1    MEFNKEEALLAKEIALRKVKTKDFLGAQRIALKAQRLYPKLENLPQLLAICEVHCAAEVK  60

Query  374  LGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSDQ  553
            +  D DWYGILQV+ + D   I+K+Y KLA +LHP KN  PGA+AAFKL+ EA+ +L D 
Sbjct  61   VNGDMDWYGILQVEATVDGTVIRKEYEKLAFLLHPSKNTLPGAQAAFKLVSEAHTILCDH  120

Query  554  TKRSIYDSK  580
             KRS YD K
Sbjct  121  VKRSRYDIK  129



>ref|XP_003594017.1| DnaJ protein-like protein [Medicago truncatula]
 gb|AES64268.1| DnaJ heat shock amino-terminal domain protein [Medicago truncatula]
Length=946

 Score =   142 bits (359),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 86/157 (55%), Positives = 112/157 (71%), Gaps = 9/157 (6%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKN-  370
            M+CNK+EAL+AK++AEKKM++ DF GA+  A KAQ+LYPDLENI Q+L VC+VHCSA+  
Sbjct  1    MDCNKEEALRAKDIAEKKMESKDFTGARTFAHKAQKLYPDLENIAQMLVVCDVHCSAEQK  60

Query  371  MLGLDK--DWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLL  544
            +LG     DWY +LQ+DR+  +  IKKQY+K AL LHPDKNKF GAEAAFKLIGEA  +L
Sbjct  61   LLGNTNVVDWYKVLQIDRNDHDGIIKKQYKKFALQLHPDKNKFAGAEAAFKLIGEAQRVL  120

Query  545  SDQTKRSIYD------SKCRVSIRSTSMRPPPHQVNP  637
             D+ KR++ +      S  + ++ S   R  P   NP
Sbjct  121  LDREKRTLLNMNLSKFSMTKPAMPSIFQRNVPVNFNP  157



>gb|KEH36710.1| DnaJ heat shock amino-terminal domain protein [Medicago truncatula]
Length=933

 Score =   142 bits (358),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 86/157 (55%), Positives = 112/157 (71%), Gaps = 9/157 (6%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKN-  370
            M+CNK+EAL+AK++AEKKM++ DF GA+  A KAQ+LYPDLENI Q+L VC+VHCSA+  
Sbjct  1    MDCNKEEALRAKDIAEKKMESKDFTGARTFAHKAQKLYPDLENIAQMLVVCDVHCSAEQK  60

Query  371  MLGLDK--DWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLL  544
            +LG     DWY +LQ+DR+  +  IKKQY+K AL LHPDKNKF GAEAAFKLIGEA  +L
Sbjct  61   LLGNTNVVDWYKVLQIDRNDHDGIIKKQYKKFALQLHPDKNKFAGAEAAFKLIGEAQRVL  120

Query  545  SDQTKRSIYD------SKCRVSIRSTSMRPPPHQVNP  637
             D+ KR++ +      S  + ++ S   R  P   NP
Sbjct  121  LDREKRTLLNMNLSKFSMTKPAMPSIFQRNVPVNFNP  157



>gb|EMS58140.1| DnaJ homolog subfamily B member 14 [Triticum urartu]
Length=896

 Score =   142 bits (358),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 71/127 (56%), Positives = 92/127 (72%), Gaps = 0/127 (0%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKNM  373
            MECN++E L+A+E+A   +++ DF GA+++A KAQRL+P  ENI QLL VC V C+A   
Sbjct  1    MECNREEGLRAREIAANMLESKDFLGARRIALKAQRLFPGFENIYQLLTVCEVQCAAVAK  60

Query  374  LGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSDQ  553
            +  D DWY ILQV+ +ADE  I KQY KLA  LHPDKN  PGAE A KL+ EA  +L D+
Sbjct  61   INEDLDWYSILQVEATADETVITKQYEKLAFWLHPDKNTLPGAEVALKLVSEARKILCDR  120

Query  554  TKRSIYD  574
            T+RS+YD
Sbjct  121  TERSLYD  127



>ref|XP_008389881.1| PREDICTED: uncharacterized protein LOC103452159 [Malus domestica]
 ref|XP_008389882.1| PREDICTED: uncharacterized protein LOC103452159 [Malus domestica]
Length=752

 Score =   141 bits (356),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 83/147 (56%), Positives = 102/147 (69%), Gaps = 4/147 (3%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKNM  373
            MECNKDEA +AKE+AE+K    D  GA+K A KAQ L+P LE I Q+LA  +VH +A+N 
Sbjct  1    MECNKDEAARAKEIAERKFTAKDLMGAKKFALKAQTLFPGLEGIPQMLATLDVHIAAENK  60

Query  374  LGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSDQ  553
            +  + DWYGIL  D  AD+  +KKQYRKLAL+LHPDKNK  GA+ AFKL+ EA  LLSD+
Sbjct  61   INGEADWYGILGADPKADDEAVKKQYRKLALMLHPDKNKSVGADGAFKLLSEAWSLLSDK  120

Query  554  TKRSIYDSKCRVSIR----STSMRPPP  622
            +KR  YD K RV  R    S S + PP
Sbjct  121  SKRVAYDQKRRVHQRVATASGSSQAPP  147



>gb|EAY81410.1| hypothetical protein OsI_36578 [Oryza sativa Indica Group]
Length=1045

 Score =   142 bits (358),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 74/149 (50%), Positives = 106/149 (71%), Gaps = 2/149 (1%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKNM  373
            MECN++EA + +E+A KK++N DF GA+K+A KAQRL+P+LENI+QLL +C V  SA+  
Sbjct  1    MECNREEAFRTREIAVKKLENRDFVGARKIAIKAQRLFPELENISQLLIICEVLSSAEAK  60

Query  374  LGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSDQ  553
            +  + DWYG+LQVD+ ADE  I+ QY  L+  LHPD N   GAEAAF+ + EA+ +LSD 
Sbjct  61   ISGELDWYGVLQVDKMADETVIRWQYNILSYRLHPDNNTLFGAEAAFRFVSEAHAILSDH  120

Query  554  TKRSIYDSKCRVSIRSTSMRP--PPHQVN  634
             KRS+YD+K + + R  +     PP++ +
Sbjct  121  VKRSLYDTKRQCASREVAKEATQPPNKTD  149



>ref|XP_009343151.1| PREDICTED: uncharacterized protein LOC103935122 [Pyrus x bretschneideri]
 ref|XP_009343154.1| PREDICTED: uncharacterized protein LOC103935122 [Pyrus x bretschneideri]
Length=733

 Score =   141 bits (355),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 83/147 (56%), Positives = 102/147 (69%), Gaps = 4/147 (3%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKNM  373
            MECNKDEA +AKE+AE+K    D  GA+K A KAQ L+P LE I Q+LA  +VH +A+N 
Sbjct  1    MECNKDEAARAKEIAERKFTAKDLMGAKKFALKAQTLFPGLEGIPQMLATLDVHIAAENK  60

Query  374  LGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSDQ  553
            +  + DWYGIL  D  AD+  +KKQYRKLAL+LHPDKNK  GA+ AFKL+ EA  LLSD+
Sbjct  61   INGEADWYGILGADPKADDEAVKKQYRKLALMLHPDKNKSVGADGAFKLLSEAWSLLSDK  120

Query  554  TKRSIYDSKCRVSIR----STSMRPPP  622
            +KR  YD K RV  R    S S + PP
Sbjct  121  SKRVAYDQKRRVHQRVATASGSSQAPP  147



>ref|XP_006285566.1| hypothetical protein CARUB_v10007010mg [Capsella rubella]
 gb|EOA18464.1| hypothetical protein CARUB_v10007010mg [Capsella rubella]
Length=364

 Score =   137 bits (346),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 77/145 (53%), Positives = 101/145 (70%), Gaps = 1/145 (1%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKNM  373
            MECNKDEA +A ++AEKK+  ND++GA+K   KAQRL P LE + Q+L + +V+ SA N 
Sbjct  1    MECNKDEARRAIDIAEKKVSENDYDGARKFVNKAQRLNPQLEGLEQVLMMIDVYISASNR  60

Query  374  LGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSDQ  553
             G + DWYG+L VD  AD   +KK+Y+KLAL+LHPDKN+F  AE AFKL+ +A  LLSD+
Sbjct  61   EGGEADWYGVLGVDPLADNEAVKKRYKKLALLLHPDKNRFNVAEGAFKLVSQAWHLLSDK  120

Query  554  TKRSIYDSKCRVSIRSTSMRPPPHQ  628
             +RS YD K R S       P PH+
Sbjct  121  AQRSAYDQK-RKSKHGQQKTPKPHE  144



>ref|XP_010656013.1| PREDICTED: dnaJ homolog subfamily B member 12-like [Vitis vinifera]
Length=267

 Score =   135 bits (340),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 80/146 (55%), Positives = 102/146 (70%), Gaps = 0/146 (0%)
 Frame = +2

Query  182  LVLLMECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCS  361
            L+  MECNKDEA +AKE+AEKK    D  GA+K+A KAQ L+P L  + Q+L   +VH S
Sbjct  22   LIREMECNKDEATRAKEIAEKKFIARDIAGAKKLALKAQNLFPGLNGLPQMLLTLDVHIS  81

Query  362  AKNMLGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVL  541
            A+N +  + DWYGIL V+  AD+ T++KQYRKLAL+LHPDKNK  GA+ AFKLI EA  L
Sbjct  82   AENKINGEADWYGILGVNPLADDDTVRKQYRKLALMLHPDKNKSIGADGAFKLISEAWSL  141

Query  542  LSDQTKRSIYDSKCRVSIRSTSMRPP  619
            LSD+TKR  +D K  V      ++PP
Sbjct  142  LSDKTKRIAFDQKRNVKAGQQKVQPP  167



>ref|XP_010558494.1| PREDICTED: uncharacterized protein LOC104827121 [Tarenaya hassleriana]
 ref|XP_010558495.1| PREDICTED: uncharacterized protein LOC104827121 [Tarenaya hassleriana]
 ref|XP_010558496.1| PREDICTED: uncharacterized protein LOC104827121 [Tarenaya hassleriana]
Length=991

 Score =   142 bits (357),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 77/146 (53%), Positives = 108/146 (74%), Gaps = 1/146 (1%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHC-SAKN  370
            M  N+DEAL+AK++AE  M+  DF  A+++  +AQ+L   LENI+ ++ VC+VHC +A+ 
Sbjct  1    MSINRDEALRAKDIAEGIMKKADFTAARRLVLRAQKLDSSLENISHMMMVCDVHCVAAEK  60

Query  371  MLGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSD  550
            + G + DWYGILQV++ AD+++IKKQY+KLA +LHPDKNK PGAEAAFKLIGEA  +L D
Sbjct  61   LSGNEMDWYGILQVEQKADDISIKKQYKKLAFLLHPDKNKLPGAEAAFKLIGEAQRILLD  120

Query  551  QTKRSIYDSKCRVSIRSTSMRPPPHQ  628
            + KRS++D K RV  R      P ++
Sbjct  121  KEKRSLHDMKRRVMNRPAQAPAPAYR  146



>ref|XP_010656024.1| PREDICTED: uncharacterized protein LOC104877364 [Vitis vinifera]
 ref|XP_010656028.1| PREDICTED: uncharacterized protein LOC104877364 [Vitis vinifera]
Length=817

 Score =   141 bits (355),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 81/142 (57%), Positives = 102/142 (72%), Gaps = 0/142 (0%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKNM  373
            MECNKDEA +AKE+AEKK    D  GA+K+A KAQ L+P L+ + Q+LA  +VH SA+N 
Sbjct  1    MECNKDEATRAKEIAEKKFIARDIAGAKKLALKAQNLFPGLDGLPQMLATLDVHISAENK  60

Query  374  LGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSDQ  553
            +  + DWYGIL V+  AD+ T++KQYRKLAL+LHPDKNK  GA+ AFKLI EA  LLSD+
Sbjct  61   INGEADWYGILGVNPQADDDTVRKQYRKLALMLHPDKNKSIGADGAFKLISEAWSLLSDK  120

Query  554  TKRSIYDSKCRVSIRSTSMRPP  619
            TKR  YD K  V      ++PP
Sbjct  121  TKRIAYDQKRNVKAGQQKVQPP  142



>ref|XP_004980631.1| PREDICTED: uncharacterized protein LOC101765238 [Setaria italica]
Length=1155

 Score =   142 bits (357),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 73/129 (57%), Positives = 98/129 (76%), Gaps = 0/129 (0%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKNM  373
            ME N++EA++A+ +A KK++  DF GAQ+VA +AQRLYP+LEN++QLL VC V+C+A+  
Sbjct  1    MEFNREEAIRARRIALKKLEKRDFFGAQRVALQAQRLYPELENLSQLLTVCKVYCAAEER  60

Query  374  LGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSDQ  553
            +    DWYGILQV+ +AD+  IKKQY +L   LHP+KN  PGAEAAFKL+ EA+ +L D 
Sbjct  61   MNRQLDWYGILQVEVTADDTVIKKQYDELVFWLHPNKNTLPGAEAAFKLVSEAHTVLCDH  120

Query  554  TKRSIYDSK  580
             KRS YD K
Sbjct  121  VKRSRYDIK  129



>ref|XP_007136553.1| hypothetical protein PHAVU_009G054500g [Phaseolus vulgaris]
 ref|XP_007136554.1| hypothetical protein PHAVU_009G054500g [Phaseolus vulgaris]
 gb|ESW08547.1| hypothetical protein PHAVU_009G054500g [Phaseolus vulgaris]
 gb|ESW08548.1| hypothetical protein PHAVU_009G054500g [Phaseolus vulgaris]
Length=697

 Score =   139 bits (351),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 78/130 (60%), Positives = 98/130 (75%), Gaps = 0/130 (0%)
 Frame = +2

Query  191  LMECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKN  370
            +MECNKDEA++AKE+AE+K    ++ GA+K A KAQ LYPDLE+I QLL   +++ SA+N
Sbjct  1    MMECNKDEAVRAKEIAERKFSEREYVGAKKFALKAQNLYPDLEDITQLLTTIDIYISAEN  60

Query  371  MLGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSD  550
             +  + DWYGIL V   ADE T++KQYRKLAL LHPDKNK  GAE AFKL+ EA  LLSD
Sbjct  61   KVSGEMDWYGILGVSPFADEDTVRKQYRKLALTLHPDKNKSLGAEGAFKLVSEAWSLLSD  120

Query  551  QTKRSIYDSK  580
            +TKR  Y+ K
Sbjct  121  KTKRLEYNQK  130



>gb|KFK28612.1| hypothetical protein AALP_AA7G020900 [Arabis alpina]
Length=428

 Score =   137 bits (345),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 81/172 (47%), Positives = 111/172 (65%), Gaps = 10/172 (6%)
 Frame = +2

Query  122  DWLQVHLCTAHW*FEWLTYFLVLLMECNKDealkakelaekkMQNNDFEGAQKVAAKAQR  301
            DW Q H+             ++  MECNKDEA +A ++A+KK+  ND+ GA+K   KAQ 
Sbjct  176  DWSQKHVEKK----------ILANMECNKDEARRAMDVAKKKLSINDYLGAKKFVNKAQN  225

Query  302  LYPDLENINQLLAVCNVHCSAKNMLGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPD  481
            +YP L+N+ Q+L + +V+ SA      + DWYG+L VD  AD+  +KKQY+KLAL+LHPD
Sbjct  226  VYPKLDNLEQVLIMIDVYISASKYGKGNADWYGVLGVDPLADDEELKKQYKKLALLLHPD  285

Query  482  KNKFPGAEAAFKLIGEANVLLSDQTKRSIYDSKCRVSIRSTSMRPPPHQVNP  637
            KNKF GAE AFKL+ EA  LLSD+TKR  YD + + +   T M+ PP+   P
Sbjct  286  KNKFHGAEEAFKLVLEAWSLLSDKTKRIAYDERRKTNQVKTGMQRPPNPHKP  337


 Score =   123 bits (309),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 72/148 (49%), Positives = 102/148 (69%), Gaps = 2/148 (1%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKNM  373
            ME NKDEA +A ++AEKK+  ND+ GA+K   KAQ LYP+L+ + Q+L + +V+ SA   
Sbjct  1    MEWNKDEARRAMDVAEKKLSINDYFGAKKFVNKAQNLYPELDGLKQVLTMIHVYISASKK  60

Query  374  LGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSDQ  553
               + DWY +L VD  AD+  +KKQY+KLAL+LHPDKNK  GAE AFKL+ EA  +LSD+
Sbjct  61   TKGEADWYRVLGVDPLADDEAVKKQYKKLALLLHPDKNKCKGAEEAFKLVSEAWCVLSDK  120

Query  554  TKRSIYDSKCRVSIRSTSMRPPPHQVNP  637
             +R++YD K +   ++  M+ P +  NP
Sbjct  121  ARRNVYDQKRKS--KTGMMQKPQNPRNP  146



>ref|XP_002451004.1| hypothetical protein SORBIDRAFT_05g022450 [Sorghum bicolor]
 gb|EES09992.1| hypothetical protein SORBIDRAFT_05g022450 [Sorghum bicolor]
Length=974

 Score =   140 bits (354),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 73/135 (54%), Positives = 97/135 (72%), Gaps = 0/135 (0%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKNM  373
            MECN++E L+A  +A  K++  DF GAQ++A KAQRLYP+LEN+ QLLAVC VHC+A+  
Sbjct  1    MECNREEGLRAGRIALTKLKKKDFRGAQRIALKAQRLYPELENLCQLLAVCEVHCAAEIE  60

Query  374  LGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSDQ  553
            +  D DWYGILQV+ +A++  I KQY KL+ +LHPDKN  PGAEAAFKL+  A+ +L D 
Sbjct  61   INGDLDWYGILQVEATANDEVITKQYCKLSYLLHPDKNTLPGAEAAFKLVCIAHKILCDH  120

Query  554  TKRSIYDSKCRVSIR  598
                +YD K +   R
Sbjct  121  MMHFLYDIKTQHVFR  135



>ref|XP_010546913.1| PREDICTED: uncharacterized protein LOC104818838 [Tarenaya hassleriana]
Length=965

 Score =   140 bits (354),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 77/137 (56%), Positives = 103/137 (75%), Gaps = 1/137 (1%)
 Frame = +2

Query  191  LMECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVH-CSAK  367
            +M  N+DEAL+AKE+AE  M+  DF GA+++  +AQ+L  +LENI+ ++ VC+VH  +A+
Sbjct  1    MMNINRDEALRAKEIAEGLMKKADFTGARRLVVRAQKLDSNLENISHMMMVCDVHSAAAE  60

Query  368  NMLGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLS  547
             + G + DWYGILQVD+ AD+V IKKQ +KLA +LHPDKNK PGAEAAFKLI EA  +L 
Sbjct  61   KVFGNEMDWYGILQVDQKADDVAIKKQVKKLAFLLHPDKNKLPGAEAAFKLIAEAQRILL  120

Query  548  DQTKRSIYDSKCRVSIR  598
            D+ KRS+YD K R   R
Sbjct  121  DRDKRSLYDMKRRTGSR  137



>dbj|BAJ87377.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=762

 Score =   139 bits (351),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 74/134 (55%), Positives = 104/134 (78%), Gaps = 0/134 (0%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKNM  373
            MECNKDEAL+AK++AE+K ++ D +GA+K A KA+ L+PDLE I Q++   +V+ +++  
Sbjct  1    MECNKDEALRAKQIAERKFESKDLQGAKKFALKAKSLFPDLEGIMQMIITLDVYLTSELK  60

Query  374  LGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSDQ  553
            +  D+DWY IL VD SAD+ T++KQYRKLAL+LHPDKNK  GAE AF+L+ EA  +LSD+
Sbjct  61   VAGDRDWYSILSVDTSADDETVRKQYRKLALLLHPDKNKSVGAEGAFQLVKEAWTVLSDK  120

Query  554  TKRSIYDSKCRVSI  595
            TKR +YD K +V +
Sbjct  121  TKRLLYDQKRKVVV  134



>ref|XP_010438758.1| PREDICTED: uncharacterized protein LOC104722282 [Camelina sativa]
Length=670

 Score =   139 bits (349),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 73/132 (55%), Positives = 105/132 (80%), Gaps = 1/132 (1%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSA-KN  370
            M  N+DEAL+AK+LAE  M+  DF  A+K+A KAQ++   L+NI++++ VC+VHC+A + 
Sbjct  1    MSINRDEALRAKDLAEGLMKKTDFTAARKLALKAQKMDASLDNISRMIMVCDVHCAATEK  60

Query  371  MLGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSD  550
            + G + DWYGILQV+++AD+V +KKQY++LAL+LHPDKNK PGAE+AFKLIG+A  +L D
Sbjct  61   LFGTEMDWYGILQVEQNADDVILKKQYKRLALLLHPDKNKLPGAESAFKLIGDAQRILLD  120

Query  551  QTKRSIYDSKCR  586
            + KR ++D K R
Sbjct  121  KEKRKLHDVKRR  132



>ref|XP_010250691.1| PREDICTED: uncharacterized protein LOC104592869 [Nelumbo nucifera]
Length=834

 Score =   140 bits (352),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 83/143 (58%), Positives = 100/143 (70%), Gaps = 1/143 (1%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKNM  373
            MECNKDEA +AKE+AEKK    D  GA+K A KAQ LYP L+ + Q+LA  +V+ SA N 
Sbjct  1    MECNKDEATRAKEIAEKKFSAKDIAGARKFALKAQNLYPTLDGLPQMLATLDVYISAANK  60

Query  374  LGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSDQ  553
            +  + DWYGIL VD  AD+ T+KKQYRKLAL+LHPDKNK  GA+ AFK I EA  LLSD+
Sbjct  61   INGEADWYGILGVDPLADDETVKKQYRKLALMLHPDKNKSIGADGAFKFISEAWSLLSDK  120

Query  554  TKRSIYDSKCRVSIRSTSMRPPP  622
            TKR+ YD + R S       PPP
Sbjct  121  TKRTAYDQR-RNSKGFQQKNPPP  142



>ref|XP_003523381.2| PREDICTED: uncharacterized protein LOC100818585 isoform X1 [Glycine 
max]
 ref|XP_006578927.1| PREDICTED: uncharacterized protein LOC100818585 isoform X2 [Glycine 
max]
Length=692

 Score =   139 bits (349),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 77/130 (59%), Positives = 98/130 (75%), Gaps = 0/130 (0%)
 Frame = +2

Query  191  LMECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKN  370
            +MECNKDEA++AKE+AE+K    ++ GA+K A KAQ LYP+LE+I QLL   +++ SA+N
Sbjct  1    MMECNKDEAVRAKEIAERKFSEREYVGAKKFALKAQNLYPELEDITQLLTTIDIYTSAEN  60

Query  371  MLGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSD  550
             +  + DWYGIL V   ADE T++KQYRKLAL LHPDKNK  GAE AFKL+ EA  LLSD
Sbjct  61   KVSGEMDWYGILGVSPFADEETVRKQYRKLALTLHPDKNKSLGAEGAFKLVSEAWSLLSD  120

Query  551  QTKRSIYDSK  580
            +TKR  Y+ K
Sbjct  121  KTKRLEYNQK  130



>ref|XP_008679574.1| PREDICTED: uncharacterized protein LOC103654523 [Zea mays]
 gb|AFW65296.1| hypothetical protein ZEAMMB73_238378 [Zea mays]
Length=1069

 Score =   140 bits (352),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 74/130 (57%), Positives = 102/130 (78%), Gaps = 0/130 (0%)
 Frame = +2

Query  191  LMECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKN  370
            ++ CN+++AL+A+E+A KK+++ DF GAQK   KAQ+L+P+LEN++QLL +C+VHC+A+ 
Sbjct  1    MISCNREQALRAREIALKKIESKDFFGAQKTVLKAQKLFPELENVSQLLTICSVHCAAEL  60

Query  371  MLGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSD  550
             +  + D+YG+LQV+  ADE  IKKQYRKLA+ LHPDKN F GAEAAFKLI EA  +L D
Sbjct  61   RVNGEMDFYGVLQVEEGADEALIKKQYRKLAVSLHPDKNCFVGAEAAFKLIAEAYSVLCD  120

Query  551  QTKRSIYDSK  580
              KR+ YD K
Sbjct  121  PAKRNDYDLK  130



>ref|XP_010418015.1| PREDICTED: uncharacterized protein LOC104703654 [Camelina sativa]
Length=425

 Score =   136 bits (343),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 71/130 (55%), Positives = 89/130 (68%), Gaps = 7/130 (5%)
 Frame = +2

Query  248  MQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKNML-GLDKDWYGILQVDRSA  424
            M   DF GA     KAQ L+P+L +I  ++A+C+VH SA N + GLD +WYGILQV R A
Sbjct  20   MMAGDFVGAHTFVTKAQTLFPNLIHIPHMMAICDVHSSAHNKINGLD-NWYGILQVHRLA  78

Query  425  DEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSDQTKRSIYD-----SKCRV  589
            D  TIKKQY+ L L+LHPDKNK  GAEAAFKL+GEAN +LSDQ +R +YD     S+ R 
Sbjct  79   DADTIKKQYKNLTLLLHPDKNKLAGAEAAFKLVGEANGILSDQMRRLLYDAQLTLSRVRS  138

Query  590  SIRSTSMRPP  619
            +I +    PP
Sbjct  139  NIANVGGVPP  148



>ref|XP_009768352.1| PREDICTED: uncharacterized protein LOC104219370 [Nicotiana sylvestris]
Length=740

 Score =   139 bits (349),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 78/144 (54%), Positives = 101/144 (70%), Gaps = 2/144 (1%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKNM  373
            MECNKDEA++AK +AE+K +  DF GA+K   KAQ LYP L+ + Q+L   +V+ SA+N 
Sbjct  1    MECNKDEAVRAKTIAERKFEQKDFAGAKKFVLKAQALYPGLDGVTQMLTTLDVYISAENK  60

Query  374  LGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSDQ  553
            +  + DWYGIL V  SAD+ T++KQYRKLAL+LHPDKNK  GAE AFKL+ EA  LLSD+
Sbjct  61   ISGEVDWYGILGVGPSADDETVRKQYRKLALILHPDKNKSVGAEGAFKLLSEAWSLLSDK  120

Query  554  TKRSIYDSKCRVSIRSTSMRPPPH  625
            +KR  Y+   R S R    + P H
Sbjct  121  SKRLAYNQ--RRSSRGFQQKAPVH  142



>ref|XP_009372266.1| PREDICTED: uncharacterized protein LOC103961447 [Pyrus x bretschneideri]
Length=745

 Score =   139 bits (349),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 81/147 (55%), Positives = 102/147 (69%), Gaps = 4/147 (3%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKNM  373
            MECNKDEA +AKE+AE+K    D  GA+K A KAQ L+P LE + Q+LA  +VH +A+N 
Sbjct  1    MECNKDEAARAKEIAERKFTAKDLMGAKKFALKAQNLFPGLEGMPQMLATLDVHIAAENK  60

Query  374  LGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSDQ  553
            +  + DWYGIL  D  AD+  ++KQYRKLAL+LHPDKNK  GA+ AFKL+ EA  LLSD+
Sbjct  61   INGEADWYGILGADPKADDEAVRKQYRKLALMLHPDKNKSIGADGAFKLLSEAWSLLSDK  120

Query  554  TKRSIYDSKCRVSIR----STSMRPPP  622
            +KR  YD K RV  R    S S + PP
Sbjct  121  SKRVAYDQKRRVHQRVATASGSSQAPP  147



>ref|XP_006581632.1| PREDICTED: uncharacterized protein LOC100814722 isoform X2 [Glycine 
max]
 ref|XP_003526697.2| PREDICTED: uncharacterized protein LOC100814722 isoform X1 [Glycine 
max]
 gb|KHN23387.1| DnaJ like subfamily B member 14 [Glycine soja]
Length=692

 Score =   138 bits (347),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 77/130 (59%), Positives = 98/130 (75%), Gaps = 0/130 (0%)
 Frame = +2

Query  191  LMECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKN  370
            +MECNKDEA++AKE+AE+K    ++ GA+K A KAQ LYP+LE+I QLL   +++ SA+N
Sbjct  1    MMECNKDEAVRAKEIAERKFSEREYVGAKKFALKAQNLYPELEDITQLLTTIDIYISAEN  60

Query  371  MLGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSD  550
             +  + DWYGIL V   ADE T++KQYRKLAL LHPDKNK  GAE AFKL+ EA  LLSD
Sbjct  61   KVSGEMDWYGILGVSPFADEETVRKQYRKLALTLHPDKNKSLGAEGAFKLVSEAWSLLSD  120

Query  551  QTKRSIYDSK  580
            +TKR  Y+ K
Sbjct  121  KTKRLEYNQK  130



>ref|XP_010449331.1| PREDICTED: dnaJ homolog subfamily B member 14-like [Camelina 
sativa]
Length=281

 Score =   133 bits (334),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 71/129 (55%), Positives = 97/129 (75%), Gaps = 0/129 (0%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKNM  373
            MECNK+EA +A ++AEKK+  ND++GA+K   KA+RLYP LE + Q+L   +V+ SA + 
Sbjct  1    MECNKEEARRAIDIAEKKISANDYDGAKKFVNKAERLYPQLEGLKQVLMTIDVYISASDK  60

Query  374  LGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSDQ  553
            +  + DWYG+L VD  AD+  +KK+Y+KLAL+LHPDKN+F GAE AFKL+ +A  LLSD+
Sbjct  61   INGESDWYGVLGVDPLADDEAVKKRYKKLALLLHPDKNRFNGAEGAFKLVLQACDLLSDK  120

Query  554  TKRSIYDSK  580
             KRS YD K
Sbjct  121  IKRSAYDQK  129



>ref|NP_198076.1| DNAJ heat shock N-terminal domain-containing protein [Arabidopsis 
thaliana]
 gb|AED93662.1| DNAJ heat shock N-terminal domain-containing protein [Arabidopsis 
thaliana]
Length=1104

 Score =   139 bits (351),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 78/135 (58%), Positives = 103/135 (76%), Gaps = 0/135 (0%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKNM  373
            M+ NK+EA +AK LAE KM+  DF GAQK+  KAQ L+  LE++ Q+LAVC+VH SA+  
Sbjct  1    MDWNKEEACRAKTLAEDKMKEGDFVGAQKLLLKAQSLFSGLESLPQMLAVCDVHNSAEKK  60

Query  374  LGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSDQ  553
            +   ++WYGILQV   AD+ TIKKQ RKLAL+LHPDKN+FPGAEAAFKL+ +A+  L+D+
Sbjct  61   INCLENWYGILQVMHFADDATIKKQVRKLALLLHPDKNQFPGAEAAFKLVWDASRFLADK  120

Query  554  TKRSIYDSKCRVSIR  598
             KRS YD + R+ +R
Sbjct  121  DKRSQYDIRRRIYLR  135



>gb|KHN44226.1| DnaJ like subfamily B member 12 [Glycine soja]
Length=691

 Score =   138 bits (347),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 77/129 (60%), Positives = 97/129 (75%), Gaps = 0/129 (0%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKNM  373
            MECNKDEA++AKE+AE+K    ++ GA+K A KAQ LYP+LE+I QLL   +++ SA+N 
Sbjct  1    MECNKDEAVRAKEIAERKFSEREYVGAKKFALKAQNLYPELEDITQLLTTIDIYTSAENK  60

Query  374  LGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSDQ  553
            +  + DWYGIL V   ADE T++KQYRKLAL LHPDKNK  GAE AFKL+ EA  LLSD+
Sbjct  61   VSGEMDWYGILGVSPFADEETVRKQYRKLALTLHPDKNKSLGAEGAFKLVSEAWSLLSDK  120

Query  554  TKRSIYDSK  580
            TKR  Y+ K
Sbjct  121  TKRLEYNQK  129



>gb|AAB61072.1| contains similarity to a DNAJ-like domain [Arabidopsis thaliana]
Length=1609

 Score =   140 bits (352),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 78/135 (58%), Positives = 103/135 (76%), Gaps = 0/135 (0%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKNM  373
            M+ NK+EA +AK LAE KM+  DF GAQK+  KAQ L+  LE++ Q+LAVC+VH SA+  
Sbjct  1    MDWNKEEACRAKTLAEDKMKEGDFVGAQKLLLKAQSLFSGLESLPQMLAVCDVHNSAEKK  60

Query  374  LGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSDQ  553
            +   ++WYGILQV   AD+ TIKKQ RKLAL+LHPDKN+FPGAEAAFKL+ +A+  L+D+
Sbjct  61   INCLENWYGILQVMHFADDATIKKQVRKLALLLHPDKNQFPGAEAAFKLVWDASRFLADK  120

Query  554  TKRSIYDSKCRVSIR  598
             KRS YD + R+ +R
Sbjct  121  DKRSQYDIRRRIYLR  135



>gb|EYU23088.1| hypothetical protein MIMGU_mgv11b011132mg [Erythranthe guttata]
Length=222

 Score =   131 bits (329),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 71/154 (46%), Positives = 107/154 (69%), Gaps = 8/154 (5%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKNM  373
            MECNKDEA +AK +AEKK+   D +GA+K A+KAQR++P L+ ++Q LA+ +V+ + +N 
Sbjct  1    MECNKDEAFRAKAIAEKKLIRGDIKGAKKFASKAQRMFPKLDGLSQFLAIIDVYVAHENK  60

Query  374  LGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSDQ  553
            +    D+YGI  +DR ADE T+KKQY+++AL LHPDKN+  GA+ AFK++ EA  +LSD+
Sbjct  61   INGHSDYYGIFGLDRFADEQTLKKQYKRMALSLHPDKNRAVGADGAFKIMSEAWCVLSDK  120

Query  554  TKRSIYDSKCRV--------SIRSTSMRPPPHQV  631
             KRS Y+SK  +        ++++ S+R    Q 
Sbjct  121  GKRSAYNSKLEIKASKQTTYTVKTQSVRRTQRQT  154



>emb|CDX99360.1| BnaC01g11920D [Brassica napus]
Length=333

 Score =   134 bits (336),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 77/148 (52%), Positives = 105/148 (71%), Gaps = 5/148 (3%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKNM  373
            MECNKDEA++A ++A++K+  ND+ GA+  A KAQ LYP+L+ + Q+L + +V+ SA N 
Sbjct  1    MECNKDEAIRAMDIAKRKVTENDYTGAKTFAVKAQNLYPELDGLKQVLMLIDVYISAGNK  60

Query  374  L-GLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSD  550
            + G + DWYG+L VD  AD+  +KKQYRKLAL+LHPDKNK  GAE AFKLI EA  LLSD
Sbjct  61   INGGEPDWYGVLGVDPLADDGVVKKQYRKLALLLHPDKNKCEGAEGAFKLILEAWSLLSD  120

Query  551  QTKRSIYDSKCRVSIRSTSMRPPPHQVN  634
            + KR  +D K RV +    ++ P  + N
Sbjct  121  KVKRIAFDQKRRVVM----VKEPKQEAN  144



>ref|XP_009420330.1| PREDICTED: uncharacterized protein LOC104000107 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009420331.1| PREDICTED: uncharacterized protein LOC104000107 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009420332.1| PREDICTED: uncharacterized protein LOC104000107 [Musa acuminata 
subsp. malaccensis]
Length=768

 Score =   138 bits (347),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 77/142 (54%), Positives = 102/142 (72%), Gaps = 0/142 (0%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKNM  373
            M+CNKDEA++AKE+AE+K    D EGA+K A KAQ L+P LE I Q++A  +VH +++  
Sbjct  1    MDCNKDEAVRAKEIAERKFSERDLEGARKFAMKAQNLFPALEGIGQMIATLDVHVASEEK  60

Query  374  LGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSDQ  553
            +  +KDWY IL V  SADE T+KKQYRKLAL LHPDKNK  GAE AF+LI EA  +LSD+
Sbjct  61   VYGEKDWYAILSVSASADEDTVKKQYRKLALQLHPDKNKSVGAEGAFQLISEAWSVLSDK  120

Query  554  TKRSIYDSKCRVSIRSTSMRPP  619
            ++R++YD K  + + S     P
Sbjct  121  SRRTLYDQKRCIKVFSQKTSRP  142



>ref|XP_010445273.1| PREDICTED: polycystic kidney disease protein 1-like 3 [Camelina 
sativa]
Length=550

 Score =   136 bits (342),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 75/146 (51%), Positives = 104/146 (71%), Gaps = 0/146 (0%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKNM  373
            MECNKDEA +A ++AEK++   D+ GA+K A KAQ LYP+L+ + Q+L + +V+ SA N 
Sbjct  1    MECNKDEARRAMDIAEKRVSEKDYNGAKKFANKAQVLYPNLDGLQQVLMMIDVYISATNK  60

Query  374  LGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSDQ  553
            +  + D YG+L VD  AD+  +K+QY+KLAL+LHPDKNKF GAE AFKL+ +A  LLSD+
Sbjct  61   INGEADLYGVLGVDPLADDGAVKRQYKKLALLLHPDKNKFKGAEGAFKLVSQAWCLLSDK  120

Query  554  TKRSIYDSKCRVSIRSTSMRPPPHQV  631
             KRS YD K +    +T M+ PP+  
Sbjct  121  VKRSGYDQKRKSKDANTGMQKPPNTT  146



>ref|XP_011076021.1| PREDICTED: meiotically up-regulated gene 184 protein [Sesamum 
indicum]
Length=744

 Score =   137 bits (346),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 74/129 (57%), Positives = 97/129 (75%), Gaps = 0/129 (0%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKNM  373
            MECNKDEAL++K +AE K++  DF GA+K A KAQ LYP L+ I+Q+L   +V+ SA+N 
Sbjct  1    MECNKDEALRSKSIAESKLEKKDFAGAKKFALKAQALYPGLDGISQMLTTVDVYVSAENK  60

Query  374  LGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSDQ  553
            +  + DWYG+L V  SAD+ TI+KQYRKLAL+LHPDKNK  G++ AFKLI EA  LLSD+
Sbjct  61   ISGEIDWYGVLGVSPSADDETIRKQYRKLALMLHPDKNKSVGSDGAFKLISEAWSLLSDK  120

Query  554  TKRSIYDSK  580
             KR  Y+ +
Sbjct  121  AKRLAYNQR  129



>gb|KEH43064.1| chaperone DnaJ-domain protein [Medicago truncatula]
Length=308

 Score =   133 bits (334),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 75/119 (63%), Positives = 91/119 (76%), Gaps = 1/119 (1%)
 Frame = +2

Query  182  LVLLMECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCS  361
            +VLLMECNKDEA++A++LAE +MQ  +F  A K A KA+ +Y D+ENI Q+L VC VH +
Sbjct  47   IVLLMECNKDEAVRARQLAESRMQRGEFVEALKFANKAKTMYADVENIAQILTVCEVHNA  106

Query  362  AKNMLG-LDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEAN  535
            A N L   D DWYGILQ +  ++E  IKKQYRKL L+LH DKNKF GAEAAFKLIGEAN
Sbjct  107  ALNKLSKSDMDWYGILQTESLSEEAIIKKQYRKLGLLLHLDKNKFTGAEAAFKLIGEAN  165



>ref|XP_009629029.1| PREDICTED: uncharacterized protein LOC104119282 [Nicotiana tomentosiformis]
 ref|XP_009629030.1| PREDICTED: uncharacterized protein LOC104119282 [Nicotiana tomentosiformis]
Length=740

 Score =   137 bits (346),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 77/144 (53%), Positives = 101/144 (70%), Gaps = 2/144 (1%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKNM  373
            MECNKDEA++AK +AE+K +  DF GA+K   KAQ LYP L+ + Q+L   +V+ SA+N 
Sbjct  1    MECNKDEAVRAKAIAERKFEQKDFAGAKKFVLKAQALYPGLDGVTQMLTTLDVYISAENK  60

Query  374  LGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSDQ  553
            +  + DWYG+L V  SAD+ T++KQYRKLAL+LHPDKNK  GAE AFKL+ EA  LLSD+
Sbjct  61   ISGEVDWYGVLGVGPSADDETVRKQYRKLALILHPDKNKSVGAEGAFKLLSEAWSLLSDK  120

Query  554  TKRSIYDSKCRVSIRSTSMRPPPH  625
            +KR  Y+   R S R    + P H
Sbjct  121  SKRLAYNQ--RRSSRGFQQKVPVH  142



>ref|XP_002438833.1| hypothetical protein SORBIDRAFT_10g026860 [Sorghum bicolor]
 gb|EER90200.1| hypothetical protein SORBIDRAFT_10g026860 [Sorghum bicolor]
Length=938

 Score =   138 bits (347),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 71/135 (53%), Positives = 102/135 (76%), Gaps = 0/135 (0%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKNM  373
            MECN++EALKA ++A KK++N DF GA+++A KAQR++P+ ENI QLL VC VHC+A+  
Sbjct  1    MECNREEALKAMKIAAKKLENRDFAGAKRIALKAQRIFPEAENIPQLLTVCEVHCAAEAK  60

Query  374  LGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSDQ  553
            +    D+YGILQV+ +ADE+ I+KQ+ KL L+L PDKN +P A++A K + EA   L+DQ
Sbjct  61   VNGILDFYGILQVEGTADEMAIRKQFCKLVLLLDPDKNSYPSADSALKFVAEAYSTLADQ  120

Query  554  TKRSIYDSKCRVSIR  598
            T+R +YD K  V+ +
Sbjct  121  TRRYVYDVKWSVAFK  135



>gb|KJB37328.1| hypothetical protein B456_006G200900 [Gossypium raimondii]
 gb|KJB37329.1| hypothetical protein B456_006G200900 [Gossypium raimondii]
 gb|KJB37330.1| hypothetical protein B456_006G200900 [Gossypium raimondii]
Length=691

 Score =   137 bits (344),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 76/140 (54%), Positives = 101/140 (72%), Gaps = 2/140 (1%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKNM  373
            MECNKDEA +AKE+AE+K++  DF GA+K A KAQ LYP L+ I Q+L + +V+ SA+N 
Sbjct  1    MECNKDEAFRAKEIAERKVREKDFAGAKKFAMKAQNLYPGLDGITQMLTILDVYISAENK  60

Query  374  LGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSDQ  553
               + DWYG+L V   AD+  ++KQYRKLAL+LHPDKNK  GA+ AFKL+ EA  LLSDQ
Sbjct  61   ASGEADWYGVLGVTAYADDEVVRKQYRKLALMLHPDKNKLVGADGAFKLVSEAWSLLSDQ  120

Query  554  TKRSIYDSKCRVSIRSTSMR  613
             KR  Y+   R+++R T  +
Sbjct  121  AKRLAYNQ--RINLRGTQQK  138



>ref|XP_010066413.1| PREDICTED: uncharacterized protein LOC104453528 [Eucalyptus grandis]
 ref|XP_010066414.1| PREDICTED: uncharacterized protein LOC104453528 [Eucalyptus grandis]
 ref|XP_010066415.1| PREDICTED: uncharacterized protein LOC104453528 [Eucalyptus grandis]
 ref|XP_010066416.1| PREDICTED: uncharacterized protein LOC104453528 [Eucalyptus grandis]
 ref|XP_010066417.1| PREDICTED: uncharacterized protein LOC104453528 [Eucalyptus grandis]
 gb|KCW64300.1| hypothetical protein EUGRSUZ_G01935 [Eucalyptus grandis]
Length=781

 Score =   137 bits (344),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 76/129 (59%), Positives = 94/129 (73%), Gaps = 0/129 (0%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKNM  373
            MECNKDEA +AKE+AE K    D  GA+K A KA  LYP LE + Q+LA  +V+ SA+N 
Sbjct  1    MECNKDEATRAKEIAETKFIARDMAGAKKFALKAHSLYPGLEGMTQMLATLDVYVSAENK  60

Query  374  LGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSDQ  553
            +  + DWYG+L VD +ADE T+++QYRKLAL+LHPDKNK  GAE AFKLI +A  LLSD+
Sbjct  61   VNGEPDWYGVLGVDPAADEETVRRQYRKLALMLHPDKNKSIGAEGAFKLISQAWSLLSDK  120

Query  554  TKRSIYDSK  580
             KR  YD K
Sbjct  121  VKRVGYDQK  129



>ref|XP_009129660.1| PREDICTED: dnaJ homolog subfamily C member 21 [Brassica rapa]
Length=653

 Score =   135 bits (341),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 81/149 (54%), Positives = 103/149 (69%), Gaps = 3/149 (2%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSA--K  367
            M  N+DEAL+A+ LAE  MQ +DF  A+K+A KA  +   LENI+ +  VC+VHC+A  K
Sbjct  1    MNINRDEALRAQALAEALMQKSDFTAARKLAIKAHSMDSTLENISHMTMVCDVHCTATEK  60

Query  368  NMLGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLS  547
             +   + DWYGILQVD +A+E  IKKQYRKLAL+LHPDKNK PGAE+AFKLIGEA  +L 
Sbjct  61   TLGNNEMDWYGILQVDVNANEAVIKKQYRKLALLLHPDKNKLPGAESAFKLIGEAQRILL  120

Query  548  DQTKRSIYDSKCRVSIRSTSMRPPPHQVN  634
            D+  R ++D K R    + S RP    VN
Sbjct  121  DKDMRMLHDVKRRTRP-APSYRPQQASVN  148



>gb|KHG05919.1| DnaJ subfamily B member 14 [Gossypium arboreum]
Length=690

 Score =   136 bits (342),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 75/140 (54%), Positives = 102/140 (73%), Gaps = 2/140 (1%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKNM  373
            MECNKDEA +AKE+AE+K++  DF GA+K A KAQ LYP L+ I Q+L + +V+ SA+  
Sbjct  1    MECNKDEAYRAKEIAERKVREKDFAGAKKFAMKAQNLYPGLDGITQMLTILDVYISAEKK  60

Query  374  LGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSDQ  553
            +  + DWYG+L V  SAD+  +++QYRKLAL+LHPDKNK  GA+ AFKL+ EA  LLSDQ
Sbjct  61   VSGEADWYGVLGVTPSADDEVVRRQYRKLALMLHPDKNKLVGADGAFKLVSEAWSLLSDQ  120

Query  554  TKRSIYDSKCRVSIRSTSMR  613
             KR  Y+   R+++R T  +
Sbjct  121  AKRLAYNQ--RINLRETQQK  138



>ref|XP_010434386.1| PREDICTED: J domain-containing protein DDB_G0295729-like isoform 
X2 [Camelina sativa]
Length=353

 Score =   133 bits (334),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 75/130 (58%), Positives = 99/130 (76%), Gaps = 1/130 (1%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKN-  370
            MECNK+EA+KA ++A+KK+  ND+ GA+K+AAKAQ LYP L+ + Q++ + +V+ SA N 
Sbjct  1    MECNKEEAIKAMDIAKKKVAENDYNGAKKLAAKAQNLYPKLDGLKQVMMLIDVYISAGNK  60

Query  371  MLGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSD  550
            ++G D DWYGIL VD  ADE  +KKQY++LAL+LHPDKNK  GAE AFKL+  A  LLSD
Sbjct  61   IIGGDLDWYGILGVDPLADEEVVKKQYKRLALLLHPDKNKCEGAEGAFKLVLAAWCLLSD  120

Query  551  QTKRSIYDSK  580
            + KR  YD K
Sbjct  121  KVKRIAYDQK  130



>ref|XP_010249039.1| PREDICTED: uncharacterized protein LOC104591743 [Nelumbo nucifera]
Length=837

 Score =   137 bits (344),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 83/148 (56%), Positives = 102/148 (69%), Gaps = 1/148 (1%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKNM  373
            MECNKDEA +AKE+AE+K    D  GA+K A KAQ LYP L+ + Q+LA  +V+ SA+N 
Sbjct  1    MECNKDEATRAKEIAERKFTAKDIAGAKKFALKAQNLYPGLDGLPQMLATLDVYISAENK  60

Query  374  LGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSDQ  553
            +  + DWYGIL V+  AD+ T+KKQYRKLAL+LHPDKNK  GA+ AFKLI EA  LLSD+
Sbjct  61   ISGEADWYGILGVNPLADDETVKKQYRKLALMLHPDKNKSVGADGAFKLISEAWSLLSDK  120

Query  554  TKRSIYDSKCRVSIRSTSMRPPPHQVNP  637
             KR+ YD K R S       PP   V P
Sbjct  121  AKRTAYDQK-RNSKGFQQKVPPSGGVPP  147



>ref|XP_010434385.1| PREDICTED: J domain-containing protein DDB_G0295729-like isoform 
X1 [Camelina sativa]
Length=354

 Score =   133 bits (334),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 75/130 (58%), Positives = 99/130 (76%), Gaps = 1/130 (1%)
 Frame = +2

Query  194  MECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKN-  370
            MECNK+EA+KA ++A+KK+  ND+ GA+K+AAKAQ LYP L+ + Q++ + +V+ SA N 
Sbjct  1    MECNKEEAIKAMDIAKKKVAENDYNGAKKLAAKAQNLYPKLDGLKQVMMLIDVYISAGNK  60

Query  371  MLGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSD  550
            ++G D DWYGIL VD  ADE  +KKQY++LAL+LHPDKNK  GAE AFKL+  A  LLSD
Sbjct  61   IIGGDLDWYGILGVDPLADEEVVKKQYKRLALLLHPDKNKCEGAEGAFKLVLAAWCLLSD  120

Query  551  QTKRSIYDSK  580
            + KR  YD K
Sbjct  121  KVKRIAYDQK  130



>ref|XP_004502621.1| PREDICTED: uncharacterized protein LOC101501612 isoform X1 [Cicer 
arietinum]
 ref|XP_004502622.1| PREDICTED: uncharacterized protein LOC101501612 isoform X2 [Cicer 
arietinum]
 ref|XP_004502623.1| PREDICTED: uncharacterized protein LOC101501612 isoform X3 [Cicer 
arietinum]
Length=715

 Score =   136 bits (342),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 76/133 (57%), Positives = 98/133 (74%), Gaps = 0/133 (0%)
 Frame = +2

Query  191  LMECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKN  370
            +MECNKDEA++AKE+AE+K    ++ GA+K A KAQ LYPDLE+I+Q L   +++ SA+N
Sbjct  1    MMECNKDEAVRAKEIAERKFSEREYIGAKKFALKAQNLYPDLEDISQFLTTIDIYISAEN  60

Query  371  MLGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSD  550
             +  + DWYGIL V   ADE  +++QYRKLAL LHPDKNK  GAE AFKL+ EA  LLSD
Sbjct  61   KVSGEMDWYGILGVSPFADEEIVRRQYRKLALTLHPDKNKALGAEGAFKLVSEAWSLLSD  120

Query  551  QTKRSIYDSKCRV  589
            +TKR  Y+ K  V
Sbjct  121  KTKRLEYNQKRSV  133



>emb|CDY05255.1| BnaC05g45480D [Brassica napus]
Length=662

 Score =   135 bits (341),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 79/148 (53%), Positives = 102/148 (69%), Gaps = 9/148 (6%)
 Frame = +2

Query  185  VLLMECNKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSA  364
            +++M  N+DEAL+A+ LAE  MQ ++F  A+K+A KA  +   LENI+ +  VC VHC+A
Sbjct  62   LVVMNINRDEALRAQALAEALMQKSNFTAARKLAIKAHSMDSTLENISHMTMVCEVHCAA  121

Query  365  --KNMLGLDKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANV  538
              K     + DWYGILQVD +AD+  IKKQYRKLAL+LHPDKNK PGAE+AFKLIGEA  
Sbjct  122  TEKTFGNNEMDWYGILQVDVNADDAIIKKQYRKLALLLHPDKNKLPGAESAFKLIGEAQR  181

Query  539  LLSDQTKRSIYDSKCRVSIRSTSMRPPP  622
            +L D+ KR ++D K R        RP P
Sbjct  182  MLLDKEKRMLHDVKRRT-------RPAP  202



>emb|CDY13919.1| BnaC09g39070D [Brassica napus]
Length=472

 Score =   134 bits (337),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 78/145 (54%), Positives = 99/145 (68%), Gaps = 0/145 (0%)
 Frame = +2

Query  203  NKDealkakelaekkMQNNDFEGAQKVAAKAQRLYPDLENINQLLAVCNVHCSAKNMLGL  382
            NKDEAL+AK LAE  M  +DF  A++VA KAQ++   LENI  ++ VC+VHC+A+   G 
Sbjct  3    NKDEALRAKGLAEDWMSKSDFPTARRVAVKAQKMDETLENIAHMIMVCDVHCAAQEKSGD  62

Query  383  DKDWYGILQVDRSADEVTIKKQYRKLALVLHPDKNKFPGAEAAFKLIGEANVLLSDQTKR  562
            + DWY ILQV+ +AD+  IKKQYRK AL LHPDKNK PGAEAAFK+IGEA  +L D+ KR
Sbjct  63   ETDWYKILQVEYNADDNAIKKQYRKFALHLHPDKNKLPGAEAAFKMIGEAQRVLLDKDKR  122

Query  563  SIYDSKCRVSIRSTSMRPPPHQVNP  637
             ++D K +   R     P   Q  P
Sbjct  123  RVHDMKRKPFKRHAPGVPSYQQHAP  147



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 933768211125