BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF044P12

Length=691
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009620233.1|  PREDICTED: KH domain-containing protein At5g...    281   5e-91   Nicotiana tomentosiformis
ref|XP_009762106.1|  PREDICTED: KH domain-containing protein At5g...    280   1e-90   Nicotiana sylvestris
ref|XP_010324228.1|  PREDICTED: KH domain-containing protein At5g...    280   1e-90   Solanum lycopersicum
ref|XP_006346087.1|  PREDICTED: KH domain-containing protein At5g...    279   4e-90   Solanum tuberosum [potatoes]
emb|CDP13650.1|  unnamed protein product                                277   6e-89   Coffea canephora [robusta coffee]
ref|XP_009620232.1|  PREDICTED: KH domain-containing protein At5g...    276   7e-89   Nicotiana tomentosiformis
ref|XP_009762105.1|  PREDICTED: KH domain-containing protein At5g...    275   2e-88   Nicotiana sylvestris
ref|XP_004244007.1|  PREDICTED: KH domain-containing protein At5g...    275   3e-88   Solanum lycopersicum
ref|XP_004244006.1|  PREDICTED: KH domain-containing protein At5g...    273   1e-87   Solanum lycopersicum
ref|XP_006346086.1|  PREDICTED: KH domain-containing protein At5g...    273   1e-87   Solanum tuberosum [potatoes]
ref|XP_010676134.1|  PREDICTED: KH domain-containing protein At5g...    271   8e-87   Beta vulgaris subsp. vulgaris [field beet]
gb|EYU27503.1|  hypothetical protein MIMGU_mgv1a011068mg                270   3e-86   Erythranthe guttata [common monkey flower]
ref|XP_011097700.1|  PREDICTED: LOW QUALITY PROTEIN: KH domain-co...    268   6e-86   Sesamum indicum [beniseed]
ref|XP_002274648.1|  PREDICTED: KH domain-containing protein At5g...    268   8e-86   Vitis vinifera
ref|XP_011095628.1|  PREDICTED: KH domain-containing protein At5g...    267   2e-85   Sesamum indicum [beniseed]
ref|XP_010324227.1|  PREDICTED: KH domain-containing protein At5g...    267   2e-85   Solanum lycopersicum
ref|XP_011095627.1|  PREDICTED: KH domain-containing protein At5g...    266   4e-85   Sesamum indicum [beniseed]
ref|XP_010676133.1|  PREDICTED: KH domain-containing protein At5g...    266   4e-85   Beta vulgaris subsp. vulgaris [field beet]
gb|KDP36322.1|  hypothetical protein JCGZ_09537                         263   1e-83   Jatropha curcas
ref|XP_002532938.1|  nucleic acid binding protein, putative             263   1e-83   Ricinus communis
ref|XP_008782987.1|  PREDICTED: KH domain-containing protein At5g...    259   2e-82   Phoenix dactylifera
ref|XP_004294880.1|  PREDICTED: KH domain-containing protein At5g...    258   7e-82   Fragaria vesca subsp. vesca
ref|XP_009415553.1|  PREDICTED: KH domain-containing protein At5g...    257   2e-81   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDO73993.1|  hypothetical protein CISIN_1g022785mg                   253   3e-81   Citrus sinensis [apfelsine]
ref|XP_006452750.1|  hypothetical protein CICLE_v10009077mg             252   8e-81   
gb|KDO73994.1|  hypothetical protein CISIN_1g022785mg                   253   9e-81   Citrus sinensis [apfelsine]
ref|XP_010929006.1|  PREDICTED: KH domain-containing protein At5g...    255   1e-80   Elaeis guineensis
ref|XP_010244820.1|  PREDICTED: KH domain-containing protein At5g...    254   2e-80   Nelumbo nucifera [Indian lotus]
ref|XP_006474774.1|  PREDICTED: KH domain-containing protein At5g...    253   4e-80   Citrus sinensis [apfelsine]
gb|KDO73992.1|  hypothetical protein CISIN_1g022785mg                   253   5e-80   Citrus sinensis [apfelsine]
ref|XP_010942513.1|  PREDICTED: KH domain-containing protein At5g...    253   6e-80   Elaeis guineensis
ref|XP_010942512.1|  PREDICTED: KH domain-containing protein At5g...    253   6e-80   Elaeis guineensis
ref|XP_009415552.1|  PREDICTED: KH domain-containing protein At5g...    253   8e-80   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009346681.1|  PREDICTED: KH domain-containing protein At5g...    253   9e-80   Pyrus x bretschneideri [bai li]
ref|XP_006452747.1|  hypothetical protein CICLE_v10009077mg             253   9e-80   Citrus clementina [clementine]
ref|XP_010252937.1|  PREDICTED: KH domain-containing protein At5g...    253   1e-79   Nelumbo nucifera [Indian lotus]
ref|XP_006377999.1|  hypothetical protein POPTR_0011s17110g             251   3e-79   Populus trichocarpa [western balsam poplar]
ref|XP_009407925.1|  PREDICTED: KH domain-containing protein At5g...    251   4e-79   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002299073.2|  KH domain-containing family protein                251   7e-79   Populus trichocarpa [western balsam poplar]
gb|KJB45526.1|  hypothetical protein B456_007G310100                    250   7e-79   Gossypium raimondii
ref|XP_011000365.1|  PREDICTED: KH domain-containing protein At5g...    250   1e-78   Populus euphratica
gb|KJB63135.1|  hypothetical protein B456_009G454400                    249   1e-78   Gossypium raimondii
gb|KJB63134.1|  hypothetical protein B456_009G454400                    250   2e-78   Gossypium raimondii
ref|XP_004139764.1|  PREDICTED: KH domain-containing protein At5g...    249   3e-78   Cucumis sativus [cucumbers]
ref|XP_011039862.1|  PREDICTED: KH domain-containing protein At5g...    248   1e-77   Populus euphratica
ref|XP_010928017.1|  PREDICTED: KH domain-containing protein At5g...    247   2e-77   Elaeis guineensis
ref|XP_008794732.1|  PREDICTED: KH domain-containing protein At5g...    246   2e-77   Phoenix dactylifera
gb|KJB45527.1|  hypothetical protein B456_007G310100                    246   3e-77   Gossypium raimondii
ref|XP_009410309.1|  PREDICTED: KH domain-containing protein At5g...    245   5e-77   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007205649.1|  hypothetical protein PRUPE_ppa009341mg             245   1e-76   Prunus persica
ref|XP_006857601.1|  hypothetical protein AMTR_s00061p00100880          244   1e-76   Amborella trichopoda
ref|XP_010092393.1|  KH domain-containing protein                       245   1e-76   Morus notabilis
ref|XP_007148648.1|  hypothetical protein PHAVU_005G003500g             243   4e-76   Phaseolus vulgaris [French bean]
ref|XP_008813750.1|  PREDICTED: KH domain-containing protein At5g...    243   5e-76   Phoenix dactylifera
ref|XP_008219133.1|  PREDICTED: KH domain-containing protein At5g...    243   7e-76   Prunus mume [ume]
ref|XP_010928016.1|  PREDICTED: KH domain-containing protein At5g...    242   1e-75   Elaeis guineensis
ref|XP_010913286.1|  PREDICTED: KH domain-containing protein At5g...    242   1e-75   Elaeis guineensis
ref|XP_009399821.1|  PREDICTED: KH domain-containing protein At5g...    242   2e-75   Musa acuminata subsp. malaccensis [pisang utan]
gb|AGV54732.1|  KH domain-containing protein                            241   2e-75   Phaseolus vulgaris [French bean]
ref|XP_009410308.1|  PREDICTED: KH domain-containing protein At5g...    241   3e-75   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007020328.1|  RNA-binding KH domain-containing protein           241   4e-75   
gb|KHG00195.1|  hypothetical protein F383_19595                         241   6e-75   Gossypium arboreum [tree cotton]
ref|XP_008384622.1|  PREDICTED: KH domain-containing protein At5g...    240   7e-75   
ref|XP_008805545.1|  PREDICTED: KH domain-containing protein At5g...    240   8e-75   Phoenix dactylifera
ref|XP_010928019.1|  PREDICTED: KH domain-containing protein At5g...    239   8e-75   Elaeis guineensis
gb|EPS67293.1|  hypothetical protein M569_07482                         238   1e-74   Genlisea aurea
ref|XP_008813749.1|  PREDICTED: KH domain-containing protein At5g...    238   4e-74   
ref|XP_010913285.1|  PREDICTED: KH domain-containing protein At5g...    238   8e-74   
ref|XP_010539351.1|  PREDICTED: KH domain-containing protein At5g...    237   2e-73   
ref|XP_003522828.1|  PREDICTED: KH domain-containing protein At5g...    236   3e-73   Glycine max [soybeans]
ref|XP_010913284.1|  PREDICTED: KH domain-containing protein At5g...    236   3e-73   Elaeis guineensis
ref|XP_008813752.1|  PREDICTED: KH domain-containing protein At5g...    236   3e-73   Phoenix dactylifera
ref|XP_008805544.1|  PREDICTED: KH domain-containing protein At5g...    236   4e-73   Phoenix dactylifera
ref|XP_010928018.1|  PREDICTED: KH domain-containing protein At5g...    235   5e-73   Elaeis guineensis
ref|XP_004499705.1|  PREDICTED: KH domain-containing protein At5g...    235   5e-73   Cicer arietinum [garbanzo]
ref|XP_010913288.1|  PREDICTED: KH domain-containing protein At5g...    234   8e-73   Elaeis guineensis
ref|XP_008219129.1|  PREDICTED: KH domain-containing protein At5g...    235   1e-72   Prunus mume [ume]
ref|XP_008805543.1|  PREDICTED: KH domain-containing protein At5g...    234   1e-72   
ref|XP_009379123.1|  PREDICTED: KH domain-containing protein At5g...    234   2e-72   Pyrus x bretschneideri [bai li]
ref|XP_008353854.1|  PREDICTED: KH domain-containing protein At5g...    234   3e-72   Malus domestica [apple tree]
ref|XP_008447797.1|  PREDICTED: KH domain-containing protein At5g...    234   3e-72   Cucumis melo [Oriental melon]
ref|XP_008805547.1|  PREDICTED: KH domain-containing protein At5g...    233   3e-72   Phoenix dactylifera
gb|EAY87341.1|  hypothetical protein OsI_08744                          231   2e-71   Oryza sativa Indica Group [Indian rice]
ref|XP_010913282.1|  PREDICTED: KH domain-containing protein At5g...    232   2e-71   
ref|XP_003527575.1|  PREDICTED: KH domain-containing protein At5g...    231   2e-71   Glycine max [soybeans]
ref|XP_008813751.1|  PREDICTED: KH domain-containing protein At5g...    231   2e-71   
ref|XP_010063215.1|  PREDICTED: KH domain-containing protein At5g...    231   3e-71   Eucalyptus grandis [rose gum]
ref|XP_003598315.1|  KH domain-containing protein                       231   3e-71   Medicago truncatula
ref|XP_010913287.1|  PREDICTED: KH domain-containing protein At5g...    230   5e-71   
ref|XP_008805542.1|  PREDICTED: KH domain-containing protein At5g...    230   8e-71   Phoenix dactylifera
ref|XP_009395891.1|  PREDICTED: KH domain-containing protein At5g...    229   1e-70   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002454368.1|  hypothetical protein SORBIDRAFT_04g029520          229   1e-70   Sorghum bicolor [broomcorn]
ref|NP_200425.1|  KH domain-containing protein                          229   2e-70   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008805546.1|  PREDICTED: KH domain-containing protein At5g...    228   2e-70   
gb|AFW63660.1|  hypothetical protein ZEAMMB73_233372                    224   6e-70   
ref|XP_004953739.1|  PREDICTED: KH domain-containing protein At5g...    227   9e-70   Setaria italica
ref|XP_006280843.1|  hypothetical protein CARUB_v10026819mg             225   2e-69   
ref|XP_006280844.1|  hypothetical protein CARUB_v10026819mg             226   4e-69   Capsella rubella
ref|XP_009415554.1|  PREDICTED: KH domain-containing protein At5g...    225   4e-69   
ref|XP_010443253.1|  PREDICTED: KH domain-containing protein At5g...    226   5e-69   Camelina sativa [gold-of-pleasure]
ref|XP_010483081.1|  PREDICTED: KH domain-containing protein At5g...    226   5e-69   Camelina sativa [gold-of-pleasure]
ref|XP_010545297.1|  PREDICTED: KH domain-containing protein At4g...    226   5e-69   Tarenaya hassleriana [spider flower]
ref|XP_006647814.1|  PREDICTED: KH domain-containing protein At5g...    225   5e-69   Oryza brachyantha
ref|XP_010450699.1|  PREDICTED: KH domain-containing protein At5g...    226   6e-69   Camelina sativa [gold-of-pleasure]
ref|XP_006452751.1|  hypothetical protein CICLE_v10009077mg             224   9e-69   
dbj|BAJ88160.1|  predicted protein                                      224   1e-68   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ACG35732.1|  nucleic acid binding protein                            224   1e-68   Zea mays [maize]
ref|NP_001141163.1|  uncharacterized protein LOC100273249               223   2e-68   Zea mays [maize]
gb|ACN35020.1|  unknown                                                 223   2e-68   Zea mays [maize]
gb|AAL87326.1|  putative RNA-binding protein                            222   3e-68   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006401374.1|  hypothetical protein EUTSA_v10014150mg             221   3e-67   Eutrema salsugineum [saltwater cress]
ref|XP_006452752.1|  hypothetical protein CICLE_v10009077mg             219   4e-67   
ref|XP_010942514.1|  PREDICTED: KH domain-containing protein At5g...    218   2e-66   Elaeis guineensis
ref|XP_010942515.1|  PREDICTED: KH domain-containing protein At5g...    218   2e-66   Elaeis guineensis
ref|XP_003570477.1|  PREDICTED: KH domain-containing protein At5g...    218   3e-66   Brachypodium distachyon [annual false brome]
gb|ADE77960.1|  unknown                                                 216   2e-65   Picea sitchensis
gb|KFK27184.1|  hypothetical protein AALP_AA8G346800                    217   2e-65   Arabis alpina [alpine rockcress]
gb|AAM14070.1|  unknown protein                                         216   2e-65   Arabidopsis thaliana [mouse-ear cress]
ref|NP_194378.2|  RNA-binding KH domain-containing protein              216   2e-65   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006284180.1|  hypothetical protein CARUB_v10005327mg             215   5e-65   Capsella rubella
ref|XP_010448266.1|  PREDICTED: KH domain-containing protein At4g...    215   5e-65   Camelina sativa [gold-of-pleasure]
ref|XP_010433498.1|  PREDICTED: KH domain-containing protein At4g...    215   5e-65   Camelina sativa [gold-of-pleasure]
emb|CDX94326.1|  BnaC01g18580D                                          214   2e-64   
ref|XP_009399829.1|  PREDICTED: KH domain-containing protein At5g...    213   2e-64   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006413178.1|  hypothetical protein EUTSA_v10025796mg             213   5e-64   Eutrema salsugineum [saltwater cress]
ref|XP_008794733.1|  PREDICTED: KH domain-containing protein At5g...    211   5e-64   
ref|XP_010438749.1|  PREDICTED: KH domain-containing protein At4g...    211   2e-63   Camelina sativa [gold-of-pleasure]
emb|CDY66744.1|  BnaAnng22840D                                          211   2e-63   Brassica napus [oilseed rape]
ref|XP_009142357.1|  PREDICTED: KH domain-containing protein At4g...    211   2e-63   Brassica rapa
gb|KFK29165.1|  hypothetical protein AALP_AA7G098000                    209   1e-62   Arabis alpina [alpine rockcress]
emb|CAA18222.1|  putative protein                                       216   1e-62   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008447796.1|  PREDICTED: KH domain-containing protein At5g...    206   2e-62   
ref|XP_002867563.1|  KH domain-containing protein                       214   4e-62   
gb|EAZ24441.1|  hypothetical protein OsJ_08192                          206   7e-62   Oryza sativa Japonica Group [Japonica rice]
gb|KJB63136.1|  hypothetical protein B456_009G454400                    206   1e-61   Gossypium raimondii
ref|XP_010942516.1|  PREDICTED: KH domain-containing protein At5g...    203   5e-61   
gb|KHN01498.1|  KH domain-containing protein                            201   2e-60   Glycine soja [wild soybean]
dbj|BAD13019.1|  putative KH domain protein                             204   2e-60   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010063216.1|  PREDICTED: KH domain-containing protein At5g...    202   4e-60   Eucalyptus grandis [rose gum]
emb|CDX92817.1|  BnaC07g40750D                                          202   8e-60   
emb|CDY11960.1|  BnaC03g13860D                                          201   1e-59   Brassica napus [oilseed rape]
ref|XP_002864436.1|  KH domain-containing protein                       202   1e-59   
emb|CDY42731.1|  BnaA03g48080D                                          201   2e-59   Brassica napus [oilseed rape]
ref|XP_009137598.1|  PREDICTED: KH domain-containing protein At4g...    201   2e-59   Brassica rapa
ref|XP_009132341.1|  PREDICTED: KH domain-containing protein At5g...    201   3e-59   Brassica rapa
ref|XP_009120126.1|  PREDICTED: KH domain-containing protein At5g...    199   9e-59   Brassica rapa
emb|CDY51960.1|  BnaCnng21440D                                          199   1e-58   Brassica napus [oilseed rape]
emb|CDY17395.1|  BnaA10g10290D                                          198   2e-58   Brassica napus [oilseed rape]
ref|XP_009410310.1|  PREDICTED: KH domain-containing protein At5g...    193   3e-57   
ref|XP_001764522.1|  predicted protein                                  187   2e-54   
ref|XP_010234630.1|  PREDICTED: KH domain-containing protein At5g...    182   5e-53   Brachypodium distachyon [annual false brome]
ref|XP_003573788.1|  PREDICTED: KH domain-containing protein At5g...    181   4e-52   Brachypodium distachyon [annual false brome]
ref|XP_009415555.1|  PREDICTED: KH domain-containing protein At5g...    181   6e-52   
ref|XP_009120127.1|  PREDICTED: KH domain-containing protein At5g...    179   1e-51   Brassica rapa
ref|XP_001777736.1|  predicted protein                                  179   3e-51   
ref|XP_004973255.1|  PREDICTED: KH domain-containing protein At4g...    178   5e-51   Setaria italica
ref|XP_001780004.1|  predicted protein                                  176   3e-50   
emb|CDX86560.1|  BnaC08g01430D                                          172   1e-49   
ref|XP_006452754.1|  hypothetical protein CICLE_v10009077mg             173   1e-49   
gb|ABR16439.1|  unknown                                                 171   3e-48   Picea sitchensis
ref|XP_010913290.1|  PREDICTED: KH domain-containing protein At5g...    170   4e-48   Elaeis guineensis
ref|XP_010913289.1|  PREDICTED: KH domain-containing protein At5g...    166   1e-46   
ref|XP_010539129.1|  PREDICTED: KH domain-containing protein At4g...    166   1e-46   
ref|XP_006645141.1|  PREDICTED: KH domain-containing protein At1g...    165   8e-46   Oryza brachyantha
ref|XP_008672524.1|  PREDICTED: hypothetical protein isoform X2         163   4e-45   Zea mays [maize]
gb|ABK25791.1|  unknown                                                 163   4e-45   Picea sitchensis
dbj|BAK03295.1|  predicted protein                                      161   6e-45   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ACF79872.1|  unknown                                                 160   7e-45   Zea mays [maize]
ref|NP_001045029.1|  Os01g0886300                                       162   8e-45   
ref|XP_004962051.1|  PREDICTED: KH domain-containing protein At1g...    162   1e-44   Setaria italica
ref|XP_006858588.1|  hypothetical protein AMTR_s00071p00192730          162   2e-44   Amborella trichopoda
ref|XP_004970832.1|  PREDICTED: KH domain-containing protein At1g...    161   3e-44   Setaria italica
ref|XP_008672523.1|  PREDICTED: hypothetical protein isoform X1         161   4e-44   Zea mays [maize]
ref|NP_001055572.1|  Os05g0419500                                       160   4e-44   
ref|XP_002456759.1|  hypothetical protein SORBIDRAFT_03g042090          160   9e-44   Sorghum bicolor [broomcorn]
ref|XP_009414641.1|  PREDICTED: KH domain-containing protein At1g...    159   1e-43   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008775561.1|  PREDICTED: KH domain-containing protein At1g...    159   1e-43   Phoenix dactylifera
emb|CDM85378.1|  unnamed protein product                                158   4e-43   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006654415.1|  PREDICTED: KH domain-containing protein At1g...    157   5e-43   Oryza brachyantha
ref|XP_008788353.1|  PREDICTED: KH domain-containing protein At1g...    157   6e-43   
ref|XP_010927868.1|  PREDICTED: KH domain-containing protein At1g...    157   1e-42   Elaeis guineensis
ref|NP_001142049.1|  hypothetical protein                               155   4e-42   Zea mays [maize]
ref|XP_010245421.1|  PREDICTED: KH domain-containing protein At1g...    154   1e-41   Nelumbo nucifera [Indian lotus]
ref|XP_004230441.1|  PREDICTED: KH domain-containing protein At1g...    154   1e-41   Solanum lycopersicum
ref|XP_010930408.1|  PREDICTED: KH domain-containing protein At1g...    154   1e-41   Elaeis guineensis
ref|XP_010930407.1|  PREDICTED: KH domain-containing protein At1g...    154   2e-41   
ref|XP_002263798.1|  PREDICTED: KH domain-containing protein At1g...    152   6e-41   Vitis vinifera
ref|XP_006349313.1|  PREDICTED: KH domain-containing protein At1g...    152   9e-41   Solanum tuberosum [potatoes]
gb|EMS53218.1|  hypothetical protein TRIUR3_13157                       152   1e-40   Triticum urartu
ref|XP_010278944.1|  PREDICTED: KH domain-containing protein At2g...    151   1e-40   Nelumbo nucifera [Indian lotus]
ref|XP_009776889.1|  PREDICTED: KH domain-containing protein At1g...    152   1e-40   Nicotiana sylvestris
gb|EYU42056.1|  hypothetical protein MIMGU_mgv1a011431mg                151   1e-40   Erythranthe guttata [common monkey flower]
ref|XP_010244589.1|  PREDICTED: KH domain-containing protein At2g...    149   2e-40   Nelumbo nucifera [Indian lotus]
ref|XP_004133720.1|  PREDICTED: KH domain-containing protein At1g...    151   2e-40   Cucumis sativus [cucumbers]
gb|EMT28447.1|  hypothetical protein F775_05859                         152   2e-40   
ref|XP_008786388.1|  PREDICTED: KH domain-containing protein At1g...    151   2e-40   Phoenix dactylifera
ref|XP_003564796.1|  PREDICTED: KH domain-containing protein At1g...    151   2e-40   Brachypodium distachyon [annual false brome]
ref|XP_010245420.1|  PREDICTED: KH domain-containing protein At1g...    151   2e-40   Nelumbo nucifera [Indian lotus]
ref|XP_008803015.1|  PREDICTED: LOW QUALITY PROTEIN: KH domain-co...    150   3e-40   Phoenix dactylifera
ref|XP_009600353.1|  PREDICTED: KH domain-containing protein At3g...    150   3e-40   Nicotiana tomentosiformis
ref|XP_011092287.1|  PREDICTED: KH domain-containing protein At1g...    150   4e-40   Sesamum indicum [beniseed]
ref|XP_009772457.1|  PREDICTED: KH domain-containing protein At3g...    150   5e-40   Nicotiana sylvestris
emb|CDO97629.1|  unnamed protein product                                149   8e-40   Coffea canephora [robusta coffee]
ref|XP_010244588.1|  PREDICTED: KH domain-containing protein At2g...    149   8e-40   Nelumbo nucifera [Indian lotus]
gb|KHG06621.1|  hypothetical protein F383_33149                         149   9e-40   Gossypium arboreum [tree cotton]
ref|XP_011095178.1|  PREDICTED: KH domain-containing protein At2g...    149   1e-39   Sesamum indicum [beniseed]
gb|KGN56263.1|  hypothetical protein Csa_3G110600                       151   1e-39   Cucumis sativus [cucumbers]
gb|KJB47893.1|  hypothetical protein B456_008G046100                    149   1e-39   Gossypium raimondii
ref|XP_009587501.1|  PREDICTED: KH domain-containing protein At1g...    148   3e-39   Nicotiana tomentosiformis
ref|XP_002441114.1|  hypothetical protein SORBIDRAFT_09g020640          148   3e-39   
ref|XP_006385053.1|  hypothetical protein POPTR_0004s23460g             148   3e-39   Populus trichocarpa [western balsam poplar]
ref|XP_006381266.1|  KH domain-containing family protein                147   3e-39   Populus trichocarpa [western balsam poplar]
ref|XP_009790260.1|  PREDICTED: KH domain-containing protein At1g...    148   4e-39   Nicotiana sylvestris
emb|CDP06370.1|  unnamed protein product                                147   4e-39   Coffea canephora [robusta coffee]
ref|XP_006305461.1|  hypothetical protein CARUB_v10009882mg             147   5e-39   Capsella rubella
ref|XP_010922800.1|  PREDICTED: KH domain-containing protein SPIN...    147   6e-39   Elaeis guineensis
ref|XP_009600354.1|  PREDICTED: KH domain-containing protein At3g...    146   7e-39   Nicotiana tomentosiformis
gb|EMT15768.1|  KH domain-containing protein                            147   8e-39   
ref|XP_009348779.1|  PREDICTED: KH domain-containing protein At5g...    142   8e-39   Pyrus x bretschneideri [bai li]
ref|XP_003534621.1|  PREDICTED: KH domain-containing protein At2g...    146   8e-39   Glycine max [soybeans]
ref|XP_006359981.1|  PREDICTED: KH domain-containing protein At2g...    146   9e-39   Solanum tuberosum [potatoes]
ref|XP_010490233.1|  PREDICTED: KH domain-containing protein At1g...    147   9e-39   Camelina sativa [gold-of-pleasure]
ref|XP_011028364.1|  PREDICTED: KH domain-containing protein At1g...    147   9e-39   Populus euphratica
ref|XP_010908089.1|  PREDICTED: KH domain-containing protein At1g...    147   1e-38   Elaeis guineensis
ref|XP_009772459.1|  PREDICTED: KH domain-containing protein At3g...    145   1e-38   Nicotiana sylvestris
gb|KDP21840.1|  hypothetical protein JCGZ_00627                         146   1e-38   Jatropha curcas
gb|KJB71496.1|  hypothetical protein B456_011G125700                    146   1e-38   Gossypium raimondii
ref|XP_009589069.1|  PREDICTED: KH domain-containing protein At2g...    146   1e-38   Nicotiana tomentosiformis
ref|XP_003552330.1|  PREDICTED: KH domain-containing protein At2g...    146   1e-38   Glycine max [soybeans]
ref|XP_009760263.1|  PREDICTED: KH domain-containing protein At2g...    146   1e-38   Nicotiana sylvestris
gb|KHG24418.1|  hypothetical protein F383_31230                         146   1e-38   Gossypium arboreum [tree cotton]
ref|XP_002892515.1|  hypothetical protein ARALYDRAFT_471067             146   1e-38   
ref|XP_004246970.1|  PREDICTED: KH domain-containing protein At2g...    145   2e-38   Solanum lycopersicum
ref|XP_011018951.1|  PREDICTED: KH domain-containing protein At2g...    145   2e-38   Populus euphratica
ref|XP_010475807.1|  PREDICTED: KH domain-containing protein At1g...    146   2e-38   Camelina sativa [gold-of-pleasure]
gb|KJB27614.1|  hypothetical protein B456_005G002300                    144   2e-38   Gossypium raimondii
ref|XP_003623654.1|  KH domain-containing protein                       145   3e-38   Medicago truncatula
gb|KJB27615.1|  hypothetical protein B456_005G002300                    144   3e-38   Gossypium raimondii
gb|ACU24211.1|  unknown                                                 145   3e-38   Glycine max [soybeans]
ref|XP_007041198.1|  RNA-binding KH domain-containing protein iso...    145   4e-38   
emb|CAN79284.1|  hypothetical protein VITISV_041524                     144   4e-38   Vitis vinifera
ref|XP_002268790.1|  PREDICTED: KH domain-containing protein At2g...    144   4e-38   Vitis vinifera
ref|XP_007140039.1|  hypothetical protein PHAVU_008G079200g             144   4e-38   Phaseolus vulgaris [French bean]
ref|XP_009411877.1|  PREDICTED: KH domain-containing protein At1g...    145   5e-38   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008218700.1|  PREDICTED: KH domain-containing protein At1g...    144   6e-38   Prunus mume [ume]
ref|XP_007033461.1|  RNA-binding KH domain-containing protein           144   7e-38   Theobroma cacao [chocolate]
gb|KJB61347.1|  hypothetical protein B456_009G352600                    142   7e-38   Gossypium raimondii
ref|XP_002979473.1|  hypothetical protein SELMODRAFT_110771             144   8e-38   
ref|XP_010030195.1|  PREDICTED: KH domain-containing protein At1g...    144   9e-38   Eucalyptus grandis [rose gum]
ref|XP_010030192.1|  PREDICTED: KH domain-containing protein At1g...    144   9e-38   
ref|XP_008463293.1|  PREDICTED: KH domain-containing protein At2g...    144   9e-38   Cucumis melo [Oriental melon]
gb|KHG06086.1|  hypothetical protein F383_05584                         144   9e-38   Gossypium arboreum [tree cotton]
ref|XP_007225752.1|  hypothetical protein PRUPE_ppa009432mg             144   1e-37   Prunus persica
ref|XP_007134588.1|  hypothetical protein PHAVU_010G059400g             143   1e-37   Phaseolus vulgaris [French bean]
ref|NP_181395.1|  RNA-binding KH domain-containing protein              144   1e-37   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002977855.1|  hypothetical protein SELMODRAFT_107444             142   1e-37   
ref|XP_004492593.1|  PREDICTED: KH domain-containing protein At2g...    143   2e-37   Cicer arietinum [garbanzo]
ref|XP_010458263.1|  PREDICTED: KH domain-containing protein At1g...    144   2e-37   Camelina sativa [gold-of-pleasure]
ref|XP_008355743.1|  PREDICTED: KH domain-containing protein At3g...    143   2e-37   Malus domestica [apple tree]
ref|XP_009370879.1|  PREDICTED: KH domain-containing protein At3g...    143   2e-37   Pyrus x bretschneideri [bai li]
ref|NP_973800.1|  RNA-binding KH domain-containing protein              142   2e-37   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006417550.1|  hypothetical protein EUTSA_v10008323mg             143   2e-37   Eutrema salsugineum [saltwater cress]
ref|XP_004142668.1|  PREDICTED: KH domain-containing protein At2g...    143   2e-37   Cucumis sativus [cucumbers]
ref|XP_010509148.1|  PREDICTED: KH domain-containing protein At2g...    143   2e-37   Camelina sativa [gold-of-pleasure]
gb|KDP42460.1|  hypothetical protein JCGZ_00257                         143   2e-37   Jatropha curcas
ref|XP_006431583.1|  hypothetical protein CICLE_v10002036mg             143   2e-37   
gb|ACU19015.1|  unknown                                                 142   2e-37   Glycine max [soybeans]
ref|XP_004510090.1|  PREDICTED: KH domain-containing protein At2g...    143   2e-37   
ref|XP_010529949.1|  PREDICTED: LOW QUALITY PROTEIN: KH domain-co...    143   3e-37   Tarenaya hassleriana [spider flower]
ref|XP_008359840.1|  PREDICTED: KH domain-containing protein At3g...    142   3e-37   
ref|XP_006294628.1|  hypothetical protein CARUB_v10023665mg             143   3e-37   
ref|XP_008463292.1|  PREDICTED: KH domain-containing protein At2g...    142   3e-37   
ref|NP_172437.2|  RNA-binding KH domain-containing protein              142   3e-37   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003521946.1|  PREDICTED: KH domain-containing protein At2g...    142   3e-37   Glycine max [soybeans]
ref|XP_011047889.1|  PREDICTED: KH domain-containing protein At1g...    142   4e-37   Populus euphratica
ref|XP_009110812.1|  PREDICTED: KH domain-containing protein At1g...    142   4e-37   Brassica rapa
ref|XP_009410498.1|  PREDICTED: KH domain-containing protein SPIN...    142   4e-37   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB47891.1|  hypothetical protein B456_008G046100                    139   4e-37   Gossypium raimondii
ref|XP_007205691.1|  hypothetical protein PRUPE_ppa009701mg             142   4e-37   Prunus persica
ref|XP_009383283.1|  PREDICTED: KH domain-containing protein SPIN...    142   5e-37   
ref|XP_004170718.1|  PREDICTED: KH domain-containing protein At2g...    142   5e-37   
ref|XP_010464471.1|  PREDICTED: KH domain-containing protein At3g...    142   6e-37   
ref|XP_009410499.1|  PREDICTED: KH domain-containing protein SPIN...    141   7e-37   
gb|KHG12649.1|  hypothetical protein F383_20322                         141   7e-37   
ref|XP_011041754.1|  PREDICTED: KH domain-containing protein At2g...    141   7e-37   
gb|ACU19066.1|  unknown                                                 141   8e-37   
ref|XP_011018952.1|  PREDICTED: KH domain-containing protein At2g...    140   8e-37   
ref|XP_003548334.1|  PREDICTED: KH domain-containing protein At2g...    141   9e-37   
ref|XP_006411078.1|  hypothetical protein EUTSA_v10017040mg             140   9e-37   
ref|XP_009353790.1|  PREDICTED: KH domain-containing protein At1g...    141   1e-36   
ref|XP_006389504.1|  hypothetical protein POPTR_0022s00450g             141   1e-36   
ref|XP_002882575.1|  KH domain-containing protein                       141   1e-36   
ref|XP_004302513.1|  PREDICTED: KH domain-containing protein At3g...    141   1e-36   
ref|XP_010043877.1|  PREDICTED: KH domain-containing protein At2g...    140   1e-36   
gb|AAL31922.1|AF419590_1  At1g09660/F21M12_5                            141   1e-36   
ref|XP_011008509.1|  PREDICTED: KH domain-containing protein At2g...    140   2e-36   
ref|XP_002325628.1|  hypothetical protein POPTR_0019s15270g             140   2e-36   
ref|XP_011018950.1|  PREDICTED: KH domain-containing protein At2g...    140   2e-36   
emb|CDP04028.1|  unnamed protein product                                140   2e-36   
ref|XP_006411077.1|  hypothetical protein EUTSA_v10017040mg             140   2e-36   
ref|XP_002533340.1|  nucleic acid binding protein, putative             140   3e-36   
gb|KJB77959.1|  hypothetical protein B456_012G169800                    140   3e-36   
ref|XP_004137670.1|  PREDICTED: KH domain-containing protein At2g...    141   3e-36   
gb|KFK36766.1|  hypothetical protein AALP_AA4G167700                    140   3e-36   
emb|CDY20680.1|  BnaC08g13780D                                          140   3e-36   
ref|XP_002531808.1|  conserved hypothetical protein                     145   3e-36   
ref|XP_010549026.1|  PREDICTED: KH domain-containing protein At1g...    140   3e-36   
ref|XP_010486402.1|  PREDICTED: KH domain-containing protein At3g...    140   3e-36   
ref|XP_010030193.1|  PREDICTED: KH domain-containing protein At1g...    139   5e-36   
ref|XP_008361674.1|  PREDICTED: LOW QUALITY PROTEIN: KH domain-co...    139   5e-36   
ref|XP_004300000.1|  PREDICTED: KH domain-containing protein At1g...    139   5e-36   
ref|XP_010030191.1|  PREDICTED: KH domain-containing protein At1g...    139   5e-36   
ref|XP_006298282.1|  hypothetical protein CARUB_v10014346mg             139   6e-36   
ref|XP_002526434.1|  nucleic acid binding protein, putative             139   6e-36   
ref|XP_010553177.1|  PREDICTED: KH domain-containing protein At3g...    139   6e-36   
ref|XP_009146996.1|  PREDICTED: KH domain-containing protein At3g...    139   6e-36   
ref|XP_010462948.1|  PREDICTED: KH domain-containing protein At3g...    139   7e-36   
emb|CDX93492.1|  BnaA06g05560D                                          139   7e-36   
ref|XP_008218701.1|  PREDICTED: KH domain-containing protein At1g...    139   8e-36   
ref|XP_009148265.1|  PREDICTED: KH domain-containing protein At1g...    139   8e-36   
ref|XP_009133271.1|  PREDICTED: KH domain-containing protein At2g...    139   8e-36   
ref|XP_009110811.1|  PREDICTED: KH domain-containing protein At1g...    139   8e-36   
ref|XP_009337813.1|  PREDICTED: KH domain-containing protein At3g...    138   1e-35   
ref|XP_010558412.1|  PREDICTED: KH domain-containing protein At3g...    138   1e-35   
ref|XP_002319982.1|  hypothetical protein POPTR_0013s15580g             138   1e-35   
ref|XP_010098608.1|  KH domain-containing protein                       139   1e-35   
emb|CDX91481.1|  BnaC04g06690D                                          138   1e-35   
gb|EYU46041.1|  hypothetical protein MIMGU_mgv1a007711mg                140   1e-35   
ref|XP_006431582.1|  hypothetical protein CICLE_v10002036mg             138   1e-35   
ref|XP_011008510.1|  PREDICTED: KH domain-containing protein At3g...    138   1e-35   
ref|XP_010931399.1|  PREDICTED: KH domain-containing protein SPIN...    137   2e-35   
ref|XP_009614149.1|  PREDICTED: KH domain-containing protein At3g...    138   2e-35   
ref|XP_002323686.2|  KH domain-containing family protein                137   2e-35   
emb|CDY27991.1|  BnaC05g43930D                                          137   3e-35   
ref|XP_002264308.1|  PREDICTED: KH domain-containing protein At3g...    137   3e-35   
ref|XP_002459573.1|  hypothetical protein SORBIDRAFT_02g006770          137   3e-35   
emb|CDY31072.1|  BnaA08g26220D                                          137   3e-35   
ref|XP_011006271.1|  PREDICTED: KH domain-containing protein At2g...    137   3e-35   
gb|KJB71497.1|  hypothetical protein B456_011G125700                    136   4e-35   
ref|NP_187474.2|  RNA-binding KH domain-containing protein              137   4e-35   
ref|XP_010096437.1|  KH domain-containing protein                       137   4e-35   
ref|XP_006429644.1|  hypothetical protein CICLE_v10012376mg             137   4e-35   
ref|XP_006429645.1|  hypothetical protein CICLE_v10012376mg             137   4e-35   
ref|XP_006407758.1|  hypothetical protein EUTSA_v10021281mg             136   6e-35   
ref|XP_010683433.1|  PREDICTED: KH domain-containing protein At3g...    136   6e-35   
gb|AAG51340.1|AC012562_1  unknown protein; 28504-31237                  137   7e-35   
ref|XP_009617854.1|  PREDICTED: KH domain-containing protein At3g...    136   9e-35   
emb|CAN61397.1|  hypothetical protein VITISV_015779                     136   9e-35   
ref|NP_001150031.1|  nucleic acid binding protein                       136   9e-35   
emb|CDY07718.1|  BnaA03g17930D                                          136   1e-34   
ref|XP_008378908.1|  PREDICTED: KH domain-containing protein At1g...    135   2e-34   
gb|KDP45673.1|  hypothetical protein JCGZ_17280                         135   2e-34   
ref|XP_009143371.1|  PREDICTED: KH domain-containing protein At2g...    135   2e-34   
ref|XP_010228217.1|  PREDICTED: KH domain-containing protein SPIN...    135   2e-34   
ref|XP_010553190.1|  PREDICTED: KH domain-containing protein At2g...    135   2e-34   
tpg|DAA60062.1|  TPA: nucleic acid binding protein                      136   3e-34   
ref|XP_009355337.1|  PREDICTED: KH domain-containing protein At1g...    135   3e-34   
ref|XP_003557365.1|  PREDICTED: KH domain-containing protein SPIN...    134   4e-34   
ref|XP_004955829.1|  PREDICTED: KH domain-containing protein SPIN...    134   4e-34   
ref|XP_009793497.1|  PREDICTED: KH domain-containing protein At3g...    134   5e-34   
ref|NP_001140438.1|  hypothetical protein                               134   5e-34   
ref|XP_002974032.1|  hypothetical protein SELMODRAFT_100146             133   5e-34   
ref|XP_008775562.1|  PREDICTED: KH domain-containing protein At1g...    134   6e-34   
emb|CDY60757.1|  BnaA05g34810D                                          134   7e-34   
emb|CDY14446.1|  BnaC03g21490D                                          133   9e-34   
tpg|DAA39471.1|  TPA: LOW QUALITY PROTEIN: hypothetical protein Z...    134   1e-33   
ref|XP_004500397.1|  PREDICTED: KH domain-containing protein SPIN...    133   1e-33   
ref|XP_009780437.1|  PREDICTED: KH domain-containing protein At2g...    132   2e-33   
ref|XP_007148574.1|  hypothetical protein PHAVU_006G219900g             133   2e-33   
ref|XP_006350897.1|  PREDICTED: KH domain-containing protein At3g...    132   2e-33   
ref|XP_004242461.1|  PREDICTED: KH domain-containing protein At3g...    132   2e-33   
ref|XP_009617855.1|  PREDICTED: KH domain-containing protein At3g...    132   2e-33   
ref|XP_003538342.1|  PREDICTED: KH domain-containing protein At3g...    132   2e-33   
gb|KHN24715.1|  KH domain-containing protein                            132   2e-33   
dbj|BAD06470.1|  hypothetical protein                                   132   3e-33   
ref|XP_006657570.1|  PREDICTED: KH domain-containing protein SPIN...    132   3e-33   
ref|XP_010327700.1|  PREDICTED: KH domain-containing protein At3g...    131   4e-33   
ref|XP_009793498.1|  PREDICTED: KH domain-containing protein At3g...    130   6e-33   
gb|EPS71004.1|  hypothetical protein M569_03750                         130   8e-33   
ref|XP_009355253.1|  PREDICTED: KH domain-containing protein At3g...    130   8e-33   
ref|XP_003553178.1|  PREDICTED: KH domain-containing protein At3g...    130   1e-32   
ref|XP_003538343.1|  PREDICTED: KH domain-containing protein At3g...    130   1e-32   
ref|XP_006842569.1|  hypothetical protein AMTR_s00077p00149420          130   1e-32   
ref|XP_006362335.1|  PREDICTED: KH domain-containing protein At3g...    130   1e-32   
gb|AET01129.2|  RNA-binding KH domain protein                           130   2e-32   
ref|XP_003626662.1|  KH domain-containing protein                       130   2e-32   
ref|XP_003626653.1|  KH domain-containing protein                       130   2e-32   
ref|XP_003626661.1|  KH domain-containing protein                       130   2e-32   
gb|AFK41392.1|  unknown                                                 130   2e-32   
ref|XP_009374412.1|  PREDICTED: KH domain-containing protein At3g...    129   2e-32   
ref|XP_007205693.1|  hypothetical protein PRUPE_ppa009725mg             129   2e-32   
ref|XP_004294849.1|  PREDICTED: KH domain-containing protein At3g...    129   2e-32   
emb|CDY50885.1|  BnaCnng19770D                                          130   2e-32   
gb|KHN18643.1|  KH domain-containing protein                            129   2e-32   
ref|NP_001059216.1|  Os07g0227400                                       129   4e-32   
gb|EAZ39172.1|  hypothetical protein OsJ_23597                          129   5e-32   
ref|XP_008354244.1|  PREDICTED: KH domain-containing protein At3g...    129   5e-32   
ref|XP_002456539.1|  hypothetical protein SORBIDRAFT_03g038070          128   7e-32   
gb|EPS65062.1|  hypothetical protein M569_09717                         126   7e-32   
ref|NP_001055861.1|  Os05g0481500                                       128   1e-31   
ref|NP_001132285.1|  uncharacterized protein LOC100193725               127   1e-31   
ref|XP_006650789.1|  PREDICTED: KH domain-containing protein SPIN...    127   2e-31   
gb|AFK41792.1|  unknown                                                 127   2e-31   
ref|XP_003600563.1|  KH domain-containing protein                       125   4e-31   
ref|NP_001051685.1|  Os03g0815700                                       126   4e-31   
ref|XP_006381264.1|  hypothetical protein POPTR_0006s11210g             125   6e-31   
ref|XP_004490738.1|  PREDICTED: KH domain-containing protein At3g...    125   7e-31   
ref|XP_002441276.1|  hypothetical protein SORBIDRAFT_09g023640          125   1e-30   
ref|XP_004490737.1|  PREDICTED: KH domain-containing protein At3g...    126   1e-30   
ref|NP_001044630.1|  Os01g0818300                                       125   1e-30   
gb|KHN30620.1|  KH domain-containing protein                            125   2e-30   
ref|XP_007141998.1|  hypothetical protein PHAVU_008G244000g             124   2e-30   
ref|XP_006655420.1|  PREDICTED: KH domain-containing protein SPIN...    124   2e-30   
gb|EEE64120.1|  hypothetical protein OsJ_18952                          124   2e-30   
ref|XP_009395222.1|  PREDICTED: KH domain-containing protein SPIN...    124   3e-30   
ref|XP_006644907.1|  PREDICTED: KH domain-containing protein SPIN...    124   3e-30   
ref|NP_001130116.1|  uncharacterized protein LOC100191210               123   5e-30   
ref|XP_003598316.1|  KH domain-containing protein                       121   6e-30   
ref|NP_001150991.1|  nucleic acid binding protein                       123   6e-30   
ref|XP_004981292.1|  PREDICTED: KH domain-containing protein SPIN...    123   7e-30   
ref|XP_010227830.1|  PREDICTED: KH domain-containing protein SPIN...    123   7e-30   
gb|AFK47467.1|  unknown                                                 122   9e-30   
ref|NP_001168305.1|  hypothetical protein                               123   9e-30   
ref|XP_004970377.1|  PREDICTED: KH domain-containing protein SPIN...    122   1e-29   
ref|XP_002466215.1|  hypothetical protein SORBIDRAFT_01g003680          122   1e-29   
ref|XP_003519299.1|  PREDICTED: KH domain-containing protein At3g...    122   2e-29   
gb|KEH36412.1|  RNA-binding KH domain protein                           122   2e-29   
ref|XP_003563829.1|  PREDICTED: KH domain-containing protein SPIN...    121   3e-29   
gb|KHN41004.1|  KH domain-containing protein                            122   3e-29   
ref|XP_006575463.1|  PREDICTED: KH domain-containing protein At3g...    122   3e-29   
gb|KHN40599.1|  KH domain-containing protein                            122   4e-29   
ref|XP_004961722.1|  PREDICTED: KH domain-containing protein SPIN...    120   5e-29   
gb|ACG41186.1|  nucleic acid binding protein                            120   7e-29   
ref|NP_001148920.1|  nucleic acid binding protein                       120   7e-29   
gb|KGN58679.1|  hypothetical protein Csa_3G727970                       119   8e-29   
gb|ACJ84729.1|  unknown                                                 120   9e-29   
gb|KHN39678.1|  KH domain-containing protein                            118   1e-28   
ref|NP_001148784.1|  protein held out wings                             120   1e-28   
gb|AES99021.2|  RNA-binding KH domain protein                           119   1e-28   
ref|XP_003616061.1|  KH domain-containing protein                       119   2e-28   
gb|AFW84763.1|  hypothetical protein ZEAMMB73_536570                    118   2e-28   
dbj|BAJ96236.1|  predicted protein                                      118   3e-28   
gb|ACF83493.1|  unknown                                                 118   4e-28   
ref|XP_003568231.1|  PREDICTED: KH domain-containing protein SPIN1      118   4e-28   
ref|XP_010030197.1|  PREDICTED: KH domain-containing protein At1g...    117   5e-28   
dbj|BAJ94104.1|  predicted protein                                      118   5e-28   
ref|XP_003592904.1|  KH domain-containing protein                       117   9e-28   
ref|XP_008218703.1|  PREDICTED: KH domain-containing protein At1g...    114   6e-27   
gb|AFK45803.1|  unknown                                                 113   2e-26   
ref|XP_006591877.1|  PREDICTED: uncharacterized protein LOC100796...    114   2e-26   
ref|XP_010030196.1|  PREDICTED: KH domain-containing protein At1g...    112   3e-26   
tpg|DAA60064.1|  TPA: hypothetical protein ZEAMMB73_533537              112   3e-26   
gb|KJB63133.1|  hypothetical protein B456_009G454400                    110   4e-26   
ref|XP_003616062.1|  KH domain-containing protein                       110   2e-25   
gb|ACJ85158.1|  unknown                                                 108   4e-25   
ref|XP_006452745.1|  hypothetical protein CICLE_v10009077mg             107   6e-25   
ref|XP_006452748.1|  hypothetical protein CICLE_v10009077mg             107   6e-25   
ref|NP_001239952.1|  uncharacterized protein LOC100796731               109   9e-25   
ref|XP_006591271.1|  PREDICTED: KH domain-containing protein At3g...    108   9e-25   
gb|EAZ13953.1|  hypothetical protein OsJ_03879                          107   2e-24   
gb|ABK95423.1|  unknown                                                 105   2e-24   
gb|KHN29474.1|  KH domain-containing protein                            107   8e-24   
gb|ACJ85819.1|  unknown                                                 102   2e-23   
gb|AFW78409.1|  hypothetical protein ZEAMMB73_819710                    101   3e-22   
gb|ACN27764.1|  unknown                                                 101   4e-22   
gb|KHG17170.1|  hypothetical protein F383_07324                       97.4    8e-21   
ref|XP_008665662.1|  PREDICTED: KH domain-containing protein SPIN...  95.5    9e-21   
gb|AAB60723.1|  F21M12.5 gene product                                 95.9    1e-20   
gb|ACN25994.1|  unknown                                               94.7    2e-20   
ref|XP_004962052.1|  PREDICTED: KH domain-containing protein At1g...  95.9    4e-20   
gb|KJB47895.1|  hypothetical protein B456_008G046100                  94.0    8e-20   
emb|CDX94961.1|  BnaC05g07100D                                        90.1    2e-19   
ref|XP_010094450.1|  KH domain-containing protein                     90.9    3e-19   
ref|XP_008357681.1|  PREDICTED: KH domain-containing protein At1g...  94.0    3e-19   
gb|KDO64187.1|  hypothetical protein CISIN_1g023068mg                 92.8    3e-19   
gb|EYU33281.1|  hypothetical protein MIMGU_mgv1a0259741mg             92.4    4e-19   
gb|KDO64189.1|  hypothetical protein CISIN_1g023068mg                 91.3    5e-19   
ref|XP_006654416.1|  PREDICTED: KH domain-containing protein At1g...  92.0    8e-19   
gb|AFW78410.1|  hypothetical protein ZEAMMB73_819710                  90.9    9e-19   
gb|EMT11095.1|  KH domain-containing protein                          92.4    9e-19   
ref|XP_007146910.1|  hypothetical protein PHAVU_006G080900g           91.7    1e-18   
gb|EMS48704.1|  KH domain-containing protein SPIN1                    92.4    1e-18   
gb|KJB47892.1|  hypothetical protein B456_008G046100                  85.5    2e-16   
ref|XP_006492549.1|  PREDICTED: KH domain-containing protein At1g...  83.2    4e-16   
ref|XP_006381265.1|  hypothetical protein POPTR_0006s11210g           82.4    9e-16   
ref|XP_009374444.1|  PREDICTED: LOW QUALITY PROTEIN: KH domain-co...  79.7    6e-15   
emb|CBI38089.3|  unnamed protein product                              76.3    1e-14   
gb|KJB63132.1|  hypothetical protein B456_009G454400                  78.2    1e-14   
gb|EJD76678.1|  hypothetical protein LOAG_16437                       79.0    3e-14   
gb|KJB61348.1|  hypothetical protein B456_009G352600                  77.4    3e-14   
dbj|BAH57043.1|  AT5G56140                                            75.5    7e-14   
ref|XP_005535069.1|  similar to RNA-binding protein QKI               80.1    1e-13   
ref|XP_007892264.1|  PREDICTED: KH domain-containing, RNA-binding...  78.6    1e-13   
gb|ACO13056.1|  held out wings                                        75.1    2e-13   
ref|XP_005702863.1|  RNA-binding protein                              79.0    2e-13   
gb|ABK93571.1|  unknown                                               73.2    3e-13   
gb|KHN75225.1|  Female germline-specific tumor suppressor gld-1       79.0    3e-13   
ref|XP_004930627.1|  PREDICTED: protein held out wings-like isofo...  75.9    6e-13   
ref|NP_001072215.1|  KH domain-containing, RNA-binding, signal tr...  76.3    7e-13   
ref|XP_011307726.1|  PREDICTED: protein held out wings isoform X5     75.5    7e-13   



>ref|XP_009620233.1| PREDICTED: KH domain-containing protein At5g56140 isoform X2 
[Nicotiana tomentosiformis]
Length=289

 Score =   281 bits (720),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 158/190 (83%), Positives = 178/190 (94%), Gaps = 0/190 (0%)
 Frame = +3

Query  117  MASSRFMAYspspsaphsphIGALRSASSALVEQEKYLAELLAERSKLSPFMPVLPNCFR  296
            M+S R+MAYSPSPSAPHSPHIG LRSASS L +QEKYL+ELLAER KLSPF+PVLP+C+R
Sbjct  1    MSSGRYMAYSPSPSAPHSPHIGGLRSASSTLADQEKYLSELLAERHKLSPFVPVLPHCYR  60

Query  297  LLNQEILRVTTLLGNASVLDQSGLEHGSPLASGGLFSNGGANKDRWSSPFQSEMSGLVqs  476
            LLNQE+LRVTTLLGNASVLDQSGLE  SPLASGG++SNGGAN DRW+SPFQSE+SGL+ S
Sbjct  61   LLNQELLRVTTLLGNASVLDQSGLEQASPLASGGMYSNGGANMDRWASPFQSEISGLMHS  120

Query  477  ssaqswlgsqssssGLIVKQTIRIDIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDCRVL  656
             SAQSWL +QS+SSGLIVK+T+RIDIPV+QYPNYNFVGRLLGPRGNSLKRVE +T+CRVL
Sbjct  121  PSAQSWLNTQSNSSGLIVKRTLRIDIPVDQYPNYNFVGRLLGPRGNSLKRVEATTECRVL  180

Query  657  IRGRGSIKDP  686
            IRGRGSIKDP
Sbjct  181  IRGRGSIKDP  190



>ref|XP_009762106.1| PREDICTED: KH domain-containing protein At5g56140 isoform X2 
[Nicotiana sylvestris]
Length=289

 Score =   280 bits (717),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 156/190 (82%), Positives = 177/190 (93%), Gaps = 0/190 (0%)
 Frame = +3

Query  117  MASSRFMAYspspsaphsphIGALRSASSALVEQEKYLAELLAERSKLSPFMPVLPNCFR  296
            M+S R+MAYSPSPSAPHSPHIG LRSASSAL +QEKYL+ELLAER K+SPF+PVLP+C+R
Sbjct  1    MSSGRYMAYSPSPSAPHSPHIGGLRSASSALADQEKYLSELLAERHKISPFVPVLPHCYR  60

Query  297  LLNQEILRVTTLLGNASVLDQSGLEHGSPLASGGLFSNGGANKDRWSSPFQSEMSGLVqs  476
            LLNQE+LRVTTLLGNASVLDQSG E  SPLASGG++SNGGAN DRW+SPFQSE+SGL+ S
Sbjct  61   LLNQELLRVTTLLGNASVLDQSGFEQASPLASGGMYSNGGANMDRWASPFQSEISGLMHS  120

Query  477  ssaqswlgsqssssGLIVKQTIRIDIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDCRVL  656
             S QSWL +QS+SSGLIVK+T+RIDIPV+QYPNYNFVGRLLGPRGNSLKRVE +T+CRVL
Sbjct  121  PSTQSWLNTQSNSSGLIVKRTLRIDIPVDQYPNYNFVGRLLGPRGNSLKRVEATTECRVL  180

Query  657  IRGRGSIKDP  686
            IRGRGSIKDP
Sbjct  181  IRGRGSIKDP  190



>ref|XP_010324228.1| PREDICTED: KH domain-containing protein At5g56140 isoform X4 
[Solanum lycopersicum]
Length=291

 Score =   280 bits (717),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 154/191 (81%), Positives = 176/191 (92%), Gaps = 0/191 (0%)
 Frame = +3

Query  117  MASSRFMAYspspsaphsphIGALRSASSALVEQEKYLAELLAERSKLSPFMPVLPNCFR  296
            M+S R+MAYSPSPSAP SPHI  LRSASSA+ EQEKYL+ELLAER KL PF+PVLP+C+R
Sbjct  1    MSSGRYMAYSPSPSAPQSPHIAGLRSASSAIAEQEKYLSELLAERHKLGPFVPVLPHCYR  60

Query  297  LLNQEILRVTTLLGNASVLDQSGLEHGSPLASGGLFSNGGANKDRWSSPFQSEMSGLVqs  476
            LLNQE+LRVTTLLGNASVLDQ+GLEH SPLASGG+FSNGGAN DRW+SPFQSE+SGL+ S
Sbjct  61   LLNQELLRVTTLLGNASVLDQNGLEHASPLASGGMFSNGGANVDRWASPFQSEISGLMHS  120

Query  477  ssaqswlgsqssssGLIVKQTIRIDIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDCRVL  656
             S Q+WL +QS+SSGLIVK+T+RIDIPV+QYP+YNFVGRLLGPRGNSLKRVE +T+CRVL
Sbjct  121  PSTQNWLNTQSNSSGLIVKRTLRIDIPVDQYPSYNFVGRLLGPRGNSLKRVEATTECRVL  180

Query  657  IRGRGSIKDPT  689
            IRGRGSIKDP 
Sbjct  181  IRGRGSIKDPV  191



>ref|XP_006346087.1| PREDICTED: KH domain-containing protein At5g56140-like isoform 
X2 [Solanum tuberosum]
Length=289

 Score =   279 bits (713),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 153/191 (80%), Positives = 175/191 (92%), Gaps = 0/191 (0%)
 Frame = +3

Query  117  MASSRFMAYspspsaphsphIGALRSASSALVEQEKYLAELLAERSKLSPFMPVLPNCFR  296
            M+S R+MAYSPSPSAP SPHI  LRSASSA+ EQEKYL+ELLAER KL PF+PVLP+C+R
Sbjct  1    MSSGRYMAYSPSPSAPQSPHIAGLRSASSAIAEQEKYLSELLAERHKLGPFVPVLPHCYR  60

Query  297  LLNQEILRVTTLLGNASVLDQSGLEHGSPLASGGLFSNGGANKDRWSSPFQSEMSGLVqs  476
            LLNQE+LRVTTLLGNASVLDQ+GLEH SPLASGG+FSNGGAN DRW+SPF SE+SGL+ S
Sbjct  61   LLNQELLRVTTLLGNASVLDQNGLEHASPLASGGMFSNGGANVDRWASPFHSEISGLMHS  120

Query  477  ssaqswlgsqssssGLIVKQTIRIDIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDCRVL  656
             S Q+WL +QS+SSGLIVK+T+RIDIPV+QYP+YNFVGRLLGPRGNSLKRVE +T+CRVL
Sbjct  121  PSTQNWLNTQSNSSGLIVKRTLRIDIPVDQYPSYNFVGRLLGPRGNSLKRVEATTECRVL  180

Query  657  IRGRGSIKDPT  689
            IRGRGSIKDP 
Sbjct  181  IRGRGSIKDPV  191



>emb|CDP13650.1| unnamed protein product [Coffea canephora]
Length=309

 Score =   277 bits (708),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 161/196 (82%), Positives = 181/196 (92%), Gaps = 5/196 (3%)
 Frame = +3

Query  117  MASSRFMAYspspsaphsphIG-----ALRSASSALVEQEKYLAELLAERSKLSPFMPVL  281
            M+S R+MAYSPSPSAPHSPHIG      LRSA+SAL EQEKYL+ELLAER KL+PFMPVL
Sbjct  1    MSSGRYMAYSPSPSAPHSPHIGPAAASGLRSAASALAEQEKYLSELLAERHKLNPFMPVL  60

Query  282  PNCFRLLNQEILRVTTLLGNASVLDQSGLEHGSPLASGGLFSNGGANKDRWSSPFQSEMS  461
            P+ +RLLNQEILRVTTLLGNASVLDQSGLEH SPLASGG++S+GGAN +RW+SPFQSE+S
Sbjct  61   PHSYRLLNQEILRVTTLLGNASVLDQSGLEHASPLASGGIYSHGGANVNRWASPFQSEIS  120

Query  462  GLVqsssaqswlgsqssssGLIVKQTIRIDIPVEQYPNYNFVGRLLGPRGNSLKRVEVST  641
            GL+Q  SAQ+WLGSQ+SSSGLIVK+TIR+DIPVEQYPN+NFVGRLLGPRGNSLKRVE +T
Sbjct  121  GLMQPPSAQNWLGSQASSSGLIVKRTIRVDIPVEQYPNFNFVGRLLGPRGNSLKRVEANT  180

Query  642  DCRVLIRGRGSIKDPT  689
            DCRVLIRGRGSIKDPT
Sbjct  181  DCRVLIRGRGSIKDPT  196



>ref|XP_009620232.1| PREDICTED: KH domain-containing protein At5g56140 isoform X1 
[Nicotiana tomentosiformis]
Length=293

 Score =   276 bits (706),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 158/194 (81%), Positives = 178/194 (92%), Gaps = 4/194 (2%)
 Frame = +3

Query  117  MASSRFMAYspspsaphsphIGALRSASSALVEQEKYLAELLAERSKLSPFMPVLPNCFR  296
            M+S R+MAYSPSPSAPHSPHIG LRSASS L +QEKYL+ELLAER KLSPF+PVLP+C+R
Sbjct  1    MSSGRYMAYSPSPSAPHSPHIGGLRSASSTLADQEKYLSELLAERHKLSPFVPVLPHCYR  60

Query  297  LLNQEILRVTTLLGNASVLDQSGLEHGSPLASGGLFSNGGANKDRWSSPFQSEMSGLVqs  476
            LLNQE+LRVTTLLGNASVLDQSGLE  SPLASGG++SNGGAN DRW+SPFQSE+SGL+ S
Sbjct  61   LLNQELLRVTTLLGNASVLDQSGLEQASPLASGGMYSNGGANMDRWASPFQSEISGLMHS  120

Query  477  ssaqswlgsqssssGLIVKQTIRIDIPVEQYPN----YNFVGRLLGPRGNSLKRVEVSTD  644
             SAQSWL +QS+SSGLIVK+T+RIDIPV+QYPN    YNFVGRLLGPRGNSLKRVE +T+
Sbjct  121  PSAQSWLNTQSNSSGLIVKRTLRIDIPVDQYPNLHLQYNFVGRLLGPRGNSLKRVEATTE  180

Query  645  CRVLIRGRGSIKDP  686
            CRVLIRGRGSIKDP
Sbjct  181  CRVLIRGRGSIKDP  194



>ref|XP_009762105.1| PREDICTED: KH domain-containing protein At5g56140 isoform X1 
[Nicotiana sylvestris]
Length=293

 Score =   275 bits (703),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 156/194 (80%), Positives = 177/194 (91%), Gaps = 4/194 (2%)
 Frame = +3

Query  117  MASSRFMAYspspsaphsphIGALRSASSALVEQEKYLAELLAERSKLSPFMPVLPNCFR  296
            M+S R+MAYSPSPSAPHSPHIG LRSASSAL +QEKYL+ELLAER K+SPF+PVLP+C+R
Sbjct  1    MSSGRYMAYSPSPSAPHSPHIGGLRSASSALADQEKYLSELLAERHKISPFVPVLPHCYR  60

Query  297  LLNQEILRVTTLLGNASVLDQSGLEHGSPLASGGLFSNGGANKDRWSSPFQSEMSGLVqs  476
            LLNQE+LRVTTLLGNASVLDQSG E  SPLASGG++SNGGAN DRW+SPFQSE+SGL+ S
Sbjct  61   LLNQELLRVTTLLGNASVLDQSGFEQASPLASGGMYSNGGANMDRWASPFQSEISGLMHS  120

Query  477  ssaqswlgsqssssGLIVKQTIRIDIPVEQYPN----YNFVGRLLGPRGNSLKRVEVSTD  644
             S QSWL +QS+SSGLIVK+T+RIDIPV+QYPN    YNFVGRLLGPRGNSLKRVE +T+
Sbjct  121  PSTQSWLNTQSNSSGLIVKRTLRIDIPVDQYPNSHLQYNFVGRLLGPRGNSLKRVEATTE  180

Query  645  CRVLIRGRGSIKDP  686
            CRVLIRGRGSIKDP
Sbjct  181  CRVLIRGRGSIKDP  194



>ref|XP_004244007.1| PREDICTED: KH domain-containing protein At5g56140 isoform X3 
[Solanum lycopersicum]
Length=295

 Score =   275 bits (702),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 154/195 (79%), Positives = 176/195 (90%), Gaps = 4/195 (2%)
 Frame = +3

Query  117  MASSRFMAYspspsaphsphIGALRSASSALVEQEKYLAELLAERSKLSPFMPVLPNCFR  296
            M+S R+MAYSPSPSAP SPHI  LRSASSA+ EQEKYL+ELLAER KL PF+PVLP+C+R
Sbjct  1    MSSGRYMAYSPSPSAPQSPHIAGLRSASSAIAEQEKYLSELLAERHKLGPFVPVLPHCYR  60

Query  297  LLNQEILRVTTLLGNASVLDQSGLEHGSPLASGGLFSNGGANKDRWSSPFQSEMSGLVqs  476
            LLNQE+LRVTTLLGNASVLDQ+GLEH SPLASGG+FSNGGAN DRW+SPFQSE+SGL+ S
Sbjct  61   LLNQELLRVTTLLGNASVLDQNGLEHASPLASGGMFSNGGANVDRWASPFQSEISGLMHS  120

Query  477  ssaqswlgsqssssGLIVKQTIRIDIPVEQYPN----YNFVGRLLGPRGNSLKRVEVSTD  644
             S Q+WL +QS+SSGLIVK+T+RIDIPV+QYP+    YNFVGRLLGPRGNSLKRVE +T+
Sbjct  121  PSTQNWLNTQSNSSGLIVKRTLRIDIPVDQYPSLPLQYNFVGRLLGPRGNSLKRVEATTE  180

Query  645  CRVLIRGRGSIKDPT  689
            CRVLIRGRGSIKDP 
Sbjct  181  CRVLIRGRGSIKDPV  195



>ref|XP_004244006.1| PREDICTED: KH domain-containing protein At5g56140 isoform X2 
[Solanum lycopersicum]
Length=299

 Score =   273 bits (699),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 154/199 (77%), Positives = 176/199 (88%), Gaps = 8/199 (4%)
 Frame = +3

Query  117  MASSRFMAYspspsaphsphIGALRSASSALVEQEKYLAELLAERSKLSPFMPVLPNCFR  296
            M+S R+MAYSPSPSAP SPHI  LRSASSA+ EQEKYL+ELLAER KL PF+PVLP+C+R
Sbjct  1    MSSGRYMAYSPSPSAPQSPHIAGLRSASSAIAEQEKYLSELLAERHKLGPFVPVLPHCYR  60

Query  297  LLNQEILRVTTLLGNASVLDQSGLEHGSPLASGGLFSNGGANKDRWSSPFQSE-------  455
            LLNQE+LRVTTLLGNASVLDQ+GLEH SPLASGG+FSNGGAN DRW+SPFQSE       
Sbjct  61   LLNQELLRVTTLLGNASVLDQNGLEHASPLASGGMFSNGGANVDRWASPFQSEVGEANNN  120

Query  456  -MSGLVqsssaqswlgsqssssGLIVKQTIRIDIPVEQYPNYNFVGRLLGPRGNSLKRVE  632
             +SGL+ S S Q+WL +QS+SSGLIVK+T+RIDIPV+QYP+YNFVGRLLGPRGNSLKRVE
Sbjct  121  KISGLMHSPSTQNWLNTQSNSSGLIVKRTLRIDIPVDQYPSYNFVGRLLGPRGNSLKRVE  180

Query  633  VSTDCRVLIRGRGSIKDPT  689
             +T+CRVLIRGRGSIKDP 
Sbjct  181  ATTECRVLIRGRGSIKDPV  199



>ref|XP_006346086.1| PREDICTED: KH domain-containing protein At5g56140-like isoform 
X1 [Solanum tuberosum]
Length=293

 Score =   273 bits (698),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 153/195 (78%), Positives = 175/195 (90%), Gaps = 4/195 (2%)
 Frame = +3

Query  117  MASSRFMAYspspsaphsphIGALRSASSALVEQEKYLAELLAERSKLSPFMPVLPNCFR  296
            M+S R+MAYSPSPSAP SPHI  LRSASSA+ EQEKYL+ELLAER KL PF+PVLP+C+R
Sbjct  1    MSSGRYMAYSPSPSAPQSPHIAGLRSASSAIAEQEKYLSELLAERHKLGPFVPVLPHCYR  60

Query  297  LLNQEILRVTTLLGNASVLDQSGLEHGSPLASGGLFSNGGANKDRWSSPFQSEMSGLVqs  476
            LLNQE+LRVTTLLGNASVLDQ+GLEH SPLASGG+FSNGGAN DRW+SPF SE+SGL+ S
Sbjct  61   LLNQELLRVTTLLGNASVLDQNGLEHASPLASGGMFSNGGANVDRWASPFHSEISGLMHS  120

Query  477  ssaqswlgsqssssGLIVKQTIRIDIPVEQYPN----YNFVGRLLGPRGNSLKRVEVSTD  644
             S Q+WL +QS+SSGLIVK+T+RIDIPV+QYP+    YNFVGRLLGPRGNSLKRVE +T+
Sbjct  121  PSTQNWLNTQSNSSGLIVKRTLRIDIPVDQYPSLPLQYNFVGRLLGPRGNSLKRVEATTE  180

Query  645  CRVLIRGRGSIKDPT  689
            CRVLIRGRGSIKDP 
Sbjct  181  CRVLIRGRGSIKDPV  195



>ref|XP_010676134.1| PREDICTED: KH domain-containing protein At5g56140 isoform X2 
[Beta vulgaris subsp. vulgaris]
Length=291

 Score =   271 bits (692),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 147/192 (77%), Positives = 168/192 (88%), Gaps = 1/192 (1%)
 Frame = +3

Query  117  MASSRFMAYspspsaphsp-hIGALRSASSALVEQEKYLAELLAERSKLSPFMPVLPNCF  293
            MAS R+MAYSPSPS      HI  LRSAS+AL EQEKYLAELLAER K+ PFMP+LPNC+
Sbjct  1    MASGRYMAYSPSPSTTPHSPHIAGLRSASTALAEQEKYLAELLAERQKIGPFMPILPNCY  60

Query  294  RLLNQEILRVTTLLGNASVLDQSGLEHGSPLASGGLFSNGGANKDRWSSPFQSEMSGLVq  473
            RLLNQEILRVTTLLGNAS+LDQ+GL+HG PL SGG++SNGGA+ + W+ PFQSEMSGL+ 
Sbjct  61   RLLNQEILRVTTLLGNASILDQTGLDHGRPLPSGGMYSNGGADMNGWAPPFQSEMSGLLH  120

Query  474  sssaqswlgsqssssGLIVKQTIRIDIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDCRV  653
             SSAQ+WLGS  +SSGLIVK+TIR+DIPV+ YPNYNFVGRLLGPRGNSLKRVE +T+CRV
Sbjct  121  QSSAQNWLGSHGNSSGLIVKRTIRVDIPVDNYPNYNFVGRLLGPRGNSLKRVEATTECRV  180

Query  654  LIRGRGSIKDPT  689
            LIRGRGSIKDP 
Sbjct  181  LIRGRGSIKDPA  192



>gb|EYU27503.1| hypothetical protein MIMGU_mgv1a011068mg [Erythranthe guttata]
Length=293

 Score =   270 bits (689),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 159/196 (81%), Positives = 181/196 (92%), Gaps = 6/196 (3%)
 Frame = +3

Query  117  MASSRFMAYspspsaphsphIG-----ALRSASSALVEQEKYLAELLAERSKLSPFMPVL  281
            M+S R+MAYSPSPSAPHSPHIG     +LR+AS ALVEQEKYLAELLAER+ L PFM VL
Sbjct  1    MSSGRYMAYSPSPSAPHSPHIGVSAAGSLRAAS-ALVEQEKYLAELLAERNSLGPFMTVL  59

Query  282  PNCFRLLNQEILRVTTLLGNASVLDQSGLEHGSPLASGGLFSNGGANKDRWSSPFQSEMS  461
            PNC+RLLNQEI+RVTTLL +ASVL+QSGLEH SPLASGG++SNGGAN +RW+SPFQSEMS
Sbjct  60   PNCYRLLNQEIVRVTTLLASASVLEQSGLEHASPLASGGMYSNGGANVNRWASPFQSEMS  119

Query  462  GLVqsssaqswlgsqssssGLIVKQTIRIDIPVEQYPNYNFVGRLLGPRGNSLKRVEVST  641
            GL+QSS+AQ+WLGSQ SSSGLIVK+T+R+DIPV+Q+PNYNFVGRLLGPRGNSLKRVE +T
Sbjct  120  GLMQSSNAQNWLGSQGSSSGLIVKRTVRVDIPVDQFPNYNFVGRLLGPRGNSLKRVEATT  179

Query  642  DCRVLIRGRGSIKDPT  689
            DCRVLIRGRGSIKDPT
Sbjct  180  DCRVLIRGRGSIKDPT  195



>ref|XP_011097700.1| PREDICTED: LOW QUALITY PROTEIN: KH domain-containing protein 
At4g26480-like [Sesamum indicum]
Length=286

 Score =   268 bits (686),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 153/191 (80%), Positives = 172/191 (90%), Gaps = 4/191 (2%)
 Frame = +3

Query  117  MASSRFMAYspspsaphsphIGALRSASSALVEQEKYLAELLAERSKLSPFMPVLPNCFR  296
            M+S R+MAYSPSPS P +   G +R+AS  LVEQEKYL+ELLAER+KLSPFM VLPNC R
Sbjct  2    MSSGRYMAYSPSPSXPGA---GGIRAAS-PLVEQEKYLSELLAERNKLSPFMAVLPNCCR  57

Query  297  LLNQEILRVTTLLGNASVLDQSGLEHGSPLASGGLFSNGGANKDRWSSPFQSEMSGLVqs  476
            LLNQEILRVTTLLGNASVL+QSG +H SPLASGG++SNGGAN +RW SPFQSEMSGL+Q+
Sbjct  58   LLNQEILRVTTLLGNASVLEQSGFDHASPLASGGIYSNGGANMNRWPSPFQSEMSGLIQT  117

Query  477  ssaqswlgsqssssGLIVKQTIRIDIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDCRVL  656
            SSAQ+WLGS  SSSGLIVK+TIR+DIPV+QYPNYNFVGRLLGPRGNSLKRVE +TDCRVL
Sbjct  118  SSAQNWLGSHGSSSGLIVKRTIRVDIPVDQYPNYNFVGRLLGPRGNSLKRVEATTDCRVL  177

Query  657  IRGRGSIKDPT  689
            IRGRGSIKDP 
Sbjct  178  IRGRGSIKDPA  188



>ref|XP_002274648.1| PREDICTED: KH domain-containing protein At5g56140 [Vitis vinifera]
 emb|CBI39805.3| unnamed protein product [Vitis vinifera]
Length=287

 Score =   268 bits (685),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 152/192 (79%), Positives = 172/192 (90%), Gaps = 4/192 (2%)
 Frame = +3

Query  117  MASSRFMAYspspsaphsp-hIGALRSASSALVEQEKYLAELLAERSKLSPFMPVLPNCF  293
            M+S R+MAYSPSPS      HI  LRSA+SALVEQEKYL+ELLAER KLSPFMPVLP+ +
Sbjct  1    MSSGRYMAYSPSPSTAPHSPHIAGLRSATSALVEQEKYLSELLAERHKLSPFMPVLPHSY  60

Query  294  RLLNQEILRVTTLLGNASVLDQSGLEHGSPLASGGLFSNGGANKDRWSSPFQSEMSGLVq  473
            RLLNQEILRVTTLLGNAS+LDQSGLEH SPLASGG+FSNGGAN + W+SPFQSEMSGL  
Sbjct  61   RLLNQEILRVTTLLGNASILDQSGLEHASPLASGGIFSNGGANVNGWASPFQSEMSGL--  118

Query  474  sssaqswlgsqssssGLIVKQTIRIDIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDCRV  653
             S+AQ+WLGSQ SSSGLIVK+TIR+DIPVE++P+YNFVGRLLGPRGNSLKR+E +T+CRV
Sbjct  119  -SAAQNWLGSQGSSSGLIVKRTIRVDIPVEKFPSYNFVGRLLGPRGNSLKRMEATTECRV  177

Query  654  LIRGRGSIKDPT  689
            LIRGRGSIKDP 
Sbjct  178  LIRGRGSIKDPA  189



>ref|XP_011095628.1| PREDICTED: KH domain-containing protein At5g56140-like isoform 
X2 [Sesamum indicum]
Length=285

 Score =   267 bits (683),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 155/191 (81%), Positives = 176/191 (92%), Gaps = 4/191 (2%)
 Frame = +3

Query  117  MASSRFMAYspspsaphsphIGALRSASSALVEQEKYLAELLAERSKLSPFMPVLPNCFR  296
            M+S R+MAYSPSPSAPHSPHIGA    +SALVEQEKYL+ELLAER+KLSPF+ VLPN +R
Sbjct  1    MSSGRYMAYSPSPSAPHSPHIGA----ASALVEQEKYLSELLAERNKLSPFIAVLPNSYR  56

Query  297  LLNQEILRVTTLLGNASVLDQSGLEHGSPLASGGLFSNGGANKDRWSSPFQSEMSGLVqs  476
            LLNQEILRVTTLLGNASVL+QSGLEH SPLASGG++SNGGAN +RW+SPFQS++S ++Q 
Sbjct  57   LLNQEILRVTTLLGNASVLEQSGLEHASPLASGGIYSNGGANMNRWASPFQSDLSSMMQP  116

Query  477  ssaqswlgsqssssGLIVKQTIRIDIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDCRVL  656
            SS Q+WLGSQ SSSGLIVK+T+R+DIPVEQYPNYNFVGRLLGPRGNSLKRVE +TDCRVL
Sbjct  117  SSVQNWLGSQGSSSGLIVKRTLRVDIPVEQYPNYNFVGRLLGPRGNSLKRVEATTDCRVL  176

Query  657  IRGRGSIKDPT  689
            IRGRGSIKDP 
Sbjct  177  IRGRGSIKDPV  187



>ref|XP_010324227.1| PREDICTED: KH domain-containing protein At5g56140 isoform X1 
[Solanum lycopersicum]
Length=303

 Score =   267 bits (683),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 154/203 (76%), Positives = 176/203 (87%), Gaps = 12/203 (6%)
 Frame = +3

Query  117  MASSRFMAYspspsaphsphIGALRSASSALVEQEKYLAELLAERSKLSPFMPVLPNCFR  296
            M+S R+MAYSPSPSAP SPHI  LRSASSA+ EQEKYL+ELLAER KL PF+PVLP+C+R
Sbjct  1    MSSGRYMAYSPSPSAPQSPHIAGLRSASSAIAEQEKYLSELLAERHKLGPFVPVLPHCYR  60

Query  297  LLNQEILRVTTLLGNASVLDQSGLEHGSPLASGGLFSNGGANKDRWSSPFQSE-------  455
            LLNQE+LRVTTLLGNASVLDQ+GLEH SPLASGG+FSNGGAN DRW+SPFQSE       
Sbjct  61   LLNQELLRVTTLLGNASVLDQNGLEHASPLASGGMFSNGGANVDRWASPFQSEVGEANNN  120

Query  456  -MSGLVqsssaqswlgsqssssGLIVKQTIRIDIPVEQYPN----YNFVGRLLGPRGNSL  620
             +SGL+ S S Q+WL +QS+SSGLIVK+T+RIDIPV+QYP+    YNFVGRLLGPRGNSL
Sbjct  121  KISGLMHSPSTQNWLNTQSNSSGLIVKRTLRIDIPVDQYPSLPLQYNFVGRLLGPRGNSL  180

Query  621  KRVEVSTDCRVLIRGRGSIKDPT  689
            KRVE +T+CRVLIRGRGSIKDP 
Sbjct  181  KRVEATTECRVLIRGRGSIKDPV  203



>ref|XP_011095627.1| PREDICTED: KH domain-containing protein At5g56140-like isoform 
X1 [Sesamum indicum]
Length=297

 Score =   266 bits (681),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 155/191 (81%), Positives = 176/191 (92%), Gaps = 4/191 (2%)
 Frame = +3

Query  117  MASSRFMAYspspsaphsphIGALRSASSALVEQEKYLAELLAERSKLSPFMPVLPNCFR  296
            M+S R+MAYSPSPSAPHSPHIGA    +SALVEQEKYL+ELLAER+KLSPF+ VLPN +R
Sbjct  1    MSSGRYMAYSPSPSAPHSPHIGA----ASALVEQEKYLSELLAERNKLSPFIAVLPNSYR  56

Query  297  LLNQEILRVTTLLGNASVLDQSGLEHGSPLASGGLFSNGGANKDRWSSPFQSEMSGLVqs  476
            LLNQEILRVTTLLGNASVL+QSGLEH SPLASGG++SNGGAN +RW+SPFQS++S ++Q 
Sbjct  57   LLNQEILRVTTLLGNASVLEQSGLEHASPLASGGIYSNGGANMNRWASPFQSDLSSMMQP  116

Query  477  ssaqswlgsqssssGLIVKQTIRIDIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDCRVL  656
            SS Q+WLGSQ SSSGLIVK+T+R+DIPVEQYPNYNFVGRLLGPRGNSLKRVE +TDCRVL
Sbjct  117  SSVQNWLGSQGSSSGLIVKRTLRVDIPVEQYPNYNFVGRLLGPRGNSLKRVEATTDCRVL  176

Query  657  IRGRGSIKDPT  689
            IRGRGSIKDP 
Sbjct  177  IRGRGSIKDPV  187



>ref|XP_010676133.1| PREDICTED: KH domain-containing protein At5g56140 isoform X1 
[Beta vulgaris subsp. vulgaris]
Length=292

 Score =   266 bits (680),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 147/193 (76%), Positives = 168/193 (87%), Gaps = 2/193 (1%)
 Frame = +3

Query  117  MASSRFMAYspspsaphsp-hIGALRSASSALVEQEKYLAELLAERSKLSPFMPVLPNCF  293
            MAS R+MAYSPSPS      HI  LRSAS+AL EQEKYLAELLAER K+ PFMP+LPNC+
Sbjct  1    MASGRYMAYSPSPSTTPHSPHIAGLRSASTALAEQEKYLAELLAERQKIGPFMPILPNCY  60

Query  294  RLLNQEILRVTTLLGNASVLDQSGLEHGSPLASGGLFSNGGANKDRWSSPFQSEMSGLVq  473
            RLLNQEILRVTTLLGNAS+LDQ+GL+HG PL SGG++SNGGA+ + W+ PFQSEMSGL+ 
Sbjct  61   RLLNQEILRVTTLLGNASILDQTGLDHGRPLPSGGMYSNGGADMNGWAPPFQSEMSGLLH  120

Query  474  sssaqswlgsqssssGLIVKQTIRIDIPVEQYPN-YNFVGRLLGPRGNSLKRVEVSTDCR  650
             SSAQ+WLGS  +SSGLIVK+TIR+DIPV+ YPN YNFVGRLLGPRGNSLKRVE +T+CR
Sbjct  121  QSSAQNWLGSHGNSSGLIVKRTIRVDIPVDNYPNQYNFVGRLLGPRGNSLKRVEATTECR  180

Query  651  VLIRGRGSIKDPT  689
            VLIRGRGSIKDP 
Sbjct  181  VLIRGRGSIKDPA  193



>gb|KDP36322.1| hypothetical protein JCGZ_09537 [Jatropha curcas]
Length=295

 Score =   263 bits (672),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 157/195 (81%), Positives = 174/195 (89%), Gaps = 0/195 (0%)
 Frame = +3

Query  105  TSKQMASSRFMAYspspsaphsphIGALRSASSALVEQEKYLAELLAERSKLSPFMPVLP  284
            TS      R+MAYSPSPSAPHSPH+  LRSASSA+VEQEKYL+ELLAER KLSPFMPVLP
Sbjct  3    TSGGGGGGRYMAYSPSPSAPHSPHLSGLRSASSAIVEQEKYLSELLAERHKLSPFMPVLP  62

Query  285  NCFRLLNQEILRVTTLLGNASVLDQSGLEHGSPLASGGLFSNGGANKDRWSSPFQSEMSG  464
            + +RLLNQEILRVTTLLGNASVL QSGLEH SPLASGG+FSNGGA+ + W+S FQSEMS 
Sbjct  63   HTYRLLNQEILRVTTLLGNASVLGQSGLEHASPLASGGIFSNGGADANGWASRFQSEMSS  122

Query  465  LVqsssaqswlgsqssssGLIVKQTIRIDIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTD  644
            L+Q SSAQ+WL SQ SSSGLIVK+TIR+DIPV+ YP+YNFVGRLLGPRGNSLKRVE ST+
Sbjct  123  LLQPSSAQNWLSSQGSSSGLIVKRTIRVDIPVDTYPSYNFVGRLLGPRGNSLKRVEASTE  182

Query  645  CRVLIRGRGSIKDPT  689
            CRVLIRGRGSIKDPT
Sbjct  183  CRVLIRGRGSIKDPT  197



>ref|XP_002532938.1| nucleic acid binding protein, putative [Ricinus communis]
 gb|EEF29442.1| nucleic acid binding protein, putative [Ricinus communis]
Length=300

 Score =   263 bits (671),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 156/187 (83%), Positives = 173/187 (93%), Gaps = 0/187 (0%)
 Frame = +3

Query  129  RFMAYspspsaphsphIGALRSASSALVEQEKYLAELLAERSKLSPFMPVLPNCFRLLNQ  308
            RFMAYSPSPSAPHSPH+  LRSASSALVEQEKYL+ELLAER KLSPFMPVLP+ +RLL+Q
Sbjct  16   RFMAYSPSPSAPHSPHLSGLRSASSALVEQEKYLSELLAERHKLSPFMPVLPHTYRLLSQ  75

Query  309  EILRVTTLLGNASVLDQSGLEHGSPLASGGLFSNGGANKDRWSSPFQSEMSGLVqsssaq  488
            EILRVTTLLGNASVL QSGLEH SPLASGG+FSNGGA+ + W+S FQSEMSGL+Q SSAQ
Sbjct  76   EILRVTTLLGNASVLGQSGLEHASPLASGGMFSNGGADANGWASRFQSEMSGLIQPSSAQ  135

Query  489  swlgsqssssGLIVKQTIRIDIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDCRVLIRGR  668
            +WL SQ SSSGLIVK+TIR+DIP+E+YP+YNFVGRLLGPRGNSLKRVE ST+CRVLIRGR
Sbjct  136  NWLSSQGSSSGLIVKRTIRVDIPIERYPSYNFVGRLLGPRGNSLKRVEASTECRVLIRGR  195

Query  669  GSIKDPT  689
            GSIKDP 
Sbjct  196  GSIKDPA  202



>ref|XP_008782987.1| PREDICTED: KH domain-containing protein At5g56140 [Phoenix dactylifera]
Length=291

 Score =   259 bits (662),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 147/193 (76%), Positives = 165/193 (85%), Gaps = 2/193 (1%)
 Frame = +3

Query  117  MASSRFMAYspspsaphsp-hIGALRSASSALVEQEKYLAELLAERSKLSPFMPVLPNCF  293
            MAS R+MAYSPSPS      HI  +RSA++A VEQEK+LAELLAER KL PFM VLPNC+
Sbjct  1    MASGRYMAYSPSPSTAPQSPHISGMRSATNAFVEQEKHLAELLAERQKLGPFMSVLPNCY  60

Query  294  RLLNQEILRVTTLLGNASVLDQSGLEHGSPLASGGLFSNGG-ANKDRWSSPFQSEMSGLV  470
            RLLNQEILRVTTLLGNAS+LDQ+GLEHGSPL +GGLFSNGG A+ + W+SPFQ E  GL+
Sbjct  61   RLLNQEILRVTTLLGNASLLDQTGLEHGSPLTTGGLFSNGGAADMNGWASPFQPERLGLL  120

Query  471  qsssaqswlgsqssssGLIVKQTIRIDIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDCR  650
            Q SSA  W G Q SSSGLIVK+TIR+DIPV++YPNYNFVGRLLGPRGNSLKRVE ST+CR
Sbjct  121  QPSSAHGWFGPQGSSSGLIVKKTIRVDIPVDKYPNYNFVGRLLGPRGNSLKRVEASTECR  180

Query  651  VLIRGRGSIKDPT  689
            VLIRGRGSIKDP 
Sbjct  181  VLIRGRGSIKDPA  193



>ref|XP_004294880.1| PREDICTED: KH domain-containing protein At5g56140-like [Fragaria 
vesca subsp. vesca]
Length=297

 Score =   258 bits (659),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 148/198 (75%), Positives = 166/198 (84%), Gaps = 2/198 (1%)
 Frame = +3

Query  102  FTSKQMASSRFMAYspspsaphsphIGALRSASSA--LVEQEKYLAELLAERSKLSPFMP  275
             TS      R+MAYSPS SAP SPHI  LRS+S+A  + EQEKYL+ELL ER KL PF+P
Sbjct  1    MTSSSGVGGRYMAYSPSLSAPLSPHISGLRSSSAAALVAEQEKYLSELLGERHKLGPFLP  60

Query  276  VLPNCFRLLNQEILRVTTLLGNASVLDQSGLEHGSPLASGGLFSNGGANKDRWSSPFQSE  455
            VLPNCFRLLNQEILRVTTLLGNASVL QSGLEH SPLASGG+FSNGGA+ D W++ FQSE
Sbjct  61   VLPNCFRLLNQEILRVTTLLGNASVLGQSGLEHASPLASGGMFSNGGADMDGWATRFQSE  120

Query  456  MSGLVqsssaqswlgsqssssGLIVKQTIRIDIPVEQYPNYNFVGRLLGPRGNSLKRVEV  635
            MS L+Q    Q+W GSQ SSSGLIVK+TIR+DIPV++YP YNFVGRLLGPRGNSLKRVE 
Sbjct  121  MSTLLQPPPTQNWHGSQGSSSGLIVKRTIRVDIPVDKYPTYNFVGRLLGPRGNSLKRVEA  180

Query  636  STDCRVLIRGRGSIKDPT  689
            +T+CRVLIRGRGSIKDP 
Sbjct  181  TTECRVLIRGRGSIKDPA  198



>ref|XP_009415553.1| PREDICTED: KH domain-containing protein At5g56140-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=291

 Score =   257 bits (657),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 145/193 (75%), Positives = 168/193 (87%), Gaps = 2/193 (1%)
 Frame = +3

Query  117  MASSRFMAYspspsaphsp-hIGALRSASSALVEQEKYLAELLAERSKLSPFMPVLPNCF  293
            MAS RFMAYSPSPS      HI  +RSA+ A  EQEKYL+ELLAER KLSPF+PVLP+C+
Sbjct  1    MASGRFMAYSPSPSTAPHSPHIPGIRSATGAFAEQEKYLSELLAERQKLSPFVPVLPHCY  60

Query  294  RLLNQEILRVTTLLGNASVLDQSGLEHGSPLASGGLFSNGGANK-DRWSSPFQSEMSGLV  470
            RLLNQEI+RVT LLGNAS+LDQSGLE+GSP+ +GGLFSNGGAN  + W+SPFQSE  GLV
Sbjct  61   RLLNQEIIRVTMLLGNASLLDQSGLEYGSPMTTGGLFSNGGANDMNGWASPFQSERMGLV  120

Query  471  qsssaqswlgsqssssGLIVKQTIRIDIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDCR  650
            Q SSA SWLGS+ SSSGLIVK+TIR+DIP++++P +NFVGRLLGPRGNSLKRVE +TDCR
Sbjct  121  QPSSAHSWLGSEGSSSGLIVKKTIRVDIPIDKFPTFNFVGRLLGPRGNSLKRVEANTDCR  180

Query  651  VLIRGRGSIKDPT  689
            +LIRGRGSIKDPT
Sbjct  181  ILIRGRGSIKDPT  193



>gb|KDO73993.1| hypothetical protein CISIN_1g022785mg [Citrus sinensis]
Length=196

 Score =   253 bits (646),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 154/194 (79%), Positives = 176/194 (91%), Gaps = 3/194 (2%)
 Frame = +3

Query  117  MASS---RFMAYspspsaphsphIGALRSASSALVEQEKYLAELLAERSKLSPFMPVLPN  287
            MASS   RFMAYS SPSAPHSPH+ +LRSASSA+++QEKYL+ELLAER KL+PF+PVLPN
Sbjct  1    MASSGGGRFMAYSLSPSAPHSPHLPSLRSASSAILDQEKYLSELLAERHKLNPFLPVLPN  60

Query  288  CFRLLNQEILRVTTLLGNASVLDQSGLEHGSPLASGGLFSNGGANKDRWSSPFQSEMSGL  467
             +RLLNQEI+RVTTLLGNASVL QSGLEH SPL SGG+FSNGGA+ +  +S FQSE+SGL
Sbjct  61   AYRLLNQEIMRVTTLLGNASVLGQSGLEHASPLTSGGIFSNGGADTNGLASRFQSEISGL  120

Query  468  VqsssaqswlgsqssssGLIVKQTIRIDIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDC  647
            +QSSSAQ+WL SQ SSSGLIVK+TIR+DIPVE+YPN+NFVGRLLGPRGNSLKRVE ST+C
Sbjct  121  MQSSSAQNWLSSQGSSSGLIVKRTIRVDIPVEKYPNFNFVGRLLGPRGNSLKRVEASTEC  180

Query  648  RVLIRGRGSIKDPT  689
            RVLIRGRGSIKDP 
Sbjct  181  RVLIRGRGSIKDPA  194



>ref|XP_006452750.1| hypothetical protein CICLE_v10009077mg [Citrus clementina]
 gb|ESR65990.1| hypothetical protein CICLE_v10009077mg [Citrus clementina]
Length=196

 Score =   252 bits (643),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 154/194 (79%), Positives = 176/194 (91%), Gaps = 3/194 (2%)
 Frame = +3

Query  117  MASS---RFMAYspspsaphsphIGALRSASSALVEQEKYLAELLAERSKLSPFMPVLPN  287
            MASS   RFMAYS SPSAPHSPH+ +LRSASSA+++QEKYL+ELLAER KL+PF+PVLPN
Sbjct  1    MASSGGGRFMAYSLSPSAPHSPHLPSLRSASSAILDQEKYLSELLAERHKLNPFLPVLPN  60

Query  288  CFRLLNQEILRVTTLLGNASVLDQSGLEHGSPLASGGLFSNGGANKDRWSSPFQSEMSGL  467
             +RLLNQEI+RVTTLLGNASVL QSGLEH SPL SGG+FSNGGA+ +  +S FQSE+SGL
Sbjct  61   TYRLLNQEIMRVTTLLGNASVLGQSGLEHASPLTSGGIFSNGGADVNGLASRFQSEISGL  120

Query  468  VqsssaqswlgsqssssGLIVKQTIRIDIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDC  647
            +QSSSAQ+WL SQ SSSGLIVK+TIR+DIPVE+YPN+NFVGRLLGPRGNSLKRVE ST+C
Sbjct  121  MQSSSAQNWLSSQGSSSGLIVKRTIRVDIPVEKYPNFNFVGRLLGPRGNSLKRVEASTEC  180

Query  648  RVLIRGRGSIKDPT  689
            RVLIRGRGSIKDP 
Sbjct  181  RVLIRGRGSIKDPA  194



>gb|KDO73994.1| hypothetical protein CISIN_1g022785mg [Citrus sinensis]
Length=222

 Score =   253 bits (646),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 154/194 (79%), Positives = 176/194 (91%), Gaps = 3/194 (2%)
 Frame = +3

Query  117  MASS---RFMAYspspsaphsphIGALRSASSALVEQEKYLAELLAERSKLSPFMPVLPN  287
            MASS   RFMAYS SPSAPHSPH+ +LRSASSA+++QEKYL+ELLAER KL+PF+PVLPN
Sbjct  1    MASSGGGRFMAYSLSPSAPHSPHLPSLRSASSAILDQEKYLSELLAERHKLNPFLPVLPN  60

Query  288  CFRLLNQEILRVTTLLGNASVLDQSGLEHGSPLASGGLFSNGGANKDRWSSPFQSEMSGL  467
             +RLLNQEI+RVTTLLGNASVL QSGLEH SPL SGG+FSNGGA+ +  +S FQSE+SGL
Sbjct  61   AYRLLNQEIMRVTTLLGNASVLGQSGLEHASPLTSGGIFSNGGADTNGLASRFQSEISGL  120

Query  468  VqsssaqswlgsqssssGLIVKQTIRIDIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDC  647
            +QSSSAQ+WL SQ SSSGLIVK+TIR+DIPVE+YPN+NFVGRLLGPRGNSLKRVE ST+C
Sbjct  121  MQSSSAQNWLSSQGSSSGLIVKRTIRVDIPVEKYPNFNFVGRLLGPRGNSLKRVEASTEC  180

Query  648  RVLIRGRGSIKDPT  689
            RVLIRGRGSIKDP 
Sbjct  181  RVLIRGRGSIKDPA  194



>ref|XP_010929006.1| PREDICTED: KH domain-containing protein At5g56140-like [Elaeis 
guineensis]
Length=291

 Score =   255 bits (651),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 147/192 (77%), Positives = 164/192 (85%), Gaps = 2/192 (1%)
 Frame = +3

Query  117  MASSRFMAYspspsaphsp-hIGALRSASSALVEQEKYLAELLAERSKLSPFMPVLPNCF  293
            MAS R+M YSPSPS      HI  +RSA+SA VEQEKYLAELLAER KLSPF  VL +C+
Sbjct  1    MASGRYMPYSPSPSTAPQSPHISGIRSATSAFVEQEKYLAELLAERQKLSPFTSVLTHCY  60

Query  294  RLLNQEILRVTTLLGNASVLDQSGLEHGSPLASGGLFSNGG-ANKDRWSSPFQSEMSGLV  470
            RLLNQEILRVTTLLGNAS+LDQ+GLEHGSPL +GGLFSNGG A+ + W+SPFQ E  GL+
Sbjct  61   RLLNQEILRVTTLLGNASLLDQTGLEHGSPLTTGGLFSNGGAADMNGWASPFQPERLGLL  120

Query  471  qsssaqswlgsqssssGLIVKQTIRIDIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDCR  650
            Q SSA  WLG Q SSSGLIVK+TIR+DIPV++YPNYNFVGRLLGPRGNSLKRVE ST+CR
Sbjct  121  QPSSAHGWLGPQGSSSGLIVKKTIRVDIPVDKYPNYNFVGRLLGPRGNSLKRVEASTECR  180

Query  651  VLIRGRGSIKDP  686
            VLIRGRGSIKDP
Sbjct  181  VLIRGRGSIKDP  192



>ref|XP_010244820.1| PREDICTED: KH domain-containing protein At5g56140-like [Nelumbo 
nucifera]
Length=290

 Score =   254 bits (650),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 145/192 (76%), Positives = 165/192 (86%), Gaps = 1/192 (1%)
 Frame = +3

Query  117  MASSRFMAYspspsaphsphIGALRSASSALVEQEKYLAELLAERSKLSPFMPVLPNCFR  296
            M+S R+MAYSPSPS         +RSA++ALVEQEKYL++LLAER KLSPFMPVLP+ +R
Sbjct  1    MSSGRYMAYSPSPSTAPHSPHIGIRSATNALVEQEKYLSDLLAERHKLSPFMPVLPHSYR  60

Query  297  LLNQEILRVTTLLGNASVLDQSGLEHGSPLASGGLFSN-GGANKDRWSSPFQSEMSGLVq  473
            LLNQEILRVTTLLGNAS+LDQSGLEH SPL SGGLFSN GGA+ + W+S FQSE  GL+Q
Sbjct  61   LLNQEILRVTTLLGNASLLDQSGLEHASPLTSGGLFSNGGGADMNGWASAFQSERLGLLQ  120

Query  474  sssaqswlgsqssssGLIVKQTIRIDIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDCRV  653
             S   SWLGSQ SSSGLIVK+TI +D+PV++YPNYNFVGRLLGPRGNSLKRVE ST+CRV
Sbjct  121  PSPTPSWLGSQGSSSGLIVKKTILVDVPVDKYPNYNFVGRLLGPRGNSLKRVEASTECRV  180

Query  654  LIRGRGSIKDPT  689
            LIRGRGSIKDPT
Sbjct  181  LIRGRGSIKDPT  192



>ref|XP_006474774.1| PREDICTED: KH domain-containing protein At5g56140-like [Citrus 
sinensis]
Length=292

 Score =   253 bits (647),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 154/194 (79%), Positives = 176/194 (91%), Gaps = 3/194 (2%)
 Frame = +3

Query  117  MASS---RFMAYspspsaphsphIGALRSASSALVEQEKYLAELLAERSKLSPFMPVLPN  287
            MASS   RFMAYS SPSAPHSPH+ +LRSASSA+++QEKYL+ELLAER KL+PF+PVLPN
Sbjct  1    MASSGGGRFMAYSLSPSAPHSPHLPSLRSASSAILDQEKYLSELLAERHKLNPFLPVLPN  60

Query  288  CFRLLNQEILRVTTLLGNASVLDQSGLEHGSPLASGGLFSNGGANKDRWSSPFQSEMSGL  467
             +RLLNQEI+RVTTLLGNASVL QSGLEH SPL SGG+FSNGGA+ +  +S FQSE+SGL
Sbjct  61   AYRLLNQEIMRVTTLLGNASVLGQSGLEHASPLTSGGIFSNGGADTNGLASRFQSEISGL  120

Query  468  VqsssaqswlgsqssssGLIVKQTIRIDIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDC  647
            +QSSSAQ+WL SQ SSSGLIVK+TIR+DIPVE+YPN+NFVGRLLGPRGNSLKRVE ST+C
Sbjct  121  MQSSSAQNWLSSQGSSSGLIVKRTIRVDIPVEKYPNFNFVGRLLGPRGNSLKRVEASTEC  180

Query  648  RVLIRGRGSIKDPT  689
            RVLIRGRGSIKDP 
Sbjct  181  RVLIRGRGSIKDPA  194



>gb|KDO73992.1| hypothetical protein CISIN_1g022785mg [Citrus sinensis]
Length=292

 Score =   253 bits (647),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 154/194 (79%), Positives = 176/194 (91%), Gaps = 3/194 (2%)
 Frame = +3

Query  117  MASS---RFMAYspspsaphsphIGALRSASSALVEQEKYLAELLAERSKLSPFMPVLPN  287
            MASS   RFMAYS SPSAPHSPH+ +LRSASSA+++QEKYL+ELLAER KL+PF+PVLPN
Sbjct  1    MASSGGGRFMAYSLSPSAPHSPHLPSLRSASSAILDQEKYLSELLAERHKLNPFLPVLPN  60

Query  288  CFRLLNQEILRVTTLLGNASVLDQSGLEHGSPLASGGLFSNGGANKDRWSSPFQSEMSGL  467
             +RLLNQEI+RVTTLLGNASVL QSGLEH SPL SGG+FSNGGA+ +  +S FQSE+SGL
Sbjct  61   AYRLLNQEIMRVTTLLGNASVLGQSGLEHASPLTSGGIFSNGGADTNGLASRFQSEISGL  120

Query  468  VqsssaqswlgsqssssGLIVKQTIRIDIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDC  647
            +QSSSAQ+WL SQ SSSGLIVK+TIR+DIPVE+YPN+NFVGRLLGPRGNSLKRVE ST+C
Sbjct  121  MQSSSAQNWLSSQGSSSGLIVKRTIRVDIPVEKYPNFNFVGRLLGPRGNSLKRVEASTEC  180

Query  648  RVLIRGRGSIKDPT  689
            RVLIRGRGSIKDP 
Sbjct  181  RVLIRGRGSIKDPA  194



>ref|XP_010942513.1| PREDICTED: KH domain-containing protein At5g56140-like isoform 
X2 [Elaeis guineensis]
Length=289

 Score =   253 bits (646),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 141/192 (73%), Positives = 163/192 (85%), Gaps = 2/192 (1%)
 Frame = +3

Query  117  MASSRFMAYspspsaphsp-hIGALRSASSALVEQEKYLAELLAERSKLSPFMPVLPNCF  293
            MA+ R+MAY PSPS      HI  +RS +SA VEQ+KYLAELLAER KL PFMPVLP+C+
Sbjct  1    MATGRYMAYPPSPSTAPQSPHITGMRSITSAFVEQQKYLAELLAERQKLGPFMPVLPHCY  60

Query  294  RLLNQEILRVTTLLGNASVLDQSGLEHGSPLASGGLFSNGG-ANKDRWSSPFQSEMSGLV  470
             LLNQEI+RVTTLLGNAS+LDQ+GLEHGSPL +GGLFSNGG A+ + W+SPFQ E  GL+
Sbjct  61   WLLNQEIMRVTTLLGNASLLDQTGLEHGSPLTTGGLFSNGGAADMNGWASPFQPERLGLL  120

Query  471  qsssaqswlgsqssssGLIVKQTIRIDIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDCR  650
            Q SSA  WLG Q S SGLIVK+T+R+DIPV++YPNYNFVGRLLGPRGNSLKR+E ST+CR
Sbjct  121  QPSSAHGWLGQQGSCSGLIVKKTLRVDIPVDKYPNYNFVGRLLGPRGNSLKRMEASTECR  180

Query  651  VLIRGRGSIKDP  686
            VLIRGRGSIKDP
Sbjct  181  VLIRGRGSIKDP  192



>ref|XP_010942512.1| PREDICTED: KH domain-containing protein At5g56140-like isoform 
X1 [Elaeis guineensis]
Length=291

 Score =   253 bits (646),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 141/192 (73%), Positives = 163/192 (85%), Gaps = 2/192 (1%)
 Frame = +3

Query  117  MASSRFMAYspspsaphsp-hIGALRSASSALVEQEKYLAELLAERSKLSPFMPVLPNCF  293
            MA+ R+MAY PSPS      HI  +RS +SA VEQ+KYLAELLAER KL PFMPVLP+C+
Sbjct  1    MATGRYMAYPPSPSTAPQSPHITGMRSITSAFVEQQKYLAELLAERQKLGPFMPVLPHCY  60

Query  294  RLLNQEILRVTTLLGNASVLDQSGLEHGSPLASGGLFSNGG-ANKDRWSSPFQSEMSGLV  470
             LLNQEI+RVTTLLGNAS+LDQ+GLEHGSPL +GGLFSNGG A+ + W+SPFQ E  GL+
Sbjct  61   WLLNQEIMRVTTLLGNASLLDQTGLEHGSPLTTGGLFSNGGAADMNGWASPFQPERLGLL  120

Query  471  qsssaqswlgsqssssGLIVKQTIRIDIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDCR  650
            Q SSA  WLG Q S SGLIVK+T+R+DIPV++YPNYNFVGRLLGPRGNSLKR+E ST+CR
Sbjct  121  QPSSAHGWLGQQGSCSGLIVKKTLRVDIPVDKYPNYNFVGRLLGPRGNSLKRMEASTECR  180

Query  651  VLIRGRGSIKDP  686
            VLIRGRGSIKDP
Sbjct  181  VLIRGRGSIKDP  192



>ref|XP_009415552.1| PREDICTED: KH domain-containing protein At5g56140-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=292

 Score =   253 bits (646),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 145/194 (75%), Positives = 168/194 (87%), Gaps = 3/194 (2%)
 Frame = +3

Query  117  MASSRFMAYspspsaphsp-hIGALRSASSALVEQEKYLAELLAERSKLSPFMPVLPNCF  293
            MAS RFMAYSPSPS      HI  +RSA+ A  EQEKYL+ELLAER KLSPF+PVLP+C+
Sbjct  1    MASGRFMAYSPSPSTAPHSPHIPGIRSATGAFAEQEKYLSELLAERQKLSPFVPVLPHCY  60

Query  294  RLLNQ-EILRVTTLLGNASVLDQSGLEHGSPLASGGLFSNGGANK-DRWSSPFQSEMSGL  467
            RLLNQ EI+RVT LLGNAS+LDQSGLE+GSP+ +GGLFSNGGAN  + W+SPFQSE  GL
Sbjct  61   RLLNQAEIIRVTMLLGNASLLDQSGLEYGSPMTTGGLFSNGGANDMNGWASPFQSERMGL  120

Query  468  VqsssaqswlgsqssssGLIVKQTIRIDIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDC  647
            VQ SSA SWLGS+ SSSGLIVK+TIR+DIP++++P +NFVGRLLGPRGNSLKRVE +TDC
Sbjct  121  VQPSSAHSWLGSEGSSSGLIVKKTIRVDIPIDKFPTFNFVGRLLGPRGNSLKRVEANTDC  180

Query  648  RVLIRGRGSIKDPT  689
            R+LIRGRGSIKDPT
Sbjct  181  RILIRGRGSIKDPT  194



>ref|XP_009346681.1| PREDICTED: KH domain-containing protein At5g56140-like [Pyrus 
x bretschneideri]
Length=295

 Score =   253 bits (645),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 151/196 (77%), Positives = 169/196 (86%), Gaps = 3/196 (2%)
 Frame = +3

Query  111  KQMASS---RFMAYspspsaphsphIGALRSASSALVEQEKYLAELLAERSKLSPFMPVL  281
            + M+SS   R+MAYS SPSAPHSPH+  LRSA+    EQEKYL ELL ER KLSPF+ VL
Sbjct  2    EMMSSSGGGRYMAYSRSPSAPHSPHLSGLRSAALVAAEQEKYLLELLGERHKLSPFLLVL  61

Query  282  PNCFRLLNQEILRVTTLLGNASVLDQSGLEHGSPLASGGLFSNGGANKDRWSSPFQSEMS  461
            PNC RLLNQEILRVTTLLGNASVL QSGLEH SPLAS G+FSNGGA+ + W+S FQSEMS
Sbjct  62   PNCNRLLNQEILRVTTLLGNASVLGQSGLEHASPLASRGMFSNGGADVNGWASRFQSEMS  121

Query  462  GLVqsssaqswlgsqssssGLIVKQTIRIDIPVEQYPNYNFVGRLLGPRGNSLKRVEVST  641
            GL+Q SS Q+WL  QSSSSGLIVK+TIR+DIPV++YPNYNFVGRLLGPRGNSLKRVE +T
Sbjct  122  GLLQPSSTQNWLSPQSSSSGLIVKRTIRVDIPVDKYPNYNFVGRLLGPRGNSLKRVEATT  181

Query  642  DCRVLIRGRGSIKDPT  689
            +CRVLIRGRGSIKDPT
Sbjct  182  ECRVLIRGRGSIKDPT  197



>ref|XP_006452747.1| hypothetical protein CICLE_v10009077mg [Citrus clementina]
 gb|ESR65987.1| hypothetical protein CICLE_v10009077mg [Citrus clementina]
Length=292

 Score =   253 bits (645),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 154/194 (79%), Positives = 176/194 (91%), Gaps = 3/194 (2%)
 Frame = +3

Query  117  MASS---RFMAYspspsaphsphIGALRSASSALVEQEKYLAELLAERSKLSPFMPVLPN  287
            MASS   RFMAYS SPSAPHSPH+ +LRSASSA+++QEKYL+ELLAER KL+PF+PVLPN
Sbjct  1    MASSGGGRFMAYSLSPSAPHSPHLPSLRSASSAILDQEKYLSELLAERHKLNPFLPVLPN  60

Query  288  CFRLLNQEILRVTTLLGNASVLDQSGLEHGSPLASGGLFSNGGANKDRWSSPFQSEMSGL  467
             +RLLNQEI+RVTTLLGNASVL QSGLEH SPL SGG+FSNGGA+ +  +S FQSE+SGL
Sbjct  61   TYRLLNQEIMRVTTLLGNASVLGQSGLEHASPLTSGGIFSNGGADVNGLASRFQSEISGL  120

Query  468  VqsssaqswlgsqssssGLIVKQTIRIDIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDC  647
            +QSSSAQ+WL SQ SSSGLIVK+TIR+DIPVE+YPN+NFVGRLLGPRGNSLKRVE ST+C
Sbjct  121  MQSSSAQNWLSSQGSSSGLIVKRTIRVDIPVEKYPNFNFVGRLLGPRGNSLKRVEASTEC  180

Query  648  RVLIRGRGSIKDPT  689
            RVLIRGRGSIKDP 
Sbjct  181  RVLIRGRGSIKDPA  194



>ref|XP_010252937.1| PREDICTED: KH domain-containing protein At5g56140-like [Nelumbo 
nucifera]
Length=294

 Score =   253 bits (645),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 148/196 (76%), Positives = 167/196 (85%), Gaps = 5/196 (3%)
 Frame = +3

Query  117  MASSRFMAYspspsaphsp-hIGALRSASSALVEQEKYLAELLAERSKLSPFMPVLPNCF  293
            M+S R+MAYSPSPS      H+  +RSA++ALVEQ+KYL+ELLAER KLSPF+ VLP+ +
Sbjct  1    MSSGRYMAYSPSPSTAPHSPHVSGIRSATNALVEQDKYLSELLAERQKLSPFLSVLPHSY  60

Query  294  RLLNQEILRVTTLLGNASVLDQSGLEHGSPLA----SGGLFSNGGANKDRWSSPFQSEMS  461
            RLLNQEILRVTTLLGNAS+LDQSGLEH SPLA    SGGLFSNGGA+ + W+S FQSE  
Sbjct  61   RLLNQEILRVTTLLGNASLLDQSGLEHASPLASPLTSGGLFSNGGADMNGWASAFQSERI  120

Query  462  GLVqsssaqswlgsqssssGLIVKQTIRIDIPVEQYPNYNFVGRLLGPRGNSLKRVEVST  641
            G +Q SS QSWLGSQ SSSGLIVK+TIR+DIPV+ YPNYNFVGRLLGPRGNSLKRVE ST
Sbjct  121  GFLQPSSTQSWLGSQGSSSGLIVKKTIRVDIPVDNYPNYNFVGRLLGPRGNSLKRVEAST  180

Query  642  DCRVLIRGRGSIKDPT  689
            DCRVLIRGRGSIKDP 
Sbjct  181  DCRVLIRGRGSIKDPA  196



>ref|XP_006377999.1| hypothetical protein POPTR_0011s17110g [Populus trichocarpa]
 gb|ERP55796.1| hypothetical protein POPTR_0011s17110g [Populus trichocarpa]
Length=301

 Score =   251 bits (642),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 155/192 (81%), Positives = 172/192 (90%), Gaps = 3/192 (2%)
 Frame = +3

Query  123  SSRFMAYspspsaphsphIGALRS--ASSALV-EQEKYLAELLAERSKLSPFMPVLPNCF  293
            +SRFMAYSPSPSAPHSPHI  LRS  ASSALV EQEKYL+ELLAER K+ PFMPVLPN +
Sbjct  12   ASRFMAYSPSPSAPHSPHISGLRSSAASSALVVEQEKYLSELLAERHKIIPFMPVLPNIY  71

Query  294  RLLNQEILRVTTLLGNASVLDQSGLEHGSPLASGGLFSNGGANKDRWSSPFQSEMSGLVq  473
            RLLNQEILRVTTLLGNASVL QSGLEH SPL+SGG+FSNG A+ + W+S FQSEMSG++Q
Sbjct  72   RLLNQEILRVTTLLGNASVLGQSGLEHASPLSSGGIFSNGAADANGWASRFQSEMSGMLQ  131

Query  474  sssaqswlgsqssssGLIVKQTIRIDIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDCRV  653
             SSAQ+WL SQ SSSGLI K+TIR+DIPV++YPNYNFVGRLLGPRGNSLKRVE ST+CRV
Sbjct  132  PSSAQNWLSSQGSSSGLIAKRTIRVDIPVDKYPNYNFVGRLLGPRGNSLKRVEASTECRV  191

Query  654  LIRGRGSIKDPT  689
            LIRGRGSIKDP 
Sbjct  192  LIRGRGSIKDPA  203



>ref|XP_009407925.1| PREDICTED: KH domain-containing protein At5g56140-like [Musa 
acuminata subsp. malaccensis]
Length=290

 Score =   251 bits (641),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 143/192 (74%), Positives = 166/192 (86%), Gaps = 1/192 (1%)
 Frame = +3

Query  117  MASSRFMAYspspsaphsphIGALRSASSALVEQEKYLAELLAERSKLSPFMPVLPNCFR  296
            MAS R+MAYSPSPSAPHSPHI  +RSA SAL EQEKYLAELLAER KLSPF+PVLP+ +R
Sbjct  1    MASGRYMAYSPSPSAPHSPHISGMRSAGSALAEQEKYLAELLAERQKLSPFVPVLPHSYR  60

Query  297  LLNQEILRVTTLLGNASVLDQSGLEHGSPLASGGLFSNGG-ANKDRWSSPFQSEMSGLVq  473
            LLNQEILR+TTLL NAS+LDQ+GLEHGSPL +GG+FSNGG A+ + W+S FQSE  G++Q
Sbjct  61   LLNQEILRITTLLENASLLDQTGLEHGSPLITGGVFSNGGAADMNGWASTFQSERLGILQ  120

Query  474  sssaqswlgsqssssGLIVKQTIRIDIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDCRV  653
             SS   W+    SSSGL+VK+TIR+DIPV+ YPNYNFVGRLLGPRGNSLKR+E +T CRV
Sbjct  121  PSSGNGWVVPPGSSSGLLVKKTIRVDIPVDHYPNYNFVGRLLGPRGNSLKRIEATTGCRV  180

Query  654  LIRGRGSIKDPT  689
            LIRGRGSIKDP+
Sbjct  181  LIRGRGSIKDPS  192



>ref|XP_002299073.2| KH domain-containing family protein [Populus trichocarpa]
 gb|EEE83878.2| KH domain-containing family protein [Populus trichocarpa]
Length=302

 Score =   251 bits (640),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 155/192 (81%), Positives = 172/192 (90%), Gaps = 3/192 (2%)
 Frame = +3

Query  123  SSRFMAYspspsaphsphIGALRS--ASSALV-EQEKYLAELLAERSKLSPFMPVLPNCF  293
            + RFMAYSPSPSAPHSPHI  LRS  ASSALV EQEKYL+ELLAER K+SPF+PVLPN +
Sbjct  13   AGRFMAYSPSPSAPHSPHISGLRSSAASSALVVEQEKYLSELLAERHKISPFLPVLPNTY  72

Query  294  RLLNQEILRVTTLLGNASVLDQSGLEHGSPLASGGLFSNGGANKDRWSSPFQSEMSGLVq  473
            RLLNQEILRVT LLGNASVL QSGLEH SPLASGG+FSNG A+ + W+S FQSEMSG++Q
Sbjct  73   RLLNQEILRVTMLLGNASVLGQSGLEHASPLASGGIFSNGAADANGWASRFQSEMSGILQ  132

Query  474  sssaqswlgsqssssGLIVKQTIRIDIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDCRV  653
             SSAQ+WL SQ SSSGLIVK+TIR+DIPV++YPNYNFVGRLLGPRGNSLKRVE ST+CRV
Sbjct  133  PSSAQNWLSSQGSSSGLIVKRTIRVDIPVDKYPNYNFVGRLLGPRGNSLKRVEASTECRV  192

Query  654  LIRGRGSIKDPT  689
            LIRGRGSIKDP 
Sbjct  193  LIRGRGSIKDPA  204



>gb|KJB45526.1| hypothetical protein B456_007G310100 [Gossypium raimondii]
Length=294

 Score =   250 bits (639),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 146/196 (74%), Positives = 168/196 (86%), Gaps = 0/196 (0%)
 Frame = +3

Query  102  FTSKQMASSRFMAYspspsaphsphIGALRSASSALVEQEKYLAELLAERSKLSPFMPVL  281
             TS      R+MA+SPSPSAPHSPH+  LRSA++AL++QEKYL+ELLAER KLSPFM V+
Sbjct  1    MTSSVGGGGRYMAFSPSPSAPHSPHLSGLRSAAAALLDQEKYLSELLAERYKLSPFMTVI  60

Query  282  PNCFRLLNQEILRVTTLLGNASVLDQSGLEHGSPLASGGLFSNGGANKDRWSSPFQSEMS  461
            P+  RLLNQEILR+TTLLGNASVL Q+GLE  SPLASGG FSNGGA+ +RW S FQSEM 
Sbjct  61   PHTCRLLNQEILRITTLLGNASVLGQNGLEQASPLASGGTFSNGGADMNRWMSQFQSEMP  120

Query  462  GLVqsssaqswlgsqssssGLIVKQTIRIDIPVEQYPNYNFVGRLLGPRGNSLKRVEVST  641
            GLVQ S A++WL SQ  SSGLIVK+TIR+DIPV++YPNYNFVGRLLGPRGNSLKRVE +T
Sbjct  121  GLVQPSLAENWLNSQGGSSGLIVKRTIRVDIPVDKYPNYNFVGRLLGPRGNSLKRVEANT  180

Query  642  DCRVLIRGRGSIKDPT  689
            +CRVLIRGRGSIKDP 
Sbjct  181  ECRVLIRGRGSIKDPA  196



>ref|XP_011000365.1| PREDICTED: KH domain-containing protein At5g56140-like [Populus 
euphratica]
Length=302

 Score =   250 bits (639),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 158/192 (82%), Positives = 172/192 (90%), Gaps = 5/192 (3%)
 Frame = +3

Query  123  SSRFMAYspspsaphsphIGALRS--ASSALV-EQEKYLAELLAERSKLSPFMPVLPNCF  293
            +SRFMAYSPSPSAPHSPHI  LRS  ASSALV EQEKYL+ELLAER K+SPFMPVLPN +
Sbjct  15   ASRFMAYSPSPSAPHSPHISGLRSSAASSALVVEQEKYLSELLAERHKMSPFMPVLPNIY  74

Query  294  RLLNQEILRVTTLLGNASVLDQSGLEHGSPLASGGLFSNGGANKDRWSSPFQSEMSGLVq  473
            RLLNQEILRVTTLLGNASVL QSGLEH SPLASG  FSNG A+ + W+S FQSEMSG++Q
Sbjct  75   RLLNQEILRVTTLLGNASVLGQSGLEHASPLASG--FSNGAADANGWASRFQSEMSGMLQ  132

Query  474  sssaqswlgsqssssGLIVKQTIRIDIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDCRV  653
            SSSAQSWLGSQ SSS LI K+TIR+DIPV++YPNYNFVGRLLGPRGNSLKRVE ST+CRV
Sbjct  133  SSSAQSWLGSQGSSSCLIAKRTIRVDIPVDKYPNYNFVGRLLGPRGNSLKRVEASTECRV  192

Query  654  LIRGRGSIKDPT  689
            LIRGRGSIKDP 
Sbjct  193  LIRGRGSIKDPA  204



>gb|KJB63135.1| hypothetical protein B456_009G454400 [Gossypium raimondii]
Length=262

 Score =   249 bits (635),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 151/202 (75%), Positives = 172/202 (85%), Gaps = 6/202 (3%)
 Frame = +3

Query  102  FTSKQMASSRFMAYspspsaphsphIGALRSASSA------LVEQEKYLAELLAERSKLS  263
             T+      R+MAYSPSPSAPHSPH+  LRS ++A      L++QEKYL+ELLAER KLS
Sbjct  1    MTTSDGGGGRYMAYSPSPSAPHSPHLSGLRSVAAAAASSAALLDQEKYLSELLAERQKLS  60

Query  264  PFMPVLPNCFRLLNQEILRVTTLLGNASVLDQSGLEHGSPLASGGLFSNGGANKDRWSSP  443
            PFMPVLPN +RLLNQEILRVTTLLGNASVL QSGLE  SPLASGG+FSNGGA+ + W+S 
Sbjct  61   PFMPVLPNTYRLLNQEILRVTTLLGNASVLGQSGLEQASPLASGGIFSNGGADMNGWTSR  120

Query  444  FQSEMSGLVqsssaqswlgsqssssGLIVKQTIRIDIPVEQYPNYNFVGRLLGPRGNSLK  623
            FQSEMS LV+ SS Q+W+GSQ SSSGLIVK+TIR+DIPV+ YPNYNFVGRLLGPRGNSLK
Sbjct  121  FQSEMSCLVRPSSVQNWVGSQGSSSGLIVKRTIRVDIPVDSYPNYNFVGRLLGPRGNSLK  180

Query  624  RVEVSTDCRVLIRGRGSIKDPT  689
            RVE +T+CRVLIRGRGSIKDPT
Sbjct  181  RVEANTECRVLIRGRGSIKDPT  202



>gb|KJB63134.1| hypothetical protein B456_009G454400 [Gossypium raimondii]
Length=301

 Score =   250 bits (638),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 151/202 (75%), Positives = 172/202 (85%), Gaps = 6/202 (3%)
 Frame = +3

Query  102  FTSKQMASSRFMAYspspsaphsphIGALRSASSA------LVEQEKYLAELLAERSKLS  263
             T+      R+MAYSPSPSAPHSPH+  LRS ++A      L++QEKYL+ELLAER KLS
Sbjct  1    MTTSDGGGGRYMAYSPSPSAPHSPHLSGLRSVAAAAASSAALLDQEKYLSELLAERQKLS  60

Query  264  PFMPVLPNCFRLLNQEILRVTTLLGNASVLDQSGLEHGSPLASGGLFSNGGANKDRWSSP  443
            PFMPVLPN +RLLNQEILRVTTLLGNASVL QSGLE  SPLASGG+FSNGGA+ + W+S 
Sbjct  61   PFMPVLPNTYRLLNQEILRVTTLLGNASVLGQSGLEQASPLASGGIFSNGGADMNGWTSR  120

Query  444  FQSEMSGLVqsssaqswlgsqssssGLIVKQTIRIDIPVEQYPNYNFVGRLLGPRGNSLK  623
            FQSEMS LV+ SS Q+W+GSQ SSSGLIVK+TIR+DIPV+ YPNYNFVGRLLGPRGNSLK
Sbjct  121  FQSEMSCLVRPSSVQNWVGSQGSSSGLIVKRTIRVDIPVDSYPNYNFVGRLLGPRGNSLK  180

Query  624  RVEVSTDCRVLIRGRGSIKDPT  689
            RVE +T+CRVLIRGRGSIKDPT
Sbjct  181  RVEANTECRVLIRGRGSIKDPT  202



>ref|XP_004139764.1| PREDICTED: KH domain-containing protein At5g56140-like [Cucumis 
sativus]
 ref|XP_004163285.1| PREDICTED: KH domain-containing protein At5g56140-like [Cucumis 
sativus]
 gb|KGN44103.1| hypothetical protein Csa_7G188690 [Cucumis sativus]
Length=296

 Score =   249 bits (636),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 133/161 (83%), Positives = 146/161 (91%), Gaps = 0/161 (0%)
 Frame = +3

Query  207  LVEQEKYLAELLAERSKLSPFMPVLPNCFRLLNQEILRVTTLLGNASVLDQSGLEHGSPL  386
            ++EQEKYL+ELLAER KLSPFMPVLPN +RLLNQEILRVTTLLG ASVL QSGLEH SPL
Sbjct  38   ILEQEKYLSELLAERQKLSPFMPVLPNSYRLLNQEILRVTTLLGKASVLGQSGLEHASPL  97

Query  387  ASGGLFSNGGANKDRWSSPFQSEMSGLVqsssaqswlgsqssssGLIVKQTIRIDIPVEQ  566
            ASGG+FSNGGA+   W S FQSEMSGL+Q+SSAQ+WL SQ SSSGLIVK+TIR+D+PVE 
Sbjct  98   ASGGIFSNGGADMSAWPSRFQSEMSGLLQASSAQNWLTSQGSSSGLIVKRTIRVDVPVET  157

Query  567  YPNYNFVGRLLGPRGNSLKRVEVSTDCRVLIRGRGSIKDPT  689
            +PNYNFVGRLLGPRGNSLKRVE STDCRVLIRGRGSIKDP 
Sbjct  158  FPNYNFVGRLLGPRGNSLKRVEASTDCRVLIRGRGSIKDPA  198



>ref|XP_011039862.1| PREDICTED: KH domain-containing protein At5g56140 [Populus euphratica]
Length=300

 Score =   248 bits (632),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 154/194 (79%), Positives = 174/194 (90%), Gaps = 3/194 (2%)
 Frame = +3

Query  117  MASSRFMAYspspsaphsphIGALRS--ASSALV-EQEKYLAELLAERSKLSPFMPVLPN  287
            + + RFMAYSPSPSAP+SPHI  LRS  ASSALV EQEKYL+ELLAER K+SPF+PVLPN
Sbjct  9    VGAGRFMAYSPSPSAPYSPHISGLRSSAASSALVVEQEKYLSELLAERLKISPFLPVLPN  68

Query  288  CFRLLNQEILRVTTLLGNASVLDQSGLEHGSPLASGGLFSNGGANKDRWSSPFQSEMSGL  467
             +RLLNQEILRVTTLLGNASVL QSGLEH SPLASGG+FSNG A+ + W+S FQSEMSG+
Sbjct  69   TYRLLNQEILRVTTLLGNASVLGQSGLEHASPLASGGIFSNGAADANGWASRFQSEMSGI  128

Query  468  VqsssaqswlgsqssssGLIVKQTIRIDIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDC  647
            +Q SSAQ+WL S+ SSSGLIVK+TIR+DIPV++YPNYNFVGRLLGPRGNSLKRVE ST+C
Sbjct  129  LQPSSAQNWLSSRGSSSGLIVKRTIRVDIPVDKYPNYNFVGRLLGPRGNSLKRVEASTEC  188

Query  648  RVLIRGRGSIKDPT  689
            RVLIRGRGSIKDP 
Sbjct  189  RVLIRGRGSIKDPA  202



>ref|XP_010928017.1| PREDICTED: KH domain-containing protein At5g56140 isoform X2 
[Elaeis guineensis]
Length=291

 Score =   247 bits (630),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 143/193 (74%), Positives = 165/193 (85%), Gaps = 2/193 (1%)
 Frame = +3

Query  117  MASSRFMAYspspsaphsp-hIGALRSASSALVEQEKYLAELLAERSKLSPFMPVLPNCF  293
            M+S R+MAYSPSPS      HI  +RSA++A+ EQEKYL+ELLAER KLSPFMPVLP+ +
Sbjct  1    MSSGRYMAYSPSPSTAPHSPHITGIRSATNAIAEQEKYLSELLAERHKLSPFMPVLPHSY  60

Query  294  RLLNQEILRVTTLLGNASVLDQSGLEHGSPLASGGLFSNGG-ANKDRWSSPFQSEMSGLV  470
            RLLNQEILR+T LLGNAS+LDQSGLEHGSPL +GGL SNGG A+ + W+S FQSE  GL+
Sbjct  61   RLLNQEILRITILLGNASLLDQSGLEHGSPLTTGGLLSNGGAADMNGWASAFQSESLGLL  120

Query  471  qsssaqswlgsqssssGLIVKQTIRIDIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDCR  650
            Q SSA SWLGSQ SSS LIVK+TIR+DIPV++YP YNFVGRLLGPRGNSLKRVE ST+CR
Sbjct  121  QPSSAHSWLGSQCSSSNLIVKKTIRVDIPVDKYPTYNFVGRLLGPRGNSLKRVEASTECR  180

Query  651  VLIRGRGSIKDPT  689
            +LIRGRGSIKDP 
Sbjct  181  ILIRGRGSIKDPA  193



>ref|XP_008794732.1| PREDICTED: KH domain-containing protein At5g56140-like isoform 
X1 [Phoenix dactylifera]
Length=288

 Score =   246 bits (629),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 138/191 (72%), Positives = 161/191 (84%), Gaps = 2/191 (1%)
 Frame = +3

Query  117  MASSRFMAYspspsaphsphIGALRSASSALVEQEKYLAELLAERSKLSPFMPVLPNCFR  296
            MAS R+MA SPS +       G +RS +SA VEQ++YLAELLAER KL PFM VLP+C+ 
Sbjct  1    MASGRYMACSPSTAPHSPHITG-MRSITSAFVEQQRYLAELLAERQKLVPFMAVLPHCYW  59

Query  297  LLNQEILRVTTLLGNASVLDQSGLEHGSPLASGGLFSNGG-ANKDRWSSPFQSEMSGLVq  473
            LLNQEI+RVTTLLGNAS+LDQ+GLEHGSPL +GGLFSNGG A+ + W+SPFQ E  GL+Q
Sbjct  60   LLNQEIMRVTTLLGNASLLDQTGLEHGSPLTTGGLFSNGGAADMNGWASPFQPERLGLLQ  119

Query  474  sssaqswlgsqssssGLIVKQTIRIDIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDCRV  653
             SSA  WLG Q SSSGLIVK+TIR+DIP+++YPNYNFVGRLLGPRGNSLKR+E ST+CRV
Sbjct  120  PSSAHGWLGQQGSSSGLIVKKTIRVDIPMDKYPNYNFVGRLLGPRGNSLKRMEASTECRV  179

Query  654  LIRGRGSIKDP  686
            LIRGRGSIKDP
Sbjct  180  LIRGRGSIKDP  190



>gb|KJB45527.1| hypothetical protein B456_007G310100 [Gossypium raimondii]
Length=295

 Score =   246 bits (628),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 146/197 (74%), Positives = 168/197 (85%), Gaps = 1/197 (1%)
 Frame = +3

Query  102  FTSKQMASSRFMAYspspsaphsphIGALRSASSALVEQEKYLAELLAERSKLSPFMPVL  281
             TS      R+MA+SPSPSAPHSPH+  LRSA++AL++QEKYL+ELLAER KLSPFM V+
Sbjct  1    MTSSVGGGGRYMAFSPSPSAPHSPHLSGLRSAAAALLDQEKYLSELLAERYKLSPFMTVI  60

Query  282  PNCFRLLNQ-EILRVTTLLGNASVLDQSGLEHGSPLASGGLFSNGGANKDRWSSPFQSEM  458
            P+  RLLNQ EILR+TTLLGNASVL Q+GLE  SPLASGG FSNGGA+ +RW S FQSEM
Sbjct  61   PHTCRLLNQAEILRITTLLGNASVLGQNGLEQASPLASGGTFSNGGADMNRWMSQFQSEM  120

Query  459  SGLVqsssaqswlgsqssssGLIVKQTIRIDIPVEQYPNYNFVGRLLGPRGNSLKRVEVS  638
             GLVQ S A++WL SQ  SSGLIVK+TIR+DIPV++YPNYNFVGRLLGPRGNSLKRVE +
Sbjct  121  PGLVQPSLAENWLNSQGGSSGLIVKRTIRVDIPVDKYPNYNFVGRLLGPRGNSLKRVEAN  180

Query  639  TDCRVLIRGRGSIKDPT  689
            T+CRVLIRGRGSIKDP 
Sbjct  181  TECRVLIRGRGSIKDPA  197



>ref|XP_009410309.1| PREDICTED: KH domain-containing protein At5g56140-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=282

 Score =   245 bits (626),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 139/190 (73%), Positives = 162/190 (85%), Gaps = 9/190 (5%)
 Frame = +3

Query  117  MASSRFMAYspspsaphsphIGALRSASSALVEQEKYLAELLAERSKLSPFMPVLPNCFR  296
            M+S R+MAYSPSPS         +RS++SA  EQEKYL+ELLAER KLSPFMPVLP+ +R
Sbjct  1    MSSGRYMAYSPSPS--------GIRSSASAFAEQEKYLSELLAERHKLSPFMPVLPHSYR  52

Query  297  LLNQEILRVTTLLGNASVLDQSGLEHGSPLASGGLFSNGGANK-DRWSSPFQSEMSGLVq  473
            LLNQEILRVT LLGNAS+LDQSGLEHGSP+ +GGL SNGGA + + W+S FQSE  GL+Q
Sbjct  53   LLNQEILRVTMLLGNASLLDQSGLEHGSPMTTGGLLSNGGATEMNGWASAFQSEGLGLIQ  112

Query  474  sssaqswlgsqssssGLIVKQTIRIDIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDCRV  653
             SSA  WLGSQSS+SGLIVK+TIR+DIP+++YP YNFVGRLLGPRGNSLKRVE +TDCR+
Sbjct  113  PSSAHGWLGSQSSASGLIVKKTIRVDIPIDKYPTYNFVGRLLGPRGNSLKRVEANTDCRI  172

Query  654  LIRGRGSIKD  683
            LIRGRGSIKD
Sbjct  173  LIRGRGSIKD  182



>ref|XP_007205649.1| hypothetical protein PRUPE_ppa009341mg [Prunus persica]
 gb|EMJ06848.1| hypothetical protein PRUPE_ppa009341mg [Prunus persica]
Length=296

 Score =   245 bits (625),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 150/190 (79%), Positives = 171/190 (90%), Gaps = 3/190 (2%)
 Frame = +3

Query  129  RFMAYspspsaphsphIGALRSASSALV---EQEKYLAELLAERSKLSPFMPVLPNCFRL  299
            R+M+YSPSPSAPHSPH+  LRSASSA +   EQEKYL+ELLAER KL PF+P+LP+C RL
Sbjct  9    RYMSYSPSPSAPHSPHLSGLRSASSAALVAAEQEKYLSELLAERHKLGPFLPLLPHCCRL  68

Query  300  LNQEILRVTTLLGNASVLDQSGLEHGSPLASGGLFSNGGANKDRWSSPFQSEMSGLVqss  479
            +NQEILRVTTLLGNASVL QSGLEH SPLASGG+FSNGGA+ + W+S FQSEMSGL+Q S
Sbjct  69   INQEILRVTTLLGNASVLGQSGLEHASPLASGGMFSNGGADVNGWASRFQSEMSGLLQPS  128

Query  480  saqswlgsqssssGLIVKQTIRIDIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDCRVLI  659
            S Q+WL S SSSSGLIVK+TIR+DIPV++YPNYNFVGRLLGPRGNSLKRVE +T+CRVLI
Sbjct  129  STQNWLNSPSSSSGLIVKRTIRVDIPVDKYPNYNFVGRLLGPRGNSLKRVEATTECRVLI  188

Query  660  RGRGSIKDPT  689
            RGRGSIKDPT
Sbjct  189  RGRGSIKDPT  198



>ref|XP_006857601.1| hypothetical protein AMTR_s00061p00100880 [Amborella trichopoda]
 gb|ERN19068.1| hypothetical protein AMTR_s00061p00100880 [Amborella trichopoda]
Length=286

 Score =   244 bits (624),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 135/191 (71%), Positives = 160/191 (84%), Gaps = 4/191 (2%)
 Frame = +3

Query  117  MASSRFMAYspspsaphsphIGALRSASSALVEQEKYLAELLAERSKLSPFMPVLPNCFR  296
            M+S R+MAYSPSPS          RSA++ALVEQ+KYL+ELLAER KL PFM VLP+ +R
Sbjct  1    MSSGRYMAYSPSPSTAPHS---PFRSAATALVEQDKYLSELLAERQKLGPFMQVLPHSYR  57

Query  297  LLNQEILRVTTLLGNASVLDQSGLEHGSPLASGGLFSNGGANKDRWSSPFQSEMSGLVqs  476
            +LNQEI+RVTTLLGNAS+LDQSGLEH SPL SGGL+SNGGA+ + W++PFQSE  G++  
Sbjct  58   VLNQEIVRVTTLLGNASLLDQSGLEHASPLNSGGLYSNGGADMNGWATPFQSERLGIL-Q  116

Query  477  ssaqswlgsqssssGLIVKQTIRIDIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDCRVL  656
             +   WLGSQ  SSGLIVK+TIR+DIPV++YPNYNFVGRLLGPRGNSLKRVE +T+CRVL
Sbjct  117  QTGHGWLGSQGGSSGLIVKRTIRVDIPVDKYPNYNFVGRLLGPRGNSLKRVEANTECRVL  176

Query  657  IRGRGSIKDPT  689
            IRGRGSIKDP 
Sbjct  177  IRGRGSIKDPA  187



>ref|XP_010092393.1| KH domain-containing protein [Morus notabilis]
 gb|EXB51069.1| KH domain-containing protein [Morus notabilis]
Length=307

 Score =   245 bits (626),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 127/161 (79%), Positives = 146/161 (91%), Gaps = 0/161 (0%)
 Frame = +3

Query  207  LVEQEKYLAELLAERSKLSPFMPVLPNCFRLLNQEILRVTTLLGNASVLDQSGLEHGSPL  386
            +VEQEKYL+ELLAER KLSPFMPVLPNC++LL+QEILRVTTLLG ASVL QSGLEH SPL
Sbjct  49   VVEQEKYLSELLAERHKLSPFMPVLPNCYKLLSQEILRVTTLLGKASVLGQSGLEHASPL  108

Query  387  ASGGLFSNGGANKDRWSSPFQSEMSGLVqsssaqswlgsqssssGLIVKQTIRIDIPVEQ  566
            ASGG+FSNGGA+ + W+S FQSEMS L+Q SS ++WL  Q SSSGLI K+T+R+DIPV++
Sbjct  109  ASGGIFSNGGADVNGWASRFQSEMSSLLQPSSTKNWLSPQGSSSGLIAKRTMRVDIPVDK  168

Query  567  YPNYNFVGRLLGPRGNSLKRVEVSTDCRVLIRGRGSIKDPT  689
            YPNYNFVGRLLGPRGNSLKRVE +T+CRVLIRGRGSIKDPT
Sbjct  169  YPNYNFVGRLLGPRGNSLKRVEATTECRVLIRGRGSIKDPT  209



>ref|XP_007148648.1| hypothetical protein PHAVU_005G003500g [Phaseolus vulgaris]
 gb|ESW20642.1| hypothetical protein PHAVU_005G003500g [Phaseolus vulgaris]
Length=291

 Score =   243 bits (621),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 140/190 (74%), Positives = 162/190 (85%), Gaps = 2/190 (1%)
 Frame = +3

Query  120  ASSRFMAYspspsaphsphIGALRSASSALVEQEKYLAELLAERSKLSPFMPVLPNCFRL  299
             + R+MA+ PSPSAP SPH+ ALRS  SAL EQ+KYL+ELL ER+KLSPFM VLP CFRL
Sbjct  6    GAGRYMAFPPSPSAPPSPHLSALRS--SALAEQDKYLSELLGERNKLSPFMAVLPQCFRL  63

Query  300  LNQEILRVTTLLGNASVLDQSGLEHGSPLASGGLFSNGGANKDRWSSPFQSEMSGLVqss  479
            LNQEILRVT+L+GNASVL QSGLE  SPLA+GG+FSNGGAN + W+S FQSE   ++QSS
Sbjct  64   LNQEILRVTSLMGNASVLGQSGLEQASPLATGGIFSNGGANVNGWASRFQSERPSMLQSS  123

Query  480  saqswlgsqssssGLIVKQTIRIDIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDCRVLI  659
               +WL  Q SSSGLIVK+T+R+DIPV+ +PN+NFVGRLLGPRGNSLKRVE STDCRVLI
Sbjct  124  PTPNWLSPQGSSSGLIVKKTVRVDIPVDTFPNFNFVGRLLGPRGNSLKRVEASTDCRVLI  183

Query  660  RGRGSIKDPT  689
            RGRGSIKDPT
Sbjct  184  RGRGSIKDPT  193



>ref|XP_008813750.1| PREDICTED: KH domain-containing protein At5g56140 isoform X2 
[Phoenix dactylifera]
Length=291

 Score =   243 bits (620),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 140/193 (73%), Positives = 163/193 (84%), Gaps = 2/193 (1%)
 Frame = +3

Query  117  MASSRFMAYspspsaphsp-hIGALRSASSALVEQEKYLAELLAERSKLSPFMPVLPNCF  293
            M+S R+MAYSPSPS      HI  +RSA++A+ E+EKYL+ELLAER KLSPF PVLP+ +
Sbjct  1    MSSGRYMAYSPSPSTAPHSPHITGIRSATNAIAEKEKYLSELLAERHKLSPFTPVLPHSY  60

Query  294  RLLNQEILRVTTLLGNASVLDQSGLEHGSPLASGGLFSNGG-ANKDRWSSPFQSEMSGLV  470
            RLLNQEILR+T LLGNAS+LDQSGLEHGSPL +GGL SNGG A+ + W+S FQSE  GL+
Sbjct  61   RLLNQEILRITILLGNASLLDQSGLEHGSPLTTGGLLSNGGAADMNGWASAFQSESLGLL  120

Query  471  qsssaqswlgsqssssGLIVKQTIRIDIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDCR  650
            Q SSA  WLGSQ SSS LIVK+TIR+DIPV++YP YNFVGRLLGPRGNSLKRVE ST+C 
Sbjct  121  QPSSAHGWLGSQCSSSNLIVKKTIRVDIPVDKYPTYNFVGRLLGPRGNSLKRVEASTECH  180

Query  651  VLIRGRGSIKDPT  689
            +LIRGRGSIKDPT
Sbjct  181  ILIRGRGSIKDPT  193



>ref|XP_008219133.1| PREDICTED: KH domain-containing protein At5g56140 isoform X2 
[Prunus mume]
Length=296

 Score =   243 bits (620),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 149/190 (78%), Positives = 170/190 (89%), Gaps = 3/190 (2%)
 Frame = +3

Query  129  RFMAYspspsaphsphIGALRSASSALV---EQEKYLAELLAERSKLSPFMPVLPNCFRL  299
            R+M+YSPSPSAPHSPH+  LRSASSA +   EQEKYL+ELLAER KL PF+P+LP+C RL
Sbjct  9    RYMSYSPSPSAPHSPHLSGLRSASSAALVAAEQEKYLSELLAERHKLGPFLPLLPHCCRL  68

Query  300  LNQEILRVTTLLGNASVLDQSGLEHGSPLASGGLFSNGGANKDRWSSPFQSEMSGLVqss  479
            +NQEILRVTTLLGNASVL QSGLEH SPLASGG+FSNGGA+ + W+S FQSEM GL+Q S
Sbjct  69   INQEILRVTTLLGNASVLGQSGLEHASPLASGGMFSNGGADVNGWASRFQSEMPGLLQPS  128

Query  480  saqswlgsqssssGLIVKQTIRIDIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDCRVLI  659
            S Q+WL S SSSSGLIVK+TIR+DIPV++YPNYNFVGRLLGPRGNSLKRVE +T+CRVLI
Sbjct  129  STQNWLNSPSSSSGLIVKRTIRVDIPVDKYPNYNFVGRLLGPRGNSLKRVEATTECRVLI  188

Query  660  RGRGSIKDPT  689
            RGRGSIKDPT
Sbjct  189  RGRGSIKDPT  198



>ref|XP_010928016.1| PREDICTED: KH domain-containing protein At5g56140 isoform X1 
[Elaeis guineensis]
Length=292

 Score =   242 bits (618),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 143/194 (74%), Positives = 165/194 (85%), Gaps = 3/194 (2%)
 Frame = +3

Query  117  MASSRFMAYspspsaphsp-hIGALRSASSALVEQEKYLAELLAERSKLSPFMPVLPNCF  293
            M+S R+MAYSPSPS      HI  +RSA++A+ EQEKYL+ELLAER KLSPFMPVLP+ +
Sbjct  1    MSSGRYMAYSPSPSTAPHSPHITGIRSATNAIAEQEKYLSELLAERHKLSPFMPVLPHSY  60

Query  294  RLLNQ-EILRVTTLLGNASVLDQSGLEHGSPLASGGLFSNGGA-NKDRWSSPFQSEMSGL  467
            RLLNQ EILR+T LLGNAS+LDQSGLEHGSPL +GGL SNGGA + + W+S FQSE  GL
Sbjct  61   RLLNQAEILRITILLGNASLLDQSGLEHGSPLTTGGLLSNGGAADMNGWASAFQSESLGL  120

Query  468  VqsssaqswlgsqssssGLIVKQTIRIDIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDC  647
            +Q SSA SWLGSQ SSS LIVK+TIR+DIPV++YP YNFVGRLLGPRGNSLKRVE ST+C
Sbjct  121  LQPSSAHSWLGSQCSSSNLIVKKTIRVDIPVDKYPTYNFVGRLLGPRGNSLKRVEASTEC  180

Query  648  RVLIRGRGSIKDPT  689
            R+LIRGRGSIKDP 
Sbjct  181  RILIRGRGSIKDPA  194



>ref|XP_010913286.1| PREDICTED: KH domain-containing protein At5g56140-like isoform 
X4 [Elaeis guineensis]
Length=291

 Score =   242 bits (618),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 144/193 (75%), Positives = 166/193 (86%), Gaps = 2/193 (1%)
 Frame = +3

Query  117  MASSRFMAYspspsaphsp-hIGALRSASSALVEQEKYLAELLAERSKLSPFMPVLPNCF  293
            MAS  FMAYSPSPSA     H+  +RSA++A+VEQEKYL+ELLAER KLSPFMPVLP+ +
Sbjct  1    MASGGFMAYSPSPSAAPHSPHLCGIRSATNAIVEQEKYLSELLAERHKLSPFMPVLPHSY  60

Query  294  RLLNQEILRVTTLLGNASVLDQSGLEHGSPLASGGLFSNGG-ANKDRWSSPFQSEMSGLV  470
            RLLNQEILRVTTLLGNAS+LDQSGLEHGSPL +GGLFSNGG A+ + W+S F+SE  GL+
Sbjct  61   RLLNQEILRVTTLLGNASLLDQSGLEHGSPLTTGGLFSNGGAADMNGWASAFRSERLGLL  120

Query  471  qsssaqswlgsqssssGLIVKQTIRIDIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDCR  650
            Q SSA SWLGSQ SSS LIVK+TIR+DIPV++YP +NFVGRLLGPRG SLKRVE ST+C 
Sbjct  121  QPSSAHSWLGSQGSSSNLIVKKTIRVDIPVDKYPTFNFVGRLLGPRGYSLKRVEASTECH  180

Query  651  VLIRGRGSIKDPT  689
            VLIRG+GSIKDP 
Sbjct  181  VLIRGQGSIKDPA  193



>ref|XP_009399821.1| PREDICTED: KH domain-containing protein At5g56140-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=291

 Score =   242 bits (617),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 141/192 (73%), Positives = 159/192 (83%), Gaps = 2/192 (1%)
 Frame = +3

Query  117  MASSRFMAYspspsaphsp-hIGALRSASSALVEQEKYLAELLAERSKLSPFMPVLPNCF  293
            MAS R+MAYSPSPS      HI  +RSASSALVEQEKYLAELL ER KLSPFM VLP+ +
Sbjct  1    MASGRYMAYSPSPSTAPQSPHISGMRSASSALVEQEKYLAELLTERQKLSPFMLVLPHSY  60

Query  294  RLLNQEILRVTTLLGNASVLDQSGLEHGSPLASGGLFSNGG-ANKDRWSSPFQSEMSGLV  470
            RLLNQEIL +TTLL NAS+LDQ+GLEHGSPL SGGLF NG   + + W+S FQSE  G++
Sbjct  61   RLLNQEILHLTTLLENASLLDQTGLEHGSPLISGGLFPNGSTTDMNGWASAFQSERLGIL  120

Query  471  qsssaqswlgsqssssGLIVKQTIRIDIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDCR  650
            Q SS   W+G Q SSSGL+VK+TIR+DIPV+QYPNYNFVGRLLGPRGNSLKRVE +T CR
Sbjct  121  QPSSGNGWVGPQGSSSGLVVKRTIRVDIPVDQYPNYNFVGRLLGPRGNSLKRVEANTGCR  180

Query  651  VLIRGRGSIKDP  686
            VLIRGRGSIKDP
Sbjct  181  VLIRGRGSIKDP  192



>gb|AGV54732.1| KH domain-containing protein [Phaseolus vulgaris]
Length=291

 Score =   241 bits (616),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 137/190 (72%), Positives = 162/190 (85%), Gaps = 2/190 (1%)
 Frame = +3

Query  120  ASSRFMAYspspsaphsphIGALRSASSALVEQEKYLAELLAERSKLSPFMPVLPNCFRL  299
             + R+MA+ PSPSAP SPH+ ALRS  SAL EQ+KYL+ELL ER+KLSPFM VLP CFRL
Sbjct  6    GAGRYMAFPPSPSAPPSPHLSALRS--SALAEQDKYLSELLGERNKLSPFMAVLPQCFRL  63

Query  300  LNQEILRVTTLLGNASVLDQSGLEHGSPLASGGLFSNGGANKDRWSSPFQSEMSGLVqss  479
             NQEILRVTTL+GNASVL QSGLEH SPLA+GG+FSNGGA+ + W+S +Q++   ++QSS
Sbjct  64   FNQEILRVTTLMGNASVLGQSGLEHASPLATGGIFSNGGADVNGWASRYQTKRPSMLQSS  123

Query  480  saqswlgsqssssGLIVKQTIRIDIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDCRVLI  659
               +WL  Q SSSGLIVK+T+R+DIPV+ +PN+NFVGRLLGPRGNSLKRVE STDCRVLI
Sbjct  124  PTPNWLSPQGSSSGLIVKKTVRVDIPVDTFPNFNFVGRLLGPRGNSLKRVEASTDCRVLI  183

Query  660  RGRGSIKDPT  689
            RGRGSIKDPT
Sbjct  184  RGRGSIKDPT  193



>ref|XP_009410308.1| PREDICTED: KH domain-containing protein At5g56140-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=283

 Score =   241 bits (614),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 139/191 (73%), Positives = 162/191 (85%), Gaps = 10/191 (5%)
 Frame = +3

Query  117  MASSRFMAYspspsaphsphIGALRSASSALVEQEKYLAELLAERSKLSPFMPVLPNCFR  296
            M+S R+MAYSPSPS         +RS++SA  EQEKYL+ELLAER KLSPFMPVLP+ +R
Sbjct  1    MSSGRYMAYSPSPS--------GIRSSASAFAEQEKYLSELLAERHKLSPFMPVLPHSYR  52

Query  297  LLNQ-EILRVTTLLGNASVLDQSGLEHGSPLASGGLFSNGGANK-DRWSSPFQSEMSGLV  470
            LLNQ EILRVT LLGNAS+LDQSGLEHGSP+ +GGL SNGGA + + W+S FQSE  GL+
Sbjct  53   LLNQAEILRVTMLLGNASLLDQSGLEHGSPMTTGGLLSNGGATEMNGWASAFQSEGLGLI  112

Query  471  qsssaqswlgsqssssGLIVKQTIRIDIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDCR  650
            Q SSA  WLGSQSS+SGLIVK+TIR+DIP+++YP YNFVGRLLGPRGNSLKRVE +TDCR
Sbjct  113  QPSSAHGWLGSQSSASGLIVKKTIRVDIPIDKYPTYNFVGRLLGPRGNSLKRVEANTDCR  172

Query  651  VLIRGRGSIKD  683
            +LIRGRGSIKD
Sbjct  173  ILIRGRGSIKD  183



>ref|XP_007020328.1| RNA-binding KH domain-containing protein [Theobroma cacao]
 gb|EOY11853.1| RNA-binding KH domain-containing protein [Theobroma cacao]
Length=312

 Score =   241 bits (616),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 153/201 (76%), Positives = 172/201 (86%), Gaps = 5/201 (2%)
 Frame = +3

Query  102  FTSKQMASSRFMAYspspsaphsphIGALRSASSA-----LVEQEKYLAELLAERSKLSP  266
             TS      R+MAYSPSPSAPHSPH+  LRSA++A      ++QEKYL+ELLAER KLSP
Sbjct  1    MTSSGGGGGRYMAYSPSPSAPHSPHLSGLRSAAAAASSAAFLDQEKYLSELLAERHKLSP  60

Query  267  FMPVLPNCFRLLNQEILRVTTLLGNASVLDQSGLEHGSPLASGGLFSNGGANKDRWSSPF  446
            FMPVLP+ +RLLNQEILRVTTLLGNASVL QSGLE  SPLASGG+ SNGGA+ + W+S F
Sbjct  61   FMPVLPHTYRLLNQEILRVTTLLGNASVLGQSGLEQASPLASGGILSNGGADMNGWTSRF  120

Query  447  QSEMSGLVqsssaqswlgsqssssGLIVKQTIRIDIPVEQYPNYNFVGRLLGPRGNSLKR  626
            QSEMSGLVQ SSAQ+WL SQ SSSGLIVK+TIR+DIPVE+YPNYNFVGRLLGPRGNSLKR
Sbjct  121  QSEMSGLVQPSSAQNWLSSQGSSSGLIVKRTIRVDIPVEKYPNYNFVGRLLGPRGNSLKR  180

Query  627  VEVSTDCRVLIRGRGSIKDPT  689
            VE +T+CRVLIRGRGSIKDP 
Sbjct  181  VEANTECRVLIRGRGSIKDPA  201



>gb|KHG00195.1| hypothetical protein F383_19595 [Gossypium arboreum]
Length=321

 Score =   241 bits (615),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 152/222 (68%), Positives = 174/222 (78%), Gaps = 26/222 (12%)
 Frame = +3

Query  102  FTSKQMASSRFMAYspspsaphsphIGALRSASSA------LVEQEKYLAELLAERSKLS  263
             T+      R+MAYSPSPSAPHSPH+  LRS ++A      L++QEKYL+ELLAER K+S
Sbjct  1    MTTSDGGGGRYMAYSPSPSAPHSPHLSGLRSVAAAAASSAALLDQEKYLSELLAERQKIS  60

Query  264  PFMPVLPNCFRLLNQE--------------------ILRVTTLLGNASVLDQSGLEHGSP  383
            PFMPVLPN +RLLNQE                    ILRVTTLLGNASVL QSGLE  SP
Sbjct  61   PFMPVLPNTYRLLNQERIEKASDPTGIHVGKQPMLEILRVTTLLGNASVLGQSGLEQASP  120

Query  384  LASGGLFSNGGANKDRWSSPFQSEMSGLVqsssaqswlgsqssssGLIVKQTIRIDIPVE  563
            LASGG+FSNGGA+ + W+S FQSEMSGLV+ SSAQ+W+GSQ SSSGLIVK+TIR+DIPV+
Sbjct  121  LASGGIFSNGGADMNGWTSRFQSEMSGLVRPSSAQNWVGSQVSSSGLIVKRTIRVDIPVD  180

Query  564  QYPNYNFVGRLLGPRGNSLKRVEVSTDCRVLIRGRGSIKDPT  689
             YPNYNFVGRLLGPRGNSLKRVE +T+CRVLIRGRGSIKDPT
Sbjct  181  SYPNYNFVGRLLGPRGNSLKRVEANTECRVLIRGRGSIKDPT  222



>ref|XP_008384622.1| PREDICTED: KH domain-containing protein At5g56140-like [Malus 
domestica]
Length=299

 Score =   240 bits (613),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 130/159 (82%), Positives = 145/159 (91%), Gaps = 0/159 (0%)
 Frame = +3

Query  213  EQEKYLAELLAERSKLSPFMPVLPNCFRLLNQEILRVTTLLGNASVLDQSGLEHGSPLAS  392
            EQEKYL+ELL ER KL PF+PVLPNC RLLNQEILRVTTLLGNASVL QSG+E  SPLAS
Sbjct  43   EQEKYLSELLGERHKLXPFLPVLPNCNRLLNQEILRVTTLLGNASVLGQSGIELASPLAS  102

Query  393  GGLFSNGGANKDRWSSPFQSEMSGLVqsssaqswlgsqssssGLIVKQTIRIDIPVEQYP  572
             G+FSNGGA+ + W+S FQSEMSGL+QSSS Q+WL  QSSSSGLIVK+TIR+DIPV++YP
Sbjct  103  RGMFSNGGADVNGWASRFQSEMSGLLQSSSTQNWLSPQSSSSGLIVKRTIRVDIPVDKYP  162

Query  573  NYNFVGRLLGPRGNSLKRVEVSTDCRVLIRGRGSIKDPT  689
            NYNFVGRLLGPRGNSLKRVEV+T+CRVLIRGRGSIKDPT
Sbjct  163  NYNFVGRLLGPRGNSLKRVEVTTECRVLIRGRGSIKDPT  201



>ref|XP_008805545.1| PREDICTED: KH domain-containing protein At5g56140-like isoform 
X4 [Phoenix dactylifera]
Length=291

 Score =   240 bits (612),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 142/191 (74%), Positives = 163/191 (85%), Gaps = 2/191 (1%)
 Frame = +3

Query  117  MASSRFMAYspspsaphsp-hIGALRSASSALVEQEKYLAELLAERSKLSPFMPVLPNCF  293
            MAS  +MAYSPSPS      H+  +RSA++A+VEQEKYL+ELLAER K+SPFMPVLP+ +
Sbjct  1    MASGGYMAYSPSPSTAPHSPHLSGIRSATNAIVEQEKYLSELLAERHKMSPFMPVLPHSY  60

Query  294  RLLNQEILRVTTLLGNASVLDQSGLEHGSPLASGGLFSNGG-ANKDRWSSPFQSEMSGLV  470
            RLLNQEILRVTTLLGNAS+LDQSGLEHGSPL +GGLFSNGG A+   W+S F+SE  GL+
Sbjct  61   RLLNQEILRVTTLLGNASLLDQSGLEHGSPLITGGLFSNGGAADMSGWASAFRSERLGLL  120

Query  471  qsssaqswlgsqssssGLIVKQTIRIDIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDCR  650
            Q SSA SWLGSQ SSS LIVK+ IRIDIP ++YP +NFVGRLLGPRGNSLKRVE ST+CR
Sbjct  121  QPSSAHSWLGSQGSSSNLIVKKMIRIDIPADKYPTFNFVGRLLGPRGNSLKRVEASTECR  180

Query  651  VLIRGRGSIKD  683
            VLIRGRGSIKD
Sbjct  181  VLIRGRGSIKD  191



>ref|XP_010928019.1| PREDICTED: KH domain-containing protein At5g56140 isoform X4 
[Elaeis guineensis]
Length=285

 Score =   239 bits (611),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 139/192 (72%), Positives = 160/192 (83%), Gaps = 8/192 (4%)
 Frame = +3

Query  117  MASSRFMAYspspsaphsp-hIGALRSASSALVEQEKYLAELLAERSKLSPFMPVLPNCF  293
            M+S R+MAYSPSPS      HI  +RSA++A+ EQEKYL+ELLAER KLSPFMPVLP+ +
Sbjct  1    MSSGRYMAYSPSPSTAPHSPHITGIRSATNAIAEQEKYLSELLAERHKLSPFMPVLPHSY  60

Query  294  RLLNQEILRVTTLLGNASVLDQSGLEHGSPLASGGLFSNGG-ANKDRWSSPFQSEMSGLV  470
            RLLNQEILR+T LLGNAS+LDQSGLEHGSPL +GGL SNGG A+ + W+S FQSE S   
Sbjct  61   RLLNQEILRITILLGNASLLDQSGLEHGSPLTTGGLLSNGGAADMNGWASAFQSEPSS--  118

Query  471  qsssaqswlgsqssssGLIVKQTIRIDIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDCR  650
                A SWLGSQ SSS LIVK+TIR+DIPV++YP YNFVGRLLGPRGNSLKRVE ST+CR
Sbjct  119  ----AHSWLGSQCSSSNLIVKKTIRVDIPVDKYPTYNFVGRLLGPRGNSLKRVEASTECR  174

Query  651  VLIRGRGSIKDP  686
            +LIRGRGSIKDP
Sbjct  175  ILIRGRGSIKDP  186



>gb|EPS67293.1| hypothetical protein M569_07482, partial [Genlisea aurea]
Length=246

 Score =   238 bits (608),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 139/197 (71%), Positives = 160/197 (81%), Gaps = 6/197 (3%)
 Frame = +3

Query  117  MASSRFMAYspspsaphsphIGALRSASSA------LVEQEKYLAELLAERSKLSPFMPV  278
            M+S RFM+YSPS SA  S  IG + SA         L+E EKYLAELL E  KL+PFM V
Sbjct  1    MSSGRFMSYSPSHSAQQSQLIGGVASAGGVNRAARDLIELEKYLAELLDECKKLTPFMAV  60

Query  279  LPNCFRLLNQEILRVTTLLGNASVLDQSGLEHGSPLASGGLFSNGGANKDRWSSPFQSEM  458
            LPNC+RLLN+EI  VTTLL NASVL+Q GLEH SPLASGG++SN GAN +RW S FQ EM
Sbjct  61   LPNCYRLLNKEISGVTTLLRNASVLEQRGLEHASPLASGGIYSNAGANLNRWPSQFQPEM  120

Query  459  SGLVqsssaqswlgsqssssGLIVKQTIRIDIPVEQYPNYNFVGRLLGPRGNSLKRVEVS  638
            SG+VQ SS Q+WLG+QSSSSGLIVK+TIR+DIP++Q+PNYNFVGRLLGPRGNSLKRVE +
Sbjct  121  SGIVQQSSMQNWLGAQSSSSGLIVKRTIRVDIPIDQFPNYNFVGRLLGPRGNSLKRVEAT  180

Query  639  TDCRVLIRGRGSIKDPT  689
            T+CRVLIRG GSIKDP 
Sbjct  181  TECRVLIRGCGSIKDPA  197



>ref|XP_008813749.1| PREDICTED: KH domain-containing protein At5g56140 isoform X1 
[Phoenix dactylifera]
Length=292

 Score =   238 bits (608),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 140/194 (72%), Positives = 163/194 (84%), Gaps = 3/194 (2%)
 Frame = +3

Query  117  MASSRFMAYspspsaphsp-hIGALRSASSALVEQEKYLAELLAERSKLSPFMPVLPNCF  293
            M+S R+MAYSPSPS      HI  +RSA++A+ E+EKYL+ELLAER KLSPF PVLP+ +
Sbjct  1    MSSGRYMAYSPSPSTAPHSPHITGIRSATNAIAEKEKYLSELLAERHKLSPFTPVLPHSY  60

Query  294  RLLNQ-EILRVTTLLGNASVLDQSGLEHGSPLASGGLFSNGGA-NKDRWSSPFQSEMSGL  467
            RLLNQ EILR+T LLGNAS+LDQSGLEHGSPL +GGL SNGGA + + W+S FQSE  GL
Sbjct  61   RLLNQAEILRITILLGNASLLDQSGLEHGSPLTTGGLLSNGGAADMNGWASAFQSESLGL  120

Query  468  VqsssaqswlgsqssssGLIVKQTIRIDIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDC  647
            +Q SSA  WLGSQ SSS LIVK+TIR+DIPV++YP YNFVGRLLGPRGNSLKRVE ST+C
Sbjct  121  LQPSSAHGWLGSQCSSSNLIVKKTIRVDIPVDKYPTYNFVGRLLGPRGNSLKRVEASTEC  180

Query  648  RVLIRGRGSIKDPT  689
             +LIRGRGSIKDPT
Sbjct  181  HILIRGRGSIKDPT  194



>ref|XP_010913285.1| PREDICTED: KH domain-containing protein At5g56140-like isoform 
X3 [Elaeis guineensis]
Length=292

 Score =   238 bits (606),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 144/194 (74%), Positives = 166/194 (86%), Gaps = 3/194 (2%)
 Frame = +3

Query  117  MASSRFMAYspspsaphsp-hIGALRSASSALVEQEKYLAELLAERSKLSPFMPVLPNCF  293
            MAS  FMAYSPSPSA     H+  +RSA++A+VEQEKYL+ELLAER KLSPFMPVLP+ +
Sbjct  1    MASGGFMAYSPSPSAAPHSPHLCGIRSATNAIVEQEKYLSELLAERHKLSPFMPVLPHSY  60

Query  294  RLLNQ-EILRVTTLLGNASVLDQSGLEHGSPLASGGLFSNGGA-NKDRWSSPFQSEMSGL  467
            RLLNQ EILRVTTLLGNAS+LDQSGLEHGSPL +GGLFSNGGA + + W+S F+SE  GL
Sbjct  61   RLLNQAEILRVTTLLGNASLLDQSGLEHGSPLTTGGLFSNGGAADMNGWASAFRSERLGL  120

Query  468  VqsssaqswlgsqssssGLIVKQTIRIDIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDC  647
            +Q SSA SWLGSQ SSS LIVK+TIR+DIPV++YP +NFVGRLLGPRG SLKRVE ST+C
Sbjct  121  LQPSSAHSWLGSQGSSSNLIVKKTIRVDIPVDKYPTFNFVGRLLGPRGYSLKRVEASTEC  180

Query  648  RVLIRGRGSIKDPT  689
             VLIRG+GSIKDP 
Sbjct  181  HVLIRGQGSIKDPA  194



>ref|XP_010539351.1| PREDICTED: KH domain-containing protein At5g56140 [Tarenaya hassleriana]
 ref|XP_010539352.1| PREDICTED: KH domain-containing protein At5g56140 [Tarenaya hassleriana]
Length=310

 Score =   237 bits (605),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 139/191 (73%), Positives = 155/191 (81%), Gaps = 7/191 (4%)
 Frame = +3

Query  129  RFMAYspspsaphsphIG-----ALRSASSALVEQEKYLAELLAERSKLSPFMPVLPNCF  293
            RFMAYSPSPS   S          LRS  S LVEQEKYL+ELLAER+KLSPF+PVLP+ +
Sbjct  24   RFMAYSPSPSVAPSAPQSPNISCGLRSQPSVLVEQEKYLSELLAERNKLSPFLPVLPHAY  83

Query  294  RLLNQEILRVTTLLGNASVLDQSGLEHGSPLASGGLFSNGGANKDRWSSPFQSEMSGLVq  473
            RLLNQEILRVTTLL NASVL Q+GL+H SPL+SGG+F N  A+ + W+SPFQSE S  V 
Sbjct  84   RLLNQEILRVTTLLENASVLSQTGLDHPSPLSSGGIFQNARADVNGWTSPFQSERS--VS  141

Query  474  sssaqswlgsqssssGLIVKQTIRIDIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDCRV  653
            SS A +WL S  SSSGLIVK+ IR+DIPVEQYPNYNFVGRLLGPRGNS+KRVE STDCRV
Sbjct  142  SSPAPNWLNSPGSSSGLIVKRAIRVDIPVEQYPNYNFVGRLLGPRGNSIKRVEASTDCRV  201

Query  654  LIRGRGSIKDP  686
            LIRGRGSIKDP
Sbjct  202  LIRGRGSIKDP  212



>ref|XP_003522828.1| PREDICTED: KH domain-containing protein At5g56140-like [Glycine 
max]
Length=291

 Score =   236 bits (602),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 137/190 (72%), Positives = 161/190 (85%), Gaps = 2/190 (1%)
 Frame = +3

Query  120  ASSRFMAYspspsaphsphIGALRSASSALVEQEKYLAELLAERSKLSPFMPVLPNCFRL  299
             + R+MA+ PSPSAP SPH+  LRS  + L + +KYLAELL ER+KLSPFM VLP+CFRL
Sbjct  6    GAGRYMAFPPSPSAPPSPHLSGLRS--TPLSDPDKYLAELLGERNKLSPFMAVLPHCFRL  63

Query  300  LNQEILRVTTLLGNASVLDQSGLEHGSPLASGGLFSNGGANKDRWSSPFQSEMSGLVqss  479
             NQEILRVTTL+GNASVL QSGLEH SPLA+GG+FSNGGA+ + W+S FQSE   L+QSS
Sbjct  64   FNQEILRVTTLMGNASVLGQSGLEHASPLATGGIFSNGGADVNGWASRFQSERPSLLQSS  123

Query  480  saqswlgsqssssGLIVKQTIRIDIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDCRVLI  659
            S Q+WL  Q SSSG+IVK+T+R+DIPV+ YPN+NFVGRLLGPRGNSLKRVE ST+CRVLI
Sbjct  124  STQNWLSPQGSSSGIIVKKTVRVDIPVDAYPNFNFVGRLLGPRGNSLKRVEASTECRVLI  183

Query  660  RGRGSIKDPT  689
            RGRGSIKDP 
Sbjct  184  RGRGSIKDPA  193



>ref|XP_010913284.1| PREDICTED: KH domain-containing protein At5g56140-like isoform 
X2 [Elaeis guineensis]
Length=298

 Score =   236 bits (602),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 144/200 (72%), Positives = 167/200 (84%), Gaps = 9/200 (5%)
 Frame = +3

Query  117  MASSRFMAYspspsaphsp-hIGALRSASSALVEQEKYLAELLAERSKLSPFMPVLPNCF  293
            MAS  FMAYSPSPSA     H+  +RSA++A+VEQEKYL+ELLAER KLSPFMPVLP+ +
Sbjct  1    MASGGFMAYSPSPSAAPHSPHLCGIRSATNAIVEQEKYLSELLAERHKLSPFMPVLPHSY  60

Query  294  RLLNQEILRVTTLLGNASVLDQSGLEHGSPLASGGLFSNGG-ANKDRWSSPFQSEMS---  461
            RLLNQEILRVTTLLGNAS+LDQSGLEHGSPL +GGLFSNGG A+ + W+S F+SE +   
Sbjct  61   RLLNQEILRVTTLLGNASLLDQSGLEHGSPLTTGGLFSNGGAADMNGWASAFRSENTRCN  120

Query  462  ----GLVqsssaqswlgsqssssGLIVKQTIRIDIPVEQYPNYNFVGRLLGPRGNSLKRV  629
                GL+Q SSA SWLGSQ SSS LIVK+TIR+DIPV++YP +NFVGRLLGPRG SLKRV
Sbjct  121  MQRLGLLQPSSAHSWLGSQGSSSNLIVKKTIRVDIPVDKYPTFNFVGRLLGPRGYSLKRV  180

Query  630  EVSTDCRVLIRGRGSIKDPT  689
            E ST+C VLIRG+GSIKDP 
Sbjct  181  EASTECHVLIRGQGSIKDPA  200



>ref|XP_008813752.1| PREDICTED: KH domain-containing protein At5g56140 isoform X4 
[Phoenix dactylifera]
Length=285

 Score =   236 bits (601),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 137/193 (71%), Positives = 159/193 (82%), Gaps = 8/193 (4%)
 Frame = +3

Query  117  MASSRFMAYspspsaphsp-hIGALRSASSALVEQEKYLAELLAERSKLSPFMPVLPNCF  293
            M+S R+MAYSPSPS      HI  +RSA++A+ E+EKYL+ELLAER KLSPF PVLP+ +
Sbjct  1    MSSGRYMAYSPSPSTAPHSPHITGIRSATNAIAEKEKYLSELLAERHKLSPFTPVLPHSY  60

Query  294  RLLNQEILRVTTLLGNASVLDQSGLEHGSPLASGGLFSNGG-ANKDRWSSPFQSEMSGLV  470
            RLLNQEILR+T LLGNAS+LDQSGLEHGSPL +GGL SNGG A+ + W+S FQSE S   
Sbjct  61   RLLNQEILRITILLGNASLLDQSGLEHGSPLTTGGLLSNGGAADMNGWASAFQSEPS---  117

Query  471  qsssaqswlgsqssssGLIVKQTIRIDIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDCR  650
               SA  WLGSQ SSS LIVK+TIR+DIPV++YP YNFVGRLLGPRGNSLKRVE ST+C 
Sbjct  118  ---SAHGWLGSQCSSSNLIVKKTIRVDIPVDKYPTYNFVGRLLGPRGNSLKRVEASTECH  174

Query  651  VLIRGRGSIKDPT  689
            +LIRGRGSIKDPT
Sbjct  175  ILIRGRGSIKDPT  187



>ref|XP_008805544.1| PREDICTED: KH domain-containing protein At5g56140-like isoform 
X3 [Phoenix dactylifera]
Length=292

 Score =   236 bits (601),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 142/192 (74%), Positives = 163/192 (85%), Gaps = 3/192 (2%)
 Frame = +3

Query  117  MASSRFMAYspspsaphsp-hIGALRSASSALVEQEKYLAELLAERSKLSPFMPVLPNCF  293
            MAS  +MAYSPSPS      H+  +RSA++A+VEQEKYL+ELLAER K+SPFMPVLP+ +
Sbjct  1    MASGGYMAYSPSPSTAPHSPHLSGIRSATNAIVEQEKYLSELLAERHKMSPFMPVLPHSY  60

Query  294  RLLNQ-EILRVTTLLGNASVLDQSGLEHGSPLASGGLFSNGGA-NKDRWSSPFQSEMSGL  467
            RLLNQ EILRVTTLLGNAS+LDQSGLEHGSPL +GGLFSNGGA +   W+S F+SE  GL
Sbjct  61   RLLNQAEILRVTTLLGNASLLDQSGLEHGSPLITGGLFSNGGAADMSGWASAFRSERLGL  120

Query  468  VqsssaqswlgsqssssGLIVKQTIRIDIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDC  647
            +Q SSA SWLGSQ SSS LIVK+ IRIDIP ++YP +NFVGRLLGPRGNSLKRVE ST+C
Sbjct  121  LQPSSAHSWLGSQGSSSNLIVKKMIRIDIPADKYPTFNFVGRLLGPRGNSLKRVEASTEC  180

Query  648  RVLIRGRGSIKD  683
            RVLIRGRGSIKD
Sbjct  181  RVLIRGRGSIKD  192



>ref|XP_010928018.1| PREDICTED: KH domain-containing protein At5g56140 isoform X3 
[Elaeis guineensis]
Length=286

 Score =   235 bits (600),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 139/194 (72%), Positives = 160/194 (82%), Gaps = 9/194 (5%)
 Frame = +3

Query  117  MASSRFMAYspspsaphsp-hIGALRSASSALVEQEKYLAELLAERSKLSPFMPVLPNCF  293
            M+S R+MAYSPSPS      HI  +RSA++A+ EQEKYL+ELLAER KLSPFMPVLP+ +
Sbjct  1    MSSGRYMAYSPSPSTAPHSPHITGIRSATNAIAEQEKYLSELLAERHKLSPFMPVLPHSY  60

Query  294  RLLNQ-EILRVTTLLGNASVLDQSGLEHGSPLASGGLFSNGGA-NKDRWSSPFQSEMSGL  467
            RLLNQ EILR+T LLGNAS+LDQSGLEHGSPL +GGL SNGGA + + W+S FQSE S  
Sbjct  61   RLLNQAEILRITILLGNASLLDQSGLEHGSPLTTGGLLSNGGAADMNGWASAFQSEPSS-  119

Query  468  VqsssaqswlgsqssssGLIVKQTIRIDIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDC  647
                 A SWLGSQ SSS LIVK+TIR+DIPV++YP YNFVGRLLGPRGNSLKRVE ST+C
Sbjct  120  -----AHSWLGSQCSSSNLIVKKTIRVDIPVDKYPTYNFVGRLLGPRGNSLKRVEASTEC  174

Query  648  RVLIRGRGSIKDPT  689
            R+LIRGRGSIKDP 
Sbjct  175  RILIRGRGSIKDPA  188



>ref|XP_004499705.1| PREDICTED: KH domain-containing protein At5g56140-like [Cicer 
arietinum]
Length=294

 Score =   235 bits (600),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 124/170 (73%), Positives = 142/170 (84%), Gaps = 1/170 (1%)
 Frame = +3

Query  177  IGALRS-ASSALVEQEKYLAELLAERSKLSPFMPVLPNCFRLLNQEILRVTTLLGNASVL  353
            + ALRS  SS + E +KYL ELL ER K+SPFMPVLP+C+RLLNQEILRVTT+LGNASVL
Sbjct  24   LSALRSPVSSTIAEHDKYLTELLGERQKMSPFMPVLPHCYRLLNQEILRVTTILGNASVL  83

Query  354  DQSGLEHGSPLASGGLFSNGGANKDRWSSPFQSEMSGLVqsssaqswlgsqssssGLIVK  533
             QSGLEH SPLASGG+FS GG + + W S FQSEM  L+Q S   +WL  Q SSSGL+VK
Sbjct  84   GQSGLEHASPLASGGMFSKGGPDANGWVSRFQSEMPSLIQGSPTPNWLSPQGSSSGLLVK  143

Query  534  QTIRIDIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDCRVLIRGRGSIKD  683
            +TIR+DIPVE YPN+NFVGRLLGPRGNSLKRVE +T+CRVLIRGRGSIKD
Sbjct  144  KTIRVDIPVESYPNFNFVGRLLGPRGNSLKRVEANTECRVLIRGRGSIKD  193



>ref|XP_010913288.1| PREDICTED: KH domain-containing protein At5g56140-like isoform 
X6 [Elaeis guineensis]
Length=285

 Score =   234 bits (598),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 140/193 (73%), Positives = 161/193 (83%), Gaps = 8/193 (4%)
 Frame = +3

Query  117  MASSRFMAYspspsaphsp-hIGALRSASSALVEQEKYLAELLAERSKLSPFMPVLPNCF  293
            MAS  FMAYSPSPSA     H+  +RSA++A+VEQEKYL+ELLAER KLSPFMPVLP+ +
Sbjct  1    MASGGFMAYSPSPSAAPHSPHLCGIRSATNAIVEQEKYLSELLAERHKLSPFMPVLPHSY  60

Query  294  RLLNQEILRVTTLLGNASVLDQSGLEHGSPLASGGLFSNGG-ANKDRWSSPFQSEMSGLV  470
            RLLNQEILRVTTLLGNAS+LDQSGLEHGSPL +GGLFSNGG A+ + W+S F+SE S   
Sbjct  61   RLLNQEILRVTTLLGNASLLDQSGLEHGSPLTTGGLFSNGGAADMNGWASAFRSEPSS--  118

Query  471  qsssaqswlgsqssssGLIVKQTIRIDIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDCR  650
                A SWLGSQ SSS LIVK+TIR+DIPV++YP +NFVGRLLGPRG SLKRVE ST+C 
Sbjct  119  ----AHSWLGSQGSSSNLIVKKTIRVDIPVDKYPTFNFVGRLLGPRGYSLKRVEASTECH  174

Query  651  VLIRGRGSIKDPT  689
            VLIRG+GSIKDP 
Sbjct  175  VLIRGQGSIKDPA  187



>ref|XP_008219129.1| PREDICTED: KH domain-containing protein At5g56140 isoform X1 
[Prunus mume]
Length=306

 Score =   235 bits (600),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 149/200 (75%), Positives = 170/200 (85%), Gaps = 13/200 (7%)
 Frame = +3

Query  129  RFMAYspspsaphsphIGALRSASSALV---EQEKYLAELLAERSKLSPFMPVLPNCFRL  299
            R+M+YSPSPSAPHSPH+  LRSASSA +   EQEKYL+ELLAER KL PF+P+LP+C RL
Sbjct  9    RYMSYSPSPSAPHSPHLSGLRSASSAALVAAEQEKYLSELLAERHKLGPFLPLLPHCCRL  68

Query  300  LNQEILRVTTLLGNASVLDQSGLEHGSPLASGGLFSNGGANKDRWSSPFQSE--------  455
            +NQEILRVTTLLGNASVL QSGLEH SPLASGG+FSNGGA+ + W+S FQSE        
Sbjct  69   INQEILRVTTLLGNASVLGQSGLEHASPLASGGMFSNGGADVNGWASRFQSEVLTYLDST  128

Query  456  --MSGLVqsssaqswlgsqssssGLIVKQTIRIDIPVEQYPNYNFVGRLLGPRGNSLKRV  629
              M GL+Q SS Q+WL S SSSSGLIVK+TIR+DIPV++YPNYNFVGRLLGPRGNSLKRV
Sbjct  129  AQMPGLLQPSSTQNWLNSPSSSSGLIVKRTIRVDIPVDKYPNYNFVGRLLGPRGNSLKRV  188

Query  630  EVSTDCRVLIRGRGSIKDPT  689
            E +T+CRVLIRGRGSIKDPT
Sbjct  189  EATTECRVLIRGRGSIKDPT  208



>ref|XP_008805543.1| PREDICTED: KH domain-containing protein At5g56140-like isoform 
X2 [Phoenix dactylifera]
Length=298

 Score =   234 bits (598),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 142/198 (72%), Positives = 164/198 (83%), Gaps = 9/198 (5%)
 Frame = +3

Query  117  MASSRFMAYspspsaphsp-hIGALRSASSALVEQEKYLAELLAERSKLSPFMPVLPNCF  293
            MAS  +MAYSPSPS      H+  +RSA++A+VEQEKYL+ELLAER K+SPFMPVLP+ +
Sbjct  1    MASGGYMAYSPSPSTAPHSPHLSGIRSATNAIVEQEKYLSELLAERHKMSPFMPVLPHSY  60

Query  294  RLLNQEILRVTTLLGNASVLDQSGLEHGSPLASGGLFSNGG-ANKDRWSSPFQSEMS---  461
            RLLNQEILRVTTLLGNAS+LDQSGLEHGSPL +GGLFSNGG A+   W+S F+SE +   
Sbjct  61   RLLNQEILRVTTLLGNASLLDQSGLEHGSPLITGGLFSNGGAADMSGWASAFRSENTRCN  120

Query  462  ----GLVqsssaqswlgsqssssGLIVKQTIRIDIPVEQYPNYNFVGRLLGPRGNSLKRV  629
                GL+Q SSA SWLGSQ SSS LIVK+ IRIDIP ++YP +NFVGRLLGPRGNSLKRV
Sbjct  121  MQRLGLLQPSSAHSWLGSQGSSSNLIVKKMIRIDIPADKYPTFNFVGRLLGPRGNSLKRV  180

Query  630  EVSTDCRVLIRGRGSIKD  683
            E ST+CRVLIRGRGSIKD
Sbjct  181  EASTECRVLIRGRGSIKD  198



>ref|XP_009379123.1| PREDICTED: KH domain-containing protein At5g56140-like [Pyrus 
x bretschneideri]
Length=299

 Score =   234 bits (598),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 127/159 (80%), Positives = 145/159 (91%), Gaps = 0/159 (0%)
 Frame = +3

Query  213  EQEKYLAELLAERSKLSPFMPVLPNCFRLLNQEILRVTTLLGNASVLDQSGLEHGSPLAS  392
            EQEKY++ELL ER KLSPF+PVLP+C RLLNQEILRVTTLLGNASVL Q+GLEH SPLAS
Sbjct  43   EQEKYVSELLGERLKLSPFLPVLPHCNRLLNQEILRVTTLLGNASVLGQNGLEHASPLAS  102

Query  393  GGLFSNGGANKDRWSSPFQSEMSGLVqsssaqswlgsqssssGLIVKQTIRIDIPVEQYP  572
             G+F NGGA+ + W+S FQSEMSGL+Q SS Q+WL SQSSSSGLIVK+TIR+DIPV++YP
Sbjct  103  RGMFPNGGADVNGWASRFQSEMSGLLQPSSTQNWLSSQSSSSGLIVKRTIRVDIPVDKYP  162

Query  573  NYNFVGRLLGPRGNSLKRVEVSTDCRVLIRGRGSIKDPT  689
            N+NFVGRLLGPRGNSLKRVE +T+CRVLIRGRGSIKDPT
Sbjct  163  NFNFVGRLLGPRGNSLKRVEATTECRVLIRGRGSIKDPT  201



>ref|XP_008353854.1| PREDICTED: KH domain-containing protein At5g56140 [Malus domestica]
Length=299

 Score =   234 bits (596),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 126/159 (79%), Positives = 143/159 (90%), Gaps = 0/159 (0%)
 Frame = +3

Query  213  EQEKYLAELLAERSKLSPFMPVLPNCFRLLNQEILRVTTLLGNASVLDQSGLEHGSPLAS  392
            E+EKYL+ELL ER KLSPF+PVLP+C RLLNQEILRVTTLLGNASVL QSGLEH SPLAS
Sbjct  43   EKEKYLSELLGERHKLSPFLPVLPHCNRLLNQEILRVTTLLGNASVLGQSGLEHASPLAS  102

Query  393  GGLFSNGGANKDRWSSPFQSEMSGLVqsssaqswlgsqssssGLIVKQTIRIDIPVEQYP  572
             G+F NGGA+ + W+S  QSEMSGL+Q  S Q+WL SQSSSSGLIVK+TIR+DIPV++YP
Sbjct  103  RGMFPNGGADVNGWASRIQSEMSGLLQPLSTQNWLSSQSSSSGLIVKRTIRVDIPVDKYP  162

Query  573  NYNFVGRLLGPRGNSLKRVEVSTDCRVLIRGRGSIKDPT  689
            N+NFVGRLLGPRGNSLKRVE +T+CRVLIRGRGSIKDPT
Sbjct  163  NFNFVGRLLGPRGNSLKRVEATTECRVLIRGRGSIKDPT  201



>ref|XP_008447797.1| PREDICTED: KH domain-containing protein At5g56140 isoform X2 
[Cucumis melo]
Length=296

 Score =   234 bits (596),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 128/156 (82%), Positives = 141/156 (90%), Gaps = 0/156 (0%)
 Frame = +3

Query  222  KYLAELLAERSKLSPFMPVLPNCFRLLNQEILRVTTLLGNASVLDQSGLEHGSPLASGGL  401
            +YL+ELLAER KLSPFMPVLPN +RLLNQEILRVTTLLG ASVL QSGLEH SPLASGG+
Sbjct  43   RYLSELLAERQKLSPFMPVLPNSYRLLNQEILRVTTLLGKASVLGQSGLEHASPLASGGI  102

Query  402  FSNGGANKDRWSSPFQSEMSGLVqsssaqswlgsqssssGLIVKQTIRIDIPVEQYPNYN  581
            FSNGGA+   W S FQSEMSGL+Q+SSAQ+WL SQ SSSGLIVK+TIR+D+PV+ +PNYN
Sbjct  103  FSNGGADMSAWPSRFQSEMSGLLQASSAQNWLSSQGSSSGLIVKRTIRVDVPVDNFPNYN  162

Query  582  FVGRLLGPRGNSLKRVEVSTDCRVLIRGRGSIKDPT  689
            FVGRLLGPRGNSLKRVE STDCRVLIRGRGSIKDP 
Sbjct  163  FVGRLLGPRGNSLKRVEASTDCRVLIRGRGSIKDPA  198



>ref|XP_008805547.1| PREDICTED: KH domain-containing protein At5g56140-like isoform 
X6 [Phoenix dactylifera]
Length=285

 Score =   233 bits (594),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 139/191 (73%), Positives = 159/191 (83%), Gaps = 8/191 (4%)
 Frame = +3

Query  117  MASSRFMAYspspsaphsp-hIGALRSASSALVEQEKYLAELLAERSKLSPFMPVLPNCF  293
            MAS  +MAYSPSPS      H+  +RSA++A+VEQEKYL+ELLAER K+SPFMPVLP+ +
Sbjct  1    MASGGYMAYSPSPSTAPHSPHLSGIRSATNAIVEQEKYLSELLAERHKMSPFMPVLPHSY  60

Query  294  RLLNQEILRVTTLLGNASVLDQSGLEHGSPLASGGLFSNGG-ANKDRWSSPFQSEMSGLV  470
            RLLNQEILRVTTLLGNAS+LDQSGLEHGSPL +GGLFSNGG A+   W+S F+SE S   
Sbjct  61   RLLNQEILRVTTLLGNASLLDQSGLEHGSPLITGGLFSNGGAADMSGWASAFRSEPS---  117

Query  471  qsssaqswlgsqssssGLIVKQTIRIDIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDCR  650
               SA SWLGSQ SSS LIVK+ IRIDIP ++YP +NFVGRLLGPRGNSLKRVE ST+CR
Sbjct  118  ---SAHSWLGSQGSSSNLIVKKMIRIDIPADKYPTFNFVGRLLGPRGNSLKRVEASTECR  174

Query  651  VLIRGRGSIKD  683
            VLIRGRGSIKD
Sbjct  175  VLIRGRGSIKD  185



>gb|EAY87341.1| hypothetical protein OsI_08744 [Oryza sativa Indica Group]
 dbj|BAH01623.1| unnamed protein product [Oryza sativa Japonica Group]
Length=286

 Score =   231 bits (590),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 133/192 (69%), Positives = 156/192 (81%), Gaps = 7/192 (4%)
 Frame = +3

Query  117  MASSRFMAYspspsaphsp-hIGALRSASSALVEQEKYLAELLAERSKLSPFMPVLPNCF  293
            MAS R+MAYSPSPS       I  LR+ASSA+ +QEKYLAELLAER KLSPF+PVLPN  
Sbjct  1    MASGRYMAYSPSPSTTPHSPRIPGLRAASSAVADQEKYLAELLAERHKLSPFIPVLPNSV  60

Query  294  RLLNQEILRVTTLLGNASVLDQSGLEHGSPLASGGLFSNG-GANKDRWSSPFQSEMSGLV  470
            RLLNQEILRV+TLL NAS+L+QSGLEHGSPL +GGL+SNG  A+ + W+S FQSE S   
Sbjct  61   RLLNQEILRVSTLLENASLLNQSGLEHGSPLTTGGLYSNGAAADMNGWTSAFQSEGS---  117

Query  471  qsssaqswlgsqssssGLIVKQTIRIDIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDCR  650
               +     GSQ SSSGLIVK+T+++DIPV++YP +NFVGR+LGPRGNSLKRVE +TDCR
Sbjct  118  --PAYSWRGGSQGSSSGLIVKKTMKVDIPVDKYPTFNFVGRILGPRGNSLKRVEATTDCR  175

Query  651  VLIRGRGSIKDP  686
            VLIRGRGSIKDP
Sbjct  176  VLIRGRGSIKDP  187



>ref|XP_010913282.1| PREDICTED: KH domain-containing protein At5g56140-like isoform 
X1 [Elaeis guineensis]
Length=299

 Score =   232 bits (591),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 144/201 (72%), Positives = 167/201 (83%), Gaps = 10/201 (5%)
 Frame = +3

Query  117  MASSRFMAYspspsaphsp-hIGALRSASSALVEQEKYLAELLAERSKLSPFMPVLPNCF  293
            MAS  FMAYSPSPSA     H+  +RSA++A+VEQEKYL+ELLAER KLSPFMPVLP+ +
Sbjct  1    MASGGFMAYSPSPSAAPHSPHLCGIRSATNAIVEQEKYLSELLAERHKLSPFMPVLPHSY  60

Query  294  RLLNQ-EILRVTTLLGNASVLDQSGLEHGSPLASGGLFSNGGA-NKDRWSSPFQSEMS--  461
            RLLNQ EILRVTTLLGNAS+LDQSGLEHGSPL +GGLFSNGGA + + W+S F+SE +  
Sbjct  61   RLLNQAEILRVTTLLGNASLLDQSGLEHGSPLTTGGLFSNGGAADMNGWASAFRSENTRC  120

Query  462  -----GLVqsssaqswlgsqssssGLIVKQTIRIDIPVEQYPNYNFVGRLLGPRGNSLKR  626
                 GL+Q SSA SWLGSQ SSS LIVK+TIR+DIPV++YP +NFVGRLLGPRG SLKR
Sbjct  121  NMQRLGLLQPSSAHSWLGSQGSSSNLIVKKTIRVDIPVDKYPTFNFVGRLLGPRGYSLKR  180

Query  627  VEVSTDCRVLIRGRGSIKDPT  689
            VE ST+C VLIRG+GSIKDP 
Sbjct  181  VEASTECHVLIRGQGSIKDPA  201



>ref|XP_003527575.1| PREDICTED: KH domain-containing protein At5g56140-like [Glycine 
max]
 gb|KHN20564.1| KH domain-containing protein [Glycine soja]
Length=292

 Score =   231 bits (590),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 140/191 (73%), Positives = 164/191 (86%), Gaps = 3/191 (2%)
 Frame = +3

Query  120  ASSRFMAYspspsaphsphI-GALRSASSALVEQEKYLAELLAERSKLSPFMPVLPNCFR  296
             ++R+MA+ PSPSAP SPH+ GALRS  + L + +KYL ELL ER+KLSPFM VLP+CFR
Sbjct  6    GAARYMAFPPSPSAPPSPHLSGALRS--TPLSDPDKYLTELLGERNKLSPFMAVLPHCFR  63

Query  297  LLNQEILRVTTLLGNASVLDQSGLEHGSPLASGGLFSNGGANKDRWSSPFQSEMSGLVqs  476
            LLNQEILRVTTL+GNASVL QSGLEH SPLA+GG+FSNGGA+ + W+S FQSE   L+QS
Sbjct  64   LLNQEILRVTTLMGNASVLGQSGLEHASPLATGGIFSNGGADVNGWASRFQSERPSLLQS  123

Query  477  ssaqswlgsqssssGLIVKQTIRIDIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDCRVL  656
            SS QSWL  Q SSSG+IVK+T+R+DIPV+ YPN+NFVGRLLGPRGNSLKRVE ST+CRVL
Sbjct  124  SSTQSWLSPQGSSSGIIVKKTVRVDIPVDAYPNFNFVGRLLGPRGNSLKRVEASTECRVL  183

Query  657  IRGRGSIKDPT  689
            IRGRGSIKDP 
Sbjct  184  IRGRGSIKDPA  194



>ref|XP_008813751.1| PREDICTED: KH domain-containing protein At5g56140 isoform X3 
[Phoenix dactylifera]
Length=286

 Score =   231 bits (589),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 137/194 (71%), Positives = 159/194 (82%), Gaps = 9/194 (5%)
 Frame = +3

Query  117  MASSRFMAYspspsaphsp-hIGALRSASSALVEQEKYLAELLAERSKLSPFMPVLPNCF  293
            M+S R+MAYSPSPS      HI  +RSA++A+ E+EKYL+ELLAER KLSPF PVLP+ +
Sbjct  1    MSSGRYMAYSPSPSTAPHSPHITGIRSATNAIAEKEKYLSELLAERHKLSPFTPVLPHSY  60

Query  294  RLLNQ-EILRVTTLLGNASVLDQSGLEHGSPLASGGLFSNGGA-NKDRWSSPFQSEMSGL  467
            RLLNQ EILR+T LLGNAS+LDQSGLEHGSPL +GGL SNGGA + + W+S FQSE S  
Sbjct  61   RLLNQAEILRITILLGNASLLDQSGLEHGSPLTTGGLLSNGGAADMNGWASAFQSEPS--  118

Query  468  VqsssaqswlgsqssssGLIVKQTIRIDIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDC  647
                SA  WLGSQ SSS LIVK+TIR+DIPV++YP YNFVGRLLGPRGNSLKRVE ST+C
Sbjct  119  ----SAHGWLGSQCSSSNLIVKKTIRVDIPVDKYPTYNFVGRLLGPRGNSLKRVEASTEC  174

Query  648  RVLIRGRGSIKDPT  689
             +LIRGRGSIKDPT
Sbjct  175  HILIRGRGSIKDPT  188



>ref|XP_010063215.1| PREDICTED: KH domain-containing protein At5g56140-like isoform 
X1 [Eucalyptus grandis]
 gb|KCW70422.1| hypothetical protein EUGRSUZ_F03650 [Eucalyptus grandis]
Length=287

 Score =   231 bits (588),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 133/187 (71%), Positives = 152/187 (81%), Gaps = 7/187 (4%)
 Frame = +3

Query  129  RFMAYspspsaphsp-hIGALRSASSALVEQEKYLAELLAERSKLSPFMPVLPNCFRLLN  305
            R+MAYSPSPS      H+  LR  SSAL EQEKYL+ELL ER KLSPFM VLP C+RLLN
Sbjct  8    RYMAYSPSPSTAPHSPHLSGLRFTSSALAEQEKYLSELLEERLKLSPFMTVLPTCYRLLN  67

Query  306  QEILRVTTLLGNASVLDQSGLEHGSPLASGGLFSNGGANKDRWSSPFQSEMSGLVqsssa  485
            QEI+RVTTLL NASVL QSGLEH SPLASGG+FSNGGA  + W S FQSE +       A
Sbjct  68   QEIMRVTTLLENASVLGQSGLEHASPLASGGIFSNGGAELNGWPSRFQSEPT------LA  121

Query  486  qswlgsqssssGLIVKQTIRIDIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDCRVLIRG  665
             +W+ SQ SSSGL+VK+T+R+DIPV+++P+YNFVGRLLGPRGNSLKRVE ST+CRVLIRG
Sbjct  122  PNWMSSQVSSSGLLVKKTVRLDIPVDKFPSYNFVGRLLGPRGNSLKRVEASTECRVLIRG  181

Query  666  RGSIKDP  686
            RGSIKDP
Sbjct  182  RGSIKDP  188



>ref|XP_003598315.1| KH domain-containing protein [Medicago truncatula]
 gb|AES68566.1| RNA-binding KH domain protein [Medicago truncatula]
Length=293

 Score =   231 bits (588),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 127/188 (68%), Positives = 151/188 (80%), Gaps = 0/188 (0%)
 Frame = +3

Query  120  ASSRFMAYspspsaphsphIGALRSASSALVEQEKYLAELLAERSKLSPFMPVLPNCFRL  299
             + R+MA+ PSPS       G    ASS + E ++YL+ELL ER K+SPFM VLP+C+RL
Sbjct  6    GAGRYMAFPPSPSQSLPHLSGLRSPASSVISEHDQYLSELLGERQKISPFMAVLPHCYRL  65

Query  300  LNQEILRVTTLLGNASVLDQSGLEHGSPLASGGLFSNGGANKDRWSSPFQSEMSGLVqss  479
            LNQEILRVTT+LGNASVL QSGLEHGSPLA+GG+FS GG + + W S FQSEM  L+QSS
Sbjct  66   LNQEILRVTTILGNASVLGQSGLEHGSPLAAGGMFSKGGLDPNGWVSRFQSEMPSLIQSS  125

Query  480  saqswlgsqssssGLIVKQTIRIDIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDCRVLI  659
               SWL  Q SSSGL+VK+TIR+DIPV+ +PN+NFVGRLLGPRGNSLKRVE +T+CRVLI
Sbjct  126  PTPSWLSPQGSSSGLLVKKTIRVDIPVDSFPNFNFVGRLLGPRGNSLKRVEANTECRVLI  185

Query  660  RGRGSIKD  683
            RGRGSIKD
Sbjct  186  RGRGSIKD  193



>ref|XP_010913287.1| PREDICTED: KH domain-containing protein At5g56140-like isoform 
X5 [Elaeis guineensis]
Length=286

 Score =   230 bits (586),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 140/194 (72%), Positives = 161/194 (83%), Gaps = 9/194 (5%)
 Frame = +3

Query  117  MASSRFMAYspspsaphsp-hIGALRSASSALVEQEKYLAELLAERSKLSPFMPVLPNCF  293
            MAS  FMAYSPSPSA     H+  +RSA++A+VEQEKYL+ELLAER KLSPFMPVLP+ +
Sbjct  1    MASGGFMAYSPSPSAAPHSPHLCGIRSATNAIVEQEKYLSELLAERHKLSPFMPVLPHSY  60

Query  294  RLLNQ-EILRVTTLLGNASVLDQSGLEHGSPLASGGLFSNGGA-NKDRWSSPFQSEMSGL  467
            RLLNQ EILRVTTLLGNAS+LDQSGLEHGSPL +GGLFSNGGA + + W+S F+SE S  
Sbjct  61   RLLNQAEILRVTTLLGNASLLDQSGLEHGSPLTTGGLFSNGGAADMNGWASAFRSEPSS-  119

Query  468  VqsssaqswlgsqssssGLIVKQTIRIDIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDC  647
                 A SWLGSQ SSS LIVK+TIR+DIPV++YP +NFVGRLLGPRG SLKRVE ST+C
Sbjct  120  -----AHSWLGSQGSSSNLIVKKTIRVDIPVDKYPTFNFVGRLLGPRGYSLKRVEASTEC  174

Query  648  RVLIRGRGSIKDPT  689
             VLIRG+GSIKDP 
Sbjct  175  HVLIRGQGSIKDPA  188



>ref|XP_008805542.1| PREDICTED: KH domain-containing protein At5g56140-like isoform 
X1 [Phoenix dactylifera]
Length=299

 Score =   230 bits (586),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 142/199 (71%), Positives = 164/199 (82%), Gaps = 10/199 (5%)
 Frame = +3

Query  117  MASSRFMAYspspsaphsp-hIGALRSASSALVEQEKYLAELLAERSKLSPFMPVLPNCF  293
            MAS  +MAYSPSPS      H+  +RSA++A+VEQEKYL+ELLAER K+SPFMPVLP+ +
Sbjct  1    MASGGYMAYSPSPSTAPHSPHLSGIRSATNAIVEQEKYLSELLAERHKMSPFMPVLPHSY  60

Query  294  RLLNQ-EILRVTTLLGNASVLDQSGLEHGSPLASGGLFSNGGA-NKDRWSSPFQSEMS--  461
            RLLNQ EILRVTTLLGNAS+LDQSGLEHGSPL +GGLFSNGGA +   W+S F+SE +  
Sbjct  61   RLLNQAEILRVTTLLGNASLLDQSGLEHGSPLITGGLFSNGGAADMSGWASAFRSENTRC  120

Query  462  -----GLVqsssaqswlgsqssssGLIVKQTIRIDIPVEQYPNYNFVGRLLGPRGNSLKR  626
                 GL+Q SSA SWLGSQ SSS LIVK+ IRIDIP ++YP +NFVGRLLGPRGNSLKR
Sbjct  121  NMQRLGLLQPSSAHSWLGSQGSSSNLIVKKMIRIDIPADKYPTFNFVGRLLGPRGNSLKR  180

Query  627  VEVSTDCRVLIRGRGSIKD  683
            VE ST+CRVLIRGRGSIKD
Sbjct  181  VEASTECRVLIRGRGSIKD  199



>ref|XP_009395891.1| PREDICTED: KH domain-containing protein At5g56140-like [Musa 
acuminata subsp. malaccensis]
Length=289

 Score =   229 bits (585),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 136/191 (71%), Positives = 158/191 (83%), Gaps = 4/191 (2%)
 Frame = +3

Query  117  MASSRFMAYspspsaphsp-hIGALRSASSALVEQEKYLAELLAERSKLSPFMPVLPNCF  293
            MAS R+MAYSPSPS      HI  +RSA  AL EQEKYL+ELLAER KLSPFMPVLP+C+
Sbjct  1    MASGRYMAYSPSPSTAPHSPHIPGIRSALGALAEQEKYLSELLAERHKLSPFMPVLPHCY  60

Query  294  RLLNQEILRVTTLLGNASVLDQSGLEHGSPLASGGLFSNGGA-NKDRWSSPFQSEMSGLV  470
            RLLNQEI+RVT LLGNAS+LDQS  EHGSP+ +GG+F NGGA + + W+   QSE  G +
Sbjct  61   RLLNQEIIRVTMLLGNASLLDQS--EHGSPMTTGGIFPNGGAIDMNGWALASQSERLGSM  118

Query  471  qsssaqswlgsqssssGLIVKQTIRIDIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDCR  650
            Q SS   WLGSQSSSSGLIVK+TIR+DIP++++PNYNFVGRLLGPRGNSLKRVE +TDC 
Sbjct  119  QPSSTHGWLGSQSSSSGLIVKKTIRVDIPIDKFPNYNFVGRLLGPRGNSLKRVEANTDCH  178

Query  651  VLIRGRGSIKD  683
            +LIRGRGSIKD
Sbjct  179  ILIRGRGSIKD  189



>ref|XP_002454368.1| hypothetical protein SORBIDRAFT_04g029520 [Sorghum bicolor]
 gb|EES07344.1| hypothetical protein SORBIDRAFT_04g029520 [Sorghum bicolor]
Length=286

 Score =   229 bits (584),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 130/192 (68%), Positives = 155/192 (81%), Gaps = 7/192 (4%)
 Frame = +3

Query  117  MASSRFMAYspspsaphsp-hIGALRSASSALVEQEKYLAELLAERSKLSPFMPVLPNCF  293
            M+S R+MAYSPSPS       IG LR+ S+A+ EQEKYLAELLAER KL PF+PV+P+  
Sbjct  1    MSSGRYMAYSPSPSTTPHSPRIGGLRTPSAAVAEQEKYLAELLAERHKLGPFIPVIPHSV  60

Query  294  RLLNQEILRVTTLLGNASVLDQSGLEHGSPLASGGLFSNGGA-NKDRWSSPFQSEMSGLV  470
            RLLNQEILRV+TLL NAS+L+QSGLEHGSPL +GGL+SNG A + + W+S FQSE S   
Sbjct  61   RLLNQEILRVSTLLENASLLNQSGLEHGSPLTTGGLYSNGAATDMNGWTSAFQSESS---  117

Query  471  qsssaqswlgsqssssGLIVKQTIRIDIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDCR  650
               +     GSQ SSSGLIVK+T+++DIPV++YP YNFVGR+LGPRGNSLKRVE +TDCR
Sbjct  118  --PAYSWLGGSQGSSSGLIVKKTMKVDIPVDKYPTYNFVGRILGPRGNSLKRVEANTDCR  175

Query  651  VLIRGRGSIKDP  686
            VLIRGRGSIKDP
Sbjct  176  VLIRGRGSIKDP  187



>ref|NP_200425.1| KH domain-containing protein [Arabidopsis thaliana]
 sp|Q9FKT4.1|QKIL2_ARATH RecName: Full=KH domain-containing protein At5g56140; AltName: 
Full=Quaking-like protein 2 [Arabidopsis thaliana]
 dbj|BAB09296.1| RNA-binding protein-like [Arabidopsis thaliana]
 gb|AAN41273.1| putative RNA-binding protein [Arabidopsis thaliana]
 gb|AED96725.1| KH domain-containing protein [Arabidopsis thaliana]
Length=315

 Score =   229 bits (585),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 125/169 (74%), Positives = 140/169 (83%), Gaps = 2/169 (1%)
 Frame = +3

Query  180  GALRSASSALVEQEKYLAELLAERSKLSPFMPVLPNCFRLLNQEILRVTTLLGNASVLDQ  359
            G LRS SS  VEQEKYL+ELLAER KL+PF+PVLP+ FRLLNQEILRVTTLL NA+VL Q
Sbjct  50   GGLRSQSSVFVEQEKYLSELLAERHKLTPFLPVLPHAFRLLNQEILRVTTLLENATVLSQ  109

Query  360  SGLEHGSPLASGGLFSNGGANKDRWSSPFQSEMSGLVqsssaqswlgsqssssGLIVKQT  539
            SGL+H SPLASGG+F N  A+ + W+S F SE S  V SS   +WL S  SSSGLI K+T
Sbjct  110  SGLDHPSPLASGGIFQNARADMNGWASQFPSERS--VPSSPGPNWLNSPGSSSGLIAKRT  167

Query  540  IRIDIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDCRVLIRGRGSIKDP  686
            IR+DIPV+ YPN+NFVGRLLGPRGNSLKRVE STDCRVLIRGRGSIKDP
Sbjct  168  IRVDIPVDNYPNFNFVGRLLGPRGNSLKRVEASTDCRVLIRGRGSIKDP  216



>ref|XP_008805546.1| PREDICTED: KH domain-containing protein At5g56140-like isoform 
X5 [Phoenix dactylifera]
Length=286

 Score =   228 bits (582),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 139/192 (72%), Positives = 159/192 (83%), Gaps = 9/192 (5%)
 Frame = +3

Query  117  MASSRFMAYspspsaphsp-hIGALRSASSALVEQEKYLAELLAERSKLSPFMPVLPNCF  293
            MAS  +MAYSPSPS      H+  +RSA++A+VEQEKYL+ELLAER K+SPFMPVLP+ +
Sbjct  1    MASGGYMAYSPSPSTAPHSPHLSGIRSATNAIVEQEKYLSELLAERHKMSPFMPVLPHSY  60

Query  294  RLLNQ-EILRVTTLLGNASVLDQSGLEHGSPLASGGLFSNGGA-NKDRWSSPFQSEMSGL  467
            RLLNQ EILRVTTLLGNAS+LDQSGLEHGSPL +GGLFSNGGA +   W+S F+SE S  
Sbjct  61   RLLNQAEILRVTTLLGNASLLDQSGLEHGSPLITGGLFSNGGAADMSGWASAFRSEPS--  118

Query  468  VqsssaqswlgsqssssGLIVKQTIRIDIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDC  647
                SA SWLGSQ SSS LIVK+ IRIDIP ++YP +NFVGRLLGPRGNSLKRVE ST+C
Sbjct  119  ----SAHSWLGSQGSSSNLIVKKMIRIDIPADKYPTFNFVGRLLGPRGNSLKRVEASTEC  174

Query  648  RVLIRGRGSIKD  683
            RVLIRGRGSIKD
Sbjct  175  RVLIRGRGSIKD  186



>gb|AFW63660.1| hypothetical protein ZEAMMB73_233372 [Zea mays]
Length=197

 Score =   224 bits (571),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 127/192 (66%), Positives = 153/192 (80%), Gaps = 7/192 (4%)
 Frame = +3

Query  117  MASSRFMAYspspsaphsp-hIGALRSASSALVEQEKYLAELLAERSKLSPFMPVLPNCF  293
            M+S R+MAYSPSPS       I  LR+ S+A+ EQEKYL+ELLAER KL+PF+PV+P+  
Sbjct  1    MSSGRYMAYSPSPSTTPHSPRIHGLRTPSAAVAEQEKYLSELLAERHKLTPFIPVIPHSV  60

Query  294  RLLNQEILRVTTLLGNASVLDQSGLEHGSPLASGGLFSNGGA-NKDRWSSPFQSEMSGLV  470
            RLLNQEI RV+TLL NAS+L+QSGLEHGSPL +GGL+SNG A + + W S FQSE S   
Sbjct  61   RLLNQEIFRVSTLLENASLLNQSGLEHGSPLTTGGLYSNGAATDMNGWPSAFQSESS---  117

Query  471  qsssaqswlgsqssssGLIVKQTIRIDIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDCR  650
               +     GSQ SSSGLIVK+T+++DIPV++YP YNFVGR+LGPRGNSLKRVE +TDCR
Sbjct  118  --PAYSWLGGSQGSSSGLIVKKTMKVDIPVDKYPTYNFVGRILGPRGNSLKRVEANTDCR  175

Query  651  VLIRGRGSIKDP  686
            VLIRGRGSIKDP
Sbjct  176  VLIRGRGSIKDP  187



>ref|XP_004953739.1| PREDICTED: KH domain-containing protein At5g56140-like [Setaria 
italica]
Length=286

 Score =   227 bits (578),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 129/192 (67%), Positives = 154/192 (80%), Gaps = 7/192 (4%)
 Frame = +3

Query  117  MASSRFMAYspspsaphsp-hIGALRSASSALVEQEKYLAELLAERSKLSPFMPVLPNCF  293
            M+S R+MAYSPSPS       I  LR+ S+A+ EQEKYLAELLAER KL PF+PV+P+  
Sbjct  1    MSSGRYMAYSPSPSTTPHSPRIAGLRAPSAAVAEQEKYLAELLAERHKLGPFIPVIPHSV  60

Query  294  RLLNQEILRVTTLLGNASVLDQSGLEHGSPLASGGLFSNGGA-NKDRWSSPFQSEMSGLV  470
            RLLNQEILRV+TLL NAS+L+QSGLEHGSPL +GGL+SNG A + + W+S FQSE S   
Sbjct  61   RLLNQEILRVSTLLENASLLNQSGLEHGSPLTTGGLYSNGAATDMNGWTSAFQSESS---  117

Query  471  qsssaqswlgsqssssGLIVKQTIRIDIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDCR  650
               +     GSQ SSSGLIVK+T+++DIPV++YP YNFVGR+LGPRGNSLKRVE +TDCR
Sbjct  118  --PAYSWLGGSQGSSSGLIVKKTMKVDIPVDKYPTYNFVGRILGPRGNSLKRVEANTDCR  175

Query  651  VLIRGRGSIKDP  686
            VLIRGRGSIKDP
Sbjct  176  VLIRGRGSIKDP  187



>ref|XP_006280843.1| hypothetical protein CARUB_v10026819mg [Capsella rubella]
 gb|EOA13741.1| hypothetical protein CARUB_v10026819mg [Capsella rubella]
Length=275

 Score =   225 bits (574),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 123/169 (73%), Positives = 138/169 (82%), Gaps = 2/169 (1%)
 Frame = +3

Query  180  GALRSASSALVEQEKYLAELLAERSKLSPFMPVLPNCFRLLNQEILRVTTLLGNASVLDQ  359
            G LRS  S  VEQEKYL+ELLAER KL PF+PVLP+ +RLLNQEILRVTTLL NA+VL Q
Sbjct  46   GGLRSQPSVFVEQEKYLSELLAERHKLIPFLPVLPHAYRLLNQEILRVTTLLENATVLSQ  105

Query  360  SGLEHGSPLASGGLFSNGGANKDRWSSPFQSEMSGLVqsssaqswlgsqssssGLIVKQT  539
            SGL+H SPLASGG+F N  A+ + W+S F SE S  V SS   +WL S  SSSGLI K+T
Sbjct  106  SGLDHHSPLASGGMFQNARADMNGWASQFPSERS--VPSSPGPNWLHSPDSSSGLIAKRT  163

Query  540  IRIDIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDCRVLIRGRGSIKDP  686
            IR+DIPV+ YPN+NFVGRLLGPRGNSLKRVE STDCRVLIRGRGSIKDP
Sbjct  164  IRVDIPVDSYPNFNFVGRLLGPRGNSLKRVEASTDCRVLIRGRGSIKDP  212



>ref|XP_006280844.1| hypothetical protein CARUB_v10026819mg [Capsella rubella]
 gb|EOA13742.1| hypothetical protein CARUB_v10026819mg [Capsella rubella]
Length=311

 Score =   226 bits (576),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 123/169 (73%), Positives = 138/169 (82%), Gaps = 2/169 (1%)
 Frame = +3

Query  180  GALRSASSALVEQEKYLAELLAERSKLSPFMPVLPNCFRLLNQEILRVTTLLGNASVLDQ  359
            G LRS  S  VEQEKYL+ELLAER KL PF+PVLP+ +RLLNQEILRVTTLL NA+VL Q
Sbjct  46   GGLRSQPSVFVEQEKYLSELLAERHKLIPFLPVLPHAYRLLNQEILRVTTLLENATVLSQ  105

Query  360  SGLEHGSPLASGGLFSNGGANKDRWSSPFQSEMSGLVqsssaqswlgsqssssGLIVKQT  539
            SGL+H SPLASGG+F N  A+ + W+S F SE S  V SS   +WL S  SSSGLI K+T
Sbjct  106  SGLDHHSPLASGGMFQNARADMNGWASQFPSERS--VPSSPGPNWLHSPDSSSGLIAKRT  163

Query  540  IRIDIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDCRVLIRGRGSIKDP  686
            IR+DIPV+ YPN+NFVGRLLGPRGNSLKRVE STDCRVLIRGRGSIKDP
Sbjct  164  IRVDIPVDSYPNFNFVGRLLGPRGNSLKRVEASTDCRVLIRGRGSIKDP  212



>ref|XP_009415554.1| PREDICTED: KH domain-containing protein At5g56140-like isoform 
X3 [Musa acuminata subsp. malaccensis]
Length=276

 Score =   225 bits (573),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 133/193 (69%), Positives = 154/193 (80%), Gaps = 17/193 (9%)
 Frame = +3

Query  117  MASSRFMAYspspsaphsp-hIGALRSASSALVEQEKYLAELLAERSKLSPFMPVLPNCF  293
            MAS RFMAYSPSPS      HI  +RSA+ A  EQEKYL+ELLAER KLSPF+PVLP+C+
Sbjct  1    MASGRFMAYSPSPSTAPHSPHIPGIRSATGAFAEQEKYLSELLAERQKLSPFVPVLPHCY  60

Query  294  RLLNQEILRVTTLLGNASVLDQSGLEHGSPLASGGLFSNGGANK-DRWSSPFQSEMSGLV  470
            RLLNQ               DQSGLE+GSP+ +GGLFSNGGAN  + W+SPFQSE  GLV
Sbjct  61   RLLNQ---------------DQSGLEYGSPMTTGGLFSNGGANDMNGWASPFQSERMGLV  105

Query  471  qsssaqswlgsqssssGLIVKQTIRIDIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDCR  650
            Q SSA SWLGS+ SSSGLIVK+TIR+DIP++++P +NFVGRLLGPRGNSLKRVE +TDCR
Sbjct  106  QPSSAHSWLGSEGSSSGLIVKKTIRVDIPIDKFPTFNFVGRLLGPRGNSLKRVEANTDCR  165

Query  651  VLIRGRGSIKDPT  689
            +LIRGRGSIKDPT
Sbjct  166  ILIRGRGSIKDPT  178



>ref|XP_010443253.1| PREDICTED: KH domain-containing protein At5g56140-like [Camelina 
sativa]
Length=310

 Score =   226 bits (575),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 123/169 (73%), Positives = 139/169 (82%), Gaps = 2/169 (1%)
 Frame = +3

Query  180  GALRSASSALVEQEKYLAELLAERSKLSPFMPVLPNCFRLLNQEILRVTTLLGNASVLDQ  359
            G LRS SS  VEQEKYL+ELLAER KL PF+PVLP+ +RLLNQEILRVTTLL NA+VL Q
Sbjct  45   GGLRSQSSVFVEQEKYLSELLAERHKLIPFLPVLPHAYRLLNQEILRVTTLLENATVLSQ  104

Query  360  SGLEHGSPLASGGLFSNGGANKDRWSSPFQSEMSGLVqsssaqswlgsqssssGLIVKQT  539
            SGL+H +PLASGG+F N  A+ + W+S F SE S  V SS   +WL S  SSSGLI K+T
Sbjct  105  SGLDHHNPLASGGIFQNARADLNGWASQFPSERS--VPSSPGPNWLHSPDSSSGLIAKRT  162

Query  540  IRIDIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDCRVLIRGRGSIKDP  686
            IR+DIPV+ YPN+NFVGRLLGPRGNSLKRVE STDCRVLIRGRGSIKDP
Sbjct  163  IRVDIPVDSYPNFNFVGRLLGPRGNSLKRVEASTDCRVLIRGRGSIKDP  211



>ref|XP_010483081.1| PREDICTED: KH domain-containing protein At5g56140-like [Camelina 
sativa]
Length=314

 Score =   226 bits (575),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 123/169 (73%), Positives = 139/169 (82%), Gaps = 2/169 (1%)
 Frame = +3

Query  180  GALRSASSALVEQEKYLAELLAERSKLSPFMPVLPNCFRLLNQEILRVTTLLGNASVLDQ  359
            G LRS SS  VEQEKYL+ELLAER KL PF+PVLP+ +RLLNQEILRVTTLL NA+VL Q
Sbjct  49   GGLRSQSSVFVEQEKYLSELLAERHKLIPFLPVLPHAYRLLNQEILRVTTLLENATVLSQ  108

Query  360  SGLEHGSPLASGGLFSNGGANKDRWSSPFQSEMSGLVqsssaqswlgsqssssGLIVKQT  539
            SGL+H +PLASGG+F N  A+ + W+S F SE S  V SS   +WL S  SSSGLI K+T
Sbjct  109  SGLDHHNPLASGGIFQNARADLNGWASQFPSERS--VPSSPGPNWLHSPDSSSGLIAKRT  166

Query  540  IRIDIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDCRVLIRGRGSIKDP  686
            IR+DIPV+ YPN+NFVGRLLGPRGNSLKRVE STDCRVLIRGRGSIKDP
Sbjct  167  IRVDIPVDSYPNFNFVGRLLGPRGNSLKRVEASTDCRVLIRGRGSIKDP  215



>ref|XP_010545297.1| PREDICTED: KH domain-containing protein At4g26480-like [Tarenaya 
hassleriana]
Length=314

 Score =   226 bits (575),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 123/169 (73%), Positives = 139/169 (82%), Gaps = 2/169 (1%)
 Frame = +3

Query  180  GALRSASSALVEQEKYLAELLAERSKLSPFMPVLPNCFRLLNQEILRVTTLLGNASVLDQ  359
            G LRS  SALVEQEKYL+ELLAER KL+PF+PVLP+ +RLL+QEILRVTTLL NASVL Q
Sbjct  50   GGLRSQPSALVEQEKYLSELLAERHKLNPFLPVLPHAYRLLSQEILRVTTLLENASVLSQ  109

Query  360  SGLEHGSPLASGGLFSNGGANKDRWSSPFQSEMSGLVqsssaqswlgsqssssGLIVKQT  539
            +G +H SPL SGG+F N  A+ + W+S FQ E S  V SS A +W  S  SSSGLIVKQ 
Sbjct  110  TGFDHPSPLVSGGIFQNARADVNGWTSQFQPERS--VSSSPAPNWRNSPGSSSGLIVKQA  167

Query  540  IRIDIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDCRVLIRGRGSIKDP  686
            IR+DIPV++YPNYNFVGRLLGPRGNSLKRVE ST CRVLIRGRGSIKDP
Sbjct  168  IRVDIPVDKYPNYNFVGRLLGPRGNSLKRVEASTGCRVLIRGRGSIKDP  216



>ref|XP_006647814.1| PREDICTED: KH domain-containing protein At5g56140-like [Oryza 
brachyantha]
Length=285

 Score =   225 bits (573),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 132/193 (68%), Positives = 155/193 (80%), Gaps = 8/193 (4%)
 Frame = +3

Query  117  MASSRFMAYspspsaphsp-hIGALRSASSALVEQEKYLAELLAERSKLSPFMPVLPNCF  293
            MAS R+MAYSPSPS       I  LR ASSA+ +QEKYL++LLAER KLSPF+PVLPN  
Sbjct  1    MASGRYMAYSPSPSTTPHSPRISGLR-ASSAVADQEKYLSDLLAERHKLSPFIPVLPNSV  59

Query  294  RLLNQEILRVTTLLGNASVLDQSGLEHGSPLASGGLFSNGGA-NKDRWSSPFQSEMSGLV  470
            RLLNQEILRV+TLL NAS+L+QSGLEHGSPL +GGL+SNG A + + W+S FQ E S   
Sbjct  60   RLLNQEILRVSTLLENASLLNQSGLEHGSPLTTGGLYSNGAATDMNGWTSAFQPESS---  116

Query  471  qsssaqswlgsqssssGLIVKQTIRIDIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDCR  650
               S     GSQ SSSGLIVK+T+++DIPV++YP +NFVGR+LGPRGNSLKRVE +TDCR
Sbjct  117  --PSYSWLGGSQGSSSGLIVKKTMKVDIPVDKYPTFNFVGRILGPRGNSLKRVEATTDCR  174

Query  651  VLIRGRGSIKDPT  689
            VLIRGRGSIKDPT
Sbjct  175  VLIRGRGSIKDPT  187



>ref|XP_010450699.1| PREDICTED: KH domain-containing protein At5g56140 [Camelina sativa]
Length=318

 Score =   226 bits (575),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 123/169 (73%), Positives = 139/169 (82%), Gaps = 2/169 (1%)
 Frame = +3

Query  180  GALRSASSALVEQEKYLAELLAERSKLSPFMPVLPNCFRLLNQEILRVTTLLGNASVLDQ  359
            G LRS SS  VEQEKYL+ELLAER KL PF+PVLP+ +RLLNQEILRVTTLL NA+VL Q
Sbjct  53   GGLRSQSSVFVEQEKYLSELLAERHKLIPFLPVLPHAYRLLNQEILRVTTLLENATVLSQ  112

Query  360  SGLEHGSPLASGGLFSNGGANKDRWSSPFQSEMSGLVqsssaqswlgsqssssGLIVKQT  539
            SGL+H +PLASGG+F N  A+ + W+S F SE S  V SS   +WL S  SSSGLI K+T
Sbjct  113  SGLDHHNPLASGGIFQNARADLNGWASQFPSERS--VPSSPGPNWLHSPDSSSGLIAKRT  170

Query  540  IRIDIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDCRVLIRGRGSIKDP  686
            IR+DIPV+ YPN+NFVGRLLGPRGNSLKRVE STDCRVLIRGRGSIKDP
Sbjct  171  IRVDIPVDSYPNFNFVGRLLGPRGNSLKRVEASTDCRVLIRGRGSIKDP  219



>ref|XP_006452751.1| hypothetical protein CICLE_v10009077mg [Citrus clementina]
 gb|ESR65991.1| hypothetical protein CICLE_v10009077mg [Citrus clementina]
Length=269

 Score =   224 bits (570),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 125/156 (80%), Positives = 143/156 (92%), Gaps = 0/156 (0%)
 Frame = +3

Query  222  KYLAELLAERSKLSPFMPVLPNCFRLLNQEILRVTTLLGNASVLDQSGLEHGSPLASGGL  401
            +YL+ELLAER KL+PF+PVLPN +RLLNQEI+RVTTLLGNASVL QSGLEH SPL SGG+
Sbjct  16   RYLSELLAERHKLNPFLPVLPNTYRLLNQEIMRVTTLLGNASVLGQSGLEHASPLTSGGI  75

Query  402  FSNGGANKDRWSSPFQSEMSGLVqsssaqswlgsqssssGLIVKQTIRIDIPVEQYPNYN  581
            FSNGGA+ +  +S FQSE+SGL+QSSSAQ+WL SQ SSSGLIVK+TIR+DIPVE+YPN+N
Sbjct  76   FSNGGADVNGLASRFQSEISGLMQSSSAQNWLSSQGSSSGLIVKRTIRVDIPVEKYPNFN  135

Query  582  FVGRLLGPRGNSLKRVEVSTDCRVLIRGRGSIKDPT  689
            FVGRLLGPRGNSLKRVE ST+CRVLIRGRGSIKDP 
Sbjct  136  FVGRLLGPRGNSLKRVEASTECRVLIRGRGSIKDPA  171



>dbj|BAJ88160.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=287

 Score =   224 bits (570),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 124/192 (65%), Positives = 148/192 (77%), Gaps = 6/192 (3%)
 Frame = +3

Query  117  MASSRFMAYspspsaphsp-hIGALRSASSALVEQEKYLAELLAERSKLSPFMPVLPNCF  293
            M+S R+MAYSPSPS       I  LR++S+A+ +QEKYLAELLAER KL+PF+PVLP+  
Sbjct  1    MSSGRYMAYSPSPSTTPHSPRISGLRASSAAVADQEKYLAELLAERHKLNPFVPVLPHSI  60

Query  294  RLLNQEILRVTTLLGNASVLDQSGLEHGSPLASGGLFSNGGA-NKDRWSSPFQSEMSGLV  470
            RLLNQEILRV+TLL NAS+L+QSG EHGSPL SGGL+SNG A + + W+S FQSE S   
Sbjct  61   RLLNQEILRVSTLLENASLLNQSGFEHGSPLTSGGLYSNGAATDMNGWTSAFQSESSSAA  120

Query  471  qsssaqswlgsqssssGLIVKQTIRIDIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDCR  650
             S    S   S       I K+T+R+DIPV++YP YNFVGR+LGPRGNSLKRVE +TDCR
Sbjct  121  YSWLGGSQGSSSGL----IGKKTMRVDIPVDKYPTYNFVGRILGPRGNSLKRVEATTDCR  176

Query  651  VLIRGRGSIKDP  686
            VLIRGRGSIKDP
Sbjct  177  VLIRGRGSIKDP  188



>gb|ACG35732.1| nucleic acid binding protein [Zea mays]
Length=286

 Score =   224 bits (570),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 127/192 (66%), Positives = 153/192 (80%), Gaps = 7/192 (4%)
 Frame = +3

Query  117  MASSRFMAYspspsaphsp-hIGALRSASSALVEQEKYLAELLAERSKLSPFMPVLPNCF  293
            M+S R+MAYSPSPS       I  LR+ S+A+ EQEKYLAELLAER KL PF+PV+P+  
Sbjct  1    MSSGRYMAYSPSPSTTPHSPRIAGLRAPSAAMAEQEKYLAELLAERQKLGPFVPVIPHSV  60

Query  294  RLLNQEILRVTTLLGNASVLDQSGLEHGSPLASGGLFSNGGA-NKDRWSSPFQSEMSGLV  470
            RLLNQEILRV+TLL NAS+L+QSGLEHGSPL +GGL+SNG A + + W+S FQ E S   
Sbjct  61   RLLNQEILRVSTLLENASLLNQSGLEHGSPLTTGGLYSNGAATDMNVWTSAFQPESS---  117

Query  471  qsssaqswlgsqssssGLIVKQTIRIDIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDCR  650
               +     GSQ SSSGLIVK+T+++DIPV++YP +NFVGR+LGPRGNSLKRVE +TDCR
Sbjct  118  --PAYSWLGGSQGSSSGLIVKKTMKVDIPVDKYPTFNFVGRILGPRGNSLKRVEANTDCR  175

Query  651  VLIRGRGSIKDP  686
            VLIRGRGSIKDP
Sbjct  176  VLIRGRGSIKDP  187



>ref|NP_001141163.1| uncharacterized protein LOC100273249 [Zea mays]
 gb|ACF85597.1| unknown [Zea mays]
 gb|AFW73198.1| nucleic acid binding protein [Zea mays]
Length=286

 Score =   223 bits (569),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 127/192 (66%), Positives = 153/192 (80%), Gaps = 7/192 (4%)
 Frame = +3

Query  117  MASSRFMAYspspsaphsp-hIGALRSASSALVEQEKYLAELLAERSKLSPFMPVLPNCF  293
            M+S R+MAYSPSPS       I  LR+ S+A+ EQEKYLAELLAER KL PF+PV+P+  
Sbjct  1    MSSGRYMAYSPSPSTTPHSPRIAGLRAPSAAVAEQEKYLAELLAERQKLGPFVPVIPHSV  60

Query  294  RLLNQEILRVTTLLGNASVLDQSGLEHGSPLASGGLFSNGGA-NKDRWSSPFQSEMSGLV  470
            RLLNQEILRV+TLL NAS+L+QSGLEHGSPL +GGL+SNG A + + W+S FQ E S   
Sbjct  61   RLLNQEILRVSTLLENASLLNQSGLEHGSPLTTGGLYSNGAATDMNVWTSAFQPESS---  117

Query  471  qsssaqswlgsqssssGLIVKQTIRIDIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDCR  650
               +     GSQ SSSGLIVK+T+++DIPV++YP +NFVGR+LGPRGNSLKRVE +TDCR
Sbjct  118  --PAYSWLGGSQGSSSGLIVKKTMKVDIPVDKYPTFNFVGRILGPRGNSLKRVEANTDCR  175

Query  651  VLIRGRGSIKDP  686
            VLIRGRGSIKDP
Sbjct  176  VLIRGRGSIKDP  187



>gb|ACN35020.1| unknown [Zea mays]
 gb|AFW63661.1| hypothetical protein ZEAMMB73_233372 [Zea mays]
Length=286

 Score =   223 bits (569),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 127/192 (66%), Positives = 153/192 (80%), Gaps = 7/192 (4%)
 Frame = +3

Query  117  MASSRFMAYspspsaphsp-hIGALRSASSALVEQEKYLAELLAERSKLSPFMPVLPNCF  293
            M+S R+MAYSPSPS       I  LR+ S+A+ EQEKYL+ELLAER KL+PF+PV+P+  
Sbjct  1    MSSGRYMAYSPSPSTTPHSPRIHGLRTPSAAVAEQEKYLSELLAERHKLTPFIPVIPHSV  60

Query  294  RLLNQEILRVTTLLGNASVLDQSGLEHGSPLASGGLFSNGGA-NKDRWSSPFQSEMSGLV  470
            RLLNQEI RV+TLL NAS+L+QSGLEHGSPL +GGL+SNG A + + W S FQSE S   
Sbjct  61   RLLNQEIFRVSTLLENASLLNQSGLEHGSPLTTGGLYSNGAATDMNGWPSAFQSESS---  117

Query  471  qsssaqswlgsqssssGLIVKQTIRIDIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDCR  650
               +     GSQ SSSGLIVK+T+++DIPV++YP YNFVGR+LGPRGNSLKRVE +TDCR
Sbjct  118  --PAYSWLGGSQGSSSGLIVKKTMKVDIPVDKYPTYNFVGRILGPRGNSLKRVEANTDCR  175

Query  651  VLIRGRGSIKDP  686
            VLIRGRGSIKDP
Sbjct  176  VLIRGRGSIKDP  187



>gb|AAL87326.1| putative RNA-binding protein [Arabidopsis thaliana]
Length=260

 Score =   222 bits (566),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 121/163 (74%), Positives = 136/163 (83%), Gaps = 2/163 (1%)
 Frame = +3

Query  198  SSALVEQEKYLAELLAERSKLSPFMPVLPNCFRLLNQEILRVTTLLGNASVLDQSGLEHG  377
            SS  VEQEKYL+ELLAER KL+PF+PVLP+ FRLLNQEILRVTTLL NA+VL QSGL+H 
Sbjct  1    SSVFVEQEKYLSELLAERHKLTPFLPVLPHAFRLLNQEILRVTTLLENATVLSQSGLDHP  60

Query  378  SPLASGGLFSNGGANKDRWSSPFQSEMSGLVqsssaqswlgsqssssGLIVKQTIRIDIP  557
            SPLASGG+F N  A+ + W+S F SE S  V SS   +WL S  SSSGLI K+TIR+DIP
Sbjct  61   SPLASGGIFQNARADMNGWASQFPSERS--VPSSPGPNWLNSPGSSSGLIAKRTIRVDIP  118

Query  558  VEQYPNYNFVGRLLGPRGNSLKRVEVSTDCRVLIRGRGSIKDP  686
            V+ YPN+NFVGRLLGPRGNSLKRVE STDCRVLIRGRGSIKDP
Sbjct  119  VDNYPNFNFVGRLLGPRGNSLKRVEASTDCRVLIRGRGSIKDP  161



>ref|XP_006401374.1| hypothetical protein EUTSA_v10014150mg [Eutrema salsugineum]
 gb|ESQ42827.1| hypothetical protein EUTSA_v10014150mg [Eutrema salsugineum]
Length=314

 Score =   221 bits (564),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 121/169 (72%), Positives = 136/169 (80%), Gaps = 2/169 (1%)
 Frame = +3

Query  180  GALRSASSALVEQEKYLAELLAERSKLSPFMPVLPNCFRLLNQEILRVTTLLGNASVLDQ  359
            G LRS SS  VEQEKYL+ELLAER  L+PF+PVLP+  RLLNQEILRVTTLL NA+VL Q
Sbjct  49   GVLRSQSSVFVEQEKYLSELLAERHNLTPFLPVLPHACRLLNQEILRVTTLLENATVLSQ  108

Query  360  SGLEHGSPLASGGLFSNGGANKDRWSSPFQSEMSGLVqsssaqswlgsqssssGLIVKQT  539
            SGL+H SPL+SGG++ N  A+   W+S F SE S  V SS   +WL S  S SGLI K+T
Sbjct  109  SGLDHPSPLSSGGIYQNARADLSGWASQFPSERS--VPSSPGPNWLNSPGSPSGLIAKRT  166

Query  540  IRIDIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDCRVLIRGRGSIKDP  686
            IR+DIPV+ YPNYNFVGRLLGPRGNSLKRVE STDCRVLIRGRGSIKDP
Sbjct  167  IRVDIPVDNYPNYNFVGRLLGPRGNSLKRVEASTDCRVLIRGRGSIKDP  215



>ref|XP_006452752.1| hypothetical protein CICLE_v10009077mg [Citrus clementina]
 gb|ESR65992.1| hypothetical protein CICLE_v10009077mg [Citrus clementina]
Length=279

 Score =   219 bits (559),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 142/194 (73%), Positives = 163/194 (84%), Gaps = 16/194 (8%)
 Frame = +3

Query  117  MASS---RFMAYspspsaphsphIGALRSASSALVEQEKYLAELLAERSKLSPFMPVLPN  287
            MASS   RFMAYS SPSAPHSPH+ +LRSASSA+++QEKYL+ELLAER KL+PF+PVLPN
Sbjct  1    MASSGGGRFMAYSLSPSAPHSPHLPSLRSASSAILDQEKYLSELLAERHKLNPFLPVLPN  60

Query  288  CFRLLNQEILRVTTLLGNASVLDQSGLEHGSPLASGGLFSNGGANKDRWSSPFQSEMSGL  467
             +RLLNQ             VL QSGLEH SPL SGG+FSNGGA+ +  +S FQSE+SGL
Sbjct  61   TYRLLNQ-------------VLGQSGLEHASPLTSGGIFSNGGADVNGLASRFQSEISGL  107

Query  468  VqsssaqswlgsqssssGLIVKQTIRIDIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDC  647
            +QSSSAQ+WL SQ SSSGLIVK+TIR+DIPVE+YPN+NFVGRLLGPRGNSLKRVE ST+C
Sbjct  108  MQSSSAQNWLSSQGSSSGLIVKRTIRVDIPVEKYPNFNFVGRLLGPRGNSLKRVEASTEC  167

Query  648  RVLIRGRGSIKDPT  689
            RVLIRGRGSIKDP 
Sbjct  168  RVLIRGRGSIKDPA  181



>ref|XP_010942514.1| PREDICTED: KH domain-containing protein At5g56140-like isoform 
X3 [Elaeis guineensis]
Length=276

 Score =   218 bits (556),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 128/192 (67%), Positives = 148/192 (77%), Gaps = 17/192 (9%)
 Frame = +3

Query  117  MASSRFMAYspspsaphsp-hIGALRSASSALVEQEKYLAELLAERSKLSPFMPVLPNCF  293
            MA+ R+MAY PSPS      HI  +RS +SA VEQ+KYLAELLAER KL PFMPVLP+C+
Sbjct  1    MATGRYMAYPPSPSTAPQSPHITGMRSITSAFVEQQKYLAELLAERQKLGPFMPVLPHCY  60

Query  294  RLLNQEILRVTTLLGNASVLDQSGLEHGSPLASGGLFSNGGA-NKDRWSSPFQSEMSGLV  470
             LLNQ               DQ+GLEHGSPL +GGLFSNGGA + + W+SPFQ E  GL+
Sbjct  61   WLLNQ---------------DQTGLEHGSPLTTGGLFSNGGAADMNGWASPFQPERLGLL  105

Query  471  qsssaqswlgsqssssGLIVKQTIRIDIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDCR  650
            Q SSA  WLG Q S SGLIVK+T+R+DIPV++YPNYNFVGRLLGPRGNSLKR+E ST+CR
Sbjct  106  QPSSAHGWLGQQGSCSGLIVKKTLRVDIPVDKYPNYNFVGRLLGPRGNSLKRMEASTECR  165

Query  651  VLIRGRGSIKDP  686
            VLIRGRGSIKDP
Sbjct  166  VLIRGRGSIKDP  177



>ref|XP_010942515.1| PREDICTED: KH domain-containing protein At5g56140-like isoform 
X4 [Elaeis guineensis]
Length=274

 Score =   218 bits (555),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 128/192 (67%), Positives = 148/192 (77%), Gaps = 17/192 (9%)
 Frame = +3

Query  117  MASSRFMAYspspsaphsp-hIGALRSASSALVEQEKYLAELLAERSKLSPFMPVLPNCF  293
            MA+ R+MAY PSPS      HI  +RS +SA VEQ+KYLAELLAER KL PFMPVLP+C+
Sbjct  1    MATGRYMAYPPSPSTAPQSPHITGMRSITSAFVEQQKYLAELLAERQKLGPFMPVLPHCY  60

Query  294  RLLNQEILRVTTLLGNASVLDQSGLEHGSPLASGGLFSNGGA-NKDRWSSPFQSEMSGLV  470
             LLNQ               DQ+GLEHGSPL +GGLFSNGGA + + W+SPFQ E  GL+
Sbjct  61   WLLNQ---------------DQTGLEHGSPLTTGGLFSNGGAADMNGWASPFQPERLGLL  105

Query  471  qsssaqswlgsqssssGLIVKQTIRIDIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDCR  650
            Q SSA  WLG Q S SGLIVK+T+R+DIPV++YPNYNFVGRLLGPRGNSLKR+E ST+CR
Sbjct  106  QPSSAHGWLGQQGSCSGLIVKKTLRVDIPVDKYPNYNFVGRLLGPRGNSLKRMEASTECR  165

Query  651  VLIRGRGSIKDP  686
            VLIRGRGSIKDP
Sbjct  166  VLIRGRGSIKDP  177



>ref|XP_003570477.1| PREDICTED: KH domain-containing protein At5g56140-like [Brachypodium 
distachyon]
Length=283

 Score =   218 bits (554),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 109/172 (63%), Positives = 134/172 (78%), Gaps = 6/172 (3%)
 Frame = +3

Query  177  IGALRSASSALVEQEKYLAELLAERSKLSPFMPVLPNCFRLLNQEILRVTTLLGNASVLD  356
            I  LR++S+A+ +QEKYL+ELLAER KL+PF+PVLP+  RLLNQEILRV++LL NAS+L+
Sbjct  19   ISGLRASSAAVADQEKYLSELLAERHKLNPFVPVLPHSIRLLNQEILRVSSLLENASLLN  78

Query  357  QSGLEHGSPLASGGLFSNGGA-NKDRWSSPFQSEMSGLVqsssaqswlgsqssssGLIVK  533
            QSG EHGSPL SGGL+SNG A + + W+S FQSE S             S       +VK
Sbjct  79   QSGFEHGSPLTSGGLYSNGAATDMNGWTSAFQSESSSAYSWLGGSQGSSSGP-----VVK  133

Query  534  QTIRIDIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDCRVLIRGRGSIKDPT  689
            +T+R+DIPV++YP YNFVGR+LGPRGNSLKRVE +TDCRVLIRGRGSIKDP 
Sbjct  134  KTLRVDIPVDKYPTYNFVGRILGPRGNSLKRVEATTDCRVLIRGRGSIKDPA  185



>gb|ADE77960.1| unknown [Picea sitchensis]
Length=286

 Score =   216 bits (550),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 114/189 (60%), Positives = 143/189 (76%), Gaps = 3/189 (2%)
 Frame = +3

Query  123  SSRFMAYspspsaphsphIGALRSASSALVEQEKYLAELLAERSKLSPFMPVLPNCFRLL  302
            S+R+M +SPS +      +  +RS S A+ E +KYL ELLAER KLSPFM VLP C RLL
Sbjct  2    SARYMNFSPSATHSPQ--LPGMRSVSIAMAEHDKYLTELLAERQKLSPFMQVLPQCCRLL  59

Query  303  NQEILRVTTLLGNASVLDQSGLEHGSPLASGGLFSNGGANKDRWSSPFQSEMSGLVqsss  482
            NQEI+RVT LLGN+S LD +G EHGSPL  GGL SNGG + + W++ F SE   +VQ+S 
Sbjct  60   NQEIVRVTALLGNSSFLDHNGPEHGSPLTHGGLLSNGGVDMNGWAA-FHSERMSMVQASP  118

Query  483  aqswlgsqssssGLIVKQTIRIDIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDCRVLIR  662
                      SSG+IVK+T+R+++PV++YPN+NFVGRLLGPRGNSLKRVE +T+CRVLIR
Sbjct  119  HGWHGAPGGGSSGIIVKKTMRVEVPVDKYPNFNFVGRLLGPRGNSLKRVEAATECRVLIR  178

Query  663  GRGSIKDPT  689
            GRGSIKDP+
Sbjct  179  GRGSIKDPS  187



>gb|KFK27184.1| hypothetical protein AALP_AA8G346800 [Arabis alpina]
Length=320

 Score =   217 bits (552),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 123/179 (69%), Positives = 139/179 (78%), Gaps = 10/179 (6%)
 Frame = +3

Query  180  GALRSASSALVEQEKYLAELLAERSKLSPFMPVLPNCFRLLNQEILRVTTLLGNASVLDQ  359
            G LRS SS  VEQEKYL+ELLAER KL+PF+PVLP+  RLL QEILRVTTLL NA+VL Q
Sbjct  43   GGLRSQSSIFVEQEKYLSELLAERHKLTPFVPVLPHACRLLEQEILRVTTLLENATVLSQ  102

Query  360  SGLEHGSPLASGGLFSNGGANKDRWSSPFQSEMS----------GLVqsssaqswlgsqs  509
            SGL+H SPL+SGG+F N  A+ + W S F SE +              SSS  +WL S S
Sbjct  103  SGLDHPSPLSSGGMFQNARADLNGWPSQFPSERTVPSSPGPNWLNSPGSSSGPNWLNSPS  162

Query  510  sssGLIVKQTIRIDIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDCRVLIRGRGSIKDP  686
            +SSGLI KQTIR+DIPV++YPNYNFVGRLLGPRGNSLKRVE STDCRVLIRGRGSIKDP
Sbjct  163  TSSGLIAKQTIRVDIPVDKYPNYNFVGRLLGPRGNSLKRVEASTDCRVLIRGRGSIKDP  221



>gb|AAM14070.1| unknown protein [Arabidopsis thaliana]
Length=308

 Score =   216 bits (551),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 123/169 (73%), Positives = 138/169 (82%), Gaps = 4/169 (2%)
 Frame = +3

Query  180  GALRSASSALVEQEKYLAELLAERSKLSPFMPVLPNCFRLLNQEILRVTTLLGNASVLDQ  359
            G LRS  S LVEQEKYL+ELLAER KL+PF+PVLP+  RL+NQEILRVTTLL NA  L Q
Sbjct  46   GGLRSQPSFLVEQEKYLSELLAERHKLTPFLPVLPHVCRLMNQEILRVTTLLENA--LSQ  103

Query  360  SGLEHGSPLASGGLFSNGGANKDRWSSPFQSEMSGLVqsssaqswlgsqssssGLIVKQT  539
            S  +H SPLASGG+F N  A+ + W+S F SE S  V SS A +WL S  SSSGLIVK+T
Sbjct  104  SRFDHPSPLASGGIFQNSRADMNGWASQFPSERS--VSSSPAPNWLNSPGSSSGLIVKRT  161

Query  540  IRIDIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDCRVLIRGRGSIKDP  686
            IR+DIPV++YPNYNFVGRLLGPRGNSLKRVE STDCRVLIRGRGSIKDP
Sbjct  162  IRVDIPVDKYPNYNFVGRLLGPRGNSLKRVEASTDCRVLIRGRGSIKDP  210



>ref|NP_194378.2| RNA-binding KH domain-containing protein [Arabidopsis thaliana]
 sp|Q0WLR1.1|QKIL1_ARATH RecName: Full=KH domain-containing protein At4g26480; AltName: 
Full=Quaking-like protein 1 [Arabidopsis thaliana]
 dbj|BAF01946.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE85206.1| RNA-binding KH domain-containing protein [Arabidopsis thaliana]
Length=308

 Score =   216 bits (551),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 123/169 (73%), Positives = 138/169 (82%), Gaps = 4/169 (2%)
 Frame = +3

Query  180  GALRSASSALVEQEKYLAELLAERSKLSPFMPVLPNCFRLLNQEILRVTTLLGNASVLDQ  359
            G LRS  S LVEQEKYL+ELLAER KL+PF+PVLP+  RL+NQEILRVTTLL NA  L Q
Sbjct  46   GGLRSQPSFLVEQEKYLSELLAERHKLTPFLPVLPHVCRLMNQEILRVTTLLENA--LSQ  103

Query  360  SGLEHGSPLASGGLFSNGGANKDRWSSPFQSEMSGLVqsssaqswlgsqssssGLIVKQT  539
            S  +H SPLASGG+F N  A+ + W+S F SE S  V SS A +WL S  SSSGLIVK+T
Sbjct  104  SRFDHPSPLASGGIFQNSRADMNGWASQFPSERS--VSSSPAPNWLNSPGSSSGLIVKRT  161

Query  540  IRIDIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDCRVLIRGRGSIKDP  686
            IR+DIPV++YPNYNFVGRLLGPRGNSLKRVE STDCRVLIRGRGSIKDP
Sbjct  162  IRVDIPVDKYPNYNFVGRLLGPRGNSLKRVEASTDCRVLIRGRGSIKDP  210



>ref|XP_006284180.1| hypothetical protein CARUB_v10005327mg [Capsella rubella]
 gb|EOA17078.1| hypothetical protein CARUB_v10005327mg [Capsella rubella]
Length=306

 Score =   215 bits (548),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 123/169 (73%), Positives = 137/169 (81%), Gaps = 4/169 (2%)
 Frame = +3

Query  180  GALRSASSALVEQEKYLAELLAERSKLSPFMPVLPNCFRLLNQEILRVTTLLGNASVLDQ  359
            G LRS  S LVEQEKYL+ELLAER KL+PF+PVLP+  RL+NQEILRVTTLL NA  L Q
Sbjct  44   GGLRSQPSFLVEQEKYLSELLAERHKLTPFLPVLPHLCRLMNQEILRVTTLLENA--LSQ  101

Query  360  SGLEHGSPLASGGLFSNGGANKDRWSSPFQSEMSGLVqsssaqswlgsqssssGLIVKQT  539
            S  +H SPLASGG+F N  A+ + W S F SE S  V SS A +WL S  SSSGLIVK+T
Sbjct  102  SRFDHPSPLASGGIFQNARADMNGWPSQFPSERS--VSSSPAPNWLNSPGSSSGLIVKRT  159

Query  540  IRIDIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDCRVLIRGRGSIKDP  686
            IR+DIPV++YPNYNFVGRLLGPRGNSLKRVE STDCRVLIRGRGSIKDP
Sbjct  160  IRVDIPVDKYPNYNFVGRLLGPRGNSLKRVEASTDCRVLIRGRGSIKDP  208



>ref|XP_010448266.1| PREDICTED: KH domain-containing protein At4g26480 [Camelina sativa]
Length=307

 Score =   215 bits (548),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 123/169 (73%), Positives = 137/169 (81%), Gaps = 4/169 (2%)
 Frame = +3

Query  180  GALRSASSALVEQEKYLAELLAERSKLSPFMPVLPNCFRLLNQEILRVTTLLGNASVLDQ  359
            G LRS  S LVEQEKYL+ELLAER KL+PF+PVLP+  RL+NQEILRVTTLL NA  L Q
Sbjct  45   GGLRSQPSFLVEQEKYLSELLAERHKLTPFLPVLPHLCRLMNQEILRVTTLLENA--LSQ  102

Query  360  SGLEHGSPLASGGLFSNGGANKDRWSSPFQSEMSGLVqsssaqswlgsqssssGLIVKQT  539
            S  +H SPLASGG+F N  A+ + W S F SE S  V SS A +WL S  SSSGLIVK+T
Sbjct  103  SRFDHPSPLASGGIFQNARADMNGWPSQFPSERS--VSSSPAPNWLNSPGSSSGLIVKRT  160

Query  540  IRIDIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDCRVLIRGRGSIKDP  686
            IR+DIPV++YPNYNFVGRLLGPRGNSLKRVE STDCRVLIRGRGSIKDP
Sbjct  161  IRVDIPVDKYPNYNFVGRLLGPRGNSLKRVEASTDCRVLIRGRGSIKDP  209



>ref|XP_010433498.1| PREDICTED: KH domain-containing protein At4g26480-like [Camelina 
sativa]
Length=308

 Score =   215 bits (548),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 123/169 (73%), Positives = 137/169 (81%), Gaps = 4/169 (2%)
 Frame = +3

Query  180  GALRSASSALVEQEKYLAELLAERSKLSPFMPVLPNCFRLLNQEILRVTTLLGNASVLDQ  359
            G LRS  S LVEQEKYL+ELLAER KL+PF+PVLP+  RL+NQEILRVTTLL NA  L Q
Sbjct  46   GGLRSQPSFLVEQEKYLSELLAERHKLTPFLPVLPHLCRLMNQEILRVTTLLENA--LSQ  103

Query  360  SGLEHGSPLASGGLFSNGGANKDRWSSPFQSEMSGLVqsssaqswlgsqssssGLIVKQT  539
            S  +H SPLASGG+F N  A+ + W S F SE S  V SS A +WL S  SSSGLIVK+T
Sbjct  104  SRFDHPSPLASGGIFQNARADMNGWPSQFPSERS--VSSSPAPNWLNSPGSSSGLIVKRT  161

Query  540  IRIDIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDCRVLIRGRGSIKDP  686
            IR+DIPV++YPNYNFVGRLLGPRGNSLKRVE STDCRVLIRGRGSIKDP
Sbjct  162  IRVDIPVDKYPNYNFVGRLLGPRGNSLKRVEASTDCRVLIRGRGSIKDP  210



>emb|CDX94326.1| BnaC01g18580D [Brassica napus]
Length=312

 Score =   214 bits (545),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 121/170 (71%), Positives = 137/170 (81%), Gaps = 4/170 (2%)
 Frame = +3

Query  180  GALRSASSALVEQEKYLAELLAERSKLSPFMPVLPNCFRLLNQEILRVTTLLGNASVLDQ  359
            G +RS  S LVEQEKYL+ELLAER KL+PF+PVLP+  RL+NQEILRVTTLL NA  + Q
Sbjct  50   GGIRSQPSFLVEQEKYLSELLAERHKLTPFLPVLPHVCRLMNQEILRVTTLLENA--ISQ  107

Query  360  SGLEHGSPLASGGLFSNGGANKDRWSSPFQSEMSGLVqsssaqswlgsqssssGLIVKQT  539
            S  +H SPL+SGG+F N  A+ + W S F SE S  V SS A +WL S  SSSGLIVK+T
Sbjct  108  SRFDHPSPLSSGGIFQNSRADMNGWPSQFPSERS--VSSSPAPNWLNSPGSSSGLIVKRT  165

Query  540  IRIDIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDCRVLIRGRGSIKDPT  689
            IR+DIPV+QYPNYNFVGRLLGPRGNSLKRVE STDCRVLIRGRGSIKDP 
Sbjct  166  IRVDIPVDQYPNYNFVGRLLGPRGNSLKRVEASTDCRVLIRGRGSIKDPV  215



>ref|XP_009399829.1| PREDICTED: KH domain-containing protein At5g56140-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=276

 Score =   213 bits (541),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 130/193 (67%), Positives = 146/193 (76%), Gaps = 17/193 (9%)
 Frame = +3

Query  117  MASSRFMAYspspsaphsp-hIGALRSASSALVEQEKYLAELLAERSKLSPFMPVLPNCF  293
            MAS R+MAYSPSPS      HI  +RSASSALVEQEKYLAELL ER KLSPFM VLP+ +
Sbjct  1    MASGRYMAYSPSPSTAPQSPHISGMRSASSALVEQEKYLAELLTERQKLSPFMLVLPHSY  60

Query  294  RLLNQEILRVTTLLGNASVLDQSGLEHGSPLASGGLFSNGGA-NKDRWSSPFQSEMSGLV  470
            RLLNQ               DQ+GLEHGSPL SGGLF NG   + + W+S FQSE  G++
Sbjct  61   RLLNQ---------------DQTGLEHGSPLISGGLFPNGSTTDMNGWASAFQSERLGIL  105

Query  471  qsssaqswlgsqssssGLIVKQTIRIDIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDCR  650
            Q SS   W+G Q SSSGL+VK+TIR+DIPV+QYPNYNFVGRLLGPRGNSLKRVE +T CR
Sbjct  106  QPSSGNGWVGPQGSSSGLVVKRTIRVDIPVDQYPNYNFVGRLLGPRGNSLKRVEANTGCR  165

Query  651  VLIRGRGSIKDPT  689
            VLIRGRGSIKDP 
Sbjct  166  VLIRGRGSIKDPA  178



>ref|XP_006413178.1| hypothetical protein EUTSA_v10025796mg [Eutrema salsugineum]
 gb|ESQ54631.1| hypothetical protein EUTSA_v10025796mg [Eutrema salsugineum]
Length=309

 Score =   213 bits (542),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 121/169 (72%), Positives = 136/169 (80%), Gaps = 4/169 (2%)
 Frame = +3

Query  180  GALRSASSALVEQEKYLAELLAERSKLSPFMPVLPNCFRLLNQEILRVTTLLGNASVLDQ  359
            G LRS  S LVEQEKYL+ELLAER KL+PF+PVLP+  RL+NQEILRVTTLL NA  + Q
Sbjct  47   GGLRSQPSFLVEQEKYLSELLAERHKLTPFLPVLPHVCRLMNQEILRVTTLLENA--ISQ  104

Query  360  SGLEHGSPLASGGLFSNGGANKDRWSSPFQSEMSGLVqsssaqswlgsqssssGLIVKQT  539
            S  +H SPL SGG+F N  A+ + W S F SE S  V SS A +WL S  SSSGLIVK+T
Sbjct  105  SRFDHPSPLGSGGIFQNARADMNGWPSQFPSERS--VSSSPAPNWLNSPGSSSGLIVKRT  162

Query  540  IRIDIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDCRVLIRGRGSIKDP  686
            IR+DIPV++YPNYNFVGRLLGPRGNSLKRVE STDCRVLIRGRGSIKDP
Sbjct  163  IRVDIPVDKYPNYNFVGRLLGPRGNSLKRVEASTDCRVLIRGRGSIKDP  211



>ref|XP_008794733.1| PREDICTED: KH domain-containing protein At5g56140-like isoform 
X2 [Phoenix dactylifera]
Length=273

 Score =   211 bits (538),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 125/192 (65%), Positives = 146/192 (76%), Gaps = 17/192 (9%)
 Frame = +3

Query  117  MASSRFMAYspspsaphsphIGALRSASSALVEQEKYLAELLAERSKLSPFMPVLPNCFR  296
            MAS R+MA SPS +       G +RS +SA VEQ++YLAELLAER KL PFM VLP+C+ 
Sbjct  1    MASGRYMACSPSTAPHSPHITG-MRSITSAFVEQQRYLAELLAERQKLVPFMAVLPHCYW  59

Query  297  LLNQEILRVTTLLGNASVLDQSGLEHGSPLASGGLFSNGGA-NKDRWSSPFQSEMSGLVq  473
            LLNQ               DQ+GLEHGSPL +GGLFSNGGA + + W+SPFQ E  GL+Q
Sbjct  60   LLNQ---------------DQTGLEHGSPLTTGGLFSNGGAADMNGWASPFQPERLGLLQ  104

Query  474  sssaqswlgsqssssGLIVKQTIRIDIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDCRV  653
             SSA  WLG Q SSSGLIVK+TIR+DIP+++YPNYNFVGRLLGPRGNSLKR+E ST+CRV
Sbjct  105  PSSAHGWLGQQGSSSGLIVKKTIRVDIPMDKYPNYNFVGRLLGPRGNSLKRMEASTECRV  164

Query  654  LIRGRGSIKDPT  689
            LIRGRGSIKDP 
Sbjct  165  LIRGRGSIKDPA  176



>ref|XP_010438749.1| PREDICTED: KH domain-containing protein At4g26480-like [Camelina 
sativa]
Length=308

 Score =   211 bits (538),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 120/169 (71%), Positives = 137/169 (81%), Gaps = 4/169 (2%)
 Frame = +3

Query  180  GALRSASSALVEQEKYLAELLAERSKLSPFMPVLPNCFRLLNQEILRVTTLLGNASVLDQ  359
            G LRS  S +VEQEKYL+ELLAER KL+PF+P+LP+  RL++QEILRVTTLL NA  L Q
Sbjct  46   GGLRSQPSFIVEQEKYLSELLAERHKLTPFLPMLPHLCRLMSQEILRVTTLLENA--LSQ  103

Query  360  SGLEHGSPLASGGLFSNGGANKDRWSSPFQSEMSGLVqsssaqswlgsqssssGLIVKQT  539
            S  +H SPLASGG+F N  A+ + W S F SE S  V SS A +WL S  SSSGLIVK+T
Sbjct  104  SRFDHPSPLASGGIFQNARADMNGWPSQFPSERS--VSSSPAPNWLNSPGSSSGLIVKRT  161

Query  540  IRIDIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDCRVLIRGRGSIKDP  686
            IR+DIPV++YPNYNFVGRLLGPRGNSLKRVE STDCRVLIRGRGSIKDP
Sbjct  162  IRVDIPVDKYPNYNFVGRLLGPRGNSLKRVEASTDCRVLIRGRGSIKDP  210



>emb|CDY66744.1| BnaAnng22840D [Brassica napus]
Length=314

 Score =   211 bits (538),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 121/169 (72%), Positives = 135/169 (80%), Gaps = 4/169 (2%)
 Frame = +3

Query  180  GALRSASSALVEQEKYLAELLAERSKLSPFMPVLPNCFRLLNQEILRVTTLLGNASVLDQ  359
            G LRS  S LVEQEKYL ELLAER KL+PF+ VLP+  RL+NQEILRVTTLL NA  + Q
Sbjct  52   GGLRSQPSFLVEQEKYLTELLAERHKLTPFLTVLPHVCRLMNQEILRVTTLLENA--ISQ  109

Query  360  SGLEHGSPLASGGLFSNGGANKDRWSSPFQSEMSGLVqsssaqswlgsqssssGLIVKQT  539
            S  +H SPL+SGG+F N  A+ + W S F SE S  V SS A +WL S  SSSGLIVK+T
Sbjct  110  SRFDHPSPLSSGGIFQNSRADMNGWPSQFPSERS--VSSSPAPNWLNSPGSSSGLIVKRT  167

Query  540  IRIDIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDCRVLIRGRGSIKDP  686
            IR+DIPV+QYPNYNFVGRLLGPRGNSLKRVE STDCRVLIRGRGSIKDP
Sbjct  168  IRVDIPVDQYPNYNFVGRLLGPRGNSLKRVEASTDCRVLIRGRGSIKDP  216



>ref|XP_009142357.1| PREDICTED: KH domain-containing protein At4g26480 [Brassica rapa]
Length=314

 Score =   211 bits (537),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 121/169 (72%), Positives = 135/169 (80%), Gaps = 4/169 (2%)
 Frame = +3

Query  180  GALRSASSALVEQEKYLAELLAERSKLSPFMPVLPNCFRLLNQEILRVTTLLGNASVLDQ  359
            G LRS  S LVEQEKYL ELLAER KL+PF+ VLP+  RL+NQEILRVTTLL NA  + Q
Sbjct  52   GGLRSQPSFLVEQEKYLTELLAERHKLTPFLTVLPHVCRLMNQEILRVTTLLENA--ISQ  109

Query  360  SGLEHGSPLASGGLFSNGGANKDRWSSPFQSEMSGLVqsssaqswlgsqssssGLIVKQT  539
            S  +H SPL+SGG+F N  A+ + W S F SE S  V SS A +WL S  SSSGLIVK+T
Sbjct  110  SRFDHPSPLSSGGIFQNSRADMNGWPSQFPSERS--VSSSPAPNWLNSPGSSSGLIVKRT  167

Query  540  IRIDIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDCRVLIRGRGSIKDP  686
            IR+DIPV+QYPNYNFVGRLLGPRGNSLKRVE STDCRVLIRGRGSIKDP
Sbjct  168  IRVDIPVDQYPNYNFVGRLLGPRGNSLKRVEASTDCRVLIRGRGSIKDP  216



>gb|KFK29165.1| hypothetical protein AALP_AA7G098000 [Arabis alpina]
Length=312

 Score =   209 bits (533),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 119/170 (70%), Positives = 136/170 (80%), Gaps = 4/170 (2%)
 Frame = +3

Query  180  GALRSASSALVEQEKYLAELLAERSKLSPFMPVLPNCFRLLNQEILRVTTLLGNASVLDQ  359
            G LRS  S LVEQ+KYL+ELLAER KL+PF+PVLP+  RL+NQEILRVTTLL NA  + Q
Sbjct  50   GGLRSQPSFLVEQDKYLSELLAERHKLTPFLPVLPHLCRLMNQEILRVTTLLENA--ISQ  107

Query  360  SGLEHGSPLASGGLFSNGGANKDRWSSPFQSEMSGLVqsssaqswlgsqssssGLIVKQT  539
            S  +H SPL SGG+F N  A+ + W S F SE S  V SS A +WL S  SSSGLIVK+T
Sbjct  108  SRFDHPSPLGSGGIFQNARADMNGWGSQFPSERS--VSSSPAPNWLNSPGSSSGLIVKRT  165

Query  540  IRIDIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDCRVLIRGRGSIKDPT  689
            IR+DIPV+++PNYNFVGRLLGPRGNSLKRVE STDCRVLIRGRGSIKDP 
Sbjct  166  IRVDIPVDKFPNYNFVGRLLGPRGNSLKRVEASTDCRVLIRGRGSIKDPV  215



>emb|CAA18222.1| putative protein [Arabidopsis thaliana]
 emb|CAB79503.1| putative protein [Arabidopsis thaliana]
Length=555

 Score =   216 bits (549),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 123/169 (73%), Positives = 138/169 (82%), Gaps = 4/169 (2%)
 Frame = +3

Query  180  GALRSASSALVEQEKYLAELLAERSKLSPFMPVLPNCFRLLNQEILRVTTLLGNASVLDQ  359
            G LRS  S LVEQEKYL+ELLAER KL+PF+PVLP+  RL+NQEILRVTTLL NA  L Q
Sbjct  293  GGLRSQPSFLVEQEKYLSELLAERHKLTPFLPVLPHVCRLMNQEILRVTTLLENA--LSQ  350

Query  360  SGLEHGSPLASGGLFSNGGANKDRWSSPFQSEMSGLVqsssaqswlgsqssssGLIVKQT  539
            S  +H SPLASGG+F N  A+ + W+S F SE S  V SS A +WL S  SSSGLIVK+T
Sbjct  351  SRFDHPSPLASGGIFQNSRADMNGWASQFPSERS--VSSSPAPNWLNSPGSSSGLIVKRT  408

Query  540  IRIDIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDCRVLIRGRGSIKDP  686
            IR+DIPV++YPNYNFVGRLLGPRGNSLKRVE STDCRVLIRGRGSIKDP
Sbjct  409  IRVDIPVDKYPNYNFVGRLLGPRGNSLKRVEASTDCRVLIRGRGSIKDP  457



>ref|XP_008447796.1| PREDICTED: KH domain-containing protein At5g56140 isoform X1 
[Cucumis melo]
Length=238

 Score =   206 bits (525),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 115/140 (82%), Positives = 126/140 (90%), Gaps = 0/140 (0%)
 Frame = +3

Query  270  MPVLPNCFRLLNQEILRVTTLLGNASVLDQSGLEHGSPLASGGLFSNGGANKDRWSSPFQ  449
            MPVLPN +RLLNQEILRVTTLLG ASVL QSGLEH SPLASGG+FSNGGA+   W S FQ
Sbjct  1    MPVLPNSYRLLNQEILRVTTLLGKASVLGQSGLEHASPLASGGIFSNGGADMSAWPSRFQ  60

Query  450  SEMSGLVqsssaqswlgsqssssGLIVKQTIRIDIPVEQYPNYNFVGRLLGPRGNSLKRV  629
            SEMSGL+Q+SSAQ+WL SQ SSSGLIVK+TIR+D+PV+ +PNYNFVGRLLGPRGNSLKRV
Sbjct  61   SEMSGLLQASSAQNWLSSQGSSSGLIVKRTIRVDVPVDNFPNYNFVGRLLGPRGNSLKRV  120

Query  630  EVSTDCRVLIRGRGSIKDPT  689
            E STDCRVLIRGRGSIKDP 
Sbjct  121  EASTDCRVLIRGRGSIKDPA  140



>ref|XP_002867563.1| KH domain-containing protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43822.1| KH domain-containing protein [Arabidopsis lyrata subsp. lyrata]
Length=565

 Score =   214 bits (546),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 123/169 (73%), Positives = 137/169 (81%), Gaps = 4/169 (2%)
 Frame = +3

Query  180  GALRSASSALVEQEKYLAELLAERSKLSPFMPVLPNCFRLLNQEILRVTTLLGNASVLDQ  359
            G LRS  S LVEQEKYL+ELLAER KL PF+PVLP+  RL+NQEILRVTTLL NA  L Q
Sbjct  303  GGLRSQPSFLVEQEKYLSELLAERHKLIPFLPVLPHVCRLMNQEILRVTTLLENA--LSQ  360

Query  360  SGLEHGSPLASGGLFSNGGANKDRWSSPFQSEMSGLVqsssaqswlgsqssssGLIVKQT  539
            S  +H SPLASGG+F N  A+ + W+S F SE S  V SS A +WL S  SSSGLIVK+T
Sbjct  361  SRFDHPSPLASGGIFQNARADMNGWASQFPSERS--VSSSPAPNWLNSPGSSSGLIVKRT  418

Query  540  IRIDIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDCRVLIRGRGSIKDP  686
            IR+DIPV++YPNYNFVGRLLGPRGNSLKRVE STDCRVLIRGRGSIKDP
Sbjct  419  IRVDIPVDKYPNYNFVGRLLGPRGNSLKRVEASTDCRVLIRGRGSIKDP  467



>gb|EAZ24441.1| hypothetical protein OsJ_08192 [Oryza sativa Japonica Group]
Length=261

 Score =   206 bits (523),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 111/156 (71%), Positives = 131/156 (84%), Gaps = 6/156 (4%)
 Frame = +3

Query  222  KYLAELLAERSKLSPFMPVLPNCFRLLNQEILRVTTLLGNASVLDQSGLEHGSPLASGGL  401
            +YLAELLAER KLSPF+PVLPN  RLLNQEILRV+TLL NAS+L+QSGLEHGSPL +GGL
Sbjct  12   RYLAELLAERHKLSPFIPVLPNSVRLLNQEILRVSTLLENASLLNQSGLEHGSPLTTGGL  71

Query  402  FSNG-GANKDRWSSPFQSEMSGLVqsssaqswlgsqssssGLIVKQTIRIDIPVEQYPNY  578
            +SNG  A+ + W+S FQSE S      +     GSQ SSSGLIVK+T+++DIPV++YP +
Sbjct  72   YSNGAAADMNGWTSAFQSEGS-----PAYSWRGGSQGSSSGLIVKKTMKVDIPVDKYPTF  126

Query  579  NFVGRLLGPRGNSLKRVEVSTDCRVLIRGRGSIKDP  686
            NFVGR+LGPRGNSLKRVE +TDCRVLIRGRGSIKDP
Sbjct  127  NFVGRILGPRGNSLKRVEATTDCRVLIRGRGSIKDP  162



>gb|KJB63136.1| hypothetical protein B456_009G454400 [Gossypium raimondii]
Length=274

 Score =   206 bits (523),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 127/202 (63%), Positives = 143/202 (71%), Gaps = 33/202 (16%)
 Frame = +3

Query  102  FTSKQMASSRFMAYspspsaphsphIGALRSASSA------LVEQEKYLAELLAERSKLS  263
             T+      R+MAYSPSPSAPHSPH+  LRS ++A      L++QEKYL+ELLAER KLS
Sbjct  1    MTTSDGGGGRYMAYSPSPSAPHSPHLSGLRSVAAAAASSAALLDQEKYLSELLAERQKLS  60

Query  264  PFMPVLPNCFRLLNQEILRVTTLLGNASVLDQSGLEHGSPLASGGLFSNGGANKDRWSSP  443
            PFMPVLPN +RLLNQEILRVTTLLGNASVL QSGLE  SPLASGG+FSNGGA+ + W+S 
Sbjct  61   PFMPVLPNTYRLLNQEILRVTTLLGNASVLGQSGLEQASPLASGGIFSNGGADMNGWTSR  120

Query  444  FQSEMSGLVqsssaqswlgsqssssGLIVKQTIRIDIPVEQYPNYNFVGRLLGPRGNSLK  623
            FQSEMS LV+                           P      YNFVGRLLGPRGNSLK
Sbjct  121  FQSEMSCLVR---------------------------PSSVQNWYNFVGRLLGPRGNSLK  153

Query  624  RVEVSTDCRVLIRGRGSIKDPT  689
            RVE +T+CRVLIRGRGSIKDPT
Sbjct  154  RVEANTECRVLIRGRGSIKDPT  175



>ref|XP_010942516.1| PREDICTED: KH domain-containing protein At5g56140-like isoform 
X5 [Elaeis guineensis]
Length=239

 Score =   203 bits (516),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 108/141 (77%), Positives = 125/141 (89%), Gaps = 1/141 (1%)
 Frame = +3

Query  270  MPVLPNCFRLLNQEILRVTTLLGNASVLDQSGLEHGSPLASGGLFSNGGA-NKDRWSSPF  446
            MPVLP+C+ LLNQEI+RVTTLLGNAS+LDQ+GLEHGSPL +GGLFSNGGA + + W+SPF
Sbjct  1    MPVLPHCYWLLNQEIMRVTTLLGNASLLDQTGLEHGSPLTTGGLFSNGGAADMNGWASPF  60

Query  447  QSEMSGLVqsssaqswlgsqssssGLIVKQTIRIDIPVEQYPNYNFVGRLLGPRGNSLKR  626
            Q E  GL+Q SSA  WLG Q S SGLIVK+T+R+DIPV++YPNYNFVGRLLGPRGNSLKR
Sbjct  61   QPERLGLLQPSSAHGWLGQQGSCSGLIVKKTLRVDIPVDKYPNYNFVGRLLGPRGNSLKR  120

Query  627  VEVSTDCRVLIRGRGSIKDPT  689
            +E ST+CRVLIRGRGSIKDP 
Sbjct  121  MEASTECRVLIRGRGSIKDPV  141



>gb|KHN01498.1| KH domain-containing protein [Glycine soja]
Length=238

 Score =   201 bits (512),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 107/140 (76%), Positives = 123/140 (88%), Gaps = 0/140 (0%)
 Frame = +3

Query  270  MPVLPNCFRLLNQEILRVTTLLGNASVLDQSGLEHGSPLASGGLFSNGGANKDRWSSPFQ  449
            M VLP+CFRL NQEILRVTTL+GNASVL QSGLEH SPLA+GG+FSNGGA+ + W+S FQ
Sbjct  1    MAVLPHCFRLFNQEILRVTTLMGNASVLGQSGLEHASPLATGGIFSNGGADVNGWASRFQ  60

Query  450  SEMSGLVqsssaqswlgsqssssGLIVKQTIRIDIPVEQYPNYNFVGRLLGPRGNSLKRV  629
            SE   L+QSSS Q+WL  Q SSSG+IVK+T+R+DIPV+ YPN+NFVGRLLGPRGNSLKRV
Sbjct  61   SERPSLLQSSSTQNWLSPQGSSSGIIVKKTVRVDIPVDAYPNFNFVGRLLGPRGNSLKRV  120

Query  630  EVSTDCRVLIRGRGSIKDPT  689
            E ST+CRVLIRGRGSIKDP 
Sbjct  121  EASTECRVLIRGRGSIKDPA  140



>dbj|BAD13019.1| putative KH domain protein [Oryza sativa Japonica Group]
 dbj|BAD13022.1| putative KH domain protein [Oryza sativa Japonica Group]
Length=341

 Score =   204 bits (519),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 131/157 (83%), Gaps = 6/157 (4%)
 Frame = +3

Query  222  KYLAELLAERSKLSPFMPVLPNCFRLLNQEILRVTTLLGNASVLDQSGLEHGSPLASGGL  401
            +YLAELLAER KLSPF+PVLPN  RLLNQEILRV+TLL NAS+L+QSGLEHGSPL +GGL
Sbjct  92   RYLAELLAERHKLSPFIPVLPNSVRLLNQEILRVSTLLENASLLNQSGLEHGSPLTTGGL  151

Query  402  FSNG-GANKDRWSSPFQSEMSGLVqsssaqswlgsqssssGLIVKQTIRIDIPVEQYPNY  578
            +SNG  A+ + W+S FQSE S      +     GSQ SSSGLIVK+T+++DIPV++YP +
Sbjct  152  YSNGAAADMNGWTSAFQSEGS-----PAYSWRGGSQGSSSGLIVKKTMKVDIPVDKYPTF  206

Query  579  NFVGRLLGPRGNSLKRVEVSTDCRVLIRGRGSIKDPT  689
            NFVGR+LGPRGNSLKRVE +TDCRVLIRGRGSIKDP 
Sbjct  207  NFVGRILGPRGNSLKRVEATTDCRVLIRGRGSIKDPA  243



>ref|XP_010063216.1| PREDICTED: KH domain-containing protein At5g56140-like isoform 
X2 [Eucalyptus grandis]
Length=274

 Score =   202 bits (513),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 122/188 (65%), Positives = 140/188 (74%), Gaps = 20/188 (11%)
 Frame = +3

Query  129  RFMAYspspsaphsp-hIGALRSASSALVEQEKYLAELLAERSKLSPFMPVLPNCFRLLN  305
            R+MAYSPSPS      H+  LR  SSAL EQEKYL+ELL ER KLSPFM VLP C+RLLN
Sbjct  8    RYMAYSPSPSTAPHSPHLSGLRFTSSALAEQEKYLSELLEERLKLSPFMTVLPTCYRLLN  67

Query  306  QEILRVTTLLGNASVLDQSGLEHGSPLASGGLFSNGGANKDRWSSPFQSEMSGLVqsssa  485
            Q             VL QSGLEH SPLASGG+FSNGGA  + W S FQSE +       A
Sbjct  68   Q-------------VLGQSGLEHASPLASGGIFSNGGAELNGWPSRFQSEPT------LA  108

Query  486  qswlgsqssssGLIVKQTIRIDIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDCRVLIRG  665
             +W+ SQ SSSGL+VK+T+R+DIPV+++P+YNFVGRLLGPRGNSLKRVE ST+CRVLIRG
Sbjct  109  PNWMSSQVSSSGLLVKKTVRLDIPVDKFPSYNFVGRLLGPRGNSLKRVEASTECRVLIRG  168

Query  666  RGSIKDPT  689
            RGSIKDP 
Sbjct  169  RGSIKDPA  176



>emb|CDX92817.1| BnaC07g40750D [Brassica napus]
Length=301

 Score =   202 bits (513),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 119/172 (69%), Positives = 137/172 (80%), Gaps = 6/172 (3%)
 Frame = +3

Query  180  GALRSASSALVEQEKYLAELLAERSKLSPFMPVLPNCFRLLNQEILRVTTLLGNASVLDQ  359
            G LRS SS LVEQEKYL+ELLAER KL+PF+PVLP+  RL+NQEILRVTTLL NA  L Q
Sbjct  37   GGLRSQSSFLVEQEKYLSELLAERHKLTPFLPVLPHVCRLMNQEILRVTTLLENA--LTQ  94

Query  360  SGLEHGSPLAS-GGLFSNGGANKDR-WSSPFQSEMSGLVqsssaqswlgsqssssGLIVK  533
            S  +H SPL+S GG+F N  A+ +  W S F SE S  + SS A +WL S   SSGLIVK
Sbjct  95   SRFDHPSPLSSSGGIFQNSRADMNGGWPSQFPSERS--LSSSPAPNWLNSPGGSSGLIVK  152

Query  534  QTIRIDIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDCRVLIRGRGSIKDPT  689
            ++IR+DIPV+QYPNYNFVGRLLGPRGNSLKRVE S++CRVLIRGRGSIKDP 
Sbjct  153  RSIRVDIPVDQYPNYNFVGRLLGPRGNSLKRVEASSECRVLIRGRGSIKDPV  204



>emb|CDY11960.1| BnaC03g13860D [Brassica napus]
Length=301

 Score =   201 bits (512),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 112/168 (67%), Positives = 129/168 (77%), Gaps = 5/168 (3%)
 Frame = +3

Query  180  GALRSASSALVEQEKYLAELLAERSKLSPFMPVLPNCFRLLNQEILRVTTLLGNASVLDQ  359
            G +RS SS  VEQEKYL+ELLAER  L+PF+PVLP+  RLLNQEILRVTTLL NA+ L Q
Sbjct  39   GGIRSQSSVFVEQEKYLSELLAERRNLTPFLPVLPHVCRLLNQEILRVTTLLENATFLSQ  98

Query  360  SGLEHGSPLASGGLFSNGGANKDRWSSPFQSEMSGLVqsssaqswlgsqssssGLIVKQT  539
            SGL+H +P   GG++ N  A+   W+S F SE S  V SS   +W  S  S SGLI K+T
Sbjct  99   SGLDHTNP---GGIYQNARADMSGWASQFPSEKS--VPSSPGPNWHNSPGSPSGLIAKRT  153

Query  540  IRIDIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDCRVLIRGRGSIKD  683
            IRIDIPV++YPN+NFVGRLLGPRGNSLKRVE ST CR LIRGRGSIKD
Sbjct  154  IRIDIPVDEYPNFNFVGRLLGPRGNSLKRVEASTGCRFLIRGRGSIKD  201



>ref|XP_002864436.1| KH domain-containing protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH40695.1| KH domain-containing protein [Arabidopsis lyrata subsp. lyrata]
Length=308

 Score =   202 bits (513),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 114/169 (67%), Positives = 132/169 (78%), Gaps = 3/169 (2%)
 Frame = +3

Query  180  GALRSASSALVEQEKYLAELLAERSKLSPFMPVLPNCFRLLNQEILRVTTLLGNASVLDQ  359
            G LRS SS  VEQEKYL+ELLAER KL+PF+PVLP+ +RLLNQ + + TT   +   L Q
Sbjct  44   GGLRSQSSVFVEQEKYLSELLAERHKLTPFLPVLPHAYRLLNQ-VDKHTTAKRDLIFLSQ  102

Query  360  SGLEHGSPLASGGLFSNGGANKDRWSSPFQSEMSGLVqsssaqswlgsqssssGLIVKQT  539
            SGL+H SPLASGG+F N  A+ + W+S F SE S  V SS   +WL S  SSSGLI K+T
Sbjct  103  SGLDHPSPLASGGIFQNARADLNGWASQFPSERS--VPSSPGPNWLNSPGSSSGLIAKRT  160

Query  540  IRIDIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDCRVLIRGRGSIKDP  686
            IR+DIPV+ YPN+NFVGRLLGPRGNSLKRVE STDCRVLIRGRGSIKDP
Sbjct  161  IRVDIPVDNYPNFNFVGRLLGPRGNSLKRVEASTDCRVLIRGRGSIKDP  209



>emb|CDY42731.1| BnaA03g48080D [Brassica napus]
Length=302

 Score =   201 bits (510),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 119/172 (69%), Positives = 137/172 (80%), Gaps = 6/172 (3%)
 Frame = +3

Query  180  GALRSASSALVEQEKYLAELLAERSKLSPFMPVLPNCFRLLNQEILRVTTLLGNASVLDQ  359
            G LRS  S LVEQEKYL+ELLAER KL+PF+PVLP+  RL+NQEILRVTTLL NA  L Q
Sbjct  38   GGLRSQPSFLVEQEKYLSELLAERHKLTPFLPVLPHVCRLMNQEILRVTTLLENA--LTQ  95

Query  360  SGLEHGSPLAS-GGLFSNGGANKDR-WSSPFQSEMSGLVqsssaqswlgsqssssGLIVK  533
            S  +H SPL+S GG+F N  A+ +  W S F SE S  + SS A +WL S  SSSGLIVK
Sbjct  96   SRFDHPSPLSSSGGIFQNSRADMNGGWPSQFPSERS--LSSSPAPNWLNSPGSSSGLIVK  153

Query  534  QTIRIDIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDCRVLIRGRGSIKDPT  689
            ++IR+DIPV+QYPNYNFVGRLLGPRGNSLKRVE S++CRVLIRGRGSIKDP 
Sbjct  154  RSIRVDIPVDQYPNYNFVGRLLGPRGNSLKRVEASSECRVLIRGRGSIKDPV  205



>ref|XP_009137598.1| PREDICTED: KH domain-containing protein At4g26480-like [Brassica 
rapa]
Length=309

 Score =   201 bits (510),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 119/172 (69%), Positives = 137/172 (80%), Gaps = 6/172 (3%)
 Frame = +3

Query  180  GALRSASSALVEQEKYLAELLAERSKLSPFMPVLPNCFRLLNQEILRVTTLLGNASVLDQ  359
            G LRS  S LVEQEKYL+ELLAER KL+PF+PVLP+  RL+NQEILRVTTLL NA  L Q
Sbjct  45   GGLRSQPSFLVEQEKYLSELLAERHKLTPFLPVLPHVCRLMNQEILRVTTLLENA--LTQ  102

Query  360  SGLEHGSPLAS-GGLFSNGGANKDR-WSSPFQSEMSGLVqsssaqswlgsqssssGLIVK  533
            S  +H SPL+S GG+F N  A+ +  W S F SE S  + SS A +WL S  SSSGLIVK
Sbjct  103  SRFDHPSPLSSSGGIFQNSRADMNGGWPSQFPSERS--LSSSPAPNWLNSPGSSSGLIVK  160

Query  534  QTIRIDIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDCRVLIRGRGSIKDPT  689
            ++IR+DIPV+QYPNYNFVGRLLGPRGNSLKRVE S++CRVLIRGRGSIKDP 
Sbjct  161  RSIRVDIPVDQYPNYNFVGRLLGPRGNSLKRVEASSECRVLIRGRGSIKDPV  212



>ref|XP_009132341.1| PREDICTED: KH domain-containing protein At5g56140-like [Brassica 
rapa]
 emb|CDY36777.1| BnaA03g11090D [Brassica napus]
Length=304

 Score =   201 bits (510),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 112/168 (67%), Positives = 128/168 (76%), Gaps = 5/168 (3%)
 Frame = +3

Query  180  GALRSASSALVEQEKYLAELLAERSKLSPFMPVLPNCFRLLNQEILRVTTLLGNASVLDQ  359
            G +RS SS  VEQE YL+ELLAER  L+PF+PVLP+  RLLNQEILRVTTLL NA+VL Q
Sbjct  42   GGIRSQSSVFVEQENYLSELLAERRNLTPFLPVLPHVCRLLNQEILRVTTLLENATVLSQ  101

Query  360  SGLEHGSPLASGGLFSNGGANKDRWSSPFQSEMSGLVqsssaqswlgsqssssGLIVKQT  539
            SGL+H +P   GG++ N  A+   W+S F SE S  V SS   +W  S  S SGLI K+T
Sbjct  102  SGLDHTNP---GGIYQNARADMSGWTSQFPSERS--VPSSPGPNWHNSPGSPSGLIAKRT  156

Query  540  IRIDIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDCRVLIRGRGSIKD  683
            IRIDIPV+ YPN+NFVGRLLGPRGNSLKRVE ST CR LIRGRGSIKD
Sbjct  157  IRIDIPVDDYPNFNFVGRLLGPRGNSLKRVEASTGCRFLIRGRGSIKD  204



>ref|XP_009120126.1| PREDICTED: KH domain-containing protein At5g56140 isoform X1 
[Brassica rapa]
Length=304

 Score =   199 bits (506),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 115/170 (68%), Positives = 131/170 (77%), Gaps = 6/170 (4%)
 Frame = +3

Query  180  GALRSASSALVEQEKYLAELLAERSKLSPFMPVLPNCFRLLNQEILRVTTLLGNASVLDQ  359
            G LRS SS  VEQEKYL+ELL ER KL+PF PV+P+  RLLNQEI+RVTTLL NA+VL Q
Sbjct  40   GGLRSQSSMFVEQEKYLSELLEERHKLTPFFPVIPHARRLLNQEIMRVTTLLENATVLTQ  99

Query  360  SGLEHGSPLASGGLFSNGGANKDRW-SSPFQSEMSGLVqsssaqswlgsqssssGLIVKQ  536
            SGL   +PL +G +F N  A+   W +S F SE S  V SS   +WL S  S SGLI K+
Sbjct  100  SGL---NPLGNGRIFQNARADLSGWGASQFPSERS--VPSSPGPNWLNSPGSPSGLIAKR  154

Query  537  TIRIDIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDCRVLIRGRGSIKDP  686
            T+R+DIPV+ YPNYNFVGRLLGPRGNSLKRVE STDCRVLIRGRGSIKDP
Sbjct  155  TLRVDIPVDDYPNYNFVGRLLGPRGNSLKRVEASTDCRVLIRGRGSIKDP  204



>emb|CDY51960.1| BnaCnng21440D [Brassica napus]
Length=306

 Score =   199 bits (505),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 115/170 (68%), Positives = 131/170 (77%), Gaps = 6/170 (4%)
 Frame = +3

Query  180  GALRSASSALVEQEKYLAELLAERSKLSPFMPVLPNCFRLLNQEILRVTTLLGNASVLDQ  359
            G LRS SS  VEQEKYL+ELL ER KL+PF PV+P+  RLLNQEI+RVTTLL NA+VL Q
Sbjct  42   GGLRSQSSLFVEQEKYLSELLEERHKLTPFFPVIPHARRLLNQEIMRVTTLLENATVLTQ  101

Query  360  SGLEHGSPLASGGLFSNGGANKDRW-SSPFQSEMSGLVqsssaqswlgsqssssGLIVKQ  536
            SGL   +PL +G +F N  A+   W +S F SE S  V SS   +WL S  S SGLI K+
Sbjct  102  SGL---NPLGNGRIFQNARADLSGWGASQFPSERS--VPSSPGPNWLNSPGSPSGLIAKR  156

Query  537  TIRIDIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDCRVLIRGRGSIKDP  686
            T+R+DIPV+ YPNYNFVGRLLGPRGNSLKRVE STDCRVLIRGRGSIKDP
Sbjct  157  TLRVDIPVDDYPNYNFVGRLLGPRGNSLKRVEASTDCRVLIRGRGSIKDP  206



>emb|CDY17395.1| BnaA10g10290D [Brassica napus]
Length=304

 Score =   198 bits (503),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 115/170 (68%), Positives = 131/170 (77%), Gaps = 6/170 (4%)
 Frame = +3

Query  180  GALRSASSALVEQEKYLAELLAERSKLSPFMPVLPNCFRLLNQEILRVTTLLGNASVLDQ  359
            G LRS SS  VEQEKYL+ELL ER KL+PF PV+P+  RLLNQEI+RVTTLL NA+VL Q
Sbjct  40   GGLRSQSSLFVEQEKYLSELLEERHKLTPFFPVIPHARRLLNQEIMRVTTLLENATVLTQ  99

Query  360  SGLEHGSPLASGGLFSNGGANKDRW-SSPFQSEMSGLVqsssaqswlgsqssssGLIVKQ  536
            SGL   +PL +G +F N  A+   W +S F SE S  V SS   +WL S  S SGLI K+
Sbjct  100  SGL---NPLGNGRIFQNARADLGGWGASQFPSERS--VPSSPGPNWLNSPGSPSGLIAKR  154

Query  537  TIRIDIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDCRVLIRGRGSIKDP  686
            T+R+DIPV+ YPNYNFVGRLLGPRGNSLKRVE STDCRVLIRGRGSIKDP
Sbjct  155  TLRVDIPVDDYPNYNFVGRLLGPRGNSLKRVEASTDCRVLIRGRGSIKDP  204



>ref|XP_009410310.1| PREDICTED: KH domain-containing protein At5g56140-like isoform 
X3 [Musa acuminata subsp. malaccensis]
Length=240

 Score =   193 bits (491),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 107/140 (76%), Positives = 124/140 (89%), Gaps = 2/140 (1%)
 Frame = +3

Query  270  MPVLPNCFRLLNQ-EILRVTTLLGNASVLDQSGLEHGSPLASGGLFSNGGANK-DRWSSP  443
            MPVLP+ +RLLNQ EILRVT LLGNAS+LDQSGLEHGSP+ +GGL SNGGA + + W+S 
Sbjct  1    MPVLPHSYRLLNQAEILRVTMLLGNASLLDQSGLEHGSPMTTGGLLSNGGATEMNGWASA  60

Query  444  FQSEMSGLVqsssaqswlgsqssssGLIVKQTIRIDIPVEQYPNYNFVGRLLGPRGNSLK  623
            FQSE  GL+Q SSA  WLGSQSS+SGLIVK+TIR+DIP+++YP YNFVGRLLGPRGNSLK
Sbjct  61   FQSEGLGLIQPSSAHGWLGSQSSASGLIVKKTIRVDIPIDKYPTYNFVGRLLGPRGNSLK  120

Query  624  RVEVSTDCRVLIRGRGSIKD  683
            RVE +TDCR+LIRGRGSIKD
Sbjct  121  RVEANTDCRILIRGRGSIKD  140



>ref|XP_001764522.1| predicted protein [Physcomitrella patens]
 gb|EDQ70789.1| predicted protein [Physcomitrella patens]
Length=278

 Score =   187 bits (474),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 103/168 (61%), Positives = 121/168 (72%), Gaps = 20/168 (12%)
 Frame = +3

Query  201  SALVEQEKYLAELLAERSKLSPFMPVLPNCFRLLNQEILRVTTLLGNASVLDQSGLEHG-  377
            SA+ E +KYL+ELLAER  L PFM VLPNC RLLNQEI+RVT L+GN+S LDQ GLEHG 
Sbjct  24   SAVAEHDKYLSELLAERQNLGPFMQVLPNCSRLLNQEIVRVTALVGNSSFLDQDGLEHGH  83

Query  378  -SPLASGGLFSNGGANK-----DRWSSPFQSEMSGLVqsssaqswlgsqssssGLIVKQT  539
             SPL+SG L +NGG+       DR   P QS   G            +  + +G IVK+T
Sbjct  84   GSPLSSGILLNNGGSGDLNGWGDRLGLP-QSSWHG------------TPGTLAGPIVKRT  130

Query  540  IRIDIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDCRVLIRGRGSIKD  683
             RID+PV++YPNYNFVGR+LGPRGNSLKRVE +T CRVLIRGRGSIKD
Sbjct  131  QRIDVPVDKYPNYNFVGRILGPRGNSLKRVEATTGCRVLIRGRGSIKD  178



>ref|XP_010234630.1| PREDICTED: KH domain-containing protein At5g56140-like isoform 
X2 [Brachypodium distachyon]
Length=234

 Score =   182 bits (462),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 99/162 (61%), Positives = 120/162 (74%), Gaps = 2/162 (1%)
 Frame = +3

Query  207  LVEQEKYLAELLAERSKLSPFMPVLPNCFRLLNQEILRVTTLLGNASVLDQSGLEHGSPL  386
            L E E+Y+ ELLAER K+ PF+PVLP   RLLNQEIL V+ LLG   VLDQ G +HGSPL
Sbjct  25   LYEHEQYITELLAERQKIGPFVPVLPCTARLLNQEILHVSALLG-IHVLDQPGFQHGSPL  83

Query  387  ASGGLFSNG-GANKDRWSSPFQSEMSGLVqsssaqswlgsqssssGLIVKQTIRIDIPVE  563
             +GG FSNG  A+ + W+  F SE  G+  S  +++ L +Q +SSG IVK+ +R+DIP  
Sbjct  84   LNGGAFSNGRPADVNGWAPRFSSERLGIFDSPPSENGLNAQGNSSGFIVKKMMRMDIPTN  143

Query  564  QYPNYNFVGRLLGPRGNSLKRVEVSTDCRVLIRGRGSIKDPT  689
             YPN+N VGRLLGPRGNSLKRVE +T CRVLIRGRGSIKDP 
Sbjct  144  NYPNFNIVGRLLGPRGNSLKRVEAATSCRVLIRGRGSIKDPA  185



>ref|XP_003573788.1| PREDICTED: KH domain-containing protein At5g56140-like isoform 
X1 [Brachypodium distachyon]
Length=283

 Score =   181 bits (460),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 100/168 (60%), Positives = 121/168 (72%), Gaps = 2/168 (1%)
 Frame = +3

Query  189  RSASSALVEQEKYLAELLAERSKLSPFMPVLPNCFRLLNQEILRVTTLLGNASVLDQSGL  368
             S    L E E+Y+ ELLAER K+ PF+PVLP   RLLNQEIL V+ LLG   VLDQ G 
Sbjct  19   HSPHLPLYEHEQYITELLAERQKIGPFVPVLPCTARLLNQEILHVSALLG-IHVLDQPGF  77

Query  369  EHGSPLASGGLFSNG-GANKDRWSSPFQSEMSGLVqsssaqswlgsqssssGLIVKQTIR  545
            +HGSPL +GG FSNG  A+ + W+  F SE  G+  S  +++ L +Q +SSG IVK+ +R
Sbjct  78   QHGSPLLNGGAFSNGRPADVNGWAPRFSSERLGIFDSPPSENGLNAQGNSSGFIVKKMMR  137

Query  546  IDIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDCRVLIRGRGSIKDPT  689
            +DIP   YPN+N VGRLLGPRGNSLKRVE +T CRVLIRGRGSIKDP 
Sbjct  138  MDIPTNNYPNFNIVGRLLGPRGNSLKRVEAATSCRVLIRGRGSIKDPA  185



>ref|XP_009415555.1| PREDICTED: KH domain-containing protein At5g56140-like isoform 
X4 [Musa acuminata subsp. malaccensis]
Length=272

 Score =   181 bits (458),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 99/128 (77%), Positives = 116/128 (91%), Gaps = 1/128 (1%)
 Frame = +3

Query  309  EILRVTTLLGNASVLDQSGLEHGSPLASGGLFSNGGANK-DRWSSPFQSEMSGLVqsssa  485
            EI+RVT LLGNAS+LDQSGLE+GSP+ +GGLFSNGGAN  + W+SPFQSE  GLVQ SSA
Sbjct  47   EIIRVTMLLGNASLLDQSGLEYGSPMTTGGLFSNGGANDMNGWASPFQSERMGLVQPSSA  106

Query  486  qswlgsqssssGLIVKQTIRIDIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDCRVLIRG  665
             SWLGS+ SSSGLIVK+TIR+DIP++++P +NFVGRLLGPRGNSLKRVE +TDCR+LIRG
Sbjct  107  HSWLGSEGSSSGLIVKKTIRVDIPIDKFPTFNFVGRLLGPRGNSLKRVEANTDCRILIRG  166

Query  666  RGSIKDPT  689
            RGSIKDPT
Sbjct  167  RGSIKDPT  174



>ref|XP_009120127.1| PREDICTED: KH domain-containing protein At5g56140 isoform X2 
[Brassica rapa]
Length=251

 Score =   179 bits (454),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 104/155 (67%), Positives = 120/155 (77%), Gaps = 6/155 (4%)
 Frame = +3

Query  225  YLAELLAERSKLSPFMPVLPNCFRLLNQEILRVTTLLGNASVLDQSGLEHGSPLASGGLF  404
            YL+ELL ER KL+PF PV+P+  RLLNQEI+RVTTLL NA+VL QSGL   +PL +G +F
Sbjct  2    YLSELLEERHKLTPFFPVIPHARRLLNQEIMRVTTLLENATVLTQSGL---NPLGNGRIF  58

Query  405  SNGGANKDRW-SSPFQSEMSGLVqsssaqswlgsqssssGLIVKQTIRIDIPVEQYPNYN  581
             N  A+   W +S F SE S  V SS   +WL S  S SGLI K+T+R+DIPV+ YPNYN
Sbjct  59   QNARADLSGWGASQFPSERS--VPSSPGPNWLNSPGSPSGLIAKRTLRVDIPVDDYPNYN  116

Query  582  FVGRLLGPRGNSLKRVEVSTDCRVLIRGRGSIKDP  686
            FVGRLLGPRGNSLKRVE STDCRVLIRGRGSIKDP
Sbjct  117  FVGRLLGPRGNSLKRVEASTDCRVLIRGRGSIKDP  151



>ref|XP_001777736.1| predicted protein [Physcomitrella patens]
 gb|EDQ57398.1| predicted protein [Physcomitrella patens]
Length=276

 Score =   179 bits (453),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 95/164 (58%), Positives = 117/164 (71%), Gaps = 10/164 (6%)
 Frame = +3

Query  195  ASSALVEQEKYLAELLAERSKLSPFMPVLPNCFRLLNQEILRVTTLLGNASVLDQSGLEH  374
            +S+A V+ +KYL+ELLAER  L PFM VLPNC RLLNQEI+RVTTL+G    LDQ GL+H
Sbjct  22   SSTAAVDHDKYLSELLAERQNLCPFMQVLPNCSRLLNQEIMRVTTLVGKLPYLDQDGLDH  81

Query  375  GSPLASGGLFSNGGANK-DRWSSPFQSEMSGLVqsssaqswlgsqssssGLIVKQTIRID  551
             SPL  G   ++GG+   + W         G           G+  +S+GLI+K+T RID
Sbjct  82   RSPLPVGTPLNDGGSGDLNGWGERLVIPQVGW---------HGTPGASAGLILKKTQRID  132

Query  552  IPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDCRVLIRGRGSIKD  683
            IP+++YPNYNFVGR+LGPRGNSLKRVE +T CRVLIRGRGSIKD
Sbjct  133  IPIDKYPNYNFVGRILGPRGNSLKRVEATTGCRVLIRGRGSIKD  176



>ref|XP_004973255.1| PREDICTED: KH domain-containing protein At4g26480-like [Setaria 
italica]
Length=282

 Score =   178 bits (452),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 107/186 (58%), Positives = 128/186 (69%), Gaps = 10/186 (5%)
 Frame = +3

Query  129  RFMAYspspsaphsphIGALRSASSALVEQEKYLAELLAERSKLSPFMPVLPNCFRLLNQ  308
            R+MAYSPSPS           S    L + EKY+AELLAE+ KL+PFM VLP   RLLNQ
Sbjct  6    RYMAYSPSPST-------GPHSPHLQLADHEKYIAELLAEKQKLTPFMQVLPCTSRLLNQ  58

Query  309  EILRVTTLLGNASVLDQSGLEHGSPLASGGLFSNG-GANKDRWSSPFQSEMSGLVqsssa  485
            EIL V+ LLG   VLDQ G +HGSPL +GG   NG     + W+    SE +G+    S 
Sbjct  59   EILHVSALLG-IPVLDQPGYQHGSPLINGGAIPNGRPVEMNGWAPAIPSEGAGMFHPPSR  117

Query  486  qswlgsqssssGLIVKQTIRIDIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDCRVLIRG  665
            +      +SS G IVK+T+R+DIPV++YPN+NFVGRLLGPRGNSLKRVE +TDCRVLIRG
Sbjct  118  KWHSPQGNSS-GFIVKKTMRMDIPVDKYPNFNFVGRLLGPRGNSLKRVEANTDCRVLIRG  176

Query  666  RGSIKD  683
            RGSIKD
Sbjct  177  RGSIKD  182



>ref|XP_001780004.1| predicted protein [Physcomitrella patens]
 gb|EDQ55213.1| predicted protein [Physcomitrella patens]
Length=278

 Score =   176 bits (447),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 95/165 (58%), Positives = 119/165 (72%), Gaps = 12/165 (7%)
 Frame = +3

Query  198  SSALVEQEKY--LAELLAERSKLSPFMPVLPNCFRLLNQEILRVTTLLGNASVLDQSGLE  371
            SS + E +KY  L+ELLAER  L PFM VLPNC RLL+QEI+RVT L+GN+S LDQ G++
Sbjct  23   SSVVAEHDKYKYLSELLAERQNLGPFMQVLPNCSRLLSQEIVRVTALVGNSSFLDQDGVD  82

Query  372  HGSPLASGGLFSNGGANK-DRWSSPFQSEMSGLVqsssaqswlgsqssssGLIVKQTIRI  548
            HGSPL+ G   +NGG+   + W        SG           G+ ++ +G IVK+T RI
Sbjct  83   HGSPLSLGTRINNGGSGDLNGWGDRLGLSQSGW---------HGTPATPAGPIVKRTQRI  133

Query  549  DIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDCRVLIRGRGSIKD  683
            D+PV+++PN+NFVGR+LGPRGNSLKRVE ST CRVLIRGRGSIKD
Sbjct  134  DVPVDKFPNFNFVGRILGPRGNSLKRVEASTGCRVLIRGRGSIKD  178



>emb|CDX86560.1| BnaC08g01430D [Brassica napus]
Length=210

 Score =   172 bits (437),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 102/184 (55%), Positives = 118/184 (64%), Gaps = 20/184 (11%)
 Frame = +3

Query  180  GALRSASSALVEQEKYLAELLAERSKLSPFMPVLPNCFRLLNQEILRVTTLLGNASVLDQ  359
            G +RS SS  VEQEKYL+ELL ER KL+PF P+LP+   LL  EILRVT LL NA+VL Q
Sbjct  21   GGIRSQSSVFVEQEKYLSELLEERHKLTPFFPILPHARSLL--EILRVTRLLENAAVLSQ  78

Query  360  SGLEHGSPLASGGLFSNGGANKDRW-SSPFQSEMSGLVqsssaqswlgsqsss-------  515
            SG  H SPL +G +F N  A+   W +S F SE +  V  ++  + L S           
Sbjct  79   SGFHHPSPLGNGRIFQNARADMRGWGASQFPSEQNIRVIVATGCTILISMERKSILSSPG  138

Query  516  ----------sGLIVKQTIRIDIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDCRVLIRG  665
                      SGLI KQTIRIDIP + YPN+NFVGR LGPRGNSL RVE STDCR LIRG
Sbjct  139  PNWLNSPGSPSGLIAKQTIRIDIPADDYPNFNFVGRFLGPRGNSLNRVEASTDCRFLIRG  198

Query  666  RGSI  677
            RGSI
Sbjct  199  RGSI  202



>ref|XP_006452754.1| hypothetical protein CICLE_v10009077mg [Citrus clementina]
 gb|ESR65994.1| hypothetical protein CICLE_v10009077mg [Citrus clementina]
Length=223

 Score =   173 bits (438),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 101/125 (81%), Positives = 114/125 (91%), Gaps = 0/125 (0%)
 Frame = +3

Query  315  LRVTTLLGNASVLDQSGLEHGSPLASGGLFSNGGANKDRWSSPFQSEMSGLVqsssaqsw  494
            +RVTTLLGNASVL QSGLEH SPL SGG+FSNGGA+ +  +S FQSE+SGL+QSSSAQ+W
Sbjct  1    MRVTTLLGNASVLGQSGLEHASPLTSGGIFSNGGADVNGLASRFQSEISGLMQSSSAQNW  60

Query  495  lgsqssssGLIVKQTIRIDIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDCRVLIRGRGS  674
            L SQ SSSGLIVK+TIR+DIPVE+YPN+NFVGRLLGPRGNSLKRVE ST+CRVLIRGRGS
Sbjct  61   LSSQGSSSGLIVKRTIRVDIPVEKYPNFNFVGRLLGPRGNSLKRVEASTECRVLIRGRGS  120

Query  675  IKDPT  689
            IKDP 
Sbjct  121  IKDPA  125



>gb|ABR16439.1| unknown [Picea sitchensis]
Length=289

 Score =   171 bits (434),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 103/193 (53%), Positives = 128/193 (66%), Gaps = 7/193 (4%)
 Frame = +3

Query  117  MASSRFMAYspspsaphsphIGALRSAS---SALVEQEKYLAELLAERSKLSPFMPVLPN  287
            M+  R++ YSP+  AP    +G +R++S          +YLAELLAER KLSPFM VLPN
Sbjct  1    MSGGRYLQYSPAARAPSPQ-MGGMRTSSMPADHDTSSSRYLAELLAERQKLSPFMQVLPN  59

Query  288  CFRLLNQEILRVTTLLGNASVLDQSGLEHGSPLASGGLFSNG-GANKDRWSSPFQSEMSG  464
            C RLLNQEI+R T ++ N    D   LEH  PLAS GL SNG G +   W    QSE  G
Sbjct  60   CSRLLNQEIIRTTGMVSNQGFGDHDRLEHSGPLASAGLISNGSGMDLGGWGG-LQSERLG  118

Query  465  LVqsssaqswlgsqssssGLIVKQTIRIDIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTD  644
             +  +S+  W G+       +VK+ +R+DIPV+ YPN+NFVGRLLGPRGNSLKRVE +TD
Sbjct  119  -ISQASSMGWHGAPGVPISPVVKKLMRLDIPVDNYPNFNFVGRLLGPRGNSLKRVEATTD  177

Query  645  CRVLIRGRGSIKD  683
            CRV IRGRGS+KD
Sbjct  178  CRVYIRGRGSVKD  190



>ref|XP_010913290.1| PREDICTED: KH domain-containing protein At5g56140-like isoform 
X8 [Elaeis guineensis]
Length=246

 Score =   170 bits (430),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 109/155 (70%), Positives = 127/155 (82%), Gaps = 8/155 (5%)
 Frame = +3

Query  117  MASSRFMAYspspsaphsp-hIGALRSASSALVEQEKYLAELLAERSKLSPFMPVLPNCF  293
            MAS  FMAYSPSPSA     H+  +RSA++A+VEQEKYL+ELLAER KLSPFMPVLP+ +
Sbjct  1    MASGGFMAYSPSPSAAPHSPHLCGIRSATNAIVEQEKYLSELLAERHKLSPFMPVLPHSY  60

Query  294  RLLNQEILRVTTLLGNASVLDQSGLEHGSPLASGGLFSNGG-ANKDRWSSPFQSEMSGLV  470
            RLLNQEILRVTTLLGNAS+LDQSGLEHGSPL +GGLFSNGG A+ + W+S F+SE S   
Sbjct  61   RLLNQEILRVTTLLGNASLLDQSGLEHGSPLTTGGLFSNGGAADMNGWASAFRSEPSS--  118

Query  471  qsssaqswlgsqssssGLIVKQTIRIDIPVEQYPN  575
                A SWLGSQ SSS LIVK+TIR+DIPV++YP 
Sbjct  119  ----AHSWLGSQGSSSNLIVKKTIRVDIPVDKYPT  149



>ref|XP_010913289.1| PREDICTED: KH domain-containing protein At5g56140-like isoform 
X7 [Elaeis guineensis]
Length=260

 Score =   166 bits (421),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 113/162 (70%), Positives = 133/162 (82%), Gaps = 10/162 (6%)
 Frame = +3

Query  117  MASSRFMAYspspsaphsp-hIGALRSASSALVEQEKYLAELLAERSKLSPFMPVLPNCF  293
            MAS  FMAYSPSPSA     H+  +RSA++A+VEQEKYL+ELLAER KLSPFMPVLP+ +
Sbjct  1    MASGGFMAYSPSPSAAPHSPHLCGIRSATNAIVEQEKYLSELLAERHKLSPFMPVLPHSY  60

Query  294  RLLNQ-EILRVTTLLGNASVLDQSGLEHGSPLASGGLFSNGG-ANKDRWSSPFQSEMS--  461
            RLLNQ EILRVTTLLGNAS+LDQSGLEHGSPL +GGLFSNGG A+ + W+S F+SE +  
Sbjct  61   RLLNQAEILRVTTLLGNASLLDQSGLEHGSPLTTGGLFSNGGAADMNGWASAFRSENTRC  120

Query  462  -----GLVqsssaqswlgsqssssGLIVKQTIRIDIPVEQYP  572
                 GL+Q SSA SWLGSQ SSS LIVK+TIR+DIPV++YP
Sbjct  121  NMQRLGLLQPSSAHSWLGSQGSSSNLIVKKTIRVDIPVDKYP  162



>ref|XP_010539129.1| PREDICTED: KH domain-containing protein At4g26480 [Tarenaya hassleriana]
Length=236

 Score =   166 bits (419),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 91/135 (67%), Positives = 103/135 (76%), Gaps = 1/135 (1%)
 Frame = +3

Query  282  PNCFRLLNQEILRVTTLLGNASVLDQSGLEHGSPLASGGLFSNGGANKDRWSSPFQSEMS  461
            P     LN EILRVTTLL NASVL Q+GL+  SPLASGG+F N  A+ + W+S FQSE S
Sbjct  3    PEICNGLNHEILRVTTLLENASVLSQTGLDRPSPLASGGIFQNARADVNGWASQFQSERS  62

Query  462  GLVqsssaqswlgsqssssGLIVKQTIRIDIPVEQYPNYNFVGRLLGPRGNSLKRVEVST  641
             +  S +         SSSGLIVK+ IR+DIPV++YPNYNFVGRLLGPRGNSLKRVE ST
Sbjct  63   -VSSSPAPNWLNSPGGSSSGLIVKREIRVDIPVDKYPNYNFVGRLLGPRGNSLKRVEAST  121

Query  642  DCRVLIRGRGSIKDP  686
            DCRVLIRGRGSIKDP
Sbjct  122  DCRVLIRGRGSIKDP  136



>ref|XP_006645141.1| PREDICTED: KH domain-containing protein At1g09660/At1g09670-like 
[Oryza brachyantha]
Length=290

 Score =   165 bits (418),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 94/170 (55%), Positives = 122/170 (72%), Gaps = 6/170 (4%)
 Frame = +3

Query  177  IGALRSASSALVEQEKYLAELLAERSKLSPFMPVLPNCFRLLNQEILRVTTLLGNASVLD  356
            + +LR +SS   E+E+YLAELLAER KL+PF+ VLP C RLLNQEILR ++L  N + +D
Sbjct  25   LSSLRYSSS---ERERYLAELLAERQKLAPFVQVLPFCTRLLNQEILRASSLPPNHNYVD  81

Query  357  QSGLEHGSPLASGGLFSNGGA-NKDRWSSPFQSEMSGLVqsssaqswlgsqssssGLIVK  533
               +EHGSPL   GL  NG   + + WS   Q+E  G++Q+SS         + +  +VK
Sbjct  82   PERIEHGSPLRLPGLPVNGQPMDLEGWSG-MQTENMGVLQASSMGWNGPPAITGTP-VVK  139

Query  534  QTIRIDIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDCRVLIRGRGSIKD  683
            + +R+D+PV++YPNYNFVGRLLGPRGNSLKRVE ST CRV IRGRGS+KD
Sbjct  140  KVVRLDVPVDKYPNYNFVGRLLGPRGNSLKRVEASTQCRVYIRGRGSVKD  189



>ref|XP_008672524.1| PREDICTED: hypothetical protein isoform X2 [Zea mays]
Length=290

 Score =   163 bits (413),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 95/185 (51%), Positives = 128/185 (69%), Gaps = 6/185 (3%)
 Frame = +3

Query  132  FMAYspspsaphsphIGALRSASSALVEQEKYLAELLAERSKLSPFMPVLPNCFRLLNQE  311
             + YS SP+      + ++R +SS   E+E+YLAELLAER KL+PF+ VLP C RLLNQE
Sbjct  10   LLQYSQSPAHSSPHPLNSMRYSSS---ERERYLAELLAERQKLAPFVQVLPFCTRLLNQE  66

Query  312  ILRVTTLLGNASVLDQSGLEHGSPLASGGLFSNGGA-NKDRWSSPFQSEMSGLVqsssaq  488
            ILR +++  N + +D   +EHGSPL   G   NG   + + WS   Q+E  G++Q+SS  
Sbjct  67   ILRASSMAPNHNFVDPERIEHGSPLRLPGHPVNGQPMDLEGWSG-IQTEHMGVLQASSMG  125

Query  489  swlgsqssssGLIVKQTIRIDIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDCRVLIRGR  668
                   +++  +VK+ +R+D+PV++YPNYNFVGRLLGPRGNSLKRVE ST CRV IRGR
Sbjct  126  WNGAPVLAATP-VVKKVMRLDVPVDKYPNYNFVGRLLGPRGNSLKRVEASTQCRVYIRGR  184

Query  669  GSIKD  683
            GS+KD
Sbjct  185  GSVKD  189



>gb|ABK25791.1| unknown [Picea sitchensis]
Length=294

 Score =   163 bits (413),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 85/156 (54%), Positives = 111/156 (71%), Gaps = 4/156 (3%)
 Frame = +3

Query  222  KYLAELLAERSKLSPFMPVLPNCFRLLNQEILRVTTLLGNASVLDQSGLEHGSPLASGGL  401
            +YL ELLAER KL PFM VLP C RLLNQEI+R++TL+ N   +D   L+HGSP+AS GL
Sbjct  42   RYLTELLAERQKLGPFMQVLPICSRLLNQEIVRLSTLVSNQGFVDHDRLDHGSPMASAGL  101

Query  402  FSNGGANKD--RWSSPFQSEMSGLVqsssaqswlgsqssssGLIVKQTIRIDIPVEQYPN  575
             SNGG   D   WS      MS  +  +++  W G+ + S   ++K  +R+D+P +++P+
Sbjct  102  LSNGGTMMDLGGWSGLQTERMS--ISQATSMGWHGAPAGSINPVIKTVLRMDVPADKFPH  159

Query  576  YNFVGRLLGPRGNSLKRVEVSTDCRVLIRGRGSIKD  683
            +NFVGRLLGPRGNSLKRVE +T CRV IRGRGS+KD
Sbjct  160  FNFVGRLLGPRGNSLKRVEATTGCRVYIRGRGSVKD  195



>dbj|BAK03295.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=225

 Score =   161 bits (407),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 85/130 (65%), Positives = 100/130 (77%), Gaps = 5/130 (4%)
 Frame = +3

Query  300  LNQEILRVTTLLGNASVLDQSGLEHGSPLASGGLFSNGGA-NKDRWSSPFQSEMSGLVqs  476
            +NQEILRV+TLL NAS+L+QSG EHGSPL SGGL+SNG A + + W+S FQSE S    S
Sbjct  1    VNQEILRVSTLLENASLLNQSGFEHGSPLTSGGLYSNGAATDMNGWTSAFQSESSSAAYS  60

Query  477  ssaqswlgsqssssGLIVKQTIRIDIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDCRVL  656
                S   S       I K+T+R+DIPV++YP YNFVGR+LGPRGNSLKRVE +TDCRVL
Sbjct  61   WLGGSQGSSSGL----IGKKTMRVDIPVDKYPTYNFVGRILGPRGNSLKRVEATTDCRVL  116

Query  657  IRGRGSIKDP  686
            IRGRGSIKDP
Sbjct  117  IRGRGSIKDP  126



>gb|ACF79872.1| unknown [Zea mays]
 tpg|DAA56468.1| TPA: hypothetical protein ZEAMMB73_282873 [Zea mays]
Length=212

 Score =   160 bits (405),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 96/187 (51%), Positives = 128/187 (68%), Gaps = 7/187 (4%)
 Frame = +3

Query  132  FMAYspspsaphsphIGALRSASSALVEQEKYLAELLAERSKLSPFMPVLPNCFRLLNQE  311
             + YS SP+      + ++R +SS   E+E+YLAELLAER KL+PF+ VLP C RLLNQE
Sbjct  10   LLQYSQSPAHSSPHPLNSMRYSSS---ERERYLAELLAERQKLAPFVQVLPFCTRLLNQE  66

Query  312  ILRVTTLLGNASVLDQSGLEHGSPLASGGLFSNGGA-NKDRWSSPFQSEMSGL--Vqsss  482
            ILR +++  N + +D   +EHGSPL   G   NG   + + WS   Q+E S    V  +S
Sbjct  67   ILRASSMAPNHNFVDPERIEHGSPLRLPGHPVNGQPMDLEGWSG-IQTEASQHMGVLQAS  125

Query  483  aqswlgsqssssGLIVKQTIRIDIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDCRVLIR  662
            +  W G+   ++  +VK+ +R+D+PV++YPNYNFVGRLLGPRGNSLKRVE ST CRV IR
Sbjct  126  SMGWNGAPVLAATPVVKKVMRLDVPVDKYPNYNFVGRLLGPRGNSLKRVEASTQCRVYIR  185

Query  663  GRGSIKD  683
            GRGS+KD
Sbjct  186  GRGSVKD  192



>ref|NP_001045029.1| Os01g0886300 [Oryza sativa Japonica Group]
 dbj|BAD82237.1| QUAKING isoform 5-like [Oryza sativa Japonica Group]
 dbj|BAD82121.1| QUAKING isoform 5-like [Oryza sativa Japonica Group]
 dbj|BAF06943.1| Os01g0886300 [Oryza sativa Japonica Group]
 gb|EAY76753.1| hypothetical protein OsI_04709 [Oryza sativa Indica Group]
 gb|EAZ14414.1| hypothetical protein OsJ_04338 [Oryza sativa Japonica Group]
 dbj|BAG89356.1| unnamed protein product [Oryza sativa Japonica Group]
Length=290

 Score =   162 bits (411),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 94/170 (55%), Positives = 122/170 (72%), Gaps = 6/170 (4%)
 Frame = +3

Query  177  IGALRSASSALVEQEKYLAELLAERSKLSPFMPVLPNCFRLLNQEILRVTTLLGNASVLD  356
            + +LR +SS   E+E+YLAELLAER KL+PF+ VLP C RLLNQEILR ++L  N + +D
Sbjct  25   LSSLRYSSS---ERERYLAELLAERQKLAPFVQVLPFCTRLLNQEILRASSLPPNHNFVD  81

Query  357  QSGLEHGSPLASGGLFSNGGA-NKDRWSSPFQSEMSGLVqsssaqswlgsqssssGLIVK  533
               +EHGSPL   GL  NG   + + WS   Q+E +  V  +S+  W G  + +   +VK
Sbjct  82   PERIEHGSPLRLPGLPVNGQPMDLEGWSG-MQTE-NMRVLQASSMGWNGPPAITGTPVVK  139

Query  534  QTIRIDIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDCRVLIRGRGSIKD  683
            + +R+D+PV++YPNYNFVGRLLGPRGNSLKRVE ST CRV IRGRGS+KD
Sbjct  140  KVVRLDVPVDKYPNYNFVGRLLGPRGNSLKRVEASTQCRVYIRGRGSVKD  189



>ref|XP_004962051.1| PREDICTED: KH domain-containing protein At1g09660-like isoform 
X1 [Setaria italica]
Length=290

 Score =   162 bits (409),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 90/162 (56%), Positives = 115/162 (71%), Gaps = 3/162 (2%)
 Frame = +3

Query  201  SALVEQEKYLAELLAERSKLSPFMPVLPNCFRLLNQEILRVTTLLGNASVLDQSGLEHGS  380
            S+  ++E+YLAELLAER KL+PF+ VLP C RLLNQEILR ++L  N + ++   ++HGS
Sbjct  30   SSSSDRERYLAELLAERQKLAPFVQVLPFCTRLLNQEILRASSLPPNQNFIEPERIDHGS  89

Query  381  PLASGGLFSNGGA-NKDRWSSPFQSEMSGLVqsssaqswlgsqssssGLIVKQTIRIDIP  557
            PL   G   NG A + D WS   Q+E  G V  S +  W G+       +VK+ +RID+P
Sbjct  90   PLRLAGQSMNGQAMDLDGWSG-MQTEHLG-VLQSPSMVWNGTPGVVGSPVVKKVVRIDVP  147

Query  558  VEQYPNYNFVGRLLGPRGNSLKRVEVSTDCRVLIRGRGSIKD  683
            V++YPNYNFVGRLLGPRGNSLKRVE +T CRV IRGRGS+KD
Sbjct  148  VDKYPNYNFVGRLLGPRGNSLKRVEATTQCRVYIRGRGSVKD  189



>ref|XP_006858588.1| hypothetical protein AMTR_s00071p00192730 [Amborella trichopoda]
 gb|ERN20055.1| hypothetical protein AMTR_s00071p00192730 [Amborella trichopoda]
Length=298

 Score =   162 bits (409),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 91/174 (52%), Positives = 120/174 (69%), Gaps = 8/174 (5%)
 Frame = +3

Query  183  ALRSASSAL-VEQEKYLAELLAERSKLSPFMPVLPNCFRLLNQEILRVTTLLGNASVLDQ  359
             +R +S++L +E  +YLAELLAER KL PFM VLP C RLLNQEI+R + L  + + +D 
Sbjct  27   TMRPSSASLDLESSRYLAELLAERQKLGPFMQVLPICSRLLNQEIVRASGLAPHQAFVDH  86

Query  360  SGLEHGSPLASGGLFSNGGA-NKDRWSSPFQSEMSG-LVqsssaqswlgsqssssGL---  524
              +E GSPL S  L SNGG  + + WS   Q+E +G L + S  Q+       + G+   
Sbjct  87   ERIEQGSPLRSAALLSNGGPMDLEGWSG-MQTEDNGHLQRMSMLQASSMGWHGAPGVPSS  145

Query  525  -IVKQTIRIDIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDCRVLIRGRGSIKD  683
             I+K+ +R+D+PV++YP YNFVGRLLGPRGNSLKRVE +T CRV IRGRGS+KD
Sbjct  146  PIIKKVVRLDVPVDKYPTYNFVGRLLGPRGNSLKRVEATTQCRVYIRGRGSVKD  199



>ref|XP_004970832.1| PREDICTED: KH domain-containing protein At1g09660-like [Setaria 
italica]
Length=291

 Score =   161 bits (407),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 92/171 (54%), Positives = 120/171 (70%), Gaps = 7/171 (4%)
 Frame = +3

Query  177  IGALRSASSALVEQEKYLAELLAERSKLSPFMPVLPNCFRLLNQEILRVTTLLGNASVLD  356
            + +LR +SS   E+E+YLAELLAER KL+PF+ VLP C RLLNQEILR +T+  N + ++
Sbjct  25   LNSLRYSSS---ERERYLAELLAERQKLAPFVQVLPFCTRLLNQEILRASTMAPNHNFVE  81

Query  357  QSGLEHGSPLASGGLFSNGGAN--KDRWSSPFQSEMSGLVqsssaqswlgsqssssGLIV  530
               +EHGSPL   G   NG     +  WS   Q+E  G++Q+SS         + +  +V
Sbjct  82   PERIEHGSPLRLPGHPVNGQPMDLEGGWSG-MQTEHMGVLQASSMGWNGAPALAGTP-VV  139

Query  531  KQTIRIDIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDCRVLIRGRGSIKD  683
            K+ +R+D+PV++YPNYNFVGRLLGPRGNSLKRVE ST CRV IRGRGS+KD
Sbjct  140  KKVVRLDVPVDKYPNYNFVGRLLGPRGNSLKRVEASTQCRVYIRGRGSVKD  190



>ref|XP_008672523.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 tpg|DAA56469.1| TPA: hypothetical protein ZEAMMB73_282873 [Zea mays]
Length=293

 Score =   161 bits (407),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 96/187 (51%), Positives = 128/187 (68%), Gaps = 7/187 (4%)
 Frame = +3

Query  132  FMAYspspsaphsphIGALRSASSALVEQEKYLAELLAERSKLSPFMPVLPNCFRLLNQE  311
             + YS SP+      + ++R +SS   E+E+YLAELLAER KL+PF+ VLP C RLLNQE
Sbjct  10   LLQYSQSPAHSSPHPLNSMRYSSS---ERERYLAELLAERQKLAPFVQVLPFCTRLLNQE  66

Query  312  ILRVTTLLGNASVLDQSGLEHGSPLASGGLFSNGGA-NKDRWSSPFQSEMSGL--Vqsss  482
            ILR +++  N + +D   +EHGSPL   G   NG   + + WS   Q+E S    V  +S
Sbjct  67   ILRASSMAPNHNFVDPERIEHGSPLRLPGHPVNGQPMDLEGWSG-IQTEASQHMGVLQAS  125

Query  483  aqswlgsqssssGLIVKQTIRIDIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDCRVLIR  662
            +  W G+   ++  +VK+ +R+D+PV++YPNYNFVGRLLGPRGNSLKRVE ST CRV IR
Sbjct  126  SMGWNGAPVLAATPVVKKVMRLDVPVDKYPNYNFVGRLLGPRGNSLKRVEASTQCRVYIR  185

Query  663  GRGSIKD  683
            GRGS+KD
Sbjct  186  GRGSVKD  192



>ref|NP_001055572.1| Os05g0419500 [Oryza sativa Japonica Group]
 gb|AAV25646.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF17486.1| Os05g0419500 [Oryza sativa Japonica Group]
 dbj|BAG93747.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC79244.1| hypothetical protein OsI_19999 [Oryza sativa Indica Group]
 gb|EEE63759.1| hypothetical protein OsJ_18578 [Oryza sativa Japonica Group]
Length=291

 Score =   160 bits (406),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 92/167 (55%), Positives = 116/167 (69%), Gaps = 7/167 (4%)
 Frame = +3

Query  186  LRSASSALVEQEKYLAELLAERSKLSPFMPVLPNCFRLLNQEILRVTTLLGNASVLDQSG  365
            LRS +S   E+E+YLAELLAER KL+PFM VLP C RLLNQEILR ++L  N + ++   
Sbjct  28   LRSPAS---ERERYLAELLAERQKLAPFMQVLPFCNRLLNQEILRASSLPPNPNFVEPER  84

Query  366  LEHGSPLASGGLFSNGGA-NKDRWSSPFQSEMSGLVqsssaqswlgsqssssGLIVKQTI  542
            + HGSPL   G   NG   + + WS   Q+EM   V  S +  W  +   +   +VK+ +
Sbjct  85   VNHGSPLRLTGHPMNGQPMDLEGWSG-MQTEMG--VLQSPSMGWNVAPGVAGSPVVKKVV  141

Query  543  RIDIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDCRVLIRGRGSIKD  683
            RID+PV++YPNYNFVGRLLGPRGNSLKRVE +T CRV IRGRGS+KD
Sbjct  142  RIDVPVDKYPNYNFVGRLLGPRGNSLKRVEATTQCRVYIRGRGSVKD  188



>ref|XP_002456759.1| hypothetical protein SORBIDRAFT_03g042090 [Sorghum bicolor]
 gb|EES01879.1| hypothetical protein SORBIDRAFT_03g042090 [Sorghum bicolor]
Length=293

 Score =   160 bits (404),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 91/172 (53%), Positives = 122/172 (71%), Gaps = 7/172 (4%)
 Frame = +3

Query  177  IGALRSASSALVEQEKYLAELLAERSKLSPFMPVLPNCFRLLNQEILRVTTLLGNASVLD  356
            + ++R +SS   E+E+YLAELLAER KL+PF+ VLP C RLLNQEILR +++  N + +D
Sbjct  25   LNSMRYSSS---ERERYLAELLAERQKLAPFVQVLPFCTRLLNQEILRASSMAPNHNFVD  81

Query  357  QSGLEHGSPLASGGLFSNGGA-NKDRWSSPFQSEMSGL--VqsssaqswlgsqssssGLI  527
               +EHGSPL   G   NG   + + W+   Q+E S    V  +S+  W G+   ++  +
Sbjct  82   PERIEHGSPLRLPGHPVNGQPMDLEGWTG-IQTEASQHMGVLQASSMGWNGAPVLAATPV  140

Query  528  VKQTIRIDIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDCRVLIRGRGSIKD  683
            VK+ +R+D+PV++YPNYNFVGRLLGPRGNSLKRVE ST CRV IRGRGS+KD
Sbjct  141  VKKVMRLDVPVDKYPNYNFVGRLLGPRGNSLKRVEASTQCRVYIRGRGSVKD  192



>ref|XP_009414641.1| PREDICTED: KH domain-containing protein At1g09660/At1g09670 [Musa 
acuminata subsp. malaccensis]
Length=295

 Score =   159 bits (403),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 95/197 (48%), Positives = 126/197 (64%), Gaps = 9/197 (5%)
 Frame = +3

Query  111  KQMASSRFMAYspspsaphsphIGALRSASSALVEQEKYLAELLAERSKLSPFMPVLPNC  290
            +++ S  +  YSPS          ++RS +S+  ++E+YLAELLAER KL PFM VLP C
Sbjct  3    ERIPSPAYFQYSPSGVHSSPSPHHSIRSPASS--DRERYLAELLAERQKLGPFMQVLPFC  60

Query  291  FRLLNQEILRVTTLLGNASVLDQSGLEHGSPLASGGLFSNGGA-NKDRWSSPFQSEMSGL  467
             RLL+QEI+R + L  N + +D   +EH SPL   G  SNGG  + + WS   Q+E +G 
Sbjct  61   NRLLSQEIMRASGLAPNQAFVDPERIEHSSPLRLAGHPSNGGPMDLEGWSG-MQAEENGY  119

Query  468  Vqsssaqswlgs-----qssssGLIVKQTIRIDIPVEQYPNYNFVGRLLGPRGNSLKRVE  632
                 A     +        S+  IVK+ IR+D+PV++YPN+NFVGRLLGPRGNSLKRVE
Sbjct  120  FHRMGAIQTSTAGWNGIPGVSTSPIVKKVIRLDVPVDKYPNFNFVGRLLGPRGNSLKRVE  179

Query  633  VSTDCRVLIRGRGSIKD  683
             +T CRV IRGRGS+KD
Sbjct  180  ATTQCRVYIRGRGSVKD  196



>ref|XP_008775561.1| PREDICTED: KH domain-containing protein At1g09660/At1g09670 isoform 
X1 [Phoenix dactylifera]
Length=293

 Score =   159 bits (403),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 91/173 (53%), Positives = 116/173 (67%), Gaps = 9/173 (5%)
 Frame = +3

Query  183  ALRSASSALVEQEKYLAELLAERSKLSPFMPVLPNCFRLLNQEILRVTTLLGNASVLDQS  362
            +LRS +S+  ++E+YLAELLAER KL PF+ VLP C RLLNQEI+R + L  N S +D  
Sbjct  25   SLRSPASS--DRERYLAELLAERQKLVPFVQVLPFCCRLLNQEIVRASGLAPNQSFVDPE  82

Query  363  GLEHGSPLASGGLFSNGGA-NKDRWSSPFQSEMSGLVqsssaqswlg-----sqssssGL  524
             +EHGSPL   G  SNGG  + + W    Q+E +G  Q              +    +  
Sbjct  83   RIEHGSPLRLTGHPSNGGPMDLEGWPG-MQTEDNGYFQRMGPLQASPVGWNGAPGVPTSP  141

Query  525  IVKQTIRIDIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDCRVLIRGRGSIKD  683
            IVK+ +R+D+PV+++PNYNFVGRLLGPRGNSLKRVE ST CRV IRGRGS+KD
Sbjct  142  IVKKVLRLDVPVDKFPNYNFVGRLLGPRGNSLKRVEASTQCRVYIRGRGSVKD  194



>emb|CDM85378.1| unnamed protein product [Triticum aestivum]
Length=294

 Score =   158 bits (400),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 88/162 (54%), Positives = 113/162 (70%), Gaps = 3/162 (2%)
 Frame = +3

Query  201  SALVEQEKYLAELLAERSKLSPFMPVLPNCFRLLNQEILRVTTLLGNASVLDQSGLEHGS  380
            SA  E+E+YLAELLAER KL PF+ VLP C RLLNQEILR ++L  N + +D   +EHGS
Sbjct  34   SASSERERYLAELLAERQKLGPFIQVLPYCTRLLNQEILRASSLPPNHNFVDAERIEHGS  93

Query  381  PLASGGLFSNGGA-NKDRWSSPFQSEMSGLVqsssaqswlgsqssssGLIVKQTIRIDIP  557
            PL   G   NG   + + WS   Q+E  G++Q+S            +  +VK+ +R+D+P
Sbjct  94   PLRLPGHPVNGQPMDLEGWSG-RQAEHMGVLQASPMSWNGAPALGGTP-VVKKLVRLDVP  151

Query  558  VEQYPNYNFVGRLLGPRGNSLKRVEVSTDCRVLIRGRGSIKD  683
            V++YPN+NFVGRLLGPRGNSLKRVE +T CRV IRGRGS+KD
Sbjct  152  VDKYPNFNFVGRLLGPRGNSLKRVEATTQCRVYIRGRGSVKD  193



>ref|XP_006654415.1| PREDICTED: KH domain-containing protein At1g09660/At1g09670-like 
isoform X1 [Oryza brachyantha]
Length=290

 Score =   157 bits (398),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 93/167 (56%), Positives = 117/167 (70%), Gaps = 6/167 (4%)
 Frame = +3

Query  186  LRSASSALVEQEKYLAELLAERSKLSPFMPVLPNCFRLLNQEILRVTTLLGNASVLDQSG  365
            LRS +S   E+E+YLAELLAER KL+PFM VLP C RLLNQEILR ++L  N + +D   
Sbjct  28   LRSPAS---ERERYLAELLAERQKLAPFMQVLPFCNRLLNQEILRASSLPPNPNFVDPER  84

Query  366  LEHGSPLASGGLFSNGGA-NKDRWSSPFQSEMSGLVqsssaqswlgsqssssGLIVKQTI  542
            +  GSPL   G   NG   + + WS   Q+E   +V  S +  W G+   + G +VK+ +
Sbjct  85   VNLGSPLRLTGRPMNGQPMDLEGWSG-MQTEHM-VVPQSPSMGWNGAPGVAGGPVVKKVV  142

Query  543  RIDIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDCRVLIRGRGSIKD  683
            RID+PV++YPNYNFVGRLLGPRGNSLKRVE +T CRV IRGRGS+KD
Sbjct  143  RIDVPVDKYPNYNFVGRLLGPRGNSLKRVEATTQCRVYIRGRGSVKD  189



>ref|XP_008788353.1| PREDICTED: KH domain-containing protein At1g09660/At1g09670-like, 
partial [Phoenix dactylifera]
Length=256

 Score =   157 bits (396),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 90/173 (52%), Positives = 116/173 (67%), Gaps = 9/173 (5%)
 Frame = +3

Query  183  ALRSASSALVEQEKYLAELLAERSKLSPFMPVLPNCFRLLNQEILRVTTLLGNASVLDQS  362
            +LRS +S+  ++E+YLAELLAER KL PF  VLP C RLL+QEI+R + L  N S +D  
Sbjct  25   SLRSPASS--DRERYLAELLAERQKLVPFAQVLPFCSRLLDQEIIRASGLAPNQSFVDSE  82

Query  363  GLEHGSPLASGGLFSNGGA-NKDRWSSPFQSEMSGLVqsssaqswlg-----sqssssGL  524
             +EHG+PL   G  SNGG  + + WS   Q+E +   Q              +   ++  
Sbjct  83   RIEHGNPLRLTGHPSNGGPMDLEGWSG-MQTEDNRYFQRMGPLQASPVGWNGAAGVATSP  141

Query  525  IVKQTIRIDIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDCRVLIRGRGSIKD  683
            IVK+ IR+D+P+E++PNYNFVGRLLGPRGNSLKRVE ST CRV IRGRGS+KD
Sbjct  142  IVKKVIRLDVPIEKFPNYNFVGRLLGPRGNSLKRVETSTQCRVYIRGRGSVKD  194



>ref|XP_010927868.1| PREDICTED: KH domain-containing protein At1g09660/At1g09670-like 
[Elaeis guineensis]
Length=293

 Score =   157 bits (396),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 88/173 (51%), Positives = 115/173 (66%), Gaps = 9/173 (5%)
 Frame = +3

Query  183  ALRSASSALVEQEKYLAELLAERSKLSPFMPVLPNCFRLLNQEILRVTTLLGNASVLDQS  362
            ++RS +S+  ++E+YLAELLAER KL PF+ VLP C RLLNQEI+R + L  N S +D  
Sbjct  25   SMRSPASS--DRERYLAELLAERQKLVPFVQVLPFCCRLLNQEIVRASGLAPNQSFVDPE  82

Query  363  GLEHGSPLASGGLFSNGGA-NKDRWSSPFQSEMSGLVqsssaqswlg-----sqssssGL  524
             +EHGSPL      SNGG  + + W    Q+E +G  Q              +    +  
Sbjct  83   RIEHGSPLRLTSHPSNGGPMDLEGWPG-MQTEDNGYFQRMGPLQASPVGWNGAPGVPTSP  141

Query  525  IVKQTIRIDIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDCRVLIRGRGSIKD  683
            +VK+ +R+D+PV+++PNYNFVGRLLGPRGNSLKRVE ST CRV IRGRGS+KD
Sbjct  142  VVKKVVRLDVPVDKFPNYNFVGRLLGPRGNSLKRVEASTQCRVYIRGRGSVKD  194



>ref|NP_001142049.1| hypothetical protein [Zea mays]
 gb|ACF87541.1| unknown [Zea mays]
 tpg|DAA56470.1| TPA: hypothetical protein ZEAMMB73_282873 [Zea mays]
Length=285

 Score =   155 bits (392),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 87/157 (55%), Positives = 112/157 (71%), Gaps = 4/157 (3%)
 Frame = +3

Query  222  KYLAELLAERSKLSPFMPVLPNCFRLLNQEILRVTTLLGNASVLDQSGLEHGSPLASGGL  401
            +YLAELLAER KL+PF+ VLP C RLLNQEILR +++  N + +D   +EHGSPL   G 
Sbjct  29   RYLAELLAERQKLAPFVQVLPFCTRLLNQEILRASSMAPNHNFVDPERIEHGSPLRLPGH  88

Query  402  FSNGGA-NKDRWSSPFQSEMSGL--VqsssaqswlgsqssssGLIVKQTIRIDIPVEQYP  572
              NG   + + WS   Q+E S    V  +S+  W G+   ++  +VK+ +R+D+PV++YP
Sbjct  89   PVNGQPMDLEGWSG-IQTEASQHMGVLQASSMGWNGAPVLAATPVVKKVMRLDVPVDKYP  147

Query  573  NYNFVGRLLGPRGNSLKRVEVSTDCRVLIRGRGSIKD  683
            NYNFVGRLLGPRGNSLKRVE ST CRV IRGRGS+KD
Sbjct  148  NYNFVGRLLGPRGNSLKRVEASTQCRVYIRGRGSVKD  184



>ref|XP_010245421.1| PREDICTED: KH domain-containing protein At1g09660/At1g09670 isoform 
X2 [Nelumbo nucifera]
Length=293

 Score =   154 bits (390),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 86/173 (50%), Positives = 109/173 (63%), Gaps = 10/173 (6%)
 Frame = +3

Query  180  GALRSASSALVEQEKYLAELLAERSKLSPFMPVLPNCFRLLNQEILRVTTLLGNASVLDQ  359
            G+L   S+A     +YLAELLAER KL PFM VLP C RLLNQEI+R + L+ N + +D 
Sbjct  27   GSLDRESNA-----RYLAELLAERQKLGPFMQVLPLCSRLLNQEIVRASGLVPNQTFVDH  81

Query  360  SGLEHGSPLASGGLFSNGGANKDRWSSPFQSEMSGLVqsssaqswlg-----sqssssGL  524
              +EH SPL S     +GG           SE +GL+Q              +    +  
Sbjct  82   ERIEHESPLRSTAQHPDGGPMDLEGWPVMHSEENGLLQRMGTFQASSMGWTGATGVPTSP  141

Query  525  IVKQTIRIDIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDCRVLIRGRGSIKD  683
            +VK+ IR+D+PV+++PNYNFVGRLLGPRGNSLKRVE +T CRV IRGRGS+KD
Sbjct  142  VVKKVIRLDVPVDKFPNYNFVGRLLGPRGNSLKRVEATTQCRVYIRGRGSVKD  194



>ref|XP_004230441.1| PREDICTED: KH domain-containing protein At1g09660/At1g09670 [Solanum 
lycopersicum]
Length=295

 Score =   154 bits (390),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 88/168 (52%), Positives = 112/168 (67%), Gaps = 8/168 (5%)
 Frame = +3

Query  198  SSALVEQEKYLAELLAERSKLSPFMPVLPNCFRLLNQEILRVTTLLGNASVLDQSGLEHG  377
            SS+L ++E+YLAELL ER KL PFM +LP C RLLNQEI+R T LL N  V DQ  +   
Sbjct  27   SSSLTDRERYLAELLGERQKLGPFMQILPICNRLLNQEIMRTTALLSNQFV-DQERMGQE  85

Query  378  SPLASGGLFSNGGA-NKDRWSSPFQSEMSGLVqsssaqsw-----lgsqssssGLIVKQT  539
            SP  S     NGG  NK  WS+  Q+E + L+Q  +              +++  +VK+ 
Sbjct  86   SPHRSVSQHMNGGQINKGAWSA-MQTEENRLLQKIAPFQPSPLDWHVVPGTATTPVVKRV  144

Query  540  IRIDIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDCRVLIRGRGSIKD  683
            IR+D+PVE +PNYNFVGR+LGPRGNSLKRVE  T+CRV IRG+GS+KD
Sbjct  145  IRLDVPVENFPNYNFVGRILGPRGNSLKRVEAITECRVYIRGQGSVKD  192



>ref|XP_010930408.1| PREDICTED: KH domain-containing protein At1g09660/At1g09670-like 
isoform X2 [Elaeis guineensis]
Length=299

 Score =   154 bits (390),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 84/164 (51%), Positives = 113/164 (69%), Gaps = 8/164 (5%)
 Frame = +3

Query  210  VEQEKYLAELLAERSKLSPFMPVLPNCFRLLNQEILRVTTLLGNASVLDQSGLEHGSPLA  389
            +++E+YLAEL+AER KL PFM VLP C RLLNQEILR + L  N + + +  +EHGSPL 
Sbjct  39   LDRERYLAELIAERQKLGPFMQVLPFCSRLLNQEILRASVLAPNQNFIPER-MEHGSPLR  97

Query  390  SGGLFSNGGA-NKDRWSSPFQSEMSGLVqsssaqswlg-----sqssssGLIVKQTIRID  551
              G  +NGG  + + WS+  Q E +G +Q   A          +   + G +VK+ +R+D
Sbjct  98   LAGHSTNGGPMDLEGWSA-MQVEENGYLQRMGAFHAPAVGWNGAPGVAIGPVVKKVVRLD  156

Query  552  IPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDCRVLIRGRGSIKD  683
            +P +++PNYNFVGRLLGPRGNSLKRVE +T CRV IRG+GS+KD
Sbjct  157  VPADKFPNYNFVGRLLGPRGNSLKRVEATTQCRVYIRGQGSVKD  200



>ref|XP_010930407.1| PREDICTED: KH domain-containing protein At1g09660/At1g09670-like 
isoform X1 [Elaeis guineensis]
Length=329

 Score =   154 bits (390),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 84/164 (51%), Positives = 113/164 (69%), Gaps = 8/164 (5%)
 Frame = +3

Query  210  VEQEKYLAELLAERSKLSPFMPVLPNCFRLLNQEILRVTTLLGNASVLDQSGLEHGSPLA  389
            +++E+YLAEL+AER KL PFM VLP C RLLNQEILR + L  N + + +  +EHGSPL 
Sbjct  39   LDRERYLAELIAERQKLGPFMQVLPFCSRLLNQEILRASVLAPNQNFIPER-MEHGSPLR  97

Query  390  SGGLFSNGGA-NKDRWSSPFQSEMSGLVqsssaqswlg-----sqssssGLIVKQTIRID  551
              G  +NGG  + + WS+  Q E +G +Q   A          +   + G +VK+ +R+D
Sbjct  98   LAGHSTNGGPMDLEGWSA-MQVEENGYLQRMGAFHAPAVGWNGAPGVAIGPVVKKVVRLD  156

Query  552  IPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDCRVLIRGRGSIKD  683
            +P +++PNYNFVGRLLGPRGNSLKRVE +T CRV IRG+GS+KD
Sbjct  157  VPADKFPNYNFVGRLLGPRGNSLKRVEATTQCRVYIRGQGSVKD  200



>ref|XP_002263798.1| PREDICTED: KH domain-containing protein At1g09660/At1g09670 [Vitis 
vinifera]
 emb|CBI29693.3| unnamed protein product [Vitis vinifera]
Length=295

 Score =   152 bits (385),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 82/163 (50%), Positives = 112/163 (69%), Gaps = 7/163 (4%)
 Frame = +3

Query  213  EQEKYLAELLAERSKLSPFMPVLPNCFRLLNQEILRVTTLLGNASVLDQSGLEHGSPLAS  392
            ++E+YLAELLAE+ KL PFM +LP C RLLNQEI R++ +  N   +D   +EH SP  S
Sbjct  31   DRERYLAELLAEKQKLGPFMQILPQCSRLLNQEIRRLSAIAPNQGFVDLERIEHDSPFRS  90

Query  393  GGLFSNGGA-NKDRWSSPFQSEMSG-LVqsssaqswlgsqssssGL----IVKQTIRIDI  554
             G   NGG  + + W +  Q+E +G L + +  Q+       + G+    +VK+ IR+D+
Sbjct  91   LGQHPNGGPMDLEGWPA-MQTEENGPLRRMAPFQASSLGWHRAPGIPTTPVVKRVIRLDV  149

Query  555  PVEQYPNYNFVGRLLGPRGNSLKRVEVSTDCRVLIRGRGSIKD  683
            PV++YPNYNFVGR+LGPRGNSLKRVE  T+CRV IRG+GS+KD
Sbjct  150  PVDKYPNYNFVGRILGPRGNSLKRVEAMTECRVYIRGQGSVKD  192



>ref|XP_006349313.1| PREDICTED: KH domain-containing protein At1g09660-like [Solanum 
tuberosum]
Length=295

 Score =   152 bits (384),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 87/168 (52%), Positives = 111/168 (66%), Gaps = 8/168 (5%)
 Frame = +3

Query  198  SSALVEQEKYLAELLAERSKLSPFMPVLPNCFRLLNQEILRVTTLLGNASVLDQSGLEHG  377
            SS+L ++E+YLAELL ER KL PFM +LP C RLLNQEI+R T LL N  V DQ  +   
Sbjct  27   SSSLTDRERYLAELLGERQKLGPFMQILPICSRLLNQEIMRATALLSNQFV-DQERMGQE  85

Query  378  SPLASGGLFSNGGA-NKDRWSSPFQSEMSGLVqsssaqsw-----lgsqssssGLIVKQT  539
            SP  S     NGG  N   WS+  Q+E + L+Q  +              +++  +VK+ 
Sbjct  86   SPHRSVSQHINGGQINMGAWSA-MQTEENRLLQKMAPFQPSPLDWHVVPGTATTPVVKRV  144

Query  540  IRIDIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDCRVLIRGRGSIKD  683
            IR+D+PVE +PNYNFVGR+LGPRGNSLKRVE  T+CRV IRG+GS+KD
Sbjct  145  IRLDVPVENFPNYNFVGRILGPRGNSLKRVEAITECRVYIRGQGSVKD  192



>gb|EMS53218.1| hypothetical protein TRIUR3_13157 [Triticum urartu]
Length=308

 Score =   152 bits (384),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 83/155 (54%), Positives = 109/155 (70%), Gaps = 3/155 (2%)
 Frame = +3

Query  222  KYLAELLAERSKLSPFMPVLPNCFRLLNQEILRVTTLLGNASVLDQSGLEHGSPLASGGL  401
            +Y+AELLAER KL+PF+ VLP C RLLNQEILR ++L  N + +D   +EHGSPL   G 
Sbjct  32   RYVAELLAERQKLAPFVQVLPYCTRLLNQEILRASSLPPNHNFVDAERIEHGSPLRLPGH  91

Query  402  FSNGGA-NKDRWSSPFQSEMSGLVqsssaqswlgsqssssGLIVKQTIRIDIPVEQYPNY  578
              NG   + + WS   Q+E  G++Q+S            +  +VK+ +R+D+PV++YPN+
Sbjct  92   PVNGQPMDLEGWSG-RQAEHMGVLQASPMSWNGAPALGGTP-VVKKLVRLDVPVDKYPNF  149

Query  579  NFVGRLLGPRGNSLKRVEVSTDCRVLIRGRGSIKD  683
            NFVGRLLGPRGNSLKRVE +T CRV IRGRGS+KD
Sbjct  150  NFVGRLLGPRGNSLKRVEATTQCRVYIRGRGSVKD  184



>ref|XP_010278944.1| PREDICTED: KH domain-containing protein At2g38610 [Nelumbo nucifera]
Length=281

 Score =   151 bits (382),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 88/160 (55%), Positives = 106/160 (66%), Gaps = 5/160 (3%)
 Frame = +3

Query  216  QEKYLAELLAERSKLSPFMPVLPNCFRLLNQEILRVTTLLGNASVLDQSGLEHGSP--LA  389
            + +YL ELLAE  KL PFM VLP C RLLNQEILRV+ +  N S  D   L+HGSP  +A
Sbjct  26   ESQYLTELLAEHQKLGPFMQVLPICSRLLNQEILRVSGMASNQSFGDYDRLQHGSPSPMA  85

Query  390  SGGLFSN-GGANKDRWSSPFQSEMSGLVqsssaqswlgsqssssGLIVKQTIRIDIPVEQ  566
            S  L S+ GG     W+   Q    G         W G+ +S S  +VK+ +R++IPV+ 
Sbjct  86   SSNLMSSFGGTGLGVWNGLSQERFGG--PQGITMDWQGAPASPSSFVVKKILRLEIPVDS  143

Query  567  YPNYNFVGRLLGPRGNSLKRVEVSTDCRVLIRGRGSIKDP  686
            YPN+NFVGRLLGPRGNSLKRVE ST CRV IRG+GSIKDP
Sbjct  144  YPNFNFVGRLLGPRGNSLKRVEASTGCRVYIRGKGSIKDP  183



>ref|XP_009776889.1| PREDICTED: KH domain-containing protein At1g09660/At1g09670-like 
[Nicotiana sylvestris]
Length=296

 Score =   152 bits (383),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 86/168 (51%), Positives = 113/168 (67%), Gaps = 8/168 (5%)
 Frame = +3

Query  198  SSALVEQEKYLAELLAERSKLSPFMPVLPNCFRLLNQEILRVTTLLGNASVLDQSGLEHG  377
            SS+L ++E+YLA+LL ER KL PFM +LP C RLLNQEI+R + LL N  V DQ  +   
Sbjct  28   SSSLTDRERYLADLLGERQKLGPFMQILPICSRLLNQEIMRASALLSNQFV-DQERMGQE  86

Query  378  SPLASGGLFSNGGA-NKDRWSSPFQSEMSGLVqsssaqsw-----lgsqssssGLIVKQT  539
            SP  S     NGG  N   WS+  Q+E + L+Q  +              +++ L+VK+ 
Sbjct  87   SPHRSISQQMNGGQINVGAWSA-MQTEENRLLQKMALFQPSPLDWHVVPGTATTLVVKKV  145

Query  540  IRIDIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDCRVLIRGRGSIKD  683
            IR+D+PVE++PNYNFVGR+LGPRGNSLKRVE  T+CRV IRG+GS+KD
Sbjct  146  IRLDVPVEKFPNYNFVGRILGPRGNSLKRVEAITECRVYIRGQGSVKD  193



>gb|EYU42056.1| hypothetical protein MIMGU_mgv1a011431mg [Erythranthe guttata]
Length=282

 Score =   151 bits (382),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 89/166 (54%), Positives = 108/166 (65%), Gaps = 5/166 (3%)
 Frame = +3

Query  198  SSALVEQEKYLAELLAERSKLSPFMPVLPNCFRLLNQEILRVTTLLGNASVLDQSGLEH-  374
            S+   +  +YL+ELLAE  KL PFM VLP C RLLNQEILRVT ++ N S  +   L H 
Sbjct  21   SNPDFDSNQYLSELLAEHQKLGPFMQVLPTCTRLLNQEILRVTGMMPNQSFGELERLRHR  80

Query  375  -GSPLASGGLFSN-GGANKDRWSSPFQSEMSGLVqsssaqswlgsqssssGLIVKQTIRI  548
              SP+AS  L SN  G     W+ P Q   SG         W G+ +S S   VK+ +R+
Sbjct  81   SPSPMASSNLLSNIAGTGLSGWNGPPQERFSG--PPGMTMDWQGAPASPSSYTVKRILRL  138

Query  549  DIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDCRVLIRGRGSIKDP  686
            +IPV+ YP +NFVGRLLGPRGNSLKRVEV+T CRV IRG+GSIKDP
Sbjct  139  EIPVDNYPTFNFVGRLLGPRGNSLKRVEVTTGCRVYIRGKGSIKDP  184



>ref|XP_010244589.1| PREDICTED: KH domain-containing protein At2g38610-like isoform 
X2 [Nelumbo nucifera]
Length=233

 Score =   149 bits (377),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 86/158 (54%), Positives = 107/158 (68%), Gaps = 5/158 (3%)
 Frame = +3

Query  222  KYLAELLAERSKLSPFMPVLPNCFRLLNQEILRVTTLLGNASVLDQSGLEHGSP--LASG  395
            +YLAELLAE  KL PF+ VLP C RLLNQEI+RV+ ++ N    +   L+HGSP  LAS 
Sbjct  28   QYLAELLAEHQKLGPFVQVLPICNRLLNQEIIRVSGMVSNQGFGEYDRLQHGSPSPLASS  87

Query  396  GLFSN-GGANKDRWSSPFQSEMSGLVqsssaqswlgsqssssGLIVKQTIRIDIPVEQYP  572
             L S+ GG     W+   Q  + GL        W G  +S S  +VK+ +R++IPV+ +P
Sbjct  88   NLVSHVGGTGISAWNGFSQERLGGL--QGMTMDWQGGSTSPSSYVVKKILRLEIPVDTFP  145

Query  573  NYNFVGRLLGPRGNSLKRVEVSTDCRVLIRGRGSIKDP  686
            N+NFVGRLLGPRGNSLKRVE ST CRV IRG+GSIKDP
Sbjct  146  NFNFVGRLLGPRGNSLKRVEASTGCRVYIRGKGSIKDP  183



>ref|XP_004133720.1| PREDICTED: KH domain-containing protein At1g09660-like [Cucumis 
sativus]
 ref|XP_004155228.1| PREDICTED: KH domain-containing protein At1g09660-like [Cucumis 
sativus]
 ref|XP_008452242.1| PREDICTED: KH domain-containing protein At1g09660/At1g09670 [Cucumis 
melo]
Length=289

 Score =   151 bits (381),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 86/166 (52%), Positives = 106/166 (64%), Gaps = 7/166 (4%)
 Frame = +3

Query  201  SALVEQEKYLAELLAERSKLSPFMPVLPNCFRLLNQEILRVTTLLGNASVLDQSGLEHGS  380
            S  +++E+ LAELL+ER KL PF+ VLP+C RLLNQEI R++ L  N + +D    EHGS
Sbjct  27   SIPLDRERCLAELLSERQKLGPFVQVLPHCSRLLNQEIRRLSGL--NQTSVDHERFEHGS  84

Query  381  PLASGGLFSNGGANKDRWSSPFQSEMSGLVqsssaqswlgsq-ssssGL----IVKQTIR  545
            P  S G  SNG         P Q E SG V                 G+    IVK+ +R
Sbjct  85   PYRSLGQLSNGRPMDMEGWPPMQMEGSGHVHGMGPLQAHSMGWPRVQGIPTTPIVKRVVR  144

Query  546  IDIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDCRVLIRGRGSIKD  683
            +D+PV++YPNYNFVGRLLGPRGNSLKRVE  T+CRV IRG+GSIKD
Sbjct  145  LDVPVDKYPNYNFVGRLLGPRGNSLKRVEALTECRVYIRGKGSIKD  190



>gb|EMT28447.1| hypothetical protein F775_05859 [Aegilops tauschii]
Length=323

 Score =   152 bits (383),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 84/155 (54%), Positives = 108/155 (70%), Gaps = 3/155 (2%)
 Frame = +3

Query  222  KYLAELLAERSKLSPFMPVLPNCFRLLNQEILRVTTLLGNASVLDQSGLEHGSPLASGGL  401
            +YLAELLAER KL PF+ VLP C RLLNQEILR ++L  N + +D   +EHGSPL   G 
Sbjct  32   RYLAELLAERQKLGPFIQVLPYCTRLLNQEILRASSLPPNHNFVDAERIEHGSPLRLPGH  91

Query  402  FSNGGA-NKDRWSSPFQSEMSGLVqsssaqswlgsqssssGLIVKQTIRIDIPVEQYPNY  578
              NG   + + WS   Q+E  G++Q+S            +  +VK+ +R+D+PV++YPN+
Sbjct  92   PVNGQPMDLEGWSG-RQAEHMGVLQASPMSWNGAPALGGTP-VVKKLVRLDVPVDKYPNF  149

Query  579  NFVGRLLGPRGNSLKRVEVSTDCRVLIRGRGSIKD  683
            NFVGRLLGPRGNSLKRVE +T CRV IRGRGS+KD
Sbjct  150  NFVGRLLGPRGNSLKRVEATTQCRVYIRGRGSVKD  184



>ref|XP_008786388.1| PREDICTED: KH domain-containing protein At1g09660/At1g09670-like 
[Phoenix dactylifera]
Length=296

 Score =   151 bits (381),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 84/161 (52%), Positives = 114/161 (71%), Gaps = 5/161 (3%)
 Frame = +3

Query  210  VEQEKYLAELLAERSKLSPFMPVLPNCFRLLNQEILRVTTLLGNASVLDQSGLEHGSPLA  389
            +++E+YLAEL+AER KL PFM VLP C R+LNQEI R + L  N + + +  +EHGSPL 
Sbjct  39   LDRERYLAELMAERQKLVPFMRVLPFCSRILNQEIFRASVLAPNQNFVTER-MEHGSPLR  97

Query  390  SGGLFSNGGA-NKDRWSSPFQSEMSGL--VqsssaqswlgsqssssGLIVKQTIRIDIPV  560
              G  + GG+ + D WS+  Q E +G      +SA  W G+   ++  +VK+ +R+D+PV
Sbjct  98   IAGHTTKGGSMDLDGWSA-MQVEENGWNGAFHASAVGWNGAPGVATSPVVKKVVRLDVPV  156

Query  561  EQYPNYNFVGRLLGPRGNSLKRVEVSTDCRVLIRGRGSIKD  683
             ++PNYNFVGRLLGPRGNSLKRVE +T CRV IRG+GS+KD
Sbjct  157  NKFPNYNFVGRLLGPRGNSLKRVEATTQCRVYIRGQGSVKD  197



>ref|XP_003564796.1| PREDICTED: KH domain-containing protein At1g09660/At1g09670 [Brachypodium 
distachyon]
Length=288

 Score =   151 bits (381),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 91/170 (54%), Positives = 119/170 (70%), Gaps = 9/170 (5%)
 Frame = +3

Query  177  IGALRSASSALVEQEKYLAELLAERSKLSPFMPVLPNCFRLLNQEILRVTTLLGNASVLD  356
              +LR++SS   E+E+YLAELLAER KL+PF+ VLP C RLLNQEILR +++  N    +
Sbjct  26   FNSLRNSSS---ERERYLAELLAERQKLAPFVQVLPFCTRLLNQEILRASSMQPNH---N  79

Query  357  QSGLEHGSPLASGGLFSNGGA-NKDRWSSPFQSEMSGLVqsssaqswlgsqssssGLIVK  533
               +EHGSPL   G   NG   + + WS   Q+   G V  +S  SW G+ + S   +VK
Sbjct  80   PERIEHGSPLRLPGHPVNGQPMDLEGWSG-MQTPHMG-VMQASPMSWNGAPTHSGPPVVK  137

Query  534  QTIRIDIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDCRVLIRGRGSIKD  683
            + +R+D+PV++YPN+NFVGRLLGPRGNSLKRVE +T CRV IRGRGS+KD
Sbjct  138  KLMRLDVPVDKYPNFNFVGRLLGPRGNSLKRVEATTQCRVYIRGRGSVKD  187



>ref|XP_010245420.1| PREDICTED: KH domain-containing protein At1g09660/At1g09670 isoform 
X1 [Nelumbo nucifera]
Length=298

 Score =   151 bits (381),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 89/178 (50%), Positives = 112/178 (63%), Gaps = 15/178 (8%)
 Frame = +3

Query  180  GALRSASSALVEQEKYLAELLAERSKLSPFMPVLPNCFRLLNQEILRVTTLLGNASVLDQ  359
            G+L   S+A     +YLAELLAER KL PFM VLP C RLLNQEI+R + L+ N + +D 
Sbjct  27   GSLDRESNA-----RYLAELLAERQKLGPFMQVLPLCSRLLNQEIVRASGLVPNQTFVDH  81

Query  360  SGLEHGSPLASGGLFSNGGANKDRWSSPFQSEMSGLVqsssaqswlgsqssssGL-----  524
              +EH SPL S     +GG           SE + L ++   Q     Q+SS G      
Sbjct  82   ERIEHESPLRSTAQHPDGGPMDLEGWPVMHSEYTLLQENGLLQRMGTFQASSMGWTGATG  141

Query  525  -----IVKQTIRIDIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDCRVLIRGRGSIKD  683
                 +VK+ IR+D+PV+++PNYNFVGRLLGPRGNSLKRVE +T CRV IRGRGS+KD
Sbjct  142  VPTSPVVKKVIRLDVPVDKFPNYNFVGRLLGPRGNSLKRVEATTQCRVYIRGRGSVKD  199



>ref|XP_008803015.1| PREDICTED: LOW QUALITY PROTEIN: KH domain-containing protein 
SPIN1-like [Phoenix dactylifera]
Length=281

 Score =   150 bits (379),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 89/157 (57%), Positives = 105/157 (67%), Gaps = 5/157 (3%)
 Frame = +3

Query  225  YLAELLAERSKLSPFMPVLPNCFRLLNQEILRVTTLLGNASVLDQSGLEHGSP--LASGG  398
            YLAELLAE  KL PFM VLP C RLLNQEI+RV+ ++ N    D   ++HGSP  +AS  
Sbjct  29   YLAELLAEHQKLGPFMQVLPICSRLLNQEIIRVSGMVSNQGFGDFDRMQHGSPSPIASSN  88

Query  399  LFSN-GGANKDRWSSPFQSEMSGLVqsssaqswlgsqssssGLIVKQTIRIDIPVEQYPN  575
            L  N GG +   WS   Q E  G +Q  +        S SS  +VK+ +R+DIPV  YPN
Sbjct  89   LIPNVGGTSLGGWSG-LQHERIGFLQGMNLDWQGAPPSPSS-YVVKKILRLDIPVNTYPN  146

Query  576  YNFVGRLLGPRGNSLKRVEVSTDCRVLIRGRGSIKDP  686
            +NFVGRLLGPRGNSLKRVE ST CRV IRG+GSIKDP
Sbjct  147  FNFVGRLLGPRGNSLKRVEASTGCRVYIRGKGSIKDP  183



>ref|XP_009600353.1| PREDICTED: KH domain-containing protein At3g08620-like isoform 
X1 [Nicotiana tomentosiformis]
Length=288

 Score =   150 bits (379),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 85/163 (52%), Positives = 107/163 (66%), Gaps = 10/163 (6%)
 Frame = +3

Query  222  KYLAELLAERSKLSPFMPVLPNCFRLLNQEILRVTTLLGNASVLDQSGLEHGSP--LASG  395
            +YL ELLAER KL PF  VLP C RLLNQEILRV+ ++ N  + D   L+ GSP  +AS 
Sbjct  30   QYLTELLAERQKLGPFTQVLPICSRLLNQEILRVSGMIPNQGLSDYDRLQRGSPSPMASF  89

Query  396  GLFSN------GGANKDRWSSPFQSEMSGLVqsssaqswlgsqssssGLIVKQTIRIDIP  557
             +  +      GG   + W++P +  + G         W  +  S S  +VK+ +R+DIP
Sbjct  90   DMMQDIGGKPLGGWTGNGWNTPQEQRLDG--PQGMPIDWQAAPGSPSSFVVKRILRLDIP  147

Query  558  VEQYPNYNFVGRLLGPRGNSLKRVEVSTDCRVLIRGRGSIKDP  686
            VE+YPN+NFVGRLLGPRGNSLKRVE ST CRV IRG+GSIKDP
Sbjct  148  VERYPNFNFVGRLLGPRGNSLKRVEASTGCRVFIRGKGSIKDP  190



>ref|XP_011092287.1| PREDICTED: KH domain-containing protein At1g09660/At1g09670 [Sesamum 
indicum]
 ref|XP_011092288.1| PREDICTED: KH domain-containing protein At1g09660/At1g09670 [Sesamum 
indicum]
Length=293

 Score =   150 bits (379),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 86/177 (49%), Positives = 113/177 (64%), Gaps = 26/177 (15%)
 Frame = +3

Query  198  SSALVEQEKYLAELLAERSKLSPFMPVLPNCFRLLNQEILRVTTLLGNASVLDQSGLEHG  377
            SS+L ++E+YLA+LLAER KL PFM +LP C RLLNQEI+RV+ LL N  V +   + H 
Sbjct  25   SSSLTDRERYLADLLAERQKLGPFMQILPVCSRLLNQEIMRVSGLLSN-QVAELERMGHD  83

Query  378  SPLASGGLFSNGG-----------ANKDRW---SSPFQ-SEMSGLVqsssaqswlgsqss  512
             P  S G   NGG            N+D+     +PFQ S ++  V   +  +       
Sbjct  84   HPYRSLGQQPNGGQMGMMAWNAMQTNEDKLLQKMAPFQPSSLNWHVVPGTPTTP------  137

Query  513  ssGLIVKQTIRIDIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDCRVLIRGRGSIKD  683
                +VK+ IR+D+PVE+YPNYNFVGR+LGPRGNSLKRVE  T+CR+ IRG+GS+KD
Sbjct  138  ----VVKRVIRLDVPVEKYPNYNFVGRILGPRGNSLKRVEAMTECRIFIRGQGSVKD  190



>ref|XP_009772457.1| PREDICTED: KH domain-containing protein At3g08620-like isoform 
X1 [Nicotiana sylvestris]
Length=288

 Score =   150 bits (378),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 87/170 (51%), Positives = 109/170 (64%), Gaps = 10/170 (6%)
 Frame = +3

Query  201  SALVEQEKYLAELLAERSKLSPFMPVLPNCFRLLNQEILRVTTLLGNASVLDQSGLEHGS  380
            S L    +YL ELLAER KL PF  VLP C RLLNQEILRV+ ++ N  + D   L+ GS
Sbjct  23   SNLDVDSQYLTELLAERQKLGPFTQVLPICSRLLNQEILRVSGMIPNQGLSDYDRLQRGS  82

Query  381  P--LASGGLFSN------GGANKDRWSSPFQSEMSGLVqsssaqswlgsqssssGLIVKQ  536
            P  +AS  +  +      GG   + W++P +  + G         W  +  S S  +VK+
Sbjct  83   PSPMASFDMMQDIGGKPLGGWTGNGWNTPQEQRLGG--PQGMPIDWQVAPGSPSSFVVKR  140

Query  537  TIRIDIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDCRVLIRGRGSIKDP  686
             +R+DIPVE+YPN+NFVGRLLGPRGNSLKRVE ST CRV IRG+GSIKDP
Sbjct  141  ILRLDIPVERYPNFNFVGRLLGPRGNSLKRVEASTGCRVFIRGKGSIKDP  190



>emb|CDO97629.1| unnamed protein product [Coffea canephora]
Length=291

 Score =   149 bits (377),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 81/165 (49%), Positives = 112/165 (68%), Gaps = 4/165 (2%)
 Frame = +3

Query  198  SSALVEQEKYLAELLAERSKLSPFMPVLPNCFRLLNQEILRVTTLLGNASVLDQSGLEHG  377
            S+++ ++E+YLA+L+AER  L PF+P+LP C RLLNQEI+RV+ L+ N   LD   + H 
Sbjct  25   STSISDRERYLADLIAERRNLGPFIPILPICSRLLNQEIMRVSGLVSN-QYLDHERMGHE  83

Query  378  SPLASGGLFSNGGANKDRWSSPFQSEMSGLVqsssaqswlgsqssssG---LIVKQTIRI  548
            SP  S G   NGG       +P  +E + L+Q  +       +  SS     IVK+ IR+
Sbjct  84   SPYGSLGQHPNGGPMSVETWNPLGTEENRLLQKLAPFQPSPLEWHSSPGTIPIVKRVIRL  143

Query  549  DIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDCRVLIRGRGSIKD  683
            D+PV+++PNYNFVGR+LGPRGNSLKRVE  T+CR+ IRG+GS+KD
Sbjct  144  DVPVDKFPNYNFVGRILGPRGNSLKRVEAMTECRIYIRGQGSVKD  188



>ref|XP_010244588.1| PREDICTED: KH domain-containing protein At2g38610-like isoform 
X1 [Nelumbo nucifera]
Length=281

 Score =   149 bits (376),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 86/158 (54%), Positives = 107/158 (68%), Gaps = 5/158 (3%)
 Frame = +3

Query  222  KYLAELLAERSKLSPFMPVLPNCFRLLNQEILRVTTLLGNASVLDQSGLEHGSP--LASG  395
            +YLAELLAE  KL PF+ VLP C RLLNQEI+RV+ ++ N    +   L+HGSP  LAS 
Sbjct  28   QYLAELLAEHQKLGPFVQVLPICNRLLNQEIIRVSGMVSNQGFGEYDRLQHGSPSPLASS  87

Query  396  GLFSN-GGANKDRWSSPFQSEMSGLVqsssaqswlgsqssssGLIVKQTIRIDIPVEQYP  572
             L S+ GG     W+   Q  + GL        W G  +S S  +VK+ +R++IPV+ +P
Sbjct  88   NLVSHVGGTGISAWNGFSQERLGGL--QGMTMDWQGGSTSPSSYVVKKILRLEIPVDTFP  145

Query  573  NYNFVGRLLGPRGNSLKRVEVSTDCRVLIRGRGSIKDP  686
            N+NFVGRLLGPRGNSLKRVE ST CRV IRG+GSIKDP
Sbjct  146  NFNFVGRLLGPRGNSLKRVEASTGCRVYIRGKGSIKDP  183



>gb|KHG06621.1| hypothetical protein F383_33149 [Gossypium arboreum]
Length=298

 Score =   149 bits (377),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 84/169 (50%), Positives = 110/169 (65%), Gaps = 9/169 (5%)
 Frame = +3

Query  195  ASSALVEQEKYLAELLAERSKLSPFMPVLPNCFRLLNQEILRVTTLLGNASVLDQSGLEH  374
            ASS   ++++YLAELLAE+ KL PF  VLP C RL+NQEI RV++L    S +DQ   EH
Sbjct  26   ASSLPTDRDRYLAELLAEKHKLVPFTQVLPLCTRLVNQEIRRVSSL--TPSFVDQERFEH  83

Query  375  GSPLASGGLFSNG-GANKDRWSSPFQSEMSGLVqsssaqswlgs-----qssssGLIVKQ  536
             SP  S G   NG   + + WS   Q+E +G +Q                 + +  IVK+
Sbjct  84   DSPFRSFGQHPNGRQMDLEGWSV-MQTEENGHMQRVPPIQAASVGWPGLPRAPTTPIVKR  142

Query  537  TIRIDIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDCRVLIRGRGSIKD  683
             +R+D+PV++YPNYNFVGR+LGPRGNSLKRVE  T+CRV IRG+GS+KD
Sbjct  143  VVRLDVPVDKYPNYNFVGRILGPRGNSLKRVEAMTECRVYIRGKGSVKD  191



>ref|XP_011095178.1| PREDICTED: KH domain-containing protein At2g38610 [Sesamum indicum]
Length=282

 Score =   149 bits (376),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 89/166 (54%), Positives = 109/166 (66%), Gaps = 5/166 (3%)
 Frame = +3

Query  198  SSALVEQEKYLAELLAERSKLSPFMPVLPNCFRLLNQEILRVTTLLGNASVLDQSGLEH-  374
            S+  V+  +YL+ELLAE  KL PFM VLP C RLLNQEILRVT ++ N S  +   L H 
Sbjct  21   STPDVDSNQYLSELLAEHQKLGPFMQVLPICSRLLNQEILRVTGMMPNQSFGELERLRHR  80

Query  375  -GSPLASGGLFSN-GGANKDRWSSPFQSEMSGLVqsssaqswlgsqssssGLIVKQTIRI  548
              SP+AS  L SN  G     W+   Q  +SG         W G+ +S S   VK+ +R+
Sbjct  81   SPSPMASSNLLSNVAGTGLTGWNGLPQERLSG--PPGMTMDWQGAPASPSSYTVKRILRL  138

Query  549  DIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDCRVLIRGRGSIKDP  686
            +IPV+ YPN+NFVGRLLGPRGNSLKRVE +T CRV IRG+GSIKDP
Sbjct  139  EIPVDNYPNFNFVGRLLGPRGNSLKRVEATTGCRVYIRGKGSIKDP  184



>gb|KGN56263.1| hypothetical protein Csa_3G110600 [Cucumis sativus]
Length=399

 Score =   151 bits (382),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 87/166 (52%), Positives = 109/166 (66%), Gaps = 7/166 (4%)
 Frame = +3

Query  201  SALVEQEKYLAELLAERSKLSPFMPVLPNCFRLLNQEILRVTTLLGNASVLDQSGLEHGS  380
            S  +++E+ LAELL+ER KL PF+ VLP+C RLLNQEI R++ L  N + +D    EHGS
Sbjct  137  SIPLDRERCLAELLSERQKLGPFVQVLPHCSRLLNQEIRRLSGL--NQTSVDHERFEHGS  194

Query  381  PLASGGLFSNGGANKDRWSSPFQSEMSGLVq-----sssaqswlgsqssssGLIVKQTIR  545
            P  S G  SNG         P Q E SG V       + +  W   Q   +  IVK+ +R
Sbjct  195  PYRSLGQLSNGRPMDMEGWPPMQMEGSGHVHGMGPLQAHSMGWPRVQGIPTTPIVKRVVR  254

Query  546  IDIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDCRVLIRGRGSIKD  683
            +D+PV++YPNYNFVGRLLGPRGNSLKRVE  T+CRV IRG+GSIKD
Sbjct  255  LDVPVDKYPNYNFVGRLLGPRGNSLKRVEALTECRVYIRGKGSIKD  300



>gb|KJB47893.1| hypothetical protein B456_008G046100 [Gossypium raimondii]
 gb|KJB47894.1| hypothetical protein B456_008G046100 [Gossypium raimondii]
Length=298

 Score =   149 bits (376),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 84/169 (50%), Positives = 110/169 (65%), Gaps = 9/169 (5%)
 Frame = +3

Query  195  ASSALVEQEKYLAELLAERSKLSPFMPVLPNCFRLLNQEILRVTTLLGNASVLDQSGLEH  374
            ASS   ++++YLAELLAE+ KL PF  VLP C RL+NQEI RV++L    S +DQ   EH
Sbjct  26   ASSLPTDRDRYLAELLAEKHKLVPFTQVLPLCTRLVNQEIRRVSSL--TPSFVDQERFEH  83

Query  375  GSPLASGGLFSNG-GANKDRWSSPFQSEMSGLVqsssaqswlgs-----qssssGLIVKQ  536
             SP  S G   NG   + + WS   Q+E +G +Q                 + +  IVK+
Sbjct  84   DSPFRSLGQHPNGRQMDLEGWSV-MQTEENGHMQRVPPIQAASVGWPGLPRAPTTPIVKR  142

Query  537  TIRIDIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDCRVLIRGRGSIKD  683
             +R+D+PV++YPNYNFVGR+LGPRGNSLKRVE  T+CRV IRG+GS+KD
Sbjct  143  VVRLDVPVDKYPNYNFVGRILGPRGNSLKRVEAMTECRVYIRGKGSVKD  191



>ref|XP_009587501.1| PREDICTED: KH domain-containing protein At1g09660/At1g09670 [Nicotiana 
tomentosiformis]
Length=296

 Score =   148 bits (374),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 86/175 (49%), Positives = 114/175 (65%), Gaps = 8/175 (5%)
 Frame = +3

Query  177  IGALRSASSALVEQEKYLAELLAERSKLSPFMPVLPNCFRLLNQEILRVTTLLGNASVLD  356
            I A    SS+L ++E+YLA+LL ER KL PFM +LP C RLLNQEI+R + LL N  V D
Sbjct  21   IHAPLQRSSSLTDRERYLADLLGERQKLGPFMQILPVCSRLLNQEIMRASALLSNQFV-D  79

Query  357  QSGLEHGSPLASGGLFSNGGA-NKDRWSSPFQSEMSGLVqsssaqsw-----lgsqssss  518
            Q  +   SP  S     NGG  N   WS+  Q+E + L+Q  +              +++
Sbjct  80   QERMGQESPHRSFSQQMNGGQINVGAWSA-MQTEENRLLQKMAPFQPSPLDWHVVPGTAT  138

Query  519  GLIVKQTIRIDIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDCRVLIRGRGSIKD  683
              +VK+ IR+D+PVE++PN+NFVGR+LGPRGNSLKRVE  T+CRV IRG+GS+KD
Sbjct  139  TPVVKKVIRLDVPVEKFPNFNFVGRILGPRGNSLKRVEAITECRVYIRGQGSVKD  193



>ref|XP_002441114.1| hypothetical protein SORBIDRAFT_09g020640 [Sorghum bicolor]
 gb|EES19544.1| hypothetical protein SORBIDRAFT_09g020640 [Sorghum bicolor]
Length=292

 Score =   148 bits (373),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 86/160 (54%), Positives = 110/160 (69%), Gaps = 5/160 (3%)
 Frame = +3

Query  213  EQEKYLAELLAERSKLSPFMPVLPNCFRLLNQEILRVTTLLGNASVLDQSGLEHGSP--L  386
            ++E+YLAELLAER KL+PFM VLP C R LNQEILR ++L  N + ++   ++HGSP  L
Sbjct  34   DRERYLAELLAERQKLAPFMQVLPFCNRFLNQEILRASSLPPNPNFVEPERIDHGSPSPL  93

Query  387  ASGGLFSNGGA-NKDRWSSPFQSEMSGLVqsssaqswlgsqssssGLIVKQTIRIDIPVE  563
               G   NG   + + WS   Q+E  G V  S + +W GS        VK+ +R+D+PV+
Sbjct  94   RLAGHPMNGQPMDLEGWSG-MQTEYRG-VLQSPSANWNGSPGVVGNPTVKKVVRMDVPVD  151

Query  564  QYPNYNFVGRLLGPRGNSLKRVEVSTDCRVLIRGRGSIKD  683
            +YPNYNFVGRLLGPRGNSLKRVE +T CRV I GRGS+KD
Sbjct  152  KYPNYNFVGRLLGPRGNSLKRVEATTHCRVYICGRGSVKD  191



>ref|XP_006385053.1| hypothetical protein POPTR_0004s23460g [Populus trichocarpa]
 ref|XP_006385054.1| hypothetical protein POPTR_0004s23460g [Populus trichocarpa]
 gb|ERP62850.1| hypothetical protein POPTR_0004s23460g [Populus trichocarpa]
 gb|ERP62851.1| hypothetical protein POPTR_0004s23460g [Populus trichocarpa]
Length=294

 Score =   148 bits (373),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 81/160 (51%), Positives = 104/160 (65%), Gaps = 7/160 (4%)
 Frame = +3

Query  219  EKYLAELLAERSKLSPFMPVLPNCFRLLNQEILRVTTLLGNASVLDQSGLEHGSPLASGG  398
            E+YLAEL AE+ KL PF+ VLPNC RLLNQEI R +    N  ++D    EH SP  S G
Sbjct  34   ERYLAELFAEKHKLGPFVQVLPNCCRLLNQEIRRASAC--NQGLVDHERYEHESPFRSLG  91

Query  399  LFSNGGA-NKDRWSSPFQSEMSGLVqsssaqswlgsqssssGL----IVKQTIRIDIPVE  563
              SNG   + + WS+    E   L + +S  +         G+    +VK+ IR+D+PV+
Sbjct  92   QHSNGRTMDLEAWSAMPTEENGHLQRMASFPAASMGWPGVPGIPITPVVKRVIRLDVPVD  151

Query  564  QYPNYNFVGRLLGPRGNSLKRVEVSTDCRVLIRGRGSIKD  683
            +YP+YNFVGR+LGPRGNSLKRVE  TDCRV IRG+GS+KD
Sbjct  152  KYPSYNFVGRILGPRGNSLKRVEALTDCRVYIRGKGSVKD  191



>ref|XP_006381266.1| KH domain-containing family protein [Populus trichocarpa]
 gb|ERP59063.1| KH domain-containing family protein [Populus trichocarpa]
Length=281

 Score =   147 bits (372),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 86/158 (54%), Positives = 104/158 (66%), Gaps = 5/158 (3%)
 Frame = +3

Query  222  KYLAELLAERSKLSPFMPVLPNCFRLLNQEILRVTTLLGNASVLDQSGLEH--GSPLASG  395
            +YL+ELLAE  KL PFM VLP C RLLNQEI RV+ ++ N    D   L H   SP+AS 
Sbjct  28   QYLSELLAEHQKLGPFMQVLPTCSRLLNQEIFRVSGMMSNQGFGDFDRLRHRSPSPMASS  87

Query  396  GLFSN-GGANKDRWSSPFQSEMSGLVqsssaqswlgsqssssGLIVKQTIRIDIPVEQYP  572
             L SN GG     W+   Q  +SG         W G+ +S S   VK+ +R++IPV+ YP
Sbjct  88   NLLSNVGGTGLSGWNGIPQERLSG--PPGMTMDWQGAPASPSSYTVKRILRLEIPVDTYP  145

Query  573  NYNFVGRLLGPRGNSLKRVEVSTDCRVLIRGRGSIKDP  686
            N+NFVGRLLGPRGNSLKRVE +T CRV IRG+GSIKDP
Sbjct  146  NFNFVGRLLGPRGNSLKRVEATTGCRVYIRGKGSIKDP  183



>ref|XP_009790260.1| PREDICTED: KH domain-containing protein At1g09660/At1g09670 [Nicotiana 
sylvestris]
Length=296

 Score =   148 bits (373),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 86/175 (49%), Positives = 114/175 (65%), Gaps = 8/175 (5%)
 Frame = +3

Query  177  IGALRSASSALVEQEKYLAELLAERSKLSPFMPVLPNCFRLLNQEILRVTTLLGNASVLD  356
            I A    SS+L ++E+YLA+LL ER KL PFM +LP C RLLNQEI+R + LL N  V D
Sbjct  21   IHAPLQRSSSLTDRERYLADLLGERQKLGPFMQILPICSRLLNQEIMRASALLSNQFV-D  79

Query  357  QSGLEHGSPLASGGLFSNGGA-NKDRWSSPFQSEMSGLVqsssaqsw-----lgsqssss  518
            Q  +   SP  S     NGG  N   WS+  Q+E + L+Q  +              +++
Sbjct  80   QERMGQESPHRSISQQMNGGQINVGAWSA-MQTEENRLLQKMAPFQPSPLDWHVVPGTAT  138

Query  519  GLIVKQTIRIDIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDCRVLIRGRGSIKD  683
              +VK+ IR+D+PVE++PN+NFVGR+LGPRGNSLKRVE  T+CRV IRG+GS+KD
Sbjct  139  TPVVKKVIRLDVPVEKFPNFNFVGRILGPRGNSLKRVEAITECRVYIRGQGSVKD  193



>emb|CDP06370.1| unnamed protein product [Coffea canephora]
Length=282

 Score =   147 bits (371),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 87/166 (52%), Positives = 109/166 (66%), Gaps = 5/166 (3%)
 Frame = +3

Query  198  SSALVEQEKYLAELLAERSKLSPFMPVLPNCFRLLNQEILRVTTLLGNASVLDQSGLEH-  374
            +++ V+  +YL+ELLAE  KL PFM VLP C RLLNQEILRV+ ++ N    D   L H 
Sbjct  21   TNSDVDSNQYLSELLAEHQKLGPFMQVLPICSRLLNQEILRVSGMIPNQGFGDLDRLRHR  80

Query  375  -GSPLASGGLFSN-GGANKDRWSSPFQSEMSGLVqsssaqswlgsqssssGLIVKQTIRI  548
              SP+AS  L SN  G     W+   Q  +SG         W G+ +S S   VK+ +R+
Sbjct  81   SPSPMASSNLMSNVAGTGIAGWNGLPQERLSG--TPGMTMDWQGAPASPSSFTVKRILRL  138

Query  549  DIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDCRVLIRGRGSIKDP  686
            +IPV+ YPN+NFVGRLLGPRGNSLKRVE +T CRV IRG+GSIKDP
Sbjct  139  EIPVDNYPNFNFVGRLLGPRGNSLKRVEATTGCRVYIRGKGSIKDP  184



>ref|XP_006305461.1| hypothetical protein CARUB_v10009882mg [Capsella rubella]
 gb|EOA38359.1| hypothetical protein CARUB_v10009882mg [Capsella rubella]
Length=298

 Score =   147 bits (372),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 84/172 (49%), Positives = 106/172 (62%), Gaps = 29/172 (17%)
 Frame = +3

Query  210  VEQEKYLAELLAERSKLSPFMPVLPNCFRLLNQEILRVTTLLGNASVLDQSGLEHGSPLA  389
             ++E+YL ELL ER KL PF+ V+PNC RLLNQEI RV+      S  D    EHGSP  
Sbjct  40   TDRERYLTELLQERQKLGPFLQVMPNCLRLLNQEIRRVS------SFPDLDRFEHGSPFR  93

Query  390  SGGLFSNGGANKDRWS-------------SPFQSEMS-GLVqsssaqswlgsqssssGLI  527
            S G  +NG  + + WS             SPF++  S G V      +           I
Sbjct  94   SLGQPTNGKLDLEGWSMMQAEENCHLQRASPFRAPASVGWVGMPGLPNPP---------I  144

Query  528  VKQTIRIDIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDCRVLIRGRGSIKD  683
            VK+ IR+D+PV++YP+YNFVGR+LGPRGNSLKRVE++T CRV IRGRGS+KD
Sbjct  145  VKRVIRLDVPVDKYPSYNFVGRILGPRGNSLKRVELATHCRVFIRGRGSVKD  196



>ref|XP_010922800.1| PREDICTED: KH domain-containing protein SPIN1-like [Elaeis guineensis]
Length=281

 Score =   147 bits (370),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 87/157 (55%), Positives = 104/157 (66%), Gaps = 5/157 (3%)
 Frame = +3

Query  225  YLAELLAERSKLSPFMPVLPNCFRLLNQEILRVTTLLGNASVLDQSGLEHGSP--LASGG  398
            YLAELLAE  KL PFM VLP C RLLNQEI+RV+ ++ N    D   ++HGSP  + S  
Sbjct  29   YLAELLAEHQKLGPFMQVLPICSRLLNQEIMRVSGMVSNQGFGDFDRMQHGSPSPIVSSN  88

Query  399  LFSN-GGANKDRWSSPFQSEMSGLVqsssaqswlgsqssssGLIVKQTIRIDIPVEQYPN  575
            L  N GG +   WS   Q E  G         W G+  S S  +VK+ +R++IPV+ YPN
Sbjct  89   LIPNVGGTSLGGWSG-LQHERIGF-PQGMNLDWQGAPPSPSSYVVKKILRLEIPVDTYPN  146

Query  576  YNFVGRLLGPRGNSLKRVEVSTDCRVLIRGRGSIKDP  686
            +NFVGRLLGPRGNSLKRVE ST CRV IRG+GSIKDP
Sbjct  147  FNFVGRLLGPRGNSLKRVEASTGCRVYIRGKGSIKDP  183



>ref|XP_009600354.1| PREDICTED: KH domain-containing protein At3g08620-like isoform 
X2 [Nicotiana tomentosiformis]
Length=258

 Score =   146 bits (368),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 84/161 (52%), Positives = 105/161 (65%), Gaps = 10/161 (6%)
 Frame = +3

Query  228  LAELLAERSKLSPFMPVLPNCFRLLNQEILRVTTLLGNASVLDQSGLEHGSP--LASGGL  401
            L ELLAER KL PF  VLP C RLLNQEILRV+ ++ N  + D   L+ GSP  +AS  +
Sbjct  2    LIELLAERQKLGPFTQVLPICSRLLNQEILRVSGMIPNQGLSDYDRLQRGSPSPMASFDM  61

Query  402  FSN------GGANKDRWSSPFQSEMSGLVqsssaqswlgsqssssGLIVKQTIRIDIPVE  563
              +      GG   + W++P +  + G         W  +  S S  +VK+ +R+DIPVE
Sbjct  62   MQDIGGKPLGGWTGNGWNTPQEQRLDG--PQGMPIDWQAAPGSPSSFVVKRILRLDIPVE  119

Query  564  QYPNYNFVGRLLGPRGNSLKRVEVSTDCRVLIRGRGSIKDP  686
            +YPN+NFVGRLLGPRGNSLKRVE ST CRV IRG+GSIKDP
Sbjct  120  RYPNFNFVGRLLGPRGNSLKRVEASTGCRVFIRGKGSIKDP  160



>gb|EMT15768.1| KH domain-containing protein [Aegilops tauschii]
Length=292

 Score =   147 bits (370),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 91/185 (49%), Positives = 121/185 (65%), Gaps = 6/185 (3%)
 Frame = +3

Query  132  FMAYspspsaphsphIGALRSASSALVEQEKYLAELLAERSKLSPFMPVLPNCFRLLNQE  311
            F  YSPS       H   +RS++S   E+E+Y+AELLAER KL PF+ VLP C RLLNQE
Sbjct  10   FFQYSPSGVHSSPHHHNPMRSSAS---ERERYIAELLAERQKLVPFLQVLPFCNRLLNQE  66

Query  312  ILRVTTLLGNASVLDQSGLEHGSPLASGGLFSNGGA-NKDRWSSPFQSEMSGLVqsssaq  488
            ILR ++L  N + ++    ++GSPL   G   NG   + + W+    +E  G + +S + 
Sbjct  67   ILRASSLPPNPNFVEPERFDYGSPLRLAGHPMNGQPMDMEGWTG-MHAEHMG-IHNSPSM  124

Query  489  swlgsqssssGLIVKQTIRIDIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDCRVLIRGR  668
             W G      G +VK+ +R+D+P E+YPN+NFVGRLLGPRGNSLKRVE +T CRV IRGR
Sbjct  125  GWNGGPGVVGGPVVKKLVRMDVPAEKYPNFNFVGRLLGPRGNSLKRVEATTQCRVYIRGR  184

Query  669  GSIKD  683
            GS+KD
Sbjct  185  GSVKD  189



>ref|XP_009348779.1| PREDICTED: KH domain-containing protein At5g56140 [Pyrus x bretschneideri]
Length=129

 Score =   142 bits (358),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 86/119 (72%), Positives = 97/119 (82%), Gaps = 3/119 (3%)
 Frame = +3

Query  111  KQMASS---RFMAYspspsaphsphIGALRSASSALVEQEKYLAELLAERSKLSPFMPVL  281
            + M+SS   R+MAYS SPSAPHSPH+  LRSA+    EQEKYL ELL ER KLSPF+ VL
Sbjct  2    EMMSSSGGGRYMAYSRSPSAPHSPHLSGLRSAALVAAEQEKYLLELLGERHKLSPFLLVL  61

Query  282  PNCFRLLNQEILRVTTLLGNASVLDQSGLEHGSPLASGGLFSNGGANKDRWSSPFQSEM  458
            PNC RLLNQEILRVTTLLGNASVL QSGLEH SPLAS G+FSNGGA+ + W+S FQSE+
Sbjct  62   PNCNRLLNQEILRVTTLLGNASVLGQSGLEHASPLASRGMFSNGGADVNGWASRFQSEV  120



>ref|XP_003534621.1| PREDICTED: KH domain-containing protein At2g38610-like [Glycine 
max]
Length=281

 Score =   146 bits (369),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 86/158 (54%), Positives = 103/158 (65%), Gaps = 5/158 (3%)
 Frame = +3

Query  222  KYLAELLAERSKLSPFMPVLPNCFRLLNQEILRVTTLLGNASVLDQSGLEH--GSPLASG  395
            +YL+ELLAE  KL PFM VLP C RLLNQEILRV+ +L N    D   L H   SP+AS 
Sbjct  28   QYLSELLAEHQKLGPFMQVLPICSRLLNQEILRVSGMLSNQGFGDFDRLRHRSPSPMASS  87

Query  396  GLFSN-GGANKDRWSSPFQSEMSGLVqsssaqswlgsqssssGLIVKQTIRIDIPVEQYP  572
             L SN  G     W+S  Q  + G         W  + +S S   VK+ +R++IPV+ YP
Sbjct  88   NLMSNVSGTGLGGWNSLQQERLCG--APGMTMDWQSAPASPSSFTVKRILRLEIPVDTYP  145

Query  573  NYNFVGRLLGPRGNSLKRVEVSTDCRVLIRGRGSIKDP  686
            N+NFVGRLLGPRGNSLKRVE +T CRV IRG+GSIKDP
Sbjct  146  NFNFVGRLLGPRGNSLKRVEATTGCRVYIRGKGSIKDP  183



>ref|XP_006359981.1| PREDICTED: KH domain-containing protein At2g38610-like [Solanum 
tuberosum]
Length=282

 Score =   146 bits (369),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 88/166 (53%), Positives = 108/166 (65%), Gaps = 5/166 (3%)
 Frame = +3

Query  198  SSALVEQEKYLAELLAERSKLSPFMPVLPNCFRLLNQEILRVTTLLGNASVLDQSGLEH-  374
            S+  V+   YL+ELLAE  KL PFM VLP C RLLNQEILRV+ +L N    +   L H 
Sbjct  21   STPDVDSNHYLSELLAEHQKLGPFMQVLPICSRLLNQEILRVSGMLPNQGFGELDRLRHR  80

Query  375  -GSPLASGGLFSN-GGANKDRWSSPFQSEMSGLVqsssaqswlgsqssssGLIVKQTIRI  548
              SP+ S  L SN  GA    W+   Q  +SG      +  W G+ +S S   VK+ +R+
Sbjct  81   SPSPMGSANLMSNVAGAGLSGWNGLPQERLSG--PPGMSMDWQGAPASPSSYTVKRILRL  138

Query  549  DIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDCRVLIRGRGSIKDP  686
            +IPV+ YPN+NFVGRLLGPRGNSLKRVE +T CRV IRG+GSIKDP
Sbjct  139  EIPVDTYPNFNFVGRLLGPRGNSLKRVEATTGCRVFIRGKGSIKDP  184



>ref|XP_010490233.1| PREDICTED: KH domain-containing protein At1g09660/At1g09670-like 
[Camelina sativa]
Length=298

 Score =   147 bits (370),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 85/177 (48%), Positives = 106/177 (60%), Gaps = 41/177 (23%)
 Frame = +3

Query  213  EQEKYLAELLAERSKLSPFMPVLPNCFRLLNQEILRVTTLLGNASVLDQSGLEHGSPLAS  392
            ++++YL ELL ER KL PF+ V+PNC RLLNQEI RV+      S  D    EHGSP  S
Sbjct  41   DRDRYLTELLQERQKLVPFLQVMPNCCRLLNQEIRRVS------SFPDLDRYEHGSPFRS  94

Query  393  GGLFSNGGANKDRWS-------------SPFQSE-------MSGLVqsssaqswlgsqss  512
             G  +NG  + D WS             SPF+S        M GL+              
Sbjct  95   LGQPTNGKLDLDGWSMMQAEENCHLQRASPFRSPAPVGWVGMPGLLNPP-----------  143

Query  513  ssGLIVKQTIRIDIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDCRVLIRGRGSIKD  683
                IVK+ IR+D+PV++YP+YNFVGR+LGPRGNSLKRVE++T CRV IRGRGS+KD
Sbjct  144  ----IVKRVIRLDVPVDKYPSYNFVGRILGPRGNSLKRVELATHCRVFIRGRGSVKD  196



>ref|XP_011028364.1| PREDICTED: KH domain-containing protein At1g09660/At1g09670 [Populus 
euphratica]
 ref|XP_011028365.1| PREDICTED: KH domain-containing protein At1g09660/At1g09670 [Populus 
euphratica]
Length=294

 Score =   147 bits (370),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 80/160 (50%), Positives = 104/160 (65%), Gaps = 7/160 (4%)
 Frame = +3

Query  219  EKYLAELLAERSKLSPFMPVLPNCFRLLNQEILRVTTLLGNASVLDQSGLEHGSPLASGG  398
            E+YLAEL AE+ KL PF+ VLPNC RLLNQEI R +    N  ++D    +H SP  S G
Sbjct  34   ERYLAELFAEKHKLGPFVQVLPNCCRLLNQEIRRASAC--NQGLVDHERYDHESPFRSLG  91

Query  399  LFSNGGA-NKDRWSSPFQSEMSGLVqsssaqswlgsqssssGL----IVKQTIRIDIPVE  563
              SNG   + + WS+    E   L + +S  +         G+    +VK+ IR+D+PV+
Sbjct  92   QHSNGRTMDLEAWSAMPTEENGHLQRMASFPAASMGWPGVPGIPVTPVVKRVIRLDVPVD  151

Query  564  QYPNYNFVGRLLGPRGNSLKRVEVSTDCRVLIRGRGSIKD  683
            +YP+YNFVGR+LGPRGNSLKRVE  TDCRV IRG+GS+KD
Sbjct  152  KYPSYNFVGRILGPRGNSLKRVEALTDCRVYIRGKGSVKD  191



>ref|XP_010908089.1| PREDICTED: KH domain-containing protein At1g09660/At1g09670 [Elaeis 
guineensis]
Length=293

 Score =   147 bits (370),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 85/173 (49%), Positives = 113/173 (65%), Gaps = 9/173 (5%)
 Frame = +3

Query  183  ALRSASSALVEQEKYLAELLAERSKLSPFMPVLPNCFRLLNQEILRVTTLLGNASVLDQS  362
            ++RS +S+  ++E+YL ELLAER KL  F  VLP C RLL+QEI+R + L  N   +D  
Sbjct  25   SMRSPASS--DRERYLTELLAERQKLVAFAQVLPFCSRLLDQEIIRASGLAPNQRFVDPE  82

Query  363  GLEHGSPLASGGLFSNGGA-NKDRWSSPFQSEMSGLVqsssaqswlg-----sqssssGL  524
             +EHG+PL      SNGG  + + WS   Q+E +G  Q              +   ++  
Sbjct  83   RIEHGNPLRLTRHPSNGGPMDLEGWSG-MQTEDNGHFQRMGPLQASPVGWNGASGVATSP  141

Query  525  IVKQTIRIDIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDCRVLIRGRGSIKD  683
            IVK+ IR+D+P++++PNYNFVGRLLGPRGNSLKRVE ST CRV IRGRGS+KD
Sbjct  142  IVKKVIRLDVPIDKFPNYNFVGRLLGPRGNSLKRVENSTHCRVYIRGRGSVKD  194



>ref|XP_009772459.1| PREDICTED: KH domain-containing protein At3g08620-like isoform 
X2 [Nicotiana sylvestris]
Length=258

 Score =   145 bits (367),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 84/161 (52%), Positives = 105/161 (65%), Gaps = 10/161 (6%)
 Frame = +3

Query  228  LAELLAERSKLSPFMPVLPNCFRLLNQEILRVTTLLGNASVLDQSGLEHGSP--LASGGL  401
            L ELLAER KL PF  VLP C RLLNQEILRV+ ++ N  + D   L+ GSP  +AS  +
Sbjct  2    LIELLAERQKLGPFTQVLPICSRLLNQEILRVSGMIPNQGLSDYDRLQRGSPSPMASFDM  61

Query  402  FSN------GGANKDRWSSPFQSEMSGLVqsssaqswlgsqssssGLIVKQTIRIDIPVE  563
              +      GG   + W++P +  + G         W  +  S S  +VK+ +R+DIPVE
Sbjct  62   MQDIGGKPLGGWTGNGWNTPQEQRLGG--PQGMPIDWQVAPGSPSSFVVKRILRLDIPVE  119

Query  564  QYPNYNFVGRLLGPRGNSLKRVEVSTDCRVLIRGRGSIKDP  686
            +YPN+NFVGRLLGPRGNSLKRVE ST CRV IRG+GSIKDP
Sbjct  120  RYPNFNFVGRLLGPRGNSLKRVEASTGCRVFIRGKGSIKDP  160



>gb|KDP21840.1| hypothetical protein JCGZ_00627 [Jatropha curcas]
Length=281

 Score =   146 bits (369),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 86/158 (54%), Positives = 104/158 (66%), Gaps = 5/158 (3%)
 Frame = +3

Query  222  KYLAELLAERSKLSPFMPVLPNCFRLLNQEILRVTTLLGNASVLDQSGLEH--GSPLASG  395
            +YL+ELLAE  KL PFM VLP C RLLNQEI RV+ ++ N    D   L H   SP+AS 
Sbjct  28   QYLSELLAEHQKLGPFMQVLPICSRLLNQEIFRVSGMMSNQGFGDFDRLRHRSPSPMASS  87

Query  396  GLFSN-GGANKDRWSSPFQSEMSGLVqsssaqswlgsqssssGLIVKQTIRIDIPVEQYP  572
             L SN GG     W+   Q  +SG         W G+ +S S   VK+ +R++IPV+ YP
Sbjct  88   NLMSNVGGTGLGSWNGLPQERLSG--PPGMTMDWQGAPASPSSYTVKRILRLEIPVDTYP  145

Query  573  NYNFVGRLLGPRGNSLKRVEVSTDCRVLIRGRGSIKDP  686
            N+NFVGRLLGPRGNSLKRVE +T CRV IRG+GSIKDP
Sbjct  146  NFNFVGRLLGPRGNSLKRVEATTGCRVYIRGKGSIKDP  183



>gb|KJB71496.1| hypothetical protein B456_011G125700 [Gossypium raimondii]
Length=281

 Score =   146 bits (368),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 86/158 (54%), Positives = 104/158 (66%), Gaps = 5/158 (3%)
 Frame = +3

Query  222  KYLAELLAERSKLSPFMPVLPNCFRLLNQEILRVTTLLGNASVLDQSGLEH--GSPLASG  395
            +YL+ELLAE  KL PFM VLP C RLLNQEI RV+ ++ N    D   L H   SP+AS 
Sbjct  28   QYLSELLAEHQKLGPFMQVLPICSRLLNQEIFRVSGMMANQGFGDLDRLRHRSPSPMASS  87

Query  396  GLFSN-GGANKDRWSSPFQSEMSGLVqsssaqswlgsqssssGLIVKQTIRIDIPVEQYP  572
             L SN  G     W+S  Q  +SG         W G+ +S S   VK+ +R++IPV+ YP
Sbjct  88   NLMSNVSGTGLGGWNSLTQERLSG--PPGMTMDWQGAPASPSSYTVKRILRLEIPVDTYP  145

Query  573  NYNFVGRLLGPRGNSLKRVEVSTDCRVLIRGRGSIKDP  686
            N+NFVGRLLGPRGNSLKRVE +T CRV IRG+GSIKDP
Sbjct  146  NFNFVGRLLGPRGNSLKRVEATTGCRVYIRGKGSIKDP  183



>ref|XP_009589069.1| PREDICTED: KH domain-containing protein At2g38610 [Nicotiana 
tomentosiformis]
Length=282

 Score =   146 bits (368),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 88/166 (53%), Positives = 109/166 (66%), Gaps = 5/166 (3%)
 Frame = +3

Query  198  SSALVEQEKYLAELLAERSKLSPFMPVLPNCFRLLNQEILRVTTLLGNASVLDQSGLEH-  374
            S+  V+  +YL+ELLAE  KL PFM VLP C RLLNQEILRV+ +L N    +   L H 
Sbjct  21   STPDVDSNQYLSELLAEHQKLGPFMQVLPICSRLLNQEILRVSGMLPNQGFGELDRLRHR  80

Query  375  -GSPLASGGLFSN-GGANKDRWSSPFQSEMSGLVqsssaqswlgsqssssGLIVKQTIRI  548
              SP+ S  L SN  GA    W+   Q  +SG      +  W G+ +S S   VK+ +R+
Sbjct  81   SPSPMGSANLMSNVAGAGLGGWNGLPQERLSG--PPGMSMDWQGAPASPSSYTVKRILRL  138

Query  549  DIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDCRVLIRGRGSIKDP  686
            +IPV+ YPN+NFVGRLLGPRGNSLKRVE +T CRV IRG+GSIKDP
Sbjct  139  EIPVDTYPNFNFVGRLLGPRGNSLKRVEATTGCRVFIRGKGSIKDP  184



>ref|XP_003552330.1| PREDICTED: KH domain-containing protein At2g38610-like [Glycine 
max]
Length=281

 Score =   146 bits (368),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 86/158 (54%), Positives = 103/158 (65%), Gaps = 5/158 (3%)
 Frame = +3

Query  222  KYLAELLAERSKLSPFMPVLPNCFRLLNQEILRVTTLLGNASVLDQSGLEH--GSPLASG  395
            +YL+ELLAE  KL PFM VLP C RLLNQEILRV+ +L N    D   L H   SP+AS 
Sbjct  28   QYLSELLAEHQKLGPFMQVLPICSRLLNQEILRVSGMLSNQGFGDFDRLRHRSPSPMASS  87

Query  396  GLFSN-GGANKDRWSSPFQSEMSGLVqsssaqswlgsqssssGLIVKQTIRIDIPVEQYP  572
             L SN  G     W+S  Q  + G         W  + +S S   VK+ +R++IPV+ YP
Sbjct  88   NLMSNVSGTGLGGWNSLQQERLCG--PPGMTMDWQSAPASPSSFTVKRILRLEIPVDTYP  145

Query  573  NYNFVGRLLGPRGNSLKRVEVSTDCRVLIRGRGSIKDP  686
            N+NFVGRLLGPRGNSLKRVE +T CRV IRG+GSIKDP
Sbjct  146  NFNFVGRLLGPRGNSLKRVEATTGCRVYIRGKGSIKDP  183



>ref|XP_009760263.1| PREDICTED: KH domain-containing protein At2g38610 [Nicotiana 
sylvestris]
Length=282

 Score =   146 bits (368),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 88/166 (53%), Positives = 109/166 (66%), Gaps = 5/166 (3%)
 Frame = +3

Query  198  SSALVEQEKYLAELLAERSKLSPFMPVLPNCFRLLNQEILRVTTLLGNASVLDQSGLEH-  374
            S+  V+  +YL+ELLAE  KL PFM VLP C RLLNQEILRV+ +L N    +   L H 
Sbjct  21   STPDVDSNQYLSELLAEHQKLGPFMQVLPICSRLLNQEILRVSGMLPNQGFGELDRLRHR  80

Query  375  -GSPLASGGLFSN-GGANKDRWSSPFQSEMSGLVqsssaqswlgsqssssGLIVKQTIRI  548
              SP+ S  L SN  GA    W+   Q  +SG      +  W G+ +S S   VK+ +R+
Sbjct  81   SPSPMGSANLMSNVSGAGLAGWNGLPQERLSG--PPGMSMDWQGAPASPSSYTVKRILRL  138

Query  549  DIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDCRVLIRGRGSIKDP  686
            +IPV+ YPN+NFVGRLLGPRGNSLKRVE +T CRV IRG+GSIKDP
Sbjct  139  EIPVDTYPNFNFVGRLLGPRGNSLKRVEATTGCRVFIRGKGSIKDP  184



>gb|KHG24418.1| hypothetical protein F383_31230 [Gossypium arboreum]
Length=281

 Score =   146 bits (368),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 86/158 (54%), Positives = 104/158 (66%), Gaps = 5/158 (3%)
 Frame = +3

Query  222  KYLAELLAERSKLSPFMPVLPNCFRLLNQEILRVTTLLGNASVLDQSGLEH--GSPLASG  395
            +YL+ELLAE  KL PFM VLP C RLLNQEI RV+ ++ N    D   L H   SP+AS 
Sbjct  28   QYLSELLAEHQKLGPFMQVLPICSRLLNQEIFRVSGMMANQGFGDFDRLRHRSPSPMASS  87

Query  396  GLFSN-GGANKDRWSSPFQSEMSGLVqsssaqswlgsqssssGLIVKQTIRIDIPVEQYP  572
             L SN  G     W+S  Q  +SG         W G+ +S S   VK+ +R++IPV+ YP
Sbjct  88   NLMSNVSGTGLGGWNSLTQERLSG--PPGMTMDWQGAPASPSSYTVKRILRLEIPVDTYP  145

Query  573  NYNFVGRLLGPRGNSLKRVEVSTDCRVLIRGRGSIKDP  686
            N+NFVGRLLGPRGNSLKRVE +T CRV IRG+GSIKDP
Sbjct  146  NFNFVGRLLGPRGNSLKRVEATTGCRVYIRGKGSIKDP  183



>ref|XP_002892515.1| hypothetical protein ARALYDRAFT_471067 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68774.1| hypothetical protein ARALYDRAFT_471067 [Arabidopsis lyrata subsp. 
lyrata]
Length=298

 Score =   146 bits (369),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 84/178 (47%), Positives = 105/178 (59%), Gaps = 41/178 (23%)
 Frame = +3

Query  210  VEQEKYLAELLAERSKLSPFMPVLPNCFRLLNQEILRVTTLLGNASVLDQSGLEHGSPLA  389
             ++E+YL ELL ER KL PF+ V+PNC RLLNQEI RV+      S  D    EHGSP  
Sbjct  40   TDRERYLTELLQERQKLGPFLQVMPNCCRLLNQEIRRVS------SFPDPDRYEHGSPFR  93

Query  390  SGGLFSNGGANKDRWS-------------SPFQSE-------MSGLVqsssaqswlgsqs  509
            S G  +NG  + + WS             SPF++        M GL              
Sbjct  94   SLGQPTNGKLDLEGWSMMQAEENCHLQRASPFRAPAPVGWIGMPGLPNPP----------  143

Query  510  sssGLIVKQTIRIDIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDCRVLIRGRGSIKD  683
                 IVK+ IR+D+PV++YP+YNFVGR+LGPRGNSLKRVE++T CRV IRGRGS+KD
Sbjct  144  -----IVKKVIRLDVPVDKYPSYNFVGRILGPRGNSLKRVELATHCRVFIRGRGSVKD  196



>ref|XP_004246970.1| PREDICTED: KH domain-containing protein At2g38610-like [Solanum 
lycopersicum]
Length=282

 Score =   145 bits (367),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 88/166 (53%), Positives = 108/166 (65%), Gaps = 5/166 (3%)
 Frame = +3

Query  198  SSALVEQEKYLAELLAERSKLSPFMPVLPNCFRLLNQEILRVTTLLGNASVLDQSGLEH-  374
            S+  V+   YL+ELLAE  KL PFM VLP C RLLNQEILRV+ +L N    +   L H 
Sbjct  21   STPDVDSNHYLSELLAEHQKLGPFMQVLPICSRLLNQEILRVSGMLPNQGFGELDRLRHR  80

Query  375  -GSPLASGGLFSN-GGANKDRWSSPFQSEMSGLVqsssaqswlgsqssssGLIVKQTIRI  548
              SP+ S  L SN  GA    W+   Q  +SG      +  W G+ +S S   VK+ +R+
Sbjct  81   SPSPMGSANLMSNVTGAGLSGWNGLPQERLSG--PPGMSMDWQGAPASPSSYTVKRILRL  138

Query  549  DIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDCRVLIRGRGSIKDP  686
            +IPV+ YPN+NFVGRLLGPRGNSLKRVE +T CRV IRG+GSIKDP
Sbjct  139  EIPVDTYPNFNFVGRLLGPRGNSLKRVEATTGCRVFIRGKGSIKDP  184



>ref|XP_011018951.1| PREDICTED: KH domain-containing protein At2g38610-like isoform 
X2 [Populus euphratica]
Length=281

 Score =   145 bits (367),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 85/158 (54%), Positives = 103/158 (65%), Gaps = 5/158 (3%)
 Frame = +3

Query  222  KYLAELLAERSKLSPFMPVLPNCFRLLNQEILRVTTLLGNASVLDQSGLEH--GSPLASG  395
            +YL+ELLAE  KL PFM VLP C RLLNQEI RV+ ++ N    D   L H   SP+AS 
Sbjct  28   QYLSELLAEHQKLGPFMQVLPTCSRLLNQEIFRVSGMMSNQGFGDFDRLRHRSPSPMASS  87

Query  396  GLFSN-GGANKDRWSSPFQSEMSGLVqsssaqswlgsqssssGLIVKQTIRIDIPVEQYP  572
             L SN GG     W+   Q  + G         W G+ +S S   VK+ +R++IPV+ YP
Sbjct  88   NLLSNVGGTGLSGWNGIPQERLGG--PPGMTMDWQGAPASPSSYTVKRILRLEIPVDTYP  145

Query  573  NYNFVGRLLGPRGNSLKRVEVSTDCRVLIRGRGSIKDP  686
            N+NFVGRLLGPRGNSLKRVE +T CRV IRG+GSIKDP
Sbjct  146  NFNFVGRLLGPRGNSLKRVEATTGCRVYIRGKGSIKDP  183



>ref|XP_010475807.1| PREDICTED: KH domain-containing protein At1g09660/At1g09670 [Camelina 
sativa]
Length=298

 Score =   146 bits (368),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 85/177 (48%), Positives = 105/177 (59%), Gaps = 41/177 (23%)
 Frame = +3

Query  213  EQEKYLAELLAERSKLSPFMPVLPNCFRLLNQEILRVTTLLGNASVLDQSGLEHGSPLAS  392
            ++++YL ELL ER KL PF+ V+PNC RLLNQEI RV+      S  D    EHGSP  S
Sbjct  41   DRDRYLTELLQERQKLVPFLQVMPNCCRLLNQEIRRVS------SFPDLDRYEHGSPFRS  94

Query  393  GGLFSNGGANKDRWS-------------SPFQSE-------MSGLVqsssaqswlgsqss  512
             G  +NG  + D WS             SPF+S        M GL               
Sbjct  95   LGQPTNGKLDLDGWSMMQAEENCHLQRASPFRSPAPVGWVGMPGLPNPP-----------  143

Query  513  ssGLIVKQTIRIDIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDCRVLIRGRGSIKD  683
                IVK+ IR+D+PV++YP+YNFVGR+LGPRGNSLKRVE++T CRV IRGRGS+KD
Sbjct  144  ----IVKRVIRLDVPVDKYPSYNFVGRILGPRGNSLKRVELATHCRVFIRGRGSVKD  196



>gb|KJB27614.1| hypothetical protein B456_005G002300 [Gossypium raimondii]
Length=235

 Score =   144 bits (363),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 81/162 (50%), Positives = 104/162 (64%), Gaps = 5/162 (3%)
 Frame = +3

Query  210  VEQEKYLAELLAERSKLSPFMPVLPNCFRLLNQEILRVTTLLGNASVLDQSGLEH--GSP  383
            ++  + L+ELLAE  KL PFM +LP C RLLNQEILRV+ ++ N    D   + H   SP
Sbjct  25   IDSNQLLSELLAEHQKLGPFMQILPTCSRLLNQEILRVSGMMSNQGFGDFDRMRHRSPSP  84

Query  384  LASGGLFSN-GGANKDRWSSPFQSEMSGLVqsssaqswlgsqssssGLIVKQTIRIDIPV  560
            +AS  + SN  G     W+S  Q  +SG    +       +  SS    VK+ +R++IPV
Sbjct  85   MASSNIMSNVSGTGLSNWNSLPQERLSGPPGMTMDWQGAPASPSSYN--VKRILRLEIPV  142

Query  561  EQYPNYNFVGRLLGPRGNSLKRVEVSTDCRVLIRGRGSIKDP  686
            + YPN+NFVGRLLGPRGNSLKRVE +T CRV IRG+GSIKDP
Sbjct  143  DTYPNFNFVGRLLGPRGNSLKRVEATTGCRVYIRGKGSIKDP  184



>ref|XP_003623654.1| KH domain-containing protein [Medicago truncatula]
 gb|AES79872.1| RNA-binding KH domain protein [Medicago truncatula]
Length=281

 Score =   145 bits (366),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 84/158 (53%), Positives = 104/158 (66%), Gaps = 5/158 (3%)
 Frame = +3

Query  222  KYLAELLAERSKLSPFMPVLPNCFRLLNQEILRVTTLLGNASVLDQSGLEH--GSPLASG  395
            +YL+ELLAE  KL PF+ VLP C RLLNQEILRV+ +L N    D   L+H   SP+AS 
Sbjct  28   QYLSELLAEHQKLGPFLQVLPICSRLLNQEILRVSGMLSNQGFGDFDRLQHRSPSPMASS  87

Query  396  GLFSN-GGANKDRWSSPFQSEMSGLVqsssaqswlgsqssssGLIVKQTIRIDIPVEQYP  572
             L SN  G     W+S  Q  + G         W  + +S S   VK+ +R++IPV+ +P
Sbjct  88   NLMSNVSGTGMGAWNSLQQERLCG--PPGMNMDWQSAPASPSSFTVKRILRLEIPVDTFP  145

Query  573  NYNFVGRLLGPRGNSLKRVEVSTDCRVLIRGRGSIKDP  686
            N+NFVGRLLGPRGNSLKRVE +T CRV IRG+GSIKDP
Sbjct  146  NFNFVGRLLGPRGNSLKRVEATTGCRVYIRGKGSIKDP  183



>gb|KJB27615.1| hypothetical protein B456_005G002300 [Gossypium raimondii]
Length=263

 Score =   144 bits (364),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 81/162 (50%), Positives = 104/162 (64%), Gaps = 5/162 (3%)
 Frame = +3

Query  210  VEQEKYLAELLAERSKLSPFMPVLPNCFRLLNQEILRVTTLLGNASVLDQSGLEH--GSP  383
            ++  + L+ELLAE  KL PFM +LP C RLLNQEILRV+ ++ N    D   + H   SP
Sbjct  25   IDSNQLLSELLAEHQKLGPFMQILPTCSRLLNQEILRVSGMMSNQGFGDFDRMRHRSPSP  84

Query  384  LASGGLFSN-GGANKDRWSSPFQSEMSGLVqsssaqswlgsqssssGLIVKQTIRIDIPV  560
            +AS  + SN  G     W+S  Q  +SG    +       +  SS    VK+ +R++IPV
Sbjct  85   MASSNIMSNVSGTGLSNWNSLPQERLSGPPGMTMDWQGAPASPSSYN--VKRILRLEIPV  142

Query  561  EQYPNYNFVGRLLGPRGNSLKRVEVSTDCRVLIRGRGSIKDP  686
            + YPN+NFVGRLLGPRGNSLKRVE +T CRV IRG+GSIKDP
Sbjct  143  DTYPNFNFVGRLLGPRGNSLKRVEATTGCRVYIRGKGSIKDP  184



>gb|ACU24211.1| unknown [Glycine max]
Length=281

 Score =   145 bits (365),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 86/158 (54%), Positives = 102/158 (65%), Gaps = 5/158 (3%)
 Frame = +3

Query  222  KYLAELLAERSKLSPFMPVLPNCFRLLNQEILRVTTLLGNASVLDQSGLEH--GSPLASG  395
            +YL+ELLAE  KL PFM VLP C RLLNQEILRV+ +L N    D   L H   SP+AS 
Sbjct  28   RYLSELLAEHQKLGPFMQVLPICSRLLNQEILRVSGMLSNQGFGDFDRLRHRSPSPMASS  87

Query  396  GLFSN-GGANKDRWSSPFQSEMSGLVqsssaqswlgsqssssGLIVKQTIRIDIPVEQYP  572
             L SN  G     W+S  Q  + G         W  + +S S   VK+ +R++IPV+ YP
Sbjct  88   NLMSNVSGTGLGGWNSLQQERLCG--APGMTMDWQSAPASPSSFTVKRILRLEIPVDTYP  145

Query  573  NYNFVGRLLGPRGNSLKRVEVSTDCRVLIRGRGSIKDP  686
            N+NFVGRLLGPRGNSLKRVE  T CRV IRG+GSIKDP
Sbjct  146  NFNFVGRLLGPRGNSLKRVEAITGCRVYIRGKGSIKDP  183



>ref|XP_007041198.1| RNA-binding KH domain-containing protein isoform 1 [Theobroma 
cacao]
 ref|XP_007041199.1| RNA-binding KH domain-containing protein isoform 1 [Theobroma 
cacao]
 gb|EOX97029.1| RNA-binding KH domain-containing protein isoform 1 [Theobroma 
cacao]
 gb|EOX97030.1| RNA-binding KH domain-containing protein isoform 1 [Theobroma 
cacao]
Length=294

 Score =   145 bits (366),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 83/168 (49%), Positives = 107/168 (64%), Gaps = 9/168 (5%)
 Frame = +3

Query  198  SSALVEQEKYLAELLAERSKLSPFMPVLPNCFRLLNQEILRVTTLLGNASVLDQSGLEHG  377
            SS   ++E+YLAELLAE+ KL PF  VLP C RLLNQEI RV+ +  N S +D    EH 
Sbjct  27   SSLPTDRERYLAELLAEKQKLVPFTQVLPLCTRLLNQEIRRVSGV--NPSFMDHERFEHD  84

Query  378  SPLASGGLFSNG-GANKDRWSSPFQSEMSGLVqsssaqswlgs-----qssssGLIVKQT  539
            SP  S G   NG   + + WS   Q+E +G +Q                   +  IVK+ 
Sbjct  85   SPFRSLGQHPNGRQMDLEGWSV-MQTEENGHLQRVVPIQAASMGWPGLPGVPTTPIVKRV  143

Query  540  IRIDIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDCRVLIRGRGSIKD  683
            +R+D+PV++YP+YNFVGR+LGPRGNSLKRVE  T+CRV IRG+GS+KD
Sbjct  144  VRLDVPVDKYPSYNFVGRILGPRGNSLKRVEAVTECRVYIRGKGSVKD  191



>emb|CAN79284.1| hypothetical protein VITISV_041524 [Vitis vinifera]
Length=249

 Score =   144 bits (362),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 82/172 (48%), Positives = 112/172 (65%), Gaps = 16/172 (9%)
 Frame = +3

Query  213  EQEKYLAELLAERSKLSPFMPVLPNCFRLLNQEILRVTTLLGNASVLDQSGLEHGSPLAS  392
            ++E+YLAELLAE+ KL PFM +LP C RLLNQEI R++ +  N   +D   +EH SP  S
Sbjct  31   DRERYLAELLAEKQKLGPFMQILPQCSRLLNQEIRRLSAIAPNQGFVDLERIEHDSPFRS  90

Query  393  GGLFSNGGA-NKDRWSSPFQSEMSG-LVqsssaqswlgsqssssGL----IVKQTIRIDI  554
             G   NGG  + + W +  Q+E +G L + +  Q+       + G+    +VK+ IR+D+
Sbjct  91   LGQHPNGGPMDLEGWPA-MQTEENGPLRRMAPFQASSLGWHRAPGIPTTPVVKRVIRLDV  149

Query  555  PVEQYPN---------YNFVGRLLGPRGNSLKRVEVSTDCRVLIRGRGSIKD  683
            PV++YPN         YNFVGR+LGPRGNSLKRVE  T+CRV IRG+GS+KD
Sbjct  150  PVDKYPNVESNSRVGQYNFVGRILGPRGNSLKRVEAMTECRVYIRGQGSVKD  201



>ref|XP_002268790.1| PREDICTED: KH domain-containing protein At2g38610 [Vitis vinifera]
 emb|CBI31159.3| unnamed protein product [Vitis vinifera]
Length=281

 Score =   144 bits (364),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 85/158 (54%), Positives = 105/158 (66%), Gaps = 5/158 (3%)
 Frame = +3

Query  222  KYLAELLAERSKLSPFMPVLPNCFRLLNQEILRVTTLLGNASVLDQSGLEH--GSPLASG  395
            +YL+ELLAE  KL PFM VLP C RLLNQEI+RV+ ++ N    D   L+H   SP+AS 
Sbjct  28   QYLSELLAEHQKLGPFMQVLPICSRLLNQEIIRVSGMISNQGFGDFDRLQHRSPSPMASS  87

Query  396  GLFSN-GGANKDRWSSPFQSEMSGLVqsssaqswlgsqssssGLIVKQTIRIDIPVEQYP  572
             L SN  G     W+   Q  +SG         W G+ +S S   VK+ +R++IPV+ YP
Sbjct  88   NLMSNVSGTGLGGWNGLPQERLSG--PHGMTMDWQGAPASPSSYTVKRILRLEIPVDTYP  145

Query  573  NYNFVGRLLGPRGNSLKRVEVSTDCRVLIRGRGSIKDP  686
            N+NFVGRLLGPRGNSLKRVE +T CRV IRG+GSIKDP
Sbjct  146  NFNFVGRLLGPRGNSLKRVEATTGCRVYIRGKGSIKDP  183



>ref|XP_007140039.1| hypothetical protein PHAVU_008G079200g [Phaseolus vulgaris]
 gb|ESW12033.1| hypothetical protein PHAVU_008G079200g [Phaseolus vulgaris]
Length=281

 Score =   144 bits (364),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 85/158 (54%), Positives = 102/158 (65%), Gaps = 5/158 (3%)
 Frame = +3

Query  222  KYLAELLAERSKLSPFMPVLPNCFRLLNQEILRVTTLLGNASVLDQSGLEH--GSPLASG  395
            +YL+ELLAE  KL PFM  LP C RLLNQEILRV+ +L N    D   L H   SP+AS 
Sbjct  28   QYLSELLAEHQKLGPFMQALPICSRLLNQEILRVSGMLSNQGFGDFDRLRHRSPSPMASS  87

Query  396  GLFSN-GGANKDRWSSPFQSEMSGLVqsssaqswlgsqssssGLIVKQTIRIDIPVEQYP  572
             L SN  G     W+S  Q  + G         W  + +S S   VK+ +R++IPV+ YP
Sbjct  88   NLMSNVSGTGLGGWNSLQQERLCG--PPGMTMDWQSAPASPSSFTVKRILRLEIPVDTYP  145

Query  573  NYNFVGRLLGPRGNSLKRVEVSTDCRVLIRGRGSIKDP  686
            N+NFVGRLLGPRGNSLKRVE +T CRV IRG+GSIKDP
Sbjct  146  NFNFVGRLLGPRGNSLKRVEATTGCRVYIRGKGSIKDP  183



>ref|XP_009411877.1| PREDICTED: KH domain-containing protein At1g09660/At1g09670-like 
[Musa acuminata subsp. malaccensis]
Length=295

 Score =   145 bits (365),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 83/167 (50%), Positives = 107/167 (64%), Gaps = 5/167 (3%)
 Frame = +3

Query  198  SSALVEQEKYLAELLAERSKLSPFMPVLPNCFRLLNQEILRVTTLLGNASVLDQSGLEHG  377
            S A  ++E+YLAEL AER KL PF+ VLP C+RLLN EI+R + L  N + ++   +E  
Sbjct  30   SPATSDRERYLAELFAERQKLGPFLQVLPFCYRLLNHEIVRASGLAPNQTFVEHERIEPF  89

Query  378  SPLASGGLFSNGGANKDRWSSPFQSEMSGL-----VqsssaqswlgsqssssGLIVKQTI  542
            SPL   G    GG       S   +E +       V  SS   W G+   ++  +VK+ I
Sbjct  90   SPLRLTGHPPIGGPMDLEGRSGMHTEENEYFQRIGVLQSSTSGWNGTPGVTTSPVVKKVI  149

Query  543  RIDIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDCRVLIRGRGSIKD  683
            R+D+PV++YPNYNFVGRLLGPRGNSLKRVE ST CRV IRG+GS+KD
Sbjct  150  RLDVPVDKYPNYNFVGRLLGPRGNSLKRVEASTQCRVYIRGQGSVKD  196



>ref|XP_008218700.1| PREDICTED: KH domain-containing protein At1g09660/At1g09670 isoform 
X1 [Prunus mume]
Length=292

 Score =   144 bits (364),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 84/183 (46%), Positives = 109/183 (60%), Gaps = 25/183 (14%)
 Frame = +3

Query  177  IGALRSASSALVEQEKYLAELLAERSKLSPFMPVLPNCFRLLNQEILRVTTLLGNASVLD  356
            + A    SS  V++E+YLAELLAE+ KL PFM +LP C RLLN EI RV+    N +++D
Sbjct  18   VHASPHRSSLPVDRERYLAELLAEKQKLGPFMQILPLCSRLLNHEIRRVSGF--NQTLVD  75

Query  357  QSGLEHGSPLASGGLFSNG-GANKDRWS-------------SPFQSEMSGLVqsssaqsw  494
               LEH SP  +    +NG   + + W              +PFQS   G        + 
Sbjct  76   HERLEHESPFRTLSQSANGRPMDLEGWPGMQMEENGHIQRMAPFQSPSMGWPGVQGIPTT  135

Query  495  lgsqssssGLIVKQTIRIDIPVEQYPNYNFVGRLLGPRGNSLKRVEVSTDCRVLIRGRGS  674
                      IVK+ IR+D+PV++YP+YNFVGR+LGPRGNSLKRVE  T+CRV IRGRGS
Sbjct  136  P---------IVKRVIRLDVPVDKYPHYNFVGRILGPRGNSLKRVEAMTECRVYIRGRGS  186

Query  675  IKD  683
            +KD
Sbjct  187  VKD  189



>ref|XP_007033461.1| RNA-binding KH domain-containing protein [Theobroma cacao]
 gb|EOY04387.1| RNA-binding KH domain-containing protein [Theobroma cacao]
Length=281

 Score =   144 bits (363),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 85/158 (54%), Positives = 104/158 (66%), Gaps = 5/158 (3%)
 Frame = +3

Query  222  KYLAELLAERSKLSPFMPVLPNCFRLLNQEILRVTTLLGNASVLDQSGLEH--GSPLASG  395
            +YL+ELLAE  KL PFM VLP C RLLNQEI RV+ ++ N    D   + H   SP+AS 
Sbjct  28   QYLSELLAEHQKLGPFMQVLPICSRLLNQEIFRVSGMMSNQGFGDFDRMRHRSPSPMASS  87

Query  396  GLFSN-GGANKDRWSSPFQSEMSGLVqsssaqswlgsqssssGLIVKQTIRIDIPVEQYP  572
             L SN  G     W+S  Q  +SG         W G+ +S S   VK+ +R++IPV+ YP
Sbjct  88   NLISNVSGTGLGGWNSLPQERLSG--PPGMTMDWQGAPASPSSYTVKRILRLEIPVDTYP  145

Query  573  NYNFVGRLLGPRGNSLKRVEVSTDCRVLIRGRGSIKDP  686
            N+NFVGRLLGPRGNSLKRVE +T CRV IRG+GSIKDP
Sbjct  146  NFNFVGRLLGPRGNSLKRVEATTGCRVYIRGKGSIKDP  183



>gb|KJB61347.1| hypothetical protein B456_009G352600 [Gossypium raimondii]
Length=211

 Score =   142 bits (358),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 84/160 (53%), Positives = 104/160 (65%), Gaps = 5/160 (3%)
 Frame = +3

Query  216  QEKYLAELLAERSKLSPFMPVLPNCFRLLNQEILRVTTLLGNASVLDQSGLEH--GSPLA  389
            + +YL+ELLAE  KL PF+ VLP C RLLNQEI RV+ ++ N    D   L H   SP+A
Sbjct  26   ESQYLSELLAEHQKLGPFLQVLPICSRLLNQEIFRVSGMMSNQGFGDFDRLRHRSPSPMA  85

Query  390  SGGLFSN-GGANKDRWSSPFQSEMSGLVqsssaqswlgsqssssGLIVKQTIRIDIPVEQ  566
            S  L SN  G     W+S  Q  +SG         W G+ +S S   VK+ +R++IPV+ 
Sbjct  86   SSNLMSNVYGTGLGSWNSLPQERLSG--PPGVTMDWQGAPASPSSYTVKRILRLEIPVDT  143

Query  567  YPNYNFVGRLLGPRGNSLKRVEVSTDCRVLIRGRGSIKDP  686
            YP +NFVGRLLGPRGNSLKRVE +T CRV IRG+GSIKDP
Sbjct  144  YPTFNFVGRLLGPRGNSLKRVEATTGCRVYIRGKGSIKDP  183



>ref|XP_002979473.1| hypothetical protein SELMODRAFT_110771 [Selaginella moellendorffii]
 gb|EFJ19362.1| hypothetical protein SELMODRAFT_110771 [Selaginella moellendorffii]
Length=285

 Score =   144 bits (363),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 86/155 (55%), Positives = 105/155 (68%), Gaps = 10/155 (6%)
 Frame = +3

Query  222  KYLAELLAERSKLSPFMPVLPNCFRLLNQ-EILRVTTLLGNASVLDQSGLEHGSPLASGG  398
            +Y  ELL E+  L PFM VLP+C  LLNQ EILRV+ L+G + +LDQ  L+ GSPL   G
Sbjct  40   RYFTELLMEQESLRPFMMVLPHCSFLLNQAEILRVSKLIGQSQLLDQDTLDMGSPL---G  96

Query  399  LFSNGGANKDRWSSPFQSEMSGLVqsssaqswlgsqssssGLIVKQTIRIDIPVEQYPNY  578
            L SNGG+      +  Q E + L        W GS + S G I+K+T+RI+IP + YPN+
Sbjct  97   LISNGGSRDLNAWAAMQHERTVL------PLWHGSPAGSPGPIIKKTLRIEIPTDDYPNF  150

Query  579  NFVGRLLGPRGNSLKRVEVSTDCRVLIRGRGSIKD  683
            NFVGRLLGPRG SLKRVE  T CRV+IRGRGSIKD
Sbjct  151  NFVGRLLGPRGLSLKRVENETGCRVMIRGRGSIKD  185



>ref|XP_010030195.1| PREDICTED: KH domain-containing protein At1g09660/At1g09670 isoform 
X4 [Eucalyptus grandis]
Length=293

 Score =   144 bits (363),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 84/162 (52%), Positives = 104/162 (64%), Gaps = 7/162 (4%)
 Frame = +3

Query  213  EQEKYLAELLAERSKLSPFMPVLPNCFRLLNQEILRVTTLLGNASVLDQSGLEHGSPLAS  392
            ++E+YLAELLAER K  PFM VLPNC RLLNQEI RV+      S LD   L+H SP   
Sbjct  31   DRERYLAELLAERQKFGPFMQVLPNCGRLLNQEIRRVSAY--GTSFLDHERLDHESPHRP  88

Query  393  GGLFSNGGANK-DRWSSPFQSEMSGLVqsssaqswlgsqssssGL----IVKQTIRIDIP  557
                 NG   + DRWS     E   L ++   QS       + G+    +VK+ IR+D+P
Sbjct  89   FNPQLNGRPLELDRWSVMQMEENGHLQKAGLFQSSSVGWPGAVGVPTTPVVKKVIRLDVP  148

Query  558  VEQYPNYNFVGRLLGPRGNSLKRVEVSTDCRVLIRGRGSIKD  683
            V++YP+YNFVGR+LGPRGNSLKRVE  T CRV IRG+GS+KD
Sbjct  149  VDKYPSYNFVGRILGPRGNSLKRVEALTQCRVYIRGKGSVKD  190



>ref|XP_010030192.1| PREDICTED: KH domain-containing protein At1g09660/At1g09670 isoform 
X2 [Eucalyptus grandis]
 gb|KCW57142.1| hypothetical protein EUGRSUZ_I02779 [Eucalyptus grandis]
Length=294

 Score =   144 bits (363),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 84/162 (52%), Positives = 104/162 (64%), Gaps = 7/162 (4%)
 Frame = +3

Query  213  EQEKYLAELLAERSKLSPFMPVLPNCFRLLNQEILRVTTLLGNASVLDQSGLEHGSPLAS  392
            ++E+YLAELLAER K  PFM VLPNC RLLNQEI RV+      S LD   L+H SP   
Sbjct  31   DRERYLAELLAERQKFGPFMQVLPNCGRLLNQEIRRVSAY--GTSFLDHERLDHESPHRP  88

Query  393  GGLFSNGGANK-DRWSSPFQSEMSGLVqsssaqswlgsqssssGL----IVKQTIRIDIP  557
                 NG   + DRWS     E   L ++   QS       + G+    +VK+ IR+D+P
Sbjct  89   FNPQLNGRPLELDRWSVMQMEENGHLQKAGLFQSSSVGWPGAVGVPTTPVVKKVIRLDVP  148

Query  558  VEQYPNYNFVGRLLGPRGNSLKRVEVSTDCRVLIRGRGSIKD  683
            V++YP+YNFVGR+LGPRGNSLKRVE  T CRV IRG+GS+KD
Sbjct  149  VDKYPSYNFVGRILGPRGNSLKRVEALTQCRVYIRGKGSVKD  190



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1158382918520