BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF044P23

Length=745
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011102309.1|  PREDICTED: cyclin-A1-1                             163   4e-43   Sesamum indicum [beniseed]
ref|XP_009593177.1|  PREDICTED: cyclin-A1-4 isoform X1                  153   1e-39   Nicotiana tomentosiformis
ref|XP_010312445.1|  PREDICTED: cyclin A1 isoform X1                    153   1e-39   
dbj|BAE06271.1|  cyclin A                                               150   2e-38   Scutellaria baicalensis [Baikal skullcap]
emb|CAA63542.1|  cyclin A-like protein                                  149   4e-38   Nicotiana tabacum [American tobacco]
ref|NP_001233762.1|  cyclin A1                                          149   5e-38   Solanum lycopersicum
ref|XP_009593178.1|  PREDICTED: cyclin-A1-4 isoform X2                  149   5e-38   Nicotiana tomentosiformis
dbj|BAA09366.1|  A-type cyclin                                          149   5e-38   Nicotiana tabacum [American tobacco]
ref|XP_006351137.1|  PREDICTED: cyclin-A1-3-like isoform X2             146   5e-37   Solanum tuberosum [potatoes]
emb|CDP10969.1|  unnamed protein product                                146   7e-37   Coffea canephora [robusta coffee]
ref|XP_009796391.1|  PREDICTED: cyclin-A1-4                             143   5e-36   Nicotiana sylvestris
ref|XP_006351136.1|  PREDICTED: cyclin-A1-3-like isoform X1             142   1e-35   Solanum tuberosum [potatoes]
ref|XP_006351138.1|  PREDICTED: cyclin-A1-3-like isoform X3             142   1e-35   Solanum tuberosum [potatoes]
ref|XP_007225619.1|  hypothetical protein PRUPE_ppa004701mg             138   5e-34   Prunus persica
ref|XP_008219598.1|  PREDICTED: cyclin-A1-1-like                        132   7e-32   Prunus mume [ume]
ref|XP_010095430.1|  hypothetical protein L484_013387                   125   1e-29   Morus notabilis
ref|XP_002284567.1|  PREDICTED: cyclin-A1-1-like                        124   3e-29   Vitis vinifera
emb|CBI18982.3|  unnamed protein product                                124   5e-29   Vitis vinifera
ref|XP_004290902.1|  PREDICTED: cyclin-A1-1                             121   3e-28   Fragaria vesca subsp. vesca
ref|XP_007019157.1|  Cyclin A1,1 isoform 1                              119   1e-27   
ref|XP_002520329.1|  cyclin A, putative                                 116   1e-26   
gb|EYU32511.1|  hypothetical protein MIMGU_mgv1a005475mg                115   3e-26   Erythranthe guttata [common monkey flower]
ref|XP_006472826.1|  PREDICTED: cyclin-A1-1-like                        113   2e-25   Citrus sinensis [apfelsine]
ref|XP_006386358.1|  hypothetical protein POPTR_0002s08020g             112   7e-25   Populus trichocarpa [western balsam poplar]
ref|XP_008352624.1|  PREDICTED: cyclin-A1-1-like                        111   1e-24   
gb|KHG23907.1|  Cyclin-A1-1 -like protein                               110   2e-24   Gossypium arboreum [tree cotton]
ref|XP_011027470.1|  PREDICTED: cyclin-A1-1-like                        110   3e-24   Populus euphratica
ref|XP_007019158.1|  Cyclin A1,1 isoform 2                              109   4e-24   
ref|XP_011027473.1|  PREDICTED: cyclin-A1-1-like                        110   4e-24   Populus euphratica
ref|XP_011003420.1|  PREDICTED: cyclin-A1-1-like                        107   3e-23   Populus euphratica
gb|KDP32823.1|  hypothetical protein JCGZ_12115                         106   7e-23   Jatropha curcas
ref|XP_009343979.1|  PREDICTED: cyclin-A1-1-like                        105   1e-22   Pyrus x bretschneideri [bai li]
dbj|BAC56853.1|  cyclin A1                                              104   3e-22   Silene latifolia
ref|XP_006434258.1|  hypothetical protein CICLE_v10000927mg             104   5e-22   Citrus clementina [clementine]
ref|XP_002306649.1|  cyclin family protein                              103   6e-22   Populus trichocarpa [western balsam poplar]
gb|KHG05847.1|  Cyclin-A1-1 -like protein                               103   1e-21   Gossypium arboreum [tree cotton]
ref|XP_006393746.1|  hypothetical protein EUTSA_v10011442mg             102   1e-21   Eutrema salsugineum [saltwater cress]
ref|XP_010260855.1|  PREDICTED: cyclin-A1-4                             101   4e-21   Nelumbo nucifera [Indian lotus]
gb|KJB59298.1|  hypothetical protein B456_009G248300                    100   9e-21   Gossypium raimondii
ref|XP_010532201.1|  PREDICTED: cyclin-A1-1-like isoform X2             100   1e-20   Tarenaya hassleriana [spider flower]
ref|XP_010532200.1|  PREDICTED: cyclin-A1-1-like isoform X1             100   1e-20   Tarenaya hassleriana [spider flower]
gb|KJB80671.1|  hypothetical protein B456_013G109600                  97.8    3e-20   Gossypium raimondii
ref|XP_006434257.1|  hypothetical protein CICLE_v10003984mg           98.2    7e-20   
gb|KJB80669.1|  hypothetical protein B456_013G109600                  98.2    7e-20   Gossypium raimondii
ref|XP_006472824.1|  PREDICTED: cyclin-A1-1-like isoform X1           98.2    7e-20   
ref|XP_006472825.1|  PREDICTED: cyclin-A1-1-like isoform X2           98.2    8e-20   Citrus sinensis [apfelsine]
ref|XP_003526649.1|  PREDICTED: cyclin-A1-1-like                      97.8    8e-20   Glycine max [soybeans]
gb|AFK46051.1|  unknown                                               95.9    4e-19   Lotus japonicus
ref|XP_004149427.1|  PREDICTED: cyclin-A1-1-like                      95.9    4e-19   Cucumis sativus [cucumbers]
ref|XP_008338670.1|  PREDICTED: cyclin-A1-4                           95.9    5e-19   
ref|XP_009341345.1|  PREDICTED: cyclin-A1-4-like                      95.9    5e-19   Pyrus x bretschneideri [bai li]
gb|KDO80523.1|  hypothetical protein CISIN_1g017988mg                 93.6    8e-19   Citrus sinensis [apfelsine]
gb|KHN05188.1|  Cyclin-A1-1                                           94.4    2e-18   Glycine soja [wild soybean]
gb|KJB80670.1|  hypothetical protein B456_013G109600                  92.8    3e-18   Gossypium raimondii
ref|NP_001241939.1|  uncharacterized protein LOC100776207             93.6    3e-18   Glycine max [soybeans]
ref|XP_007019153.1|  Cyclin A1,1, putative                            93.2    3e-18   
gb|KEH35325.1|  carboxy-terminal domain cyclin                        92.0    4e-18   Medicago truncatula
gb|KJB64519.1|  hypothetical protein B456_010G052900                  91.7    4e-18   Gossypium raimondii
gb|KEH35324.1|  carboxy-terminal domain cyclin                        92.0    6e-18   Medicago truncatula
gb|KFK38207.1|  hypothetical protein AALP_AA3G082800                  91.3    8e-18   Arabis alpina [alpine rockcress]
gb|KJB64518.1|  hypothetical protein B456_010G052900                  91.7    1e-17   Gossypium raimondii
gb|KEH35323.1|  carboxy-terminal domain cyclin                        91.7    1e-17   Medicago truncatula
ref|XP_003630475.1|  Cyclin A-like protein                            91.7    1e-17   
ref|XP_004160710.1|  PREDICTED: cyclin-A1-1-like                      91.3    2e-17   
ref|XP_002893979.1|  CYCA1_1                                          90.5    2e-17   Arabidopsis lyrata subsp. lyrata
ref|XP_008219599.1|  PREDICTED: cyclin-A1-4-like                      90.9    2e-17   Prunus mume [ume]
gb|KFK24211.1|  hypothetical protein AALP_AAs42301U000600             89.4    5e-17   Arabis alpina [alpine rockcress]
ref|XP_004292715.1|  PREDICTED: cyclin-A1-4-like                      89.7    6e-17   Fragaria vesca subsp. vesca
ref|XP_010063417.1|  PREDICTED: cyclin-A1-1                           89.0    9e-17   
ref|XP_008352630.1|  PREDICTED: cyclin-A1-1-like                      85.9    1e-16   
ref|XP_010530202.1|  PREDICTED: cyclin-A1-1                           89.0    1e-16   Tarenaya hassleriana [spider flower]
ref|XP_009343978.1|  PREDICTED: cyclin-A1-1-like                      88.6    1e-16   Pyrus x bretschneideri [bai li]
ref|NP_001237800.1|  mitotic cyclin a2-type                           88.2    2e-16   Glycine max [soybeans]
ref|XP_003545652.1|  PREDICTED: cyclin-A1-1-like                      87.8    2e-16   Glycine max [soybeans]
ref|XP_010684698.1|  PREDICTED: cyclin-A1-4-like                      87.8    2e-16   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007137455.1|  hypothetical protein PHAVU_009G128200g           87.4    3e-16   Phaseolus vulgaris [French bean]
gb|KHN38997.1|  Cyclin-A1-1                                           87.0    4e-16   Glycine soja [wild soybean]
ref|XP_008466750.1|  PREDICTED: cyclin-A1-1                           86.7    7e-16   Cucumis melo [Oriental melon]
ref|XP_006307397.1|  hypothetical protein CARUB_v10009020mg           85.9    1e-15   Capsella rubella
emb|CDY36335.1|  BnaC08g05160D                                        85.5    1e-15   Brassica napus [oilseed rape]
ref|XP_010925928.1|  PREDICTED: cyclin-A1-4                           80.1    9e-14   Elaeis guineensis
gb|EPS73971.1|  hypothetical protein M569_00786                       78.2    1e-13   Genlisea aurea
ref|XP_010664179.1|  PREDICTED: cyclin-A1-1-like                      77.8    4e-13   
ref|XP_010461434.1|  PREDICTED: cyclin-A1-1-like                      76.6    1e-12   Camelina sativa [gold-of-pleasure]
ref|XP_008806186.1|  PREDICTED: cyclin-A1-4 isoform X1                75.9    2e-12   Phoenix dactylifera
ref|XP_007223288.1|  hypothetical protein PRUPE_ppa005557mg           75.5    3e-12   
ref|NP_175077.1|  cyclin-A1-1                                         75.1    4e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006355258.1|  PREDICTED: cyclin-A1-1-like                      56.6    7e-12   
ref|XP_003630468.1|  Cyclin A                                         73.6    1e-11   
ref|XP_010095429.1|  hypothetical protein L484_013386                 73.6    2e-11   Morus notabilis
gb|KEH35322.1|  carboxy-terminal domain cyclin                        73.6    2e-11   Medicago truncatula
ref|XP_010500134.1|  PREDICTED: cyclin-A1-1-like                      73.2    2e-11   Camelina sativa [gold-of-pleasure]
gb|KDO80524.1|  hypothetical protein CISIN_1g043577mg                 73.2    2e-11   Citrus sinensis [apfelsine]
gb|ADA70359.1|  mitotic cyclin A1-like protein                        72.8    2e-11   Persea americana
gb|KHN35496.1|  Cyclin-A1-1                                           71.2    6e-11   Glycine soja [wild soybean]
ref|XP_008783212.1|  PREDICTED: cyclin-A1-4-like                      65.9    5e-09   Phoenix dactylifera
ref|XP_006859067.1|  hypothetical protein AMTR_s00068p00198800        64.7    1e-08   Amborella trichopoda
ref|XP_009399851.1|  PREDICTED: cyclin-A1-4-like                      64.3    1e-08   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006643958.1|  PREDICTED: cyclin-A1-1-like                      63.2    3e-08   
emb|CBI18983.3|  unnamed protein product                              62.8    4e-08   Vitis vinifera
gb|EEC70248.1|  hypothetical protein OsI_01039                        62.8    5e-08   Oryza sativa Indica Group [Indian rice]
ref|XP_010915934.1|  PREDICTED: cyclin-A1-1-like isoform X3           62.8    6e-08   
ref|XP_010915931.1|  PREDICTED: cyclin-A1-4-like isoform X1           62.4    7e-08   Elaeis guineensis
gb|EEE54185.1|  hypothetical protein OsJ_01008                        62.4    7e-08   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010915932.1|  PREDICTED: cyclin-A1-4-like isoform X2           62.4    7e-08   
ref|XP_009387253.1|  PREDICTED: cyclin-A1-4-like                      62.4    7e-08   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001042512.1|  Os01g0233500                                     62.0    1e-07   
ref|XP_004502519.1|  PREDICTED: cyclin-A1-1-like                      61.6    1e-07   
ref|XP_004967382.1|  PREDICTED: cyclin-A1-1-like                      61.2    2e-07   Setaria italica
ref|XP_003566077.1|  PREDICTED: cyclin-A1-1-like                      60.8    2e-07   Brachypodium distachyon [annual false brome]
gb|EAY73159.1|  hypothetical protein OsI_01032                        58.2    2e-07   Oryza sativa Indica Group [Indian rice]
ref|XP_002454880.1|  hypothetical protein SORBIDRAFT_03g000690        60.8    2e-07   Sorghum bicolor [broomcorn]
ref|XP_002457051.1|  hypothetical protein SORBIDRAFT_03g000520        60.5    3e-07   
gb|EAY73164.1|  hypothetical protein OsI_01037                        58.2    1e-06   Oryza sativa Indica Group [Indian rice]
sp|Q0INT0.2|CCA13_ORYSJ  RecName: Full=Cyclin-A1-3; AltName: Full...  58.9    1e-06   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001288521.1|  uncharacterized protein LOC103649996             57.8    2e-06   Zea mays [maize]
gb|AAA20237.1|  cyclin IIZm                                           57.4    3e-06   Zea mays [maize]
ref|XP_006645684.1|  PREDICTED: cyclin-A1-1-like                      57.4    3e-06   
ref|XP_002455447.1|  hypothetical protein SORBIDRAFT_03g010940        57.0    5e-06   Sorghum bicolor [broomcorn]
emb|CDM82517.1|  unnamed protein product                              55.5    1e-05   Triticum aestivum [Canadian hard winter wheat]
ref|XP_003566081.1|  PREDICTED: cyclin-A1-1-like                      55.5    2e-05   Brachypodium distachyon [annual false brome]
gb|AIL50247.1|  Ttam-3D                                               55.1    2e-05   Triticum aestivum [Canadian hard winter wheat]
gb|AIL50245.1|  Ttam-3A                                               55.1    2e-05   Triticum turgidum [cone wheat]
dbj|BAJ94732.1|  predicted protein                                    54.3    4e-05   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMS46237.1|  Cyclin-A1-1                                           53.9    4e-05   Triticum urartu
emb|CDY25649.1|  BnaC05g25280D                                        53.9    5e-05   Brassica napus [oilseed rape]
ref|XP_010521285.1|  PREDICTED: cyclin-A1-2 isoform X1                53.5    6e-05   Tarenaya hassleriana [spider flower]
ref|XP_010521286.1|  PREDICTED: cyclin-A1-2 isoform X2                53.5    6e-05   Tarenaya hassleriana [spider flower]
ref|NP_001042509.2|  Os01g0233100                                     52.4    2e-04   
dbj|BAD81374.1|  putative type A-like cyclin                          52.4    2e-04   Oryza sativa Japonica Group [Japonica rice]
sp|Q0JPA4.2|CCA12_ORYSJ  RecName: Full=Cyclin-A1-2; AltName: Full...  52.4    2e-04   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001105387.1|  cyclin2                                          52.4    2e-04   
gb|EEE54183.1|  hypothetical protein OsJ_01006                        49.7    2e-04   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009145051.1|  PREDICTED: cyclin-A1-1                           51.6    3e-04   Brassica rapa
gb|ACR33952.1|  unknown                                               51.2    4e-04   Zea mays [maize]
gb|ACF80031.1|  unknown                                               51.2    4e-04   Zea mays [maize]



>ref|XP_011102309.1| PREDICTED: cyclin-A1-1 [Sesamum indicum]
Length=495

 Score =   163 bits (413),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 98/179 (55%), Positives = 124/179 (69%), Gaps = 5/179 (3%)
 Frame = +1

Query  208  GKVAAAADQRLAHKRPALTNITNQR--TGsllssrstfsesssIAPCTSKNVGIKKSSSS  381
            GKVA++A      KRPAL NITNQR  +G L S R++  ESS I PC++K V IKK SS+
Sbjct  27   GKVASSAPA--GKKRPALANITNQRHGSGPLNSGRASVPESSKIVPCSAKIVSIKKGSST  84

Query  382  STGNAGFLGTSIVPTSTLVKPITVPSKGPSAIGSDAILQKATLPPVTCSMDNSPAKSDGM  561
            S  NA F G ++ PTS+  + + VPS+  S   SD +  K +  P + SMD SP KSD  
Sbjct  85   SM-NASFSGATLPPTSSAKQSMVVPSRATSHTKSDVVYSKTSAAPDSFSMDKSPDKSDSF  143

Query  562  TASMDESMSPCDSLRSPEVEYIDNNETAGVHSIEKKASSALYISEHQETTGNICKRDII  738
            + SMDESMS CDSL+SPEVEY+D NE A V SIE+KAS+ L ISEH+E +GNICKRD++
Sbjct  144  SVSMDESMSTCDSLKSPEVEYMDTNEIAAVDSIERKASNMLCISEHEEISGNICKRDVL  202



>ref|XP_009593177.1| PREDICTED: cyclin-A1-4 isoform X1 [Nicotiana tomentosiformis]
Length=484

 Score =   153 bits (387),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 98/184 (53%), Positives = 122/184 (66%), Gaps = 22/184 (12%)
 Frame = +1

Query  199  NRHGKVAAAADQRLAHKRPALTNITNQRTGsllssrstfsesssIAPCTSKNVGIKKSSS  378
            N HGK+       +A KRPALTNI+N  T S  +S S  S+   +APCTSK V IKKS+S
Sbjct  30   NNHGKL-------VAKKRPALTNISNHTTASARNSLSHSSK---LAPCTSKAVSIKKSNS  79

Query  379  SSTGNAGFLGTSIVPTSTLVKPITVPSKGPSAIGSDAILQKAT-LP-PVTCSMDNSPAKS  552
            ++        +S++PTS+ VKPI   SK  S   SDA + K T +P P TCSMD SP+ S
Sbjct  80   NA-------ASSVLPTSSFVKPI---SKTVSIPRSDAAIPKITAIPLPATCSMDISPSHS  129

Query  553  DGMTASMDESMSPCDSLRSPEVEYIDNNETAGVHSIEKKASSALYISEHQETTGNICKRD  732
            DG   SMDE+MS  DSLRSP+VEYID+N+TA   SIEKKA S LYISE  +   +ICKRD
Sbjct  130  DGSLVSMDETMSTSDSLRSPDVEYIDDNQTAAFDSIEKKAFSTLYISEDVKAAADICKRD  189

Query  733  IIVD  744
            ++VD
Sbjct  190  VLVD  193



>ref|XP_010312445.1| PREDICTED: cyclin A1 isoform X1 [Solanum lycopersicum]
Length=489

 Score =   153 bits (387),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 94/170 (55%), Positives = 121/170 (71%), Gaps = 8/170 (5%)
 Frame = +1

Query  241  AHKRPALTNITNQRTGsllssrstfsesssIAPCTSKNVGIKKSSSSSTGNAGFLGTSIV  420
            A KRPAL+NI+N  T   +S+R++ S SS +APCTSK V IKK++S+   NA   GT+++
Sbjct  35   AKKRPALSNISNNTT---VSARNSVSHSSKLAPCTSKIVNIKKNTSACNSNAVSSGTAVL  91

Query  421  PTSTLVKPITVPSKGPSAIGSDAILQKATLPPV--TCSMDNSPAKSDGMTASMDESMSPC  594
            P S+ V+P    SK  S   SDA++ K T+ PV  TCSMD SP+ SDG   SMDESMS  
Sbjct  92   PASSSVRP---SSKPVSIQRSDAVVPKITVIPVPATCSMDISPSHSDGSLVSMDESMSNS  148

Query  595  DSLRSPEVEYIDNNETAGVHSIEKKASSALYISEHQETTGNICKRDIIVD  744
            D++RSPEVEYID++E A V SIEKKA S LYISEH +   +ICKRD++VD
Sbjct  149  DTVRSPEVEYIDDHELAAVDSIEKKACSTLYISEHVKAAADICKRDVLVD  198



>dbj|BAE06271.1| cyclin A [Scutellaria baicalensis]
Length=496

 Score =   150 bits (380),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 97/180 (54%), Positives = 124/180 (69%), Gaps = 7/180 (4%)
 Frame = +1

Query  208  GKVAAAADQRLAHKRPALTNITNQR--TGsllssrstfsesssIAPCTSKNVGIKKSSSS  381
            GKVA++A    + KRPAL N+TNQR  TGS  + R+   ESS IAPCT+K V IKK  S+
Sbjct  28   GKVASSASA--SKKRPALANVTNQRHGTGSANAGRAPLPESSKIAPCTTKIVSIKKGPSA  85

Query  382  STGNAGFLGTSIVPTSTLVKPITVPSKGPSAI-GSDAILQKATLPPVTCSMDNSPAKSDG  558
            ST N+GF G +I+PTS+ VK   V     + I  SD +L K    PV+CSMD SP KSD 
Sbjct  86   ST-NSGFPG-AILPTSSSVKQNIVAVGRSTFIPKSDVVLPKTLAAPVSCSMDVSPDKSDS  143

Query  559  MTASMDESMSPCDSLRSPEVEYIDNNETAGVHSIEKKASSALYISEHQETTGNICKRDII  738
            ++ SMDESMS CDSL+SP+VE++D  + A V SIE+KAS+ L IS+H E  GN+CKRD +
Sbjct  144  LSVSMDESMSTCDSLKSPDVEHVDYIDVAAVDSIERKASNMLCISDHMEIAGNLCKRDAL  203



>emb|CAA63542.1| cyclin A-like protein [Nicotiana tabacum]
Length=483

 Score =   149 bits (376),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 98/184 (53%), Positives = 122/184 (66%), Gaps = 23/184 (13%)
 Frame = +1

Query  199  NRHGKVAAAADQRLAHKRPALTNITNQRTGsllssrstfsesssIAPCTSKNVGIKKSSS  378
            N HGK+       +A KRPALTNI+N  T S  +S S  S+   +APCTSK V IKKS+S
Sbjct  30   NNHGKL-------VAKKRPALTNISNHTTASARNSLSHSSK---LAPCTSKAVSIKKSNS  79

Query  379  SSTGNAGFLGTSIVPTSTLVKPITVPSKGPSAIGSDAILQKAT-LP-PVTCSMDNSPAKS  552
            ++        +S++PTS+ VKPI   SK  S   SDA + K T +P P TCSMD SP+ S
Sbjct  80   NA-------ASSVLPTSSFVKPI---SKTVSIPRSDAAIPKITAIPLPATCSMDISPSHS  129

Query  553  DGMTASMDESMSPCDSLRSPEVEYIDNNETAGVHSIEKKASSALYISEHQETTGNICKRD  732
            DG   SMDE+MS  DSLRSP+VEYID+N+TA   SIEKKA S LYISE  +   +ICKRD
Sbjct  130  DGSLVSMDETMSTSDSLRSPDVEYIDDNQTAAFDSIEKKAFSTLYISEDVK-AADICKRD  188

Query  733  IIVD  744
            ++VD
Sbjct  189  VLVD  192



>ref|NP_001233762.1| cyclin A1 [Solanum lycopersicum]
 emb|CAB46641.1| cyclin A1 [Solanum lycopersicum]
Length=490

 Score =   149 bits (376),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 94/171 (55%), Positives = 121/171 (71%), Gaps = 9/171 (5%)
 Frame = +1

Query  241  AHKRPALTNITNQRTGsllssrstfsesssIAPCTSKNVGIKKSSSSSTGNAGFLGTSIV  420
            A KRPAL+NI+N  T   +S+R++ S SS +APCTSK V IKK++S+   NA   GT+++
Sbjct  35   AKKRPALSNISNNTT---VSARNSVSHSSKLAPCTSKIVNIKKNTSACNSNAVSSGTAVL  91

Query  421  PTSTLVKPITVPSKGPSAIGSDAILQKATLPPV--TCSMDNSPAKSDGMTASMDESMSPC  594
            P S+ V+P    SK  S   SDA++ K T+ PV  TCSMD SP+ SDG   SMDESMS  
Sbjct  92   PASSSVRP---SSKPVSIQRSDAVVPKITVIPVPATCSMDISPSHSDGSLVSMDESMSNS  148

Query  595  DSLRSPEVEYIDNNETAGVHSIEKKASSALYISEH-QETTGNICKRDIIVD  744
            D++RSPEVEYID++E A V SIEKKA S LYISEH +    +ICKRD++VD
Sbjct  149  DTVRSPEVEYIDDHELAAVDSIEKKACSTLYISEHVKAAAADICKRDVLVD  199



>ref|XP_009593178.1| PREDICTED: cyclin-A1-4 isoform X2 [Nicotiana tomentosiformis]
Length=483

 Score =   149 bits (376),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 98/184 (53%), Positives = 122/184 (66%), Gaps = 23/184 (13%)
 Frame = +1

Query  199  NRHGKVAAAADQRLAHKRPALTNITNQRTGsllssrstfsesssIAPCTSKNVGIKKSSS  378
            N HGK+       +A KRPALTNI+N  T S  +S S  S+   +APCTSK V IKKS+S
Sbjct  30   NNHGKL-------VAKKRPALTNISNHTTASARNSLSHSSK---LAPCTSKAVSIKKSNS  79

Query  379  SSTGNAGFLGTSIVPTSTLVKPITVPSKGPSAIGSDAILQKAT-LP-PVTCSMDNSPAKS  552
            ++        +S++PTS+ VKPI   SK  S   SDA + K T +P P TCSMD SP+ S
Sbjct  80   NA-------ASSVLPTSSFVKPI---SKTVSIPRSDAAIPKITAIPLPATCSMDISPSHS  129

Query  553  DGMTASMDESMSPCDSLRSPEVEYIDNNETAGVHSIEKKASSALYISEHQETTGNICKRD  732
            DG   SMDE+MS  DSLRSP+VEYID+N+TA   SIEKKA S LYISE  +   +ICKRD
Sbjct  130  DGSLVSMDETMSTSDSLRSPDVEYIDDNQTAAFDSIEKKAFSTLYISEDVK-AADICKRD  188

Query  733  IIVD  744
            ++VD
Sbjct  189  VLVD  192



>dbj|BAA09366.1| A-type cyclin [Nicotiana tabacum]
Length=483

 Score =   149 bits (376),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 98/184 (53%), Positives = 122/184 (66%), Gaps = 23/184 (13%)
 Frame = +1

Query  199  NRHGKVAAAADQRLAHKRPALTNITNQRTGsllssrstfsesssIAPCTSKNVGIKKSSS  378
            N HGK+       +A KRPALTNI+N  T S  +S S  S+   +APCTSK V IKKS+S
Sbjct  30   NNHGKL-------VAKKRPALTNISNHTTASARNSLSHSSK---LAPCTSKAVSIKKSNS  79

Query  379  SSTGNAGFLGTSIVPTSTLVKPITVPSKGPSAIGSDAILQKAT-LP-PVTCSMDNSPAKS  552
            ++        +S++PTS+ VKPI   SK  S   SDA + K T +P P TCSMD SP+ S
Sbjct  80   NA-------ASSVLPTSSFVKPI---SKTVSIPRSDAAIPKITAIPLPATCSMDISPSHS  129

Query  553  DGMTASMDESMSPCDSLRSPEVEYIDNNETAGVHSIEKKASSALYISEHQETTGNICKRD  732
            DG   SMDE+MS  DSLRSP+VEYID+N+TA   SIEKKA S LYISE  +   +ICKRD
Sbjct  130  DGSLVSMDETMSTSDSLRSPDVEYIDDNQTAAFDSIEKKAFSTLYISEDVK-AADICKRD  188

Query  733  IIVD  744
            ++VD
Sbjct  189  VLVD  192



>ref|XP_006351137.1| PREDICTED: cyclin-A1-3-like isoform X2 [Solanum tuberosum]
Length=487

 Score =   146 bits (368),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 98/184 (53%), Positives = 125/184 (68%), Gaps = 20/184 (11%)
 Frame = +1

Query  199  NRHGKVAAAADQRLAHKRPALTNITNQRTGsllssrstfsesssIAPCTSKNVGIKKSSS  378
            N+ GK+ A A    A KRPAL+NI+N  T   +S+R++ S SS +APCTSK V IKK+ S
Sbjct  31   NQTGKLNAGA----AKKRPALSNISNHTT---VSARNSISHSSKLAPCTSKIVSIKKNIS  83

Query  379  SSTGNAGFLGTSIVPTSTLVKPITVPSKGPSAIGSDAILQKAT-LP-PVTCSMDNSPAKS  552
            S        GT+++P S+ V+P    SK  S   SDA++ K T +P P TCSMD SP+ S
Sbjct  84   S--------GTAVLPASSSVRP---SSKPVSIQRSDAVVPKITAIPLPATCSMDISPSHS  132

Query  553  DGMTASMDESMSPCDSLRSPEVEYIDNNETAGVHSIEKKASSALYISEHQETTGNICKRD  732
            DG   SMDESMS  D++RSPEVEYID+ E+A V SIEKKA S LYISEH +   +ICKRD
Sbjct  133  DGSLVSMDESMSTSDTVRSPEVEYIDDLESAAVDSIEKKACSTLYISEHIKAAADICKRD  192

Query  733  IIVD  744
            ++VD
Sbjct  193  VLVD  196



>emb|CDP10969.1| unnamed protein product [Coffea canephora]
Length=504

 Score =   146 bits (368),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 99/183 (54%), Positives = 128/183 (70%), Gaps = 11/183 (6%)
 Frame = +1

Query  208  GKVAAA---ADQRLAHKRPALTNITNQRT-GsllssrstfsesssIAPCTSKNVGIKKSS  375
            GK+ A+   + Q LA KRPAL N+TNQR  G+  ++RST SE S IAPCT+K V IKK +
Sbjct  32   GKMVASGLPSQQHLAKKRPALANVTNQRAQGNFSNNRSTLSEPSKIAPCTAKIVSIKKGA  91

Query  376  -SSSTGNAGFLGTSIVPTSTLVKP-ITVPSKGPSAIGSDAILQKATLPPVTCSMDNSPAK  549
             +S+  NAG +  + +P S+ +KP I   SK  SA+ +DAIL  A   PV CSMD SP +
Sbjct  92   PTSNISNAG-ISAATLPASSFMKPNIVACSK--SAL-TDAIL-PAIAGPVPCSMDVSPTQ  146

Query  550  SDGMTASMDESMSPCDSLRSPEVEYIDNNETAGVHSIEKKASSALYISEHQETTGNICKR  729
            S+G++ SMDESMS CDSL SPEVEY+DNNE   V SIEKKAS+ L IS+H ++ G ICKR
Sbjct  147  SEGLSVSMDESMSTCDSLNSPEVEYLDNNEITAVDSIEKKASTKLCISDHVQSPGIICKR  206

Query  730  DII  738
            + +
Sbjct  207  EAL  209



>ref|XP_009796391.1| PREDICTED: cyclin-A1-4 [Nicotiana sylvestris]
 emb|CAA63543.1| cyclin A-like protein [Nicotiana tabacum]
Length=482

 Score =   143 bits (361),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 98/187 (52%), Positives = 124/187 (66%), Gaps = 22/187 (12%)
 Frame = +1

Query  196  ENRHGKVAAAADQRLAHKRPALTNITNQRTGsllssrstfsesssIAPCTSKNVGIKKSS  375
            EN HGK+ A      A KRPALTNI+N  T S  +S S  S+   +APCTSK V IKK++
Sbjct  23   ENNHGKLPAGG----AKKRPALTNISNHTTASARNSLSHSSK---LAPCTSKVVSIKKNN  75

Query  376  SSSTGNAGFLGTSIVPTST-LVKPITVPSKGPSAIGSDAILQKAT-LPPV--TCSMDNSP  543
            S++        +S++PTS+  VKPI   SK  S   SDA + K T +PP+  TCSMD SP
Sbjct  76   SNA-------ASSVLPTSSSFVKPI---SKTVSLPRSDAAVPKITAIPPLPSTCSMDISP  125

Query  544  AKSDGMTASMDESMSPCDSLRSPEVEYIDNNETAGVHSIEKKASSALYISEHQETTGNIC  723
            + SDG   SMDE+MS  +SLRSP+VEYID+N+TA   SIEKKA S LYISE  +   +IC
Sbjct  126  SHSDGSLVSMDETMSTSNSLRSPDVEYIDDNQTAAFDSIEKKAFSTLYISEDVK-AADIC  184

Query  724  KRDIIVD  744
            KRD++VD
Sbjct  185  KRDVLVD  191



>ref|XP_006351136.1| PREDICTED: cyclin-A1-3-like isoform X1 [Solanum tuberosum]
Length=488

 Score =   142 bits (358),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 98/185 (53%), Positives = 125/185 (68%), Gaps = 21/185 (11%)
 Frame = +1

Query  199  NRHGKVAAAADQRLAHKRPALTNITNQRTGsllssrstfsesssIAPCTSKNVGIKKSSS  378
            N+ GK+ A A    A KRPAL+NI+N  T   +S+R++ S SS +APCTSK V IKK+ S
Sbjct  31   NQTGKLNAGA----AKKRPALSNISNHTT---VSARNSISHSSKLAPCTSKIVSIKKNIS  83

Query  379  SSTGNAGFLGTSIVPTSTLVKPITVPSKGPSAIGSDAILQKAT-LP-PVTCSMDNSPAKS  552
            S        GT+++P S+ V+P    SK  S   SDA++ K T +P P TCSMD SP+ S
Sbjct  84   S--------GTAVLPASSSVRP---SSKPVSIQRSDAVVPKITAIPLPATCSMDISPSHS  132

Query  553  DGMTASMDESMSPCDSLRSPEVEYIDNNETAGVHSIEKKASSALYISEH-QETTGNICKR  729
            DG   SMDESMS  D++RSPEVEYID+ E+A V SIEKKA S LYISEH +    +ICKR
Sbjct  133  DGSLVSMDESMSTSDTVRSPEVEYIDDLESAAVDSIEKKACSTLYISEHIKAAAADICKR  192

Query  730  DIIVD  744
            D++VD
Sbjct  193  DVLVD  197



>ref|XP_006351138.1| PREDICTED: cyclin-A1-3-like isoform X3 [Solanum tuberosum]
Length=483

 Score =   142 bits (358),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 98/185 (53%), Positives = 125/185 (68%), Gaps = 21/185 (11%)
 Frame = +1

Query  199  NRHGKVAAAADQRLAHKRPALTNITNQRTGsllssrstfsesssIAPCTSKNVGIKKSSS  378
            N+ GK+ A A    A KRPAL+NI+N  T   +S+R++ S SS +APCTSK V IKK+ S
Sbjct  31   NQTGKLNAGA----AKKRPALSNISNHTT---VSARNSISHSSKLAPCTSKIVSIKKNIS  83

Query  379  SSTGNAGFLGTSIVPTSTLVKPITVPSKGPSAIGSDAILQKAT-LP-PVTCSMDNSPAKS  552
            S        GT+++P S+ V+P    SK  S   SDA++ K T +P P TCSMD SP+ S
Sbjct  84   S--------GTAVLPASSSVRP---SSKPVSIQRSDAVVPKITAIPLPATCSMDISPSHS  132

Query  553  DGMTASMDESMSPCDSLRSPEVEYIDNNETAGVHSIEKKASSALYISEH-QETTGNICKR  729
            DG   SMDESMS  D++RSPEVEYID+ E+A V SIEKKA S LYISEH +    +ICKR
Sbjct  133  DGSLVSMDESMSTSDTVRSPEVEYIDDLESAAVDSIEKKACSTLYISEHIKAAAADICKR  192

Query  730  DIIVD  744
            D++VD
Sbjct  193  DVLVD  197



>ref|XP_007225619.1| hypothetical protein PRUPE_ppa004701mg [Prunus persica]
 gb|EMJ26818.1| hypothetical protein PRUPE_ppa004701mg [Prunus persica]
Length=495

 Score =   138 bits (347),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 84/181 (46%), Positives = 114/181 (63%), Gaps = 5/181 (3%)
 Frame = +1

Query  208  GKVAAAADQRLAHKRPALTNITNQRTGsllssrstfsesssIAPCTSKNVGIKKSSSSST  387
            GKV AA +  LA KR  L+N+TN+ + S    RS+   S ++ PCT+K   +KK   + T
Sbjct  31   GKVVAA-EPHLARKRAPLSNLTNRNSVSNNGLRSSGGSSCTLVPCTNKIAKVKKGPPACT  89

Query  388  GNAGFLGTSIVPTSTLVKP--ITVPSKGPSAIGSDAILQKATLPPVTCSMDNSPAKSDGM  561
            GN G   +S+ P S  VKP  + +P   P+    +A+     LP   CSMD SP+KSDG 
Sbjct  90   GNKGVSASSL-PASFNVKPSAVVLPKVTPAPRSDEAVPNSFALPG-PCSMDVSPSKSDGN  147

Query  562  TASMDESMSPCDSLRSPEVEYIDNNETAGVHSIEKKASSALYISEHQETTGNICKRDIIV  741
            + SMDE+MS CDS +SPEVEYIDNN+   + SI +K  S LYIS+H ETTG  CKR+++V
Sbjct  148  SVSMDETMSSCDSFKSPEVEYIDNNDVPAIDSINRKTFSNLYISDHAETTGVACKREVLV  207

Query  742  D  744
            +
Sbjct  208  E  208



>ref|XP_008219598.1| PREDICTED: cyclin-A1-1-like [Prunus mume]
Length=496

 Score =   132 bits (331),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 83/176 (47%), Positives = 109/176 (62%), Gaps = 5/176 (3%)
 Frame = +1

Query  208  GKVAAAADQRLAHKRPALTNITNQRTGsllssrstfsesssIAPCTSKNVGIKKSSSSST  387
            GKV AA +  LA KR  L+N+TN+ + S    RS+   S ++ PCT+K   +KK   + T
Sbjct  32   GKVVAA-EPHLAKKRAPLSNLTNRNSVSNNGLRSSGGSSCTLVPCTNKIAKVKKGPPACT  90

Query  388  GNAGFLGTSIVPTSTLVKP--ITVPSKGPSAIGSDAILQKATLPPVTCSMDNSPAKSDGM  561
            GN G   +S+ P S  VKP  + +P   P+    +A+     LP   CSMD SP+KSDG 
Sbjct  91   GNKGISASSL-PASFNVKPSAVLLPKVTPAPRSDEAVPSSFALPG-PCSMDVSPSKSDGN  148

Query  562  TASMDESMSPCDSLRSPEVEYIDNNETAGVHSIEKKASSALYISEHQETTGNICKR  729
            + SMDE+MS CDS +SPEVEYIDNN+   + SI +K  S LYIS+H ETTG  CKR
Sbjct  149  SVSMDETMSSCDSFKSPEVEYIDNNDVPAIDSINRKTFSNLYISDHAETTGIACKR  204



>ref|XP_010095430.1| hypothetical protein L484_013387 [Morus notabilis]
 gb|EXB60122.1| hypothetical protein L484_013387 [Morus notabilis]
Length=495

 Score =   125 bits (314),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 77/180 (43%), Positives = 108/180 (60%), Gaps = 14/180 (8%)
 Frame = +1

Query  217  AAAADQRLAHKRPALTNITNQRTGsllssrstfsesssIAPC-TSKNVGIKKS--SSSST  387
            A A    LA KR  L NITN+      ++  T    S++ PC T+K   +KK   + +ST
Sbjct  38   ATAVPPHLAKKRAPLGNITNRSNAVSQNASRTAVPPSTLVPCATTKIAKVKKGPLACTST  97

Query  388  GNAGFLGTSIVPTSTLVKPITVPSKGPSAI-GSDAILQKATLPPVTCSMDNSPAKSDGMT  564
             ++  + T+I+          VPSK  S++  SD  L +    P  CSMD SP+KSD ++
Sbjct  98   NSSLNVKTNII----------VPSKVTSSLPRSDETLPRTVAVPAPCSMDMSPSKSDDVS  147

Query  565  ASMDESMSPCDSLRSPEVEYIDNNETAGVHSIEKKASSALYISEHQETTGNICKRDIIVD  744
             S+DE+MS CDS +SPEVEY+DNN+   V SI +K  S LYIS+H ETTGN+C RD++V+
Sbjct  148  VSLDETMSTCDSFKSPEVEYVDNNDAPAVDSINRKTFSNLYISDHSETTGNVCSRDVLVE  207



>ref|XP_002284567.1| PREDICTED: cyclin-A1-1-like [Vitis vinifera]
Length=495

 Score =   124 bits (311),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 84/183 (46%), Positives = 108/183 (59%), Gaps = 5/183 (3%)
 Frame = +1

Query  199  NRHGKVAAAADQRLAHKRPALTNITNQRTGsllssrstfsesssIAPCTSKNVGIKKSSS  378
            + HGKV       LA KRP L+NITNQ+  SL   +S+ +  + + PC  K    K+ SS
Sbjct  26   DNHGKVTTVPSH-LAKKRPPLSNITNQKNASLSGLKSSAAVGTMV-PCAEKISKAKRGSS  83

Query  379  SSTGNAGFLGTSIVPTSTLVKPITV-PSKGPSAIGSDAILQKATLPPVTCSMDNSPAKSD  555
              + + G  G +    S  VKP  V P K  S   SD      T  P  CS+D SP +SD
Sbjct  84   KISRSVGITGNT-SSASLNVKPTAVIPCKDTSLPKSDGTASTVTALPDPCSLDVSPNRSD  142

Query  556  GMTASMDESMSPCDSLRSPEVEYIDNNETAGVHSIEKKASSALYISEHQETTGNICKRDI  735
            G++ASMDE+MS CDS +SPEVEY+D ++ A V+SIE+K  S LYISEH E  GNIC  DI
Sbjct  143  GISASMDETMSTCDSFKSPEVEYMDVDDLA-VNSIERKTCSKLYISEHVEAEGNICSEDI  201

Query  736  IVD  744
             V+
Sbjct  202  HVE  204



>emb|CBI18982.3| unnamed protein product [Vitis vinifera]
Length=550

 Score =   124 bits (311),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 84/183 (46%), Positives = 108/183 (59%), Gaps = 5/183 (3%)
 Frame = +1

Query  199  NRHGKVAAAADQRLAHKRPALTNITNQRTGsllssrstfsesssIAPCTSKNVGIKKSSS  378
            + HGKV       LA KRP L+NITNQ+  SL   +S+ +  + + PC  K    K+ SS
Sbjct  81   DNHGKVTTVPSH-LAKKRPPLSNITNQKNASLSGLKSSAAVGTMV-PCAEKISKAKRGSS  138

Query  379  SSTGNAGFLGTSIVPTSTLVKPITV-PSKGPSAIGSDAILQKATLPPVTCSMDNSPAKSD  555
              + + G  G +    S  VKP  V P K  S   SD      T  P  CS+D SP +SD
Sbjct  139  KISRSVGITGNT-SSASLNVKPTAVIPCKDTSLPKSDGTASTVTALPDPCSLDVSPNRSD  197

Query  556  GMTASMDESMSPCDSLRSPEVEYIDNNETAGVHSIEKKASSALYISEHQETTGNICKRDI  735
            G++ASMDE+MS CDS +SPEVEY+D ++ A V+SIE+K  S LYISEH E  GNIC  DI
Sbjct  198  GISASMDETMSTCDSFKSPEVEYMDVDDLA-VNSIERKTCSKLYISEHVEAEGNICSEDI  256

Query  736  IVD  744
             V+
Sbjct  257  HVE  259



>ref|XP_004290902.1| PREDICTED: cyclin-A1-1 [Fragaria vesca subsp. vesca]
Length=500

 Score =   121 bits (304),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 75/187 (40%), Positives = 111/187 (59%), Gaps = 21/187 (11%)
 Frame = +1

Query  226  ADQRLAHKRPALTNITNQRTGsllssrstfsesssIAPCTSKNVGIKKSSSSSTGNAGFL  405
            A+ RLA KR  L+N+TN+      +  +  +  S++ PC  K   +KK S +ST N G  
Sbjct  34   AEPRLAKKRAPLSNLTNR-----SNVGAGSASKSALVPC--KIAKVKKGSPASTSNRGIS  86

Query  406  GTSIVPTSTLVKPITVPSKGPSAIG-SDAILQKAT-------------LPPVTCSMDNSP  543
            G+++   S  VKP T+     +A+  SD +  K+T             + PV C+MD SP
Sbjct  87   GSNVPAASCSVKPSTIVLPKVTAVQRSDEVFPKSTSVQRSGEAAPISVVIPVPCNMDESP  146

Query  544  AKSDGMTASMDESMSPCDSLRSPEVEYIDNNETAGVHSIEKKASSALYISEHQETTGNIC  723
            +KSDG + SMDE+MS CDS +SP+VEYIDNN+   + SI +K  S L+IS+  ETTG +C
Sbjct  147  SKSDGDSVSMDETMSTCDSFKSPQVEYIDNNDVQAIDSINRKTFSHLHISDQPETTGIVC  206

Query  724  KRDIIVD  744
             R+++V+
Sbjct  207  SRELLVE  213



>ref|XP_007019157.1| Cyclin A1,1 isoform 1 [Theobroma cacao]
 gb|EOY16382.1| Cyclin A1,1 isoform 1 [Theobroma cacao]
Length=493

 Score =   119 bits (299),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 78/187 (42%), Positives = 112/187 (60%), Gaps = 23/187 (12%)
 Frame = +1

Query  208  GKVAAAADQRLAHKRPALTNITNQRTGsllssrstfsesssIAPCTSKNVGIKKSSSSST  387
            GKV A+    LA KR  L+NITNQ+  S  S  ++      + PC++K +  +K+   S 
Sbjct  34   GKVTAS----LAKKRVPLSNITNQKNSSRSSVSASS-----LVPCSNKILKARKTQPVS-  83

Query  388  GNAGFLG-----TSIVPTSTLVKPITVPSKGPSAIGSDAILQKATLPPVT---CSMDNSP  543
             N GF G     T++ P+S L  P  V +  P   G++ ++   ++  +    CSM+ SP
Sbjct  84   -NVGFSGHVLPSTNVRPSSVL--PPKVVTSFPR--GNEVVVPPPSISTIPPPLCSMEFSP  138

Query  544  AKSDGMTASMDESMSPCDSLRSPEVEYIDNNETAGVHSIEKKASSALYISEHQETTGNIC  723
            +KSDG++ SMDE+MS CDS +SPEVEY+DN +   + SIE+K  S LYIS+H E TGNIC
Sbjct  139  SKSDGVSVSMDETMSTCDSFKSPEVEYMDNRDVTAIDSIERKTFSNLYISDHLEATGNIC  198

Query  724  KRDIIVD  744
             RD I +
Sbjct  199  NRDAIAE  205



>ref|XP_002520329.1| cyclin A, putative [Ricinus communis]
 gb|EEF42115.1| cyclin A, putative [Ricinus communis]
Length=498

 Score =   116 bits (291),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 78/186 (42%), Positives = 110/186 (59%), Gaps = 10/186 (5%)
 Frame = +1

Query  196  ENRHGKVAAAADQRLAHKRPALTNITNQRTGsllssrstfsesssIAPCTSKNVGIKKSS  375
            EN  GK  A      A KR  L +ITN +         T   SS++APC++K   +KK +
Sbjct  29   ENAVGKSTALT----ARKRAPLGDITNHK-NVTQKGSRTSIPSSTLAPCSNKIAKVKKGT  83

Query  376  SSSTGNAG--FLGTSIVPTSTLVKPITVPS-KGPSAIGSDAILQKATLPPVTCSMDNSPA  546
             + T N    F G+++ P S  VK   + + K PS   +D  ++  ++ PV CSMD SP+
Sbjct  84   PACTSNTATAFSGSNL-PASLNVKSSAISTCKVPSVPRNDEAVRSISVDPVPCSMDVSPS  142

Query  547  KSDGMTASMDESMSPCDSLRSPEVEYIDNNETAGVHSIEKKASSALYISEHQETTGNICK  726
            KSD ++ S+DE+MS CDS +SPEVEY+DNN+   + SI KK  S LYIS+H +T  N+C 
Sbjct  143  KSDAISVSLDETMS-CDSFKSPEVEYMDNNDIPAIDSINKKTLSNLYISDHVQTAENLCC  201

Query  727  RDIIVD  744
            RDI+ D
Sbjct  202  RDILTD  207



>gb|EYU32511.1| hypothetical protein MIMGU_mgv1a005475mg [Erythranthe guttata]
Length=482

 Score =   115 bits (289),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 76/166 (46%), Positives = 103/166 (62%), Gaps = 19/166 (11%)
 Frame = +1

Query  247  KRPALTNITNQR--TGsllssrstfsesssIAPCTSKNVGIKKSSSSSTGNAGFLGTSIV  420
            KRPAL+NITNQR  +GSL   R+   ESS I PC++K V IKK SS+ST NA F G ++ 
Sbjct  41   KRPALSNITNQRHASGSLNPGRAHLPESSKIVPCSTKIVSIKKGSSTST-NASFSGPTLP  99

Query  421  PTSTLVKPITVPSKGPSAIGSDAILQKATLPPVTCSMDNSPAKSDGMTASMDESMSPCDS  600
            P  +  +    PS+  +             PPV  S    P KSD  + SMDESMS CDS
Sbjct  100  PIVSSKQSTVAPSRAIAP------------PPVNVS----PDKSDSYSVSMDESMSTCDS  143

Query  601  LRSPEVEYIDNNETAGVHSIEKKASSALYISEHQETTGNICKRDII  738
            L+SP++EY+DN+E   V  IE+KAS  L IS++ + + ++CKRD++
Sbjct  144  LKSPDIEYMDNSEIVAVDYIERKASDMLCISDNMDISVDVCKRDLL  189



>ref|XP_006472826.1| PREDICTED: cyclin-A1-1-like [Citrus sinensis]
Length=503

 Score =   113 bits (283),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 75/177 (42%), Positives = 106/177 (60%), Gaps = 10/177 (6%)
 Frame = +1

Query  238  LAHKRPALTNITNQRTGsllssrstfsesssIAPCTSKNVGIKKSSSSSTGNAGFLGTSI  417
            LA KR  L+N+TNQ+  +   S+S  S S+ + PC++K    KK+  ++  N    G + 
Sbjct  39   LAKKRAPLSNVTNQKNVTQSGSKSLLSSSALV-PCSTKLAKAKKAPEANNANTSISG-NF  96

Query  418  VPTSTLVKP---ITVPSKGPSAIGSDAILQK-----ATLPPVTCSMDNSPAKSDGMTASM  573
            +P S+  K    + VP K  S   SD  ++      A    V+CSMD SP+KSD  + SM
Sbjct  97   LPASSNGKTSTTVPVPCKVTSLPRSDENVKTSAPSIAAAVSVSCSMDVSPSKSDANSVSM  156

Query  574  DESMSPCDSLRSPEVEYIDNNETAGVHSIEKKASSALYISEHQETTGNICKRDIIVD  744
            DESMS CDS +SPEVEY+DNN+   + SI++K+   LYIS+H E T N+C RDI+ D
Sbjct  157  DESMSVCDSFKSPEVEYLDNNDVPPLDSIDRKSFRNLYISDHTERTENVCSRDILAD  213



>ref|XP_006386358.1| hypothetical protein POPTR_0002s08020g [Populus trichocarpa]
 gb|ERP64155.1| hypothetical protein POPTR_0002s08020g [Populus trichocarpa]
Length=499

 Score =   112 bits (279),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 79/180 (44%), Positives = 104/180 (58%), Gaps = 4/180 (2%)
 Frame = +1

Query  208  GKVAAAADQRLAHKRPALTNITNQRTGsllssrstfsesssIAPCTSKNVGIKKSSSSST  387
            GK  A A   LA KR  L +ITNQ+  +   SR++   S+ +AP ++K   +KK   +S 
Sbjct  32   GKATAVAPH-LAKKRAPLGDITNQKNATQKGSRNSIPSST-LAPFSNKIAKVKKGPPASN  89

Query  388  GNAGFLGTSIVPTSTLVKPITV-PSKGPSAIGSDAILQKATLPPVTCSMDNSPAKSDGMT  564
             +AGF G ++ P S   K  T    K  S    D  +  AT   V C MD SP+KSD  +
Sbjct  90   SSAGFYGKTL-PASLNAKSSTGGACKVISNPRRDENVTIATAVSVPCCMDVSPSKSDDFS  148

Query  565  ASMDESMSPCDSLRSPEVEYIDNNETAGVHSIEKKASSALYISEHQETTGNICKRDIIVD  744
             S+DESMS CDS +SPE+EYID+NE   + SI KK  S LYIS+H ET  N+C RD + D
Sbjct  149  ISLDESMSTCDSFKSPEIEYIDSNEITAIDSINKKTLSNLYISDHVETAENMCIRDALAD  208



>ref|XP_008352624.1| PREDICTED: cyclin-A1-1-like [Malus domestica]
Length=479

 Score =   111 bits (277),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 73/187 (39%), Positives = 105/187 (56%), Gaps = 18/187 (10%)
 Frame = +1

Query  217  AAAADQRLAHKRPALTNITNQRTGsllssrstfsesssIAPCTSKNVGIKKSSSSSTGNA  396
            A AA+  L  KR  L+N+TN+ +      RS+   S ++ P T+K   +K+   + TGN 
Sbjct  32   AVAAEPHLGKKRAPLSNLTNRNSVPNNGLRSSGGSSCALVPSTNKIAKVKRGPPACTGNK  91

Query  397  GFLGTSIVPTSTLVKP--------ITVPSK---GPSAIGSDAILQKATLPPVTCSMDNSP  543
            G +  S  P    VKP         + P +    PS + S   +      P  CSMD SP
Sbjct  92   G-VSASNPPXPFCVKPNXPVLPKVTSCPRREEAAPSNVPSTFAI------PAPCSMDVSP  144

Query  544  AKSDGMTASMDESMSPCDSLRSPEVEYIDNNETAGVHSIEKKASSALYISEHQETTGNIC  723
            +KSDG + SMDE+MS CDS +SP++EYIDNN+   + SI +K  S LYIS++ ETTG  C
Sbjct  145  SKSDGNSVSMDETMSTCDSFKSPDIEYIDNNDVPAIDSINRKTFSNLYISDNAETTGIGC  204

Query  724  KRDIIVD  744
            KR+++ +
Sbjct  205  KREVLAE  211



>gb|KHG23907.1| Cyclin-A1-1 -like protein [Gossypium arboreum]
Length=493

 Score =   110 bits (276),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 75/189 (40%), Positives = 111/189 (59%), Gaps = 24/189 (13%)
 Frame = +1

Query  208  GKVAAAADQRLAHKRPALTNITNQRTGsllssrstfsesssIAPCTSKNVGIKKSSSSST  387
            GKV A+    +  KR  L+NI+NQ+      +  +   +SS+ PC++K V   + +    
Sbjct  32   GKVMAS----MPKKRVPLSNISNQKN-----TSRSSVSASSLVPCSNK-VPKTRKTMPDN  81

Query  388  GNAGFLGTSIVPTSTLVKPITVPSKGPSAI-----GSDAILQK-----ATLPPVTCSMDN  537
             N GF G  ++P ST V+P +VP   P  +     G++  L       +T+PP   +M+ 
Sbjct  82   NNVGFSG-HVLP-STHVQPGSVPP--PKVVTSFPRGNEVALPPPPATISTIPPPPSTMEV  137

Query  538  SPAKSDGMTASMDESMSPCDSLRSPEVEYIDNNETAGVHSIEKKASSALYISEHQETTGN  717
            SP+KSDG++ SMDE+MS CDS +SPEVEY+DN++   V SIE+K    LYIS+H E  GN
Sbjct  138  SPSKSDGLSVSMDETMSTCDSFKSPEVEYMDNHDVTAVDSIERKTFRNLYISDHVEAPGN  197

Query  718  ICKRDIIVD  744
            IC RD + +
Sbjct  198  ICNRDAVAE  206



>ref|XP_011027470.1| PREDICTED: cyclin-A1-1-like [Populus euphratica]
 ref|XP_011027471.1| PREDICTED: cyclin-A1-1-like [Populus euphratica]
Length=499

 Score =   110 bits (275),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 78/180 (43%), Positives = 103/180 (57%), Gaps = 4/180 (2%)
 Frame = +1

Query  208  GKVAAAADQRLAHKRPALTNITNQRTGsllssrstfsesssIAPCTSKNVGIKKSSSSST  387
            GK  A A   LA KR  L +ITNQ+  +   SR++   S+ +AP ++K   +KK   +S 
Sbjct  32   GKATAVATH-LAKKRAPLGDITNQKNATQKGSRNSIPSST-LAPFSNKIAKVKKGPPASN  89

Query  388  GNAGFLGTSIVPTSTLVKPITV-PSKGPSAIGSDAILQKATLPPVTCSMDNSPAKSDGMT  564
             +AGF G ++ P S   K  T    K  S    D  +  AT   + C MD SP+KSD  +
Sbjct  90   SSAGFSGKTL-PASLNAKSSTGGACKVISNPRRDENVSIATAVSIPCCMDVSPSKSDDFS  148

Query  565  ASMDESMSPCDSLRSPEVEYIDNNETAGVHSIEKKASSALYISEHQETTGNICKRDIIVD  744
             S+DESMS CDS +SPE+EYID+NE   + SI KK  S LYIS+H ET  N+C RD   D
Sbjct  149  ISLDESMSTCDSFKSPEIEYIDSNEITAIDSINKKTLSNLYISDHVETAENMCIRDAFAD  208



>ref|XP_007019158.1| Cyclin A1,1 isoform 2, partial [Theobroma cacao]
 gb|EOY16383.1| Cyclin A1,1 isoform 2, partial [Theobroma cacao]
Length=389

 Score =   109 bits (272),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 63/144 (44%), Positives = 94/144 (65%), Gaps = 10/144 (7%)
 Frame = +1

Query  331  IAPCTSKNVGIKKSSSSSTGNAGFLGTSIVPTSTLVKPITV-PSKGPSAI--GSDAILQK  501
            + PC++K +  +K+   S  N GF G  ++P ST V+P +V P K  ++   G++ ++  
Sbjct  7    LVPCSNKILKARKTQPVS--NVGFSG-HVLP-STNVRPSSVLPPKVVTSFPRGNEVVVPP  62

Query  502  ATLPPVT---CSMDNSPAKSDGMTASMDESMSPCDSLRSPEVEYIDNNETAGVHSIEKKA  672
             ++  +    CSM+ SP+KSDG++ SMDE+MS CDS +SPEVEY+DN +   + SIE+K 
Sbjct  63   PSISTIPPPLCSMEFSPSKSDGVSVSMDETMSTCDSFKSPEVEYMDNRDVTAIDSIERKT  122

Query  673  SSALYISEHQETTGNICKRDIIVD  744
             S LYIS+H E TGNIC RD I +
Sbjct  123  FSNLYISDHLEATGNICNRDAIAE  146



>ref|XP_011027473.1| PREDICTED: cyclin-A1-1-like [Populus euphratica]
 ref|XP_011027474.1| PREDICTED: cyclin-A1-1-like [Populus euphratica]
Length=499

 Score =   110 bits (274),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 78/180 (43%), Positives = 103/180 (57%), Gaps = 4/180 (2%)
 Frame = +1

Query  208  GKVAAAADQRLAHKRPALTNITNQRTGsllssrstfsesssIAPCTSKNVGIKKSSSSST  387
            GK  A A   LA KR  L +ITNQ+  +   SR++   S+ +AP ++K   +KK   +S 
Sbjct  32   GKATAYATH-LAKKRAPLGDITNQKNATQKGSRNSIPSST-LAPFSNKIAKVKKGPPASN  89

Query  388  GNAGFLGTSIVPTSTLVKPITV-PSKGPSAIGSDAILQKATLPPVTCSMDNSPAKSDGMT  564
             +AGF G ++ P S   K  T    K  S    D  +  AT   + C MD SP+KSD  +
Sbjct  90   SSAGFSGKTL-PASLNAKSSTGGACKVISNPRRDENVSIATAVSIPCCMDVSPSKSDDFS  148

Query  565  ASMDESMSPCDSLRSPEVEYIDNNETAGVHSIEKKASSALYISEHQETTGNICKRDIIVD  744
             S+DESMS CDS +SPE+EYID+NE   + SI KK  S LYIS+H ET  N+C RD   D
Sbjct  149  ISLDESMSTCDSFKSPEIEYIDSNEITAIDSINKKTLSNLYISDHVETAENMCIRDAFAD  208



>ref|XP_011003420.1| PREDICTED: cyclin-A1-1-like [Populus euphratica]
Length=493

 Score =   107 bits (268),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 80/187 (43%), Positives = 104/187 (56%), Gaps = 24/187 (13%)
 Frame = +1

Query  208  GKVAAAADQRLAHKRPALTNITNQRTGsllssrstfsesssIAPCTSKNVGIKKSSSSST  387
            GK  A A   LA KR  L +ITNQ+         T   SS++AP ++K   +KK + +S 
Sbjct  32   GKATAVAPH-LAKKRAPLGDITNQK-NVTQKGSRTLIPSSTLAPFSNKFAKVKKGTPAS-  88

Query  388  GNAGFLGTSIVPTSTLV---KPITVPSKGPSAIGSDAILQKATLPPVT-----CSMDNSP  543
             N+  L  S+   S+ V   K I+V ++G S            +PPV      CS+D SP
Sbjct  89   -NSSTLPASLNAKSSAVGVCKVISVSTRGES------------VPPVAAVSVPCSIDVSP  135

Query  544  AKSDGMTASMDESMSPCDSLRSPEVEYIDNNETAGVHSIEKKASSALYISEHQETTGNIC  723
            +KSD ++ S+DESMS CDS +SPEVEYIDNNE   + SI KK  S LYIS+H ET  N C
Sbjct  136  SKSDDLSISLDESMSTCDSFKSPEVEYIDNNEIIAIDSINKKTLSNLYISDHLETAENAC  195

Query  724  KRDIIVD  744
             RD   D
Sbjct  196  IRDTRTD  202



>gb|KDP32823.1| hypothetical protein JCGZ_12115 [Jatropha curcas]
Length=494

 Score =   106 bits (265),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 68/173 (39%), Positives = 98/173 (57%), Gaps = 6/173 (3%)
 Frame = +1

Query  226  ADQRLAHKRPALTNITNQRTGsllssrstfsesssIAPCTSKNVGIKKSSSSSTGNAGFL  405
            A   +A KR  L +ITN +         T   SS++APC++K   +KK   + T N GF 
Sbjct  38   ATTHIARKRAPLGDITNHK-NVPQKGSRTSIPSSTLAPCSNKIAKVKKGPPACTSNTGFS  96

Query  406  GTSIVPTSTLVKPITVPSKGPSAIGSDAILQKATLPPVTCSMDNSPAKSDGMTASMDESM  585
             +++ P ++    I    K  S   SD  +    + P  C+MD SP+KS     S+DE+M
Sbjct  97   ASNLAPLNSKSSAIGA-CKVTSVPRSDQAVPSIVVDPAPCNMDVSPSKS----ISLDETM  151

Query  586  SPCDSLRSPEVEYIDNNETAGVHSIEKKASSALYISEHQETTGNICKRDIIVD  744
            S CDS +SPEVEY+D+N+   + SI KK  S LYIS+H +T  N+C RD++VD
Sbjct  152  STCDSFKSPEVEYLDHNDIPAIDSINKKTLSNLYISDHVQTEENVCCRDMLVD  204



>ref|XP_009343979.1| PREDICTED: cyclin-A1-1-like [Pyrus x bretschneideri]
Length=498

 Score =   105 bits (263),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 70/191 (37%), Positives = 104/191 (54%), Gaps = 18/191 (9%)
 Frame = +1

Query  205  HGKVAAAADQRLAHKRPALTNITNQRTGsllssrstfsesssIAPCTSKNVGIKKSSSSS  384
            +G  A AA+  L  KR  L+N+TN+ +      RS+     ++ P T+K   +K+   + 
Sbjct  29   NGGKAVAAEPHLGKKRAPLSNLTNRNSVPNNGLRSSGGSLCALVPSTNKIAKVKRGPPAC  88

Query  385  TGNAGFLGTSIVPTSTLVKP--------ITVPSK---GPSAIGSDAILQKATLPPVTCSM  531
             GN G +  S  P    VKP         + P +    PS + S   +      P  CSM
Sbjct  89   IGNKG-VSASNPPAPFCVKPNLPVLPKVTSCPRRDEAAPSNVPSTFAI------PGPCSM  141

Query  532  DNSPAKSDGMTASMDESMSPCDSLRSPEVEYIDNNETAGVHSIEKKASSALYISEHQETT  711
            D SP+KSDG + SMDE+MS CDS +SP++EY+DNN+   + SI +   S LYIS++ ETT
Sbjct  142  DVSPSKSDGNSVSMDETMSTCDSFKSPDIEYVDNNDVPAIDSINRTTFSNLYISDNAETT  201

Query  712  GNICKRDIIVD  744
            G  CKR+++ +
Sbjct  202  GIGCKREVLAE  212



>dbj|BAC56853.1| cyclin A1 [Silene latifolia]
Length=487

 Score =   104 bits (260),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 69/182 (38%), Positives = 97/182 (53%), Gaps = 28/182 (15%)
 Frame = +1

Query  235  RLAHKRPALTNITNQRTGsllssrstfsesssIAPCTSKNVGIKKSSSSSTGNAGFLGTS  414
            +L  KRP L+N+TN                S +    +K+   K+ SS+   +  F   +
Sbjct  29   KLTKKRPPLSNLTNH------------PRPSLVPSAITKSTKAKRDSSTGVRSTSFPAEN  76

Query  415  IVPTSTL-VKP-ITVPSKGPSAIGSDAILQKATLP------------PVTCSMDNSPAKS  552
              P++TL  KP   VP K      +  +  KA+LP            P +C+MD +P   
Sbjct  77   --PSATLNSKPSAVVPLKTAFTRSNVLVSCKASLPNGKGEQSHITRHPASCTMDTTPTPE  134

Query  553  DGMTASMDESMSPCDSLRSPEVEYIDNNETAGVHSIEKKASSALYISEHQETTGNICKRD  732
            D  + SMDESMS CDSL+SPEVEY+D N+ A + SIE+K S  LYIS+  ETTG+ CKR+
Sbjct  135  DAQSVSMDESMSTCDSLKSPEVEYMDENDVAALCSIERKTSKNLYISDDMETTGSFCKRE  194

Query  733  II  738
            I+
Sbjct  195  IV  196



>ref|XP_006434258.1| hypothetical protein CICLE_v10000927mg [Citrus clementina]
 gb|ESR47498.1| hypothetical protein CICLE_v10000927mg [Citrus clementina]
Length=503

 Score =   104 bits (259),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 77/181 (43%), Positives = 103/181 (57%), Gaps = 18/181 (10%)
 Frame = +1

Query  238  LAHKRPALTNITNQRTGsllssrstfsesssIAPCTSK------NVGIKKSSSSSTGNAG  399
            LA KR  L+N+TNQ+     S   +   SS + PC++K            +++S +GN  
Sbjct  39   LAKKRAPLSNVTNQK-NVTQSGSKSLLSSSVLVPCSTKLAKAKKAPAANNANTSISGN--  95

Query  400  FL-GTSIVPTSTLVKPITVPSKGPSAIGSDAILQK-----ATLPPVTCSMDNSPAKSDGM  561
            FL  +S   TST V    VP K  S   SD  ++      A    V+CSMD SP+KSD  
Sbjct  96   FLPASSNGKTSTTVP---VPCKVTSLPRSDENVKTSAPSIAAAVSVSCSMDVSPSKSDAN  152

Query  562  TASMDESMSPCDSLRSPEVEYIDNNETAGVHSIEKKASSALYISEHQETTGNICKRDIIV  741
            + SMDESMS CDS +SPEVEY+DNN+   + SI++K    LYIS+H E T N+C RDI+ 
Sbjct  153  SVSMDESMSVCDSFKSPEVEYLDNNDVPPLDSIDRKTFRNLYISDHTERTENVCSRDILA  212

Query  742  D  744
            D
Sbjct  213  D  213



>ref|XP_002306649.1| cyclin family protein [Populus trichocarpa]
 gb|EEE93645.1| cyclin family protein [Populus trichocarpa]
Length=493

 Score =   103 bits (258),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 79/188 (42%), Positives = 103/188 (55%), Gaps = 26/188 (14%)
 Frame = +1

Query  208  GKVAAAADQRLAHKRPALTNITNQRTGsllssrstfsesssIAPCTSKNVGIKKSSSSST  387
            GK  A A   LA KR  L +ITNQ+         T   SS++AP ++K   +KK   +S 
Sbjct  32   GKATAVAPH-LAKKRAPLGDITNQK-NVTQKGSRTLIPSSTLAPFSNKFAKVKKGPPASN  89

Query  388  GNAGFLGTSIVPTSTLVKPITVPSKGPSAIGSDAILQKAT----LPPVT-----CSMDNS  540
                        +STL  P  + +K  SA+G   ++  +T    +PPV      CS D S
Sbjct  90   ------------SSTL--PAFLNAKS-SAVGVCKVISISTRDESVPPVAAVSVPCSNDVS  134

Query  541  PAKSDGMTASMDESMSPCDSLRSPEVEYIDNNETAGVHSIEKKASSALYISEHQETTGNI  720
            P+KSD ++ S+DESMS CDS +SPEVEYIDNNE   + SI KK  S LYIS+H ET  N+
Sbjct  135  PSKSDDLSISLDESMSTCDSFKSPEVEYIDNNEIIAIDSINKKTLSNLYISDHLETAENV  194

Query  721  CKRDIIVD  744
            C RD   D
Sbjct  195  CIRDTRTD  202



>gb|KHG05847.1| Cyclin-A1-1 -like protein [Gossypium arboreum]
Length=489

 Score =   103 bits (256),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 79/185 (43%), Positives = 108/185 (58%), Gaps = 21/185 (11%)
 Frame = +1

Query  208  GKVAAAADQRLAHKRPALTNITNQRTGsllssrstfsesssIAPCTSKNVGIKKSSSSST  387
            GKV A+    LA KR  LTNITNQ+  S   S +  S         S N   K   + S 
Sbjct  32   GKVMAS----LAKKRVPLTNITNQKQSSSSKSSALASSLV-----PSSNKIQKARKTQSV  82

Query  388  GNAGFLGTSIVPT----STLVKPITVPSKGPSAIGSDAILQKATLPPVTCSMDNSPAKSD  555
             N G  G  + PT    S+++ P  VPS  P+  G++ +L     PPV CSM+ SP+KSD
Sbjct  83   TNVGLSGHVLPPTNERRSSVLPPKVVPS-LPT--GNEVVLLP---PPVQCSMEFSPSKSD  136

Query  556  GMTA-SMDESMSPCDSLRSPEVEYIDNNETAGVHSIEKKASSALYISEHQET-TGNICKR  729
            G+++ S+DE+MS CDS +SPEVEYIDN++ + + SIE+K  S L IS+H    TG+IC R
Sbjct  137  GLSSVSLDETMSTCDSFKSPEVEYIDNHDVSAIGSIERKTFSNLCISDHDVVATGSICNR  196

Query  730  DIIVD  744
            D + +
Sbjct  197  DAVAE  201



>ref|XP_006393746.1| hypothetical protein EUTSA_v10011442mg [Eutrema salsugineum]
 gb|ESQ31032.1| hypothetical protein EUTSA_v10011442mg [Eutrema salsugineum]
Length=481

 Score =   102 bits (255),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 70/180 (39%), Positives = 96/180 (53%), Gaps = 31/180 (17%)
 Frame = +1

Query  214  VAAAADQRLAHKRPALTNITNQRTGsllssrstfsesssIAPCTSKNVGIKKSSSSSTG-  390
            +   AD RL  KR  L NITNQ+ GS               P +S ++  K   + +   
Sbjct  40   ITVMADPRLTKKRAPLGNITNQKNGSR-------------IPNSSSDLSAKLKLAPTQPV  86

Query  391  --NAGFLGTSIVPTSTLVKPITVPSKGPSAIGSDAILQKATLPPVTCSMDNSPAKSDGMT  564
              N+G L ++++P    VKP    S  P+ + S     KA           SP+KSD  +
Sbjct  87   CVNSG-LSSNVLPLQQSVKP----SVAPTKVTSFPYEHKAA----------SPSKSDDES  131

Query  565  ASMDESMSPCDSLRSPEVEYIDNNETAGVHSIEKKASSALYISEHQETTGNICKRDIIVD  744
             SMDE++S CDS +SP+VEYIDN E + V SIE+KA S LYI+   ETTGN C+RD++ D
Sbjct  132  VSMDETVSTCDSYKSPQVEYIDNEEISAVVSIERKALSNLYITPSSETTGNYCRRDVLSD  191



>ref|XP_010260855.1| PREDICTED: cyclin-A1-4 [Nelumbo nucifera]
Length=497

 Score =   101 bits (252),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 78/185 (42%), Positives = 110/185 (59%), Gaps = 14/185 (8%)
 Frame = +1

Query  208  GKVAAAADQRLAHKRPALTNITNQRTGsllssrstfsesssIAPCTSKNVGIKKSSSSST  387
             KV A   Q+ A KRPAL+N+TNQ T    +         +  P  SK V +KK S+   
Sbjct  29   SKVPAILAQQ-AKKRPALSNLTNQ-THLSRNPVRNSGTVGNQVPSESKTVKLKKGSTYVR  86

Query  388  GNAGFLGTSIVPTSTLVKPIT-VPSKGPSA----IGSDAILQKATLPPVTCSMDNSPAKS  552
              +  L  S V  ST VK  T V SK  S     I + ++L  AT+ P  C+   SP++S
Sbjct  87   PTS--LPRSSVSASTAVKSATAVSSKDASVTKIDIPTSSVL--ATIAP--CNAHISPSRS  140

Query  553  DGMTASMDESMSPCDSLRSPEVEYIDNNETAGVHSIEKKASSALYISEHQETT-GNICKR  729
            DG +AS+DE+MS CDSL+SP++EYIDN + + V SIE++  + LYISE+ E+   N+CKR
Sbjct  141  DGDSASLDETMSTCDSLKSPDIEYIDNADASAVASIERRTCNNLYISENVESAPENLCKR  200

Query  730  DIIVD  744
            DI+++
Sbjct  201  DILME  205



>gb|KJB59298.1| hypothetical protein B456_009G248300 [Gossypium raimondii]
Length=489

 Score =   100 bits (249),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 77/185 (42%), Positives = 107/185 (58%), Gaps = 21/185 (11%)
 Frame = +1

Query  208  GKVAAAADQRLAHKRPALTNITNQRTGsllssrstfsesssIAPCTSKNVGIKKSSSSST  387
            G+V A+    LA KR  LTNITNQ+  S   S +  S         S N   K   + S 
Sbjct  32   GRVIAS----LAKKRVPLTNITNQKQSSSSKSSALASSLVQ-----SSNKIQKARKTQSV  82

Query  388  GNAGFLGTSIVPT----STLVKPITVPSKGPSAIGSDAILQKATLPPVTCSMDNSPAKSD  555
             N G  G  + P     S+++ P  VPS  P+  G++ +L     PPV CSM+ SP+KSD
Sbjct  83   TNVGLSGHVLPPINERRSSVLPPKVVPS-LPT--GNEVVLPP---PPVQCSMEFSPSKSD  136

Query  556  GMTA-SMDESMSPCDSLRSPEVEYIDNNETAGVHSIEKKASSALYISEHQET-TGNICKR  729
            G+++ S+DE+MS CDS +SPEVEYIDN++ + + SIE+K  S L IS+H    TG+IC R
Sbjct  137  GLSSVSLDETMSTCDSFKSPEVEYIDNHDVSAIGSIERKTFSNLCISDHDVVATGSICNR  196

Query  730  DIIVD  744
            D + +
Sbjct  197  DAVAE  201



>ref|XP_010532201.1| PREDICTED: cyclin-A1-1-like isoform X2 [Tarenaya hassleriana]
Length=501

 Score =   100 bits (249),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 72/184 (39%), Positives = 106/184 (58%), Gaps = 21/184 (11%)
 Frame = +1

Query  214  VAAAADQRLAHKRPALTNITNQRTGsllssrstfsesssIAPCTSKNVGIKKSSSSS---  384
            +AA A  RL  KR  L NITNQ+ GS + + S+ S     A C++K+  IK + + +   
Sbjct  36   LAAPAAPRLTKKRAPLGNITNQKNGSRIPNSSSTS-----AHCSNKSAKIKVAPTQTACL  90

Query  385  ---TGNAGFLGTSIVPTSTLV--KPITVPSKGPSAIGSDAILQKATLPPVTCSMD-NSPA  546
               + + G     IV TS++V  K  ++P +  +A  +  I       P  C  + +SP 
Sbjct  91   YTDSASTGLRAQPIVQTSSVVPGKDTSLPCRDENASATAVIF------PNQCENEASSPI  144

Query  547  KSDGMTASMDESMSPCDSLRSPEVEYIDNNETAGVHSIEKKASSALYISEHQETTGNICK  726
            + + ++ SMDESMS CDS +SP+VEYIDN E + V SIE+KA S LYI+E+ ET+ N C 
Sbjct  145  QFEDVSVSMDESMSTCDSFKSPQVEYIDNGEVSAVESIERKALSNLYIAENSETS-NFCS  203

Query  727  RDII  738
            RD +
Sbjct  204  RDTL  207



>ref|XP_010532200.1| PREDICTED: cyclin-A1-1-like isoform X1 [Tarenaya hassleriana]
Length=503

 Score =   100 bits (249),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 72/184 (39%), Positives = 106/184 (58%), Gaps = 21/184 (11%)
 Frame = +1

Query  214  VAAAADQRLAHKRPALTNITNQRTGsllssrstfsesssIAPCTSKNVGIKKSSSSS---  384
            +AA A  RL  KR  L NITNQ+ GS + + S+ S     A C++K+  IK + + +   
Sbjct  36   LAAPAAPRLTKKRAPLGNITNQKNGSRIPNSSSTS-----AHCSNKSAKIKVAPTQTACL  90

Query  385  ---TGNAGFLGTSIVPTSTLV--KPITVPSKGPSAIGSDAILQKATLPPVTCSMD-NSPA  546
               + + G     IV TS++V  K  ++P +  +A  +  I       P  C  + +SP 
Sbjct  91   YTDSASTGLRAQPIVQTSSVVPGKDTSLPCRDENASATAVIF------PNQCENEASSPI  144

Query  547  KSDGMTASMDESMSPCDSLRSPEVEYIDNNETAGVHSIEKKASSALYISEHQETTGNICK  726
            + + ++ SMDESMS CDS +SP+VEYIDN E + V SIE+KA S LYI+E+ ET+ N C 
Sbjct  145  QFEDVSVSMDESMSTCDSFKSPQVEYIDNGEVSAVESIERKALSNLYIAENSETS-NFCS  203

Query  727  RDII  738
            RD +
Sbjct  204  RDTL  207



>gb|KJB80671.1| hypothetical protein B456_013G109600 [Gossypium raimondii]
Length=411

 Score = 97.8 bits (242),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 72/189 (38%), Positives = 106/189 (56%), Gaps = 24/189 (13%)
 Frame = +1

Query  208  GKVAAAADQRLAHKRPALTNITNQRTGsllssrstfsesssIAPCTSKNVGIKKSSSSST  387
            GKV A+    +  KR  L+NI+NQ+  S  S  ++         C++K V   + +    
Sbjct  32   GKVMAS----MPKKRVPLSNISNQKNTSRSSVSASSLVL-----CSNK-VPKTRKTMPDN  81

Query  388  GNAGFLGTSIVPTSTLVKPITVPSKGPSAI-----GSDAILQK-----ATLPPVTCSMDN  537
             N GF G  ++P  T V+P +VP   P  +     G++  L       +T+PP    M+ 
Sbjct  82   NNVGFSG-HVLPL-THVEPGSVPP--PKVVLSFPRGNEVALPPPPATISTIPPPPSIMEV  137

Query  538  SPAKSDGMTASMDESMSPCDSLRSPEVEYIDNNETAGVHSIEKKASSALYISEHQETTGN  717
            SP+KSDG++ S DE+MS CDS +SPEVEY+DN++   V SIE+K    L IS+H E+TGN
Sbjct  138  SPSKSDGLSVSTDETMSTCDSFKSPEVEYMDNHDVTAVDSIERKTFRNLCISDHVESTGN  197

Query  718  ICKRDIIVD  744
            IC RD + +
Sbjct  198  ICNRDAVAE  206



>ref|XP_006434257.1| hypothetical protein CICLE_v10003984mg, partial [Citrus clementina]
 gb|ESR47497.1| hypothetical protein CICLE_v10003984mg, partial [Citrus clementina]
Length=489

 Score = 98.2 bits (243),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 73/196 (37%), Positives = 111/196 (57%), Gaps = 20/196 (10%)
 Frame = +1

Query  205  HGKVAAAADQRLAHKRPALTNITNQRTGsllssrstfsesssIAPCTSKNVGIKKSSSSS  384
            H K  A    +LA KRPAL+++TNQR GS   SR   ++S  I PC++K +  KK SS+ 
Sbjct  27   HVKKIAIMKPQLAKKRPALSDMTNQRDGSQAVSRVVGTQSKPIVPCSAK-IAKKKESSAH  85

Query  385  TGNAGFLGTSIVPTSTLVKPITVPSKGPSAIGSDAILQKATLPPVTCSMDNSPAKSDGM-  561
            + + G  G ++ P S  VK I V +K   +  SD  + +A +P  + ++ + PA S  + 
Sbjct  86   SHDKGLSGNTL-PASLSVK-IGVIAKDAFSTRSDHPIIRA-IPAPSSNISSLPASSSAIM  142

Query  562  ---------------TASMDESMSPCDSLRSPEVEYIDNNETAGVHSIEKKASSALYISE  696
                           + S+DE+MS CDSL+SPE  YID  +++ V SIE++  S+L IS+
Sbjct  143  VPRCKNISLSTSVSGSVSLDETMSTCDSLKSPEFVYIDKEDSSAVKSIERRTCSSLNISD  202

Query  697  HQETTGNICKRDIIVD  744
              +  G  CKRDI+V+
Sbjct  203  CAQGKGKTCKRDILVE  218



>gb|KJB80669.1| hypothetical protein B456_013G109600 [Gossypium raimondii]
Length=493

 Score = 98.2 bits (243),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 72/189 (38%), Positives = 106/189 (56%), Gaps = 24/189 (13%)
 Frame = +1

Query  208  GKVAAAADQRLAHKRPALTNITNQRTGsllssrstfsesssIAPCTSKNVGIKKSSSSST  387
            GKV A+    +  KR  L+NI+NQ+  S  S  ++         C++K V   + +    
Sbjct  32   GKVMAS----MPKKRVPLSNISNQKNTSRSSVSASSLVL-----CSNK-VPKTRKTMPDN  81

Query  388  GNAGFLGTSIVPTSTLVKPITVPSKGPSAI-----GSDAILQK-----ATLPPVTCSMDN  537
             N GF G  ++P  T V+P +VP   P  +     G++  L       +T+PP    M+ 
Sbjct  82   NNVGFSG-HVLPL-THVEPGSVPP--PKVVLSFPRGNEVALPPPPATISTIPPPPSIMEV  137

Query  538  SPAKSDGMTASMDESMSPCDSLRSPEVEYIDNNETAGVHSIEKKASSALYISEHQETTGN  717
            SP+KSDG++ S DE+MS CDS +SPEVEY+DN++   V SIE+K    L IS+H E+TGN
Sbjct  138  SPSKSDGLSVSTDETMSTCDSFKSPEVEYMDNHDVTAVDSIERKTFRNLCISDHVESTGN  197

Query  718  ICKRDIIVD  744
            IC RD + +
Sbjct  198  ICNRDAVAE  206



>ref|XP_006472824.1| PREDICTED: cyclin-A1-1-like isoform X1 [Citrus sinensis]
Length=516

 Score = 98.2 bits (243),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 73/196 (37%), Positives = 111/196 (57%), Gaps = 20/196 (10%)
 Frame = +1

Query  205  HGKVAAAADQRLAHKRPALTNITNQRTGsllssrstfsesssIAPCTSKNVGIKKSSSSS  384
            H K  A    +LA KRPAL+++TNQR GS   SR   ++S  I PC++K +  KK SS+ 
Sbjct  27   HVKKIAIMKPQLAKKRPALSDMTNQRDGSQAVSRVVGTQSKPIVPCSAK-IAKKKESSAH  85

Query  385  TGNAGFLGTSIVPTSTLVKPITVPSKGPSAIGSDAILQKATLPPVTCSMDNSPAKSDGM-  561
            + + G  G ++ P S  VK I V +K   +  SD  + +A +P  + ++ + PA S  + 
Sbjct  86   SHDKGLSGNTL-PASLSVK-IGVIAKDAFSTRSDHPIIRA-IPAPSSNISSLPASSSAIM  142

Query  562  ---------------TASMDESMSPCDSLRSPEVEYIDNNETAGVHSIEKKASSALYISE  696
                           + S+DE+MS CDSL+SPE  YID  +++ V SIE++  S+L IS+
Sbjct  143  VPRCKNISPSTSVSGSVSLDETMSTCDSLKSPEFVYIDKEDSSAVKSIERRTCSSLNISD  202

Query  697  HQETTGNICKRDIIVD  744
              +  G  CKRDI+V+
Sbjct  203  CAQGKGKTCKRDILVE  218



>ref|XP_006472825.1| PREDICTED: cyclin-A1-1-like isoform X2 [Citrus sinensis]
Length=511

 Score = 98.2 bits (243),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 73/196 (37%), Positives = 111/196 (57%), Gaps = 20/196 (10%)
 Frame = +1

Query  205  HGKVAAAADQRLAHKRPALTNITNQRTGsllssrstfsesssIAPCTSKNVGIKKSSSSS  384
            H K  A    +LA KRPAL+++TNQR GS   SR   ++S  I PC++K +  KK SS+ 
Sbjct  27   HVKKIAIMKPQLAKKRPALSDMTNQRDGSQAVSRVVGTQSKPIVPCSAK-IAKKKESSAH  85

Query  385  TGNAGFLGTSIVPTSTLVKPITVPSKGPSAIGSDAILQKATLPPVTCSMDNSPAKSDGM-  561
            + + G  G ++ P S  VK I V +K   +  SD  + +A +P  + ++ + PA S  + 
Sbjct  86   SHDKGLSGNTL-PASLSVK-IGVIAKDAFSTRSDHPIIRA-IPAPSSNISSLPASSSAIM  142

Query  562  ---------------TASMDESMSPCDSLRSPEVEYIDNNETAGVHSIEKKASSALYISE  696
                           + S+DE+MS CDSL+SPE  YID  +++ V SIE++  S+L IS+
Sbjct  143  VPRCKNISPSTSVSGSVSLDETMSTCDSLKSPEFVYIDKEDSSAVKSIERRTCSSLNISD  202

Query  697  HQETTGNICKRDIIVD  744
              +  G  CKRDI+V+
Sbjct  203  CAQGKGKTCKRDILVE  218



>ref|XP_003526649.1| PREDICTED: cyclin-A1-1-like [Glycine max]
Length=480

 Score = 97.8 bits (242),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 70/175 (40%), Positives = 96/175 (55%), Gaps = 26/175 (15%)
 Frame = +1

Query  238  LAHKRPALTNITNQRTGsllssrstfsesssIAPCTSKNVGIKKSS-SSSTGNAGFLGTS  414
            +A KRP L+N+TN               SSS+ PC +K    KK    + +GN      +
Sbjct  38   MAKKRPPLSNLTN---------TVAHRNSSSLVPCAAKFAKTKKEVVPACSGNKRPTLAN  88

Query  415  IVPTSTLVKP----ITVPSKGPSAIGSDAILQKATLP-PVTCSMDNSPAKSDGMTASMDE  579
            + PTS  + P      V  + P  + +       T+P PV   +D SP+KSD M+ SMDE
Sbjct  89   VKPTSAAIFPKANSFPVRDEAPPPVAT------VTVPAPV---VDVSPSKSDAMSVSMDE  139

Query  580  SMSPCDSLRSPEVEYIDNNETAGVHSIEKKASSALYISEHQETTGNICKRDIIVD  744
            SMS CDS +SP++EY+DN + A V SIE+K  S L IS+  E  GNIC RDI+V+
Sbjct  140  SMSSCDSFKSPDIEYVDNIDVAAVDSIERKTFSNLNISDSTE--GNICSRDILVE  192



>gb|AFK46051.1| unknown [Lotus japonicus]
Length=507

 Score = 95.9 bits (237),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 68/173 (39%), Positives = 93/173 (54%), Gaps = 13/173 (8%)
 Frame = +1

Query  241  AHKRPALTNITNQRTGsllssrstfsesssIAPCTSKNVGIKKSSSSSTG----NAGFLG  408
            A KRP L+N+TN          S  S S S+ PC SK    KK +         N     
Sbjct  54   AKKRPPLSNLTNH-------IASRNSSSQSLVPCVSKFAKTKKEAPPKVAPALPNVKSAA  106

Query  409  TSIVPTSTLVKPITVPSKGPSAIGSDAILQKATLPPVTCSMDNSPAKSDGMTASMDESMS  588
             ++V         +   +      + A   +A++P V+ SMD SP KSDG + SMDESMS
Sbjct  107  AAVVFPKVATATASFTERNEDDAAAAASGARASVP-VSTSMDVSPCKSDGCSVSMDESMS  165

Query  589  PCDSLRSP-EVEYIDNNETAGVHSIEKKASSALYISEHQETTGNICKRDIIVD  744
             CDS +SP E+EY+DN++ + V SIE+K  S L IS+ +E  GNIC RDI+V+
Sbjct  166  SCDSFKSPAEIEYVDNSDVSAVDSIERKTFSILNISDAKEQAGNICSRDILVE  218



>ref|XP_004149427.1| PREDICTED: cyclin-A1-1-like [Cucumis sativus]
 gb|KGN47698.1| hypothetical protein Csa_6G382370 [Cucumis sativus]
Length=506

 Score = 95.9 bits (237),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 66/185 (36%), Positives = 102/185 (55%), Gaps = 14/185 (8%)
 Frame = +1

Query  208  GKVAAAADQRLAHKRPALTNITNQRTGsllssrstfsesssIAPCTSKNVGIKKSSSSST  387
            GKV A     LA KR  L N+TN +     S+  +      + PC +K V  +KSS + T
Sbjct  33   GKVMAVPPH-LAKKRAPLGNLTNFK-NVSHSAAKSSGPPPVMVPCATKAVKARKSSPART  90

Query  388  GNAGFLGTSIVPTSTLVKPITVPSKGPSAIGSDAILQKATLPPVTCSMDNSPAKSDGMTA  567
             +    GT+   T+T++   T  +  PS + +     +  +  V+  MD SP+KSDG++ 
Sbjct  91   RSTNLPGTN---TTTMLDVKTTNAVAPSNVTA---FSRTDVTAVSSCMDVSPSKSDGVSV  144

Query  568  SMDESMSPCDSLRSPEVEYIDNNETAGVHSIEKKASSALYISEHQ------ETTGNICKR  729
            S+DE++S CDS +SP+VEY+DN +   V S+E+K  S+L IS H        T G+IC R
Sbjct  145  SLDETISTCDSFKSPDVEYLDNTDVPAVDSVERKTKSSLCISGHAPISCQPPTKGSICSR  204

Query  730  DIIVD  744
            D++ +
Sbjct  205  DVLTE  209



>ref|XP_008338670.1| PREDICTED: cyclin-A1-4 [Malus domestica]
Length=522

 Score = 95.9 bits (237),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 71/200 (36%), Positives = 95/200 (48%), Gaps = 27/200 (14%)
 Frame = +1

Query  223  AADQRLAHKRPALTNITNQRTGsllssrstfsesssIAPCTSK---------NVGIKKSS  375
            AA  ++  KR AL ++TNQR     S   T + S  + PCT+K              K  
Sbjct  33   AAKTQVLKKRTALADVTNQR-NRCQSVPPTLASSKPMVPCTNKIAKTIANKTTAKTTKEV  91

Query  376  SSSTGNAGFLGTSIVPTSTLVKPITVPSKGPSAIGSDAILQKA-----------TLPPVT  522
            SS T N G  G     + +    I VP    S  G+D  ++              LP ++
Sbjct  92   SSCTSNTGLSGNVFQASLSAKSNILVPFSDTSFSGTDPAIKVXCTDPSPSSSGTVLPALS  151

Query  523  C------SMDNSPAKSDGMTASMDESMSPCDSLRSPEVEYIDNNETAGVHSIEKKASSAL  684
            C      S D SP++S   + S+DESMS CDSL SPE EYIDN + + V  IEKK + +L
Sbjct  152  CINHAFRSWDASPSRSVSASVSLDESMSTCDSLNSPEFEYIDNEDVSDVKWIEKKTTKSL  211

Query  685  YISEHQETTGNICKRDIIVD  744
            +IS H     NI K+DI  D
Sbjct  212  FISNHPGKEANIWKKDIFFD  231



>ref|XP_009341345.1| PREDICTED: cyclin-A1-4-like [Pyrus x bretschneideri]
 ref|XP_009341346.1| PREDICTED: cyclin-A1-4-like [Pyrus x bretschneideri]
 ref|XP_009341352.1| PREDICTED: cyclin-A1-4-like [Pyrus x bretschneideri]
 ref|XP_009341353.1| PREDICTED: cyclin-A1-4-like [Pyrus x bretschneideri]
Length=521

 Score = 95.9 bits (237),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 71/192 (37%), Positives = 102/192 (53%), Gaps = 22/192 (11%)
 Frame = +1

Query  223  AADQRLAHKRPALTNITNQRTGsllssrstfsesssIAPCTSKNVGIKKSSSSSTGNAGF  402
            AA  +++ KR AL ++TNQR GS +   S+ S    + PC ++   +   +SS T   G 
Sbjct  43   AAKTQVSKKRTALADVTNQRNGSQIVPPSSASSKPMV-PCQTEVAKMATKASSCTSKTGI  101

Query  403  LGTSIVPTSTLVKP-ITVPSKGPSAIGSDAILQK-----------ATLPPVTC------S  528
             G+     S   KP I VP  G S  G+D  ++              LP  +C      S
Sbjct  102  SGSD---ESLSSKPSILVPFSGTSVAGTDPTIKVIGTDPSPSSSGTFLPAPSCINHAFRS  158

Query  529  MDNSPAKSDGMTASMDESMSPCDSLRSPEVEYIDNNETAGVHSIEKKASSALYISEHQET  708
             D SP++S   + S++ESMS CDSL+SPE EYID  + + V SI KK + +L+IS++   
Sbjct  159  RDVSPSRSVSASVSLNESMSTCDSLKSPEFEYIDTEDVSEVKSIGKKTTKSLFISDYPGK  218

Query  709  TGNICKRDIIVD  744
             GNI K+DI VD
Sbjct  219  EGNIWKKDIFVD  230



>gb|KDO80523.1| hypothetical protein CISIN_1g017988mg [Citrus sinensis]
Length=362

 Score = 93.6 bits (231),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 42/72 (58%), Positives = 54/72 (75%), Gaps = 0/72 (0%)
 Frame = +1

Query  529  MDNSPAKSDGMTASMDESMSPCDSLRSPEVEYIDNNETAGVHSIEKKASSALYISEHQET  708
            MD SP+KSD  + SMDESMS CDS +SPEVEY+DNN+   + SI++K+   LYIS+H E 
Sbjct  1    MDVSPSKSDANSVSMDESMSVCDSFKSPEVEYLDNNDVPPLDSIDRKSFRNLYISDHTER  60

Query  709  TGNICKRDIIVD  744
            T N+C RDI+ D
Sbjct  61   TENVCSRDILAD  72



>gb|KHN05188.1| Cyclin-A1-1 [Glycine soja]
Length=503

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 74/183 (40%), Positives = 98/183 (54%), Gaps = 9/183 (5%)
 Frame = +1

Query  208  GKVAAAADQRLAHKRPALTNITNQRTGsllssrstfsesssIAPCTSKNVGIKKSSSSST  387
            GK    + Q LA KR  L N+TNQR     SS S+  + S+    T K    + S S ST
Sbjct  36   GKAKVVSTQNLAVKRAPLANLTNQRNAPYSSSSSSLVQGSNKVAKTKKEAPARTSVSKST  95

Query  388  --GNAGFLGTSIVPTSTLVKPITVPSKGPSAIGSDAILQKATLP-PVTCSMDNSPAKSDG  558
              GN      S+  +S     + +P     +   DA    AT   PV   +D SP+KSDG
Sbjct  96   ISGNKSSQLKSVNSSS-----VVIPKANSLSQKKDAAPTVATFAVPVRSGIDVSPSKSDG  150

Query  559  MTASMDESMSPCDSLRSP-EVEYIDNNETAGVHSIEKKASSALYISEHQETTGNICKRDI  735
               SMDE+ S CDS++SP EVEY+DN + + V SI+KK  S L IS+  E  GN+C R+I
Sbjct  151  RFVSMDETTSSCDSIKSPDEVEYLDNRDVSDVDSIQKKIISNLNISDTTEPEGNVCSREI  210

Query  736  IVD  744
            IV+
Sbjct  211  IVE  213



>gb|KJB80670.1| hypothetical protein B456_013G109600 [Gossypium raimondii]
Length=416

 Score = 92.8 bits (229),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 56/129 (43%), Positives = 79/129 (61%), Gaps = 14/129 (11%)
 Frame = +1

Query  388  GNAGFLGTSIVPTSTLVKPITVPSKGPSAI-----GSDAILQK-----ATLPPVTCSMDN  537
             N GF G  ++P  T V+P +VP   P  +     G++  L       +T+PP    M+ 
Sbjct  5    NNVGFSG-HVLPL-THVEPGSVPP--PKVVLSFPRGNEVALPPPPATISTIPPPPSIMEV  60

Query  538  SPAKSDGMTASMDESMSPCDSLRSPEVEYIDNNETAGVHSIEKKASSALYISEHQETTGN  717
            SP+KSDG++ S DE+MS CDS +SPEVEY+DN++   V SIE+K    L IS+H E+TGN
Sbjct  61   SPSKSDGLSVSTDETMSTCDSFKSPEVEYMDNHDVTAVDSIERKTFRNLCISDHVESTGN  120

Query  718  ICKRDIIVD  744
            IC RD + +
Sbjct  121  ICNRDAVAE  129



>ref|NP_001241939.1| uncharacterized protein LOC100776207 [Glycine max]
 gb|ACU22685.1| unknown [Glycine max]
Length=503

 Score = 93.6 bits (231),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 74/182 (41%), Positives = 97/182 (53%), Gaps = 9/182 (5%)
 Frame = +1

Query  208  GKVAAAADQRLAHKRPALTNITNQRTGsllssrstfsesssIAPCTSKNVGIKKSSSSST  387
            GK    + Q LA KR  L N+TNQR     SS S+  + S+    T K    + S S ST
Sbjct  36   GKAKVVSTQNLAVKRAPLANLTNQRNAPYSSSSSSLVQGSNKVAKTKKEAPARTSVSKST  95

Query  388  --GNAGFLGTSIVPTSTLVKPITVPSKGPSAIGSDAILQKATLP-PVTCSMDNSPAKSDG  558
              GN      S+  +S     + +P     +   DA    AT   PV   +D SP+KSDG
Sbjct  96   ISGNKSSQLKSVNSSS-----VVIPKANSLSQKKDAAPTVATFAVPVRSGIDVSPSKSDG  150

Query  559  MTASMDESMSPCDSLRSP-EVEYIDNNETAGVHSIEKKASSALYISEHQETTGNICKRDI  735
               SMDE+ S CDS++SP EVEY+DN + + V SI+KK  S L IS+  E  GN+C R+I
Sbjct  151  RFVSMDETTSSCDSIKSPDEVEYLDNRDVSDVDSIQKKIISNLNISDTTEPEGNVCSREI  210

Query  736  IV  741
            IV
Sbjct  211  IV  212



>ref|XP_007019153.1| Cyclin A1,1, putative [Theobroma cacao]
 gb|EOY16378.1| Cyclin A1,1, putative [Theobroma cacao]
Length=499

 Score = 93.2 bits (230),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 70/196 (36%), Positives = 98/196 (50%), Gaps = 27/196 (14%)
 Frame = +1

Query  199  NRHGKVAAAADQRLAHKRPALTNITNQRTGsllssrstfsesssIAPCTSKNVGIKKSSS  378
            N+  K+ A   Q    KR AL++ITNQ  G    SR     S  + PCTSK +  KK +S
Sbjct  26   NQSKKMGAVKTQ-FIKKRAALSDITNQGNGYPNGSRVIVIRSKPMVPCTSK-LAKKKETS  83

Query  379  SSTGNAGFLGTSIVPTSTLVKPITV-PSKGPSAIGSDAILQK----------ATLPPVTC  525
            + T + G           L +P T+ P         D I  +             P   C
Sbjct  84   TCTQDHG-----------LSRPTTLSPESCADVSCMDTIWTRDDQPTPKVLGLLSPSSMC  132

Query  526  ---SMDNSPAKSDGMTASMDESMSPCDSLRSPEVEYIDNNETAGVHSIEKKASSALYISE  696
               SMD SP +S   + S+DE+MS CDSL+ PE EY++N + + V  IE+KA+  LYIS+
Sbjct  133  TPGSMDISPDRSLSGSVSLDETMSTCDSLKGPEFEYVENEDVSAVKWIERKANYNLYISK  192

Query  697  HQETTGNICKRDIIVD  744
            + +  G ICKR+I+ D
Sbjct  193  YTQREGKICKRNILSD  208



>gb|KEH35325.1| carboxy-terminal domain cyclin [Medicago truncatula]
Length=397

 Score = 92.0 bits (227),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 43/78 (55%), Positives = 59/78 (76%), Gaps = 1/78 (1%)
 Frame = +1

Query  514  PVTCSMD-NSPAKSDGMTASMDESMSPCDSLRSPEVEYIDNNETAGVHSIEKKASSALYI  690
            PV+ SMD +SP KSDGM+ SMDE+MS CDS +SP++EY+DN++   V SIE+K   +L I
Sbjct  140  PVSSSMDLSSPGKSDGMSVSMDETMSSCDSFKSPDIEYVDNSDVPAVDSIERKTFCSLNI  199

Query  691  SEHQETTGNICKRDIIVD  744
            S+    +GNIC RDI+V+
Sbjct  200  SDSNYPSGNICSRDILVE  217



>gb|KJB64519.1| hypothetical protein B456_010G052900 [Gossypium raimondii]
 gb|KJB64521.1| hypothetical protein B456_010G052900 [Gossypium raimondii]
Length=384

 Score = 91.7 bits (226),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 68/181 (38%), Positives = 97/181 (54%), Gaps = 17/181 (9%)
 Frame = +1

Query  199  NRHGKVAAAADQRLAHKRPALTNITNQRTGsllssrstfsesssIAPCTSKNVGIKKSSS  378
            N+  K+ AA  Q  + KR AL++ITNQR G    SR+  + S  + PCTSK    K++S+
Sbjct  25   NQSKKMGAAKTQ-FSKKRVALSDITNQRNGFPSGSRAMVTHSKPMVPCTSKVAKKKETST  83

Query  379  SSTGNA--GFLGTSIVPTSTLVKPITVPSKGPSAIGSDAILQKATLPPVTCSMDNSPAKS  552
              T  +   F G S + T      I      P+         K +  P+  SMD SP +S
Sbjct  84   LPTTPSLESFDGVSCINT------ICTRDDHPTT--------KVSALPLPSSMDISPCRS  129

Query  553  DGMTASMDESMSPCDSLRSPEVEYIDNNETAGVHSIEKKASSALYISEHQETTGNICKRD  732
               + S+DE+MS CDSL SP+ EY++N + + + SIE KA+  LYISE  +  G I K +
Sbjct  130  PCASVSLDETMSTCDSLESPKFEYLENEDVSAIESIETKANDNLYISELTQKEGKISKTN  189

Query  733  I  735
            I
Sbjct  190  I  190



>gb|KEH35324.1| carboxy-terminal domain cyclin [Medicago truncatula]
Length=443

 Score = 92.0 bits (227),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 43/78 (55%), Positives = 59/78 (76%), Gaps = 1/78 (1%)
 Frame = +1

Query  514  PVTCSMD-NSPAKSDGMTASMDESMSPCDSLRSPEVEYIDNNETAGVHSIEKKASSALYI  690
            PV+ SMD +SP KSDGM+ SMDE+MS CDS +SP++EY+DN++   V SIE+K   +L I
Sbjct  140  PVSSSMDLSSPGKSDGMSVSMDETMSSCDSFKSPDIEYVDNSDVPAVDSIERKTFCSLNI  199

Query  691  SEHQETTGNICKRDIIVD  744
            S+    +GNIC RDI+V+
Sbjct  200  SDSNYPSGNICSRDILVE  217



>gb|KFK38207.1| hypothetical protein AALP_AA3G082800 [Arabis alpina]
Length=399

 Score = 91.3 bits (225),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 50/114 (44%), Positives = 69/114 (61%), Gaps = 11/114 (10%)
 Frame = +1

Query  403  LGTSIVPTSTLVKPITVPSKGPSAIGSDAILQKATLPPVTCSMDNSPAKSDGMTASMDES  582
            L  S++P    VKP  +P+K  +++  +    KA           SP+KSD  T SMDE+
Sbjct  27   LNASVLPLQQSVKPSVIPNKA-TSLPYEHYQSKAP----------SPSKSDDETVSMDET  75

Query  583  MSPCDSLRSPEVEYIDNNETAGVHSIEKKASSALYISEHQETTGNICKRDIIVD  744
             S CDS +SP+VEYIDN+E + V SIEKKA S LYI+++ ET    C RD++ D
Sbjct  76   RSTCDSFKSPQVEYIDNDEVSAVVSIEKKALSNLYITQNPETLEKYCSRDVLSD  129



>gb|KJB64518.1| hypothetical protein B456_010G052900 [Gossypium raimondii]
 gb|KJB64520.1| hypothetical protein B456_010G052900 [Gossypium raimondii]
Length=482

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 68/181 (38%), Positives = 97/181 (54%), Gaps = 17/181 (9%)
 Frame = +1

Query  199  NRHGKVAAAADQRLAHKRPALTNITNQRTGsllssrstfsesssIAPCTSKNVGIKKSSS  378
            N+  K+ AA  Q  + KR AL++ITNQR G    SR+  + S  + PCTSK    K++S+
Sbjct  25   NQSKKMGAAKTQ-FSKKRVALSDITNQRNGFPSGSRAMVTHSKPMVPCTSKVAKKKETST  83

Query  379  SSTGNA--GFLGTSIVPTSTLVKPITVPSKGPSAIGSDAILQKATLPPVTCSMDNSPAKS  552
              T  +   F G S + T      I      P+         K +  P+  SMD SP +S
Sbjct  84   LPTTPSLESFDGVSCINT------ICTRDDHPTT--------KVSALPLPSSMDISPCRS  129

Query  553  DGMTASMDESMSPCDSLRSPEVEYIDNNETAGVHSIEKKASSALYISEHQETTGNICKRD  732
               + S+DE+MS CDSL SP+ EY++N + + + SIE KA+  LYISE  +  G I K +
Sbjct  130  PCASVSLDETMSTCDSLESPKFEYLENEDVSAIESIETKANDNLYISELTQKEGKISKTN  189

Query  733  I  735
            I
Sbjct  190  I  190



>gb|KEH35323.1| carboxy-terminal domain cyclin [Medicago truncatula]
Length=505

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 43/78 (55%), Positives = 59/78 (76%), Gaps = 1/78 (1%)
 Frame = +1

Query  514  PVTCSMD-NSPAKSDGMTASMDESMSPCDSLRSPEVEYIDNNETAGVHSIEKKASSALYI  690
            PV+ SMD +SP KSDGM+ SMDE+MS CDS +SP++EY+DN++   V SIE+K   +L I
Sbjct  140  PVSSSMDLSSPGKSDGMSVSMDETMSSCDSFKSPDIEYVDNSDVPAVDSIERKTFCSLNI  199

Query  691  SEHQETTGNICKRDIIVD  744
            S+    +GNIC RDI+V+
Sbjct  200  SDSNYPSGNICSRDILVE  217



>ref|XP_003630475.1| Cyclin A-like protein [Medicago truncatula]
Length=531

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 43/78 (55%), Positives = 59/78 (76%), Gaps = 1/78 (1%)
 Frame = +1

Query  514  PVTCSMD-NSPAKSDGMTASMDESMSPCDSLRSPEVEYIDNNETAGVHSIEKKASSALYI  690
            PV+ SMD +SP KSDGM+ SMDE+MS CDS +SP++EY+DN++   V SIE+K   +L I
Sbjct  140  PVSSSMDLSSPGKSDGMSVSMDETMSSCDSFKSPDIEYVDNSDVPAVDSIERKTFCSLNI  199

Query  691  SEHQETTGNICKRDIIVD  744
            S+    +GNIC RDI+V+
Sbjct  200  SDSNYPSGNICSRDILVE  217



>ref|XP_004160710.1| PREDICTED: cyclin-A1-1-like [Cucumis sativus]
Length=506

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 64/185 (35%), Positives = 101/185 (55%), Gaps = 14/185 (8%)
 Frame = +1

Query  208  GKVAAAADQRLAHKRPALTNITNQRTGsllssrstfsesssIAPCTSKNVGIKKSSSSST  387
            GKV A     LA KR  L N+TN +     S+  +      + PC +K V  +KSS + T
Sbjct  33   GKVMAVPPH-LAKKRAPLGNLTNFK-NVSHSAAKSSGPPPVMVPCATKAVKARKSSPART  90

Query  388  GNAGFLGTSIVPTSTLVKPITVPSKGPSAIGSDAILQKATLPPVTCSMDNSPAKSDGMTA  567
             +     T+   T+T++   T  +  PS + +     +  +  V+  MD SP+KSDG++ 
Sbjct  91   RSTNLPVTN---TTTMLDVKTTNAVAPSNVTA---FSRTDVTAVSSCMDVSPSKSDGVSV  144

Query  568  SMDESMSPCDSLRSPEVEYIDNNETAGVHSIEKKASSALYISEHQETT------GNICKR  729
            S+DE++S CDS +SP+VEY+DN +   V S+E+K  S+L IS H   +      G+IC R
Sbjct  145  SLDETISTCDSFKSPDVEYLDNTDVPAVDSVERKTKSSLCISGHAPISCQPPIKGSICSR  204

Query  730  DIIVD  744
            D++ +
Sbjct  205  DVLTE  209



>ref|XP_002893979.1| CYCA1_1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH70238.1| CYCA1_1 [Arabidopsis lyrata subsp. lyrata]
Length=467

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 66/170 (39%), Positives = 93/170 (55%), Gaps = 33/170 (19%)
 Frame = +1

Query  238  LAHKRPALTNITNQRTGsllssrstfsesssIAPCTSKNVGIKKSSSSSTG-NAGFLGTS  414
            +  KR  L+NITNQ+ GS L + S  S       C++K+  +K + +     NAGF  ++
Sbjct  39   MTKKRAPLSNITNQKNGSRLPNSSFDSVH-----CSNKSAKLKLAPTPPVCVNAGF-SSN  92

Query  415  IVPTSTLVKPITVPSKGPSAIGSDAILQKATLPPVTCSMDNSPAKSDGMTASMDESMSPC  594
            ++P                       LQK+ +P    S   SP+KSD  + SMDE+MS  
Sbjct  93   VLP-----------------------LQKSVVPHKVAS---SPSKSDDGSVSMDETMSSS  126

Query  595  DSLRSPEVEYIDNNETAGVHSIEKKASSALYISEHQETTGNICKRDIIVD  744
            DS +SP+VEYIDN+E + V SIE+KA S LYI+   ET GN C RD++ D
Sbjct  127  DSYKSPQVEYIDNDEVSAVVSIERKALSNLYITPTSETIGNYCSRDVLSD  176



>ref|XP_008219599.1| PREDICTED: cyclin-A1-4-like [Prunus mume]
Length=514

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 65/191 (34%), Positives = 95/191 (50%), Gaps = 17/191 (9%)
 Frame = +1

Query  223  AADQRLAHKRPALTNITNQRTGsllssrstfsesssIAPCTSKNVGIKKSSSSSTGNAGF  402
            A   ++A+KR AL ++TNQR GS     +  + S  + PC +K     K  S+ + N   
Sbjct  33   ATRAQVANKRTALADVTNQRNGSQGGPPTFIASSKPLVPCATKLAKTTKELSTCSSNTDL  92

Query  403  LGTSIVPTSTLVKPITVPSKGPSAIGSDAILQ----------KATLPPVTCSM-------  531
             G    P+ +    I VP    S  G +   +            T+ P   S+       
Sbjct  93   SGNVFPPSLSAKSSIVVPFSDTSFSGRNTTTEIVATNPSPSSSVTVLPAPSSIVHTFRSR  152

Query  532  DNSPAKSDGMTASMDESMSPCDSLRSPEVEYIDNNETAGVHSIEKKASSALYISEHQETT  711
            D SP +S   + S+DE+MS C+SL+SPE EYIDN E + V SIEKK + +L IS++    
Sbjct  153  DGSPRRSVSGSVSLDENMSTCESLKSPEFEYIDNEEISEVKSIEKKTTKSLCISDYPGKE  212

Query  712  GNICKRDIIVD  744
            GNI K+D  V+
Sbjct  213  GNIWKKDTYVN  223



>gb|KFK24211.1| hypothetical protein AALP_AAs42301U000600 [Arabis alpina]
Length=444

 Score = 89.4 bits (220),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 40/69 (58%), Positives = 53/69 (77%), Gaps = 0/69 (0%)
 Frame = +1

Query  538  SPAKSDGMTASMDESMSPCDSLRSPEVEYIDNNETAGVHSIEKKASSALYISEHQETTGN  717
            SP+KSD  T SMDE+MS CDS +SP+VEYIDN++ + V SIE+KA S LYI+++ ET G 
Sbjct  86   SPSKSDDETVSMDETMSTCDSFKSPQVEYIDNDQVSAVVSIERKALSNLYITQNPETLGK  145

Query  718  ICKRDIIVD  744
             C RD++ D
Sbjct  146  YCSRDVLSD  154



>ref|XP_004292715.1| PREDICTED: cyclin-A1-4-like [Fragaria vesca subsp. vesca]
Length=506

 Score = 89.7 bits (221),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 72/197 (37%), Positives = 104/197 (53%), Gaps = 23/197 (12%)
 Frame = +1

Query  208  GKVAAAADQRLAHKRPALTNITNQRTGsllssrstfsesssIAPCTSKNVGIKKSSSSST  387
             K A AA  ++A KR AL ++TNQR GS     S+ S    + PCT+K V  KK +S+S 
Sbjct  23   NKKAMAAKPQVAKKRTALCDVTNQRNGSQTGPWSSASSLKPMVPCTTKVVKTKKETSTSI  82

Query  388  GNAGFLGTSIVPTSTLVKP-ITVPSKGPSAIGSDAILQ----------KATLPPVTCSM-  531
             N G  G ++ P S   K  + VP    S   S   ++          + T+ P + S+ 
Sbjct  83   SNHGLSG-NVFPESLNSKSSVLVPYSDTSVSRSVESIETIATNHSPSSRGTVFPASSSII  141

Query  532  ------DNSPAKSDGMTASMDESMSPCDSLRSPEVEYIDNNETAGVHSIEKKASSALYIS  693
                  D SP++S     S+DESMS  +S++SPE EYID+ + + V SIEKK  S+LY +
Sbjct  142  QALRSKDVSPSRS----VSLDESMSTSNSVKSPEFEYIDSEDISEVKSIEKKTISSLYTT  197

Query  694  EHQETTGNICKRDIIVD  744
            +  +  G I KRD+  D
Sbjct  198  DIPQIEGIIQKRDVFTD  214



>ref|XP_010063417.1| PREDICTED: cyclin-A1-1 [Eucalyptus grandis]
 gb|KCW70645.1| hypothetical protein EUGRSUZ_F03815 [Eucalyptus grandis]
Length=498

 Score = 89.0 bits (219),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 68/175 (39%), Positives = 99/175 (57%), Gaps = 18/175 (10%)
 Frame = +1

Query  238  LAHKRPALTNITNQRTGsllssrstfsesssIAPCT-----SKNVGIKKSSSSSTGNAGF  402
            LA KR  L N+TN + G   S  S+       AP T     +K    +K SS+S+   G 
Sbjct  45   LAKKRAPLGNLTNLKAGDGNSRSSS-------APSTLVANATKLAKTRKGSSTSSSIMGL  97

Query  403  LGTSIVPTSTLVKPITVPSKGPSAIGSDAILQKATLPPVTCSMDNSPAKSDGMTASMDES  582
             G+++ P     KP  V    PS   S   ++ A + P+ CSM  SP++SD  + S+DES
Sbjct  98   SGSAL-PRYASTKPSGV---LPSVNLSIPRIEIA-VDPMPCSMVVSPSRSDMQSVSLDES  152

Query  583  MSPCDSLRSPEVEYIDNNETAGVHSIEKKASSALYISEHQETTG-NICKRDIIVD  744
            MS C+S +SP+VEYIDN + + V SI++K  S LYIS+    T  NIC+RD++++
Sbjct  153  MSTCESFKSPDVEYIDNEDVSAVDSIDRKTFSNLYISDTAAKTAVNICERDVLME  207



>ref|XP_008352630.1| PREDICTED: cyclin-A1-1-like [Malus domestica]
Length=210

 Score = 85.9 bits (211),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 58/162 (36%), Positives = 76/162 (47%), Gaps = 26/162 (16%)
 Frame = +1

Query  337  PCTSK---------NVGIKKSSSSSTGNAGFLGTSIVPTSTLVKPITVPSKGPSAIGSDA  489
            PCT+K              K  SS T N G  G     + +    I VP    S  G+D 
Sbjct  13   PCTNKIAKTIANKTTAKTTKEVSSCTSNTGLSGNVFQASLSAKSNILVPFSDTSFSGTDP  72

Query  490  ILQK-----------ATLPPVTC------SMDNSPAKSDGMTASMDESMSPCDSLRSPEV  618
             ++              LP ++C      S D SP++S   + S+DESMS CDSL SPE 
Sbjct  73   AIKVFCTDPSPSSSGTVLPALSCINHAFRSWDASPSRSVSASVSLDESMSTCDSLNSPEF  132

Query  619  EYIDNNETAGVHSIEKKASSALYISEHQETTGNICKRDIIVD  744
            EYIDN + + V  IEKK + +L+IS H     NI K+DI  D
Sbjct  133  EYIDNEDVSDVKWIEKKTTKSLFISNHPGKEANIWKKDIFFD  174



>ref|XP_010530202.1| PREDICTED: cyclin-A1-1 [Tarenaya hassleriana]
Length=493

 Score = 89.0 bits (219),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 70/186 (38%), Positives = 101/186 (54%), Gaps = 24/186 (13%)
 Frame = +1

Query  205  HGKVAAAADQRLAHKRPALTNITNQRTGsllssrstfsesssIAPCTSKNVGIKKSSSSS  384
             GK  AAA  RL  KR  L+NITNQ++ S + + S+ S       C++K+  IK + +  
Sbjct  31   FGKPTAAAP-RLTKKRAPLSNITNQKSVSRIPNSSSTSVH-----CSNKSAKIKVAPTQP  84

Query  385  TGNAGF----LGTSIVPTSTLVKPITVPSKGPSAIGSDAILQKATLPPVT--CSMD-NSP  543
             G        L T +      V  +T   +  SAI           P V+  C  + +SP
Sbjct  85   VGLNDLTSTGLRTHLAVVRNKVTSLTCRDENASAIA----------PIVSNQCETEASSP  134

Query  544  AKSDGMTASMDESMSPCDSLRSPEV-EYIDNNETAGVHSIEKKASSALYISEHQETTGNI  720
               + ++ SMDESMS CDS +SP+V EYI+N+E + V S+E+KA S LYI+++ ETTGN 
Sbjct  135  IHCEDVSVSMDESMSTCDSFKSPQVVEYIENDEVSAVESVERKALSNLYITKNSETTGNF  194

Query  721  CKRDII  738
            C RD +
Sbjct  195  CSRDAL  200



>ref|XP_009343978.1| PREDICTED: cyclin-A1-1-like [Pyrus x bretschneideri]
Length=515

 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 70/198 (35%), Positives = 94/198 (47%), Gaps = 20/198 (10%)
 Frame = +1

Query  208  GKVAAAADQRLAHKRPALTNITNQRTGsllssrstfsesssIAPCT---SKNVGIK----  366
             K   AA  ++  KR AL ++TNQR     S   T + S  + PCT   +K +  K    
Sbjct  28   NKKPMAAKTQVPKKRTALADVTNQR-NRCQSVPPTLASSKPMVPCTNTIAKTIANKTTAK  86

Query  367  --KSSSSSTGNAGFLGTSIVPTSTLVKPITVPSKGPSAIGSDAILQKATLPP--------  516
              K  SS T N G  G     + +    I VP    S  G+D  ++     P        
Sbjct  87   MTKEVSSCTNNTGLSGNVFQASLSAKSNILVPFSDTSFSGTDLAIEVIRTDPSPSSSGTV  146

Query  517  --VTCSMDNSPAKSDGMTASMDESMSPCDSLRSPEVEYIDNNETAGVHSIEKKASSALYI  690
                 S D SP++S   + S+DESMS CDSL+SPE EYIDN + + V  IEKK + +L+I
Sbjct  147  NHAFRSRDASPSRSVSASVSLDESMSTCDSLKSPEFEYIDNEDVSDVKWIEKKTTKSLFI  206

Query  691  SEHQETTGNICKRDIIVD  744
            S       NI K+DI  D
Sbjct  207  SNSPGKEANIWKKDIFFD  224



>ref|NP_001237800.1| mitotic cyclin a2-type [Glycine max]
 dbj|BAA09466.1| mitotic cyclin a2-type [Glycine max]
Length=484

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 66/178 (37%), Positives = 94/178 (53%), Gaps = 16/178 (9%)
 Frame = +1

Query  220  AAADQRLAHKRPALTNITNQRTGsllssrstfsesssIAPCTSKNVGIKKSSS-SSTGNA  396
            AAA   +A KRP L+N+TN       SS           PC +K    KK    + +GN 
Sbjct  32   AAAPTNMAKKRPPLSNLTNTVAHRNSSSS---------VPCAAKFAKTKKDVVPACSGNK  82

Query  397  GFLGTSIVPTSTLVKPI--TVPSKGPSAIGSDAILQKATLPPVTCSMDNSPAKSDGMTAS  570
                 ++ P S ++ P   + P K  +       +   T+      +D SP+KSD M+ S
Sbjct  83   RPTLANVKPASAVIFPKANSFPVKNEAPPTPPPPVATVTV--PAPVVDVSPSKSDTMSVS  140

Query  571  MDESMSPCDSLRSPEVEYIDNNETAGVHSIEKKASSALYISEHQETTGNICKRDIIVD  744
             DESMS CDS +SP++EY+DN++ A V SIE+K  S L IS+   T GNIC R+I+V+
Sbjct  141  TDESMSSCDSFKSPDIEYVDNSDVAAVDSIERKTFSHLNISD--STEGNICSREILVE  196



>ref|XP_003545652.1| PREDICTED: cyclin-A1-1-like [Glycine max]
Length=504

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 72/185 (39%), Positives = 104/185 (56%), Gaps = 14/185 (8%)
 Frame = +1

Query  208  GKVAAAADQRLAHKRPALTNITNQRTGsllssrstfsesssIAPCTSKNVGIKKSSSSST  387
            GK      Q +A KR  L N+TNQR  S  SS S     S     T K    + S + ST
Sbjct  37   GKAKRVTTQNVAVKRAPLANLTNQRNASSSSSSSLVQGGSIKVSKTKKEAPARTSITKST  96

Query  388  GNAGFL-GTSIVPTSTLVKPI--TVPSKGPSA--IGSDAILQKATLPPVTCSMDNSPAKS  552
             +   L     V +S++V P   ++P +  +A  + S A+       PV  S+D SP+K 
Sbjct  97   ISWNKLPELKSVNSSSVVIPRANSLPRRKDAAPTVASFAV-------PVHSSIDVSPSKI  149

Query  553  DGMTASMDESMSPCDSLRSP-EVEYIDNNETAGVHSIEKKASSALYISEHQETTGNICKR  729
            DG + SMDE+MS CDS+ SP EVEY+DN + + VHSI+++ +S L IS+ +E  G++C R
Sbjct  150  DGRSVSMDETMS-CDSIESPDEVEYMDNRDVSDVHSIQREITSNLNISDTKEPEGDVCSR  208

Query  730  DIIVD  744
            +IIV+
Sbjct  209  EIIVE  213



>ref|XP_010684698.1| PREDICTED: cyclin-A1-4-like [Beta vulgaris subsp. vulgaris]
Length=504

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 67/191 (35%), Positives = 97/191 (51%), Gaps = 22/191 (12%)
 Frame = +1

Query  196  ENRHGKVAAAADQRLAHKRPALTNITNQRTGsllssrstfsesssIAPC-TSKNVGIKKS  372
            EN +  V + ++ R   KRP L+N+TNQ          +     ++ PC T+KN+  KK 
Sbjct  34   ENGNSNVISISNNR---KRPPLSNLTNQ--------SRSSVSLPTLVPCVTTKNIKAKKG  82

Query  373  SSSSTGNAGFLGTSIVPTSTLVKPITVPSKGPSAIGSDAI-LQKATLPPVTCS-------  528
              +    A   G +  P          PSK  S   SDA+ + + T   V  +       
Sbjct  83   YDTRFNTAKIPGNNQPPFLIKKHDAVAPSKI-SLPRSDAVAVCRVTSSKVATTGVSSRMD  141

Query  529  -MDNSPAKSDGMTASMDESMSPCDSLRSPEVEYIDNNETAGVHSIEKKASSALYISEHQE  705
             MD SP  SD  + SM++SMS CDSL+SPE+EY+D +E   + SI++K S  L+I E  E
Sbjct  142  HMDVSPTPSDADSMSMEDSMSTCDSLKSPEIEYLDESEITTLSSIQRKTSQNLHIDEQVE  201

Query  706  TTGNICKRDII  738
              GN CKR+I+
Sbjct  202  IAGNYCKREIL  212



>ref|XP_007137455.1| hypothetical protein PHAVU_009G128200g [Phaseolus vulgaris]
 gb|ESW09449.1| hypothetical protein PHAVU_009G128200g [Phaseolus vulgaris]
Length=488

 Score = 87.4 bits (215),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 63/169 (37%), Positives = 93/169 (55%), Gaps = 15/169 (9%)
 Frame = +1

Query  247  KRPALTNITNQRTGsllssrstfsesssIAPCTSKNVGIKKSSSS-STGNAGFLGTSIVP  423
            KRP L+N+TN       SS           PC +K    KK      +GN      ++ P
Sbjct  44   KRPPLSNLTNTVAHRNSSSS---------VPCAAKLAKTKKEPVPLCSGNKRPALANVKP  94

Query  424  TSTLVKPI--TVPSKGPSAIGSDAILQKATLPPVTCSMDNSPAKSDGMTASMDESMSPCD  597
            T+ +V P   ++P++  +      ++   T+      +D SP+ SD M+ SMDESMS CD
Sbjct  95   TNAVVFPKANSLPARNQAPPPPPPLVLTVTV--PPPVLDASPSTSDAMSVSMDESMSSCD  152

Query  598  SLRSPEVEYIDNNETAGVHSIEKKASSALYISEHQETTGNICKRDIIVD  744
            S +SP++EY+DN++ A V SIE+K  S L IS+  E +GNIC RDI+V+
Sbjct  153  SFKSPDIEYVDNSDIAAVDSIERKTFSNLNISDSAE-SGNICSRDILVE  200



>gb|KHN38997.1| Cyclin-A1-1 [Glycine soja]
Length=504

 Score = 87.0 bits (214),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 71/185 (38%), Positives = 104/185 (56%), Gaps = 14/185 (8%)
 Frame = +1

Query  208  GKVAAAADQRLAHKRPALTNITNQRTGsllssrstfsesssIAPCTSKNVGIKKSSSSST  387
            GK      Q +A KR  L N+TNQR  S  SS S     S     T K    + S + ST
Sbjct  37   GKAKRVTTQNVAVKRAPLANLTNQRNASSSSSSSLVQGGSIKVSKTKKEAPARTSITKST  96

Query  388  GNAGFL-GTSIVPTSTLVKPI--TVPSKGPSA--IGSDAILQKATLPPVTCSMDNSPAKS  552
             +   L     V +S++V P   ++P +  +A  + + A+       PV  S+D SP+K 
Sbjct  97   ISWNKLPELKSVNSSSVVIPRANSLPRRKDAAPTVATFAV-------PVHSSIDVSPSKI  149

Query  553  DGMTASMDESMSPCDSLRSP-EVEYIDNNETAGVHSIEKKASSALYISEHQETTGNICKR  729
            DG + SMDE+MS CDS+ SP EVEY+DN + + VHSI+++ +S L IS+ +E  G++C R
Sbjct  150  DGRSVSMDETMS-CDSIESPDEVEYMDNRDVSDVHSIQREITSNLNISDTKEPEGDVCSR  208

Query  730  DIIVD  744
            +IIV+
Sbjct  209  EIIVE  213



>ref|XP_008466750.1| PREDICTED: cyclin-A1-1 [Cucumis melo]
Length=507

 Score = 86.7 bits (213),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 61/185 (33%), Positives = 94/185 (51%), Gaps = 14/185 (8%)
 Frame = +1

Query  208  GKVAAAADQRLAHKRPALTNITNQRTGsllssrstfsesssIAPCTSKNVGIKKSSSSST  387
            GKV A     LA KR  L N+TN +     S+  +      + PC +K +  +KSS + T
Sbjct  33   GKVLAVPPH-LAKKRAPLGNLTNFK-NVSHSAAKSSGPPPIMVPCATKALKARKSSPART  90

Query  388  GNAGFLGTSIVPTSTLVKPITVPSKGPSAIGSDAILQKATLPPVTCSMDNSPAKSDGMTA  567
             +        +P +     + V +  P A  +     +     V+  MD SP+KSDG++ 
Sbjct  91   RSTN------MPVTNTTTMLDVKTTNPVAPSNVTAFSRTDATAVSSCMDVSPSKSDGVSV  144

Query  568  SMDESMSPCDSLRSPEVEYIDNNETAGVHSIEKKASSALYISE------HQETTGNICKR  729
            S+DE+MS CDS +SP+VEY+DN +   V S+E+K  S+L IS            G+IC R
Sbjct  145  SLDETMSTCDSFKSPDVEYMDNTDVPAVDSVERKTKSSLCISGPAPISCQAPIKGSICNR  204

Query  730  DIIVD  744
            D++ +
Sbjct  205  DVLTE  209



>ref|XP_006307397.1| hypothetical protein CARUB_v10009020mg [Capsella rubella]
 gb|EOA40295.1| hypothetical protein CARUB_v10009020mg [Capsella rubella]
Length=476

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 63/174 (36%), Positives = 92/174 (53%), Gaps = 33/174 (19%)
 Frame = +1

Query  238  LAHKRPALTNITNQRTGsllssrstfsesssIAPCTSKNVGIKKS--SSSSTGNAGF---  402
            +  KR  L+NITNQ+  S + + S+ S       C++K+  +K +  +     NA F   
Sbjct  40   MTKKRAPLSNITNQKNCSRIPNSSSDSVH-----CSNKSAKLKLAPPTQGVCENASFSSN  94

Query  403  LGTSIVPTSTLVKPITVPSKGPSAIGSDAILQKATLPPVTCSMDNSPAKSDGMTASMDES  582
            L  S+ P+    K +++P K                        +SP+KSD  + SMDE+
Sbjct  95   LLQSVKPSLVQSKVVSLPYKV-----------------------SSPSKSDDGSVSMDET  131

Query  583  MSPCDSLRSPEVEYIDNNETAGVHSIEKKASSALYISEHQETTGNICKRDIIVD  744
            MS  DS +SP+VEYIDN+E + V SIE+KA S LYI+   ET GN C RD++ D
Sbjct  132  MSSSDSYKSPQVEYIDNDEVSAVVSIERKALSNLYITPSSETLGNYCSRDVLSD  185



>emb|CDY36335.1| BnaC08g05160D [Brassica napus]
Length=424

 Score = 85.5 bits (210),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 41/84 (49%), Positives = 58/84 (69%), Gaps = 0/84 (0%)
 Frame = +1

Query  493  LQKATLPPVTCSMDNSPAKSDGMTASMDESMSPCDSLRSPEVEYIDNNETAGVHSIEKKA  672
            + K T  P   +  +SP+KSD  + S+D++MS CDS +SP+VEYIDN + + V SIE+KA
Sbjct  59   ISKVTSLPYEQTKLHSPSKSDAASVSIDKTMSSCDSYKSPQVEYIDNEQVSAVVSIERKA  118

Query  673  SSALYISEHQETTGNICKRDIIVD  744
             S LYI+   ETT N C+RD++ D
Sbjct  119  LSNLYITPSSETTFNCCRRDVLSD  142



>ref|XP_010925928.1| PREDICTED: cyclin-A1-4 [Elaeis guineensis]
Length=491

 Score = 80.1 bits (196),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 64/186 (34%), Positives = 100/186 (54%), Gaps = 16/186 (9%)
 Frame = +1

Query  196  ENRHGKVAAAADQRLAHKRPALTNITNQRTGsllssrstfsesssIAPCTSKNVGIKKSS  375
            EN     AAA++Q  A KR AL NITN+      +S    ++       TS  + +KK S
Sbjct  27   ENTANVAAAASEQ--AKKRVALGNITNKSNAGRSASWLPGTKGVDRESATSLTLNVKKGS  84

Query  376  SSSTGNAGFLGTSIVPTSTLV--KPITVP-SKGP-SAIGSDAILQKATLPPVTCSMDNSP  543
             +   +  F  +S+  ++  +  K I++P   GP S IG+          P  CS   SP
Sbjct  85   VTCVLDTNFPASSVTASAATISNKDISLPLCDGPASTIGT---------CPEPCSTVISP  135

Query  544  AKSDGMTASMDESMSPCDSLRSPEVEYIDNNETAGVHSIEKKASSALYISEHQETTGNIC  723
              S G + S DE+MS CDS++SP+ +YIDN +++ + S+E++A + L+IS+     G+ C
Sbjct  136  NHS-GDSVSSDETMSTCDSMKSPDFDYIDNGDSSAIASLERRAINNLHISDRANAAGSTC  194

Query  724  KRDIIV  741
            KRD+ V
Sbjct  195  KRDVPV  200



>gb|EPS73971.1| hypothetical protein M569_00786 [Genlisea aurea]
Length=324

 Score = 78.2 bits (191),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/56 (64%), Positives = 46/56 (82%), Gaps = 0/56 (0%)
 Frame = +1

Query  571  MDESMSPCDSLRSPEVEYIDNNETAGVHSIEKKASSALYISEHQETTGNICKRDII  738
            MDESMS CDSLRSP+VEY+DN + + + SIEKKAS+ L ISE+ +T  +ICKRD+I
Sbjct  1    MDESMSTCDSLRSPDVEYMDNKDISAIESIEKKASAILSISENFDTPVSICKRDVI  56



>ref|XP_010664179.1| PREDICTED: cyclin-A1-1-like [Vitis vinifera]
Length=424

 Score = 77.8 bits (190),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 67/196 (34%), Positives = 91/196 (46%), Gaps = 50/196 (26%)
 Frame = +1

Query  205  HGKVAAAADQRLAHKRPALTNITNQRTGsllssrstfsesssIAPCTSKNVGIKKSSSSS  384
            HGK     D   A KRP L N+TN+R G  + + +       +APCT+K   IKK S + 
Sbjct  5    HGK-----DVMAAKKRPPLRNVTNERKGPQIGASNA------MAPCTAKTFKIKKRSLTC  53

Query  385  TGNAGFLGTSIVPTSTLVKPITVPSKGPSAIGSDAILQKATLP----------------P  516
                  L  +  P S  VK        P+    D    K+  P                P
Sbjct  54   IRGTT-LSQNTFPASLNVK------SSPAVSCEDTCFPKSDQPVGSLSASSSMVSVLSAP  106

Query  517  VTCSMDNSPAKSDGMTASMDESMSPCDSLRSPEVEYIDNNETAGVHSIEKKASSALYISE  696
             T  M  SP++SDG + S+DE+MS CDSL+SPE EYI+N++ + V  +E K         
Sbjct  107  RT--MGVSPSQSDG-SVSLDETMSTCDSLKSPEFEYINNHDASPVSFVETK---------  154

Query  697  HQETTGNICKRDIIVD  744
                TGNICK D+ V+
Sbjct  155  ----TGNICKGDVEVE  166



>ref|XP_010461434.1| PREDICTED: cyclin-A1-1-like [Camelina sativa]
Length=486

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/58 (60%), Positives = 43/58 (74%), Gaps = 0/58 (0%)
 Frame = +1

Query  571  MDESMSPCDSLRSPEVEYIDNNETAGVHSIEKKASSALYISEHQETTGNICKRDIIVD  744
            MD++MS CDS +SP+VEYIDN E + V SIE+KA S LYIS   ET GN C RD++ D
Sbjct  139  MDDTMSICDSYKSPQVEYIDNKEVSAVVSIERKALSNLYISPSSETLGNYCSRDVLSD  196



>ref|XP_008806186.1| PREDICTED: cyclin-A1-4 isoform X1 [Phoenix dactylifera]
Length=493

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 54/167 (32%), Positives = 91/167 (54%), Gaps = 12/167 (7%)
 Frame = +1

Query  241  AHKRPALTNITNQRTGsllssrstfsesssIAPCTSKNVGIKKSSSSSTGNAGFLGTSIV  420
            A KR AL N+TNQ      +SR   ++       TS ++ +KK S +   +     +S+ 
Sbjct  42   AKKRVALGNVTNQSNAGRSASRLPGTKGVHRGSTTSSSLNVKKGSVTCVRDTNLPRSSVT  101

Query  421  PTSTLV--KPITVP-SKGPSAIGSDAILQKATLPPVTCSMDNSPAKSDGMTASMDESMSP  591
             ++  +  K +++P   GP++             P  CS+  SP +S G + S DE+MS 
Sbjct  102  ASAATISSKDVSLPLHHGPTSTTGTC--------PEPCSIVISPNRSGG-SVSSDETMST  152

Query  592  CDSLRSPEVEYIDNNETAGVHSIEKKASSALYISEHQETTGNICKRD  732
            C+S+RSP+ EYIDN +++ + S+E++A   L+IS+H    G++ KRD
Sbjct  153  CESMRSPDFEYIDNGDSSAIASLERRAIKNLHISDHANAAGSVWKRD  199



>ref|XP_007223288.1| hypothetical protein PRUPE_ppa005557mg [Prunus persica]
 gb|EMJ24487.1| hypothetical protein PRUPE_ppa005557mg [Prunus persica]
Length=454

 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 52/154 (34%), Positives = 75/154 (49%), Gaps = 17/154 (11%)
 Frame = +1

Query  334  APCTSKNVGIKKSSSSSTGNAGFLGTSIVPTSTLVKPITVPSKGPSAIGSDAILQ-----  498
             PC +K     K  S+   +    G    P+ +    I VP    S  G +   +     
Sbjct  10   VPCATKIAKTTKELSTCANDTDLSGNVFPPSLSAKSSIVVPFSDTSFSGKNTTTEIVATN  69

Query  499  -----KATLPPVTCSM-------DNSPAKSDGMTASMDESMSPCDSLRSPEVEYIDNNET  642
                   T+ PV  S+       D SP++S   + S+DE+MS C+SL+SPE EYIDN E 
Sbjct  70   PSPSSSVTVLPVPSSIVHTFRSRDGSPSRSVSGSVSLDENMSTCESLKSPEFEYIDNEEI  129

Query  643  AGVHSIEKKASSALYISEHQETTGNICKRDIIVD  744
            + V SIEKK + +L IS++    GNI K+D  V+
Sbjct  130  SEVKSIEKKTTKSLCISDYPGKEGNIWKKDTFVN  163



>ref|NP_175077.1| cyclin-A1-1 [Arabidopsis thaliana]
 sp|Q9C6Y3.1|CCA11_ARATH RecName: Full=Cyclin-A1-1; AltName: Full=G2/mitotic-specific 
cyclin-A1-1; Short=CycA1;1 [Arabidopsis thaliana]
 gb|AAG50557.1|AC074228_12 mitotic cyclin a2-type, putative [Arabidopsis thaliana]
 dbj|BAD43169.1| putative mitotic cyclin a2-type [Arabidopsis thaliana]
 gb|AEE32021.1| cyclin-A1-1 [Arabidopsis thaliana]
Length=460

 Score = 75.1 bits (183),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 57/84 (68%), Gaps = 3/84 (4%)
 Frame = +1

Query  493  LQKATLPPVTCSMDNSPAKSDGMTASMDESMSPCDSLRSPEVEYIDNNETAGVHSIEKKA  672
            LQ++ +P    S   SP+KSD  + SMDE+ S  DS +SP+VEYI+N++ + V SIE+KA
Sbjct  89   LQQSIVPHKVAS---SPSKSDDGSVSMDETRSSSDSYKSPQVEYIENDDVSAVVSIERKA  145

Query  673  SSALYISEHQETTGNICKRDIIVD  744
             S L+I+ + ET  N C RD++ D
Sbjct  146  LSNLFITPNSETIDNYCSRDVLSD  169



>ref|XP_006355258.1| PREDICTED: cyclin-A1-1-like [Solanum tuberosum]
Length=174

 Score = 56.6 bits (135),  Expect(2) = 7e-12, Method: Compositional matrix adjust.
 Identities = 31/53 (58%), Positives = 37/53 (70%), Gaps = 2/53 (4%)
 Frame = +1

Query  481  SDAILQKATL--PPVTCSMDNSPAKSDGMTASMDESMSPCDSLRSPEVEYIDN  633
            S+AIL K T    P TCSM  SP+ SD    SMDESMS  D++R+PEVEYID+
Sbjct  15   SEAILPKITAIHVPATCSMVISPSHSDESLVSMDESMSTSDTVRTPEVEYIDD  67


 Score = 41.2 bits (95),  Expect(2) = 7e-12, Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 27/44 (61%), Gaps = 0/44 (0%)
 Frame = +2

Query  614  KLNILTTMKLLEFIPLRRRHLVRSIFRNTKKQQEIYARET*LWT  745
            ++  +  M  L+ IP RRR +  S  +N  KQQ++YARE  LWT
Sbjct  61   EVEYIDDMNWLQLIPSRRRRVAPSTSQNMSKQQQLYAREIYLWT  104



>ref|XP_003630468.1| Cyclin A [Medicago truncatula]
Length=558

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 69/203 (34%), Positives = 88/203 (43%), Gaps = 34/203 (17%)
 Frame = +1

Query  208  GKVAAAADQRLAHKRPALTNITNQRTGsllssrstfsesssIAPCTSKNVGIKKSS----  375
             K  AA   RL  KRPAL ++TN R  SL+ +         + PC SK    KK S    
Sbjct  27   NKNVAAVKTRLTKKRPALADVTNNRNASLVKTSLAAPYKPMV-PCASKTAKTKKDSIASS  85

Query  376  ------------SSSTGNAGFL------GTSIVPTSTLVKPITVPSKGPSAIGSDAILQK  501
                        SS   ++GFL       T      T VK    PS    A+  D     
Sbjct  86   QKNVMSENILQPSSRIRSSGFLVSKEACSTKASQIKTGVKAFIAPS-NDGAVCPD-----  139

Query  502  ATLPPVTCS---MDNSPAKSDGMTASMDESMSPCDSLRSPEVEYIDNNETAGVHSIEKKA  672
                 V CS   MD  P+ S   +AS+DESMS  DSL +PE EYI N++   + SIE K 
Sbjct  140  --FKSVVCSPRWMDIYPSNSFSGSASLDESMSTSDSLMTPEFEYIRNDDVVSIKSIENKT  197

Query  673  SSALYISEHQETTGNICKRDIIV  741
             + L IS+  +  G I   D I+
Sbjct  198  CNILNISDSSKMGGRIHDIDTIL  220



>ref|XP_010095429.1| hypothetical protein L484_013386 [Morus notabilis]
 gb|EXB60121.1| hypothetical protein L484_013386 [Morus notabilis]
Length=498

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 55/184 (30%), Positives = 95/184 (52%), Gaps = 2/184 (1%)
 Frame = +1

Query  199  NRHGKVAAAADQRLAHKRPALTNITNQRTGsllssrstfsesssIAPCTSKNVGIKKSSS  378
            ++ G+   A+  +LA KR AL +ITNQ+ GS    +++      + PC +K    K   S
Sbjct  25   DKSGEKVMASKAQLAKKRSALADITNQKNGSQTGPKTSSFPLKPMVPCMAKIAKTKSEFS  84

Query  379  SSTGNAGFLGTSIVPTSTLVKPITVPSKGPS-AIGSDAILQKATLPPVTCSMDNSPAKSD  555
            +   +      +++ +S+    I VPS   S  I   A++ +  +      +D SP++S 
Sbjct  85   ACIPSTDISRHTLLESSSSKPTIGVPSSNASLTIRDTALIAQRRITNAPRCIDASPSRSV  144

Query  556  GMTASMDESMSPCDSLRSPEVEYIDNNE-TAGVHSIEKKASSALYISEHQETTGNICKRD  732
            G++  +D + S CDSL+  + +  DN E ++ V+SIE K S++  ISE     G+ C RD
Sbjct  145  GVSVYLDGNFSICDSLKCQDFDCDDNEEVSSAVNSIEGKPSNSFCISEDLGKPGSTCNRD  204

Query  733  IIVD  744
            +  D
Sbjct  205  VFFD  208



>gb|KEH35322.1| carboxy-terminal domain cyclin [Medicago truncatula]
Length=510

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 69/203 (34%), Positives = 88/203 (43%), Gaps = 34/203 (17%)
 Frame = +1

Query  208  GKVAAAADQRLAHKRPALTNITNQRTGsllssrstfsesssIAPCTSKNVGIKKSS----  375
             K  AA   RL  KRPAL ++TN R  SL+ +         + PC SK    KK S    
Sbjct  27   NKNVAAVKTRLTKKRPALADVTNNRNASLVKTSLAAPYKPMV-PCASKTAKTKKDSIASS  85

Query  376  ------------SSSTGNAGFL------GTSIVPTSTLVKPITVPSKGPSAIGSDAILQK  501
                        SS   ++GFL       T      T VK    PS    A+  D     
Sbjct  86   QKNVMSENILQPSSRIRSSGFLVSKEACSTKASQIKTGVKAFIAPSND-GAVCPD-----  139

Query  502  ATLPPVTCS---MDNSPAKSDGMTASMDESMSPCDSLRSPEVEYIDNNETAGVHSIEKKA  672
                 V CS   MD  P+ S   +AS+DESMS  DSL +PE EYI N++   + SIE K 
Sbjct  140  --FKSVVCSPRWMDIYPSNSFSGSASLDESMSTSDSLMTPEFEYIRNDDVVSIKSIENKT  197

Query  673  SSALYISEHQETTGNICKRDIIV  741
             + L IS+  +  G I   D I+
Sbjct  198  CNILNISDSSKMGGRIHDIDTIL  220



>ref|XP_010500134.1| PREDICTED: cyclin-A1-1-like [Camelina sativa]
Length=474

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = +1

Query  565  ASMDESMSPCDSLRSPEVEYIDNNETAGVHSIEKKASSALYISEHQETTGNICKRDIIVD  744
             S++++MS CDS +SP+VEYIDN + + V SIE+KA S LYIS   ET GN C RD++ D
Sbjct  125  VSIEDTMSLCDSYKSPQVEYIDNKQVSAVVSIERKALSNLYISPSSETLGNYCSRDVLSD  184



>gb|KDO80524.1| hypothetical protein CISIN_1g043577mg, partial [Citrus sinensis]
Length=402

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 53/153 (35%), Positives = 85/153 (56%), Gaps = 20/153 (13%)
 Frame = +1

Query  334  APCTSKNVGIKKSSSSSTGNAGFLGTSIVPTSTLVKPITVPSKGPSAIGSDAILQKATLP  513
             PC++K +  KK SS+ + + G  G ++ P S  VK I V +K   +  SD  + +A +P
Sbjct  1    VPCSAK-IAKKKESSAHSHDKGLSGNTL-PASLSVK-IGVIAKDAFSTRSDHPIIRA-IP  56

Query  514  PVTCSMDNSPAKSDGM----------------TASMDESMSPCDSLRSPEVEYIDNNETA  645
              + ++ + PA S  +                + S+DE+MS CDSL+SPE  YID  +++
Sbjct  57   APSSNISSLPASSSAIMVPRCKNISPSTSVSGSVSLDETMSTCDSLKSPEFVYIDKEDSS  116

Query  646  GVHSIEKKASSALYISEHQETTGNICKRDIIVD  744
             V SIE++  S+L IS+  +  G  CKRDI+V+
Sbjct  117  AVKSIERRTCSSLNISDCAQGKGKTCKRDILVE  149



>gb|ADA70359.1| mitotic cyclin A1-like protein [Persea americana]
Length=479

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 64/183 (35%), Positives = 100/183 (55%), Gaps = 28/183 (15%)
 Frame = +1

Query  247  KRPALTNITNQRTGsllssrstfsesssIAPCTSKNVGIKKSSSSSTGNAGFLGTSIVPT  426
            KR ALTN+TNQ  G + +  S+       A  TSK+   KK     TG++G    S V  
Sbjct  17   KRAALTNLTNQSLGRMGTQVSS-------ASTTSKH---KKGPIMLTGDSGLRPNSSVSM  66

Query  427  STLVKPITV------PSKGPSAIGSDAILQK------ATLPPVT--CSMDNSPAKS-DGM  561
             T+ +  ++      P    +   + +IL+       A++ P+   C+   SP+KS D  
Sbjct  67   LTVKQATSIAHKSAFPKSSETLPNASSILRNKYEGPAASVIPLQQPCATKFSPSKSSDDG  126

Query  562  TASMDESMSPCDSLRSPEVEYIDNNETAGVHSIEKKASSALYISEHQETT-GNICKR-DI  735
            + S+DE+MS CDSL+SP++EY+D NE + V S+E++    LYISE   +  G++ KR DI
Sbjct  127  SVSLDETMSTCDSLKSPDIEYVD-NEASAVASLERRTCQNLYISEDANSKEGHVWKRSDI  185

Query  736  IVD  744
            ++D
Sbjct  186  LMD  188



>gb|KHN35496.1| Cyclin-A1-1 [Glycine soja]
Length=348

 Score = 71.2 bits (173),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 46/62 (74%), Gaps = 2/62 (3%)
 Frame = +1

Query  559  MTASMDESMSPCDSLRSPEVEYIDNNETAGVHSIEKKASSALYISEHQETTGNICKRDII  738
            M+ S DESMS CDS +SP++EY+DN++ A V SIE+K  S L IS+   T GNIC R+I+
Sbjct  1    MSVSTDESMSSCDSFKSPDIEYVDNSDVAAVDSIERKTFSHLNISD--STEGNICSREIL  58

Query  739  VD  744
            V+
Sbjct  59   VE  60



>ref|XP_008783212.1| PREDICTED: cyclin-A1-4-like [Phoenix dactylifera]
Length=534

 Score = 65.9 bits (159),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 48/71 (68%), Gaps = 1/71 (1%)
 Frame = +1

Query  523  CSMDNSPAKSDGMTASMDESMSPCDSLRSPEVEYIDNNETAGVHSIEKKASSALYISEHQ  702
            CS   SP  S G + S+ E+MS CDS++SP+ EYIDN +++ V S+E++AS   +IS+H 
Sbjct  172  CSTVISPNPS-GDSVSLAETMSTCDSMKSPDFEYIDNGDSSAVASLERRASDNFHISDHA  230

Query  703  ETTGNICKRDI  735
               G+  KRD+
Sbjct  231  NAAGSTWKRDV  241



>ref|XP_006859067.1| hypothetical protein AMTR_s00068p00198800 [Amborella trichopoda]
 gb|ERN20534.1| hypothetical protein AMTR_s00068p00198800 [Amborella trichopoda]
Length=498

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 54/170 (32%), Positives = 83/170 (49%), Gaps = 13/170 (8%)
 Frame = +1

Query  205  HGKVAAAADQRLAHKRPALTNITNQRTGsllssrstfsesssIAPCTSKNVGIKKS---S  375
            + KV      + A +R AL N+TNQ   +      T ++         ++ G K++   +
Sbjct  39   NAKVPVVQQTQQAKRRAALHNLTNQCRENQGMIELTTTKLRKAPISHVQDAGTKENRAPT  98

Query  376  SSSTGNAGFLGTSIVPTSTLVKPI--TVPSKGPSAIGSDAILQKATLPPVTCSMDNSPAK  549
            SS   + G + T     S   +P    +P K   + G    L         C+ + SP +
Sbjct  99   SSVPKSFGVVATKDTHLSRKEEPKGPHLPRKEEPSFGFVEFL-------APCNSNVSPNR  151

Query  550  SDGMTASMDESMSPCDSLRSPEVEYIDNNETAGVHSIEKKASSALYISEH  699
            SDG + SMDE+MS CDSL+SPE EY+DN E + V ++E+K    LYIS+ 
Sbjct  152  SDGDSVSMDETMSTCDSLKSPEFEYVDNAEDSIV-ALERKTCQNLYISKQ  200



>ref|XP_009399851.1| PREDICTED: cyclin-A1-4-like [Musa acuminata subsp. malaccensis]
Length=495

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 57/176 (32%), Positives = 96/176 (55%), Gaps = 2/176 (1%)
 Frame = +1

Query  208  GKVAAAADQRLAHKRPALTNITNQRTGsllssrstfsesssIAPCTSKNVGIKKSSSSST  387
             K+A A  ++ A KR AL NI+NQ   +   +R   ++S++ A  TS    +KK S +  
Sbjct  29   AKLATAMGEQ-AKKRVALGNISNQSNVARNPARPLGAKSANKAIPTSSASTVKKGSLTGA  87

Query  388  GNAGFLGTSIVPTSTLVKPITVPSKGPSAIGSDAILQKATLPPVTCSMDNSPAKSDGMTA  567
             +     +S V TS  ++P T  S   S++  +   + A    +T  +    +   G + 
Sbjct  88   RDTRLSRSSAV-TSATIRPNTNKSSKRSSLPVNNGPKPAAAASLTSCIIVESSNFSGDSV  146

Query  568  SMDESMSPCDSLRSPEVEYIDNNETAGVHSIEKKASSALYISEHQETTGNICKRDI  735
            S+DE+MS CD ++SP+VEYIDN +++ V S+E++A+  L+ISEH    G+    D+
Sbjct  147  SLDETMSTCDLMKSPDVEYIDNGDSSVVASLERRATENLHISEHVAAAGSTSNIDV  202



>ref|XP_006643958.1| PREDICTED: cyclin-A1-1-like [Oryza brachyantha]
Length=496

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 58/183 (32%), Positives = 92/183 (50%), Gaps = 23/183 (13%)
 Frame = +1

Query  217  AAAADQRLAHKRPALTNITNQRTGsllssrstfsesssIAPCTSKNVGIKKSSSSSTGNA  396
            AA A  + A KR AL NITN       +  ++ +    +AP    ++G  +S+S++  + 
Sbjct  32   AAVAAGQQAKKRVALGNITNVAAAGGRAKLNSAAS---VAPLKKGSLGSGRSASTNRAS-  87

Query  397  GFLGTSIVPTS----------TLVKPITVPSKGPSAIGSDAILQKATLPPVTCSMDNSPA  546
               G    PT              K   +P K PS + + A+       PV CS   SP 
Sbjct  88   ---GVKSAPTKPAPAISRHEVAAQKESVLPPKVPSIVATAALAPA----PVPCSSFVSPM  140

Query  547  KSDGMTASMDESMSPCDSLRSPEVEYIDNNETAGV-HSIEKKASSALYISEHQETTGNIC  723
             S G + S+DE+MS CDS++SP+ EYIDN +++ V  S++++A+  L ISE ++      
Sbjct  141  HS-GDSVSVDETMSTCDSMKSPDFEYIDNGDSSSVLASLQRRANENLRISEDRDVEEAKW  199

Query  724  KRD  732
            K+D
Sbjct  200  KKD  202



>emb|CBI18983.3| unnamed protein product [Vitis vinifera]
Length=343

 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +1

Query  583  MSPCDSLRSPEVEYIDNNETAGVHSIEKKASSALYISEHQETTGNICKRDIIVD  744
            MS CDSL+SPE EYI+N++ + V  +E K  + L++S+H E TGNICK D+ V+
Sbjct  1    MSTCDSLKSPEFEYINNHDASPVSFVETKTGTCLHLSKHVEITGNICKGDVEVE  54



>gb|EEC70248.1| hypothetical protein OsI_01039 [Oryza sativa Indica Group]
Length=506

 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 50/135 (37%), Positives = 75/135 (56%), Gaps = 13/135 (10%)
 Frame = +1

Query  361  IKKSSSSSTGNAGFLGTSIVPTSTLVKPITVPSKGPSAIGSDAILQ--------KATLPP  516
            +KK S +S  N G    S V +++  KP    S+  SA   +++L          A L P
Sbjct  80   VKKGSLASVRNVGTNRASAVKSAS-TKPAPAISRHESAAQKESVLPPKVPSIVPTAALAP  138

Query  517  VT--CSMDNSPAKSDGMTASMDESMSPCDSLRSPEVEYIDNNETAGVH-SIEKKASSALY  687
            VT  CS   SP  S G + S+DE+MS CDS++SPE EYIDN +++ V  S++++A+  L 
Sbjct  139  VTVPCSSFVSPMHS-GDSVSVDETMSTCDSMKSPEFEYIDNGDSSSVLGSLQRRANENLR  197

Query  688  ISEHQETTGNICKRD  732
            ISE ++      K+D
Sbjct  198  ISEDRDVEETKWKKD  212



>ref|XP_010915934.1| PREDICTED: cyclin-A1-1-like isoform X3 [Elaeis guineensis]
Length=491

 Score = 62.8 bits (151),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 47/71 (66%), Gaps = 1/71 (1%)
 Frame = +1

Query  523  CSMDNSPAKSDGMTASMDESMSPCDSLRSPEVEYIDNNETAGVHSIEKKASSALYISEHQ  702
            CS   SP  S G + S+ E+MS CDS++SP+ EYIDN +++ V S+E++AS   +IS+  
Sbjct  172  CSTVISPNPS-GDSVSLAETMSTCDSMKSPDFEYIDNGDSSAVASLERRASDNFHISDRA  230

Query  703  ETTGNICKRDI  735
               G+  KRD+
Sbjct  231  NAAGSTWKRDV  241



>ref|XP_010915931.1| PREDICTED: cyclin-A1-4-like isoform X1 [Elaeis guineensis]
Length=534

 Score = 62.4 bits (150),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 47/71 (66%), Gaps = 1/71 (1%)
 Frame = +1

Query  523  CSMDNSPAKSDGMTASMDESMSPCDSLRSPEVEYIDNNETAGVHSIEKKASSALYISEHQ  702
            CS   SP  S G + S+ E+MS CDS++SP+ EYIDN +++ V S+E++AS   +IS+  
Sbjct  172  CSTVISPNPS-GDSVSLAETMSTCDSMKSPDFEYIDNGDSSAVASLERRASDNFHISDRA  230

Query  703  ETTGNICKRDI  735
               G+  KRD+
Sbjct  231  NAAGSTWKRDV  241



>gb|EEE54185.1| hypothetical protein OsJ_01008 [Oryza sativa Japonica Group]
Length=497

 Score = 62.4 bits (150),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 50/135 (37%), Positives = 75/135 (56%), Gaps = 13/135 (10%)
 Frame = +1

Query  361  IKKSSSSSTGNAGFLGTSIVPTSTLVKPITVPSKGPSAIGSDAILQ--------KATLPP  516
            +KK S +S  N G    S V +++  KP    S+  SA   +++L          A L P
Sbjct  82   VKKGSLASGRNVGTNRASAVKSAS-AKPAPAISRHESATQKESVLPPKVPSIVPTAALAP  140

Query  517  VT--CSMDNSPAKSDGMTASMDESMSPCDSLRSPEVEYIDNNETAGVH-SIEKKASSALY  687
            VT  CS   SP  S G + S+DE+MS CDS++SPE EYIDN +++ V  S++++A+  L 
Sbjct  141  VTVPCSSFVSPMHS-GDSVSVDETMSTCDSMKSPEFEYIDNGDSSSVLGSLQRRANENLR  199

Query  688  ISEHQETTGNICKRD  732
            ISE ++      K+D
Sbjct  200  ISEDRDVEETKWKKD  214



>ref|XP_010915932.1| PREDICTED: cyclin-A1-4-like isoform X2 [Elaeis guineensis]
Length=533

 Score = 62.4 bits (150),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 47/71 (66%), Gaps = 1/71 (1%)
 Frame = +1

Query  523  CSMDNSPAKSDGMTASMDESMSPCDSLRSPEVEYIDNNETAGVHSIEKKASSALYISEHQ  702
            CS   SP  S G + S+ E+MS CDS++SP+ EYIDN +++ V S+E++AS   +IS+  
Sbjct  172  CSTVISPNPS-GDSVSLAETMSTCDSMKSPDFEYIDNGDSSAVASLERRASDNFHISDRA  230

Query  703  ETTGNICKRDI  735
               G+  KRD+
Sbjct  231  NAAGSTWKRDV  241



>ref|XP_009387253.1| PREDICTED: cyclin-A1-4-like [Musa acuminata subsp. malaccensis]
Length=493

 Score = 62.4 bits (150),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 65/185 (35%), Positives = 91/185 (49%), Gaps = 28/185 (15%)
 Frame = +1

Query  217  AAAADQRLAHKRPALTNITNQ-RTGsllssrstfsesssIAPCTSKNVGIKKSSSSSTGN  393
            AA A Q  A KR AL NI+NQ +     +       ++ I   T+ +   KK S SS  +
Sbjct  32   AALAGQ--AKKRVALANISNQSKVARNPARPLGAKGANKIN--TTSSASTKKGSLSSYRD  87

Query  394  AGFLGTSIVPTSTLVKPITVPSK---------GPSAIGSDAILQKATLPP--VTCSMDNS  540
                G+S V TS  +KP T  S          GP          K T+P   V CS   S
Sbjct  88   TRSGGSSAV-TSAAIKPDTNKSSNKSSLSINNGP----------KITVPACLVPCSTLKS  136

Query  541  PAKSDGMTASMDESMSPCDSLRSPEVEYIDNNETAGVHSIEKKASSALYISEHQETTGNI  720
            P  S   + S+DE+MS CDS+RSP+ EYID  + + + S+E++A+  L+ISEH    G+ 
Sbjct  137  PGHSRD-SVSLDETMSTCDSMRSPDFEYIDKGDCSVITSLERQANKNLHISEHAAEAGSK  195

Query  721  CKRDI  735
               D+
Sbjct  196  LSIDV  200



>ref|NP_001042512.1| Os01g0233500 [Oryza sativa Japonica Group]
 sp|Q7F830.1|CCA11_ORYSJ RecName: Full=Cyclin-A1-1; AltName: Full=G2/mitotic-specific 
cyclin-A1-1; Short=CycA1;1 [Oryza sativa Japonica Group]
 dbj|BAA86628.1| cyclin [Oryza sativa]
 dbj|BAA96590.1| putative type A-like cyclin [Oryza sativa Japonica Group]
 dbj|BAF04426.1| Os01g0233500 [Oryza sativa Japonica Group]
Length=508

 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 50/135 (37%), Positives = 75/135 (56%), Gaps = 13/135 (10%)
 Frame = +1

Query  361  IKKSSSSSTGNAGFLGTSIVPTSTLVKPITVPSKGPSAIGSDAILQ--------KATLPP  516
            +KK S +S  N G    S V +++  KP    S+  SA   +++L          A L P
Sbjct  82   VKKGSLASGRNVGTNRASAVKSAS-AKPAPAISRHESATQKESVLPPKVPSIVPTAALAP  140

Query  517  VT--CSMDNSPAKSDGMTASMDESMSPCDSLRSPEVEYIDNNETAGVH-SIEKKASSALY  687
            VT  CS   SP  S G + S+DE+MS CDS++SPE EYIDN +++ V  S++++A+  L 
Sbjct  141  VTVPCSSFVSPMHS-GDSVSVDETMSTCDSMKSPEFEYIDNGDSSSVLGSLQRRANENLR  199

Query  688  ISEHQETTGNICKRD  732
            ISE ++      K+D
Sbjct  200  ISEDRDVEETKWKKD  214



>ref|XP_004502519.1| PREDICTED: cyclin-A1-1-like [Cicer arietinum]
Length=514

 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 62/185 (34%), Positives = 84/185 (45%), Gaps = 24/185 (13%)
 Frame = +1

Query  223  AADQRLAHKRPALTNITNQRTGsllssrstfsesssIAPCTSKNVGIKKSS-SSSTGNAG  399
            A   R A KRPALT++TN R  SL           ++ PC SK    KK S +SS  N  
Sbjct  34   AVKTRSAKKRPALTDVTNSRNASLAKPAVGAPSKPTV-PCASKTAKTKKDSVASSQKNVK  92

Query  400  -----FLGTSIVPTSTLVKPITVPSKGPSAIGSDAILQKATLPP------------VTCS  528
                    +S V +S LV P    S   S   +  +   A++ P            V C+
Sbjct  93   PCRNTLQASSSVKSSRLVLPKEACSTRASKTKTGGV--HASIAPSNDGAVCPEFKSVVCA  150

Query  529  ---MDNSPAKSDGMTASMDESMSPCDSLRSPEVEYIDNNETAGVHSIEKKASSALYISEH  699
               MD SP+ S   +AS+DESMS  DS  S E +Y  N++   + SIE +  S L IS+ 
Sbjct  151  PRWMDISPSNSFSGSASLDESMSTSDSFMSSEFQYTGNDDIVSIKSIENRTCSILNISDS  210

Query  700  QETTG  714
             +  G
Sbjct  211  SKIAG  215



>ref|XP_004967382.1| PREDICTED: cyclin-A1-1-like [Setaria italica]
Length=506

 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/72 (42%), Positives = 51/72 (71%), Gaps = 1/72 (1%)
 Frame = +1

Query  517  VTCSMDNSPAKSDGMTASMDESMSPCDSLRSPEVEYIDNNETAGVHSIEKKASSALYISE  696
            V CS   SP +S G + S+DE+MS CDS++SP++EYIDN +T+ + S++++A+  L IS+
Sbjct  142  VPCSTFVSPGRS-GDSVSVDETMSTCDSMKSPDIEYIDNGDTSMLASLQRRANEHLRISD  200

Query  697  HQETTGNICKRD  732
             ++   N  K++
Sbjct  201  DRDVEENKWKKN  212



>ref|XP_003566077.1| PREDICTED: cyclin-A1-1-like [Brachypodium distachyon]
Length=510

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 42/104 (40%), Positives = 61/104 (59%), Gaps = 11/104 (11%)
 Frame = +1

Query  427  STLVKPITVPSKGPSAIGSDAILQKATLPPVT-CSMDNSPAKS-DGMTASMDESMSPCDS  600
            ST  K I  P K P+A+   A       PP+  CS   SP  S D M  S DE+MS CDS
Sbjct  122  STTQKEIVPPPKLPAAMPIVA-------PPIVPCSSFVSPRHSADSM--STDETMSTCDS  172

Query  601  LRSPEVEYIDNNETAGVHSIEKKASSALYISEHQETTGNICKRD  732
            ++SP+ EYIDN +++ + S++++A++ L ISE  +  G   K+D
Sbjct  173  MKSPDFEYIDNGDSSVLDSLQRRANANLRISEDSDVEGAKWKKD  216



>gb|EAY73159.1| hypothetical protein OsI_01032 [Oryza sativa Indica Group]
Length=146

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 47/129 (36%), Positives = 73/129 (57%), Gaps = 13/129 (10%)
 Frame = +1

Query  361  IKKSSSSSTGNAGFLGTSIVPTSTLVKPITVPSKGPSAIGSDAILQKATL--------PP  516
            +KK S +S  N G    S V +++  KP +  S+  SA   +++L    L         P
Sbjct  19   VKKGSLASGRNVGTNRVSAVKSAS-TKPASAISRHESAPQKESVLPPKVLRIVPTAAPAP  77

Query  517  VT--CSMDNSPAKSDGMTASMDESMSPCDSLRSPEVEYIDNNETAGV-HSIEKKASSALY  687
            VT  CS   SP  S G + S+DE+MS CDS++SP+ EYIDN +++ V  S++++A+  L 
Sbjct  78   VTVPCSSFVSPMHS-GDSVSVDETMSTCDSMKSPDFEYIDNGDSSSVLGSLQRRANENLR  136

Query  688  ISEHQETTG  714
            ISE ++  G
Sbjct  137  ISEDRDVEG  145



>ref|XP_002454880.1| hypothetical protein SORBIDRAFT_03g000690 [Sorghum bicolor]
 gb|EER99999.1| hypothetical protein SORBIDRAFT_03g000690 [Sorghum bicolor]
Length=502

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 35/96 (36%), Positives = 56/96 (58%), Gaps = 15/96 (16%)
 Frame = +1

Query  445  ITVPSKGPSAIGSDAILQKATLPPVTCSMDNSPAKSDGMTASMDESMSPCDSLRSPEVEY  624
            + VPS+ P+               V CS   SPA+S G + S+DE+MS CDS++SP+ EY
Sbjct  129  VHVPSRAPAL--------------VPCSSFVSPARS-GDSVSIDETMSTCDSMKSPDFEY  173

Query  625  IDNNETAGVHSIEKKASSALYISEHQETTGNICKRD  732
            IDN +++ + S++++A   L ISE  +   N  K++
Sbjct  174  IDNGDSSMLASLQRRADEHLRISEDTDVEENKWKKN  209



>ref|XP_002457051.1| hypothetical protein SORBIDRAFT_03g000520 [Sorghum bicolor]
 gb|EES02171.1| hypothetical protein SORBIDRAFT_03g000520 [Sorghum bicolor]
Length=533

 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 36/105 (34%), Positives = 60/105 (57%), Gaps = 15/105 (14%)
 Frame = +1

Query  418  VPTSTLVKPITVPSKGPSAIGSDAILQKATLPPVTCSMDNSPAKSDGMTASMDESMSPCD  597
            VP   +   + VPS+ P+               V CS   SP +S G + SMDE+MS CD
Sbjct  125  VPPPKVPTTVNVPSRAPAL--------------VPCSSFMSPGRS-GDSVSMDETMSICD  169

Query  598  SLRSPEVEYIDNNETAGVHSIEKKASSALYISEHQETTGNICKRD  732
            S++SP+ E+IDN +++ + S++++A+  L ISE ++   N  K++
Sbjct  170  SMKSPDFEFIDNGDSSVLASLQRQANEHLRISEGRDVEENKWKKN  214



>gb|EAY73164.1| hypothetical protein OsI_01037 [Oryza sativa Indica Group]
Length=265

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 48/140 (34%), Positives = 74/140 (53%), Gaps = 24/140 (17%)
 Frame = +1

Query  361  IKKSSSSSTGNAGFLGTSIVPTSTLVKPITVPSKGPSAIGSDAILQKATLPP--------  516
            +KK S +S  N G    S V +++  KP    S+  SA       Q++ LPP        
Sbjct  64   VKKGSLASGRNVGMNRVSAVKSAS-TKPAPAISRHESAP------QESVLPPKVLSIVPT  116

Query  517  -------VTCSMDNSPAKSDGMTASMDESMSPCDSLRSPEVEYIDNNETAGVH-SIEKKA  672
                   V CS   SP  S G + S+DE+MS CDS++SP+ EYIDN +++ V  S++++A
Sbjct  117  AAPAPVTVPCSSFVSPMHS-GDSVSVDETMSTCDSMKSPDFEYIDNGDSSSVLGSLQRRA  175

Query  673  SSALYISEHQETTGNICKRD  732
            +  L+ISE ++      K+D
Sbjct  176  NENLHISEDRDVEETKWKKD  195



>sp|Q0INT0.2|CCA13_ORYSJ RecName: Full=Cyclin-A1-3; AltName: Full=G2/mitotic-specific 
cyclin-A1-3; Short=CycA1;3 [Oryza sativa Japonica Group]
 gb|ABG21983.1| Cyclin, N-terminal domain containing protein, expressed [Oryza 
sativa Japonica Group]
Length=491

 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 48/135 (36%), Positives = 75/135 (56%), Gaps = 13/135 (10%)
 Frame = +1

Query  361  IKKSSSSSTGNAGFLGTSIVPTSTLVKPITVPSKGPSAIGSDAILQKATL--------PP  516
            +KK S +S  N G    S V +++  KP +  S+  SA   +++L    L         P
Sbjct  65   VKKGSLASGRNVGTNRVSAVKSAS-TKPASAISRHESAPQKESVLPPKVLRIVPTAAPAP  123

Query  517  VT--CSMDNSPAKSDGMTASMDESMSPCDSLRSPEVEYIDNNETAGVH-SIEKKASSALY  687
            VT  CS   SP  S G + S+DE+MS CDS++SP+ EYIDN +++ V  S++++A+  L 
Sbjct  124  VTVPCSSFVSPMHS-GDSVSVDETMSTCDSMKSPDFEYIDNGDSSSVLGSLQRRANENLR  182

Query  688  ISEHQETTGNICKRD  732
            ISE ++      K+D
Sbjct  183  ISEDRDVEETKWKKD  197



>ref|NP_001288521.1| uncharacterized protein LOC103649996 [Zea mays]
 ref|XP_008673897.1| PREDICTED: cyclin-A1-1 [Zea mays]
 ref|XP_008673900.1| PREDICTED: cyclin-A1-1-like [Zea mays]
 gb|ACF87709.1| unknown [Zea mays]
Length=509

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 50/74 (68%), Gaps = 1/74 (1%)
 Frame = +1

Query  517  VTCSMDNSPAKSDGMTASMDESMSPCDSLRSPEVEYIDNNETAGVHSIEKKASSALYISE  696
            V+C+   SP +S G + S DE+MS CDS++SP+ EY+DN +T+ + S++++ S  L ISE
Sbjct  145  VSCTGLVSPGRS-GDSVSSDETMSTCDSMKSPDFEYVDNQDTSMLASLQRRTSEHLRISE  203

Query  697  HQETTGNICKRDII  738
             ++   N  K++ +
Sbjct  204  DRDVEENKRKKNAV  217



>gb|AAA20237.1| cyclin IIZm, partial [Zea mays]
Length=456

 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 50/74 (68%), Gaps = 1/74 (1%)
 Frame = +1

Query  517  VTCSMDNSPAKSDGMTASMDESMSPCDSLRSPEVEYIDNNETAGVHSIEKKASSALYISE  696
            V+C+   SP +S G + S DE+MS CDS++SP+ EY+DN +T+ + S++++ S  L ISE
Sbjct  89   VSCTGLVSPGRS-GDSVSSDETMSTCDSMKSPDFEYVDNQDTSMLASLQRRTSEHLRISE  147

Query  697  HQETTGNICKRDII  738
             ++   N  K++ +
Sbjct  148  DRDVEENKRKKNAV  161



>ref|XP_006645684.1| PREDICTED: cyclin-A1-1-like [Oryza brachyantha]
Length=538

 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 56/173 (32%), Positives = 89/173 (51%), Gaps = 23/173 (13%)
 Frame = +1

Query  247  KRPALTNITNQRTGsllssrstfsesssIAPCTSKNVGIKKSSSSSTGNAGFLGTSIVPT  426
            KR AL NITN       +     + ++S+AP    ++G  +S+S++  +    G    PT
Sbjct  84   KRVALGNITNV---VAAAGGRKLNSAASVAPLKKGSLGSGRSASTNRAS----GVKSAPT  136

Query  427  S----------TLVKPITVPSKGPSAIGSDAILQKATLPPVTCSMDNSPAKSDGMTASMD  576
                          K   +P K PS + + A L  A +P   CS   SP  S G + S+D
Sbjct  137  KPAPAISRHEVAAQKESVLPPKVPSIVATVA-LAPAHVP---CSSFVSPMHS-GDSVSVD  191

Query  577  ESMSPCDSLRSPEVEYIDNNETAGV-HSIEKKASSALYISEHQETTGNICKRD  732
            E+MS CDS++SP+ EYIDN +++ V  S++++A+  L ISE ++      K+D
Sbjct  192  ETMSTCDSMKSPDFEYIDNGDSSSVLASLQRRANENLRISEDRDVEEAKWKKD  244



>ref|XP_002455447.1| hypothetical protein SORBIDRAFT_03g010940 [Sorghum bicolor]
 gb|EES00567.1| hypothetical protein SORBIDRAFT_03g010940 [Sorghum bicolor]
Length=505

 Score = 57.0 bits (136),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 60/196 (31%), Positives = 96/196 (49%), Gaps = 33/196 (17%)
 Frame = +1

Query  211  KVAAAADQRLAHKRPALTNITNQRTGsllssrstfsesssIAPCTSKN----VGIKKSSS  378
            KVAAA     A KR AL NITN       +       +++  P TS      V +KK S 
Sbjct  31   KVAAAQ----AKKRVALGNITNVAARGGRAVVGGGLGNAA-PPTTSAKLNPAVPLKKPSL  85

Query  379  SSTGNAGFLGTSIVPTSTLVKPITVPSKGPSAIGSDAILQKATLPP--------------  516
            +S  +   +    V +++ +KP    S+  SAI      QK  +PP              
Sbjct  86   ASARSVSSIRGQAVKSAS-IKPAPPVSRHGSAI------QKHNVPPPKVPTIADVPSHAP  138

Query  517  --VTCSMDNSPAKSDGMTASMDESMSPCDSLRSPEVEYIDNNETAGVHSIEKKASSALYI  690
              V C+   SP +S G   S+D++MS CDS++SP+ EYIDN +++ + S++++ +  L I
Sbjct  139  ALVPCTGLVSPGRS-GDFVSIDDTMSTCDSMKSPDFEYIDNQDSSMLASLQRRTNEHLRI  197

Query  691  SEHQETTGNICKRDII  738
            +E ++   N  K++ I
Sbjct  198  TEDRDVEENKWKKNAI  213



>emb|CDM82517.1| unnamed protein product [Triticum aestivum]
 gb|AIL50246.1| Ttam-3B [Triticum turgidum]
Length=510

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 45/138 (33%), Positives = 70/138 (51%), Gaps = 22/138 (16%)
 Frame = +1

Query  361  IKKSSSSSTGNAGFLGTSIVPTSTLVKPITVPSKGPSAIGSDAILQKATLPP--------  516
            +KK +  S  NA     S V  S   KP  V S+  S++      QK ++PP        
Sbjct  87   VKKGALPSARNASTNRGSAV-KSAFTKPAPVTSRHESSV------QKESVPPRKVPTVVP  139

Query  517  ------VTCSMDNSPAKSDGMTASMDESMSPCDSLRSPEVEYIDNNETAGVHSIEKKASS  678
                  +  S   SP  S G + S DE+MS CDS++SP+ EYIDN +++ + S++++A+ 
Sbjct  140  IAVPAVIPFSSFASPGHS-GDSISTDETMSSCDSMKSPDFEYIDNGDSSLLDSLQRRANE  198

Query  679  ALYISEHQETTGNICKRD  732
             L IS+ +   G   K+D
Sbjct  199  NLRISDDRTVEGAKWKKD  216



>ref|XP_003566081.1| PREDICTED: cyclin-A1-1-like [Brachypodium distachyon]
Length=501

 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 59/179 (33%), Positives = 87/179 (49%), Gaps = 28/179 (16%)
 Frame = +1

Query  241  AHKRPALTNITN------QRTGsllssrstfsesssIAPCTSKNVGIKKSSSSSTGNA--  396
            A KR AL NITN       RTG    + +T   +   +  T+    +KK S +S  NA  
Sbjct  42   AKKRVALGNITNIAAGAMGRTGCGKVAVATPGNARLHS--TTSAAPVKKGSLASVQNAIA  99

Query  397  ----GFLGTSIVPT---STLVKPITVPSKGPSAIGSDAILQKATLPPVTCSMDNSPAKSD  555
                     S  PT     +V P  VP+  P  I + AI        V C    SP  S+
Sbjct  100  NRSLAVKSASTRPTPKAEDIVPPPKVPTVMP--IAASAI--------VPCCSFASPQHSE  149

Query  556  GMTASMDESMSPCDSLRSPEVEYIDNNETAGVHSIEKKASSALYISEHQETTGNICKRD  732
              + S DE+MS  DS++SP++EYIDN ++  + S++++A++ L ISE  +  G   K+D
Sbjct  150  D-SISTDETMSTSDSMKSPDLEYIDNGDSLVLDSLQQRANANLRISEESDVEGTKWKKD  207



>gb|AIL50247.1| Ttam-3D [Triticum aestivum]
Length=510

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 45/138 (33%), Positives = 70/138 (51%), Gaps = 22/138 (16%)
 Frame = +1

Query  361  IKKSSSSSTGNAGFLGTSIVPTSTLVKPITVPSKGPSAIGSDAILQKATLPP--------  516
            +KK +  S  NA     S V  S   KP  V S+  S++      QK ++PP        
Sbjct  87   VKKGALPSARNASANRGSAV-KSAFTKPAPVTSRHESSV------QKESVPPRKVPTVVP  139

Query  517  ------VTCSMDNSPAKSDGMTASMDESMSPCDSLRSPEVEYIDNNETAGVHSIEKKASS  678
                  +  S   SP  S G + S DE+MS CDS++SP+ EYIDN +++ + S++++A+ 
Sbjct  140  IAVPAVIPFSSFVSPGHS-GDSISTDETMSSCDSMKSPDFEYIDNGDSSLLDSLQRRANE  198

Query  679  ALYISEHQETTGNICKRD  732
             L IS+ +   G   K+D
Sbjct  199  NLRISDDRTVEGAKWKKD  216



>gb|AIL50245.1| Ttam-3A [Triticum turgidum]
Length=513

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 45/139 (32%), Positives = 70/139 (50%), Gaps = 24/139 (17%)
 Frame = +1

Query  361  IKKSSSSSTGNAGF-LGTSIVPTSTLVKPITVPSKGPSAIGSDAILQKATLPP-------  516
            +KK S  S  NA    G+S+   ST   P+T   +G         +QK + PP       
Sbjct  90   VKKGSLPSARNASANRGSSVKSASTKPAPVTSRHEGS--------MQKESAPPRKVPTAV  141

Query  517  -------VTCSMDNSPAKSDGMTASMDESMSPCDSLRSPEVEYIDNNETAGVHSIEKKAS  675
                   +  S   SP  S G + S DE+MS CDS++SP+ EYIDN +++ + S++++A+
Sbjct  142  PIAVPAVIPFSSFVSPGHS-GDSISTDETMSSCDSMKSPDFEYIDNGDSSLLDSLQRRAN  200

Query  676  SALYISEHQETTGNICKRD  732
              L IS+ +   G   K+D
Sbjct  201  ENLRISDDRTVEGAKWKKD  219



>dbj|BAJ94732.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=515

 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/59 (41%), Positives = 41/59 (69%), Gaps = 0/59 (0%)
 Frame = +1

Query  556  GMTASMDESMSPCDSLRSPEVEYIDNNETAGVHSIEKKASSALYISEHQETTGNICKRD  732
            G + S DE+MS CDS++SP+ EYIDN +++ + S++++A+  L IS+ +   G   K+D
Sbjct  163  GDSISTDETMSSCDSMKSPDFEYIDNGDSSLLDSLQRRANENLRISDDRTVEGTKWKKD  221



>gb|EMS46237.1| Cyclin-A1-1 [Triticum urartu]
Length=439

 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 40/125 (32%), Positives = 64/125 (51%), Gaps = 22/125 (18%)
 Frame = +1

Query  361  IKKSSSSSTGNAGF-LGTSIVPTSTLVKPITVPSKGPSAIGSDAILQKATLPPVTCSMDN  537
            +KK S  S  NA    G+S+   ST   P+T   +G         +QK + PP       
Sbjct  24   VKKGSLPSARNASANRGSSVKSASTKPAPVTSRHEGS--------MQKESAPPRD-----  70

Query  538  SPAKSDGMTASMDESMSPCDSLRSPEVEYIDNNETAGVHSIEKKASSALYISEHQETTGN  717
                    + S DE+MS CDS++SP+ EYIDN +++ + S++++A+  L IS+ +   G 
Sbjct  71   --------SISTDETMSSCDSMKSPDFEYIDNGDSSLLDSLQRRANENLRISDDRTVEGA  122

Query  718  ICKRD  732
              K+D
Sbjct  123  KWKKD  127



>emb|CDY25649.1| BnaC05g25280D [Brassica napus]
Length=437

 Score = 53.9 bits (128),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 38/57 (67%), Gaps = 5/57 (9%)
 Frame = +1

Query  571  MDESMSPCDSLRSPEVEYIDNNETAGVHSIEKKASSALYISEHQETTG-NICKRDII  738
            +DE+ S CDS +SP VEYIDN +     SIE+KA S LYI+   ETT  N C++ ++
Sbjct  96   IDETKSTCDSYKSPRVEYIDNEDV----SIERKAFSNLYITPSSETTNVNYCRKYVL  148



>ref|XP_010521285.1| PREDICTED: cyclin-A1-2 isoform X1 [Tarenaya hassleriana]
Length=518

 Score = 53.5 bits (127),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 27/53 (51%), Positives = 38/53 (72%), Gaps = 4/53 (8%)
 Frame = +1

Query  526  SMDNSPAKSDGMTASMDESMSPCDSLRSPEVEYIDNNETAGVHSIEKKASSAL  684
            +MD SPA+SD  + S+DES+S CDS +SPEVEY+DN +      +E+K  S+L
Sbjct  156  AMDASPARSDLDSVSLDESISTCDSFKSPEVEYMDNIDDP----LERKCPSSL  204



>ref|XP_010521286.1| PREDICTED: cyclin-A1-2 isoform X2 [Tarenaya hassleriana]
Length=493

 Score = 53.5 bits (127),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 27/53 (51%), Positives = 38/53 (72%), Gaps = 4/53 (8%)
 Frame = +1

Query  526  SMDNSPAKSDGMTASMDESMSPCDSLRSPEVEYIDNNETAGVHSIEKKASSAL  684
            +MD SPA+SD  + S+DES+S CDS +SPEVEY+DN +      +E+K  S+L
Sbjct  156  AMDASPARSDLDSVSLDESISTCDSFKSPEVEYMDNID----DPLERKCPSSL  204



>ref|NP_001042509.2| Os01g0233100 [Oryza sativa Japonica Group]
 dbj|BAF04423.2| Os01g0233100 [Oryza sativa Japonica Group]
Length=634

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 34/74 (46%), Positives = 49/74 (66%), Gaps = 7/74 (9%)
 Frame = +1

Query  514  PVT--CSMDNSPAKSDGMTASMDESMSPCDSLRSPEVEYIDNNETAGVH-SIEKKASSAL  684
            PVT  CS   SP  S G + S+DE+MS CDS++SP+ EYIDN +++ V  S++++A+  L
Sbjct  110  PVTVPCSSFVSPMHS-GDSVSVDETMSMCDSMKSPDFEYIDNGDSSSVLGSLQRRANENL  168

Query  685  YISEH---QETTGN  717
             ISE    +ET  N
Sbjct  169  RISEDRDVEETKWN  182



>dbj|BAD81374.1| putative type A-like cyclin [Oryza sativa Japonica Group]
Length=521

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 49/76 (64%), Gaps = 4/76 (5%)
 Frame = +1

Query  514  PVT--CSMDNSPAKSDGMTASMDESMSPCDSLRSPEVEYIDNNETAGVH-SIEKKASSAL  684
            PVT  CS   SP  S G + S+DE+MS CDS++SP+ EYIDN +++ V  S++++A+  L
Sbjct  136  PVTVPCSSFVSPMHS-GDSVSVDETMSMCDSMKSPDFEYIDNGDSSSVLGSLQRRANENL  194

Query  685  YISEHQETTGNICKRD  732
             ISE ++       +D
Sbjct  195  RISEDRDVEETKWNKD  210



>sp|Q0JPA4.2|CCA12_ORYSJ RecName: Full=Cyclin-A1-2; AltName: Full=G2/mitotic-specific 
cyclin-A1-2; Short=CycA1;2 [Oryza sativa Japonica Group]
Length=477

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 34/74 (46%), Positives = 49/74 (66%), Gaps = 7/74 (9%)
 Frame = +1

Query  514  PVT--CSMDNSPAKSDGMTASMDESMSPCDSLRSPEVEYIDNNETAGVH-SIEKKASSAL  684
            PVT  CS   SP  S G + S+DE+MS CDS++SP+ EYIDN +++ V  S++++A+  L
Sbjct  110  PVTVPCSSFVSPMHS-GDSVSVDETMSMCDSMKSPDFEYIDNGDSSSVLGSLQRRANENL  168

Query  685  YISEH---QETTGN  717
             ISE    +ET  N
Sbjct  169  RISEDRDVEETKWN  182



>ref|NP_001105387.1| cyclin2 [Zea mays]
 gb|AAC50013.1| type A-like cyclin [Zea mays]
Length=502

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 34/105 (32%), Positives = 55/105 (52%), Gaps = 18/105 (17%)
 Frame = +1

Query  418  VPTSTLVKPITVPSKGPSAIGSDAILQKATLPPVTCSMDNSPAKSDGMTASMDESMSPCD  597
            VP  T V    VPS+ P+ +   + +              SP +S G + S DE+MS CD
Sbjct  122  VPVPTTVH---VPSRAPALVPYSSFV--------------SPGRS-GDSVSTDETMSTCD  163

Query  598  SLRSPEVEYIDNNETAGVHSIEKKASSALYISEHQETTGNICKRD  732
            S++SP+ EYIDN   + + S++++A   L  SE ++   N  K++
Sbjct  164  SMKSPDFEYIDNGGCSMLASLQRRADEHLRTSEDRDVEENKWKKN  208



>gb|EEE54183.1| hypothetical protein OsJ_01006 [Oryza sativa Japonica Group]
Length=133

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 41/58 (71%), Gaps = 4/58 (7%)
 Frame = +1

Query  556  GMTASMDESMSPCDSLRSPEVEYIDNNETAGVH-SIEKKASSALYISEH---QETTGN  717
            G + S+DE+MS CDS++SP+ EYIDN +++ V  S++++A+  L ISE    +ET  N
Sbjct  34   GDSVSVDETMSMCDSMKSPDFEYIDNGDSSSVLGSLQRRANENLRISEDRDVEETKWN  91



>ref|XP_009145051.1| PREDICTED: cyclin-A1-1 [Brassica rapa]
 emb|CDY65994.1| BnaA05g35600D [Brassica napus]
Length=443

 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 38/57 (67%), Gaps = 5/57 (9%)
 Frame = +1

Query  571  MDESMSPCDSLRSPEVEYIDNNETAGVHSIEKKASSALYISEHQETTG-NICKRDII  738
            +DE+ S CDS +SP VEYID+ +     SIE+KA S LYI+   ETT  N C+R ++
Sbjct  93   IDETKSTCDSYKSPGVEYIDSEDV----SIERKAFSNLYITPSSETTNVNYCRRYVL  145



>gb|ACR33952.1| unknown [Zea mays]
Length=527

 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 32/106 (30%), Positives = 56/106 (53%), Gaps = 20/106 (19%)
 Frame = +1

Query  415  IVPTSTLVKPITVPSKGPSAIGSDAILQKATLPPVTCSMDNSPAKSDGMTASMDESMSPC  594
            +VPT+     + VPS+ P+ +   + +              SP +S   + S DE+MS C
Sbjct  148  LVPTT-----VHVPSRAPALVPYSSFV--------------SPGRSRD-SVSTDETMSTC  187

Query  595  DSLRSPEVEYIDNNETAGVHSIEKKASSALYISEHQETTGNICKRD  732
            DS++SP+ EYIDN   + + S++++A   L  SE ++   N  K++
Sbjct  188  DSMKSPDFEYIDNGGCSMLASLQRRADEHLRTSEDRDVEENKWKKN  233



>gb|ACF80031.1| unknown [Zea mays]
Length=502

 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 32/106 (30%), Positives = 56/106 (53%), Gaps = 20/106 (19%)
 Frame = +1

Query  415  IVPTSTLVKPITVPSKGPSAIGSDAILQKATLPPVTCSMDNSPAKSDGMTASMDESMSPC  594
            +VPT+     + VPS+ P+ +   + +              SP +S   + S DE+MS C
Sbjct  123  LVPTT-----VHVPSRAPALVPYSSFV--------------SPGRSRD-SVSTDETMSTC  162

Query  595  DSLRSPEVEYIDNNETAGVHSIEKKASSALYISEHQETTGNICKRD  732
            DS++SP+ EYIDN   + + S++++A   L  SE ++   N  K++
Sbjct  163  DSMKSPDFEYIDNGGCSMLASLQRRADEHLRTSEDRDVEENKWKKN  208



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1360982043420