BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF044N15

Length=753
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006360332.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    379   2e-126   Solanum tuberosum [potatoes]
ref|XP_004247828.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    379   2e-126   
ref|XP_009619812.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    378   4e-126   Nicotiana tomentosiformis
ref|XP_009784398.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    376   2e-125   Nicotiana sylvestris
gb|EYU32624.1|  hypothetical protein MIMGU_mgv1a005944mg                376   2e-125   Erythranthe guttata [common monkey flower]
gb|AGC59769.1|  3-ketoacyl-CoA thiolase 1                               374   2e-124   Rehmannia glutinosa [Chinese foxglove]
gb|AGC24176.1|  3-ketoacyl-CoA thiolase 2                               374   2e-124   Rehmannia glutinosa [Chinese foxglove]
ref|XP_011073762.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    369   1e-122   Sesamum indicum [beniseed]
gb|KCW57292.1|  hypothetical protein EUGRSUZ_H00090                     361   2e-120   Eucalyptus grandis [rose gum]
gb|KDO43603.1|  hypothetical protein CISIN_1g012506mg                   360   8e-120   Citrus sinensis [apfelsine]
gb|KDO43602.1|  hypothetical protein CISIN_1g012506mg                   359   2e-119   Citrus sinensis [apfelsine]
ref|XP_008457258.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    360   2e-119   Cucumis melo [Oriental melon]
ref|XP_010069076.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    360   3e-119   Eucalyptus grandis [rose gum]
gb|KDO43601.1|  hypothetical protein CISIN_1g012506mg                   358   7e-119   Citrus sinensis [apfelsine]
ref|XP_006420604.1|  hypothetical protein CICLE_v10004931mg             359   1e-118   Citrus clementina [clementine]
ref|XP_011091395.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    357   8e-118   Sesamum indicum [beniseed]
emb|CDO99410.1|  unnamed protein product                                356   1e-117   Coffea canephora [robusta coffee]
ref|XP_010522426.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    356   1e-117   Tarenaya hassleriana [spider flower]
emb|CAA53078.1|  3-ketoacyl-CoA thiolase B                              355   2e-117   Mangifera indica
gb|AAL25590.1|  At2g33150/F25I18.11                                     353   2e-117   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007034449.1|  Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 1    355   2e-117   
gb|KJB72151.1|  hypothetical protein B456_011G161700                    352   1e-116   Gossypium raimondii
ref|NP_180873.1|  3-ketoacyl-CoA thiolase 2                             352   4e-116   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002881265.1|  hypothetical protein ARALYDRAFT_482251             352   4e-116   
gb|KJB72150.1|  hypothetical protein B456_011G161700                    352   6e-116   Gossypium raimondii
ref|NP_001267690.1|  3-ketoacyl-CoA thiolase 2, peroxisomal-like        352   6e-116   Cucumis sativus [cucumbers]
gb|ACV70033.1|  3-ketoacyl CoA thiolase 2                               352   7e-116   Petunia x hybrida [garden petunia]
gb|KHG05724.1|  3-ketoacyl-CoA thiolase 2, peroxisomal -like protein    352   8e-116   Gossypium arboreum [tree cotton]
gb|AAQ77242.1|  acetoacetyl CoA thiolase                                351   8e-116   Helianthus annuus
gb|KJB72152.1|  hypothetical protein B456_011G161700                    351   1e-115   Gossypium raimondii
ref|XP_009132912.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    351   1e-115   Brassica rapa
emb|CAN81585.1|  hypothetical protein VITISV_023191                     349   7e-115   Vitis vinifera
ref|XP_010556945.1|  PREDICTED: LOW QUALITY PROTEIN: 3-ketoacyl-C...    349   7e-115   Tarenaya hassleriana [spider flower]
ref|XP_006294172.1|  hypothetical protein CARUB_v10023167mg             349   7e-115   Capsella rubella
ref|XP_002285653.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    348   1e-114   Vitis vinifera
ref|XP_010243983.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    347   4e-114   Nelumbo nucifera [Indian lotus]
emb|CDX79511.1|  BnaC03g18470D                                          347   5e-114   
emb|CDX84701.1|  BnaA03g15290D                                          347   5e-114   
emb|CDY19452.1|  BnaC04g11470D                                          347   5e-114   Brassica napus [oilseed rape]
ref|XP_007225742.1|  hypothetical protein PRUPE_ppa005421mg             346   9e-114   Prunus persica
ref|XP_008224585.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    346   1e-113   Prunus mume [ume]
ref|XP_010509924.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    346   1e-113   Camelina sativa [gold-of-pleasure]
ref|XP_009143894.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    346   2e-113   Brassica rapa
ref|XP_002299284.2|  hypothetical protein POPTR_0001s14280g             345   2e-113   Populus trichocarpa [western balsam poplar]
ref|XP_010413914.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    345   3e-113   Camelina sativa [gold-of-pleasure]
ref|XP_011002175.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    345   3e-113   Populus euphratica
emb|CDY37750.1|  BnaA04g19180D                                          345   4e-113   Brassica napus [oilseed rape]
ref|XP_006410451.1|  hypothetical protein EUTSA_v10016622mg             344   6e-113   Eutrema salsugineum [saltwater cress]
gb|EPS68937.1|  hypothetical protein M569_05826                         344   7e-113   Genlisea aurea
gb|KDP20330.1|  hypothetical protein JCGZ_06416                         344   8e-113   Jatropha curcas
emb|CAA63598.1|  glyoxysomal beta-ketoacyl-thiolase                     343   1e-112   Brassica napus [oilseed rape]
emb|CDY23766.1|  BnaC04g43560D                                          343   1e-112   Brassica napus [oilseed rape]
ref|XP_009141289.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    343   1e-112   Brassica rapa
ref|XP_009385864.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    342   4e-112   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010935683.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    342   4e-112   Elaeis guineensis
ref|XP_008438387.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    342   5e-112   Cucumis melo [Oriental melon]
ref|XP_008800565.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    341   9e-112   Phoenix dactylifera
ref|XP_010696158.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    341   1e-111   Beta vulgaris subsp. vulgaris [field beet]
pir||S72532  acetyl-CoA C-acyltransferase (EC 2.3.1.16) precursor...    340   2e-111
ref|XP_004296638.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    340   2e-111   Fragaria vesca subsp. vesca
ref|XP_004138952.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    340   3e-111   Cucumis sativus [cucumbers]
ref|XP_004164123.1|  PREDICTED: LOW QUALITY PROTEIN: 3-ketoacyl-C...    340   4e-111   
gb|ACU21519.1|  unknown                                                 333   6e-110   Glycine max [soybeans]
ref|XP_010469514.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    335   1e-109   Camelina sativa [gold-of-pleasure]
ref|XP_011020687.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    333   9e-109   Populus euphratica
ref|XP_011020688.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    333   1e-108   Populus euphratica
ref|XP_006854408.1|  hypothetical protein AMTR_s00039p00196630          333   1e-108   Amborella trichopoda
ref|NP_001238475.1|  peroxisomal 3-ketoacyl-CoA thiolase                332   3e-108   Glycine max [soybeans]
ref|XP_006649171.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    331   5e-108   Oryza brachyantha
gb|AFW74040.1|  hypothetical protein ZEAMMB73_080325                    327   2e-107   
gb|ACJ84483.1|  unknown                                                 323   3e-107   Medicago truncatula
ref|XP_010940650.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    329   4e-107   Elaeis guineensis
ref|XP_006605730.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    326   1e-106   
ref|XP_009376354.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    327   3e-106   Pyrus x bretschneideri [bai li]
pdb|2WUA|A  Chain A, Structure Of The Peroxisomal 3-Ketoacyl-Coa ...    326   4e-106   Helianthus annuus
gb|AFW74041.1|  hypothetical protein ZEAMMB73_080325                    325   4e-106   
ref|NP_001241698.1|  3-ketoacyl-CoA thiolase 2, peroxisomal precu...    327   4e-106   
ref|NP_001131193.1|  acetyl-CoA C-acyltransferase-like protein          327   5e-106   Zea mays [maize]
ref|XP_003555712.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    326   6e-106   Glycine max [soybeans]
ref|XP_008380600.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    325   1e-105   Malus domestica [apple tree]
ref|XP_010099126.1|  3-ketoacyl-CoA thiolase 2                          325   2e-105   
ref|XP_002518136.1|  3-ketoacyl-CoA thiolase B, putative                324   3e-105   
ref|XP_009400955.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    324   4e-105   Musa acuminata subsp. malaccensis [pisang utan]
gb|KEH41248.1|  3-ketoacyl-CoA thiolase 2, peroxisomal-like protein     324   6e-105   Medicago truncatula
gb|ACN39947.1|  unknown                                                 323   6e-105   Picea sitchensis
ref|XP_003570403.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    323   7e-105   Brachypodium distachyon [annual false brome]
ref|XP_008372446.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    323   1e-104   
ref|XP_007145410.1|  hypothetical protein PHAVU_007G236600g             320   1e-103   Phaseolus vulgaris [French bean]
ref|XP_004954382.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    320   3e-103   Setaria italica
ref|XP_004497755.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    319   5e-103   Cicer arietinum [garbanzo]
ref|XP_002974835.1|  hypothetical protein SELMODRAFT_101898             318   8e-103   
ref|XP_002963753.1|  hypothetical protein SELMODRAFT_450889             318   8e-103   Selaginella moellendorffii
dbj|BAJ87577.1|  predicted protein                                      317   2e-102   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009371217.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    317   2e-102   Pyrus x bretschneideri [bai li]
gb|ABR16781.1|  unknown                                                 316   5e-102   Picea sitchensis
pdb|2WU9|A  Chain A, Crystal Structure Of Peroxisomal Kat2 From A...    316   5e-102   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011083116.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    315   1e-101   Sesamum indicum [beniseed]
gb|KDO43599.1|  hypothetical protein CISIN_1g012506mg                   314   2e-101   Citrus sinensis [apfelsine]
gb|KDO65878.1|  hypothetical protein CISIN_1g0125222mg                  310   2e-101   Citrus sinensis [apfelsine]
ref|XP_009411367.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    314   4e-101   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010457531.1|  PREDICTED: 3-ketoacyl-CoA thiolase 1, peroxi...    313   6e-101   Camelina sativa [gold-of-pleasure]
pdb|2C7Y|A  Chain A, Plant Enzyme                                       311   6e-101   Arabidopsis thaliana [mouse-ear cress]
gb|KDO65876.1|  hypothetical protein CISIN_1g0125222mg                  310   9e-101   Citrus sinensis [apfelsine]
ref|XP_009336051.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    313   1e-100   
dbj|BAI66423.1|  3-ketoacyl-CoA thiolase-like protein                   313   1e-100   Triticum aestivum [Canadian hard winter wheat]
gb|EMT31542.1|  3-ketoacyl-CoA thiolase 2, peroxisomal                  313   1e-100   
ref|XP_004247103.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    311   3e-100   
gb|ABR17647.1|  unknown                                                 311   3e-100   Picea sitchensis
gb|KDO65875.1|  hypothetical protein CISIN_1g0125222mg                  309   4e-100   Citrus sinensis [apfelsine]
ref|XP_008235516.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    311   7e-100   Prunus mume [ume]
gb|ACV70032.1|  3-ketoacyl CoA thiolase 1                               311   7e-100   Petunia x hybrida [garden petunia]
ref|XP_006350308.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    310   8e-100   Solanum tuberosum [potatoes]
gb|AEQ94132.1|  putative 3-ketoacyl CoA thiolase                        305   1e-99    Elaeis guineensis
gb|KDP26413.1|  hypothetical protein JCGZ_17571                         310   1e-99    Jatropha curcas
ref|XP_008804745.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    310   1e-99    Phoenix dactylifera
ref|NP_001048523.1|  Os02g0817700                                       310   1e-99    
ref|XP_004290230.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    309   2e-99    Fragaria vesca subsp. vesca
ref|XP_011006998.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    309   3e-99    Populus euphratica
ref|XP_009796304.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    310   4e-99    Nicotiana sylvestris
ref|XP_006368897.1|  hypothetical protein POPTR_0001s14290g             308   4e-99    
emb|CDX86611.1|  BnaC08g00920D                                          308   5e-99    
ref|XP_006443651.1|  hypothetical protein CICLE_v10020068mg             308   7e-99    Citrus clementina [clementine]
ref|XP_007201004.1|  hypothetical protein PRUPE_ppa005303mg             308   8e-99    Prunus persica
ref|XP_009111084.1|  PREDICTED: 3-ketoacyl-CoA thiolase 1, peroxi...    306   3e-98    Brassica rapa
ref|XP_009629663.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    307   3e-98    Nicotiana tomentosiformis
ref|XP_011034453.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    306   4e-98    Populus euphratica
ref|XP_011002176.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    306   4e-98    Populus euphratica
ref|XP_002301570.1|  hypothetical protein POPTR_0002s22410g             305   7e-98    Populus trichocarpa [western balsam poplar]
ref|XP_008804452.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    305   7e-98    Phoenix dactylifera
ref|XP_010484155.1|  PREDICTED: 3-ketoacyl-CoA thiolase 1, peroxi...    305   8e-98    Camelina sativa [gold-of-pleasure]
gb|AAM61609.1|  putative acetyl-CoA acyltransferase                     305   8e-98    Arabidopsis thaliana [mouse-ear cress]
ref|NP_171965.1|  3-ketoacyl-CoA thiolase 1                             305   9e-98    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010484150.1|  PREDICTED: 3-ketoacyl-CoA thiolase 1, peroxi...    305   9e-98    Camelina sativa [gold-of-pleasure]
ref|XP_001764272.1|  predicted protein                                  305   2e-97    
emb|CDP03848.1|  unnamed protein product                                304   4e-97    Coffea canephora [robusta coffee]
dbj|BAJ85217.1|  predicted protein                                      301   8e-97    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010933143.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    301   3e-96    Elaeis guineensis
emb|CDY15520.1|  BnaA08g28040D                                          300   5e-96    Brassica napus [oilseed rape]
ref|XP_006307516.1|  hypothetical protein CARUB_v10009140mg             295   1e-95    
ref|XP_010109695.1|  3-ketoacyl-CoA thiolase 2                          299   1e-95    Morus notabilis
gb|KDO43600.1|  hypothetical protein CISIN_1g012506mg                   298   3e-95    Citrus sinensis [apfelsine]
gb|KFK42814.1|  hypothetical protein AALP_AA1G042000                    298   4e-95    Arabis alpina [alpine rockcress]
gb|KHG13200.1|  3-ketoacyl-CoA thiolase 2, peroxisomal -like protein    298   8e-95    Gossypium arboreum [tree cotton]
ref|XP_001762605.1|  predicted protein                                  297   2e-94    
ref|XP_009384048.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    296   3e-94    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010684942.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    296   4e-94    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010475137.1|  PREDICTED: 3-ketoacyl-CoA thiolase 1, peroxi...    295   5e-94    Camelina sativa [gold-of-pleasure]
gb|ACN29136.1|  unknown                                                 295   6e-94    Zea mays [maize]
gb|EYU17978.1|  hypothetical protein MIMGU_mgv1a005895mg                295   8e-94    Erythranthe guttata [common monkey flower]
ref|XP_002467133.1|  hypothetical protein SORBIDRAFT_01g020150          295   1e-93    Sorghum bicolor [broomcorn]
ref|XP_006307517.1|  hypothetical protein CARUB_v10009140mg             294   1e-93    Capsella rubella
gb|EMS48058.1|  3-ketoacyl-CoA thiolase 2, peroxisomal                  294   2e-93    Triticum urartu
ref|XP_002521123.1|  3-ketoacyl-CoA thiolase B, putative                294   3e-93    Ricinus communis
gb|KJB10129.1|  hypothetical protein B456_001G185200                    290   5e-93    Gossypium raimondii
gb|AAB80634.1|  Strong similarity to Cucumis acetyl-CoA acyltrans...    292   1e-92    Arabidopsis thaliana [mouse-ear cress]
gb|KCW50170.1|  hypothetical protein EUGRSUZ_K03601                     290   2e-92    Eucalyptus grandis [rose gum]
gb|KCW50169.1|  hypothetical protein EUGRSUZ_K03601                     290   2e-92    Eucalyptus grandis [rose gum]
ref|XP_010918893.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    291   3e-92    Elaeis guineensis
ref|XP_003632434.2|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    290   4e-92    
ref|XP_004982961.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    290   5e-92    Setaria italica
gb|KJB10128.1|  hypothetical protein B456_001G185200                    290   2e-91    Gossypium raimondii
ref|XP_010038353.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    289   2e-91    Eucalyptus grandis [rose gum]
gb|KCW50166.1|  hypothetical protein EUGRSUZ_K03601                     288   6e-91    Eucalyptus grandis [rose gum]
ref|XP_002889522.1|  hypothetical protein ARALYDRAFT_470458             286   7e-91    
gb|KJB42404.1|  hypothetical protein B456_007G152600                    287   9e-91    Gossypium raimondii
gb|KJB42405.1|  hypothetical protein B456_007G152600                    287   1e-90    Gossypium raimondii
ref|XP_007225741.1|  hypothetical protein PRUPE_ppa005421mg             286   1e-90    
ref|XP_006662414.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    287   1e-90    Oryza brachyantha
ref|XP_007153157.1|  hypothetical protein PHAVU_003G011600g             286   2e-90    Phaseolus vulgaris [French bean]
ref|XP_003604976.1|  3-ketoacyl-CoA thiolase 2, peroxisomal             285   2e-90    Medicago truncatula
ref|XP_004506590.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    285   3e-90    Cicer arietinum [garbanzo]
ref|XP_009796305.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    286   4e-90    Nicotiana sylvestris
ref|NP_001064764.1|  Os10g0457600                                       285   6e-90    
gb|EEC67095.1|  hypothetical protein OsI_33888                          285   8e-90    Oryza sativa Indica Group [Indian rice]
gb|AFK40880.1|  unknown                                                 282   5e-89    Medicago truncatula
gb|KHN15993.1|  3-ketoacyl-CoA thiolase 2, peroxisomal                  282   6e-89    Glycine soja [wild soybean]
ref|NP_001242568.1|  uncharacterized protein LOC100789930               281   1e-88    
ref|XP_004506669.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    281   2e-88    Cicer arietinum [garbanzo]
gb|KHG11493.1|  3-ketoacyl-CoA thiolase 2, peroxisomal -like protein    281   2e-88    Gossypium arboreum [tree cotton]
ref|XP_009336047.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    280   3e-88    
ref|XP_010547051.1|  PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxi...    279   2e-87    Tarenaya hassleriana [spider flower]
ref|XP_010547050.1|  PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxi...    279   2e-87    Tarenaya hassleriana [spider flower]
ref|NP_001237076.1|  3-ketoacyl-CoA thiolase                            278   4e-87    Glycine max [soybeans]
ref|XP_008454505.1|  PREDICTED: 3-ketoacyl-CoA thiolase 1, peroxi...    276   2e-86    
ref|XP_007049827.1|  Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 3    273   2e-86    
ref|XP_007049828.1|  Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 4    273   4e-86    
ref|XP_008454504.1|  PREDICTED: 3-ketoacyl-CoA thiolase 1, peroxi...    276   8e-86    
ref|XP_004152018.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    272   4e-85    Cucumis sativus [cucumbers]
ref|XP_006280441.1|  hypothetical protein CARUB_v10026373mg             272   6e-85    Capsella rubella
ref|XP_007049825.1|  Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 1    272   9e-85    
ref|XP_007049826.1|  Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 2    272   9e-85    
ref|XP_006395129.1|  hypothetical protein EUTSA_v10004174mg             271   1e-84    Eutrema salsugineum [saltwater cress]
gb|EMS60447.1|  3-ketoacyl-CoA thiolase 2, peroxisomal                  270   3e-84    Triticum urartu
ref|XP_002865685.1|  KAT5/PKT1/PKT2 peroxisomal 3-keto-acyl-CoA t...    269   1e-83    Arabidopsis lyrata subsp. lyrata
ref|XP_003574006.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    268   2e-83    Brachypodium distachyon [annual false brome]
ref|NP_568704.2|  3-keto-acyl-CoA thiolase 2                            267   6e-83    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010439766.1|  PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxi...    266   1e-82    Camelina sativa [gold-of-pleasure]
ref|XP_007049829.1|  Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 5    259   1e-81    
emb|CDY33940.1|  BnaA02g30470D                                          263   2e-81    Brassica napus [oilseed rape]
ref|XP_010442336.1|  PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxi...    261   9e-81    Camelina sativa [gold-of-pleasure]
ref|XP_009129750.1|  PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxi...    261   2e-80    Brassica rapa
ref|XP_010482154.1|  PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxi...    260   2e-80    Camelina sativa [gold-of-pleasure]
gb|ADE77908.1|  unknown                                                 259   7e-80    Picea sitchensis
ref|XP_010482155.1|  PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxi...    254   1e-78    Camelina sativa [gold-of-pleasure]
emb|CDY05657.1|  BnaC02g38800D                                          256   1e-78    
ref|XP_010442338.1|  PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxi...    254   2e-78    Camelina sativa [gold-of-pleasure]
ref|XP_010439770.1|  PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxi...    253   3e-78    Camelina sativa [gold-of-pleasure]
ref|XP_006395130.1|  hypothetical protein EUTSA_v10004174mg             253   7e-78    Eutrema salsugineum [saltwater cress]
dbj|BAF02017.1|  peroxisomal-3-keto-acyl-CoA thiolase 1                 251   4e-77    Arabidopsis thaliana [mouse-ear cress]
ref|XP_005646163.1|  thiolase                                           252   4e-77    Coccomyxa subellipsoidea C-169
ref|NP_851157.1|  3-keto-acyl-CoA thiolase 2                            251   4e-77    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009129751.1|  PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxi...    249   2e-76    Brassica rapa
gb|AIB06952.1|  3-ketoacyl-CoA thiolase                                 247   2e-75    Vanda hybrid cultivar
ref|XP_010547052.1|  PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxi...    244   2e-74    Tarenaya hassleriana [spider flower]
ref|XP_002946078.1|  hypothetical protein VOLCADRAFT_102696             241   8e-73    Volvox carteri f. nagariensis
gb|ACJ84675.1|  unknown                                                 233   2e-72    Medicago truncatula
gb|KDO43604.1|  hypothetical protein CISIN_1g012506mg                   233   9e-71    Citrus sinensis [apfelsine]
ref|XP_005845320.1|  hypothetical protein CHLNCDRAFT_25846              231   4e-70    Chlorella variabilis
ref|XP_001697225.1|  acetyl-CoA acyltransferase                         233   9e-70    Chlamydomonas reinhardtii
ref|XP_002989683.1|  hypothetical protein SELMODRAFT_447769             228   3e-68    
gb|KIY92728.1|  acetyl-CoA acyltransferase 1                            224   5e-68    Monoraphidium neglectum
ref|XP_002991797.1|  hypothetical protein SELMODRAFT_236388             226   6e-68    
ref|XP_011400620.1|  3-ketoacyl-CoA thiolase 2, peroxisomal             217   9e-64    Auxenochlorella protothecoides
gb|AFW74043.1|  hypothetical protein ZEAMMB73_080325                    207   1e-63    
emb|CEF98532.1|  Thiolase-like, subgroup                                213   3e-62    Ostreococcus tauri
gb|KDO65879.1|  hypothetical protein CISIN_1g0125222mg                  206   6e-61    Citrus sinensis [apfelsine]
ref|XP_001418570.1|  predicted protein                                  207   2e-60    Ostreococcus lucimarinus CCE9901
gb|KJB42403.1|  hypothetical protein B456_007G152600                    201   2e-58    Gossypium raimondii
ref|XP_007513169.1|  unknown                                            201   1e-57    Bathycoccus prasinos
ref|XP_003080093.1|  Dynein 1-alpha heavy chain, flagellar inner ...    210   2e-57    
ref|XP_008349049.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    188   1e-56    
ref|XP_002500295.1|  acetyl-coa acyltransferase                         193   9e-55    Micromonas commoda
ref|XP_002591918.1|  hypothetical protein BRAFLDRAFT_284464             188   8e-53    Branchiostoma floridae
ref|XP_643924.1|  acetyl-CoA C-acyltransferase                          187   2e-52    Dictyostelium discoideum AX4
ref|NP_001072686.1|  3-ketoacyl-CoA thiolase, peroxisomal               186   2e-52    Xenopus tropicalis [western clawed frog]
gb|ACF24566.1|  acetyl-CoA acyltransferase                              182   3e-52    Gymnochlora stellata
ref|XP_003724378.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    186   7e-52    Strongylocentrotus purpuratus [purple urchin]
gb|KDD73648.1|  beta-ketoacyl-ACP synthase                              184   2e-51    Helicosporidium sp. ATCC 50920
ref|XP_005082434.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    180   2e-51    
gb|AAL65399.1|  3-ketoacyl-CoA thiolase                                 176   5e-51    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004349337.1|  peroxisomal 3-ketoacyl-CoA thiolase B              183   6e-51    Capsaspora owczarzaki ATCC 30864
ref|NP_001080604.1|  3-ketoacyl-CoA thiolase, peroxisomal               182   1e-50    Xenopus laevis [clawed frog]
ref|XP_006512179.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    176   3e-50    Mus musculus [mouse]
ref|XP_008844714.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    181   3e-50    
ref|XP_002742159.1|  PREDICTED: 3-ketoacyl-CoA thiolase A, peroxi...    181   4e-50    Saccoglossus kowalevskii
gb|EDL76922.1|  rCG25918, isoform CRA_a                                 175   5e-50    Rattus norvegicus [brown rat]
ref|XP_005348140.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    180   7e-50    Microtus ochrogaster [prairie voles]
ref|XP_006986814.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    175   7e-50    Peromyscus maniculatus bairdii
ref|XP_002111185.1|  expressed hypothetical protein                     180   8e-50    Trichoplax adhaerens
ref|XP_007034451.1|  Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 3    177   1e-49    
ref|XP_003283381.1|  acetyl-CoA C-acyltransferase                       179   1e-49    Dictyostelium purpureum
ref|XP_004339798.1|  acetylCoA acyltransferase, putative                178   5e-49    Acanthamoeba castellanii str. Neff
ref|XP_005096572.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    177   5e-49    Aplysia californica
ref|XP_005348137.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    177   7e-49    Microtus ochrogaster [prairie voles]
dbj|GAM22408.1|  hypothetical protein SAMD00019534_055830               177   7e-49    Acytostelium subglobosum LB1
ref|XP_009066824.1|  hypothetical protein LOTGIDRAFT_134529             177   7e-49    Lottia gigantea
ref|XP_003221941.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    177   7e-49    Anolis carolinensis [Carolina anole]
ref|NP_666342.1|  3-ketoacyl-CoA thiolase B, peroxisomal precursor      177   8e-49    Mus musculus [mouse]
gb|EFA76209.1|  acetyl-CoA C-acyltransferase                            177   1e-48    Heterostelium album PN500
gb|KDO43605.1|  hypothetical protein CISIN_1g012506mg                   175   1e-48    Citrus sinensis [apfelsine]
dbj|BAA14107.1|  peroxisomal 3-ketoacyl-CoA thiolase B                  176   1e-48    Rattus norvegicus [brown rat]
sp|P07871.2|THIKB_RAT  RecName: Full=3-ketoacyl-CoA thiolase B, p...    176   2e-48    Rattus norvegicus [brown rat]
gb|AAH89821.1|  Acaa1 protein                                           175   2e-48    Rattus norvegicus [brown rat]
ref|XP_005849380.1|  hypothetical protein CHLNCDRAFT_143854             176   2e-48    Chlorella variabilis
ref|XP_006634258.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    176   2e-48    Lepisosteus oculatus
ref|NP_570934.1|  3-ketoacyl-CoA thiolase A, peroxisomal precursor      176   3e-48    Mus musculus [mouse]
ref|XP_010785602.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    175   4e-48    Notothenia coriiceps [yellowbelly rockcod]
dbj|BAE25296.1|  unnamed protein product                                175   4e-48    Mus musculus [mouse]
ref|XP_006986793.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    175   4e-48    Peromyscus maniculatus bairdii
gb|EDL76915.1|  rCG25819, isoform CRA_a                                 175   7e-48    Rattus norvegicus [brown rat]
gb|EIE80258.1|  hypothetical protein RO3G_04963                         174   7e-48    Rhizopus delemar RA 99-880
ref|NP_001002207.1|  3-ketoacyl-CoA thiolase, peroxisomal               174   8e-48    Danio rerio [leopard danio]
ref|XP_008853327.1|  PREDICTED: LOW QUALITY PROTEIN: 3-ketoacyl-C...    174   8e-48    
dbj|BAA14106.1|  peroxisomal 3-ketoacyl-CoA thiolase A                  174   1e-47    Rattus norvegicus [brown rat]
ref|NP_036621.1|  3-ketoacyl-CoA thiolase A, peroxisomal                174   1e-47    Rattus norvegicus [brown rat]
ref|XP_002759778.2|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    174   1e-47    Callithrix jacchus [common marmoset]
dbj|BAE35878.1|  unnamed protein product                                173   2e-47    Mus musculus [mouse]
ref|NP_001035108.1|  3-ketoacyl-CoA thiolase B, peroxisomal precu...    174   2e-47    Rattus norvegicus [brown rat]
ref|XP_005297192.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    174   2e-47    Chrysemys picta bellii
ref|XP_010355558.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    173   3e-47    
ref|XP_007943890.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    173   3e-47    
gb|ETI53494.1|  hypothetical protein F443_03599                         172   3e-47    
ref|XP_006713185.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    171   3e-47    
ref|XP_007253620.1|  PREDICTED: 3-ketoacyl-CoA thiolase A, peroxi...    172   4e-47    
sp|P21775.2|THIKA_RAT  RecName: Full=3-ketoacyl-CoA thiolase A, p...    172   4e-47    
ref|XP_010865004.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    172   4e-47    
gb|ETK93319.1|  hypothetical protein L915_03492                         172   4e-47    
ref|XP_005150078.1|  PREDICTED: 3-ketoacyl-CoA thiolase A, peroxi...    172   5e-47    
dbj|BAE72965.1|  hypothetical protein                                   172   6e-47    
ref|XP_007366726.1|  thiolase                                           171   9e-47    
ref|XP_004635291.1|  PREDICTED: 3-ketoacyl-CoA thiolase A, peroxi...    172   9e-47    
ref|XP_007969955.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    172   9e-47    
ref|XP_002813979.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    172   9e-47    
ref|XP_009537056.1|  hypothetical protein PHYSODRAFT_340572             171   9e-47    
ref|XP_003894723.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    172   9e-47    
emb|CDO68177.1|  hypothetical protein BN946_scf184938.g29               171   9e-47    
ref|XP_001088834.2|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    172   9e-47    
ref|NP_001598.1|  3-ketoacyl-CoA thiolase, peroxisomal isoform a        172   9e-47    
ref|XP_005546711.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    172   1e-46    
ref|XP_007517129.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    171   1e-46    
ref|XP_004033892.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    171   1e-46    
pdb|2IIK|A  Chain A, Crystal Structure Of Human Peroxisomal Acety...    171   1e-46    
ref|XP_002904159.1|  3-ketoacyl-CoA thiolase A                          171   1e-46    
ref|XP_003256905.2|  PREDICTED: LOW QUALITY PROTEIN: 3-ketoacyl-C...    171   2e-46    
ref|XP_003132151.1|  PREDICTED: 3-ketoacyl-CoA thiolase A, peroxi...    171   2e-46    
ref|XP_006869210.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    171   2e-46    
emb|CCA76233.1|  probable POT1-acetyl-CoA C-acyltransferase, pero...    170   3e-46    
ref|XP_007578554.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    170   4e-46    
ref|XP_003464147.2|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    170   4e-46    
dbj|BAA25250.1|  mutated 3-ketoacyl-CoA thiolase                        161   5e-46    
gb|ABK94786.1|  unknown                                                 168   5e-46    
ref|XP_005386652.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    170   6e-46    
ref|XP_003930949.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    169   6e-46    
ref|NP_001187475.1|  peroxisomal 3-ketoacyl-CoA thiolase A              169   7e-46    
gb|KIM26928.1|  hypothetical protein M408DRAFT_72087                    169   7e-46    
ref|XP_004377453.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    169   1e-45    
ref|XP_004704131.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    169   1e-45    
gb|ERZ96342.1|  hypothetical protein GLOINDRAFT_71751                   169   1e-45    
ref|XP_008421414.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    168   1e-45    
ref|XP_010739674.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    168   2e-45    
gb|EPZ32623.1|  3-ketoacyl-CoA thiolase A, peroxisomal                  168   2e-45    
ref|XP_005813530.1|  PREDICTED: LOW QUALITY PROTEIN: 3-ketoacyl-C...    168   2e-45    
gb|ACJ02108.1|  3-ketoacyl-coenzyme A thiolase                          162   2e-45    
ref|XP_007191535.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    168   2e-45    
ref|XP_003992303.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    168   2e-45    
ref|XP_008900800.1|  hypothetical protein PPTG_08457                    167   2e-45    
dbj|BAK06976.1|  predicted protein                                      167   2e-45    
ref|XP_004676369.1|  PREDICTED: 3-ketoacyl-CoA thiolase A, peroxi...    168   2e-45    
ref|XP_003456538.2|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    169   3e-45    
ref|XP_004419563.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    168   3e-45    
gb|ELK13640.1|  3-ketoacyl-CoA thiolase, peroxisomal                    167   3e-45    
ref|XP_006910841.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    167   3e-45    
emb|CCF32753.1|  acetyl-CoA acetyltransferase                           167   3e-45    
ref|XP_004642271.1|  PREDICTED: 3-ketoacyl-CoA thiolase A, peroxi...    167   3e-45    
gb|KGL84935.1|  3-ketoacyl-CoA thiolase B, peroxisomal                  167   4e-45    
ref|XP_009833032.1|  hypothetical protein, variant 3                    165   4e-45    
ref|XP_010559421.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    167   5e-45    
ref|XP_007127845.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    167   5e-45    
ref|XP_009833030.1|  hypothetical protein, variant 1                    166   5e-45    
ref|XP_007127844.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    167   6e-45    
ref|XP_011328216.1|  3-ketoacyl-CoA thiolase                            167   6e-45    
gb|EKC24920.1|  3-ketoacyl-CoA thiolase A, peroxisomal                  162   6e-45    
ref|XP_009262137.1|  hypothetical protein FPSE_10745                    167   6e-45    
ref|XP_534222.2|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal...    167   6e-45    
ref|XP_008314704.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    167   7e-45    
ref|XP_001488609.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    167   7e-45    
ref|XP_008522879.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    167   7e-45    
ref|XP_004277954.1|  PREDICTED: 3-ketoacyl-CoA thiolase A, peroxi...    167   7e-45    
ref|XP_005317428.1|  PREDICTED: 3-ketoacyl-CoA thiolase A, peroxi...    166   8e-45    
ref|XP_004614628.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    166   9e-45    
ref|XP_005317422.1|  PREDICTED: 3-ketoacyl-CoA thiolase A, peroxi...    166   9e-45    
ref|XP_007462753.1|  PREDICTED: 3-ketoacyl-CoA thiolase A, peroxi...    166   1e-44    
ref|XP_008153138.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    166   1e-44    
emb|CEF85217.1|  unnamed protein product                                166   1e-44    
ref|XP_006806602.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    167   1e-44    
ref|XP_001373770.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    166   2e-44    
ref|XP_009833029.1|  hypothetical protein H257_08703                    165   2e-44    
gb|EHH51426.1|  hypothetical protein EGM_10792                          165   2e-44    
ref|XP_005901200.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    166   2e-44    
ref|NP_001029491.1|  3-ketoacyl-CoA thiolase, peroxisomal               165   2e-44    
ref|XP_008250935.1|  PREDICTED: LOW QUALITY PROTEIN: 3-ketoacyl-C...    166   2e-44    
emb|CCX07864.1|  Similar to 3-ketoacyl-CoA thiolase B, peroxisoma...    165   2e-44    
ref|XP_010224152.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    166   2e-44    
ref|XP_005994280.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    165   2e-44    
ref|XP_004412369.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    165   4e-44    
ref|XP_005748614.1|  PREDICTED: 3-ketoacyl-CoA thiolase A, peroxi...    166   4e-44    
ref|XP_005040595.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    164   4e-44    
ref|XP_010393120.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    164   4e-44    
ref|XP_005491482.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    164   4e-44    
gb|EIE78703.1|  hypothetical protein RO3G_03407                         164   5e-44    
ref|XP_004823725.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    164   5e-44    
ref|XP_004588416.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    164   5e-44    
ref|XP_004360305.1|  acetyl-CoA C-acyltransferase                       170   6e-44    
ref|XP_006890653.1|  PREDICTED: 3-ketoacyl-CoA thiolase A, peroxi...    164   6e-44    
ref|XP_005040594.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    164   7e-44    
ref|XP_002914680.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    164   7e-44    
emb|CCI45800.1|  unnamed protein product                                164   9e-44    
gb|KGG50758.1|  hypothetical protein DI09_57p130                        163   1e-43    
ref|XP_011217238.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    163   1e-43    
emb|CEG73130.1|  Putative Acetyl-CoA acyltransferase                    163   1e-43    
ref|XP_006077082.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    163   1e-43    
ref|XP_008276561.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    164   1e-43    
ref|XP_003781848.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    163   1e-43    
ref|XP_007000547.1|  hypothetical protein TREMEDRAFT_24802              163   2e-43    
gb|KIJ47990.1|  hypothetical protein M422DRAFT_28531                    163   2e-43    
ref|XP_003353115.1|  hypothetical protein SMAC_03432                    163   2e-43    
ref|XP_008877314.1|  hypothetical protein H310_12126                    162   2e-43    
ref|XP_960422.1|  3-ketoacyl-CoA thiolase                               162   2e-43    
gb|KDQ18816.1|  hypothetical protein BOTBODRAFT_103597                  162   2e-43    
ref|XP_004835307.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    162   2e-43    
gb|KIM88443.1|  hypothetical protein PILCRDRAFT_85575                   162   2e-43    
ref|XP_004854313.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    162   3e-43    
ref|XP_005940527.1|  PREDICTED: 3-ketoacyl-CoA thiolase A, peroxi...    163   3e-43    
dbj|BAD95031.1|  3-ketoacyl-CoA thiolase                                160   3e-43    
ref|XP_006077081.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    163   3e-43    
gb|KIK43764.1|  hypothetical protein CY34DRAFT_803509                   162   4e-43    
ref|XP_011415902.1|  PREDICTED: 3-ketoacyl-CoA thiolase A, peroxi...    161   4e-43    
ref|XP_004538713.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    162   6e-43    
ref|XP_011363629.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    162   6e-43    
ref|XP_009549597.1|  hypothetical protein HETIRDRAFT_441328             161   6e-43    
ref|XP_008066531.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    161   7e-43    
ref|XP_004880487.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    161   8e-43    
ref|XP_004835306.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    162   8e-43    
gb|EPB90768.1|  acetyl-CoA acyltransferase                              161   9e-43    
ref|XP_006680802.1|  hypothetical protein BATDEDRAFT_37225              160   9e-43    
ref|XP_006265991.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    161   9e-43    
ref|XP_004538712.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    162   9e-43    
ref|XP_008161239.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    161   1e-42    
gb|KFP07326.1|  3-ketoacyl-CoA thiolase B, peroxisomal                  160   1e-42    
gb|EFQ33554.1|  acetyl-CoA acetyltransferase                            160   1e-42    
gb|KIN95402.1|  hypothetical protein M404DRAFT_1007539                  160   2e-42    
gb|EPB86339.1|  acetyl-CoA acyltransferase                              160   2e-42    
dbj|GAN10585.1|  3-ketoacyl-CoA thiolase, peroxisomal precursor         160   2e-42    
ref|XP_007770641.1|  acetyl-CoA acetyl transferase                      160   2e-42    
gb|KDN71907.1|  putative acetyl-CoA acetyltransferase                   160   2e-42    
ref|XP_005852686.1|  3-ketoacyl- thiolase peroxisomal                   159   2e-42    
gb|KFG51612.1|  putative acetyl-CoA acyltransferase B                   160   3e-42    
gb|ELU09588.1|  hypothetical protein CAPTEDRAFT_229355                  160   3e-42    
ref|XP_002365975.1|  acetyl-CoA acyltransferase B, putative             159   3e-42    
gb|KFH17089.1|  putative acetyl-CoA acyltransferase B                   159   3e-42    
ref|XP_007595974.1|  acetyl-CoA acetyltransferase                       159   3e-42    
ref|XP_008500452.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    160   3e-42    
emb|CEG63739.1|  Putative Acetyl-CoA acyltransferase                    159   4e-42    
gb|EPR64554.1|  putative acetyl-CoA acyltransferase B                   159   4e-42    
emb|CEI96344.1|  Putative Acetyl-CoA acyltransferase                    159   4e-42    
ref|XP_007322708.1|  hypothetical protein SERLADRAFT_477203             159   4e-42    
gb|KFU95853.1|  3-ketoacyl-CoA thiolase A, peroxisomal                  159   4e-42    
gb|EWM24705.1|  3-ketoacyl- thiolase peroxisomal                        159   4e-42    
ref|XP_005854303.1|  beta-ketoacyl-CoA thiolase                         159   4e-42    
gb|KDQ50409.1|  hypothetical protein JAAARDRAFT_584417                  159   4e-42    
gb|KFH69993.1|  acetyl-CoA acyltransferase                              159   4e-42    
dbj|GAA95537.1|  hypothetical protein E5Q_02192                         159   5e-42    
ref|XP_010833811.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    159   5e-42    
gb|KIO21034.1|  hypothetical protein M407DRAFT_131995                   159   5e-42    
ref|NP_001184217.1|  acetyl-Coenzyme A acyltransferase 1 (peroxis...    159   5e-42    
ref|XP_010710649.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    159   5e-42    
gb|EWG42127.1|  acetyl-CoA acyltransferase                              159   6e-42    
gb|KDQ28695.1|  hypothetical protein PLEOSDRAFT_1054697                 159   6e-42    
gb|EGU82326.1|  hypothetical protein FOXB_07155                         159   6e-42    
ref|XP_010004292.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    159   9e-42    
ref|XP_006462290.1|  hypothetical protein AGABI2DRAFT_193507            158   9e-42    
gb|KDO30583.1|  hypothetical protein SPRG_04484                         157   1e-41    
gb|KIK20810.1|  hypothetical protein PISMIDRAFT_682010                  158   1e-41    
ref|XP_007034450.1|  Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 2    157   1e-41    
ref|XP_005383786.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    158   1e-41    
gb|KFH68616.1|  acetyl-CoA acyltransferase                              158   1e-41    
ref|XP_008882673.1|  acetyl-CoA acyltransferase B, putative             158   1e-41    
ref|XP_007276712.1|  3-ketoacyl- thiolase                               157   1e-41    
dbj|GAN03156.1|  conserved hypothetical protein                         157   1e-41    
gb|KIJ12049.1|  acetyl-CoA C-acyltransferase                            157   2e-41    
ref|XP_003001876.1|  3-ketoacyl-CoA thiolase                            157   2e-41    
ref|XP_003664280.1|  3-ketoacyl-CoA thiolase                            157   2e-41    
emb|CDS10007.1|  Putative Acetyl-CoA acyltransferase                    157   2e-41    
gb|KEY69142.1|  hypothetical protein S7711_04925                        157   3e-41    
gb|EQB52382.1|  acetyl-CoA acetyltransferase                            157   3e-41    
ref|XP_002567514.1|  Pc21g04680                                         157   3e-41    
emb|CCA20150.1|  3ketoacylCoA thiolase A putative                       156   4e-41    
ref|XP_008616222.1|  acetyl-CoA acyltransferase 1                       156   4e-41    
gb|EKV05584.1|  3-ketoacyl-CoA thiolase (POT1), putative                156   4e-41    
gb|KIK92591.1|  hypothetical protein PAXRUDRAFT_829798                  156   5e-41    
gb|KDN40444.1|  thiolase                                                155   6e-41    
gb|KIR48491.1|  acetyl-CoA acyltransferase                              156   6e-41    
ref|XP_566859.1|  acetyl-CoA C-acyltransferase                          156   6e-41    
gb|KIY37061.1|  acetyl-CoA acyltransferase                              156   6e-41    
emb|CDM30934.1|  Thiolase                                               155   8e-41    
gb|KFA63582.1|  hypothetical protein S40285_04144                       155   8e-41    
ref|XP_002780408.1|  3-ketoacyl-CoA thiolase A, peroxisomal precu...    155   1e-40    
ref|XP_007382657.1|  thiolase                                           155   1e-40    
ref|XP_003191423.1|  acetyl-CoA C-acyltransferase                       155   1e-40    
ref|XP_006955790.1|  thiolase                                           155   1e-40    
emb|CDH52593.1|  3-ketoacyl-thiolase                                    155   1e-40    
gb|EPT01198.1|  hypothetical protein FOMPIDRAFT_1029944                 155   1e-40    
gb|KDR70838.1|  hypothetical protein GALMADRAFT_254446                  155   1e-40    
gb|KIR50795.1|  acetyl-CoA acyltransferase                              155   1e-40    
ref|XP_002780409.1|  3-ketoacyl-CoA thiolase A, peroxisomal precu...    155   1e-40    
gb|AFR92621.1|  acetyl-CoA acyltransferase                              155   1e-40    
ref|XP_003415748.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    155   1e-40    
gb|KFH70491.1|  acetyl-CoA acyltransferase                              155   2e-40    
ref|XP_005975939.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    155   2e-40    
ref|XP_001396199.1|  acetyl-CoA C-acyltransferase                       155   2e-40    
emb|CDJ69704.1|  acetyl-CoA acyltransferase B, putative                 152   2e-40    
ref|XP_749100.1|  3-ketoacyl-CoA thiolase (POT1)                        155   2e-40    
ref|XP_002564709.1|  Pc22g06820                                         154   2e-40    
gb|KIL93411.1|  hypothetical protein FAVG1_03392                        154   2e-40    
gb|KIM38401.1|  hypothetical protein M413DRAFT_20051                    154   2e-40    
ref|XP_001905889.1|  hypothetical protein                               154   2e-40    
ref|XP_009648812.1|  3-ketoacyl-CoA thiolase                            154   3e-40    
emb|CEP14254.1|  hypothetical protein                                   154   3e-40    
ref|XP_003032461.1|  hypothetical protein SCHCODRAFT_75718              154   4e-40    
ref|XP_005718521.1|  Fatty acid beta-oxydation multifunctional pr...    159   4e-40    
ref|XP_663302.1|  hypothetical protein AN5698.2                         154   4e-40    
gb|KJA14052.1|  hypothetical protein HYPSUDRAFT_150863                  153   4e-40    
gb|EKV04734.1|  hypothetical protein PDIG_87260                         154   4e-40    
ref|XP_001226866.1|  conserved hypothetical protein                     153   4e-40    
ref|XP_010616927.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    154   5e-40    
ref|XP_001261330.1|  3-ketoacyl-CoA thiolase (POT1), putative           154   5e-40    
ref|XP_001273248.1|  3-ketoacyl-CoA thiolase (POT1), putative           153   5e-40    
gb|KIJ59087.1|  hypothetical protein HYDPIDRAFT_118844                  153   5e-40    
gb|EJU03448.1|  thiolase                                                154   6e-40    
gb|ENH73947.1|  3-ketoacyl-CoA thiolase, peroxisomal                    157   6e-40    



>ref|XP_006360332.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Solanum 
tuberosum]
Length=465

 Score =   379 bits (973),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 186/215 (87%), Positives = 206/215 (96%), Gaps = 0/215 (0%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  241
            AIERQRVLLQHLRP+  +SSL++IESS+SASVC+AGDSAAYQR SV+GDD+VIVAAYRTP
Sbjct  4    AIERQRVLLQHLRPSQTSSSLENIESSISASVCSAGDSAAYQRTSVFGDDVVIVAAYRTP  63

Query  242  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  421
            LCK+K+GGFKDTYPDD+LA+VLKA+IEKTN+NPSEVGDI+VG+VLAPGS RASECRMAAF
Sbjct  64   LCKAKKGGFKDTYPDDILAAVLKAVIEKTNVNPSEVGDIVVGSVLAPGSQRASECRMAAF  123

Query  422  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  601
            YAGFPETVP+RTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMT N MAWEGSVNP
Sbjct  124  YAGFPETVPIRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTTNPMAWEGSVNP  183

Query  602  RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
            +  T+ QAQ+CLLPMGITSENVAHRFGVTRQEQDQ
Sbjct  184  KVKTMVQAQDCLLPMGITSENVAHRFGVTRQEQDQ  218



>ref|XP_004247828.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Solanum lycopersicum]
Length=465

 Score =   379 bits (973),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 186/215 (87%), Positives = 206/215 (96%), Gaps = 0/215 (0%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  241
            AIERQRVLLQHLRP+  +SSL++IESS+SASVC+AGDSAAYQR SV+GDD+VIVAAYRTP
Sbjct  4    AIERQRVLLQHLRPSQTSSSLENIESSISASVCSAGDSAAYQRTSVFGDDVVIVAAYRTP  63

Query  242  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  421
            LCK+KRGGFKDTYPDD+LA+VLKA+IEKTN+NPSEVGDI+VG+VLAPGS RASECRMAAF
Sbjct  64   LCKAKRGGFKDTYPDDILAAVLKAVIEKTNVNPSEVGDIVVGSVLAPGSQRASECRMAAF  123

Query  422  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  601
            YAGFPETVP+RTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMT N MAWEGSVNP
Sbjct  124  YAGFPETVPIRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTTNPMAWEGSVNP  183

Query  602  RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
            +  ++ QAQ+CLLPMGITSENVAHRFGVTRQEQDQ
Sbjct  184  KVKSMVQAQDCLLPMGITSENVAHRFGVTRQEQDQ  218



>ref|XP_009619812.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Nicotiana 
tomentosiformis]
Length=464

 Score =   378 bits (970),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 188/215 (87%), Positives = 204/215 (95%), Gaps = 0/215 (0%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  241
            AIERQRVLLQHLRP+  +SSL++IESS++ASVC+AGDSAAYQR SV+GDD+VIVAAYRTP
Sbjct  4    AIERQRVLLQHLRPSQTSSSLENIESSIAASVCSAGDSAAYQRTSVFGDDVVIVAAYRTP  63

Query  242  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  421
            LCK+KRGGFKDTYPDDLLA VLKAL+EKTNL+PSEVGDI+VGTVLAPGS RASECRMAAF
Sbjct  64   LCKAKRGGFKDTYPDDLLAPVLKALMEKTNLSPSEVGDIVVGTVLAPGSQRASECRMAAF  123

Query  422  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  601
            YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMT N MAWEGSVNP
Sbjct  124  YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTANPMAWEGSVNP  183

Query  602  RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
            +   + QAQ+CLLPMGITSENVAHRFGVTRQEQDQ
Sbjct  184  KVKMMAQAQDCLLPMGITSENVAHRFGVTRQEQDQ  218



>ref|XP_009784398.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Nicotiana 
sylvestris]
Length=464

 Score =   376 bits (966),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 186/215 (87%), Positives = 204/215 (95%), Gaps = 0/215 (0%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  241
            AIERQRVLLQHLRP+  +SSL++IESS++ASVC+AGDSAAYQR SV+GDD+VIVAAYRTP
Sbjct  4    AIERQRVLLQHLRPSQTSSSLENIESSIAASVCSAGDSAAYQRTSVFGDDVVIVAAYRTP  63

Query  242  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  421
            LCK+KRGGFKDTYPDDLLA VLKAL+EKTN++PSE+GDI+VGTVLAPGS RASECRMAAF
Sbjct  64   LCKAKRGGFKDTYPDDLLAPVLKALMEKTNVSPSEIGDIVVGTVLAPGSQRASECRMAAF  123

Query  422  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  601
            YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMT N MAWEGSVNP
Sbjct  124  YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTTNPMAWEGSVNP  183

Query  602  RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
            +   + QAQ+CLLPMGITSENVAHRFGVTRQEQDQ
Sbjct  184  KVKMMAQAQDCLLPMGITSENVAHRFGVTRQEQDQ  218



>gb|EYU32624.1| hypothetical protein MIMGU_mgv1a005944mg [Erythranthe guttata]
Length=464

 Score =   376 bits (965),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 187/215 (87%), Positives = 204/215 (95%), Gaps = 0/215 (0%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  241
            A+ERQRVLLQHLRP+  +SSL+ IESS+SAS+C+AGDSAAY R+SV+GDD+VIVAAYRT 
Sbjct  4    AVERQRVLLQHLRPSFTSSSLEDIESSLSASICSAGDSAAYHRSSVFGDDVVIVAAYRTA  63

Query  242  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  421
            LCKSKRGGFKDTYPDDLLA VL+A++EKTN+NPSEVGDI+VGTVLAPGS RASECRMAAF
Sbjct  64   LCKSKRGGFKDTYPDDLLAPVLRAVMEKTNVNPSEVGDIVVGTVLAPGSQRASECRMAAF  123

Query  422  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  601
            YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTVN MAWEGSVNP
Sbjct  124  YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTVNPMAWEGSVNP  183

Query  602  RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
            R  T+ QAQ+CLLPMGITSENVAHRFGVTRQEQDQ
Sbjct  184  RVKTMAQAQDCLLPMGITSENVAHRFGVTRQEQDQ  218



>gb|AGC59769.1| 3-ketoacyl-CoA thiolase 1 [Rehmannia glutinosa]
Length=464

 Score =   374 bits (959),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 186/215 (87%), Positives = 203/215 (94%), Gaps = 0/215 (0%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  241
            A ERQRVLLQHLRP+  +SSL+ IESSVSAS+C+AGDSAAY R+SV+GDD+VIVAAYRT 
Sbjct  4    ATERQRVLLQHLRPSFTSSSLEDIESSVSASICSAGDSAAYHRSSVFGDDVVIVAAYRTA  63

Query  242  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  421
            LCKSKRGGFKDTYPDDLLA VL+A++EKTN+NP+EVGDI+VGTVLAPGS RASECRMAAF
Sbjct  64   LCKSKRGGFKDTYPDDLLAPVLRAVVEKTNVNPNEVGDIVVGTVLAPGSQRASECRMAAF  123

Query  422  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  601
            YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTVN MAWEGSVNP
Sbjct  124  YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTVNPMAWEGSVNP  183

Query  602  RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
            R  ++ QAQ+CLLPMGITSENVAHRFGVTRQEQDQ
Sbjct  184  RVKSMAQAQDCLLPMGITSENVAHRFGVTRQEQDQ  218



>gb|AGC24176.1| 3-ketoacyl-CoA thiolase 2 [Rehmannia glutinosa]
Length=464

 Score =   374 bits (959),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 186/215 (87%), Positives = 203/215 (94%), Gaps = 0/215 (0%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  241
            A ERQRVLLQHLRP+  +SSL+ IESSVSAS+C+AGDSAAY R+SV+GDD+VIVAAYRT 
Sbjct  4    ATERQRVLLQHLRPSFTSSSLEDIESSVSASICSAGDSAAYHRSSVFGDDVVIVAAYRTA  63

Query  242  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  421
            LCKSKRGGFKDTYPDDLLA VL+A++EKTN+NP+EVGDI+VGTVLAPGS RASECRMAAF
Sbjct  64   LCKSKRGGFKDTYPDDLLAPVLRAVVEKTNVNPNEVGDIVVGTVLAPGSQRASECRMAAF  123

Query  422  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  601
            YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTVN MAWEGSVNP
Sbjct  124  YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTVNPMAWEGSVNP  183

Query  602  RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
            R  ++ QAQ+CLLPMGITSENVAHRFGVTRQEQDQ
Sbjct  184  RVKSMAQAQDCLLPMGITSENVAHRFGVTRQEQDQ  218



>ref|XP_011073762.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Sesamum 
indicum]
Length=464

 Score =   369 bits (948),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 184/215 (86%), Positives = 202/215 (94%), Gaps = 0/215 (0%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  241
            AI+RQRVLLQHLRP+  +S+L+ I SSVSAS+C AGDSAAY R+SV+GDD+VIVAA+RT 
Sbjct  4    AIDRQRVLLQHLRPSFTSSTLEDIGSSVSASICLAGDSAAYHRSSVFGDDVVIVAAHRTA  63

Query  242  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  421
            LCKSKRGGFKDTYPDDLLA VL+AL+EKTN+NP+EVGDI+VGTVLAPGS RASECRMAAF
Sbjct  64   LCKSKRGGFKDTYPDDLLAPVLRALLEKTNVNPNEVGDIVVGTVLAPGSQRASECRMAAF  123

Query  422  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  601
            YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMT+N MAWEGSVNP
Sbjct  124  YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTINPMAWEGSVNP  183

Query  602  RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
            R  T+ QAQ+CLLPMGITSENVAHRFGVTRQEQDQ
Sbjct  184  RVKTMAQAQDCLLPMGITSENVAHRFGVTRQEQDQ  218



>gb|KCW57292.1| hypothetical protein EUGRSUZ_H00090 [Eucalyptus grandis]
Length=380

 Score =   361 bits (926),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 183/215 (85%), Positives = 200/215 (93%), Gaps = 0/215 (0%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  241
            AIERQRVLLQHLRP++++SS+    SS+SAS+CAAGDSAAYQR+  +GDDIVIVAAYRT 
Sbjct  4    AIERQRVLLQHLRPSSSSSSVHGDASSLSASICAAGDSAAYQRSGSFGDDIVIVAAYRTA  63

Query  242  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  421
            LCKSKRGGFKDTYPDDLLA VL+ALI+KT +NPSEVGDI+VGTVLAPGS RASECRMAAF
Sbjct  64   LCKSKRGGFKDTYPDDLLAPVLRALIDKTKINPSEVGDIVVGTVLAPGSQRASECRMAAF  123

Query  422  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  601
            YAGFPETVP+RTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTVN MAWEGSVNP
Sbjct  124  YAGFPETVPIRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTVNPMAWEGSVNP  183

Query  602  RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
            +  +  QAQNCLLPMG+TSENVAHRFGVTRQEQDQ
Sbjct  184  KVKSFAQAQNCLLPMGVTSENVAHRFGVTRQEQDQ  218



>gb|KDO43603.1| hypothetical protein CISIN_1g012506mg [Citrus sinensis]
Length=415

 Score =   360 bits (924),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 182/215 (85%), Positives = 198/215 (92%), Gaps = 2/215 (1%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  241
            AI RQ+VLL+HLRP+N++S   + ES +SAS CAAGDSAAY R SVYGDD+VIVAAYRT 
Sbjct  4    AINRQQVLLEHLRPSNSSSH--NYESILSASACAAGDSAAYHRTSVYGDDVVIVAAYRTA  61

Query  242  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  421
            LCKSKRGGFKDTYPDDLLA VLKA+IEKTN++PSEVGDI+VGTVLAPGS RASECRMAAF
Sbjct  62   LCKSKRGGFKDTYPDDLLAPVLKAVIEKTNVDPSEVGDIVVGTVLAPGSQRASECRMAAF  121

Query  422  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  601
            YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTVN MAWEGSVNP
Sbjct  122  YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTVNPMAWEGSVNP  181

Query  602  RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
            +    +QAQNCLLPMG+TSENVAHRFGVTR+EQDQ
Sbjct  182  KVKAFEQAQNCLLPMGVTSENVAHRFGVTRKEQDQ  216



>gb|KDO43602.1| hypothetical protein CISIN_1g012506mg [Citrus sinensis]
Length=406

 Score =   359 bits (921),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 182/215 (85%), Positives = 198/215 (92%), Gaps = 2/215 (1%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  241
            AI RQ+VLL+HLRP+N++S   + ES +SAS CAAGDSAAY R SVYGDD+VIVAAYRT 
Sbjct  4    AINRQQVLLEHLRPSNSSSH--NYESILSASACAAGDSAAYHRTSVYGDDVVIVAAYRTA  61

Query  242  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  421
            LCKSKRGGFKDTYPDDLLA VLKA+IEKTN++PSEVGDI+VGTVLAPGS RASECRMAAF
Sbjct  62   LCKSKRGGFKDTYPDDLLAPVLKAVIEKTNVDPSEVGDIVVGTVLAPGSQRASECRMAAF  121

Query  422  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  601
            YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTVN MAWEGSVNP
Sbjct  122  YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTVNPMAWEGSVNP  181

Query  602  RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
            +    +QAQNCLLPMG+TSENVAHRFGVTR+EQDQ
Sbjct  182  KVKAFEQAQNCLLPMGVTSENVAHRFGVTRKEQDQ  216



>ref|XP_008457258.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Cucumis 
melo]
Length=461

 Score =   360 bits (925),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 183/215 (85%), Positives = 196/215 (91%), Gaps = 3/215 (1%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  241
            AI RQ+VLL HLRP+   SSL S +S +SAS C AGDSAAYQRNSV+GDD+VIVAAYRT 
Sbjct  4    AINRQKVLLHHLRPS---SSLHSHDSPLSASACLAGDSAAYQRNSVFGDDVVIVAAYRTA  60

Query  242  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  421
            LCKSKRGGFKDT+PDDLLA VLKALIEKTNLNPSEVGDI+VG+VL PGS RASECRMAAF
Sbjct  61   LCKSKRGGFKDTHPDDLLAPVLKALIEKTNLNPSEVGDIVVGSVLGPGSQRASECRMAAF  120

Query  422  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  601
            YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTVN MAWEGSVNP
Sbjct  121  YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTVNPMAWEGSVNP  180

Query  602  RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
            +    +QAQNCLLPMGITSENVAHRFGVTR++QDQ
Sbjct  181  KVKMFEQAQNCLLPMGITSENVAHRFGVTREQQDQ  215



>ref|XP_010069076.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Eucalyptus 
grandis]
 gb|KCW57291.1| hypothetical protein EUGRSUZ_H00090 [Eucalyptus grandis]
Length=464

 Score =   360 bits (925),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 183/215 (85%), Positives = 200/215 (93%), Gaps = 0/215 (0%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  241
            AIERQRVLLQHLRP++++SS+    SS+SAS+CAAGDSAAYQR+  +GDDIVIVAAYRT 
Sbjct  4    AIERQRVLLQHLRPSSSSSSVHGDASSLSASICAAGDSAAYQRSGSFGDDIVIVAAYRTA  63

Query  242  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  421
            LCKSKRGGFKDTYPDDLLA VL+ALI+KT +NPSEVGDI+VGTVLAPGS RASECRMAAF
Sbjct  64   LCKSKRGGFKDTYPDDLLAPVLRALIDKTKINPSEVGDIVVGTVLAPGSQRASECRMAAF  123

Query  422  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  601
            YAGFPETVP+RTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTVN MAWEGSVNP
Sbjct  124  YAGFPETVPIRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTVNPMAWEGSVNP  183

Query  602  RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
            +  +  QAQNCLLPMG+TSENVAHRFGVTRQEQDQ
Sbjct  184  KVKSFAQAQNCLLPMGVTSENVAHRFGVTRQEQDQ  218



>gb|KDO43601.1| hypothetical protein CISIN_1g012506mg [Citrus sinensis]
Length=437

 Score =   358 bits (920),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 182/215 (85%), Positives = 198/215 (92%), Gaps = 2/215 (1%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  241
            AI RQ+VLL+HLRP+N++S   + ES +SAS CAAGDSAAY R SVYGDD+VIVAAYRT 
Sbjct  4    AINRQQVLLEHLRPSNSSSH--NYESILSASACAAGDSAAYHRTSVYGDDVVIVAAYRTA  61

Query  242  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  421
            LCKSKRGGFKDTYPDDLLA VLKA+IEKTN++PSEVGDI+VGTVLAPGS RASECRMAAF
Sbjct  62   LCKSKRGGFKDTYPDDLLAPVLKAVIEKTNVDPSEVGDIVVGTVLAPGSQRASECRMAAF  121

Query  422  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  601
            YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTVN MAWEGSVNP
Sbjct  122  YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTVNPMAWEGSVNP  181

Query  602  RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
            +    +QAQNCLLPMG+TSENVAHRFGVTR+EQDQ
Sbjct  182  KVKAFEQAQNCLLPMGVTSENVAHRFGVTRKEQDQ  216



>ref|XP_006420604.1| hypothetical protein CICLE_v10004931mg [Citrus clementina]
 ref|XP_006489799.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Citrus 
sinensis]
 gb|ESR33844.1| hypothetical protein CICLE_v10004931mg [Citrus clementina]
 gb|KDO43598.1| hypothetical protein CISIN_1g012506mg [Citrus sinensis]
Length=462

 Score =   359 bits (921),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 182/215 (85%), Positives = 198/215 (92%), Gaps = 2/215 (1%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  241
            AI RQ+VLL+HLRP+N++S   + ES +SAS CAAGDSAAY R SVYGDD+VIVAAYRT 
Sbjct  4    AINRQQVLLEHLRPSNSSSH--NYESILSASACAAGDSAAYHRTSVYGDDVVIVAAYRTA  61

Query  242  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  421
            LCKSKRGGFKDTYPDDLLA VLKA+IEKTN++PSEVGDI+VGTVLAPGS RASECRMAAF
Sbjct  62   LCKSKRGGFKDTYPDDLLAPVLKAVIEKTNVDPSEVGDIVVGTVLAPGSQRASECRMAAF  121

Query  422  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  601
            YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTVN MAWEGSVNP
Sbjct  122  YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTVNPMAWEGSVNP  181

Query  602  RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
            +    +QAQNCLLPMG+TSENVAHRFGVTR+EQDQ
Sbjct  182  KVKAFEQAQNCLLPMGVTSENVAHRFGVTRKEQDQ  216



>ref|XP_011091395.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Sesamum indicum]
Length=464

 Score =   357 bits (915),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 186/215 (87%), Positives = 205/215 (95%), Gaps = 0/215 (0%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  241
            A+ERQRVLLQHLRP+  +SSL+ I+SS+SAS+C+AGDS+AY R++V+GDD+VIVAAYRTP
Sbjct  4    AVERQRVLLQHLRPSFTSSSLEDIDSSISASICSAGDSSAYHRSTVFGDDVVIVAAYRTP  63

Query  242  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  421
            LCKSKRGGFKDTYPDDLLA VL+ALIEKTN+NPSEVGDI+VGTVLAPGS RASECRMAAF
Sbjct  64   LCKSKRGGFKDTYPDDLLAPVLRALIEKTNVNPSEVGDIVVGTVLAPGSQRASECRMAAF  123

Query  422  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  601
            YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTVN MAWEGSVNP
Sbjct  124  YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTVNPMAWEGSVNP  183

Query  602  RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
            +  T+ QAQ+CLLPMGITSENVAHRFGVTRQEQDQ
Sbjct  184  KVKTMAQAQDCLLPMGITSENVAHRFGVTRQEQDQ  218



>emb|CDO99410.1| unnamed protein product [Coffea canephora]
Length=461

 Score =   356 bits (914),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 181/215 (84%), Positives = 198/215 (92%), Gaps = 3/215 (1%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  241
            AIERQRV+LQHL+P+  +SSL++++SS+SASVCAAGDSAAY R S +GDD+VIVAAYRT 
Sbjct  4    AIERQRVVLQHLKPSFTSSSLENLDSSLSASVCAAGDSAAYHRTSAFGDDVVIVAAYRTA  63

Query  242  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  421
            LCKSKRGGFKDTYPDDLLA VL+ALIEKTNLNPSEVGDI+VGTVLAPGS RASECRMAAF
Sbjct  64   LCKSKRGGFKDTYPDDLLAPVLRALIEKTNLNPSEVGDIVVGTVLAPGSQRASECRMAAF  123

Query  422  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  601
            YA   ETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMT N MAWEGSVNP
Sbjct  124  YA---ETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTTNPMAWEGSVNP  180

Query  602  RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
            R  ++ +AQNCLLPMG+TSENVAHRF VTRQEQDQ
Sbjct  181  RVKSMAEAQNCLLPMGVTSENVAHRFNVTRQEQDQ  215



>ref|XP_010522426.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Tarenaya hassleriana]
Length=464

 Score =   356 bits (914),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 179/215 (83%), Positives = 198/215 (92%), Gaps = 2/215 (1%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  241
            AIERQRVLL+HLRP+++ S   + E+S+SAS C AGDSAAYQR S+YGDD+VIVAA+RT 
Sbjct  4    AIERQRVLLEHLRPSSSPSH--NFEASLSASACLAGDSAAYQRTSLYGDDVVIVAAHRTA  61

Query  242  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  421
            LCKSKRGGFKDTYPDDLLA VL+ALIEKTN+NP+EVGDI+VGTVLAPGS RASECRMAAF
Sbjct  62   LCKSKRGGFKDTYPDDLLAPVLRALIEKTNVNPNEVGDIVVGTVLAPGSQRASECRMAAF  121

Query  422  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  601
            YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMT N MAWEGSVNP
Sbjct  122  YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTTNPMAWEGSVNP  181

Query  602  RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
            +  + +QAQNCLLPMG+TSENVA RFGVTR+EQDQ
Sbjct  182  KVKSFEQAQNCLLPMGVTSENVAGRFGVTREEQDQ  216



>emb|CAA53078.1| 3-ketoacyl-CoA thiolase B [Mangifera indica]
Length=430

 Score =   355 bits (911),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 181/215 (84%), Positives = 198/215 (92%), Gaps = 2/215 (1%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  241
            AI RQ+VLLQHLRP+N++S   + ES+++ASVCAAGDSAAY R SVYGDD+VIVAA+RT 
Sbjct  4    AINRQQVLLQHLRPSNSSSH--NYESALAASVCAAGDSAAYHRASVYGDDVVIVAAHRTA  61

Query  242  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  421
            LCKSKRGGFKDTYPDDLLA VLKALIEKTNL+PSEVGDI+VGTVLA GS RASECRMAAF
Sbjct  62   LCKSKRGGFKDTYPDDLLAPVLKALIEKTNLDPSEVGDIVVGTVLAAGSQRASECRMAAF  121

Query  422  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  601
            YAGFP+TVP+RTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMT N MAWEGSVNP
Sbjct  122  YAGFPDTVPLRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTANPMAWEGSVNP  181

Query  602  RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
            +    +QA+NCLLPMGITSENVAHRFGVTRQEQDQ
Sbjct  182  KVKEFEQARNCLLPMGITSENVAHRFGVTRQEQDQ  216



>gb|AAL25590.1| At2g33150/F25I18.11 [Arabidopsis thaliana]
Length=390

 Score =   353 bits (906),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 180/215 (84%), Positives = 195/215 (91%), Gaps = 2/215 (1%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  241
            AIERQRVLL+HLRP++++S   + E+S+SAS C AGDSAAYQR S+YGDD+VIVAA+RTP
Sbjct  4    AIERQRVLLEHLRPSSSSSH--NYEASLSASACLAGDSAAYQRTSLYGDDVVIVAAHRTP  61

Query  242  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  421
            LCKSKRG FKDTYPDDLLA VL+ALIEKTNLNPSEVGDI+VGTVLAPGS RASECRMAAF
Sbjct  62   LCKSKRGNFKDTYPDDLLAPVLRALIEKTNLNPSEVGDIVVGTVLAPGSQRASECRMAAF  121

Query  422  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  601
            YAGFPETV VRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMT N MAWEGSVNP
Sbjct  122  YAGFPETVAVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTTNPMAWEGSVNP  181

Query  602  RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
                  QAQNCLLPMG+TSENVA RFGV+RQEQDQ
Sbjct  182  AVKKFAQAQNCLLPMGVTSENVAQRFGVSRQEQDQ  216



>ref|XP_007034449.1| Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 1 [Theobroma cacao]
 gb|EOY05375.1| Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 1 [Theobroma cacao]
Length=464

 Score =   355 bits (912),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 178/215 (83%), Positives = 194/215 (90%), Gaps = 0/215 (0%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  241
            AI RQ++LLQHL P+  +S+  +  S++SAS C AGDSAAYQR + +GDD+VIVAAYRT 
Sbjct  4    AINRQQILLQHLNPSAPSSADQNYNSALSASACLAGDSAAYQRTNAFGDDVVIVAAYRTA  63

Query  242  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  421
            LCKSKRGGFKDTYPDDLLA VL+ALIEKTNLNP EVGDI+VGTVLAPGS RASECRMAAF
Sbjct  64   LCKSKRGGFKDTYPDDLLAPVLRALIEKTNLNPGEVGDIVVGTVLAPGSQRASECRMAAF  123

Query  422  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  601
            YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMT N MAWEGSVNP
Sbjct  124  YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTTNPMAWEGSVNP  183

Query  602  RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
            R   ++QAQNCLLPMG+TSENVAHRFGVTRQEQDQ
Sbjct  184  RVKQMEQAQNCLLPMGVTSENVAHRFGVTRQEQDQ  218



>gb|KJB72151.1| hypothetical protein B456_011G161700 [Gossypium raimondii]
Length=415

 Score =   352 bits (903),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 178/215 (83%), Positives = 194/215 (90%), Gaps = 0/215 (0%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  241
            AI RQ+VLLQHL P+ ++       S++SAS C AGDSAAY+R +V+GDD+VIVAAYRT 
Sbjct  4    AINRQQVLLQHLNPSASSFLSHQNNSALSASACLAGDSAAYRRTNVFGDDVVIVAAYRTA  63

Query  242  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  421
            LCKSKRGGFKDTYPDDLLA VL+A+IEKTNLNPSEVGDI+VGTVLAPGS RASECRMAAF
Sbjct  64   LCKSKRGGFKDTYPDDLLAPVLRAVIEKTNLNPSEVGDIVVGTVLAPGSQRASECRMAAF  123

Query  422  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  601
            YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFY+IGIGAGLESMT N MAWEGSVNP
Sbjct  124  YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYEIGIGAGLESMTTNPMAWEGSVNP  183

Query  602  RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
            R   ++QAQNCLLPMGITSENVAHRFGVTRQEQDQ
Sbjct  184  RVKQMEQAQNCLLPMGITSENVAHRFGVTRQEQDQ  218



>ref|NP_180873.1| 3-ketoacyl-CoA thiolase 2 [Arabidopsis thaliana]
 sp|Q56WD9.2|THIK2_ARATH RecName: Full=3-ketoacyl-CoA thiolase 2, peroxisomal; AltName: 
Full=Acetyl-CoA acyltransferase 2; AltName: Full=Beta-ketothiolase 
2; AltName: Full=Peroxisomal 3-oxoacyl-CoA thiolase 
2; AltName: Full=Peroxisome defective protein 1; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAG42910.1|AF327529_1 putative 3-ketoacyl-CoA thiolase [Arabidopsis thaliana]
 gb|AAK15577.1|AF349530_1 putative 3-ketoacyl-CoA thiolase [Arabidopsis thaliana]
 gb|AAC04908.1| 3-ketoacyl-CoA thiolase [Arabidopsis thaliana]
 dbj|BAA25248.1| 3-ketoacyl-CoA thiolase [Arabidopsis thaliana]
 dbj|BAA25249.1| 3-ketoacyl-CoA thiolase [Arabidopsis thaliana]
 gb|AAK96606.1| At2g33150/F25I18.11 [Arabidopsis thaliana]
 gb|AAL36070.1| At2g33150/F25I18.11 [Arabidopsis thaliana]
 gb|AAM65085.1| 3-ketoacyl-CoA thiolase [Arabidopsis thaliana]
 gb|AEC08791.1| 3-ketoacyl-CoA thiolase 2 [Arabidopsis thaliana]
Length=462

 Score =   352 bits (904),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 180/215 (84%), Positives = 195/215 (91%), Gaps = 2/215 (1%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  241
            AIERQRVLL+HLRP++++S   + E+S+SAS C AGDSAAYQR S+YGDD+VIVAA+RTP
Sbjct  4    AIERQRVLLEHLRPSSSSSH--NYEASLSASACLAGDSAAYQRTSLYGDDVVIVAAHRTP  61

Query  242  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  421
            LCKSKRG FKDTYPDDLLA VL+ALIEKTNLNPSEVGDI+VGTVLAPGS RASECRMAAF
Sbjct  62   LCKSKRGNFKDTYPDDLLAPVLRALIEKTNLNPSEVGDIVVGTVLAPGSQRASECRMAAF  121

Query  422  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  601
            YAGFPETV VRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMT N MAWEGSVNP
Sbjct  122  YAGFPETVAVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTTNPMAWEGSVNP  181

Query  602  RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
                  QAQNCLLPMG+TSENVA RFGV+RQEQDQ
Sbjct  182  AVKKFAQAQNCLLPMGVTSENVAQRFGVSRQEQDQ  216



>ref|XP_002881265.1| hypothetical protein ARALYDRAFT_482251 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57524.1| hypothetical protein ARALYDRAFT_482251 [Arabidopsis lyrata subsp. 
lyrata]
Length=462

 Score =   352 bits (904),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 179/215 (83%), Positives = 195/215 (91%), Gaps = 2/215 (1%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  241
            AIERQRVLL+HLRP++++S   + E+S+SAS C AGDSAAYQR S+YGDD+VIVAA+RTP
Sbjct  4    AIERQRVLLEHLRPSSSSSH--NFEASLSASACLAGDSAAYQRTSLYGDDVVIVAAHRTP  61

Query  242  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  421
            LCKSKRG FKDTYPDDLLA VL+ALIEKTNLNPSEVGDI+VGTVLAPGS RASECRM+AF
Sbjct  62   LCKSKRGNFKDTYPDDLLAPVLRALIEKTNLNPSEVGDIVVGTVLAPGSQRASECRMSAF  121

Query  422  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  601
            YAGFPETV VRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMT N MAWEGSVNP
Sbjct  122  YAGFPETVAVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTTNPMAWEGSVNP  181

Query  602  RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
                  QAQNCLLPMG+TSENVA RFGV+RQEQDQ
Sbjct  182  AVKKFAQAQNCLLPMGVTSENVAQRFGVSRQEQDQ  216



>gb|KJB72150.1| hypothetical protein B456_011G161700 [Gossypium raimondii]
Length=464

 Score =   352 bits (903),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 178/215 (83%), Positives = 194/215 (90%), Gaps = 0/215 (0%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  241
            AI RQ+VLLQHL P+ ++       S++SAS C AGDSAAY+R +V+GDD+VIVAAYRT 
Sbjct  4    AINRQQVLLQHLNPSASSFLSHQNNSALSASACLAGDSAAYRRTNVFGDDVVIVAAYRTA  63

Query  242  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  421
            LCKSKRGGFKDTYPDDLLA VL+A+IEKTNLNPSEVGDI+VGTVLAPGS RASECRMAAF
Sbjct  64   LCKSKRGGFKDTYPDDLLAPVLRAVIEKTNLNPSEVGDIVVGTVLAPGSQRASECRMAAF  123

Query  422  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  601
            YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFY+IGIGAGLESMT N MAWEGSVNP
Sbjct  124  YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYEIGIGAGLESMTTNPMAWEGSVNP  183

Query  602  RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
            R   ++QAQNCLLPMGITSENVAHRFGVTRQEQDQ
Sbjct  184  RVKQMEQAQNCLLPMGITSENVAHRFGVTRQEQDQ  218



>ref|NP_001267690.1| 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Cucumis sativus]
 emb|CAA47926.1| 3-ketoacyl-CoA thiolase [Cucumis sativus]
 gb|KGN56763.1| hypothetical protein Csa_3G133140 [Cucumis sativus]
Length=462

 Score =   352 bits (903),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 178/215 (83%), Positives = 196/215 (91%), Gaps = 3/215 (1%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  241
            AI RQ +LL HLRP+   SS  + ESS+SASVCAAGDSA+YQR SV+GDD+VIVAAYRT 
Sbjct  4    AINRQSILLHHLRPS---SSAYTNESSLSASVCAAGDSASYQRTSVFGDDVVIVAAYRTA  60

Query  242  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  421
            +CKSKRGGFKDTYPDDLLA VLKALIEKTNLNPSEVGDI+VG+VLAPGS RASECRMAAF
Sbjct  61   ICKSKRGGFKDTYPDDLLAPVLKALIEKTNLNPSEVGDIVVGSVLAPGSQRASECRMAAF  120

Query  422  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  601
            YAGFPETVPVRTVNRQCSSGLQAVADVAAAI+AGFYDIGIGAGLESMT N MAWEGSVNP
Sbjct  121  YAGFPETVPVRTVNRQCSSGLQAVADVAAAIRAGFYDIGIGAGLESMTTNPMAWEGSVNP  180

Query  602  RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
            R  +++ AQNCLLPMG+TSENVA RFGV+R++QDQ
Sbjct  181  RVKSIENAQNCLLPMGVTSENVAQRFGVSREKQDQ  215



>gb|ACV70033.1| 3-ketoacyl CoA thiolase 2 [Petunia x hybrida]
Length=463

 Score =   352 bits (902),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 178/215 (83%), Positives = 198/215 (92%), Gaps = 1/215 (0%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  241
            +IERQRVLLQHLRP+  +SSL++++SS+SASVC+AGDSAAYQR SV+GDD+VIVAAYRTP
Sbjct  4    SIERQRVLLQHLRPSQTSSSLENLDSSISASVCSAGDSAAYQRTSVFGDDVVIVAAYRTP  63

Query  242  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  421
            LCK+KRG FKDTYPDDLLA VLKAL+EKTN++PSEVGDI+VGTVLAPGS RASECRMAAF
Sbjct  64   LCKAKRGSFKDTYPDDLLAPVLKALMEKTNVSPSEVGDIVVGTVLAPGSQRASECRMAAF  123

Query  422  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  601
            YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMT N      S NP
Sbjct  124  YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTTNPRLGRFS-NP  182

Query  602  RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
            +  T+ QAQ+CLLPMG+TSENVAHRFGVTRQEQDQ
Sbjct  183  KVKTMAQAQDCLLPMGVTSENVAHRFGVTRQEQDQ  217



>gb|KHG05724.1| 3-ketoacyl-CoA thiolase 2, peroxisomal -like protein [Gossypium 
arboreum]
Length=464

 Score =   352 bits (902),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 178/215 (83%), Positives = 194/215 (90%), Gaps = 0/215 (0%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  241
            AI RQ+VLLQHL P+ ++ S     S++SAS C AGDSAAY R +V+GDD+VIVAAYRT 
Sbjct  4    AINRQQVLLQHLNPSASSFSSHQNNSALSASACLAGDSAAYLRTNVFGDDVVIVAAYRTA  63

Query  242  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  421
            LCKSKRGGFKDTYPDDLLA VL+A+IEKTNLNPSEVGDI+VGTVLAPGS RASECRMAAF
Sbjct  64   LCKSKRGGFKDTYPDDLLAPVLRAVIEKTNLNPSEVGDIVVGTVLAPGSQRASECRMAAF  123

Query  422  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  601
            YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFY+IGIGAGLESMT N MAWEGSVNP
Sbjct  124  YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYEIGIGAGLESMTTNPMAWEGSVNP  183

Query  602  RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
            R   ++QAQNCLLPMG+TSENVAHRFGVTRQEQDQ
Sbjct  184  RVKQMEQAQNCLLPMGVTSENVAHRFGVTRQEQDQ  218



>gb|AAQ77242.1| acetoacetyl CoA thiolase [Helianthus annuus]
Length=449

 Score =   351 bits (901),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 176/215 (82%), Positives = 197/215 (92%), Gaps = 4/215 (2%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  241
            AIERQRVLL+HLRP++ +SSL+++    S SVCAAGDSAAYQRNSV+GDD+VIVAAYR+P
Sbjct  4    AIERQRVLLEHLRPSSTSSSLENL----SVSVCAAGDSAAYQRNSVFGDDVVIVAAYRSP  59

Query  242  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  421
            LCK+KRGG KDTYPDD+LA VLKALIEKTN+NP+EVGDI+VG+VL  GS RASECRMAAF
Sbjct  60   LCKAKRGGLKDTYPDDILAPVLKALIEKTNINPAEVGDIVVGSVLGAGSQRASECRMAAF  119

Query  422  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  601
            YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMT N MAWEGSVNP
Sbjct  120  YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTANPMAWEGSVNP  179

Query  602  RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
            +  T+ QAQ+CLLPMGITSENVA +F +TRQEQDQ
Sbjct  180  KVKTMAQAQDCLLPMGITSENVAQKFSITRQEQDQ  214



>gb|KJB72152.1| hypothetical protein B456_011G161700 [Gossypium raimondii]
Length=453

 Score =   351 bits (901),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 178/215 (83%), Positives = 194/215 (90%), Gaps = 0/215 (0%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  241
            AI RQ+VLLQHL P+ ++       S++SAS C AGDSAAY+R +V+GDD+VIVAAYRT 
Sbjct  4    AINRQQVLLQHLNPSASSFLSHQNNSALSASACLAGDSAAYRRTNVFGDDVVIVAAYRTA  63

Query  242  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  421
            LCKSKRGGFKDTYPDDLLA VL+A+IEKTNLNPSEVGDI+VGTVLAPGS RASECRMAAF
Sbjct  64   LCKSKRGGFKDTYPDDLLAPVLRAVIEKTNLNPSEVGDIVVGTVLAPGSQRASECRMAAF  123

Query  422  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  601
            YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFY+IGIGAGLESMT N MAWEGSVNP
Sbjct  124  YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYEIGIGAGLESMTTNPMAWEGSVNP  183

Query  602  RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
            R   ++QAQNCLLPMGITSENVAHRFGVTRQEQDQ
Sbjct  184  RVKQMEQAQNCLLPMGITSENVAHRFGVTRQEQDQ  218



>ref|XP_009132912.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Brassica 
rapa]
Length=460

 Score =   351 bits (900),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 180/215 (84%), Positives = 192/215 (89%), Gaps = 4/215 (2%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  241
            AIERQRVLL+HLRP    SS  S E S+SAS C AGDSAAYQR S+YGDD+VIVAA+RT 
Sbjct  4    AIERQRVLLEHLRP----SSSHSFEGSLSASACLAGDSAAYQRTSLYGDDVVIVAAHRTA  59

Query  242  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  421
            LCKSKRG FKDTYPDDLLA VL+ALIEKTNL+PSEVGDI+VGTVLAPGS RASECRM+AF
Sbjct  60   LCKSKRGNFKDTYPDDLLAPVLRALIEKTNLDPSEVGDIVVGTVLAPGSQRASECRMSAF  119

Query  422  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  601
            YAGFPETV VRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMT N MAWEGSVNP
Sbjct  120  YAGFPETVAVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTTNPMAWEGSVNP  179

Query  602  RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
                 +QAQNCLLPMG+TSENVAHRFGV+RQEQDQ
Sbjct  180  AVKKFEQAQNCLLPMGVTSENVAHRFGVSRQEQDQ  214



>emb|CAN81585.1| hypothetical protein VITISV_023191 [Vitis vinifera]
Length=461

 Score =   349 bits (896),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 183/215 (85%), Positives = 196/215 (91%), Gaps = 3/215 (1%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  241
            AI RQRVLLQHL P+++A+     ESS+SASVC AGDSAAYQR SV+GDD+VIVAAYRT 
Sbjct  4    AINRQRVLLQHLSPSSSAAED---ESSLSASVCVAGDSAAYQRTSVFGDDVVIVAAYRTA  60

Query  242  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  421
            LCKSKRGGFKDTYPDDLLA VL+ALIEKTNLNP+EVGDI+VGTVLAPGS RASECRMAAF
Sbjct  61   LCKSKRGGFKDTYPDDLLAPVLRALIEKTNLNPNEVGDIVVGTVLAPGSQRASECRMAAF  120

Query  422  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  601
            YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMT N MAWEGS+NP
Sbjct  121  YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTANPMAWEGSINP  180

Query  602  RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
            +     QAQ+CLLPMGITSENVAHRFGVTRQEQDQ
Sbjct  181  KVKEFVQAQDCLLPMGITSENVAHRFGVTRQEQDQ  215



>ref|XP_010556945.1| PREDICTED: LOW QUALITY PROTEIN: 3-ketoacyl-CoA thiolase 2, peroxisomal-like 
[Tarenaya hassleriana]
Length=463

 Score =   349 bits (896),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 177/215 (82%), Positives = 195/215 (91%), Gaps = 2/215 (1%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  241
            AIERQRVLL+HLRP++  SS  + E+S+SAS C AGDSA+YQR S+YGDD+VIVAAYRT 
Sbjct  4    AIERQRVLLEHLRPSS--SSSHNFEASLSASACLAGDSASYQRASLYGDDVVIVAAYRTA  61

Query  242  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  421
            LCKSKRGGFKDTYPDDLLA VL+ALIEK N+NP+EVGDI+VGTVLA GS RASECRMAAF
Sbjct  62   LCKSKRGGFKDTYPDDLLAPVLRALIEKKNVNPAEVGDIVVGTVLAAGSQRASECRMAAF  121

Query  422  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  601
            YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMT N MAWEGSVNP
Sbjct  122  YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTANPMAWEGSVNP  181

Query  602  RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
            +  + +QA NCLLPMG+TSENVA RFGVTR+EQDQ
Sbjct  182  KVKSFEQAHNCLLPMGVTSENVAARFGVTREEQDQ  216



>ref|XP_006294172.1| hypothetical protein CARUB_v10023167mg [Capsella rubella]
 gb|EOA27070.1| hypothetical protein CARUB_v10023167mg [Capsella rubella]
Length=462

 Score =   349 bits (896),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 180/215 (84%), Positives = 192/215 (89%), Gaps = 2/215 (1%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  241
            AIERQRVLL+HLRP   ASS  + E+S+SAS C AGDSAAYQR S+YGDD+VIVAA+RTP
Sbjct  4    AIERQRVLLEHLRP--CASSSHNFEASLSASACLAGDSAAYQRTSLYGDDVVIVAAHRTP  61

Query  242  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  421
            LCKSKRG  KDTYPDDLLA VL+ALIEKTNLNPSEVGDI+VGTVLAPGS RASECRM+AF
Sbjct  62   LCKSKRGNLKDTYPDDLLAPVLRALIEKTNLNPSEVGDIVVGTVLAPGSQRASECRMSAF  121

Query  422  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  601
            YAGFPETV VRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMT N MAWEGSVNP
Sbjct  122  YAGFPETVAVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTTNPMAWEGSVNP  181

Query  602  RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
                  QAQNCLLPMG+TSENVA RFGV+RQEQDQ
Sbjct  182  AVKQFVQAQNCLLPMGVTSENVAQRFGVSRQEQDQ  216



>ref|XP_002285653.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Vitis vinifera]
 emb|CBI33354.3| unnamed protein product [Vitis vinifera]
Length=461

 Score =   348 bits (894),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 182/215 (85%), Positives = 196/215 (91%), Gaps = 3/215 (1%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  241
            AI RQRVLLQHL P+++A+     ESS+SASVC AGDSAAYQR SV+GDD+VIVAAYRT 
Sbjct  4    AINRQRVLLQHLSPSSSAAED---ESSLSASVCVAGDSAAYQRTSVFGDDVVIVAAYRTA  60

Query  242  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  421
            LCKSKRGGFKDTYPDDLLA VL+AL+EKTNLNP+EVGDI+VGTVLAPGS RASECRMAAF
Sbjct  61   LCKSKRGGFKDTYPDDLLAPVLRALLEKTNLNPNEVGDIVVGTVLAPGSQRASECRMAAF  120

Query  422  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  601
            YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMT N MAWEGS+NP
Sbjct  121  YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTANPMAWEGSINP  180

Query  602  RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
            +     QAQ+CLLPMGITSENVAHRFGVTRQEQDQ
Sbjct  181  KVKEFVQAQDCLLPMGITSENVAHRFGVTRQEQDQ  215



>ref|XP_010243983.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Nelumbo nucifera]
Length=460

 Score =   347 bits (891),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 177/215 (82%), Positives = 192/215 (89%), Gaps = 4/215 (2%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  241
            AI RQRVLL HLRP    SS    +SS+SASVC AGDSAAY R + +GDD+VIVAAYRT 
Sbjct  4    AINRQRVLLDHLRP----SSQTHHQSSLSASVCLAGDSAAYHRTAAFGDDVVIVAAYRTA  59

Query  242  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  421
            LCKSKRGG+KDT+PDDLLA VLKALIEKTNLNP+EVGDIIVGTVLAPGS RA+ECRMAAF
Sbjct  60   LCKSKRGGYKDTHPDDLLAPVLKALIEKTNLNPNEVGDIIVGTVLAPGSQRATECRMAAF  119

Query  422  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  601
            YAGFPETVP+RTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMT+N M WEGS+NP
Sbjct  120  YAGFPETVPIRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTINPMGWEGSINP  179

Query  602  RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
            RA   Q A++CLLPMGITSENVAHRFGV+RQEQDQ
Sbjct  180  RAKDFQPAEDCLLPMGITSENVAHRFGVSRQEQDQ  214



>emb|CDX79511.1| BnaC03g18470D [Brassica napus]
Length=462

 Score =   347 bits (890),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 179/215 (83%), Positives = 195/215 (91%), Gaps = 2/215 (1%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  241
            AIERQRVLL+HLRP++++S   S E S+SAS C AGDSAAYQR S+YGDD+VIVAA+RT 
Sbjct  4    AIERQRVLLEHLRPSSSSSH--SFEGSLSASACLAGDSAAYQRTSLYGDDVVIVAAHRTA  61

Query  242  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  421
            LCKSKRG FKDTYPDDLLA VL+ALIEKTNL+PSEVGDI+VGTVLAPGS RASECRM+AF
Sbjct  62   LCKSKRGNFKDTYPDDLLAPVLRALIEKTNLDPSEVGDIVVGTVLAPGSQRASECRMSAF  121

Query  422  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  601
            YAGFPETV VRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMT N MAWEGSVNP
Sbjct  122  YAGFPETVAVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTTNPMAWEGSVNP  181

Query  602  RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
                 +QAQNCLLPMG+TSENVAHRFGV+RQEQDQ
Sbjct  182  AVKKFEQAQNCLLPMGVTSENVAHRFGVSRQEQDQ  216



>emb|CDX84701.1| BnaA03g15290D [Brassica napus]
Length=462

 Score =   347 bits (890),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 179/215 (83%), Positives = 195/215 (91%), Gaps = 2/215 (1%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  241
            AIERQRVLL+HLRP++++S   S E S+SAS C AGDSAAYQR S+YGDD+VIVAA+RT 
Sbjct  4    AIERQRVLLEHLRPSSSSSH--SFEGSLSASACLAGDSAAYQRTSLYGDDVVIVAAHRTA  61

Query  242  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  421
            LCKSKRG FKDTYPDDLLA VL+ALIEKTNL+PSEVGDI+VGTVLAPGS RASECRM+AF
Sbjct  62   LCKSKRGNFKDTYPDDLLAPVLRALIEKTNLDPSEVGDIVVGTVLAPGSQRASECRMSAF  121

Query  422  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  601
            YAGFPETV VRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMT N MAWEGSVNP
Sbjct  122  YAGFPETVAVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTTNPMAWEGSVNP  181

Query  602  RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
                 +QAQNCLLPMG+TSENVAHRFGV+RQEQDQ
Sbjct  182  AVKKFEQAQNCLLPMGVTSENVAHRFGVSRQEQDQ  216



>emb|CDY19452.1| BnaC04g11470D [Brassica napus]
Length=463

 Score =   347 bits (890),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 180/215 (84%), Positives = 196/215 (91%), Gaps = 1/215 (0%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  241
            AIERQRVLL+HLRP++++SS  S E S+SAS C AGDSAAYQR S+YGDD+VIVAA+RT 
Sbjct  4    AIERQRVLLEHLRPSSSSSSH-SFEGSLSASACLAGDSAAYQRTSLYGDDVVIVAAHRTA  62

Query  242  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  421
            LCKSKRG FKDTYPDDLLA VL+ALIEKTNLNPS+VGDI+VGTVLAPGS RASECRM+AF
Sbjct  63   LCKSKRGNFKDTYPDDLLAPVLRALIEKTNLNPSDVGDIVVGTVLAPGSQRASECRMSAF  122

Query  422  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  601
            YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMT N MAWEGSVNP
Sbjct  123  YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTTNPMAWEGSVNP  182

Query  602  RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
                 +QAQNCLLPMG+TSENVA RFGV+RQEQDQ
Sbjct  183  AVKKFEQAQNCLLPMGVTSENVAQRFGVSRQEQDQ  217



>ref|XP_007225742.1| hypothetical protein PRUPE_ppa005421mg [Prunus persica]
 gb|EMJ26941.1| hypothetical protein PRUPE_ppa005421mg [Prunus persica]
Length=462

 Score =   346 bits (888),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 174/216 (81%), Positives = 194/216 (90%), Gaps = 3/216 (1%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIE-SSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRT  238
            A  RQRVLL HLRP+  +SSL   + SS+SAS C AGDSAAY R +V+GDD+VIVAAYRT
Sbjct  4    AFNRQRVLLDHLRPS--SSSLHGTDPSSLSASACVAGDSAAYARKNVFGDDVVIVAAYRT  61

Query  239  PLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAA  418
            P+CK+KRGGFKDT+ DDLLA VLKA+IEK+NLNPSEVGDI+VGTVLAPGS RASECRMAA
Sbjct  62   PICKAKRGGFKDTHADDLLAPVLKAVIEKSNLNPSEVGDIVVGTVLAPGSQRASECRMAA  121

Query  419  FYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVN  598
            FYAGFPETVP+RTVNRQCSSGLQAVADVAA+I+AGFYDIGIGAGLESMT N MAWEGSVN
Sbjct  122  FYAGFPETVPIRTVNRQCSSGLQAVADVAASIRAGFYDIGIGAGLESMTANPMAWEGSVN  181

Query  599  PRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
            P+    +QAQNCLLPMG+TSENVAHRFGV+RQEQDQ
Sbjct  182  PKVKIFEQAQNCLLPMGVTSENVAHRFGVSRQEQDQ  217



>ref|XP_008224585.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Prunus mume]
Length=462

 Score =   346 bits (888),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 174/216 (81%), Positives = 194/216 (90%), Gaps = 3/216 (1%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESS-VSASVCAAGDSAAYQRNSVYGDDIVIVAAYRT  238
            A  RQRVLL HLRP+  +SSL   +SS +SAS C AGDSAAY R +V+GDD+VIVAAYRT
Sbjct  4    AFNRQRVLLDHLRPS--SSSLHGTDSSSLSASACVAGDSAAYARTNVFGDDVVIVAAYRT  61

Query  239  PLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAA  418
            P+CK+KRGGFKDT+ DDLLA VLKA+IEK+NLNPSEVGDI+VGTVLAPGS RASECRMAA
Sbjct  62   PICKAKRGGFKDTHADDLLAPVLKAVIEKSNLNPSEVGDIVVGTVLAPGSQRASECRMAA  121

Query  419  FYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVN  598
            FYAGFPETVP+RTVNRQCSSGLQAVADVAA+I+AGFYDIGIGAGLESMT N MAWEGSVN
Sbjct  122  FYAGFPETVPIRTVNRQCSSGLQAVADVAASIRAGFYDIGIGAGLESMTANPMAWEGSVN  181

Query  599  PRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
            P+    +QAQNCLLPMG+TSENVAHRFGV+RQEQDQ
Sbjct  182  PKVKIFEQAQNCLLPMGVTSENVAHRFGVSRQEQDQ  217



>ref|XP_010509924.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Camelina 
sativa]
Length=462

 Score =   346 bits (888),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 179/215 (83%), Positives = 194/215 (90%), Gaps = 2/215 (1%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  241
            AIERQRVLL+HLRP +++S   S E+S+SAS C AGDSAAYQR S+YGDD+VIVAA+RTP
Sbjct  4    AIERQRVLLEHLRPCSSSSH--SFEASLSASACLAGDSAAYQRTSLYGDDVVIVAAHRTP  61

Query  242  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  421
            LCK+KRG FKDTYPDDLLA VL+ALIEKTN+NPSEVGDI+VGTVLAPGS RASECRM+AF
Sbjct  62   LCKAKRGNFKDTYPDDLLAPVLRALIEKTNINPSEVGDIVVGTVLAPGSQRASECRMSAF  121

Query  422  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  601
            YAGFPETV VRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMT N MAWEGSVNP
Sbjct  122  YAGFPETVAVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTTNPMAWEGSVNP  181

Query  602  RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
                  QAQNCLLPMG+TSENVA RFGVTRQEQDQ
Sbjct  182  AVKQFVQAQNCLLPMGVTSENVAQRFGVTRQEQDQ  216



>ref|XP_009143894.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Brassica rapa]
 emb|CDY17140.1| BnaA05g10480D [Brassica napus]
Length=462

 Score =   346 bits (887),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 178/215 (83%), Positives = 195/215 (91%), Gaps = 2/215 (1%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  241
            AIERQRVLL+HLRP++++S   S E S+SAS C AGDSAAYQR S+YGDD+VIVAA+RT 
Sbjct  4    AIERQRVLLEHLRPSSSSSH--SFEGSLSASACLAGDSAAYQRTSLYGDDVVIVAAHRTA  61

Query  242  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  421
            LCKSKRG FKDTYPDDLLA VL+ALIEKTNLNPS+VGDI+VGTVLAPGS RASECRM+AF
Sbjct  62   LCKSKRGNFKDTYPDDLLAPVLRALIEKTNLNPSDVGDIVVGTVLAPGSQRASECRMSAF  121

Query  422  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  601
            YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMT N MAWEGSVNP
Sbjct  122  YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTTNPMAWEGSVNP  181

Query  602  RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
                 +QAQNCLLPMG+TSENVA RFGV+RQ+QDQ
Sbjct  182  AVKKFEQAQNCLLPMGVTSENVAQRFGVSRQDQDQ  216



>ref|XP_002299284.2| hypothetical protein POPTR_0001s14280g [Populus trichocarpa]
 gb|EEE84089.2| hypothetical protein POPTR_0001s14280g [Populus trichocarpa]
Length=461

 Score =   345 bits (886),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 174/215 (81%), Positives = 192/215 (89%), Gaps = 4/215 (2%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  241
            AI RQRVLL+HLRP    SS  + ES++SAS C AGDSAAYQR S YGDD+VIVAAYRTP
Sbjct  4    AINRQRVLLEHLRP----SSSHNFESTLSASACLAGDSAAYQRTSAYGDDVVIVAAYRTP  59

Query  242  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  421
             CKSKRGGFKDT+ DDLLA VLKALIEKTNL+P EVGDI+VG+VLAPGS RASECRMAAF
Sbjct  60   QCKSKRGGFKDTHADDLLAPVLKALIEKTNLDPREVGDIVVGSVLAPGSQRASECRMAAF  119

Query  422  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  601
            YAGFPETVP+RTVNRQCSSGLQAVADVAA+IKAGFY+IGIGAGLESMT+N M+W+G VNP
Sbjct  120  YAGFPETVPIRTVNRQCSSGLQAVADVAASIKAGFYEIGIGAGLESMTINQMSWDGDVNP  179

Query  602  RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
            +    Q+AQ+CLLPMGITSENVAHRFGVTRQEQDQ
Sbjct  180  KLKNFQKAQDCLLPMGITSENVAHRFGVTRQEQDQ  214



>ref|XP_010413914.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Camelina sativa]
Length=462

 Score =   345 bits (885),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 178/215 (83%), Positives = 194/215 (90%), Gaps = 2/215 (1%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  241
            AIERQRVLL+HLRP +++S   S E+S+SAS C AGDSAAYQR S+YGDD+VIVAA+RTP
Sbjct  4    AIERQRVLLEHLRPCSSSSH--SFEASLSASACLAGDSAAYQRTSLYGDDVVIVAAHRTP  61

Query  242  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  421
            LCK+KRG FKDTYPDDLLA VL+ALIEKTN+NPSEVGDI+VGTVLAPGS RASECRM+AF
Sbjct  62   LCKAKRGNFKDTYPDDLLAPVLRALIEKTNINPSEVGDIVVGTVLAPGSQRASECRMSAF  121

Query  422  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  601
            YAGFPETV VRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMT N MAWEGSVNP
Sbjct  122  YAGFPETVAVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTTNPMAWEGSVNP  181

Query  602  RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
                  QAQNCLLPMG+TSENVA RFGV+RQEQDQ
Sbjct  182  AVKKFVQAQNCLLPMGVTSENVAQRFGVSRQEQDQ  216



>ref|XP_011002175.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Populus euphratica]
Length=462

 Score =   345 bits (885),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 174/215 (81%), Positives = 192/215 (89%), Gaps = 3/215 (1%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  241
            AI RQRVLL HLRP+   SS  + ES++SAS C AGDSAAYQR S YGDD+VIVAAYRTP
Sbjct  4    AINRQRVLLDHLRPS---SSSHNFESTLSASACLAGDSAAYQRTSAYGDDVVIVAAYRTP  60

Query  242  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  421
             CKSKRGGFKDT+ DDLLA VLKALIEKTNL+P EVGDI+VG+VLAPGS RASECRMAAF
Sbjct  61   QCKSKRGGFKDTHADDLLAPVLKALIEKTNLDPREVGDIVVGSVLAPGSQRASECRMAAF  120

Query  422  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  601
            YAGFPETVPVRTVNRQCSSGLQAVADVAA+IKAGFY+IGIGAGLESMT+N M+W+G VNP
Sbjct  121  YAGFPETVPVRTVNRQCSSGLQAVADVAASIKAGFYEIGIGAGLESMTINQMSWDGDVNP  180

Query  602  RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
            +    Q+AQ+CLLPMG+TSENVAHRFGVTRQEQDQ
Sbjct  181  KLKNFQKAQDCLLPMGVTSENVAHRFGVTRQEQDQ  215



>emb|CDY37750.1| BnaA04g19180D [Brassica napus]
Length=462

 Score =   345 bits (884),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 179/215 (83%), Positives = 194/215 (90%), Gaps = 2/215 (1%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  241
            AIERQRVLLQHLRP++++S   S E S+SAS C AGDSAAYQR S+YGDD+VIVAA+RT 
Sbjct  4    AIERQRVLLQHLRPSSSSSH--SFEGSLSASACLAGDSAAYQRTSLYGDDVVIVAAHRTA  61

Query  242  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  421
            LCKSKRG FKDTYPDDLLA VL+ALIEKTNL+PSEVGDI+VGTVLAPGS RASECRM+AF
Sbjct  62   LCKSKRGNFKDTYPDDLLAPVLRALIEKTNLDPSEVGDIVVGTVLAPGSQRASECRMSAF  121

Query  422  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  601
            YAGFPETV VRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMT N MAWEGSVNP
Sbjct  122  YAGFPETVAVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTTNPMAWEGSVNP  181

Query  602  RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
                  QAQ+CLLPMG+TSENVAHRFGV+RQEQDQ
Sbjct  182  AVKKFAQAQSCLLPMGVTSENVAHRFGVSRQEQDQ  216



>ref|XP_006410451.1| hypothetical protein EUTSA_v10016622mg [Eutrema salsugineum]
 dbj|BAJ34444.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ51904.1| hypothetical protein EUTSA_v10016622mg [Eutrema salsugineum]
Length=462

 Score =   344 bits (883),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 179/215 (83%), Positives = 193/215 (90%), Gaps = 2/215 (1%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  241
            AIERQRVLL+HLRP++++S   S E S+SAS C AGDSAAYQR S+YGDD+VIVAA+RT 
Sbjct  4    AIERQRVLLEHLRPSSSSSH--SFEGSLSASACLAGDSAAYQRTSLYGDDVVIVAAHRTA  61

Query  242  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  421
            LCKSKRG FKDTYPDDLLA VL+ALIEKTNLNPSEVGDI+VGTVLAPGS RASECRM+AF
Sbjct  62   LCKSKRGNFKDTYPDDLLAPVLRALIEKTNLNPSEVGDIVVGTVLAPGSQRASECRMSAF  121

Query  422  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  601
            YAGFPETV VRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMT N MAWEGSVNP
Sbjct  122  YAGFPETVAVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTTNPMAWEGSVNP  181

Query  602  RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
                  QAQNCLLPMG+TSENVA RFGV+RQEQDQ
Sbjct  182  AVKKFAQAQNCLLPMGVTSENVAQRFGVSRQEQDQ  216



>gb|EPS68937.1| hypothetical protein M569_05826, partial [Genlisea aurea]
Length=457

 Score =   344 bits (882),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 172/215 (80%), Positives = 195/215 (91%), Gaps = 6/215 (3%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  241
            A++RQRVLL+HLRP      +++ ESS+SAS+CAAGDSA Y R+SV+GDD+VIVAAYR+ 
Sbjct  4    AVDRQRVLLRHLRP------IENTESSISASICAAGDSAPYHRSSVFGDDVVIVAAYRSA  57

Query  242  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  421
            LCKSKRG FKDTYP+D+LA VL+ALI+KTNLNP+EVGDI+VGTVLAPGS RASECRMAAF
Sbjct  58   LCKSKRGSFKDTYPEDILAPVLRALIDKTNLNPNEVGDIVVGTVLAPGSQRASECRMAAF  117

Query  422  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  601
            YAGFPETVP+RTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMT N MAW+GSVNP
Sbjct  118  YAGFPETVPIRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTANPMAWDGSVNP  177

Query  602  RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
            R  T+ QAQ+CLLPMGITSENVA RFGV+R EQDQ
Sbjct  178  RVKTMAQAQDCLLPMGITSENVAQRFGVSRLEQDQ  212



>gb|KDP20330.1| hypothetical protein JCGZ_06416 [Jatropha curcas]
Length=462

 Score =   344 bits (882),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 179/215 (83%), Positives = 196/215 (91%), Gaps = 2/215 (1%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  241
            AI RQRVLL HLRP++++S   + ESS+SAS C AGDSAAYQR +V+GDD+VIVAAYRTP
Sbjct  4    AINRQRVLLDHLRPSSSSSH--NYESSLSASACLAGDSAAYQRTAVFGDDVVIVAAYRTP  61

Query  242  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  421
            LCKSKRGGFKDT+ DDLLA VLKALIEKTNLN SEVGDI+VGTVLAPGS RASECRMAAF
Sbjct  62   LCKSKRGGFKDTHADDLLAPVLKALIEKTNLNASEVGDIVVGTVLAPGSQRASECRMAAF  121

Query  422  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  601
            YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMT+N MAW+G VNP
Sbjct  122  YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTINQMAWDGDVNP  181

Query  602  RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
            +    ++AQNCLLPMG+TSENVAHRFGVTRQEQDQ
Sbjct  182  KVKIFEKAQNCLLPMGVTSENVAHRFGVTRQEQDQ  216



>emb|CAA63598.1| glyoxysomal beta-ketoacyl-thiolase [Brassica napus]
Length=462

 Score =   343 bits (881),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 177/215 (82%), Positives = 194/215 (90%), Gaps = 2/215 (1%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  241
            A+ERQRVLL+HLRP++++S   S E S+SAS C AGDSAAYQR S+YGDD+VIVAA+RT 
Sbjct  4    AMERQRVLLEHLRPSSSSSH--SFEGSLSASACLAGDSAAYQRTSLYGDDVVIVAAHRTA  61

Query  242  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  421
            LCKSKRG FKDTYPDDLLA VL+ALIEKTNLNPS+VGDI+VGTV APGS RASECRM+AF
Sbjct  62   LCKSKRGNFKDTYPDDLLAPVLRALIEKTNLNPSDVGDIVVGTVWAPGSQRASECRMSAF  121

Query  422  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  601
            YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMT N MAWEGSVNP
Sbjct  122  YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTTNPMAWEGSVNP  181

Query  602  RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
                 +QAQNCLLPMG+TSENVA RFGV+RQEQDQ
Sbjct  182  AVKKFEQAQNCLLPMGVTSENVAQRFGVSRQEQDQ  216



>emb|CDY23766.1| BnaC04g43560D [Brassica napus]
Length=462

 Score =   343 bits (881),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 178/215 (83%), Positives = 194/215 (90%), Gaps = 2/215 (1%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  241
            AIERQRVLL+HLRP++++S   S E S+SAS C AGDSAAYQR S+YGDD+VIVAA+RT 
Sbjct  4    AIERQRVLLEHLRPSSSSSH--SFEGSLSASACLAGDSAAYQRTSLYGDDVVIVAAHRTA  61

Query  242  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  421
            LCKSKRG FKDTYPDDLLA VL+ALIEKTNL+PSEVGDI+VGTVLAPGS RASECRM+AF
Sbjct  62   LCKSKRGNFKDTYPDDLLAPVLRALIEKTNLDPSEVGDIVVGTVLAPGSQRASECRMSAF  121

Query  422  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  601
            YAGFPETV VRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMT N MAWEGSVNP
Sbjct  122  YAGFPETVAVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTTNPMAWEGSVNP  181

Query  602  RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
                  QAQ+CLLPMG+TSENVAHRFGV+RQEQDQ
Sbjct  182  AVKKFAQAQSCLLPMGVTSENVAHRFGVSRQEQDQ  216



>ref|XP_009141289.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Brassica rapa]
Length=462

 Score =   343 bits (880),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 178/215 (83%), Positives = 194/215 (90%), Gaps = 2/215 (1%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  241
            AIERQRVLL+HLRP++++S   S E S+SAS C AGDSAAYQR S+YGDD+VIVAA+RT 
Sbjct  4    AIERQRVLLEHLRPSSSSSH--SFEGSLSASACLAGDSAAYQRTSLYGDDVVIVAAHRTA  61

Query  242  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  421
            LCKSKRG FKDTYPDDLLA VL+ALIEKTNL+PSEVGDI+VGTVLAPGS RASECRM+AF
Sbjct  62   LCKSKRGNFKDTYPDDLLAPVLRALIEKTNLDPSEVGDIVVGTVLAPGSQRASECRMSAF  121

Query  422  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  601
            YAGFPETV VRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMT N MAWEGSVNP
Sbjct  122  YAGFPETVAVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTTNPMAWEGSVNP  181

Query  602  RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
                  QAQ+CLLPMG+TSENVAHRFGV+RQEQDQ
Sbjct  182  AVKKFAQAQSCLLPMGVTSENVAHRFGVSRQEQDQ  216



>ref|XP_009385864.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Musa 
acuminata subsp. malaccensis]
Length=463

 Score =   342 bits (877),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 172/215 (80%), Positives = 198/215 (92%), Gaps = 2/215 (1%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  241
            AI+RQRVLL+HLRP+ ++S   S    +SASVCAAGDSAAYQRNS +GDD+V+VAAYRT 
Sbjct  4    AIDRQRVLLRHLRPSPSSSPNGS--HLISASVCAAGDSAAYQRNSCFGDDVVVVAAYRTA  61

Query  242  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  421
            +CKSKRGGFKDTYP++LL  VLKAL++KTNLNP+EVGDI+VGTVLAPG+ RA+ECRMAAF
Sbjct  62   ICKSKRGGFKDTYPEELLTVVLKALLDKTNLNPNEVGDIVVGTVLAPGAQRATECRMAAF  121

Query  422  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  601
            YAGFPETVPVRTVNRQCSSGLQAVADVAAAIK+GFYDIGIGAGLESMT N+M+W+GS+NP
Sbjct  122  YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKSGFYDIGIGAGLESMTTNSMSWDGSINP  181

Query  602  RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
            + +  QQAQNCLLPMGITSENVAHR+GVTRQEQDQ
Sbjct  182  KVNAFQQAQNCLLPMGITSENVAHRYGVTRQEQDQ  216



>ref|XP_010935683.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Elaeis 
guineensis]
Length=461

 Score =   342 bits (877),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 172/214 (80%), Positives = 195/214 (91%), Gaps = 3/214 (1%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  241
            AI RQRVLLQHL+P+    SLD   S +SAS+CAAGDS AYQR+S +GDD+V+VAAYRTP
Sbjct  4    AINRQRVLLQHLQPST--PSLDE-SSMLSASICAAGDSTAYQRSSCFGDDVVVVAAYRTP  60

Query  242  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  421
            +CKSKRGGFKDTYP+DLLA+VLK L++KT LNP+EVGDI+VGTVLAPGS RA+ECRMAAF
Sbjct  61   ICKSKRGGFKDTYPEDLLATVLKGLLDKTKLNPNEVGDIVVGTVLAPGSQRATECRMAAF  120

Query  422  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  601
            YAGFPETVPVRTVNRQCSSGLQAVADVAA+IKAGFYDIGIGAGLESMT N ++WEGS+NP
Sbjct  121  YAGFPETVPVRTVNRQCSSGLQAVADVAASIKAGFYDIGIGAGLESMTANVVSWEGSINP  180

Query  602  RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQD  703
            +  TLQQAQ+CLLPMGITSENVA R+GVTRQEQD
Sbjct  181  KVKTLQQAQDCLLPMGITSENVACRYGVTRQEQD  214



>ref|XP_008438387.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Cucumis melo]
Length=462

 Score =   342 bits (877),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 178/215 (83%), Positives = 197/215 (92%), Gaps = 3/215 (1%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  241
            AI RQ +LL HLRP+++A S    ESS+SASVCAAGDSA+YQR SV+GDD+VIVAAYRT 
Sbjct  4    AINRQNILLHHLRPSSSAYSH---ESSLSASVCAAGDSASYQRTSVFGDDVVIVAAYRTA  60

Query  242  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  421
            LCKSKRGGFKDTY DDLLA VLKALIEKTNLNPSEVGDI+VG+VLAPGS RASECRMAAF
Sbjct  61   LCKSKRGGFKDTYADDLLAPVLKALIEKTNLNPSEVGDIVVGSVLAPGSQRASECRMAAF  120

Query  422  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  601
            YAGFPETVPVRTVNRQCSSGLQAVADVAAAI+AGFYDIGIGAGLESMT+N MAWEGSVNP
Sbjct  121  YAGFPETVPVRTVNRQCSSGLQAVADVAAAIRAGFYDIGIGAGLESMTINPMAWEGSVNP  180

Query  602  RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
            R  +++ AQNCLLPMG+TSENVA RFGV+R++QDQ
Sbjct  181  RVKSMENAQNCLLPMGVTSENVAQRFGVSREKQDQ  215



>ref|XP_008800565.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Phoenix 
dactylifera]
Length=461

 Score =   341 bits (875),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 170/215 (79%), Positives = 198/215 (92%), Gaps = 3/215 (1%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  241
            AI RQRVLLQHL+P++ + +   +   +SAS+CAAGDSAAYQR+S +GDD+V+VAAYRTP
Sbjct  4    AINRQRVLLQHLQPSSPSPNESPM---LSASICAAGDSAAYQRSSCFGDDVVVVAAYRTP  60

Query  242  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  421
            +CKSKRGGFKDTYP+DLLA+VLK L++KT LNP+EVGDI+VGTVLAPGS RA+ECRMAAF
Sbjct  61   ICKSKRGGFKDTYPEDLLATVLKGLLDKTKLNPNEVGDIVVGTVLAPGSQRATECRMAAF  120

Query  422  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  601
            YAGFPE VPVRTVNRQCSSGLQAVADVAA+IKAGFYDIGIGAGLESMT N+++WEGS+NP
Sbjct  121  YAGFPENVPVRTVNRQCSSGLQAVADVAASIKAGFYDIGIGAGLESMTANSVSWEGSINP  180

Query  602  RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
            + +TLQQAQ CLLPMGITSENVAHR+GVTRQEQDQ
Sbjct  181  KVNTLQQAQACLLPMGITSENVAHRYGVTRQEQDQ  215



>ref|XP_010696158.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Beta vulgaris 
subsp. vulgaris]
Length=462

 Score =   341 bits (875),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 174/215 (81%), Positives = 191/215 (89%), Gaps = 2/215 (1%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  241
            AI RQ++LL HLRP +  SS  + E+ +SAS CAAGDS+AY R + +GDD+VIVAA+RT 
Sbjct  4    AINRQKILLDHLRPPS--SSDHNYEAFLSASNCAAGDSSAYHRTTAFGDDVVIVAAHRTA  61

Query  242  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  421
            LCK+KRG FKDTYPDDLLA VLKALIEKTN+NP+EVGDI+VGTVLAPGS RASECRMAAF
Sbjct  62   LCKAKRGSFKDTYPDDLLAPVLKALIEKTNVNPAEVGDIVVGTVLAPGSQRASECRMAAF  121

Query  422  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  601
            YAGFPE VPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMT N MAWEGSVNP
Sbjct  122  YAGFPEIVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTTNPMAWEGSVNP  181

Query  602  RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
            R   L QAQ+CLLPMGITSENVAHRFGVTR+EQDQ
Sbjct  182  RVKELAQAQDCLLPMGITSENVAHRFGVTREEQDQ  216



>pir||S72532 acetyl-CoA C-acyltransferase (EC 2.3.1.16) precursor - cucurbit
 dbj|BAA11117.1| 3-ketoacyl-CoA thiolase [Cucurbita cv. Kurokawa Amakuri]
Length=461

 Score =   340 bits (873),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 177/215 (82%), Positives = 196/215 (91%), Gaps = 3/215 (1%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  241
            AI RQ +LL HLRP+++A S    ESS+SASVCAAGDSA+YQR SV+GDD+VIVAAYRT 
Sbjct  4    AINRQSILLHHLRPSSSAYSH---ESSLSASVCAAGDSASYQRTSVFGDDVVIVAAYRTA  60

Query  242  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  421
            LCKSKRGGFKDTYPDDLLA VLKALIEKTNLNPSEVGDI+VG+VLAPGS RASECRMA F
Sbjct  61   LCKSKRGGFKDTYPDDLLAPVLKALIEKTNLNPSEVGDIVVGSVLAPGSQRASECRMATF  120

Query  422  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  601
            Y GFPETVPVRTVNRQCSSGLQAVADVAAAI+AGFYDIGIGAGLESMTVN MAW+GSVNP
Sbjct  121  YPGFPETVPVRTVNRQCSSGLQAVADVAAAIRAGFYDIGIGAGLESMTVNPMAWDGSVNP  180

Query  602  RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
            R  +++ AQNCLLPMG+TSENVA RFGV+R+EQD+
Sbjct  181  RVKSMENAQNCLLPMGVTSENVAQRFGVSREEQDK  215



>ref|XP_004296638.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Fragaria vesca 
subsp. vesca]
Length=458

 Score =   340 bits (873),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 177/215 (82%), Positives = 193/215 (90%), Gaps = 5/215 (2%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  241
            AI RQ+VLL HLRP++++       SS+SASVCAAGDSAAY RN V+GDD+VIVAAYRTP
Sbjct  4    AINRQKVLLDHLRPSSSSDD-----SSLSASVCAAGDSAAYARNHVFGDDVVIVAAYRTP  58

Query  242  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  421
            LCK+KRGGFKDTY DDLLA VLKA++EKTNLNP EVGDI+VGTVLAPGS RASECRMAAF
Sbjct  59   LCKAKRGGFKDTYADDLLAPVLKAVVEKTNLNPKEVGDIVVGTVLAPGSQRASECRMAAF  118

Query  422  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  601
            YAGFPETVPVRTVNRQCSSGLQAVADVAAAI+AGFYDIGIGAGLESMT N MAWEG VNP
Sbjct  119  YAGFPETVPVRTVNRQCSSGLQAVADVAAAIRAGFYDIGIGAGLESMTANPMAWEGDVNP  178

Query  602  RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
            +    +QAQNCLLPMGITSENVAHRFGV+RQEQDQ
Sbjct  179  KVKIFEQAQNCLLPMGITSENVAHRFGVSRQEQDQ  213



>ref|XP_004138952.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Cucumis 
sativus]
 gb|KGN61456.1| hypothetical protein Csa_2G129150 [Cucumis sativus]
Length=461

 Score =   340 bits (871),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 179/215 (83%), Positives = 195/215 (91%), Gaps = 3/215 (1%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  241
            AI RQ+VLL HLRP+++  S    +SS+SAS C AGDSAAYQR+SV+GDD+VIVAAYRT 
Sbjct  4    AINRQKVLLHHLRPSSSLPSH---DSSLSASACLAGDSAAYQRSSVFGDDVVIVAAYRTA  60

Query  242  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  421
            LCKSKRGGFKDT+PDDLLA VLKALIEKTNLNPSEVGDIIVG+VL PGS RASECRMAAF
Sbjct  61   LCKSKRGGFKDTHPDDLLAPVLKALIEKTNLNPSEVGDIIVGSVLGPGSQRASECRMAAF  120

Query  422  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  601
            YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMT N MAWEGSVNP
Sbjct  121  YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTANPMAWEGSVNP  180

Query  602  RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
            +    +QA+NCLLPMGITSENVAHRFGVTR++QDQ
Sbjct  181  KVKMFEQAKNCLLPMGITSENVAHRFGVTREQQDQ  215



>ref|XP_004164123.1| PREDICTED: LOW QUALITY PROTEIN: 3-ketoacyl-CoA thiolase 2, peroxisomal-like 
[Cucumis sativus]
Length=461

 Score =   340 bits (871),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 179/215 (83%), Positives = 195/215 (91%), Gaps = 3/215 (1%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  241
            AI RQ+VLL HLRP+++  S    +SS+SAS C AGDSAAYQR+SV+GDD+VIVAAYRT 
Sbjct  4    AINRQKVLLHHLRPSSSLPSH---DSSLSASACLAGDSAAYQRSSVFGDDVVIVAAYRTA  60

Query  242  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  421
            LCKSKRGGFKDT+PDDLLA VLKALIEKTNLNPSEVGDIIVG+VL PGS RASECRMAAF
Sbjct  61   LCKSKRGGFKDTHPDDLLAPVLKALIEKTNLNPSEVGDIIVGSVLGPGSQRASECRMAAF  120

Query  422  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  601
            YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMT N MAWEGSVNP
Sbjct  121  YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTANPMAWEGSVNP  180

Query  602  RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
            +    +QA+NCLLPMGITSENVAHRFGVTR++QDQ
Sbjct  181  KVKMFEQAKNCLLPMGITSENVAHRFGVTREQQDQ  215



>gb|ACU21519.1| unknown [Glycine max]
Length=349

 Score =   333 bits (853),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 166/215 (77%), Positives = 187/215 (87%), Gaps = 2/215 (1%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  241
            AI RQ++LL HL P+++    +S  SS+ AS C AGDSAAYQR S +GDD+VIVAAYRT 
Sbjct  4    AINRQKILLHHLNPSSSTHPNES--SSLHASACVAGDSAAYQRTSTFGDDVVIVAAYRTA  61

Query  242  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  421
             CK+KRGGFKDT PDDLLA VLKA+IEKTN+NPSEVGDI+VG+VLAPG+ RASECRMAAF
Sbjct  62   HCKAKRGGFKDTLPDDLLAPVLKAVIEKTNVNPSEVGDIVVGSVLAPGAQRASECRMAAF  121

Query  422  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  601
            YAGFPETVPVRTVNRQCSSGLQAVADVAAAI+AGFYDIGIGAGLESMT N M W+GSVNP
Sbjct  122  YAGFPETVPVRTVNRQCSSGLQAVADVAAAIRAGFYDIGIGAGLESMTTNPMGWDGSVNP  181

Query  602  RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
            +    +Q QNCLLPMGITSENVA RFGV+R+EQDQ
Sbjct  182  KVKMFEQVQNCLLPMGITSENVAQRFGVSRKEQDQ  216



>ref|XP_010469514.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Camelina 
sativa]
Length=462

 Score =   335 bits (860),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 178/215 (83%), Positives = 194/215 (90%), Gaps = 2/215 (1%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  241
            AIERQRVLL+HLRP +++S   S ESS+SAS C AGDSAAYQR S+YGDD+VIVAA+RTP
Sbjct  4    AIERQRVLLEHLRPCSSSSH--SFESSLSASACLAGDSAAYQRTSLYGDDVVIVAAHRTP  61

Query  242  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  421
            LCK+KRG FKDTYPDDLLA VL+ALI+KTN+NPSEVGDI+VGTVLAPGS RASECRM+AF
Sbjct  62   LCKAKRGNFKDTYPDDLLAPVLRALIDKTNINPSEVGDIVVGTVLAPGSQRASECRMSAF  121

Query  422  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  601
            YAGFPETV VRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMT N MAWEGSVNP
Sbjct  122  YAGFPETVAVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTTNPMAWEGSVNP  181

Query  602  RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
                  QAQNCLLPMG+TSENVA RFGV+RQEQDQ
Sbjct  182  AVKKFVQAQNCLLPMGVTSENVAQRFGVSRQEQDQ  216



>ref|XP_011020687.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like isoform 
X1 [Populus euphratica]
Length=460

 Score =   333 bits (855),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 167/215 (78%), Positives = 189/215 (88%), Gaps = 2/215 (1%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  241
            AI+RQRVLL HLRP++   S  + ES++SAS C AGDS AYQR S +GDD+VIVAAYRTP
Sbjct  4    AIDRQRVLLDHLRPSS--PSHHNFESTLSASACLAGDSTAYQRTSAFGDDVVIVAAYRTP  61

Query  242  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  421
            LCKSK G FKDT+ DDLLA VLKALIEKTN++P EVGDI+VG+VLAPGS RASECRMAAF
Sbjct  62   LCKSKGGSFKDTHADDLLAPVLKALIEKTNVDPREVGDIVVGSVLAPGSQRASECRMAAF  121

Query  422  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  601
            YAGFPETVP+RTVNRQCSSGLQAVADV A+IKAGFY+IGIGAGLESMT+N MAW+G VNP
Sbjct  122  YAGFPETVPIRTVNRQCSSGLQAVADVVASIKAGFYEIGIGAGLESMTINPMAWDGDVNP  181

Query  602  RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
            +    Q+AQ+CLLPMG+TSENVAH FGVTRQEQDQ
Sbjct  182  KVKDFQKAQDCLLPMGVTSENVAHCFGVTRQEQDQ  216



>ref|XP_011020688.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like isoform 
X2 [Populus euphratica]
Length=458

 Score =   333 bits (854),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 167/215 (78%), Positives = 189/215 (88%), Gaps = 2/215 (1%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  241
            AI+RQRVLL HLRP+  + S  + ES++SAS C AGDS AYQR S +GDD+VIVAAYRTP
Sbjct  4    AIDRQRVLLDHLRPS--SPSHHNFESTLSASACLAGDSTAYQRTSAFGDDVVIVAAYRTP  61

Query  242  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  421
            LCKSK G FKDT+ DDLLA VLKALIEKTN++P EVGDI+VG+VLAPGS RASECRMAAF
Sbjct  62   LCKSKGGSFKDTHADDLLAPVLKALIEKTNVDPREVGDIVVGSVLAPGSQRASECRMAAF  121

Query  422  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  601
            YAGFPETVP+RTVNRQCSSGLQAVADV A+IKAGFY+IGIGAGLESMT+N MAW+G VNP
Sbjct  122  YAGFPETVPIRTVNRQCSSGLQAVADVVASIKAGFYEIGIGAGLESMTINPMAWDGDVNP  181

Query  602  RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
            +    Q+AQ+CLLPMG+TSENVAH FGVTRQEQDQ
Sbjct  182  KVKDFQKAQDCLLPMGVTSENVAHCFGVTRQEQDQ  216



>ref|XP_006854408.1| hypothetical protein AMTR_s00039p00196630 [Amborella trichopoda]
 gb|ERN15875.1| hypothetical protein AMTR_s00039p00196630 [Amborella trichopoda]
Length=460

 Score =   333 bits (855),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 172/212 (81%), Positives = 193/212 (91%), Gaps = 4/212 (2%)
 Frame = +2

Query  71   RQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTPLCK  250
            RQ++LL HLRP+  ASS ++  S++ ASVC AGDSAAY R++ +GDD+VIVAAYRT  CK
Sbjct  7    RQKILLDHLRPS--ASSQEN--SNLQASVCLAGDSAAYARSAPFGDDVVIVAAYRTAQCK  62

Query  251  SKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAFYAG  430
            SKRGGFKDT+P+DLLA VLKALI+KT L+P EVGDI+VGTVLAPGS RASECRMAAFYAG
Sbjct  63   SKRGGFKDTFPEDLLAPVLKALIDKTKLDPREVGDIVVGTVLAPGSQRASECRMAAFYAG  122

Query  431  FPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNPRAS  610
            +PETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMT N+MAW+GS+NPRAS
Sbjct  123  YPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTANSMAWDGSINPRAS  182

Query  611  TLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
            T  QAQ+CLLPMGITSENVAHRFGVTRQEQDQ
Sbjct  183  TNTQAQDCLLPMGITSENVAHRFGVTRQEQDQ  214



>ref|NP_001238475.1| peroxisomal 3-ketoacyl-CoA thiolase [Glycine max]
 dbj|BAG09380.1| peroxisomal 3-ketoacyl-CoA thiolase precursor [Glycine max]
 gb|KHN21671.1| 3-ketoacyl-CoA thiolase 2, peroxisomal [Glycine soja]
Length=463

 Score =   332 bits (852),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 167/215 (78%), Positives = 188/215 (87%), Gaps = 2/215 (1%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  241
            AI RQ++LL HL P+++    +S  SS+ AS C AGDSAAYQR S +GDD+VIVAAYRT 
Sbjct  4    AINRQKILLHHLNPSSSTHPNES--SSLHASACVAGDSAAYQRTSTFGDDVVIVAAYRTA  61

Query  242  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  421
             CK+KRGGFKDT PDDLLA VLKA+IEKTN+NPSEVGDI+VG+VLAPG+ RASECRMAAF
Sbjct  62   HCKAKRGGFKDTLPDDLLAPVLKAVIEKTNVNPSEVGDIVVGSVLAPGAQRASECRMAAF  121

Query  422  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  601
            YAGFPETVPVRTVNRQCSSGLQAVADVAAAI+AGFYDIGIGAGLESMT N M W+GSVNP
Sbjct  122  YAGFPETVPVRTVNRQCSSGLQAVADVAAAIRAGFYDIGIGAGLESMTTNPMGWDGSVNP  181

Query  602  RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
            +    +QAQNCLLPMGITSENVA RFGV+R+EQDQ
Sbjct  182  KVKMFEQAQNCLLPMGITSENVAQRFGVSRKEQDQ  216



>ref|XP_006649171.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Oryza 
brachyantha]
Length=449

 Score =   331 bits (849),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 164/215 (76%), Positives = 192/215 (89%), Gaps = 4/215 (2%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  241
            AI+RQRVLL HL P++++S+    +  +SAS CAAGDSAAYQR S YGDD+V+VAAYRTP
Sbjct  4    AIDRQRVLLAHLLPSSSSSN----QPLLSASACAAGDSAAYQRTSAYGDDVVVVAAYRTP  59

Query  242  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  421
            +C++KRGGFKDTYP+DLL +VLKA+++ T +NP E+GDI+VG+VL PGS RA ECR AAF
Sbjct  60   ICRAKRGGFKDTYPEDLLTTVLKAVLDNTRINPGEIGDIVVGSVLGPGSQRAVECRAAAF  119

Query  422  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  601
            YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESM+VN+M WEG VNP
Sbjct  120  YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMSVNSMGWEGQVNP  179

Query  602  RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
            + S +Q+AQ+CLLPMGITSENVAHRFGVTRQEQDQ
Sbjct  180  KVSEVQKAQDCLLPMGITSENVAHRFGVTRQEQDQ  214



>gb|AFW74040.1| hypothetical protein ZEAMMB73_080325 [Zea mays]
Length=378

 Score =   327 bits (838),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 160/215 (74%), Positives = 193/215 (90%), Gaps = 3/215 (1%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  241
            AI+RQRVLL HL P+ +A+S    +  ++AS CAAGDSAAYQR+S +GDD+V+VAAYRTP
Sbjct  4    AIDRQRVLLAHLLPSPSAASS---QPQLAASACAAGDSAAYQRSSSFGDDVVVVAAYRTP  60

Query  242  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  421
            +CK+KRGGFKDTYP+DLL  VLKA+++ T +NP+++GDI+VGTVL PGS RA+ECRMAA 
Sbjct  61   ICKAKRGGFKDTYPEDLLTVVLKAVLDNTRINPADIGDIVVGTVLGPGSQRANECRMAAL  120

Query  422  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  601
            +AGFPETVPVRTVNRQCSSGLQAVADVAAAIKAG+YDIGIGAGLESM++N++AWEG VNP
Sbjct  121  FAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGYYDIGIGAGLESMSINSIAWEGQVNP  180

Query  602  RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
            + S  Q+AQ+CLLPMGITSENVAHR+GVTRQEQDQ
Sbjct  181  KISAFQKAQDCLLPMGITSENVAHRYGVTRQEQDQ  215



>gb|ACJ84483.1| unknown [Medicago truncatula]
Length=259

 Score =   323 bits (827),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 167/215 (78%), Positives = 190/215 (88%), Gaps = 1/215 (0%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  241
            AI RQ+VLLQHL P++ +S+  S  +S++AS C AGDSAAY R + +GDD+VIVAAYRT 
Sbjct  4    AINRQKVLLQHLNPSSFSSND-SSSTSLNASACLAGDSAAYHRTAAFGDDVVIVAAYRTA  62

Query  242  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  421
            LCK+KRGGFKDT+ DD+LA VLKA+IEKTNLNPSEVGDI+VG+VL  GS RASECRMAAF
Sbjct  63   LCKAKRGGFKDTHADDILAPVLKAVIEKTNLNPSEVGDIVVGSVLGAGSQRASECRMAAF  122

Query  422  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  601
            YAGFPETVPVRTVNRQCSSGLQAVADVAAAI+AGFYDIGIGAGLESMT N MAW+GSVNP
Sbjct  123  YAGFPETVPVRTVNRQCSSGLQAVADVAAAIRAGFYDIGIGAGLESMTTNPMAWDGSVNP  182

Query  602  RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
            R    +QAQNCLLPMGITSENVA RFGV+R+EQD+
Sbjct  183  RVKMFEQAQNCLLPMGITSENVASRFGVSRKEQDE  217



>ref|XP_010940650.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Elaeis 
guineensis]
Length=461

 Score =   329 bits (844),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 172/215 (80%), Positives = 201/215 (93%), Gaps = 3/215 (1%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  241
            AI RQRVLLQHL+P +++S+   +   +SAS+CAAGDSAAYQR+S +GDD+V+VAAYRTP
Sbjct  4    AINRQRVLLQHLQPPSSSSNDAPM---LSASICAAGDSAAYQRSSSFGDDVVVVAAYRTP  60

Query  242  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  421
            +CKSKRGGFKDTYP+DLLA+VLKAL++KT LNP EVGDI+VGTVLAPGS RA+ECRMAAF
Sbjct  61   ICKSKRGGFKDTYPEDLLAAVLKALLDKTKLNPREVGDIVVGTVLAPGSQRANECRMAAF  120

Query  422  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  601
            YAGFPETVPVRTVNRQCSSGLQAVADVAA+IKAGFYDIGIGAGLESMT N++AWEGS+NP
Sbjct  121  YAGFPETVPVRTVNRQCSSGLQAVADVAASIKAGFYDIGIGAGLESMTTNSVAWEGSINP  180

Query  602  RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
            + +TLQ+AQ+CLLPMGITSENVAHR+GVTR+EQDQ
Sbjct  181  KVNTLQKAQDCLLPMGITSENVAHRYGVTRKEQDQ  215



>ref|XP_006605730.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like isoform 
X2 [Glycine max]
Length=410

 Score =   326 bits (836),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 165/215 (77%), Positives = 186/215 (87%), Gaps = 2/215 (1%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  241
            AI RQ++LL HL P+++    +S  SS+ AS C AGDSAAYQR S + DD+VIVAAYRT 
Sbjct  4    AISRQKILLHHLNPSSSTHVNES--SSLYASACVAGDSAAYQRTSTFRDDVVIVAAYRTA  61

Query  242  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  421
             CK KRGGFKDT PDDLLA VLKA+IE+TN+NPSEVGDI+VG+VLAPG+ RASECRMAAF
Sbjct  62   HCKGKRGGFKDTLPDDLLAPVLKAVIERTNVNPSEVGDIVVGSVLAPGAQRASECRMAAF  121

Query  422  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  601
            YAGFPETVPVRTVNRQCSSGLQAVADVAAAI+AGFYDIGIGAGLESMT N M W+GSVNP
Sbjct  122  YAGFPETVPVRTVNRQCSSGLQAVADVAAAIRAGFYDIGIGAGLESMTTNPMGWDGSVNP  181

Query  602  RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
            +    +QAQNCLLPMGITSENVA RFGV+R+EQDQ
Sbjct  182  KVKMFEQAQNCLLPMGITSENVAQRFGVSRKEQDQ  216



>ref|XP_009376354.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Pyrus x bretschneideri]
Length=459

 Score =   327 bits (838),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 174/215 (81%), Positives = 194/215 (90%), Gaps = 5/215 (2%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  241
            AI RQRVLL HLRP +A SS     SS+SAS CAAGDSAAY R +V+GDD+VIVAAYRTP
Sbjct  4    AINRQRVLLDHLRPPSADSS-----SSLSASACAAGDSAAYARTNVFGDDVVIVAAYRTP  58

Query  242  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  421
            +CK+KRGGFKDT+ DDLLA VLKA++EKTN+NPSE+GDI+VGTVLAPGS RASECRMAAF
Sbjct  59   ICKAKRGGFKDTHADDLLAPVLKAVVEKTNVNPSEIGDIVVGTVLAPGSQRASECRMAAF  118

Query  422  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  601
            YAGFPETVP+RTVNRQCSSGLQAVADVAA+I+AGFYDIGIGAGLESMT N MAWEGSVNP
Sbjct  119  YAGFPETVPIRTVNRQCSSGLQAVADVAASIRAGFYDIGIGAGLESMTANPMAWEGSVNP  178

Query  602  RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
            +    +QAQNCLLPMGITSENVAHRFGV+R+EQDQ
Sbjct  179  KVKIFEQAQNCLLPMGITSENVAHRFGVSRKEQDQ  213



>pdb|2WUA|A Chain A, Structure Of The Peroxisomal 3-Ketoacyl-Coa Thiolase 
From Sunflower
 pdb|2WUA|B Chain B, Structure Of The Peroxisomal 3-Ketoacyl-Coa Thiolase 
From Sunflower
Length=440

 Score =   326 bits (836),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 164/202 (81%), Positives = 184/202 (91%), Gaps = 4/202 (2%)
 Frame = +2

Query  101  PTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTPLCKSKRGGFKDTY  280
            P++ +SSL+++    S SVCAAGDSAAYQRNSV+GDD+VIVAAYR+PLCK+KRGG KDTY
Sbjct  2    PSSTSSSLENL----SVSVCAAGDSAAYQRNSVFGDDVVIVAAYRSPLCKAKRGGLKDTY  57

Query  281  PDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAFYAGFPETVPVRTV  460
            PDD+LA VLKALIEKTN+NP+EVGDI+VG+VL  GS RASECRMAAFYAGFPETVPVRTV
Sbjct  58   PDDILAPVLKALIEKTNINPAEVGDIVVGSVLGAGSQRASECRMAAFYAGFPETVPVRTV  117

Query  461  NRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNPRASTLQQAQNCLL  640
            NRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMT N MAWEGSVNP+  T+ QAQ+CLL
Sbjct  118  NRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTANPMAWEGSVNPKVKTMAQAQDCLL  177

Query  641  PMGITSENVAHRFGVTRQEQDQ  706
            PMGITSENVA +F +TRQEQDQ
Sbjct  178  PMGITSENVAQKFSITRQEQDQ  199



>gb|AFW74041.1| hypothetical protein ZEAMMB73_080325 [Zea mays]
Length=407

 Score =   325 bits (833),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 160/215 (74%), Positives = 193/215 (90%), Gaps = 3/215 (1%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  241
            AI+RQRVLL HL P+ +A+S    +  ++AS CAAGDSAAYQR+S +GDD+V+VAAYRTP
Sbjct  4    AIDRQRVLLAHLLPSPSAASS---QPQLAASACAAGDSAAYQRSSSFGDDVVVVAAYRTP  60

Query  242  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  421
            +CK+KRGGFKDTYP+DLL  VLKA+++ T +NP+++GDI+VGTVL PGS RA+ECRMAA 
Sbjct  61   ICKAKRGGFKDTYPEDLLTVVLKAVLDNTRINPADIGDIVVGTVLGPGSQRANECRMAAL  120

Query  422  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  601
            +AGFPETVPVRTVNRQCSSGLQAVADVAAAIKAG+YDIGIGAGLESM++N++AWEG VNP
Sbjct  121  FAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGYYDIGIGAGLESMSINSIAWEGQVNP  180

Query  602  RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
            + S  Q+AQ+CLLPMGITSENVAHR+GVTRQEQDQ
Sbjct  181  KISAFQKAQDCLLPMGITSENVAHRYGVTRQEQDQ  215



>ref|NP_001241698.1| 3-ketoacyl-CoA thiolase 2, peroxisomal precursor [Zea mays]
 gb|ACG36949.1| 3-ketoacyl-CoA thiolase 2, peroxisomal precursor [Zea mays]
Length=461

 Score =   327 bits (837),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 160/215 (74%), Positives = 193/215 (90%), Gaps = 3/215 (1%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  241
            AI+RQRVLL HL P+ +A+S    +  ++AS CAAGDSAAYQR+S +GDD+V+VAAYRTP
Sbjct  4    AIDRQRVLLAHLLPSPSAASS---QPHLAASACAAGDSAAYQRSSSFGDDVVVVAAYRTP  60

Query  242  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  421
            +CK+KRGGFKDTYP+DLL  VLKA+++ T +NP+++GDI+VGTVL PGS RA+ECRMAA 
Sbjct  61   ICKAKRGGFKDTYPEDLLTVVLKAVLDNTRINPADIGDIVVGTVLGPGSQRANECRMAAL  120

Query  422  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  601
            +AGFPETVPVRTVNRQCSSGLQAVADVAAAIKAG+YDIGIGAGLESM++N++AWEG VNP
Sbjct  121  FAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGYYDIGIGAGLESMSINSIAWEGQVNP  180

Query  602  RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
            + S  Q+AQ+CLLPMGITSENVAHR+GVTRQEQDQ
Sbjct  181  KISAFQKAQDCLLPMGITSENVAHRYGVTRQEQDQ  215



>ref|NP_001131193.1| acetyl-CoA C-acyltransferase-like protein [Zea mays]
 gb|ACF79501.1| unknown [Zea mays]
 gb|AFW74042.1| LOW QUALITY PROTEIN: acetyl-CoA C-acyltransferase-like protein 
[Zea mays]
Length=461

 Score =   327 bits (837),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 160/215 (74%), Positives = 193/215 (90%), Gaps = 3/215 (1%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  241
            AI+RQRVLL HL P+ +A+S    +  ++AS CAAGDSAAYQR+S +GDD+V+VAAYRTP
Sbjct  4    AIDRQRVLLAHLLPSPSAASS---QPQLAASACAAGDSAAYQRSSSFGDDVVVVAAYRTP  60

Query  242  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  421
            +CK+KRGGFKDTYP+DLL  VLKA+++ T +NP+++GDI+VGTVL PGS RA+ECRMAA 
Sbjct  61   ICKAKRGGFKDTYPEDLLTVVLKAVLDNTRINPADIGDIVVGTVLGPGSQRANECRMAAL  120

Query  422  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  601
            +AGFPETVPVRTVNRQCSSGLQAVADVAAAIKAG+YDIGIGAGLESM++N++AWEG VNP
Sbjct  121  FAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGYYDIGIGAGLESMSINSIAWEGQVNP  180

Query  602  RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
            + S  Q+AQ+CLLPMGITSENVAHR+GVTRQEQDQ
Sbjct  181  KISAFQKAQDCLLPMGITSENVAHRYGVTRQEQDQ  215



>ref|XP_003555712.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like isoform 
X1 [Glycine max]
 gb|KHN18010.1| 3-ketoacyl-CoA thiolase 2, peroxisomal [Glycine soja]
Length=461

 Score =   326 bits (836),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 165/215 (77%), Positives = 186/215 (87%), Gaps = 2/215 (1%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  241
            AI RQ++LL HL P+++    +S  SS+ AS C AGDSAAYQR S + DD+VIVAAYRT 
Sbjct  4    AISRQKILLHHLNPSSSTHVNES--SSLYASACVAGDSAAYQRTSTFRDDVVIVAAYRTA  61

Query  242  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  421
             CK KRGGFKDT PDDLLA VLKA+IE+TN+NPSEVGDI+VG+VLAPG+ RASECRMAAF
Sbjct  62   HCKGKRGGFKDTLPDDLLAPVLKAVIERTNVNPSEVGDIVVGSVLAPGAQRASECRMAAF  121

Query  422  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  601
            YAGFPETVPVRTVNRQCSSGLQAVADVAAAI+AGFYDIGIGAGLESMT N M W+GSVNP
Sbjct  122  YAGFPETVPVRTVNRQCSSGLQAVADVAAAIRAGFYDIGIGAGLESMTTNPMGWDGSVNP  181

Query  602  RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
            +    +QAQNCLLPMGITSENVA RFGV+R+EQDQ
Sbjct  182  KVKMFEQAQNCLLPMGITSENVAQRFGVSRKEQDQ  216



>ref|XP_008380600.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Malus domestica]
Length=459

 Score =   325 bits (834),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 173/215 (80%), Positives = 193/215 (90%), Gaps = 5/215 (2%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  241
            AI RQRVLL HLRP +A SS     SS+SAS CAAGDSAAY R  V+GDD+VIVAAYRTP
Sbjct  4    AINRQRVLLDHLRPPSADSS-----SSLSASACAAGDSAAYARTHVFGDDVVIVAAYRTP  58

Query  242  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  421
            +CK+KRGGFKDT+ DDLLA VLKA++E+TN+NPSE+GDI+VGTVLAPGS RASECRMAAF
Sbjct  59   ICKAKRGGFKDTHADDLLAPVLKAVVERTNVNPSEIGDIVVGTVLAPGSQRASECRMAAF  118

Query  422  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  601
            YAGFPETVP+RTVNRQCSSGLQAVADVAA+I+AGFYDIGIGAGLESMT N MAWEGSVNP
Sbjct  119  YAGFPETVPIRTVNRQCSSGLQAVADVAASIRAGFYDIGIGAGLESMTANPMAWEGSVNP  178

Query  602  RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
            +    +QAQNCLLPMGITSENVAHRFGV+R+EQDQ
Sbjct  179  KVKMFEQAQNCLLPMGITSENVAHRFGVSRKEQDQ  213



>ref|XP_010099126.1| 3-ketoacyl-CoA thiolase 2 [Morus notabilis]
 gb|EXB76920.1| 3-ketoacyl-CoA thiolase 2 [Morus notabilis]
Length=464

 Score =   325 bits (834),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 162/186 (87%), Positives = 175/186 (94%), Gaps = 0/186 (0%)
 Frame = +2

Query  149  ASVCAAGDSAAYQRNSVYGDDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKT  328
            ASVC AGDSAAYQR +V+GDD+VIVAAYRTPLCKSKRGGFKDT+ DDLLA VLKALIEKT
Sbjct  33   ASVCLAGDSAAYQRTNVFGDDVVIVAAYRTPLCKSKRGGFKDTHADDLLAPVLKALIEKT  92

Query  329  NLNPSEVGDIIVGTVLAPGSIRASECRMAAFYAGFPETVPVRTVNRQCSSGLQavadvaa  508
            NLNPSEVGDI+VGTVLAPGS RASECRMAAFYAGFPETVP+RTVNRQCSSGLQAVADVAA
Sbjct  93   NLNPSEVGDIVVGTVLAPGSQRASECRMAAFYAGFPETVPIRTVNRQCSSGLQAVADVAA  152

Query  509  aikaGFYDIGIGAGLESMTVNTMAWEGSVNPRASTLQQAQNCLLPMGITSENVAHRFGVT  688
            AI+AGFYDIGIGAGLESMT+N MAWEGSVNP+    +QAQNCLLPMG+TSENVA RFGV+
Sbjct  153  AIRAGFYDIGIGAGLESMTMNPMAWEGSVNPKVKIFEQAQNCLLPMGVTSENVASRFGVS  212

Query  689  RQEQDQ  706
            R+EQDQ
Sbjct  213  RKEQDQ  218



>ref|XP_002518136.1| 3-ketoacyl-CoA thiolase B, putative [Ricinus communis]
 gb|EEF44269.1| 3-ketoacyl-CoA thiolase B, putative [Ricinus communis]
Length=460

 Score =   324 bits (831),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 173/215 (80%), Positives = 194/215 (90%), Gaps = 4/215 (2%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  241
            AI RQ++LL HLRP+ ++SSL + +SS+SAS C+AGDSAAYQR SVYGDD+VIVAA+RT 
Sbjct  4    AINRQKILLDHLRPS-SSSSLHNYDSSLSASACSAGDSAAYQRTSVYGDDVVIVAAHRTA  62

Query  242  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  421
            LCKSKRGGFKDT+ DDLLA VLKALIEKT LNPSEVGDI+VGTVLAPGS RASECRMAAF
Sbjct  63   LCKSKRGGFKDTFADDLLAPVLKALIEKTKLNPSEVGDIVVGTVLAPGSQRASECRMAAF  122

Query  422  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  601
            YAGFPETVP+RTVNRQCSSGLQAVADVAAAIKAGFYDI   AG+ESMT+N M+W+G VNP
Sbjct  123  YAGFPETVPIRTVNRQCSSGLQAVADVAAAIKAGFYDI---AGVESMTINPMSWDGDVNP  179

Query  602  RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
            +    +QAQNCLLPMG+TSENVAHRFGVTRQEQDQ
Sbjct  180  KVKAFEQAQNCLLPMGVTSENVAHRFGVTRQEQDQ  214



>ref|XP_009400955.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009400962.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Musa 
acuminata subsp. malaccensis]
Length=459

 Score =   324 bits (830),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 170/215 (79%), Positives = 195/215 (91%), Gaps = 5/215 (2%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  241
            AI RQRVLLQHL+P  ++SS     S VSASVCAAGDSAAYQRNS +GDD+V+VAAYRT 
Sbjct  4    AINRQRVLLQHLQPFPSSSS-----SLVSASVCAAGDSAAYQRNSSFGDDVVVVAAYRTA  58

Query  242  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  421
            + KSKRGGFKDTYP++LL +VLKAL++KTNLNP+EVGDI+VGTVLAPGS RA+ECRMAAF
Sbjct  59   ISKSKRGGFKDTYPEELLTAVLKALLDKTNLNPNEVGDIVVGTVLAPGSQRATECRMAAF  118

Query  422  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  601
            YAGFPETVP+RTVNRQCSSGLQAVADVAA+IKAGFYDIGIGAGLESMT N++AW+GS+NP
Sbjct  119  YAGFPETVPIRTVNRQCSSGLQAVADVAASIKAGFYDIGIGAGLESMTANSVAWDGSINP  178

Query  602  RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
            + +  QQ Q+CLLPMGITSENVA R+GVTRQEQDQ
Sbjct  179  KVNKFQQVQDCLLPMGITSENVAFRYGVTRQEQDQ  213



>gb|KEH41248.1| 3-ketoacyl-CoA thiolase 2, peroxisomal-like protein [Medicago 
truncatula]
Length=462

 Score =   324 bits (830),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 167/215 (78%), Positives = 190/215 (88%), Gaps = 1/215 (0%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  241
            AI RQ+VLLQHL P++ +S+  S  +S++AS C AGDSAAY R + +GDD+VIVAAYRT 
Sbjct  4    AINRQKVLLQHLNPSSFSSND-SSSTSLNASACLAGDSAAYHRTAAFGDDVVIVAAYRTA  62

Query  242  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  421
            LCK+KRGGFKDT+ DD+LA VLKA+IEKTNLNPSEVGDI+VG+VL  GS RASECRMAAF
Sbjct  63   LCKAKRGGFKDTHADDILAPVLKAVIEKTNLNPSEVGDIVVGSVLGAGSQRASECRMAAF  122

Query  422  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  601
            YAGFPETVPVRTVNRQCSSGLQAVADVAAAI+AGFYDIGIGAGLESMT N MAW+GSVNP
Sbjct  123  YAGFPETVPVRTVNRQCSSGLQAVADVAAAIRAGFYDIGIGAGLESMTTNPMAWDGSVNP  182

Query  602  RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
            R    +QAQNCLLPMGITSENVA RFGV+R+EQD+
Sbjct  183  RVKMFEQAQNCLLPMGITSENVASRFGVSRKEQDE  217



>gb|ACN39947.1| unknown [Picea sitchensis]
 gb|ACN40646.1| unknown [Picea sitchensis]
Length=462

 Score =   323 bits (829),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 163/212 (77%), Positives = 185/212 (87%), Gaps = 4/212 (2%)
 Frame = +2

Query  71   RQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTPLCK  250
            RQ+VLL HLRP    +      + + ASVC+AGDSAAY+R + +GDD+VIVAAYRTP+CK
Sbjct  9    RQQVLLDHLRP----ARFPKASTDLVASVCSAGDSAAYERAAEFGDDVVIVAAYRTPICK  64

Query  251  SKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAFYAG  430
            +KRGGFKDT PDDLLA VLKALI+KT +NP+EV DI+VGTVLAPGS RASECRMA+FYAG
Sbjct  65   AKRGGFKDTLPDDLLAPVLKALIDKTGINPNEVRDIVVGTVLAPGSQRASECRMASFYAG  124

Query  431  FPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNPRAS  610
            FPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMT N MAWEGSVNPR  
Sbjct  125  FPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTANPMAWEGSVNPRVE  184

Query  611  TLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
              +QAQ+CLLPMGITSENVA R+G++RQ+QDQ
Sbjct  185  IFKQAQDCLLPMGITSENVAERYGISRQDQDQ  216



>ref|XP_003570403.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Brachypodium 
distachyon]
Length=461

 Score =   323 bits (829),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 163/215 (76%), Positives = 186/215 (87%), Gaps = 3/215 (1%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  241
            AI+RQRVLL HL P+ ++S+       +SAS CAAGDSAAYQR+S +GDD+VIVAAYRTP
Sbjct  4    AIDRQRVLLAHLAPSASSSAQGQ---QLSASACAAGDSAAYQRSSCFGDDVVIVAAYRTP  60

Query  242  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  421
            +CK+KRGGFKDTYP+DLL  VLKA+++ T +NP E+GDI+VGTVL PGS RA ECR A+ 
Sbjct  61   ICKAKRGGFKDTYPEDLLTPVLKAVLDNTGINPGEIGDIVVGTVLGPGSQRAIECRTASL  120

Query  422  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  601
             AGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESM+VN M WEG VNP
Sbjct  121  LAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMSVNAMGWEGQVNP  180

Query  602  RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
            R   LQ+AQ+CLLPMGITSENVAHR+GVTRQEQDQ
Sbjct  181  RVIELQKAQDCLLPMGITSENVAHRYGVTRQEQDQ  215



>ref|XP_008372446.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Malus domestica]
Length=453

 Score =   323 bits (827),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 161/215 (75%), Positives = 187/215 (87%), Gaps = 0/215 (0%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  241
            A+ RQ+VLLQHLRP+++ SS D   +++SAS CAAGDSAAY R S +GDDIVIVAAYRT 
Sbjct  4    ALNRQKVLLQHLRPSSSVSSPDYESAALSASTCAAGDSAAYHRTSAFGDDIVIVAAYRTA  63

Query  242  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  421
            +CK+KRGGFKDT PDDLLA VLKA+IE+TNLNP EVGDI+VGTVLAPGS+RA ECRMAAF
Sbjct  64   ICKAKRGGFKDTLPDDLLAPVLKAVIERTNLNPKEVGDIVVGTVLAPGSLRAMECRMAAF  123

Query  422  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  601
            YAGFP+TVP+RTVNRQCSSGLQAVADVAAAIKAG+YDIGI AGLESMTV+ +     VNP
Sbjct  124  YAGFPDTVPIRTVNRQCSSGLQAVADVAAAIKAGYYDIGIAAGLESMTVDNIGGLSKVNP  183

Query  602  RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
            +     QA++CLLPMG+TSENVA R+GVTRQEQD+
Sbjct  184  KVDIFAQARDCLLPMGVTSENVAQRYGVTRQEQDR  218



>ref|XP_007145410.1| hypothetical protein PHAVU_007G236600g [Phaseolus vulgaris]
 gb|ESW17404.1| hypothetical protein PHAVU_007G236600g [Phaseolus vulgaris]
Length=458

 Score =   320 bits (821),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 171/214 (80%), Positives = 190/214 (89%), Gaps = 5/214 (2%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  241
            AI RQ++LL HL P+++  S     SS+SAS CAAGDSAAY R S +GDD+VIVAAYRT 
Sbjct  4    AINRQKILLHHLNPSSSNHS-----SSLSASACAAGDSAAYHRTSTFGDDVVIVAAYRTA  58

Query  242  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  421
            LCKSKRGGFKDT+ DDLLA VLKA+IE+TN+NPSEVGDIIVGTVLAPGS RASECRM+AF
Sbjct  59   LCKSKRGGFKDTHADDLLAPVLKAVIERTNVNPSEVGDIIVGTVLAPGSQRASECRMSAF  118

Query  422  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  601
            YAGFPETVP+RTVNRQCSSGLQAVADVAAAI+AGFYDIGIGAGLESMT N MAWEGSVNP
Sbjct  119  YAGFPETVPIRTVNRQCSSGLQAVADVAAAIRAGFYDIGIGAGLESMTANPMAWEGSVNP  178

Query  602  RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQD  703
            +    +QAQNCLLPMGITSENVAHRFGV+R+EQD
Sbjct  179  KVKMFEQAQNCLLPMGITSENVAHRFGVSRKEQD  212



>ref|XP_004954382.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Setaria 
italica]
Length=461

 Score =   320 bits (819),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 162/215 (75%), Positives = 188/215 (87%), Gaps = 3/215 (1%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  241
            AI+RQRVLL H      +SS  S +  ++AS CAAGDSAAYQR S +GDD+V+VAAYRTP
Sbjct  4    AIDRQRVLLAH---LLPSSSSPSSQPQLAASECAAGDSAAYQRTSSFGDDVVVVAAYRTP  60

Query  242  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  421
            +CK+KRGGFKDTYP+DLL  VLKA+++ T +NP ++GDI+VGTVL PGS RA+ECRMAAF
Sbjct  61   ICKAKRGGFKDTYPEDLLTVVLKAVLDNTKINPGDIGDIVVGTVLGPGSQRANECRMAAF  120

Query  422  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  601
            YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESM++N++ WEG VNP
Sbjct  121  YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMSINSIGWEGQVNP  180

Query  602  RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
            R S  Q+AQ+CLLPMGITSENVAHR+GVTRQEQDQ
Sbjct  181  RISAFQKAQDCLLPMGITSENVAHRYGVTRQEQDQ  215



>ref|XP_004497755.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Cicer 
arietinum]
Length=458

 Score =   319 bits (817),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 168/215 (78%), Positives = 190/215 (88%), Gaps = 5/215 (2%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  241
            AI RQ+VLLQHL P+ ++SS     +S+SAS C AGDSAAY R + +GDD+VIVAAYRT 
Sbjct  4    AINRQKVLLQHLNPSQSSSS-----TSLSASACLAGDSAAYHRTASFGDDVVIVAAYRTA  58

Query  242  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  421
            LCK+KRGGFKDT+ DDLLA VLKA+IEKTNLNPSEVGDI+VG+VL  GS RASECRMAAF
Sbjct  59   LCKAKRGGFKDTHADDLLAPVLKAVIEKTNLNPSEVGDIVVGSVLGGGSQRASECRMAAF  118

Query  422  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  601
            YAGFPETVPVRTVNRQCSSGLQAVADVAAAI+AGFYDIGIGAGLESMT N MAWEGSVNP
Sbjct  119  YAGFPETVPVRTVNRQCSSGLQAVADVAAAIRAGFYDIGIGAGLESMTTNPMAWEGSVNP  178

Query  602  RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
            +    +QAQNCLLPMGITSENV++RFGV+R+EQD+
Sbjct  179  KVQMFEQAQNCLLPMGITSENVSNRFGVSRKEQDE  213



>ref|XP_002974835.1| hypothetical protein SELMODRAFT_101898 [Selaginella moellendorffii]
 gb|EFJ24355.1| hypothetical protein SELMODRAFT_101898 [Selaginella moellendorffii]
Length=454

 Score =   318 bits (815),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 157/212 (74%), Positives = 184/212 (87%), Gaps = 5/212 (2%)
 Frame = +2

Query  71   RQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTPLCK  250
            RQ++LL HLRP++A   ++ +      S+C+AGDSAAY R + Y DD+V+VAAYRTP+CK
Sbjct  2    RQQILLDHLRPSSAPRPVNLV-----TSICSAGDSAAYHRTTDYSDDVVVVAAYRTPICK  56

Query  251  SKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAFYAG  430
            SKRGGFKDTYP+DLL  VLKA++EK  LNP+EVGDI+VGTVLAPGS RA+ECRMAAFYAG
Sbjct  57   SKRGGFKDTYPEDLLTPVLKAVVEKVGLNPAEVGDIVVGTVLAPGSQRANECRMAAFYAG  116

Query  431  FPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNPRAS  610
            FPETVPVRTVNRQCSSGLQAVADV AAIKAGFYDIGIGAGLESMT N +AWEGSVNP+  
Sbjct  117  FPETVPVRTVNRQCSSGLQAVADVVAAIKAGFYDIGIGAGLESMTANLVAWEGSVNPKVE  176

Query  611  TLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
              Q+AQ+CLLPMGITSENVA R+GV+R+EQD+
Sbjct  177  MNQKAQDCLLPMGITSENVAERYGVSRKEQDE  208



>ref|XP_002963753.1| hypothetical protein SELMODRAFT_450889 [Selaginella moellendorffii]
 gb|EFJ35624.1| hypothetical protein SELMODRAFT_450889 [Selaginella moellendorffii]
Length=462

 Score =   318 bits (815),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 157/212 (74%), Positives = 184/212 (87%), Gaps = 5/212 (2%)
 Frame = +2

Query  71   RQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTPLCK  250
            RQ++LL HLRP++A   ++ +      S+C+AGDSAAY R + Y DD+V+VAAYRTP+CK
Sbjct  10   RQQILLDHLRPSSAPRPVNLV-----TSICSAGDSAAYHRTTDYSDDVVVVAAYRTPICK  64

Query  251  SKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAFYAG  430
            SKRGGFKDTYP+DLL  VLKA++EK  LNP+EVGDI+VGTVLAPGS RA+ECRMAAFYAG
Sbjct  65   SKRGGFKDTYPEDLLTPVLKAVVEKVGLNPAEVGDIVVGTVLAPGSQRANECRMAAFYAG  124

Query  431  FPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNPRAS  610
            FPETVPVRTVNRQCSSGLQAVADV AAIKAGFYDIGIGAGLESMT N +AWEGSVNP+  
Sbjct  125  FPETVPVRTVNRQCSSGLQAVADVVAAIKAGFYDIGIGAGLESMTANLVAWEGSVNPKVE  184

Query  611  TLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
              Q+AQ+CLLPMGITSENVA R+GV+R+EQD+
Sbjct  185  MNQKAQDCLLPMGITSENVAERYGVSRKEQDE  216



>dbj|BAJ87577.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=460

 Score =   317 bits (813),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 160/215 (74%), Positives = 186/215 (87%), Gaps = 5/215 (2%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  241
            AI+RQRVLL HL P+ A++      S +SAS CAAGDSAAYQR S +GDD+VIVAAYRTP
Sbjct  4    AIDRQRVLLAHLLPSPASAG-----SQLSASACAAGDSAAYQRTSCFGDDVVIVAAYRTP  58

Query  242  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  421
            +CK+KRGGFKDTYP+DLL  VLKA+++KT +NP+E+GD++VGTVL PGS RA ECR A+ 
Sbjct  59   ICKAKRGGFKDTYPEDLLTPVLKAVLDKTGINPAEIGDVVVGTVLGPGSQRAIECRTASL  118

Query  422  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  601
             AG PETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESM+VN++ WEG VNP
Sbjct  119  LAGIPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMSVNSVGWEGQVNP  178

Query  602  RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
            R   LQ+AQ+CLLPMGITSENVA R+GVTRQEQD+
Sbjct  179  RVIELQKAQDCLLPMGITSENVAERYGVTRQEQDK  213



>ref|XP_009371217.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Pyrus x bretschneideri]
Length=453

 Score =   317 bits (812),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 157/215 (73%), Positives = 188/215 (87%), Gaps = 0/215 (0%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  241
            A+ RQ+VLLQHLRP+++ SS D   +++SAS CAAGDSAAY R S +GDDIVIVAAYRT 
Sbjct  4    ALNRQKVLLQHLRPSSSVSSPDYESAALSASTCAAGDSAAYHRTSAFGDDIVIVAAYRTA  63

Query  242  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  421
            +CK+KRGGFKDT PDDLLA VLKA+IE+TNLNP+EVGDI+VGTVLAPGS+RA ECRMAAF
Sbjct  64   ICKAKRGGFKDTLPDDLLAPVLKAVIERTNLNPNEVGDIVVGTVLAPGSLRAIECRMAAF  123

Query  422  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  601
            YAGFP+TVP+RTVNRQCSSGLQAVAD+AAAIKAG+YDIGI AGLE MTV+ ++    VNP
Sbjct  124  YAGFPDTVPIRTVNRQCSSGLQAVADIAAAIKAGYYDIGIAAGLECMTVDNISGLSKVNP  183

Query  602  RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
            +     QA++C+LPMG+TSENVA R+GVTR+EQD+
Sbjct  184  KVDIFAQARDCVLPMGMTSENVAERYGVTREEQDR  218



>gb|ABR16781.1| unknown [Picea sitchensis]
Length=462

 Score =   316 bits (810),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 162/212 (76%), Positives = 183/212 (86%), Gaps = 4/212 (2%)
 Frame = +2

Query  71   RQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTPLCK  250
            RQ+VLL HLRP +           + ASVCAAGDSAAY+R + +GDD+VIVAAYRTP+CK
Sbjct  9    RQQVLLDHLRPAH----FPKASKDLVASVCAAGDSAAYERAAEFGDDVVIVAAYRTPICK  64

Query  251  SKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAFYAG  430
            +KRGGFKDT  DDLLA VLKALI+KT LNP EVGDI+VGTVLAPGS RASECRMAAFYAG
Sbjct  65   AKRGGFKDTLADDLLAPVLKALIDKTGLNPVEVGDIVVGTVLAPGSQRASECRMAAFYAG  124

Query  431  FPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNPRAS  610
            FPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAG+ESM+V  +A+EGSVNP+  
Sbjct  125  FPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGVESMSVAPLAFEGSVNPKVE  184

Query  611  TLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
              +QAQ+CLLPMGITSENVA R+GV+RQ+QDQ
Sbjct  185  IFRQAQDCLLPMGITSENVAERYGVSRQDQDQ  216



>pdb|2WU9|A Chain A, Crystal Structure Of Peroxisomal Kat2 From Arabidopsis 
Thaliana
 pdb|2WU9|B Chain B, Crystal Structure Of Peroxisomal Kat2 From Arabidopsis 
Thaliana
Length=442

 Score =   316 bits (809),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 160/181 (88%), Positives = 167/181 (92%), Gaps = 0/181 (0%)
 Frame = +2

Query  164  AGDSAAYQRNSVYGDDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPS  343
            AGDSAAYQR S+YGDD+VIVAA+RTPLCKSKRG FKDTYPDDLLA VL+ALIEKTNLNPS
Sbjct  16   AGDSAAYQRTSLYGDDVVIVAAHRTPLCKSKRGNFKDTYPDDLLAPVLRALIEKTNLNPS  75

Query  344  EVGDIIVGTVLAPGSIRASECRMAAFYAGFPETVPVRTVNRQCSSGLQavadvaaaikaG  523
            EVGDI+VGTVLAPGS RASECRMAAFYAGFPETV VRTVNRQCSSGLQAVADVAAAIKAG
Sbjct  76   EVGDIVVGTVLAPGSQRASECRMAAFYAGFPETVAVRTVNRQCSSGLQAVADVAAAIKAG  135

Query  524  FYDIGIGAGLESMTVNTMAWEGSVNPRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQD  703
            FYDIGIGAGLESMT N MAWEGSVNP      QAQNCLLPMG+TSENVA RFGV+RQEQD
Sbjct  136  FYDIGIGAGLESMTTNPMAWEGSVNPAVKKFAQAQNCLLPMGVTSENVAQRFGVSRQEQD  195

Query  704  Q  706
            Q
Sbjct  196  Q  196



>ref|XP_011083116.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Sesamum indicum]
Length=463

 Score =   315 bits (808),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 160/215 (74%), Positives = 185/215 (86%), Gaps = 1/215 (0%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  241
            A  RQR+LLQHLRPT++ S   S +SS+S S+C AGDSAAY R + +GDDIVIVAAYRT 
Sbjct  4    ATNRQRILLQHLRPTSSVSHQTS-DSSLSPSICLAGDSAAYHRTAAFGDDIVIVAAYRTA  62

Query  242  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  421
            +CKSKRGGFKDT PDDLLA+VLKALI++TNLNP+EVGDIIVGTVLAPGS+RA ECRMAA 
Sbjct  63   ICKSKRGGFKDTLPDDLLAAVLKALIDRTNLNPAEVGDIIVGTVLAPGSLRAIECRMAAL  122

Query  422  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  601
            YAGFP++VPVRTVNRQCSSGLQAVADVAA I+AG+YDIGI AGLESMTV+ M     VNP
Sbjct  123  YAGFPDSVPVRTVNRQCSSGLQAVADVAAFIQAGYYDIGIAAGLESMTVDAMGAIQMVNP  182

Query  602  RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
            +     QA++CLLPMG+TSENVA R+GVTR+EQDQ
Sbjct  183  KVERFSQARDCLLPMGVTSENVAERYGVTREEQDQ  217



>gb|KDO43599.1| hypothetical protein CISIN_1g012506mg [Citrus sinensis]
Length=445

 Score =   314 bits (805),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 166/215 (77%), Positives = 182/215 (85%), Gaps = 19/215 (9%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  241
            AI RQ+VLL+HLRP+N++S   + ES +SAS CAAGDSAAY R SVYGDD+VIVAAYRT 
Sbjct  4    AINRQQVLLEHLRPSNSSSH--NYESILSASACAAGDSAAYHRTSVYGDDVVIVAAYRTA  61

Query  242  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  421
            LCKSKRGGFKDTYPDDLLA VLKA+IEKTN++PSEVGDI+VGTVLAPGS RASECRMAAF
Sbjct  62   LCKSKRGGFKDTYPDDLLAPVLKAVIEKTNVDPSEVGDIVVGTVLAPGSQRASECRMAAF  121

Query  422  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  601
            YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDI                 GSVNP
Sbjct  122  YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDI-----------------GSVNP  164

Query  602  RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
            +    +QAQNCLLPMG+TSENVAHRFGVTR+EQDQ
Sbjct  165  KVKAFEQAQNCLLPMGVTSENVAHRFGVTRKEQDQ  199



>gb|KDO65878.1| hypothetical protein CISIN_1g0125222mg [Citrus sinensis]
Length=320

 Score =   310 bits (793),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 157/214 (73%), Positives = 180/214 (84%), Gaps = 3/214 (1%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  241
            A+ RQR+LLQHL+P+   SS  S   ++SAS+C+AG++A Y R   + DD+VIVAAYRT 
Sbjct  4    ALHRQRILLQHLQPS---SSQTSDSPAISASICSAGEAAGYHRKPAFDDDVVIVAAYRTA  60

Query  242  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  421
            +CK+KRGGFKDT  DDLLA VLKA+IEKT LNPSEVGDI+VGTVLAPGS RA ECRMAAF
Sbjct  61   ICKAKRGGFKDTLADDLLAPVLKAVIEKTRLNPSEVGDIVVGTVLAPGSTRAMECRMAAF  120

Query  422  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  601
            YAGFPETVP+RTVNRQCSSGLQAVADVA AIKAG YDIGI AGLESMTVN+++  G VNP
Sbjct  121  YAGFPETVPLRTVNRQCSSGLQAVADVATAIKAGLYDIGIAAGLESMTVNSISVVGQVNP  180

Query  602  RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQD  703
            +     QA++CLLPMGITSENVA RFGVTRQEQD
Sbjct  181  KVEIFTQARDCLLPMGITSENVAQRFGVTRQEQD  214



>ref|XP_009411367.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Musa 
acuminata subsp. malaccensis]
Length=459

 Score =   314 bits (804),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 163/214 (76%), Positives = 184/214 (86%), Gaps = 5/214 (2%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  241
            AIERQRVLL HL+P+    S       +S  VCAAGDSA YQR+S +GDD+VIVAA RT 
Sbjct  4    AIERQRVLLHHLQPSPPLRS-----PILSTEVCAAGDSAKYQRSSCFGDDVVIVAACRTA  58

Query  242  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  421
            +CKSKRGGFKDT+P+DLLA VLKAL++KT LNPSEVGDI+VGTVLAPGS RA ECRMAAF
Sbjct  59   ICKSKRGGFKDTHPEDLLAPVLKALLDKTQLNPSEVGDIVVGTVLAPGSQRAIECRMAAF  118

Query  422  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  601
            YAGFP+TVP+RTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTVN++   G VNP
Sbjct  119  YAGFPDTVPLRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTVNSVGLNGPVNP  178

Query  602  RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQD  703
            +A T  QA++CLLPMGITSENVA R+G+TRQEQD
Sbjct  179  KAETFPQARDCLLPMGITSENVADRYGITRQEQD  212



>ref|XP_010457531.1| PREDICTED: 3-ketoacyl-CoA thiolase 1, peroxisomal [Camelina sativa]
Length=439

 Score =   313 bits (801),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 160/214 (75%), Positives = 182/214 (85%), Gaps = 13/214 (6%)
 Frame = +2

Query  65   IERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTPL  244
            +ERQRVLLQHL+P++A         S+S S C A    +Y+R S+YGDD+VIVAA RT L
Sbjct  5    MERQRVLLQHLQPSDA---------SLSPSACLA----SYERTSLYGDDVVIVAAQRTAL  51

Query  245  CKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAFY  424
            CK+KRG FKDTYPDDLLASVL+ALIEKTN+NP+EVGDI+VGTVL PGS RASECRMAAFY
Sbjct  52   CKAKRGSFKDTYPDDLLASVLRALIEKTNVNPTEVGDIVVGTVLGPGSQRASECRMAAFY  111

Query  425  AGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNPR  604
            AGFP+TVP+RTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMT N   W+GSVNP+
Sbjct  112  AGFPQTVPIRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTTNPRGWKGSVNPK  171

Query  605  ASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
                +QA +CLLPMGITSENVAHRF V+R+EQDQ
Sbjct  172  VEKFEQAHSCLLPMGITSENVAHRFNVSREEQDQ  205



>pdb|2C7Y|A Chain A, Plant Enzyme
 pdb|2C7Y|B Chain B, Plant Enzyme
 pdb|2C7Z|A Chain A, Plant Enzyme Crystal Form Ii
Length=404

 Score =   311 bits (798),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 158/179 (88%), Positives = 165/179 (92%), Gaps = 0/179 (0%)
 Frame = +2

Query  170  DSAAYQRNSVYGDDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEV  349
            DSAAYQR S+YGDD+VIVAA+RTPLCKSKRG FKDTYPDDLLA VL+ALIEKTNLNPSEV
Sbjct  1    DSAAYQRTSLYGDDVVIVAAHRTPLCKSKRGNFKDTYPDDLLAPVLRALIEKTNLNPSEV  60

Query  350  GDIIVGTVLAPGSIRASECRMAAFYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFY  529
            GDI+VGTVLAPGS RASECRMAAFYAGFPETV VRTVNRQCSSGLQAVADVAAAIKAGFY
Sbjct  61   GDIVVGTVLAPGSQRASECRMAAFYAGFPETVAVRTVNRQCSSGLQAVADVAAAIKAGFY  120

Query  530  DIGIGAGLESMTVNTMAWEGSVNPRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
            DIGIGAGLESMT N MAWEGSVNP      QAQNCLLPMG+TSENVA RFGV+RQEQDQ
Sbjct  121  DIGIGAGLESMTTNPMAWEGSVNPAVKKFAQAQNCLLPMGVTSENVAQRFGVSRQEQDQ  179



>gb|KDO65876.1| hypothetical protein CISIN_1g0125222mg [Citrus sinensis]
 gb|KDO65877.1| hypothetical protein CISIN_1g0125222mg [Citrus sinensis]
Length=374

 Score =   310 bits (794),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 157/214 (73%), Positives = 183/214 (86%), Gaps = 3/214 (1%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  241
            A+ RQR+LLQHL+P+++ +S DS   ++SAS+C+AG++A Y R   + DD+VIVAAYRT 
Sbjct  4    ALHRQRILLQHLQPSSSQTS-DS--PAISASICSAGEAAGYHRKPAFDDDVVIVAAYRTA  60

Query  242  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  421
            +CK+KRGGFKDT  DDLLA VLKA+IEKT LNPSEVGDI+VGTVLAPGS RA ECRMAAF
Sbjct  61   ICKAKRGGFKDTLADDLLAPVLKAVIEKTRLNPSEVGDIVVGTVLAPGSTRAMECRMAAF  120

Query  422  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  601
            YAGFPETVP+RTVNRQCSSGLQAVADVA AIKAG YDIGI AGLESMTVN+++  G VNP
Sbjct  121  YAGFPETVPLRTVNRQCSSGLQAVADVATAIKAGLYDIGIAAGLESMTVNSISVVGQVNP  180

Query  602  RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQD  703
            +     QA++CLLPMGITSENVA RFGVTRQEQD
Sbjct  181  KVEIFTQARDCLLPMGITSENVAQRFGVTRQEQD  214



>ref|XP_009336051.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Pyrus 
x bretschneideri]
Length=453

 Score =   313 bits (801),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 155/215 (72%), Positives = 186/215 (87%), Gaps = 0/215 (0%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  241
            A+ RQRVLLQHLRP ++ SS +     +SAS+CAAGDSAAY R + +GDD+VIVAAYRT 
Sbjct  4    AMNRQRVLLQHLRPNSSVSSSNYESDPLSASICAAGDSAAYHRTAAFGDDVVIVAAYRTA  63

Query  242  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  421
            +CK+KRGGFKDT PDDLLA VLK +IE+TNLNPSEVGDI+VGTV+APGS+RA+ECRMAAF
Sbjct  64   ICKAKRGGFKDTLPDDLLAPVLKEVIERTNLNPSEVGDIVVGTVMAPGSLRATECRMAAF  123

Query  422  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  601
            YAGFP+TVP+RTVNRQCSSGLQAVADVAA+IKAG+YDIGI AGLES+TV+ +     +NP
Sbjct  124  YAGFPDTVPIRTVNRQCSSGLQAVADVAASIKAGYYDIGIAAGLESLTVDKLGRSRKINP  183

Query  602  RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
            +     QA++CLLPMGITSENVA R+GVTR+EQD+
Sbjct  184  KVDIFAQARDCLLPMGITSENVAQRYGVTREEQDR  218



>dbj|BAI66423.1| 3-ketoacyl-CoA thiolase-like protein [Triticum aestivum]
Length=459

 Score =   313 bits (801),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 159/215 (74%), Positives = 188/215 (87%), Gaps = 6/215 (3%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  241
            AI+RQRVLL HL P+  ASS    ++ +SAS CAAGDSAAYQR+S +GDD+VIVAAYRTP
Sbjct  4    AIDRQRVLLAHLLPS--ASS----QTQLSASPCAAGDSAAYQRSSCFGDDVVIVAAYRTP  57

Query  242  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  421
            +CK+KRGGFKDTYP+DLL  VLKA+++KT +NP+E+GD++VGTVL PGS RA ECR A+ 
Sbjct  58   ICKAKRGGFKDTYPEDLLTPVLKAVLDKTGINPAEIGDVVVGTVLGPGSQRAIECRTASL  117

Query  422  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  601
             AG PETVPVRTVNRQCSSGLQAVADVAAAIKAGFY+IGIGAGLESM+VN++ WEG VNP
Sbjct  118  LAGIPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYEIGIGAGLESMSVNSVGWEGQVNP  177

Query  602  RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
            R   LQ+AQ+CLLPMGITSENVA R+GVTR+EQD+
Sbjct  178  RVIELQKAQDCLLPMGITSENVAQRYGVTREEQDK  212



>gb|EMT31542.1| 3-ketoacyl-CoA thiolase 2, peroxisomal [Aegilops tauschii]
Length=459

 Score =   313 bits (801),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 159/215 (74%), Positives = 188/215 (87%), Gaps = 6/215 (3%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  241
            AI+RQRVLL HL P+  ASS    ++ +SAS CAAGDSAAYQR+S +GDD+VIVAAYRTP
Sbjct  4    AIDRQRVLLAHLLPS--ASS----QTQLSASPCAAGDSAAYQRSSCFGDDVVIVAAYRTP  57

Query  242  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  421
            +CK+KRGGFKDTYP+DLL  VLKA+++KT +NP+E+GD++VGTVL PGS RA ECR A+ 
Sbjct  58   ICKAKRGGFKDTYPEDLLTPVLKAVLDKTGINPAEIGDVVVGTVLGPGSQRAIECRTASL  117

Query  422  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  601
             AG PETVPVRTVNRQCSSGLQAVADVAAAIKAGFY+IGIGAGLESM+VN++ WEG VNP
Sbjct  118  LAGIPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYEIGIGAGLESMSVNSVGWEGQVNP  177

Query  602  RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
            R   LQ+AQ+CLLPMGITSENVA R+GVTR+EQD+
Sbjct  178  RVIELQKAQDCLLPMGITSENVAQRYGVTREEQDK  212



>ref|XP_004247103.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Solanum lycopersicum]
Length=456

 Score =   311 bits (798),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 160/215 (74%), Positives = 180/215 (84%), Gaps = 8/215 (4%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  241
            AIERQRVLL+HL+P  +        SS++ SVC AGDS+AY R S +GDD+VIVAAYRT 
Sbjct  4    AIERQRVLLEHLQPIRS--------SSITPSVCLAGDSSAYHRTSAFGDDVVIVAAYRTA  55

Query  242  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  421
            +CK+KRGGFKDT  DDLLA VLKA++EKTNLNPSEVGDI+VGTVLAPGSIRA ECRMAAF
Sbjct  56   ICKAKRGGFKDTLSDDLLAPVLKAVVEKTNLNPSEVGDIVVGTVLAPGSIRAMECRMAAF  115

Query  422  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  601
            YAGFP+TVP+RTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLE MTV+ +      NP
Sbjct  116  YAGFPDTVPIRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLEFMTVDNIGLVVKANP  175

Query  602  RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
            +     QA++CLLPMGITSENVA RFGVTR EQDQ
Sbjct  176  KVDAFAQARDCLLPMGITSENVAQRFGVTRLEQDQ  210



>gb|ABR17647.1| unknown [Picea sitchensis]
Length=462

 Score =   311 bits (798),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 160/212 (75%), Positives = 181/212 (85%), Gaps = 4/212 (2%)
 Frame = +2

Query  71   RQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTPLCK  250
            RQ+V L HLRP +           + ASVCAAGDSAAY+R + +GDD+VIVAAYRTP+CK
Sbjct  9    RQQVSLDHLRPAH----FPKASKDLVASVCAAGDSAAYERAAEFGDDVVIVAAYRTPICK  64

Query  251  SKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAFYAG  430
            +KRGGFKDT  DDLLA VLKALI+KT LNP EVGDI+VGTVLAPGS RA ECRMAAFYAG
Sbjct  65   AKRGGFKDTLADDLLAPVLKALIDKTGLNPVEVGDIVVGTVLAPGSQRAIECRMAAFYAG  124

Query  431  FPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNPRAS  610
            FPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAG+ESM+V  +A+EGSVNP+  
Sbjct  125  FPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGVESMSVTPLAFEGSVNPKVE  184

Query  611  TLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
              +QAQ+CLLPMGITSENVA R+GV+RQ+QDQ
Sbjct  185  IFRQAQDCLLPMGITSENVAERYGVSRQDQDQ  216



>gb|KDO65875.1| hypothetical protein CISIN_1g0125222mg, partial [Citrus sinensis]
Length=397

 Score =   309 bits (792),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 157/214 (73%), Positives = 180/214 (84%), Gaps = 3/214 (1%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  241
            A+ RQR+LLQHL+P+   SS  S   ++SAS+C+AG++A Y R   + DD+VIVAAYRT 
Sbjct  4    ALHRQRILLQHLQPS---SSQTSDSPAISASICSAGEAAGYHRKPAFDDDVVIVAAYRTA  60

Query  242  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  421
            +CK+KRGGFKDT  DDLLA VLKA+IEKT LNPSEVGDI+VGTVLAPGS RA ECRMAAF
Sbjct  61   ICKAKRGGFKDTLADDLLAPVLKAVIEKTRLNPSEVGDIVVGTVLAPGSTRAMECRMAAF  120

Query  422  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  601
            YAGFPETVP+RTVNRQCSSGLQAVADVA AIKAG YDIGI AGLESMTVN+++  G VNP
Sbjct  121  YAGFPETVPLRTVNRQCSSGLQAVADVATAIKAGLYDIGIAAGLESMTVNSISVVGQVNP  180

Query  602  RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQD  703
            +     QA++CLLPMGITSENVA RFGVTRQEQD
Sbjct  181  KVEIFTQARDCLLPMGITSENVAQRFGVTRQEQD  214



>ref|XP_008235516.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Prunus mume]
Length=467

 Score =   311 bits (796),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 156/218 (72%), Positives = 186/218 (85%), Gaps = 3/218 (1%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSL---DSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAY  232
            A  RQRVLLQHL P ++ SS        +++SAS+CAAGDSAAY R + +GDD+VIVAAY
Sbjct  4    AHNRQRVLLQHLLPNSSFSSAPPETHQSAALSASICAAGDSAAYHRTAAFGDDVVIVAAY  63

Query  233  RTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRM  412
            RT +CK+KRGGFKDT PDDLLA VLKALIE+TNLNPSEVGDI+VGTV+APGS+RA+ECRM
Sbjct  64   RTAICKAKRGGFKDTSPDDLLAPVLKALIERTNLNPSEVGDIVVGTVMAPGSLRATECRM  123

Query  413  AAFYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGS  592
            AAFYAGFP+TVP+RTVNRQCSSGLQAVADVAA+IKAGFY+IG+ AGLESM+V+ +     
Sbjct  124  AAFYAGFPDTVPIRTVNRQCSSGLQAVADVAASIKAGFYEIGVAAGLESMSVDKLGRMNK  183

Query  593  VNPRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
            +NP+     QA++CLLPMGITSENVA R+GVTRQEQD+
Sbjct  184  INPKVDIFAQARDCLLPMGITSENVAQRYGVTRQEQDK  221



>gb|ACV70032.1| 3-ketoacyl CoA thiolase 1 [Petunia x hybrida]
Length=462

 Score =   311 bits (796),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 161/215 (75%), Positives = 182/215 (85%), Gaps = 2/215 (1%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  241
            AI+RQRVLL+HL+P    +   S  SS++ S+CAAGDSAAYQR + +GDD+VIVAAYRT 
Sbjct  4    AIQRQRVLLEHLQPIRHHTHDHS--SSLTTSICAAGDSAAYQRTAAFGDDVVIVAAYRTA  61

Query  242  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  421
            +CKSKRGGFKDT  DDLLA VLKA+IEKTNL+P EVGDI+VGTVLAPGSIRA ECRMAAF
Sbjct  62   ICKSKRGGFKDTLSDDLLAPVLKAVIEKTNLDPKEVGDIVVGTVLAPGSIRAMECRMAAF  121

Query  422  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  601
            YAGFPETVP+RTVNRQCSSGLQAVADVAA+IKAGFYDIGIGAGLE MTV+ +      N 
Sbjct  122  YAGFPETVPIRTVNRQCSSGLQAVADVAASIKAGFYDIGIGAGLELMTVDNIGRVQQRNT  181

Query  602  RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
            +  T  QA++CLLPMGITSENVA RFGVTR EQDQ
Sbjct  182  KVDTFAQARDCLLPMGITSENVAQRFGVTRLEQDQ  216



>ref|XP_006350308.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Solanum 
tuberosum]
Length=456

 Score =   310 bits (795),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 159/215 (74%), Positives = 180/215 (84%), Gaps = 8/215 (4%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  241
            AIERQRVLL+HL+P  +        SS++ SVC AGDS+AY R S +GDD+VIVAAYRT 
Sbjct  4    AIERQRVLLEHLQPIRS--------SSITPSVCLAGDSSAYHRTSAFGDDVVIVAAYRTA  55

Query  242  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  421
            +CK+KRGGFKDT  DDLLA VLKA++EKTNLNP+EVGDI+VGTVLAPGSIRA ECRMAAF
Sbjct  56   ICKAKRGGFKDTLSDDLLAPVLKAVVEKTNLNPNEVGDIVVGTVLAPGSIRAMECRMAAF  115

Query  422  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  601
            YAGFP+TVP+RTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLE MTV+ +      NP
Sbjct  116  YAGFPDTVPIRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLELMTVDNIGLVQKANP  175

Query  602  RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
            +     QA++CLLPMGITSENVA RFGVTR EQDQ
Sbjct  176  KVDAFAQARDCLLPMGITSENVAQRFGVTRLEQDQ  210



>gb|AEQ94132.1| putative 3-ketoacyl CoA thiolase [Elaeis guineensis]
Length=324

 Score =   305 bits (782),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 148/178 (83%), Positives = 168/178 (94%), Gaps = 0/178 (0%)
 Frame = +2

Query  170  DSAAYQRNSVYGDDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEV  349
            DSAAYQR+S +GDD+V+VAAYRTP+CKSKRGGFKDT+P+DLLA+VLK L++KT LNP+EV
Sbjct  1    DSAAYQRSSSFGDDVVVVAAYRTPICKSKRGGFKDTHPEDLLATVLKGLLDKTKLNPNEV  60

Query  350  GDIIVGTVLAPGSIRASECRMAAFYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFY  529
             DI+VGTVLAPGS RA+ECRMAAFYAGFPETVPVRTVNRQCSSGLQAVADVAA+IKAGFY
Sbjct  61   SDIVVGTVLAPGSQRATECRMAAFYAGFPETVPVRTVNRQCSSGLQAVADVAASIKAGFY  120

Query  530  DIGIGAGLESMTVNTMAWEGSVNPRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQD  703
            DIGIGAGLESMT N ++WEGS+NP+  TLQQAQ+CLLPMGITSENVA R+GVTRQEQD
Sbjct  121  DIGIGAGLESMTANVVSWEGSINPKVKTLQQAQDCLLPMGITSENVARRYGVTRQEQD  178



>gb|KDP26413.1| hypothetical protein JCGZ_17571 [Jatropha curcas]
Length=452

 Score =   310 bits (793),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 156/214 (73%), Positives = 184/214 (86%), Gaps = 2/214 (1%)
 Frame = +2

Query  71   RQRVLLQHLRPTNAASSLDSIE--SSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTPL  244
            RQ+VLL HL+P +++S L   +  SS+S S+CAAG+ AAY+R +V GDD+VIVAAYRT +
Sbjct  7    RQKVLLGHLQPNSSSSFLSHTQKSSSLSTSICAAGNGAAYRRTAVSGDDVVIVAAYRTAI  66

Query  245  CKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAFY  424
            CK+K+GGFKDT PDDL+ SVLKALIEKTN+NPSEVGDI+VGTVLAPGS+RA ECRM AFY
Sbjct  67   CKAKKGGFKDTLPDDLIGSVLKALIEKTNVNPSEVGDIVVGTVLAPGSLRAIECRMGAFY  126

Query  425  AGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNPR  604
            AGFPETVP+RTVNRQCSSGLQAVADVAA+IKAGFYDIGIGAGLESMTV+ +     VNP+
Sbjct  127  AGFPETVPIRTVNRQCSSGLQAVADVAASIKAGFYDIGIGAGLESMTVDKIDIVSQVNPK  186

Query  605  ASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
                 QA++CLLPMGITSENVA R+G+TR EQDQ
Sbjct  187  VEIFAQARDCLLPMGITSENVAQRYGITRLEQDQ  220



>ref|XP_008804745.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Phoenix dactylifera]
Length=460

 Score =   310 bits (794),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 159/215 (74%), Positives = 184/215 (86%), Gaps = 4/215 (2%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  241
            AI RQRVLLQHL P++ +        ++S S+CAAGDSAAYQR+S +GDD+VIVAA RT 
Sbjct  4    AIGRQRVLLQHLHPSSGSDD----HPTLSTSICAAGDSAAYQRSSCFGDDVVIVAACRTA  59

Query  242  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  421
            +CKSKRGGFKDT+P+DLLA VLKAL++KT LNPSEVGDI+VGTVLAPGS RA ECRMAAF
Sbjct  60   ICKSKRGGFKDTHPEDLLAPVLKALLDKTKLNPSEVGDIVVGTVLAPGSQRAIECRMAAF  119

Query  422  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  601
            YAGFPETVP+RTVNRQCSSGLQAVAD+AA+IKAGFYDIGI AG+ESMTVN++     VNP
Sbjct  120  YAGFPETVPLRTVNRQCSSGLQAVADIAASIKAGFYDIGIAAGMESMTVNSVGRIVPVNP  179

Query  602  RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
            RA    QA++CLLPMG+TSE VA R+GVTRQEQDQ
Sbjct  180  RAEMFAQARDCLLPMGMTSEIVAQRYGVTRQEQDQ  214



>ref|NP_001048523.1| Os02g0817700 [Oryza sativa Japonica Group]
 gb|AAO72588.1| 3-ketoacyl-CoA thiolase-like protein [Oryza sativa Japonica Group]
 dbj|BAD21525.1| putative 3-ketoacyl-CoA thiolase; acetyl-CoA acyltransferase 
[Oryza sativa Japonica Group]
 dbj|BAF10437.1| Os02g0817700 [Oryza sativa Japonica Group]
 gb|EAY88029.1| hypothetical protein OsI_09452 [Oryza sativa Indica Group]
Length=448

 Score =   310 bits (793),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 162/215 (75%), Positives = 183/215 (85%), Gaps = 5/215 (2%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  241
            AI+RQRVLL H        S  S +S +SAS CAAGDSAAYQR S YGDD+V+VAAYRTP
Sbjct  4    AIDRQRVLLAH-----LLPSSSSDQSLLSASACAAGDSAAYQRTSAYGDDVVVVAAYRTP  58

Query  242  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  421
            +CK+KRGGFKDTYP+DLL  VLKA+++ T +NP E+GDI+VGTVL PGS RA ECR AAF
Sbjct  59   ICKAKRGGFKDTYPEDLLTVVLKAVLDNTKINPGEIGDIVVGTVLGPGSQRAIECRAAAF  118

Query  422  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  601
            YAG PE VPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESM+VN M WEG VNP
Sbjct  119  YAGVPENVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMSVNAMGWEGQVNP  178

Query  602  RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
            + + +Q+AQ+CLLPMGITSENVAHR+GVTRQEQDQ
Sbjct  179  KVNEVQKAQDCLLPMGITSENVAHRYGVTRQEQDQ  213



>ref|XP_004290230.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Fragaria 
vesca subsp. vesca]
Length=456

 Score =   309 bits (792),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 158/217 (73%), Positives = 186/217 (86%), Gaps = 2/217 (1%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASS-LDSIESSV-SASVCAAGDSAAYQRNSVYGDDIVIVAAYR  235
            A+ RQ+VLLQHLRP ++ SS + + ESSV SA +CAAGDSAAY R   +GDDIVIVAAYR
Sbjct  4    ALNRQKVLLQHLRPNSSLSSAIQTHESSVLSAEICAAGDSAAYHRTGAFGDDIVIVAAYR  63

Query  236  TPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMA  415
            T +CK+KRGGFKDT  DDLLA VLKA+IE+TNLNPSEVGDI+VGTVLAPGS+RA ECRMA
Sbjct  64   TAVCKAKRGGFKDTLADDLLAPVLKAVIERTNLNPSEVGDIVVGTVLAPGSLRAIECRMA  123

Query  416  AFYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSV  595
            AFYAGFP+TVP+RTVNRQCSSGLQAVADVAA IKAG+YDIGI AG+E MT++++     +
Sbjct  124  AFYAGFPDTVPIRTVNRQCSSGLQAVADVAAFIKAGYYDIGIAAGVECMTIDSIGSIHKI  183

Query  596  NPRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
            NP+A    QA++CLLPMG+TSENVA  +GVTRQEQDQ
Sbjct  184  NPKAEAFAQARDCLLPMGVTSENVAQCYGVTRQEQDQ  220



>ref|XP_011006998.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Populus 
euphratica]
Length=457

 Score =   309 bits (791),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 157/215 (73%), Positives = 183/215 (85%), Gaps = 7/215 (3%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  241
            A  RQ+VLL HL+PT+ +  L       SAS+CAAGDSAAY R + +GDDIVIVAAYRT 
Sbjct  4    AFNRQKVLLAHLQPTSPSPLL-------SASICAAGDSAAYHRTAAFGDDIVIVAAYRTA  56

Query  242  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  421
            +CK++RGGFKDT+PDDLL  VLKA++EKTN+NPSEVGDI+VGTVLAPGS RA ECRMAAF
Sbjct  57   ICKARRGGFKDTFPDDLLGFVLKAVVEKTNVNPSEVGDIVVGTVLAPGSERAIECRMAAF  116

Query  422  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  601
            YAGFP+TVP+RTVNRQCSSGLQAVADVAA+IKAG+YDIGI AGLE MTVN++     VNP
Sbjct  117  YAGFPDTVPLRTVNRQCSSGLQAVADVAASIKAGYYDIGIAAGLECMTVNSIRSVPQVNP  176

Query  602  RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
            R  T QQA++CLLPMG+TSENVA R+GVTRQ+QDQ
Sbjct  177  RVETFQQARDCLLPMGLTSENVAQRYGVTRQDQDQ  211



>ref|XP_009796304.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like isoform 
X1 [Nicotiana sylvestris]
Length=486

 Score =   310 bits (793),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 158/215 (73%), Positives = 184/215 (86%), Gaps = 3/215 (1%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  241
            AIERQRVLL+HL+P  ++S      SS++ S+C AGDSAAYQR + +GDD+VIVAAYRT 
Sbjct  29   AIERQRVLLEHLQPIRSSSHQ---FSSLTPSICLAGDSAAYQRTAAFGDDVVIVAAYRTA  85

Query  242  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  421
            +CK+KRGGFK+T  DDLLA VLKA++EKTNL+P+EVGDI+VGTVLAPGS+RA ECRMAAF
Sbjct  86   ICKAKRGGFKNTLADDLLAPVLKAVVEKTNLSPNEVGDIVVGTVLAPGSLRAMECRMAAF  145

Query  422  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  601
            YAGFPETVP+RTVNRQCSSGLQAVADVAA+IKAGFYDIGIGAGLE MTV+ +     VNP
Sbjct  146  YAGFPETVPIRTVNRQCSSGLQAVADVAASIKAGFYDIGIGAGLELMTVDNIGRVQQVNP  205

Query  602  RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
            +     QA++CLLPMGITSENVA RFGVTR EQDQ
Sbjct  206  KVDAFAQARDCLLPMGITSENVAQRFGVTRLEQDQ  240



>ref|XP_006368897.1| hypothetical protein POPTR_0001s14290g [Populus trichocarpa]
 gb|ERP65466.1| hypothetical protein POPTR_0001s14290g [Populus trichocarpa]
Length=455

 Score =   308 bits (790),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 163/215 (76%), Positives = 183/215 (85%), Gaps = 9/215 (4%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  241
            A  RQRVLL HLR   ++SS ++ ESS+SAS C AG SAA       GDD+V+VAAYRTP
Sbjct  4    ASNRQRVLLGHLR---SSSSYNNHESSLSASACLAGGSAAC------GDDVVVVAAYRTP  54

Query  242  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  421
            LCKSKRGGFKDT+ DDLLA VLKALIEKTNL+  EVGDI+VG+ LAPGS RASECRMAA 
Sbjct  55   LCKSKRGGFKDTHADDLLAPVLKALIEKTNLDAREVGDIVVGSSLAPGSQRASECRMAAL  114

Query  422  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  601
            YAGFPETVP+RTVNR+CSSGLQAVADVAA+IKAGFY+IGIGAGLESMTVN+ AW G VNP
Sbjct  115  YAGFPETVPIRTVNRKCSSGLQAVADVAASIKAGFYEIGIGAGLESMTVNSRAWVGDVNP  174

Query  602  RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
            +    Q+AQ+CLLPMG+TSENVAHRFGVTRQEQDQ
Sbjct  175  KVKRFQEAQDCLLPMGVTSENVAHRFGVTRQEQDQ  209



>emb|CDX86611.1| BnaC08g00920D [Brassica napus]
Length=451

 Score =   308 bits (789),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 166/215 (77%), Positives = 185/215 (86%), Gaps = 3/215 (1%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  241
            AIERQRVLL HLRP   +SS     SS+S S C AGDSAAYQR S+YGDD+VIVAA RT 
Sbjct  4    AIERQRVLLHHLRPPPPSSSQ---ASSLSVSACLAGDSAAYQRTSLYGDDVVIVAAQRTA  60

Query  242  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  421
            LCK+KRG FKDTYPD+LLA VL+A+IEKT LNPSEVGDI+VGTVL  GS +A+E RMAAF
Sbjct  61   LCKAKRGSFKDTYPDELLAPVLRAVIEKTKLNPSEVGDIVVGTVLGSGSQKATEFRMAAF  120

Query  422  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  601
            YAGFPETVP+RTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMT +   W+GSVNP
Sbjct  121  YAGFPETVPIRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTTSPRGWKGSVNP  180

Query  602  RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
            +    +QAQ+CLLPMGITSENVAHRFGV+R+EQDQ
Sbjct  181  KVKKFEQAQSCLLPMGITSENVAHRFGVSREEQDQ  215



>ref|XP_006443651.1| hypothetical protein CICLE_v10020068mg [Citrus clementina]
 ref|XP_006480201.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Citrus 
sinensis]
 gb|ESR56891.1| hypothetical protein CICLE_v10020068mg [Citrus clementina]
Length=461

 Score =   308 bits (789),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 157/214 (73%), Positives = 180/214 (84%), Gaps = 3/214 (1%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  241
            A+ RQR+LLQHL+P+   SS  S   ++SAS+C+AG++A Y R   + DD+VIVAAYRT 
Sbjct  4    ALHRQRILLQHLQPS---SSQTSDSPAISASICSAGEAAGYHRKPAFDDDVVIVAAYRTA  60

Query  242  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  421
            +CK+KRGGFKDT  DDLLA VLKA+IEKT LNPSEVGDI+VGTVLAPGS RA ECRMAAF
Sbjct  61   ICKAKRGGFKDTLADDLLAPVLKAVIEKTRLNPSEVGDIVVGTVLAPGSTRAMECRMAAF  120

Query  422  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  601
            YAGFPETVP+RTVNRQCSSGLQAVADVA AIKAG YDIGI AGLESMTVN+++  G VNP
Sbjct  121  YAGFPETVPLRTVNRQCSSGLQAVADVATAIKAGLYDIGIAAGLESMTVNSISVVGQVNP  180

Query  602  RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQD  703
            +     QA++CLLPMGITSENVA RFGVTRQEQD
Sbjct  181  KVEIFTQARDCLLPMGITSENVAQRFGVTRQEQD  214



>ref|XP_007201004.1| hypothetical protein PRUPE_ppa005303mg [Prunus persica]
 gb|EMJ02203.1| hypothetical protein PRUPE_ppa005303mg [Prunus persica]
Length=467

 Score =   308 bits (789),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 155/218 (71%), Positives = 184/218 (84%), Gaps = 3/218 (1%)
 Frame = +2

Query  62   AIERQRVLLQHLRPT---NAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAY  232
            A  RQRVLLQHL P    +AA       +++SAS+CAAGDSAAY R + +GDD+VIVAAY
Sbjct  4    AHNRQRVLLQHLLPNCSFSAAPPETHQSAALSASICAAGDSAAYHRTAAFGDDVVIVAAY  63

Query  233  RTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRM  412
            RT +CK+KRGGFKDT PDDLLA VLKALIE+TNLNP EVGDI+VGTV+APGS+RA+ECRM
Sbjct  64   RTAICKAKRGGFKDTSPDDLLAPVLKALIERTNLNPGEVGDIVVGTVMAPGSLRATECRM  123

Query  413  AAFYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGS  592
            AAFYAGFP+TVP+RTVNRQCSSGLQAVADVAA+IKAGFY+IG+ AGLESM+V+ +     
Sbjct  124  AAFYAGFPDTVPIRTVNRQCSSGLQAVADVAASIKAGFYEIGVAAGLESMSVDKLGRMNK  183

Query  593  VNPRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
            +NP+     QA++CLLPMGITSENVA R+GVTRQEQD+
Sbjct  184  INPKVDIFAQARDCLLPMGITSENVAQRYGVTRQEQDK  221



>ref|XP_009111084.1| PREDICTED: 3-ketoacyl-CoA thiolase 1, peroxisomal [Brassica rapa]
Length=451

 Score =   306 bits (784),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 163/215 (76%), Positives = 186/215 (87%), Gaps = 3/215 (1%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  241
            A+ERQRVLL HL+P  ++SS     SS+S S C AGDS AYQR S+YGDD+VIVAA RT 
Sbjct  4    AMERQRVLLHHLQPLPSSSSQ---ASSLSVSACLAGDSNAYQRTSLYGDDVVIVAAQRTA  60

Query  242  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  421
            LCK+KRG FKDTYPD+LLASVL+A+IEKT L+PSEVGDI+VGTVL  GS +A+E RMAAF
Sbjct  61   LCKAKRGSFKDTYPDELLASVLRAVIEKTKLDPSEVGDIVVGTVLGSGSQKATEFRMAAF  120

Query  422  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  601
            YAGFPETVP+RTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMT +   W+GSVNP
Sbjct  121  YAGFPETVPIRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTTSPRGWKGSVNP  180

Query  602  RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
            +    +QAQ+CLLPMGITSENVAHRFGV+R+EQDQ
Sbjct  181  KVKKFEQAQSCLLPMGITSENVAHRFGVSREEQDQ  215



>ref|XP_009629663.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Nicotiana 
tomentosiformis]
Length=494

 Score =   307 bits (787),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 157/216 (73%), Positives = 184/216 (85%), Gaps = 1/216 (0%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESS-VSASVCAAGDSAAYQRNSVYGDDIVIVAAYRT  238
            AIERQRVLL+HL+P  ++S     +SS ++ S+C AGDSAAY+R + + DD+VIVAAYRT
Sbjct  33   AIERQRVLLEHLQPIRSSSHHTHDQSSSLTPSICLAGDSAAYRRTAAFDDDVVIVAAYRT  92

Query  239  PLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAA  418
             +CK+KRGGFKDT  DDLLA VLKA++EKTNL+P+EVGDI+VGTVLAPGS+RA ECRMAA
Sbjct  93   AICKAKRGGFKDTLADDLLAPVLKAVVEKTNLSPNEVGDIVVGTVLAPGSLRAMECRMAA  152

Query  419  FYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVN  598
            FYAGFPETVP+RTVNRQCSSGLQAVADVAA+IKAGFYDIGIGAGLE MTV+ +     VN
Sbjct  153  FYAGFPETVPIRTVNRQCSSGLQAVADVAASIKAGFYDIGIGAGLELMTVDNIGRVQQVN  212

Query  599  PRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
            P+     QA++CLLPMGITSENVA RFGVTR EQDQ
Sbjct  213  PKVDAFAQARDCLLPMGITSENVAQRFGVTRLEQDQ  248



>ref|XP_011034453.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Populus 
euphratica]
Length=455

 Score =   306 bits (784),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 162/215 (75%), Positives = 182/215 (85%), Gaps = 9/215 (4%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  241
            A  RQRVLL HL   + +SS ++ ESS+SAS C AG SAA       GDD+V+VAAYRTP
Sbjct  4    ASNRQRVLLGHL---HYSSSYNNHESSLSASACLAGGSAAC------GDDVVVVAAYRTP  54

Query  242  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  421
            LCKSKRGGFKDT+ DDLLASVLKALIEKTNL+  EVGDI+VG+ LAPGS RASECRMAA 
Sbjct  55   LCKSKRGGFKDTHADDLLASVLKALIEKTNLDAREVGDIVVGSSLAPGSQRASECRMAAL  114

Query  422  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  601
            YAGFPETVP+RTVNR+CSSGLQAVADVAA+IKAGFY+IGIGAGLESMTVN+ AW G VNP
Sbjct  115  YAGFPETVPIRTVNRKCSSGLQAVADVAASIKAGFYEIGIGAGLESMTVNSRAWAGDVNP  174

Query  602  RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
            +    Q+AQ+CLLPMG+TSENVAHRF VTRQEQDQ
Sbjct  175  KVKRFQEAQDCLLPMGVTSENVAHRFSVTRQEQDQ  209



>ref|XP_011002176.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Populus 
euphratica]
Length=455

 Score =   306 bits (783),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 162/215 (75%), Positives = 182/215 (85%), Gaps = 9/215 (4%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  241
            A  RQRVLL HL   + +SS ++ ESS+SAS C AG SAA       GDD+V+VAAYRTP
Sbjct  4    ASNRQRVLLGHL---HYSSSYNNHESSLSASACLAGGSAAC------GDDVVVVAAYRTP  54

Query  242  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  421
            LCKSKRGGFKDT+ DDLLASVLKALIEKTNL+  EVGDI+VG+ LAPGS RASECRMAA 
Sbjct  55   LCKSKRGGFKDTHADDLLASVLKALIEKTNLDAREVGDIVVGSSLAPGSQRASECRMAAL  114

Query  422  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  601
            YAGFPETVP+RTVNR+CSSGLQAVADVAA+IKAGFY+IGIGAGLESMTVN+ AW G VNP
Sbjct  115  YAGFPETVPIRTVNRKCSSGLQAVADVAASIKAGFYEIGIGAGLESMTVNSRAWAGDVNP  174

Query  602  RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
            +    Q+AQ+CLLPMG+TSENVAHRF VTRQEQDQ
Sbjct  175  KVKRFQEAQDCLLPMGVTSENVAHRFSVTRQEQDQ  209



>ref|XP_002301570.1| hypothetical protein POPTR_0002s22410g [Populus trichocarpa]
 gb|EEE80843.1| hypothetical protein POPTR_0002s22410g [Populus trichocarpa]
Length=457

 Score =   305 bits (782),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 156/215 (73%), Positives = 181/215 (84%), Gaps = 7/215 (3%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  241
            A  RQ+VLL HL+PT+ +  L       SAS+CAAGDSAAY R + +GDDIVIVAAYRT 
Sbjct  4    AFNRQKVLLAHLQPTSPSPLL-------SASICAAGDSAAYHRTAAFGDDIVIVAAYRTA  56

Query  242  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  421
            +CK++RGGFKDT+PDDLL  VLKA++EKTN+NPSEVGDI+VGTVLAPGS RA ECRMAAF
Sbjct  57   ICKARRGGFKDTFPDDLLGFVLKAVVEKTNVNPSEVGDIVVGTVLAPGSERAIECRMAAF  116

Query  422  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  601
            YAGFP+TVP+RTVNRQCSSGLQAVADVAA+IKAG+YDIGI AGLE MTVN +     VNP
Sbjct  117  YAGFPDTVPLRTVNRQCSSGLQAVADVAASIKAGYYDIGIAAGLECMTVNGIRSVPQVNP  176

Query  602  RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
            R    QQA++CLLPMG+TSENVA R+GVTRQ+QDQ
Sbjct  177  RVEAFQQARDCLLPMGLTSENVAQRYGVTRQDQDQ  211



>ref|XP_008804452.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Phoenix 
dactylifera]
Length=460

 Score =   305 bits (782),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 157/215 (73%), Positives = 183/215 (85%), Gaps = 4/215 (2%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  241
            AI RQ VLLQHLRP    SS      ++SAS+CAAGDSAAYQR+S +GDD+VIVAA RT 
Sbjct  4    AINRQSVLLQHLRP----SSDFGDRPALSASICAAGDSAAYQRSSCFGDDVVIVAACRTA  59

Query  242  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  421
            +CKS RGGF++T+P+DLLA VLKAL++KT LNPSEVGDI+VGTVLAPGS RA ECRMAAF
Sbjct  60   ICKSSRGGFRNTHPEDLLAPVLKALLDKTKLNPSEVGDIVVGTVLAPGSQRAIECRMAAF  119

Query  422  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  601
            YAGFPETVP+RTVNRQCSSGLQAVAD+AAAIK+GFY+IGI AG+ESMTV+ + W G  NP
Sbjct  120  YAGFPETVPLRTVNRQCSSGLQAVADIAAAIKSGFYEIGIAAGMESMTVDKIRWIGPANP  179

Query  602  RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
            RA    QA++CLLPMG+TSE VA R+G+TRQEQDQ
Sbjct  180  RAEMFAQARDCLLPMGMTSEIVAERYGITRQEQDQ  214



>ref|XP_010484155.1| PREDICTED: 3-ketoacyl-CoA thiolase 1, peroxisomal-like isoform 
X2 [Camelina sativa]
Length=440

 Score =   305 bits (780),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 157/215 (73%), Positives = 180/215 (84%), Gaps = 13/215 (6%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  241
            A+ERQRVLLQHL+P++A         S+S S C A    +Y+R S+YGDD+VIVAA RT 
Sbjct  4    AMERQRVLLQHLQPSDA---------SLSPSACLA----SYERTSLYGDDVVIVAAQRTA  50

Query  242  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  421
            LCK+KRG FKDTYPDDLLASVL+A+I KTN+NPSEVGDI+VGTVL  GS RA+ECRMAAF
Sbjct  51   LCKAKRGSFKDTYPDDLLASVLRAMIVKTNVNPSEVGDIVVGTVLGTGSQRATECRMAAF  110

Query  422  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  601
            YAGFP+TVP+RTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMT N   W+G VNP
Sbjct  111  YAGFPQTVPIRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTTNPRGWKGLVNP  170

Query  602  RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
            +    +QA +CLLPMGITSENVAHRF V+R+EQDQ
Sbjct  171  KVEKFEQAHSCLLPMGITSENVAHRFNVSREEQDQ  205



>gb|AAM61609.1| putative acetyl-CoA acyltransferase [Arabidopsis thaliana]
Length=443

 Score =   305 bits (780),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 162/215 (75%), Positives = 184/215 (86%), Gaps = 10/215 (5%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  241
            A ERQR+LL+HL+P++++ +      S+SAS C + DSAAYQ    YGDD+VIVAA RT 
Sbjct  4    ATERQRILLRHLQPSSSSDA------SLSASACLSKDSAAYQ----YGDDVVIVAAQRTA  53

Query  242  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  421
            LCK+KRG FKDT+PD+LLASVL+ALIEKTN+NPSEVGDI+VGTVL PGS RASECRMAAF
Sbjct  54   LCKAKRGSFKDTFPDELLASVLRALIEKTNVNPSEVGDIVVGTVLGPGSQRASECRMAAF  113

Query  422  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  601
            YAGFPETVP+RTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMT N   W+GSVNP
Sbjct  114  YAGFPETVPIRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTTNPRGWKGSVNP  173

Query  602  RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
                 +QA NCLLPMGITSENVAHRF V+R+EQDQ
Sbjct  174  NVKKFEQAHNCLLPMGITSENVAHRFNVSREEQDQ  208



>ref|NP_171965.1| 3-ketoacyl-CoA thiolase 1 [Arabidopsis thaliana]
 sp|Q8LF48.2|THIK1_ARATH RecName: Full=3-ketoacyl-CoA thiolase 1, peroxisomal; AltName: 
Full=Acetyl-CoA acyltransferase 1; AltName: Full=Beta-ketothiolase 
1; AltName: Full=Peroxisomal 3-oxoacyl-CoA thiolase 
1; Flags: Precursor [Arabidopsis thaliana]
 gb|AAM20592.1| putative acetyl-CoA acyltransferase [Arabidopsis thaliana]
 gb|AAO30078.1| putative acetyl-CoA acyltransferase [Arabidopsis thaliana]
 gb|AEE27736.1| 3-ketoacyl-CoA thiolase 1 [Arabidopsis thaliana]
Length=443

 Score =   305 bits (780),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 162/215 (75%), Positives = 184/215 (86%), Gaps = 10/215 (5%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  241
            A ERQR+LL+HL+P++++ +      S+SAS C + DSAAYQ    YGDD+VIVAA RT 
Sbjct  4    ATERQRILLRHLQPSSSSDA------SLSASACLSKDSAAYQ----YGDDVVIVAAQRTA  53

Query  242  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  421
            LCK+KRG FKDT+PD+LLASVL+ALIEKTN+NPSEVGDI+VGTVL PGS RASECRMAAF
Sbjct  54   LCKAKRGSFKDTFPDELLASVLRALIEKTNVNPSEVGDIVVGTVLGPGSQRASECRMAAF  113

Query  422  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  601
            YAGFPETVP+RTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMT N   W+GSVNP
Sbjct  114  YAGFPETVPIRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTTNPRGWKGSVNP  173

Query  602  RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
                 +QA NCLLPMGITSENVAHRF V+R+EQDQ
Sbjct  174  NVKKFEQAHNCLLPMGITSENVAHRFNVSREEQDQ  208



>ref|XP_010484150.1| PREDICTED: 3-ketoacyl-CoA thiolase 1, peroxisomal-like isoform 
X1 [Camelina sativa]
Length=446

 Score =   305 bits (780),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 157/215 (73%), Positives = 180/215 (84%), Gaps = 13/215 (6%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  241
            A+ERQRVLLQHL+P++A         S+S S C A    +Y+R S+YGDD+VIVAA RT 
Sbjct  4    AMERQRVLLQHLQPSDA---------SLSPSACLA----SYERTSLYGDDVVIVAAQRTA  50

Query  242  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  421
            LCK+KRG FKDTYPDDLLASVL+A+I KTN+NPSEVGDI+VGTVL  GS RA+ECRMAAF
Sbjct  51   LCKAKRGSFKDTYPDDLLASVLRAMIVKTNVNPSEVGDIVVGTVLGTGSQRATECRMAAF  110

Query  422  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  601
            YAGFP+TVP+RTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMT N   W+G VNP
Sbjct  111  YAGFPQTVPIRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTTNPRGWKGLVNP  170

Query  602  RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
            +    +QA +CLLPMGITSENVAHRF V+R+EQDQ
Sbjct  171  KVEKFEQAHSCLLPMGITSENVAHRFNVSREEQDQ  205



>ref|XP_001764272.1| predicted protein [Physcomitrella patens]
 gb|EDQ70826.1| predicted protein [Physcomitrella patens]
Length=460

 Score =   305 bits (780),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 149/212 (70%), Positives = 181/212 (85%), Gaps = 4/212 (2%)
 Frame = +2

Query  71   RQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTPLCK  250
            RQ++LL HL+P     +     ++V  S+C+A DSA Y R + + DD+VIVAAYRTP+CK
Sbjct  7    RQQLLLDHLKPETGRRA----AANVVTSICSANDSAPYARTTDFLDDVVIVAAYRTPICK  62

Query  251  SKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAFYAG  430
            +KRGGFKDTYPDDLLA VL+A++EKT +NP+E+GDI++GTVLAPG+ RA+ECRMAAFYAG
Sbjct  63   AKRGGFKDTYPDDLLAPVLRAVVEKTGVNPAEIGDIVIGTVLAPGAQRANECRMAAFYAG  122

Query  431  FPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNPRAS  610
            FPETVP+RTVNRQCSSGLQAVADV AAIKAGFYDIGIG GLESMTVN MAWEG+VNP+  
Sbjct  123  FPETVPIRTVNRQCSSGLQAVADVVAAIKAGFYDIGIGGGLESMTVNPMAWEGAVNPKVE  182

Query  611  TLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
              Q+AQ+CLLPMGITSENVA R+GV R++QD+
Sbjct  183  ADQRAQDCLLPMGITSENVAERYGVDRRQQDE  214



>emb|CDP03848.1| unnamed protein product [Coffea canephora]
Length=466

 Score =   304 bits (778),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 162/217 (75%), Positives = 183/217 (84%), Gaps = 2/217 (1%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASS--LDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYR  235
            AI RQ+VLL+HL+PT+  S        SS+S S+C AGDSAAYQR + +GDD+VIVAAYR
Sbjct  4    AIFRQKVLLEHLQPTSCFSHQLTHEESSSISPSICLAGDSAAYQRTAAFGDDVVIVAAYR  63

Query  236  TPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMA  415
            T +CKSKRGGFKDT  DDLLA VLKALI+KTN+NPSEVGDI+VGTV+APGS RA+ECRMA
Sbjct  64   TAICKSKRGGFKDTLADDLLAPVLKALIDKTNINPSEVGDIVVGTVVAPGSQRATECRMA  123

Query  416  AFYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSV  595
            AFYAGFPETVP+RTVNRQCSSGLQAVADVAA IKAGFYDIGIGAGLESMT N+       
Sbjct  124  AFYAGFPETVPIRTVNRQCSSGLQAVADVAACIKAGFYDIGIGAGLESMTTNSNVSIQQA  183

Query  596  NPRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
            NPR  +  QA++CLLPMGITSENVA R+GVTRQEQDQ
Sbjct  184  NPRVDSFPQARDCLLPMGITSENVAERYGVTRQEQDQ  220



>dbj|BAJ85217.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ87964.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=401

 Score =   301 bits (770),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 154/215 (72%), Positives = 177/215 (82%), Gaps = 3/215 (1%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  241
            A++RQR+LL+HL P   A+  +   S+VSASVCAAGDSAAY R   + DDIVIVAAYRT 
Sbjct  4    ALDRQRILLRHLEP---AAGANPTASAVSASVCAAGDSAAYHRGPCFADDIVIVAAYRTA  60

Query  242  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  421
            +CK+KRG FKDT P+DLL  V KAL+EKT LNPSEVGDI+VGTVLAPGS RA ECRMAA 
Sbjct  61   ICKAKRGSFKDTLPEDLLVPVFKALVEKTKLNPSEVGDIVVGTVLAPGSQRAIECRMAAL  120

Query  422  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  601
            YAGFP+TVP++TVNRQCSSGLQAVADVAAAIKAG YDIGI AG+ESMTVN +   G VNP
Sbjct  121  YAGFPDTVPLKTVNRQCSSGLQAVADVAAAIKAGMYDIGIAAGVESMTVNKVDLVGKVNP  180

Query  602  RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
            +     QA++CLLPMG+TSENVA RFG+TR EQDQ
Sbjct  181  KVELFAQARDCLLPMGLTSENVAQRFGITRMEQDQ  215



>ref|XP_010933143.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Elaeis 
guineensis]
Length=460

 Score =   301 bits (772),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 154/215 (72%), Positives = 182/215 (85%), Gaps = 4/215 (2%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  241
            AI RQRVLLQH  P++A+        ++S S+CAAGDSAAYQR+S +GDD+VIVAA RT 
Sbjct  4    AISRQRVLLQHFHPSSASDD----HPTLSTSICAAGDSAAYQRSSCFGDDVVIVAACRTA  59

Query  242  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  421
            +CKSKRGGFKDT+P+DLLA VLK L++KT LNPSEVGDI+VGTVLA GS RA ECRMAAF
Sbjct  60   ICKSKRGGFKDTHPEDLLAPVLKELLDKTKLNPSEVGDIVVGTVLASGSQRAIECRMAAF  119

Query  422  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  601
            YAGFPETV ++TVNRQCSSGLQAVAD+AAAIKAG YDIGI AG+ESMTVN++  +G VNP
Sbjct  120  YAGFPETVSLKTVNRQCSSGLQAVADIAAAIKAGLYDIGIAAGMESMTVNSVRLKGPVNP  179

Query  602  RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
            RA    QA++CLLPMG+TSE VA R+G+TR+EQDQ
Sbjct  180  RAEMFAQARDCLLPMGMTSEIVAQRYGITRREQDQ  214



>emb|CDY15520.1| BnaA08g28040D [Brassica napus]
Length=451

 Score =   300 bits (769),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 160/215 (74%), Positives = 181/215 (84%), Gaps = 3/215 (1%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  241
            A+ERQRVLL H           S ++S+S S C AG SAAYQR S+YGDD+VIVAA RT 
Sbjct  4    AMERQRVLLHH---LQPPLPSSSSQASLSVSACLAGGSAAYQRTSLYGDDVVIVAAQRTA  60

Query  242  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  421
            LCK+KRG FKDTYPD+LLASVL+A+IEKT L+PSEVGDI+VGTVL  GS +A+E RMAAF
Sbjct  61   LCKAKRGSFKDTYPDELLASVLRAVIEKTKLDPSEVGDIVVGTVLGSGSQKATEFRMAAF  120

Query  422  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  601
            YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMT +   W+GSVNP
Sbjct  121  YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTTSPRGWKGSVNP  180

Query  602  RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
            +    +QAQ+CLLPMGITSENVAHRFGV+R+EQDQ
Sbjct  181  KVQKFEQAQSCLLPMGITSENVAHRFGVSREEQDQ  215



>ref|XP_006307516.1| hypothetical protein CARUB_v10009140mg [Capsella rubella]
 gb|EOA40414.1| hypothetical protein CARUB_v10009140mg [Capsella rubella]
Length=315

 Score =   295 bits (754),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 154/215 (72%), Positives = 180/215 (84%), Gaps = 10/215 (5%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  241
            A+ERQRVLLQHL+P++++ S  S  + +          AAYQ  S YGDD+VIVAA RT 
Sbjct  4    AMERQRVLLQHLQPSSSSDSALSPSACL----------AAYQNTSKYGDDVVIVAAQRTA  53

Query  242  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  421
            +CK+KRG FKDTYPD+LLASVL+ALIEKTN+NPSEVGDI+VGTVL PGS RASECRMA+F
Sbjct  54   ICKAKRGSFKDTYPDELLASVLRALIEKTNVNPSEVGDIVVGTVLGPGSQRASECRMASF  113

Query  422  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  601
            YAGFP TVP+RTVNRQC+SGLQAVADVAAAIKAGFYDIGIGAGLESMT N   W+GSVNP
Sbjct  114  YAGFPLTVPIRTVNRQCASGLQAVADVAAAIKAGFYDIGIGAGLESMTTNPRGWKGSVNP  173

Query  602  RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
            +    +QA +CLLPMGITSENV+HRF ++R+EQDQ
Sbjct  174  KVKNFEQAHSCLLPMGITSENVSHRFNISREEQDQ  208



>ref|XP_010109695.1| 3-ketoacyl-CoA thiolase 2 [Morus notabilis]
 gb|EXC24165.1| 3-ketoacyl-CoA thiolase 2 [Morus notabilis]
Length=452

 Score =   299 bits (766),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 156/217 (72%), Positives = 184/217 (85%), Gaps = 5/217 (2%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  241
            A ERQRVLLQHL PT   SS  +  +S+SAS+CAAG S AYQR + +GDDIVIVAA RT 
Sbjct  4    AAERQRVLLQHLSPT---SSQTNDTASLSASICAAGQSGAYQRTAAFGDDIVIVAACRTA  60

Query  242  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  421
            +CK+KRGGFKDT  DDLLA+VLKA+IE+TNL+PSE+GDI+VGTVLAPGS+RA ECRMAA 
Sbjct  61   ICKAKRGGFKDTPVDDLLAAVLKAVIERTNLDPSEIGDIVVGTVLAPGSVRAIECRMAAI  120

Query  422  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSV--  595
            YAG P+TVPVRTVNRQCSSGLQAVAD+AA+IKAG+YDIGIGAG+E MT+++MA    V  
Sbjct  121  YAGIPDTVPVRTVNRQCSSGLQAVADIAASIKAGYYDIGIGAGVECMTIDSMALSEHVAK  180

Query  596  NPRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
            NPR     QA++CLLPMG+TSENVA R+GVTR+EQDQ
Sbjct  181  NPRLQVFTQARDCLLPMGMTSENVAERYGVTRREQDQ  217



>gb|KDO43600.1| hypothetical protein CISIN_1g012506mg [Citrus sinensis]
Length=438

 Score =   298 bits (763),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 159/215 (74%), Positives = 175/215 (81%), Gaps = 26/215 (12%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  241
            AI RQ+VLL+HLRP+N++S   + ES +SAS CAAGDSAAY R SVYGDD+VIVAAYRT 
Sbjct  4    AINRQQVLLEHLRPSNSSSH--NYESILSASACAAGDSAAYHRTSVYGDDVVIVAAYRTA  61

Query  242  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  421
            LCKSKRGGFKDTYPDDLLA VLKA+IEKTN++PSEVGDI+V                   
Sbjct  62   LCKSKRGGFKDTYPDDLLAPVLKAVIEKTNVDPSEVGDIVV-------------------  102

Query  422  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  601
                 ETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTVN MAWEGSVNP
Sbjct  103  -----ETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTVNPMAWEGSVNP  157

Query  602  RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
            +    +QAQNCLLPMG+TSENVAHRFGVTR+EQDQ
Sbjct  158  KVKAFEQAQNCLLPMGVTSENVAHRFGVTRKEQDQ  192



>gb|KFK42814.1| hypothetical protein AALP_AA1G042000 [Arabis alpina]
Length=439

 Score =   298 bits (762),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 160/215 (74%), Positives = 184/215 (86%), Gaps = 7/215 (3%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  241
            AIERQRVLL HL+P +++S+     +S+S S C AG++   QR S Y DD+VIVAA RT 
Sbjct  4    AIERQRVLLHHLQPLSSSSN----AASLSVSACFAGEN---QRTSQYEDDVVIVAAQRTA  56

Query  242  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  421
            LCK+KRG FKDTYPD+LLA VL+ALIEKT+LNPSEVGDI+VGTVL PGS RASECRMAAF
Sbjct  57   LCKAKRGSFKDTYPDELLAPVLRALIEKTHLNPSEVGDIVVGTVLGPGSQRASECRMAAF  116

Query  422  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  601
            YAGFPETVP+RTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMT N   W+GSVNP
Sbjct  117  YAGFPETVPIRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTTNPRGWKGSVNP  176

Query  602  RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
            +    +QA++CLLPMGITSENVAHRF V+R+EQD+
Sbjct  177  KVKKFEQAESCLLPMGITSENVAHRFDVSREEQDE  211



>gb|KHG13200.1| 3-ketoacyl-CoA thiolase 2, peroxisomal -like protein [Gossypium 
arboreum]
 gb|KHG18802.1| 3-ketoacyl-CoA thiolase 2, peroxisomal -like protein [Gossypium 
arboreum]
Length=454

 Score =   298 bits (762),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 158/216 (73%), Positives = 181/216 (84%), Gaps = 3/216 (1%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  241
            AI RQ+VLL HL+P++   S  S  + +  S CAAGDSAAY R + +GDD+VIVAA RT 
Sbjct  4    AINRQQVLLNHLQPSS--QSHQSPAAILFPSNCAAGDSAAYHRTAAFGDDVVIVAACRTA  61

Query  242  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  421
            +CK+KRGGFKDT  DDLLA VLKA+I++T LNPSEVGDI+VGTVLAPGS RASECRMAAF
Sbjct  62   ICKAKRGGFKDTLADDLLAPVLKAVIDRTKLNPSEVGDIVVGTVLAPGSQRASECRMAAF  121

Query  422  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGS-VN  598
            YAGFP+TVP+RTVNRQCSSGLQAVADVAA IKAGFYDIGIGAGLESMT N  A + S VN
Sbjct  122  YAGFPDTVPIRTVNRQCSSGLQAVADVAACIKAGFYDIGIGAGLESMTTNGSAPDQSKVN  181

Query  599  PRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
            P+  +  QA++CLLPMGITSENVA R+GVTRQEQDQ
Sbjct  182  PKVESFAQARDCLLPMGITSENVAQRYGVTRQEQDQ  217



>ref|XP_001762605.1| predicted protein [Physcomitrella patens]
 gb|EDQ72728.1| predicted protein [Physcomitrella patens]
Length=455

 Score =   297 bits (760),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 148/212 (70%), Positives = 179/212 (84%), Gaps = 9/212 (4%)
 Frame = +2

Query  71   RQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTPLCK  250
            RQ+VLL HL+P     +         +S+C+A DSA Y R + + DD+VIVAAYRT +C+
Sbjct  7    RQQVLLDHLKPETGRRA---------SSICSANDSAPYARTTDFLDDVVIVAAYRTAICR  57

Query  251  SKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAFYAG  430
            +KRGGFKDTYPDDLLA VL+A++EKT ++P+E+GDI++G+VLAPG+ RA+ECRMAAF+AG
Sbjct  58   AKRGGFKDTYPDDLLAPVLRAVVEKTGVSPAEIGDIVIGSVLAPGAQRANECRMAAFFAG  117

Query  431  FPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNPRAS  610
            FPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIG GLESMTVN MAWEGSVNPR  
Sbjct  118  FPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGGGLESMTVNPMAWEGSVNPRVE  177

Query  611  TLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
              Q+AQ+CLLPMGITSENVA R+GV R++QD+
Sbjct  178  ADQRAQDCLLPMGITSENVAERYGVGRRQQDE  209



>ref|XP_009384048.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Musa 
acuminata subsp. malaccensis]
Length=451

 Score =   296 bits (758),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 154/215 (72%), Positives = 179/215 (83%), Gaps = 6/215 (3%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  241
            AIERQR+LL HLRP+ +A        S+S +VC+A  SA   R+S +GDD+VIVAA RT 
Sbjct  4    AIERQRILLHHLRPSPSADP-----PSISTAVCSASGSAK-DRSSCFGDDVVIVAACRTA  57

Query  242  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  421
            LCK+++GGFKDTYPDDLLA VLKAL++KT LNPSEVGDIIVGTVLAPGS RA ECRM AF
Sbjct  58   LCKARKGGFKDTYPDDLLAPVLKALLDKTRLNPSEVGDIIVGTVLAPGSQRAIECRMGAF  117

Query  422  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  601
            YAGFP+TVP+RTVNRQCSSGLQAVAD+AAAIKAGFYD GIGAG+ESMTV+ + W+   NP
Sbjct  118  YAGFPDTVPLRTVNRQCSSGLQAVADIAAAIKAGFYDFGIGAGVESMTVDPVRWDWPANP  177

Query  602  RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
             A    QA++CLLPMGITSENVA R+G+TRQEQDQ
Sbjct  178  NAQLFAQARDCLLPMGITSENVAERYGITRQEQDQ  212



>ref|XP_010684942.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Beta vulgaris 
subsp. vulgaris]
Length=453

 Score =   296 bits (757),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 151/215 (70%), Positives = 175/215 (81%), Gaps = 4/215 (2%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  241
            A+ RQ+VLLQHL PT    S      + S SVC++GD   Y RN+ +GDD+VIVAA RTP
Sbjct  4    ALNRQKVLLQHLNPT----STRPHNVTFSTSVCSSGDDGTYHRNAAFGDDVVIVAACRTP  59

Query  242  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  421
            +CK+KRGGFKDT  DDLLA VLKALI+KTN+ PSEVGDI+VGTVLAPGS RA ECRMAAF
Sbjct  60   ICKAKRGGFKDTLADDLLAPVLKALIQKTNVKPSEVGDIVVGTVLAPGSARAMECRMAAF  119

Query  422  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  601
            YAGFP+TVP+RTVNRQCSSGLQAVADVAA IKAGFYDIGIGAG+ESMT++ +     +NP
Sbjct  120  YAGFPDTVPIRTVNRQCSSGLQAVADVAACIKAGFYDIGIGAGVESMTIDRVDGPRHINP  179

Query  602  RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
            +     QA++CLLPMGITSENVA  +GVTRQEQDQ
Sbjct  180  KVENFPQAKDCLLPMGITSENVAQYYGVTRQEQDQ  214



>ref|XP_010475137.1| PREDICTED: 3-ketoacyl-CoA thiolase 1, peroxisomal-like [Camelina 
sativa]
Length=446

 Score =   295 bits (755),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 155/214 (72%), Positives = 177/214 (83%), Gaps = 14/214 (7%)
 Frame = +2

Query  65   IERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTPL  244
            +ERQRVLLQHL+P++A         S+S S C A    +Y+R S+YGDD+VIVAA RT L
Sbjct  5    MERQRVLLQHLQPSDA---------SLSPSACLA----SYERTSLYGDDVVIVAAQRTAL  51

Query  245  CKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAFY  424
            CK+KRG FKDTYP+DLLASVL+ALIEKTN+NPSEVGDI+VGTVL PGS RA+ECRMAAFY
Sbjct  52   CKAKRGSFKDTYPEDLLASVLRALIEKTNVNPSEVGDIVVGTVLGPGSQRATECRMAAFY  111

Query  425  AGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNPR  604
            AGFP+TVP+RTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMT N   W+G     
Sbjct  112  AGFPQTVPIRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTTNPRGWKG-CKGT  170

Query  605  ASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
                +QA +CLLPMGITSENVAHRF V+R+EQDQ
Sbjct  171  VEKFEQAHSCLLPMGITSENVAHRFNVSREEQDQ  204



>gb|ACN29136.1| unknown [Zea mays]
 gb|AFW68658.1| hypothetical protein ZEAMMB73_512974 [Zea mays]
Length=461

 Score =   295 bits (756),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 149/215 (69%), Positives = 177/215 (82%), Gaps = 3/215 (1%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  241
            A++RQRVLL+HL   N A++      ++SAS CAAGDSAAY R   + DD+VIVAAYRT 
Sbjct  4    AVDRQRVLLRHL---NPAAAGSPAPPAISASACAAGDSAAYHRRPAFADDVVIVAAYRTA  60

Query  242  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  421
            +CK+KRGGFKDT+ +DLL  V KAL++KT L+PSEVGDI+VGTVLAPGS RA ECRMAA 
Sbjct  61   ICKAKRGGFKDTFAEDLLVPVFKALVDKTKLDPSEVGDIVVGTVLAPGSQRAIECRMAAL  120

Query  422  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  601
            YAGFP+TVP++TVNRQCSSGLQAVADVA AIKAG YDIGI AGLESMTVN ++ +G  NP
Sbjct  121  YAGFPDTVPLKTVNRQCSSGLQAVADVATAIKAGLYDIGIAAGLESMTVNKVSLDGQANP  180

Query  602  RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
            +     QA++CLLPMG+TSENVAHRFG+TR EQDQ
Sbjct  181  KVELFSQARDCLLPMGLTSENVAHRFGITRLEQDQ  215



>gb|EYU17978.1| hypothetical protein MIMGU_mgv1a005895mg [Erythranthe guttata]
Length=466

 Score =   295 bits (756),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 153/218 (70%), Positives = 178/218 (82%), Gaps = 4/218 (2%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  241
            A  RQ++LL HLRPT++   L S + S+S +VC AGDSAAY R   +GDDIVIVAAYRT 
Sbjct  4    AANRQKILLDHLRPTSSVPHLIS-QPSLSRAVCLAGDSAAYHRTPAFGDDIVIVAAYRTA  62

Query  242  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  421
            LCKS RGGFKDT PDDLLA+VLKALI++TNLNP+EVGDI+VGTVLAPGS+RA ECRMAA 
Sbjct  63   LCKSTRGGFKDTLPDDLLAAVLKALIDRTNLNPAEVGDIVVGTVLAPGSLRAIECRMAAL  122

Query  422  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGS---  592
            YAGFP+ VP+RTVNRQCSSGLQAVADVAA IKAG+YDIGI AGLESMT +      +   
Sbjct  123  YAGFPDKVPIRTVNRQCSSGLQAVADVAAFIKAGYYDIGIAAGLESMTADFATSANTIEK  182

Query  593  VNPRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
            +NP+     QA++CLLPMG TSENVA R+GVTR+EQDQ
Sbjct  183  INPKVEAFPQARDCLLPMGATSENVAERYGVTREEQDQ  220



>ref|XP_002467133.1| hypothetical protein SORBIDRAFT_01g020150 [Sorghum bicolor]
 gb|EER94131.1| hypothetical protein SORBIDRAFT_01g020150 [Sorghum bicolor]
Length=462

 Score =   295 bits (755),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 153/215 (71%), Positives = 178/215 (83%), Gaps = 2/215 (1%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  241
            AI+RQRVLL+HL P  AA S      ++SAS CAAGDSAAY R   + DD+VIVAAYRT 
Sbjct  4    AIDRQRVLLRHLSPAAAAES--PAPPAISASACAAGDSAAYHRTPAFADDVVIVAAYRTA  61

Query  242  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  421
            +CK+KRGGFKDT+ +DLL  V KAL++KT L+PSEVGDI+VGTVLAPGS RA ECRMAA 
Sbjct  62   ICKAKRGGFKDTFAEDLLVPVFKALVDKTKLDPSEVGDIVVGTVLAPGSQRAIECRMAAL  121

Query  422  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  601
            YAGFP+TVP++TVNRQCSSGLQAVADVA AIKAG YDIGI AGLESMTVN ++ +G VNP
Sbjct  122  YAGFPDTVPLKTVNRQCSSGLQAVADVATAIKAGLYDIGIAAGLESMTVNKVSLDGQVNP  181

Query  602  RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
            +     QA++CLLPMG+TSENVAHRFG+TR EQDQ
Sbjct  182  KVELFSQARDCLLPMGLTSENVAHRFGITRLEQDQ  216



>ref|XP_006307517.1| hypothetical protein CARUB_v10009140mg [Capsella rubella]
 gb|EOA40415.1| hypothetical protein CARUB_v10009140mg [Capsella rubella]
Length=444

 Score =   294 bits (753),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 154/215 (72%), Positives = 180/215 (84%), Gaps = 10/215 (5%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  241
            A+ERQRVLLQHL+P++++ S  S  + +          AAYQ  S YGDD+VIVAA RT 
Sbjct  4    AMERQRVLLQHLQPSSSSDSALSPSACL----------AAYQNTSKYGDDVVIVAAQRTA  53

Query  242  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  421
            +CK+KRG FKDTYPD+LLASVL+ALIEKTN+NPSEVGDI+VGTVL PGS RASECRMA+F
Sbjct  54   ICKAKRGSFKDTYPDELLASVLRALIEKTNVNPSEVGDIVVGTVLGPGSQRASECRMASF  113

Query  422  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  601
            YAGFP TVP+RTVNRQC+SGLQAVADVAAAIKAGFYDIGIGAGLESMT N   W+GSVNP
Sbjct  114  YAGFPLTVPIRTVNRQCASGLQAVADVAAAIKAGFYDIGIGAGLESMTTNPRGWKGSVNP  173

Query  602  RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
            +    +QA +CLLPMGITSENV+HRF ++R+EQDQ
Sbjct  174  KVKNFEQAHSCLLPMGITSENVSHRFNISREEQDQ  208



>gb|EMS48058.1| 3-ketoacyl-CoA thiolase 2, peroxisomal [Triticum urartu]
Length=453

 Score =   294 bits (752),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 144/186 (77%), Positives = 168/186 (90%), Gaps = 0/186 (0%)
 Frame = +2

Query  149  ASVCAAGDSAAYQRNSVYGDDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKT  328
            AS CAAGDSAAYQR+S +GDD+VIVAAYRTP+CK+KRGGFKDTYP+DLL  VLKA+++KT
Sbjct  36   ASACAAGDSAAYQRSSCFGDDVVIVAAYRTPICKAKRGGFKDTYPEDLLTPVLKAVLDKT  95

Query  329  NLNPSEVGDIIVGTVLAPGSIRASECRMAAFYAGFPETVPVRTVNRQCSSGLQavadvaa  508
             +NP+++GD++VGTVL PGS RA ECR A+  AG PETVPVRTVNRQCSSGLQAVADVAA
Sbjct  96   GINPAQIGDVVVGTVLGPGSQRAIECRTASLLAGIPETVPVRTVNRQCSSGLQAVADVAA  155

Query  509  aikaGFYDIGIGAGLESMTVNTMAWEGSVNPRASTLQQAQNCLLPMGITSENVAHRFGVT  688
            AIKAGFYDIGIGAGLESM+VN++ WEG VNPR   LQ+AQ+CLLPMGITSENVA R+GVT
Sbjct  156  AIKAGFYDIGIGAGLESMSVNSVGWEGQVNPRVIELQKAQDCLLPMGITSENVAQRYGVT  215

Query  689  RQEQDQ  706
            R+EQD+
Sbjct  216  REEQDK  221



>ref|XP_002521123.1| 3-ketoacyl-CoA thiolase B, putative [Ricinus communis]
 gb|EEF41274.1| 3-ketoacyl-CoA thiolase B, putative [Ricinus communis]
Length=467

 Score =   294 bits (752),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 157/218 (72%), Positives = 184/218 (84%), Gaps = 3/218 (1%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSV--SASVCAAGDSAAYQRNSVYGDDIVIVAAYR  235
            A+ RQ++LL HL+P++  SSL   + SV  S S+CAAGDS AY R + + DD+VIVAAYR
Sbjct  4    AVNRQKILLGHLQPSSPLSSLSQTQESVRLSTSICAAGDSTAYHRTAAFNDDVVIVAAYR  63

Query  236  TPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMA  415
            T +CKSKR GFKDT+PDDLL SVLKALIEKTN+NP+EVGDI+VGTVLAPGS+RA+ECRMA
Sbjct  64   TAICKSKRRGFKDTHPDDLLGSVLKALIEKTNVNPNEVGDIVVGTVLAPGSVRATECRMA  123

Query  416  AFYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTV-NTMAWEGS  592
            AF+AGFPETVP+RTVNRQCSSGLQAVADVAA+IKAGFYDIGIGAGLE MT+ N  +    
Sbjct  124  AFFAGFPETVPIRTVNRQCSSGLQAVADVAASIKAGFYDIGIGAGLECMTLDNIRSTPSQ  183

Query  593  VNPRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
             NPR  +  QA++CLLPMGITSENVA R+GVTR EQDQ
Sbjct  184  PNPRVESFTQARDCLLPMGITSENVAQRYGVTRLEQDQ  221



>gb|KJB10129.1| hypothetical protein B456_001G185200 [Gossypium raimondii]
Length=371

 Score =   290 bits (743),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 152/216 (70%), Positives = 179/216 (83%), Gaps = 1/216 (0%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  241
            A+ RQRVLL HLRP++++SS     +++  S CAAGDSAAY R + +GDD+VIVAA RT 
Sbjct  4    ALNRQRVLLHHLRPSSSSSSSHESAATLFPSNCAAGDSAAYHRTAAFGDDVVIVAACRTA  63

Query  242  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  421
            +CK+KRGGFKDT  DDLLA VLKALI++T L+PSEV DI+VGTVLAPGS R  ECRMAAF
Sbjct  64   ICKAKRGGFKDTLADDLLAPVLKALIDRTKLDPSEVSDIVVGTVLAPGSQRGIECRMAAF  123

Query  422  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMA-WEGSVN  598
            YAGFP+TVP+RTVNRQCSSGLQAVADVAA+IKAGFYDIGIGAGLESMT + +      VN
Sbjct  124  YAGFPDTVPIRTVNRQCSSGLQAVADVAASIKAGFYDIGIGAGLESMTTDKVVPGVPKVN  183

Query  599  PRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
            P+  +  QA++CLLPMGITSENVA  +GVTRQEQDQ
Sbjct  184  PKVESFAQARDCLLPMGITSENVAEHYGVTRQEQDQ  219



>gb|AAB80634.1| Strong similarity to Cucumis acetyl-CoA acyltransferase (gb|D70895) 
[Arabidopsis thaliana]
Length=460

 Score =   292 bits (747),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 162/225 (72%), Positives = 184/225 (82%), Gaps = 20/225 (9%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  241
            A ERQR+LL+HL+P++++ +      S+SAS C + DSAAYQ    YGDD+VIVAA RT 
Sbjct  4    ATERQRILLRHLQPSSSSDA------SLSASACLSKDSAAYQ----YGDDVVIVAAQRTA  53

Query  242  LCKSKRGGFKDTYPDDLLASVLK---ALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRM  412
            LCK+KRG FKDT+PD+LLASVL+   ALIEKTN+NPSEVGDI+VGTVL PGS RASECRM
Sbjct  54   LCKAKRGSFKDTFPDELLASVLRVCLALIEKTNVNPSEVGDIVVGTVLGPGSQRASECRM  113

Query  413  AAFYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDI-------GIGAGLESMTVN  571
            AAFYAGFPETVP+RTVNRQCSSGLQAVADVAAAIKAGFYDI       GIGAGLESMT N
Sbjct  114  AAFYAGFPETVPIRTVNRQCSSGLQAVADVAAAIKAGFYDIGKIVTIFGIGAGLESMTTN  173

Query  572  TMAWEGSVNPRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
               W+GSVNP     +QA NCLLPMGITSENVAHRF V+R+EQDQ
Sbjct  174  PRGWKGSVNPNVKKFEQAHNCLLPMGITSENVAHRFNVSREEQDQ  218



>gb|KCW50170.1| hypothetical protein EUGRSUZ_K03601 [Eucalyptus grandis]
Length=406

 Score =   290 bits (742),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 160/217 (74%), Positives = 186/217 (86%), Gaps = 2/217 (1%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSI--ESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYR  235
            A++RQRVLL+HL+P+ ++ S       + VSAS CAAGD AAYQR + +GDD+VIVAAYR
Sbjct  4    ALDRQRVLLRHLQPSPSSGSPSHTPQSACVSASACAAGDLAAYQRTASFGDDVVIVAAYR  63

Query  236  TPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMA  415
            T +CKS+RGGFKDT P+DLLA VL+A++EKTNLNP+EVGDI+VGTVLAPGS R  ECRMA
Sbjct  64   TAICKSRRGGFKDTLPEDLLAPVLRAVVEKTNLNPAEVGDIVVGTVLAPGSQRGIECRMA  123

Query  416  AFYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSV  595
            AFYAGFPETVP+RTVNRQCSSGLQAVADVAA+IKAGFYDIGIGAGLESMTV+ +     V
Sbjct  124  AFYAGFPETVPLRTVNRQCSSGLQAVADVAASIKAGFYDIGIGAGLESMTVDQVRAVPKV  183

Query  596  NPRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
            NPR  +  QA++CLLPMGITSENVA RFGVTRQEQDQ
Sbjct  184  NPRVHSFAQARDCLLPMGITSENVAQRFGVTRQEQDQ  220



>gb|KCW50169.1| hypothetical protein EUGRSUZ_K03601 [Eucalyptus grandis]
Length=406

 Score =   290 bits (741),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 160/217 (74%), Positives = 186/217 (86%), Gaps = 2/217 (1%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSI--ESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYR  235
            A++RQRVLL+HL+P+ ++ S       + VSAS CAAGD AAYQR + +GDD+VIVAAYR
Sbjct  4    ALDRQRVLLRHLQPSPSSGSPSHTPQSACVSASACAAGDLAAYQRTASFGDDVVIVAAYR  63

Query  236  TPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMA  415
            T +CKS+RGGFKDT P+DLLA VL+A++EKTNLNP+EVGDI+VGTVLAPGS R  ECRMA
Sbjct  64   TAICKSRRGGFKDTLPEDLLAPVLRAVVEKTNLNPAEVGDIVVGTVLAPGSQRGIECRMA  123

Query  416  AFYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSV  595
            AFYAGFPETVP+RTVNRQCSSGLQAVADVAA+IKAGFYDIGIGAGLESMTV+ +     V
Sbjct  124  AFYAGFPETVPLRTVNRQCSSGLQAVADVAASIKAGFYDIGIGAGLESMTVDQVRAVPKV  183

Query  596  NPRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
            NPR  +  QA++CLLPMGITSENVA RFGVTRQEQDQ
Sbjct  184  NPRVHSFAQARDCLLPMGITSENVAQRFGVTRQEQDQ  220



>ref|XP_010918893.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Elaeis 
guineensis]
Length=460

 Score =   291 bits (745),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 153/215 (71%), Positives = 184/215 (86%), Gaps = 4/215 (2%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  241
            AI RQRVLLQHLRP++ +        +++ S+CAAGDSAAYQR+S +GDD+VIVAA RT 
Sbjct  4    AINRQRVLLQHLRPSSGSDD----RPALTTSICAAGDSAAYQRSSCFGDDVVIVAACRTA  59

Query  242  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  421
            +CKS RGGFK+T+P+DLLA +LKAL++KT +NPSEVGDI+VGTVLAPGS RA ECRMAAF
Sbjct  60   ICKSNRGGFKNTHPEDLLAPLLKALLDKTKVNPSEVGDIVVGTVLAPGSQRAIECRMAAF  119

Query  422  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  601
            YAGFPETVP+RTVNRQCSSGLQAVAD+AAAIK+GFY+IGI AG+ESMTV+ + W G  NP
Sbjct  120  YAGFPETVPLRTVNRQCSSGLQAVADIAAAIKSGFYEIGIAAGMESMTVDKIGWIGQTNP  179

Query  602  RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
            RA    QA++CLLPMG+TSE VA R+G+TRQEQDQ
Sbjct  180  RAEMFAQAKDCLLPMGMTSEIVAERYGITRQEQDQ  214



>ref|XP_003632434.2| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Vitis 
vinifera]
 emb|CBI37268.3| unnamed protein product [Vitis vinifera]
Length=443

 Score =   290 bits (743),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 155/216 (72%), Positives = 182/216 (84%), Gaps = 3/216 (1%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSI-ESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRT  238
            AI RQRVLL+HLRP++++ S   I ESS+SAS+C AG+ A    +S  GDDIV+VAA RT
Sbjct  4    AINRQRVLLEHLRPSSSSPSPSPINESSLSASICLAGNRATNPVDS--GDDIVVVAACRT  61

Query  239  PLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAA  418
             +CK+KRGGFKDT PDD+LA VLKALIEKTN++PSEVGDI+VGTVLAPGS RA ECRMAA
Sbjct  62   AICKAKRGGFKDTLPDDILAPVLKALIEKTNVDPSEVGDIVVGTVLAPGSQRAIECRMAA  121

Query  419  FYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVN  598
            FYAGFP+TVP+RTVNRQCSSGLQAV DV AAI+AG YDIGIGAGLESMT + +A   +VN
Sbjct  122  FYAGFPDTVPIRTVNRQCSSGLQAVVDVVAAIRAGLYDIGIGAGLESMTTDNIAGVTTVN  181

Query  599  PRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
            P+     QA++CLLPMG+TSENVA R+GVTRQEQDQ
Sbjct  182  PKVDIFAQARDCLLPMGLTSENVAKRYGVTRQEQDQ  217



>ref|XP_004982961.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Setaria 
italica]
Length=461

 Score =   290 bits (743),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 151/215 (70%), Positives = 180/215 (84%), Gaps = 3/215 (1%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  241
            AI+RQR+LL+HL   + A++      ++SAS CAAGDSAAY R + + DD+VIVAAYRT 
Sbjct  4    AIDRQRILLRHL---DPAAAPSPAPPAISASACAAGDSAAYHRRAAFADDVVIVAAYRTA  60

Query  242  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  421
            +CK+KRGGFKDT+ +DLL  VLKAL++KT LNPSEVGDI+VGTVLAPGS RA ECRMAA 
Sbjct  61   ICKAKRGGFKDTFAEDLLVPVLKALVDKTKLNPSEVGDIVVGTVLAPGSQRAIECRMAAL  120

Query  422  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  601
            YAGFP+TVP++TVNRQCSSGLQAVADVAAAIKAG YDIGI AGLESMTVN ++ +  VNP
Sbjct  121  YAGFPDTVPLKTVNRQCSSGLQAVADVAAAIKAGLYDIGIAAGLESMTVNKVSLDSQVNP  180

Query  602  RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
            +     QA++CLLPMG+TSENVAHRFG+TR EQDQ
Sbjct  181  KVELFSQARDCLLPMGLTSENVAHRFGITRLEQDQ  215



>gb|KJB10128.1| hypothetical protein B456_001G185200 [Gossypium raimondii]
Length=465

 Score =   290 bits (741),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 152/216 (70%), Positives = 179/216 (83%), Gaps = 1/216 (0%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  241
            A+ RQRVLL HLRP++++SS     +++  S CAAGDSAAY R + +GDD+VIVAA RT 
Sbjct  4    ALNRQRVLLHHLRPSSSSSSSHESAATLFPSNCAAGDSAAYHRTAAFGDDVVIVAACRTA  63

Query  242  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  421
            +CK+KRGGFKDT  DDLLA VLKALI++T L+PSEV DI+VGTVLAPGS R  ECRMAAF
Sbjct  64   ICKAKRGGFKDTLADDLLAPVLKALIDRTKLDPSEVSDIVVGTVLAPGSQRGIECRMAAF  123

Query  422  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMA-WEGSVN  598
            YAGFP+TVP+RTVNRQCSSGLQAVADVAA+IKAGFYDIGIGAGLESMT + +      VN
Sbjct  124  YAGFPDTVPIRTVNRQCSSGLQAVADVAASIKAGFYDIGIGAGLESMTTDKVVPGVPKVN  183

Query  599  PRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
            P+  +  QA++CLLPMGITSENVA  +GVTRQEQDQ
Sbjct  184  PKVESFAQARDCLLPMGITSENVAEHYGVTRQEQDQ  219



>ref|XP_010038353.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Eucalyptus 
grandis]
 ref|XP_010038354.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Eucalyptus 
grandis]
 gb|KCW50167.1| hypothetical protein EUGRSUZ_K03601 [Eucalyptus grandis]
 gb|KCW50168.1| hypothetical protein EUGRSUZ_K03601 [Eucalyptus grandis]
Length=466

 Score =   289 bits (740),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 160/217 (74%), Positives = 186/217 (86%), Gaps = 2/217 (1%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSI--ESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYR  235
            A++RQRVLL+HL+P+ ++ S       + VSAS CAAGD AAYQR + +GDD+VIVAAYR
Sbjct  4    ALDRQRVLLRHLQPSPSSGSPSHTPQSACVSASACAAGDLAAYQRTASFGDDVVIVAAYR  63

Query  236  TPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMA  415
            T +CKS+RGGFKDT P+DLLA VL+A++EKTNLNP+EVGDI+VGTVLAPGS R  ECRMA
Sbjct  64   TAICKSRRGGFKDTLPEDLLAPVLRAVVEKTNLNPAEVGDIVVGTVLAPGSQRGIECRMA  123

Query  416  AFYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSV  595
            AFYAGFPETVP+RTVNRQCSSGLQAVADVAA+IKAGFYDIGIGAGLESMTV+ +     V
Sbjct  124  AFYAGFPETVPLRTVNRQCSSGLQAVADVAASIKAGFYDIGIGAGLESMTVDQVRAVPKV  183

Query  596  NPRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
            NPR  +  QA++CLLPMGITSENVA RFGVTRQEQDQ
Sbjct  184  NPRVHSFAQARDCLLPMGITSENVAQRFGVTRQEQDQ  220



>gb|KCW50166.1| hypothetical protein EUGRSUZ_K03601 [Eucalyptus grandis]
Length=474

 Score =   288 bits (737),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 160/217 (74%), Positives = 186/217 (86%), Gaps = 2/217 (1%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSI--ESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYR  235
            A++RQRVLL+HL+P+ ++ S       + VSAS CAAGD AAYQR + +GDD+VIVAAYR
Sbjct  4    ALDRQRVLLRHLQPSPSSGSPSHTPQSACVSASACAAGDLAAYQRTASFGDDVVIVAAYR  63

Query  236  TPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMA  415
            T +CKS+RGGFKDT P+DLLA VL+A++EKTNLNP+EVGDI+VGTVLAPGS R  ECRMA
Sbjct  64   TAICKSRRGGFKDTLPEDLLAPVLRAVVEKTNLNPAEVGDIVVGTVLAPGSQRGIECRMA  123

Query  416  AFYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSV  595
            AFYAGFPETVP+RTVNRQCSSGLQAVADVAA+IKAGFYDIGIGAGLESMTV+ +     V
Sbjct  124  AFYAGFPETVPLRTVNRQCSSGLQAVADVAASIKAGFYDIGIGAGLESMTVDQVRAVPKV  183

Query  596  NPRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
            NPR  +  QA++CLLPMGITSENVA RFGVTRQEQDQ
Sbjct  184  NPRVHSFAQARDCLLPMGITSENVAQRFGVTRQEQDQ  220



>ref|XP_002889522.1| hypothetical protein ARALYDRAFT_470458 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65781.1| hypothetical protein ARALYDRAFT_470458 [Arabidopsis lyrata subsp. 
lyrata]
Length=419

 Score =   286 bits (732),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 146/186 (78%), Positives = 162/186 (87%), Gaps = 4/186 (2%)
 Frame = +2

Query  149  ASVCAAGDSAAYQRNSVYGDDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKT  328
            AS C A +SAAYQ    YGDD+VIVAA RTPLCK+KRG FKDTYPD+LLASVL+ LIEKT
Sbjct  1    ASPCLAKESAAYQ----YGDDVVIVAAQRTPLCKAKRGSFKDTYPDELLASVLRGLIEKT  56

Query  329  NLNPSEVGDIIVGTVLAPGSIRASECRMAAFYAGFPETVPVRTVNRQCSSGLQavadvaa  508
            N+NPSEVGDI+VGTVL PGS RASECRMAAFYAGFPETVP+R VNRQCSSGLQAVADVAA
Sbjct  57   NVNPSEVGDIVVGTVLGPGSQRASECRMAAFYAGFPETVPIRIVNRQCSSGLQAVADVAA  116

Query  509  aikaGFYDIGIGAGLESMTVNTMAWEGSVNPRASTLQQAQNCLLPMGITSENVAHRFGVT  688
            AI+AGFYDIGIGAGLESMT N   W+G VNP+    +QA +CLLPMGITSENVA+RF V+
Sbjct  117  AIRAGFYDIGIGAGLESMTTNPRGWKGPVNPKVKKFEQAHSCLLPMGITSENVANRFNVS  176

Query  689  RQEQDQ  706
            R+EQDQ
Sbjct  177  REEQDQ  182



>gb|KJB42404.1| hypothetical protein B456_007G152600 [Gossypium raimondii]
Length=453

 Score =   287 bits (734),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 154/216 (71%), Positives = 180/216 (83%), Gaps = 3/216 (1%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  241
            AI RQ+VLL HL+P++ +    +  + +  S CAAGDSAAY R + +GDD+VIVAA RT 
Sbjct  4    AINRQQVLLNHLQPSSQSHQSSA--AILFPSNCAAGDSAAYHRTAAFGDDVVIVAACRTA  61

Query  242  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  421
            +CK+KRGGFKDT  DDLLA VL+A+I++T LNPSEVGDI+VGTVLAPGS RA ECRMAAF
Sbjct  62   ICKAKRGGFKDTLADDLLAPVLRAVIDRTKLNPSEVGDIVVGTVLAPGSQRAMECRMAAF  121

Query  422  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGS-VN  598
            YAGFP+TVP+RTVNRQCSSGLQAVADVAA IKAGFYDIGIGAGLESMT N  A + S VN
Sbjct  122  YAGFPDTVPIRTVNRQCSSGLQAVADVAACIKAGFYDIGIGAGLESMTTNGSAPDQSKVN  181

Query  599  PRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
            P+  +  QA++CLLPMGITSENVA R+GVTRQEQDQ
Sbjct  182  PKVKSFAQARDCLLPMGITSENVAQRYGVTRQEQDQ  217



>gb|KJB42405.1| hypothetical protein B456_007G152600 [Gossypium raimondii]
Length=454

 Score =   287 bits (734),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 154/216 (71%), Positives = 180/216 (83%), Gaps = 3/216 (1%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  241
            AI RQ+VLL HL+P++ +    +  + +  S CAAGDSAAY R + +GDD+VIVAA RT 
Sbjct  4    AINRQQVLLNHLQPSSQSHQSSA--AILFPSNCAAGDSAAYHRTAAFGDDVVIVAACRTA  61

Query  242  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  421
            +CK+KRGGFKDT  DDLLA VL+A+I++T LNPSEVGDI+VGTVLAPGS RA ECRMAAF
Sbjct  62   ICKAKRGGFKDTLADDLLAPVLRAVIDRTKLNPSEVGDIVVGTVLAPGSQRAMECRMAAF  121

Query  422  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGS-VN  598
            YAGFP+TVP+RTVNRQCSSGLQAVADVAA IKAGFYDIGIGAGLESMT N  A + S VN
Sbjct  122  YAGFPDTVPIRTVNRQCSSGLQAVADVAACIKAGFYDIGIGAGLESMTTNGSAPDQSKVN  181

Query  599  PRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
            P+  +  QA++CLLPMGITSENVA R+GVTRQEQDQ
Sbjct  182  PKVKSFAQARDCLLPMGITSENVAQRYGVTRQEQDQ  217



>ref|XP_007225741.1| hypothetical protein PRUPE_ppa005421mg [Prunus persica]
 gb|EMJ26940.1| hypothetical protein PRUPE_ppa005421mg [Prunus persica]
Length=429

 Score =   286 bits (732),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 144/216 (67%), Positives = 161/216 (75%), Gaps = 36/216 (17%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIE-SSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRT  238
            A  RQRVLL HLRP+  +SSL   + SS+SAS C AGDSAAY R +V+GDD+VIVAAYRT
Sbjct  4    AFNRQRVLLDHLRPS--SSSLHGTDPSSLSASACVAGDSAAYARKNVFGDDVVIVAAYRT  61

Query  239  PLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAA  418
            P+CK+KRGGFKDT+ DDLLA VLKA+IEK+NLNPSEVGDI+VGTVLAPGS RASECRMAA
Sbjct  62   PICKAKRGGFKDTHADDLLAPVLKAVIEKSNLNPSEVGDIVVGTVLAPGSQRASECRMAA  121

Query  419  FYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVN  598
            FYAGFP                                 GIGAGLESMT N MAWEGSVN
Sbjct  122  FYAGFP---------------------------------GIGAGLESMTANPMAWEGSVN  148

Query  599  PRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
            P+    +QAQNCLLPMG+TSENVAHRFGV+RQEQDQ
Sbjct  149  PKVKIFEQAQNCLLPMGVTSENVAHRFGVSRQEQDQ  184



>ref|XP_006662414.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Oryza 
brachyantha]
Length=460

 Score =   287 bits (734),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 149/215 (69%), Positives = 173/215 (80%), Gaps = 5/215 (2%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  241
            AI RQRVLL HL P    ++      + +AS CAAGDSAAY R + + DD+VIVAAYRT 
Sbjct  4    AINRQRVLLAHLEPAATPAA-----PAFTASACAAGDSAAYHRGACFADDVVIVAAYRTA  58

Query  242  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  421
            +CKSKRGGFKDT  +DLL  V KALI+KT LNPSEVGDI+VGTVLAPGS RA ECRMAAF
Sbjct  59   ICKSKRGGFKDTPAEDLLVPVFKALIDKTKLNPSEVGDIVVGTVLAPGSQRAIECRMAAF  118

Query  422  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  601
            YAGFP+TVP+ TVNRQCSSGLQAV++VA+ IKAG YDIGI AGLESMTVN ++ +G +NP
Sbjct  119  YAGFPDTVPLMTVNRQCSSGLQAVSNVASNIKAGLYDIGIAAGLESMTVNKVSLDGQLNP  178

Query  602  RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
            +     QA++CLLPMG+TSENVA RFGVTR EQDQ
Sbjct  179  KVELFSQARDCLLPMGLTSENVAKRFGVTRMEQDQ  213



>ref|XP_007153157.1| hypothetical protein PHAVU_003G011600g [Phaseolus vulgaris]
 gb|ESW25151.1| hypothetical protein PHAVU_003G011600g [Phaseolus vulgaris]
Length=445

 Score =   286 bits (732),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 152/218 (70%), Positives = 183/218 (84%), Gaps = 4/218 (2%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSI---ESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAY  232
            AI+RQRVLL+HL+P++++S+        + +SAS C AG+S+  QR     DD+VIVAAY
Sbjct  4    AIQRQRVLLEHLQPSSSSSNFSHQTHQSTDLSASSCFAGNSSHGQRGGSE-DDVVIVAAY  62

Query  233  RTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRM  412
            RT +CK+KRGGFKDT PDDLLA+VLKA+IEKTN++P+EVGDI+VGTVLAPGS R  ECRM
Sbjct  63   RTAICKAKRGGFKDTLPDDLLATVLKAVIEKTNVDPAEVGDIVVGTVLAPGSDRGIECRM  122

Query  413  AAFYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGS  592
            AAFYAGFPETVP+RTVNRQCSSGLQAVADVAA IKAGFYDIGIGAGLESM+ +T+    +
Sbjct  123  AAFYAGFPETVPLRTVNRQCSSGLQAVADVAAYIKAGFYDIGIGAGLESMSYDTVNRLSN  182

Query  593  VNPRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
            +NP+  T  QA++CLLPMGITSENVA R+GVTR EQDQ
Sbjct  183  INPKVETFAQARDCLLPMGITSENVAQRYGVTRLEQDQ  220



>ref|XP_003604976.1| 3-ketoacyl-CoA thiolase 2, peroxisomal [Medicago truncatula]
 gb|AES87173.1| 3-ketoacyl-CoA thiolase 2, peroxisomal-like protein [Medicago 
truncatula]
Length=435

 Score =   285 bits (730),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 151/215 (70%), Positives = 175/215 (81%), Gaps = 8/215 (4%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  241
            A+ERQRVLLQHL P +  SS  S  + +SAS+C+AG +   +      +D+VIVAAYRT 
Sbjct  4    AVERQRVLLQHLNPNSVTSSHHS--THLSASLCSAGQTGGSE------NDVVIVAAYRTA  55

Query  242  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  421
            +CK+KRGGFKDT PDDLLASVLKA+IEKTN+ PSEVGDI+VGTVL PGS RA ECRMAAF
Sbjct  56   ICKAKRGGFKDTLPDDLLASVLKAVIEKTNVEPSEVGDIVVGTVLGPGSERAIECRMAAF  115

Query  422  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  601
            YAGFP+TVP+RTVNRQCSSGLQAVADVAA IKAGFYDIGIGAGLE MT +T++     NP
Sbjct  116  YAGFPDTVPLRTVNRQCSSGLQAVADVAAYIKAGFYDIGIGAGLECMTQDTISGVRKTNP  175

Query  602  RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
            +     QA++CLL MGITSENVA R+GVTRQEQDQ
Sbjct  176  KVEIFAQARDCLLSMGITSENVAQRYGVTRQEQDQ  210



>ref|XP_004506590.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Cicer 
arietinum]
Length=440

 Score =   285 bits (730),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 150/218 (69%), Positives = 179/218 (82%), Gaps = 9/218 (4%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSI---ESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAY  232
            AIERQRVLL+HL+P ++ S+  S     + +SAS C+AG +   +      +D+VIVAAY
Sbjct  4    AIERQRVLLEHLQPNSSNSAFLSHTHQSTDLSASFCSAGQTGGSE------NDVVIVAAY  57

Query  233  RTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRM  412
            RT +CK+KRGGFKDT PDDLLA VLKA+IEKTN+ PSEVGDIIVGTVL PGS +A+ECRM
Sbjct  58   RTAICKAKRGGFKDTLPDDLLAPVLKAVIEKTNVEPSEVGDIIVGTVLGPGSEKATECRM  117

Query  413  AAFYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGS  592
            AAFYAGFPETVP+RTVNRQCSSGLQAVADVAA IKAGFYDIGIGAGLE M+ + ++   +
Sbjct  118  AAFYAGFPETVPLRTVNRQCSSGLQAVADVAAYIKAGFYDIGIGAGLECMSQDNISRLRN  177

Query  593  VNPRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
            +NP+  T  QA++CLLPMGITSENVA R+GVTRQEQDQ
Sbjct  178  INPKVETFAQARDCLLPMGITSENVAERYGVTRQEQDQ  215



>ref|XP_009796305.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like isoform 
X2 [Nicotiana sylvestris]
Length=462

 Score =   286 bits (731),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 143/185 (77%), Positives = 163/185 (88%), Gaps = 0/185 (0%)
 Frame = +2

Query  152  SVCAAGDSAAYQRNSVYGDDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKTN  331
            S+C AGDSAAYQR + +GDD+VIVAAYRT +CK+KRGGFK+T  DDLLA VLKA++EKTN
Sbjct  32   SICLAGDSAAYQRTAAFGDDVVIVAAYRTAICKAKRGGFKNTLADDLLAPVLKAVVEKTN  91

Query  332  LNPSEVGDIIVGTVLAPGSIRASECRMAAFYAGFPETVPVRTVNRQCSSGLQavadvaaa  511
            L+P+EVGDI+VGTVLAPGS+RA ECRMAAFYAGFPETVP+RTVNRQCSSGLQAVADVAA+
Sbjct  92   LSPNEVGDIVVGTVLAPGSLRAMECRMAAFYAGFPETVPIRTVNRQCSSGLQAVADVAAS  151

Query  512  ikaGFYDIGIGAGLESMTVNTMAWEGSVNPRASTLQQAQNCLLPMGITSENVAHRFGVTR  691
            IKAGFYDIGIGAGLE MTV+ +     VNP+     QA++CLLPMGITSENVA RFGVTR
Sbjct  152  IKAGFYDIGIGAGLELMTVDNIGRVQQVNPKVDAFAQARDCLLPMGITSENVAQRFGVTR  211

Query  692  QEQDQ  706
             EQDQ
Sbjct  212  LEQDQ  216



>ref|NP_001064764.1| Os10g0457600 [Oryza sativa Japonica Group]
 gb|AAK54299.1|AC034258_17 putative thiolase [Oryza sativa Japonica Group]
 gb|AAP54100.1| 3-ketoacyl-CoA thiolase 2, peroxisomal precursor, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF26678.1| Os10g0457600 [Oryza sativa Japonica Group]
 gb|EAZ16317.1| hypothetical protein OsJ_31778 [Oryza sativa Japonica Group]
 dbj|BAG92981.1| unnamed protein product [Oryza sativa Japonica Group]
Length=461

 Score =   285 bits (730),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 150/215 (70%), Positives = 174/215 (81%), Gaps = 3/215 (1%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  241
            AI RQRVLL HL P  + ++      +++AS CAAGDSAAY R + + DD+VIVAAYRT 
Sbjct  4    AINRQRVLLAHLEPAASPAAA---APAITASACAAGDSAAYHRGACFADDVVIVAAYRTA  60

Query  242  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  421
            +CKSKRGGFKDT  +DLL  V KALI+KT LNPSEVGDI+VGTVLAPGS RA ECRMAAF
Sbjct  61   ICKSKRGGFKDTPAEDLLVPVFKALIDKTKLNPSEVGDIVVGTVLAPGSQRAIECRMAAF  120

Query  422  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  601
            YAGFP+TVP+ TVNRQCSSGLQAVA+VA+ IKAG YDIGI AGLESMTVN +  +G VNP
Sbjct  121  YAGFPDTVPLMTVNRQCSSGLQAVANVASNIKAGLYDIGIAAGLESMTVNQVRLDGQVNP  180

Query  602  RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
            +     QA++CLLPMG+TSENVA RFG+TR EQDQ
Sbjct  181  KVELFSQARDCLLPMGLTSENVAKRFGITRMEQDQ  215



>gb|EEC67095.1| hypothetical protein OsI_33888 [Oryza sativa Indica Group]
Length=461

 Score =   285 bits (729),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 150/215 (70%), Positives = 174/215 (81%), Gaps = 3/215 (1%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  241
            AI RQRVLL HL P  + ++      +++AS CAAGDSAAY R + + DD+VIVAAYRT 
Sbjct  4    AINRQRVLLAHLEPAASPAAA---APAITASACAAGDSAAYHRGACFADDVVIVAAYRTA  60

Query  242  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  421
            +CKSKRGGFKDT  +DLL  V KALI+KT LNPSEVGDI+VGTVLAPGS RA ECRMAAF
Sbjct  61   ICKSKRGGFKDTPAEDLLVPVFKALIDKTKLNPSEVGDIVVGTVLAPGSQRAIECRMAAF  120

Query  422  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  601
            YAGFP+TVP+ TVNRQCSSGLQAVA+VA+ IKAG YDIGI AGLESMTVN +  +G VNP
Sbjct  121  YAGFPDTVPLMTVNRQCSSGLQAVANVASNIKAGLYDIGIAAGLESMTVNQVRLDGQVNP  180

Query  602  RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
            +     QA++CLLPMG+TSENVA RFG+TR EQDQ
Sbjct  181  KVELFSQARDCLLPMGLTSENVAKRFGITRMEQDQ  215



>gb|AFK40880.1| unknown [Medicago truncatula]
Length=435

 Score =   282 bits (721),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 149/215 (69%), Positives = 173/215 (80%), Gaps = 8/215 (4%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  241
            A+ERQRVLLQHL P +  SS  S  + +SAS+C+AG +   +      +D+VIVAAYRT 
Sbjct  4    AVERQRVLLQHLNPNSVTSSHHS--THLSASLCSAGQTGGSE------NDVVIVAAYRTA  55

Query  242  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  421
            +CK+KRGGFKDT PDDLLASVLKA+IEKTN+ PSEVGDI+VGTVL PGS RA ECRMAAF
Sbjct  56   ICKAKRGGFKDTLPDDLLASVLKAVIEKTNVEPSEVGDIVVGTVLGPGSERAIECRMAAF  115

Query  422  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  601
            YAGFP+T P+RTVNRQCSSGLQAVADVAA IKAGFYDIGIGAGLE MT +T++     NP
Sbjct  116  YAGFPDTAPLRTVNRQCSSGLQAVADVAAYIKAGFYDIGIGAGLECMTQDTISGVRKTNP  175

Query  602  RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
            +     QA++CLL MGITSENV  R+GVTRQEQDQ
Sbjct  176  KVEIFAQARDCLLSMGITSENVTQRYGVTRQEQDQ  210



>gb|KHN15993.1| 3-ketoacyl-CoA thiolase 2, peroxisomal [Glycine soja]
Length=445

 Score =   282 bits (722),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 151/218 (69%), Positives = 183/218 (84%), Gaps = 4/218 (2%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSI---ESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAY  232
            AI+RQRVLL+HL+P +++S+  S     + +SAS+C AG+S+  Q      DD+VIVAAY
Sbjct  4    AIQRQRVLLEHLQPISSSSNFSSQTHQSTDLSASLCFAGNSSHGQTGG-SDDDVVIVAAY  62

Query  233  RTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRM  412
            RT +CK+KRGGFKDT PDDLLA+VLKA+IEKTN++P+EVGDI+VGTVLAPGS R  ECRM
Sbjct  63   RTAICKAKRGGFKDTLPDDLLATVLKAVIEKTNVDPAEVGDIVVGTVLAPGSDRGIECRM  122

Query  413  AAFYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGS  592
            AAFYAGFPETVP+RTVNRQCSSGLQAV+DVAA IKAGFYDIGIGAGLESMTV+ +    +
Sbjct  123  AAFYAGFPETVPLRTVNRQCSSGLQAVSDVAAYIKAGFYDIGIGAGLESMTVDRVNRLPN  182

Query  593  VNPRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
            +NP+  T  +A++CLLPMGITSENVA R+GVTR EQDQ
Sbjct  183  INPKVETFAEARDCLLPMGITSENVAQRYGVTRLEQDQ  220



>ref|NP_001242568.1| uncharacterized protein LOC100789930 [Glycine max]
 gb|ACU23006.1| unknown [Glycine max]
Length=445

 Score =   281 bits (719),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 151/218 (69%), Positives = 183/218 (84%), Gaps = 4/218 (2%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSI---ESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAY  232
            AI+RQRVLL+HL+P +++S+  S     + +SAS+C AG+S+  Q      DD+VIVAAY
Sbjct  4    AIQRQRVLLEHLQPISSSSNFSSQTHQSTDLSASLCFAGNSSHGQTGG-SDDDVVIVAAY  62

Query  233  RTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRM  412
            RT +CK+KRGGFKDT PDDLLA+VLKA+IEKTN++P+EVGDI+VGTVLAPGS R  ECRM
Sbjct  63   RTAICKAKRGGFKDTPPDDLLATVLKAVIEKTNVDPAEVGDIVVGTVLAPGSDRGIECRM  122

Query  413  AAFYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGS  592
            AAFYAGFPETVP+RTVNRQCSSGLQAV+DVAA IKAGFYDIGIGAGLESMTV+ +    +
Sbjct  123  AAFYAGFPETVPLRTVNRQCSSGLQAVSDVAAYIKAGFYDIGIGAGLESMTVDRVNRLPN  182

Query  593  VNPRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
            +NP+  T  +A++CLLPMGITSENVA R+GVTR EQDQ
Sbjct  183  INPKVETFAEARDCLLPMGITSENVAQRYGVTRLEQDQ  220



>ref|XP_004506669.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Cicer 
arietinum]
Length=440

 Score =   281 bits (718),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 148/218 (68%), Positives = 175/218 (80%), Gaps = 9/218 (4%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSI---ESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAY  232
            AIERQRVLL+HL+P ++ S   S     + +SAS C+AG +   +      +D+VIVAAY
Sbjct  4    AIERQRVLLEHLQPNSSNSVFLSHTHQSTDLSASFCSAGQTGGSE------NDVVIVAAY  57

Query  233  RTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRM  412
            RT +CK+KRGGFKDT PDDLLA VLKA+IEKTN+ PSEVGDI+VGTVL PGS +A+ECRM
Sbjct  58   RTAICKAKRGGFKDTLPDDLLAPVLKAVIEKTNVEPSEVGDIVVGTVLGPGSEKATECRM  117

Query  413  AAFYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGS  592
            AAFYAGFPETVP+RTVNRQCSSGLQAVADVAA IKAGFYDIGIGAGLE M+ + +     
Sbjct  118  AAFYAGFPETVPLRTVNRQCSSGLQAVADVAACIKAGFYDIGIGAGLECMSQDNILRHRK  177

Query  593  VNPRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
             NP+  T  +A++CLLPMGITSENVA R+GVTRQEQDQ
Sbjct  178  TNPKVETFAKARDCLLPMGITSENVAERYGVTRQEQDQ  215



>gb|KHG11493.1| 3-ketoacyl-CoA thiolase 2, peroxisomal -like protein [Gossypium 
arboreum]
Length=463

 Score =   281 bits (719),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 151/216 (70%), Positives = 178/216 (82%), Gaps = 2/216 (1%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  241
            A+ RQRVLL HLRP++++SS     +++  S CAAGDSAAY R + +GDD+VIVAA RT 
Sbjct  4    ALNRQRVLLHHLRPSSSSSSH-ESAAALFPSNCAAGDSAAYHRTAAFGDDVVIVAACRTA  62

Query  242  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  421
            +CK+KRGGFKDT  DDLLA VLKALI++T L+PSEV DI+VGTVLAPGS R  ECRMAAF
Sbjct  63   ICKAKRGGFKDTLADDLLAPVLKALIDRTKLDPSEVSDIVVGTVLAPGSQRGIECRMAAF  122

Query  422  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMA-WEGSVN  598
            YAGFP+TVP+RTVNRQCSSGLQAVADVAA+IKAGFYDIGIGAGLESMT + +      VN
Sbjct  123  YAGFPDTVPIRTVNRQCSSGLQAVADVAASIKAGFYDIGIGAGLESMTTDKVVPGVPKVN  182

Query  599  PRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
             +  +  QA++CLLPMGITSENVA  +GVTRQEQDQ
Sbjct  183  AKVESFAQARDCLLPMGITSENVAEHYGVTRQEQDQ  218



>ref|XP_009336047.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Pyrus 
x bretschneideri]
Length=443

 Score =   280 bits (717),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 139/215 (65%), Positives = 176/215 (82%), Gaps = 0/215 (0%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  241
            A+ +Q+VLLQHLRP ++ SS +   + +SAS+CAAGDSAAY R + +   I++  AYRT 
Sbjct  4    AMNKQKVLLQHLRPNSSVSSSNYESAPLSASICAAGDSAAYHRTAAFAVKIMLNRAYRTA  63

Query  242  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  421
            +CK+KRGGFKDT PDDLL  VLKA+IE+TNLNPS V D++VGTV+APGS+RA+E RM AF
Sbjct  64   ICKAKRGGFKDTLPDDLLPPVLKAVIERTNLNPSAVADVVVGTVMAPGSLRATESRMVAF  123

Query  422  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  601
            YA FP+TVP+RTVNRQCSSGLQAV DVAA+IKAG+YDIGI AG+ES+TV+ +     +NP
Sbjct  124  YASFPDTVPIRTVNRQCSSGLQAVFDVAASIKAGYYDIGIAAGVESLTVDKLGRSRKINP  183

Query  602  RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
            +     QA++CLLPMGITSENVA R+GVTR+EQD+
Sbjct  184  KVDIFAQARDCLLPMGITSENVAQRYGVTREEQDR  218



>ref|XP_010547051.1| PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxisomal isoform X2 
[Tarenaya hassleriana]
Length=468

 Score =   279 bits (713),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 143/218 (66%), Positives = 183/218 (84%), Gaps = 4/218 (2%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAA--SSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYR  235
            AI+RQR+LL+HL P +++  S +D   + +SA  CAAGD +AY   + +GDDIVIVAA+R
Sbjct  4    AIDRQRILLRHLNPVSSSLSSRIDHDPAILSAVNCAAGDFSAYSPMAAFGDDIVIVAAHR  63

Query  236  TPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMA  415
            T +CK++RGGFKDT  DDLLA+VLKA++E+T+L+PSEVGDI+VGTV+APGS RA ECR+A
Sbjct  64   TAICKARRGGFKDTLADDLLATVLKAMVERTSLDPSEVGDIVVGTVIAPGSQRAMECRVA  123

Query  416  AFYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEG--  589
            A+YAGFP++VP+RTVNRQCSSGLQAVADVAA+IKAGFYDIGI AG+ESM+ + +A  G  
Sbjct  124  AYYAGFPDSVPIRTVNRQCSSGLQAVADVAASIKAGFYDIGIAAGVESMSTDHVAGGGFR  183

Query  590  SVNPRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQD  703
             VNP+     +A++CLLPMGITSENVA R+GVTR+EQD
Sbjct  184  VVNPKVEDFPKARDCLLPMGITSENVAERYGVTREEQD  221



>ref|XP_010547050.1| PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxisomal isoform X1 
[Tarenaya hassleriana]
Length=474

 Score =   279 bits (713),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 143/218 (66%), Positives = 183/218 (84%), Gaps = 4/218 (2%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAA--SSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYR  235
            AI+RQR+LL+HL P +++  S +D   + +SA  CAAGD +AY   + +GDDIVIVAA+R
Sbjct  4    AIDRQRILLRHLNPVSSSLSSRIDHDPAILSAVNCAAGDFSAYSPMAAFGDDIVIVAAHR  63

Query  236  TPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMA  415
            T +CK++RGGFKDT  DDLLA+VLKA++E+T+L+PSEVGDI+VGTV+APGS RA ECR+A
Sbjct  64   TAICKARRGGFKDTLADDLLATVLKAMVERTSLDPSEVGDIVVGTVIAPGSQRAMECRVA  123

Query  416  AFYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEG--  589
            A+YAGFP++VP+RTVNRQCSSGLQAVADVAA+IKAGFYDIGI AG+ESM+ + +A  G  
Sbjct  124  AYYAGFPDSVPIRTVNRQCSSGLQAVADVAASIKAGFYDIGIAAGVESMSTDHVAGGGFR  183

Query  590  SVNPRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQD  703
             VNP+     +A++CLLPMGITSENVA R+GVTR+EQD
Sbjct  184  VVNPKVEDFPKARDCLLPMGITSENVAERYGVTREEQD  221



>ref|NP_001237076.1| 3-ketoacyl-CoA thiolase [Glycine max]
 ref|XP_006605407.1| PREDICTED: 3-ketoacyl-CoA thiolase isoform X1 [Glycine max]
 gb|AAQ93070.1| 3-ketoacyl-CoA thiolase [Glycine max]
 gb|KHM99006.1| 3-ketoacyl-CoA thiolase 2, peroxisomal [Glycine soja]
Length=445

 Score =   278 bits (710),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 150/218 (69%), Positives = 181/218 (83%), Gaps = 4/218 (2%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSI---ESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAY  232
            AI+RQRVLL HL+P +++S+  S     + +SAS+C A +S+  Q      DD+VIVAAY
Sbjct  4    AIQRQRVLLDHLQPISSSSNFSSQTHQSTDLSASLCFAKNSSHGQIGG-SDDDVVIVAAY  62

Query  233  RTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRM  412
            RT +CK+KRGGFKDT PDDLLA+VLKA+IEKTN+NP+EVGDI+VGTVLAPGS R  ECRM
Sbjct  63   RTAICKAKRGGFKDTLPDDLLATVLKAVIEKTNVNPAEVGDIVVGTVLAPGSDRGIECRM  122

Query  413  AAFYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGS  592
            AAFYAGFPETVP+RTVNRQCSSGLQAV+DVAA IKAGFY+IGIGAGLESMTV+ +    +
Sbjct  123  AAFYAGFPETVPLRTVNRQCSSGLQAVSDVAAYIKAGFYEIGIGAGLESMTVDRVNRLRN  182

Query  593  VNPRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
            +NP+  T  +A++CLLPMGITSENVA R+GVTR EQDQ
Sbjct  183  INPKVETFAEARDCLLPMGITSENVAQRYGVTRLEQDQ  220



>ref|XP_008454505.1| PREDICTED: 3-ketoacyl-CoA thiolase 1, peroxisomal-like isoform 
X2 [Cucumis melo]
Length=461

 Score =   276 bits (706),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 149/217 (69%), Positives = 185/217 (85%), Gaps = 7/217 (3%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAA--YQRNSVYGDDIVIVAAYR  235
            A+ RQ+VLLQHL+P++++ S     +S+S SVCAAG+SA+  Y R + +GDDIVIVAA R
Sbjct  13   ALNRQKVLLQHLQPSSSSGS-----ASLSTSVCAAGESASNSYHRTAAFGDDIVIVAANR  67

Query  236  TPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMA  415
            T +C++K+GGFKDT  +DLLASVLKA+IEKT LNP EVGDI+VGTVLAPGSIRASECRMA
Sbjct  68   TAICRAKKGGFKDTPAEDLLASVLKAVIEKTKLNPIEVGDIVVGTVLAPGSIRASECRMA  127

Query  416  AFYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSV  595
            AF AGFP+TV +RTVNRQCSSGLQAVADVAAAIK G+YDIGIGAGLE M++N + +  S 
Sbjct  128  AFCAGFPDTVSIRTVNRQCSSGLQAVADVAAAIKVGYYDIGIGAGLECMSINDIEFAVSD  187

Query  596  NPRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
            +P  + +QQA++C+LPMGITSENVA ++GVTR+EQDQ
Sbjct  188  SPNVNGIQQARDCMLPMGITSENVAQQYGVTREEQDQ  224



>ref|XP_007049827.1| Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 3 [Theobroma cacao]
 gb|EOX93984.1| Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 3 [Theobroma cacao]
Length=376

 Score =   273 bits (699),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 146/221 (66%), Positives = 176/221 (80%), Gaps = 6/221 (3%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSA-----SVCAAGDSAAYQRNSVYGDDIVIVA  226
            A+ RQR+LL HLRP++++S      ++ +A     S+CAAGD +AY   + + +D+VIVA
Sbjct  4    ALNRQRILLHHLRPSSSSSHQSFDSAAAAAAALFPSICAAGDGSAYHGTAAFANDVVIVA  63

Query  227  AYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASEC  406
            A RT +CK+KRGGFKDT  DDLLA VLKALI++T LNPSEVGDI+VGTVLAPGS R  EC
Sbjct  64   ACRTAICKAKRGGFKDTPADDLLAPVLKALIDRTKLNPSEVGDIVVGTVLAPGSQRGIEC  123

Query  407  RMAAFYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWE  586
            RMAAFYAGFP+TVP++TVNRQCSSGLQAVADVA  IKAG YDIGI AGLESMT + +   
Sbjct  124  RMAAFYAGFPDTVPIKTVNRQCSSGLQAVADVALCIKAGLYDIGIAAGLESMTTDKVVPG  183

Query  587  GS-VNPRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
             S VNP+  +  QA++CLLPMGITSENVA R+GVTRQEQDQ
Sbjct  184  VSKVNPQVESFAQARDCLLPMGITSENVAQRYGVTRQEQDQ  224



>ref|XP_007049828.1| Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 4 [Theobroma cacao]
 gb|EOX93985.1| Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 4 [Theobroma cacao]
Length=374

 Score =   273 bits (697),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 146/221 (66%), Positives = 176/221 (80%), Gaps = 6/221 (3%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSA-----SVCAAGDSAAYQRNSVYGDDIVIVA  226
            A+ RQR+LL HLRP++++S      ++ +A     S+CAAGD +AY   + + +D+VIVA
Sbjct  4    ALNRQRILLHHLRPSSSSSHQSFDSAAAAAAALFPSICAAGDGSAYHGTAAFANDVVIVA  63

Query  227  AYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASEC  406
            A RT +CK+KRGGFKDT  DDLLA VLKALI++T LNPSEVGDI+VGTVLAPGS R  EC
Sbjct  64   ACRTAICKAKRGGFKDTPADDLLAPVLKALIDRTKLNPSEVGDIVVGTVLAPGSQRGIEC  123

Query  407  RMAAFYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWE  586
            RMAAFYAGFP+TVP++TVNRQCSSGLQAVADVA  IKAG YDIGI AGLESMT + +   
Sbjct  124  RMAAFYAGFPDTVPIKTVNRQCSSGLQAVADVALCIKAGLYDIGIAAGLESMTTDKVVPG  183

Query  587  GS-VNPRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
             S VNP+  +  QA++CLLPMGITSENVA R+GVTRQEQDQ
Sbjct  184  VSKVNPQVESFAQARDCLLPMGITSENVAQRYGVTRQEQDQ  224



>ref|XP_008454504.1| PREDICTED: 3-ketoacyl-CoA thiolase 1, peroxisomal-like isoform 
X1 [Cucumis melo]
Length=502

 Score =   276 bits (705),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 149/217 (69%), Positives = 185/217 (85%), Gaps = 7/217 (3%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAA--YQRNSVYGDDIVIVAAYR  235
            A+ RQ+VLLQHL+P++++ S     +S+S SVCAAG+SA+  Y R + +GDDIVIVAA R
Sbjct  54   ALNRQKVLLQHLQPSSSSGS-----ASLSTSVCAAGESASNSYHRTAAFGDDIVIVAANR  108

Query  236  TPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMA  415
            T +C++K+GGFKDT  +DLLASVLKA+IEKT LNP EVGDI+VGTVLAPGSIRASECRMA
Sbjct  109  TAICRAKKGGFKDTPAEDLLASVLKAVIEKTKLNPIEVGDIVVGTVLAPGSIRASECRMA  168

Query  416  AFYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSV  595
            AF AGFP+TV +RTVNRQCSSGLQAVADVAAAIK G+YDIGIGAGLE M++N + +  S 
Sbjct  169  AFCAGFPDTVSIRTVNRQCSSGLQAVADVAAAIKVGYYDIGIGAGLECMSINDIEFAVSD  228

Query  596  NPRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
            +P  + +QQA++C+LPMGITSENVA ++GVTR+EQDQ
Sbjct  229  SPNVNGIQQARDCMLPMGITSENVAQQYGVTREEQDQ  265



>ref|XP_004152018.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Cucumis 
sativus]
 ref|XP_004163039.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Cucumis 
sativus]
 gb|KGN58339.1| hypothetical protein Csa_3G624070 [Cucumis sativus]
Length=452

 Score =   272 bits (696),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 148/217 (68%), Positives = 182/217 (84%), Gaps = 7/217 (3%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAA--YQRNSVYGDDIVIVAAYR  235
            A  RQ+VLLQHL+P++++ S     +S+S SVC AG+SA+  Y R + +GDDIVIVAA R
Sbjct  4    AFNRQKVLLQHLQPSSSSES-----ASLSTSVCVAGESASNSYHRTAAFGDDIVIVAANR  58

Query  236  TPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMA  415
            T +C++K+GGFKDT  +DLLASVLKA+IEKT LNP EVGDI+VGTVLAPGSIRASECRMA
Sbjct  59   TAICRAKKGGFKDTPAEDLLASVLKAVIEKTKLNPIEVGDIVVGTVLAPGSIRASECRMA  118

Query  416  AFYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSV  595
            AF AGFP+TV +RTVNRQCSSGLQAVADVAAAIK G+YDIGIGAGLE M++N + +  S 
Sbjct  119  AFCAGFPDTVSIRTVNRQCSSGLQAVADVAAAIKVGYYDIGIGAGLECMSINDIEFAVSD  178

Query  596  NPRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
            NP  + + QA++C+LPMGITSENVA ++GVTR+EQDQ
Sbjct  179  NPNLNGIPQARDCMLPMGITSENVAQQYGVTREEQDQ  215



>ref|XP_006280441.1| hypothetical protein CARUB_v10026373mg [Capsella rubella]
 gb|EOA13339.1| hypothetical protein CARUB_v10026373mg [Capsella rubella]
Length=457

 Score =   272 bits (696),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 142/216 (66%), Positives = 181/216 (84%), Gaps = 5/216 (2%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  241
            A ERQ++LL+HL P ++ SS  + E +V +SV  A + +     + +GDDIVIVAAYRT 
Sbjct  4    AAERQKILLRHLNPISSFSSSLNHEPTVLSSVNCASEVSPM---AAFGDDIVIVAAYRTA  60

Query  242  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  421
            +CK+KRGGFKDT PDDLLASVLKA++E+T+L+PSEVGDI+VGTVLAPGS RA ECR+AA+
Sbjct  61   ICKAKRGGFKDTLPDDLLASVLKAVVERTSLDPSEVGDIVVGTVLAPGSQRAMECRVAAY  120

Query  422  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEG--SV  595
            +AGFP++VP+RTVNRQCSSGLQAVADVAA+IKAG+YDIGIGAG+ESM+ + M+  G  + 
Sbjct  121  FAGFPDSVPIRTVNRQCSSGLQAVADVAASIKAGYYDIGIGAGVESMSTDHMSGGGFQAS  180

Query  596  NPRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQD  703
            NPRA    +A++CLLPMG+TSENVA R+GVTR+EQD
Sbjct  181  NPRAQNFPKARDCLLPMGVTSENVAERYGVTREEQD  216



>ref|XP_007049825.1| Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 1 [Theobroma cacao]
 gb|EOX93982.1| Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 1 [Theobroma cacao]
Length=470

 Score =   272 bits (696),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 146/221 (66%), Positives = 176/221 (80%), Gaps = 6/221 (3%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSA-----SVCAAGDSAAYQRNSVYGDDIVIVA  226
            A+ RQR+LL HLRP++++S      ++ +A     S+CAAGD +AY   + + +D+VIVA
Sbjct  4    ALNRQRILLHHLRPSSSSSHQSFDSAAAAAAALFPSICAAGDGSAYHGTAAFANDVVIVA  63

Query  227  AYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASEC  406
            A RT +CK+KRGGFKDT  DDLLA VLKALI++T LNPSEVGDI+VGTVLAPGS R  EC
Sbjct  64   ACRTAICKAKRGGFKDTPADDLLAPVLKALIDRTKLNPSEVGDIVVGTVLAPGSQRGIEC  123

Query  407  RMAAFYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWE  586
            RMAAFYAGFP+TVP++TVNRQCSSGLQAVADVA  IKAG YDIGI AGLESMT + +   
Sbjct  124  RMAAFYAGFPDTVPIKTVNRQCSSGLQAVADVALCIKAGLYDIGIAAGLESMTTDKVVPG  183

Query  587  GS-VNPRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
             S VNP+  +  QA++CLLPMGITSENVA R+GVTRQEQDQ
Sbjct  184  VSKVNPQVESFAQARDCLLPMGITSENVAQRYGVTRQEQDQ  224



>ref|XP_007049826.1| Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 2 [Theobroma cacao]
 gb|EOX93983.1| Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 2 [Theobroma cacao]
Length=472

 Score =   272 bits (696),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 146/221 (66%), Positives = 176/221 (80%), Gaps = 6/221 (3%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSA-----SVCAAGDSAAYQRNSVYGDDIVIVA  226
            A+ RQR+LL HLRP++++S      ++ +A     S+CAAGD +AY   + + +D+VIVA
Sbjct  4    ALNRQRILLHHLRPSSSSSHQSFDSAAAAAAALFPSICAAGDGSAYHGTAAFANDVVIVA  63

Query  227  AYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASEC  406
            A RT +CK+KRGGFKDT  DDLLA VLKALI++T LNPSEVGDI+VGTVLAPGS R  EC
Sbjct  64   ACRTAICKAKRGGFKDTPADDLLAPVLKALIDRTKLNPSEVGDIVVGTVLAPGSQRGIEC  123

Query  407  RMAAFYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWE  586
            RMAAFYAGFP+TVP++TVNRQCSSGLQAVADVA  IKAG YDIGI AGLESMT + +   
Sbjct  124  RMAAFYAGFPDTVPIKTVNRQCSSGLQAVADVALCIKAGLYDIGIAAGLESMTTDKVVPG  183

Query  587  GS-VNPRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
             S VNP+  +  QA++CLLPMGITSENVA R+GVTRQEQDQ
Sbjct  184  VSKVNPQVESFAQARDCLLPMGITSENVAQRYGVTRQEQDQ  224



>ref|XP_006395129.1| hypothetical protein EUTSA_v10004174mg [Eutrema salsugineum]
 gb|ESQ32415.1| hypothetical protein EUTSA_v10004174mg [Eutrema salsugineum]
Length=460

 Score =   271 bits (694),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 139/216 (64%), Positives = 179/216 (83%), Gaps = 2/216 (1%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  241
            A ERQ++LL+HL P  ++SS  ++     A + A   ++ +   + +GDDIVIVAAYRT 
Sbjct  4    ATERQKILLRHLNPIYSSSSSLTLIKDEPALLSAVNCASEFSPMAAFGDDIVIVAAYRTA  63

Query  242  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  421
            +CK+KRGGFKDT PDDLLASVLKA++E+T+L+PSEVGDI+VGTV+APGS RA ECR+AA+
Sbjct  64   ICKAKRGGFKDTRPDDLLASVLKAVVERTSLDPSEVGDIVVGTVIAPGSQRAMECRVAAY  123

Query  422  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEG--SV  595
            +AGFP+TVP+RTVNRQCSSGLQAVADVAA+I+AG+Y+IGIGAG+ESM+++  A  G  S 
Sbjct  124  FAGFPDTVPIRTVNRQCSSGLQAVADVAASIRAGYYEIGIGAGVESMSIDHTAGGGFQST  183

Query  596  NPRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQD  703
            NPRA    +A++CLLPMGITSENVA R+GVTR+EQD
Sbjct  184  NPRAQDFPKARDCLLPMGITSENVAERYGVTREEQD  219



>gb|EMS60447.1| 3-ketoacyl-CoA thiolase 2, peroxisomal [Triticum urartu]
Length=435

 Score =   270 bits (690),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 146/215 (68%), Positives = 170/215 (79%), Gaps = 3/215 (1%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  241
            A++RQR+LL+HL P   AS   S  S+   +   AGDSAAY R   + DD+VIVAAYRT 
Sbjct  4    ALDRQRILLRHLEPAAGASPAASAVSASVCA---AGDSAAYHRGPCFADDVVIVAAYRTA  60

Query  242  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  421
            +CK+KRG FKDT P+DLL  V KAL++KT LNPSEVGDI+VGTVLAPGS RA ECRMAA 
Sbjct  61   ICKAKRGSFKDTLPEDLLVPVFKALVDKTKLNPSEVGDIVVGTVLAPGSQRAIECRMAAL  120

Query  422  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  601
            YAGFP+TVP++TVNRQCSSGLQAVADVAAAIKAG YDIGI AG+ESMTVN +     VNP
Sbjct  121  YAGFPDTVPLKTVNRQCSSGLQAVADVAAAIKAGMYDIGIAAGVESMTVNKVNLVEKVNP  180

Query  602  RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
            +     QA++CLLPMG+TSENVA RFG+TR EQDQ
Sbjct  181  KVELFAQARDCLLPMGLTSENVAQRFGITRMEQDQ  215



>ref|XP_002865685.1| KAT5/PKT1/PKT2 peroxisomal 3-keto-acyl-CoA thiolase [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH41944.1| KAT5/PKT1/PKT2 peroxisomal 3-keto-acyl-CoA thiolase [Arabidopsis 
lyrata subsp. lyrata]
Length=457

 Score =   269 bits (687),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 140/216 (65%), Positives = 180/216 (83%), Gaps = 5/216 (2%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  241
            A+ERQ++LL+HL P ++ +S  + E S+ + V  A + +     + +GDDIVIVAAYRT 
Sbjct  4    AVERQKILLRHLNPISSTNSSLNHEPSLFSLVNCASEVSPM---AAFGDDIVIVAAYRTA  60

Query  242  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  421
            +CK++RGGFKDT PDDLLASVLKA++E+T+L+PSEVGDI+VGTV+APGS RA ECR+AA+
Sbjct  61   ICKARRGGFKDTLPDDLLASVLKAVVERTSLDPSEVGDIVVGTVIAPGSQRAMECRVAAY  120

Query  422  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEG--SV  595
            +AGFP+TVPVRTVNRQCSSGLQAVADVAA+I+AG+YDIGIGAG+ESM+ + +   G  + 
Sbjct  121  FAGFPDTVPVRTVNRQCSSGLQAVADVAASIRAGYYDIGIGAGVESMSTDHIPGGGFHAS  180

Query  596  NPRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQD  703
            NPRA    +A++CLLPMGITSENVA RFGVTR+EQD
Sbjct  181  NPRAQDFPKARDCLLPMGITSENVAERFGVTREEQD  216



>ref|XP_003574006.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Brachypodium 
distachyon]
Length=453

 Score =   268 bits (686),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 148/215 (69%), Positives = 173/215 (80%), Gaps = 11/215 (5%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  241
            A++RQR+LL+HL P   A+  +   S++SAS CAAG          + DD+VIVAAYRT 
Sbjct  4    ALDRQRILLRHLEP---AAGPNPAASAISASACAAG--------GCFADDVVIVAAYRTA  52

Query  242  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  421
            +CKSKRGGFKDT P+DLL  V KAL++KT LNPSE+GDI+VGTVLAPGS RA ECRMAA 
Sbjct  53   ICKSKRGGFKDTLPEDLLVPVFKALVDKTKLNPSEIGDIVVGTVLAPGSQRAIECRMAAL  112

Query  422  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  601
            YAGFP+TVP+RTVNRQCSSGLQAVADVAAAIKAG YDIGI AGLESMTVN ++ EG VNP
Sbjct  113  YAGFPDTVPLRTVNRQCSSGLQAVADVAAAIKAGMYDIGIAAGLESMTVNKVSLEGQVNP  172

Query  602  RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
            +     QA++CLLPMG+TSENVA RFG+TR EQDQ
Sbjct  173  KVELFSQARDCLLPMGLTSENVAKRFGITRVEQDQ  207



>ref|NP_568704.2| 3-keto-acyl-CoA thiolase 2 [Arabidopsis thaliana]
 ref|NP_001032037.1| 3-keto-acyl-CoA thiolase 2 [Arabidopsis thaliana]
 sp|Q570C8.2|THIK5_ARATH RecName: Full=3-ketoacyl-CoA thiolase 5, peroxisomal; AltName: 
Full=Acetyl-CoA acyltransferase 5; AltName: Full=Beta-ketothiolase 
5; AltName: Full=Peroxisomal 3-oxoacyl-CoA thiolase 
5; Flags: Precursor [Arabidopsis thaliana]
 gb|AAC17877.1| 3-keto-acyl-CoA thiolase 2 [Arabidopsis thaliana]
 gb|AAC23571.1| peroxisomal 3-keto-acyl-CoA thiolase 2 precursor [Arabidopsis 
thaliana]
 dbj|BAB09441.1| 3-keto-acyl-CoA thiolase 2 [Arabidopsis thaliana]
 gb|AAL84980.1| AT5g48880/K24G6_22 [Arabidopsis thaliana]
 gb|AED95737.1| 3-keto-acyl-CoA thiolase 2 [Arabidopsis thaliana]
 gb|AED95738.1| 3-keto-acyl-CoA thiolase 2 [Arabidopsis thaliana]
Length=457

 Score =   267 bits (682),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 139/217 (64%), Positives = 180/217 (83%), Gaps = 7/217 (3%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  241
            A+ERQ++LL+HL P ++++S    E S+ + V    + +     + +GDDIVIVAAYRT 
Sbjct  4    AMERQKILLRHLNPVSSSNSSLKHEPSLLSPVNCVSEVSPM---AAFGDDIVIVAAYRTA  60

Query  242  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  421
            +CK++RGGFKDT PDDLLASVLKA++E+T+L+PSEVGDI+VGTV+APGS RA ECR+AA+
Sbjct  61   ICKARRGGFKDTLPDDLLASVLKAVVERTSLDPSEVGDIVVGTVIAPGSQRAMECRVAAY  120

Query  422  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTM---AWEGS  592
            +AGFP++VPVRTVNRQCSSGLQAVADVAA+I+AG+YDIGIGAG+ESM+ + +    + GS
Sbjct  121  FAGFPDSVPVRTVNRQCSSGLQAVADVAASIRAGYYDIGIGAGVESMSTDHIPGGGFHGS  180

Query  593  VNPRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQD  703
             NPRA    +A++CLLPMGITSENVA RFGVTR+EQD
Sbjct  181  -NPRAQDFPKARDCLLPMGITSENVAERFGVTREEQD  216



>ref|XP_010439766.1| PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxisomal isoform X1 
[Camelina sativa]
Length=456

 Score =   266 bits (680),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 143/217 (66%), Positives = 180/217 (83%), Gaps = 6/217 (3%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  241
            A ERQ++LL+HL P  ++SSL+   S +S   CA+  S      + +GDDIVIVAAYRT 
Sbjct  4    AAERQKILLRHLNPIPSSSSLNHESSVLSPVNCASEVSPM----AAFGDDIVIVAAYRTA  59

Query  242  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  421
            +CK+KRGGFKDT PDDLLASVLKA++E+T+L+PSEVGDI+VGTVLAPGS RA ECR+AA+
Sbjct  60   ICKAKRGGFKDTLPDDLLASVLKAVVERTSLDPSEVGDIVVGTVLAPGSQRAMECRVAAY  119

Query  422  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEG--SV  595
            +AGFP+TVP+RTVNRQCSSGLQAVADVAA+I+AG+YDIGIGAG+ESM+ ++M   G  + 
Sbjct  120  FAGFPDTVPIRTVNRQCSSGLQAVADVAASIRAGYYDIGIGAGVESMSTDSMPGGGFQTS  179

Query  596  NPRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
            NPRA    +A++CLLPMG+TSENVA R+GVTR+EQD 
Sbjct  180  NPRALEFPKARDCLLPMGVTSENVAKRYGVTREEQDM  216



>ref|XP_007049829.1| Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 5, partial [Theobroma 
cacao]
 gb|EOX93986.1| Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 5, partial [Theobroma 
cacao]
Length=333

 Score =   259 bits (663),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 134/186 (72%), Positives = 155/186 (83%), Gaps = 1/186 (1%)
 Frame = +2

Query  152  SVCAAGDSAAYQRNSVYGDDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKTN  331
            S+CAAGD +AY   + + +D+VIVAA RT +CK+KRGGFKDT  DDLLA VLKALI++T 
Sbjct  9    SICAAGDGSAYHGTAAFANDVVIVAACRTAICKAKRGGFKDTPADDLLAPVLKALIDRTK  68

Query  332  LNPSEVGDIIVGTVLAPGSIRASECRMAAFYAGFPETVPVRTVNRQCSSGLQavadvaaa  511
            LNPSEVGDI+VGTVLAPGS R  ECRMAAFYAGFP+TVP++TVNRQCSSGLQAVADVA  
Sbjct  69   LNPSEVGDIVVGTVLAPGSQRGIECRMAAFYAGFPDTVPIKTVNRQCSSGLQAVADVALC  128

Query  512  ikaGFYDIGIGAGLESMTVNTMAWEGS-VNPRASTLQQAQNCLLPMGITSENVAHRFGVT  688
            IKAG YDIGI AGLESMT + +    S VNP+  +  QA++CLLPMGITSENVA R+GVT
Sbjct  129  IKAGLYDIGIAAGLESMTTDKVVPGVSKVNPQVESFAQARDCLLPMGITSENVAQRYGVT  188

Query  689  RQEQDQ  706
            RQEQDQ
Sbjct  189  RQEQDQ  194



>emb|CDY33940.1| BnaA02g30470D [Brassica napus]
Length=456

 Score =   263 bits (672),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 140/217 (65%), Positives = 177/217 (82%), Gaps = 7/217 (3%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  241
            A ERQ++LL+HL P ++ S      + +SA  CAA  S+     + +GDD+VIVAAYRT 
Sbjct  4    ATERQKILLRHLNPLSS-SPPPYKPTLLSAVNCAAELSSM----AAFGDDVVIVAAYRTA  58

Query  242  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  421
            +CK+KRGGFKDT PDDLLASVLKA++E+T+L+PSEVGDI+VGTV+APGS RA ECR+AAF
Sbjct  59   ICKAKRGGFKDTLPDDLLASVLKAVVERTSLDPSEVGDIVVGTVIAPGSQRAMECRVAAF  118

Query  422  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEG--SV  595
            +AGFP++VP+RTVNRQCSSGLQAVADVAA+I+AG+YDIGIGAG+ESM+ + +   G  + 
Sbjct  119  FAGFPDSVPIRTVNRQCSSGLQAVADVAASIRAGYYDIGIGAGVESMSTDHIPGGGFNTT  178

Query  596  NPRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
            NPRA     A++CLLPMGITSENVA R+GVTR+EQD 
Sbjct  179  NPRAQEFPGARDCLLPMGITSENVAERYGVTREEQDM  215



>ref|XP_010442336.1| PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxisomal-like isoform 
X1 [Camelina sativa]
Length=458

 Score =   261 bits (668),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 141/219 (64%), Positives = 177/219 (81%), Gaps = 8/219 (4%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESS--VSASVCAAGDSAAYQRNSVYGDDIVIVAAYR  235
            A ERQ++ L+HL P  ++SS      S  +S   CA+  S      + +GDDIVIVAAYR
Sbjct  4    AAERQKIFLRHLNPIPSSSSSSLNHESSVLSPVNCASEVSPM----AAFGDDIVIVAAYR  59

Query  236  TPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMA  415
            T +CK+KRGGFKDT PDDLLASVLKA++E+T+L+PSEVGDI+VGTVLAPGS RA ECR+A
Sbjct  60   TAICKAKRGGFKDTLPDDLLASVLKAVVERTSLDPSEVGDIVVGTVLAPGSQRAMECRVA  119

Query  416  AFYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEG--  589
            A++AGFP+TVP+RTVNRQCSSGLQAVADVAA+I+AG+YDIGIGAG+ESM+ ++M   G  
Sbjct  120  AYFAGFPDTVPIRTVNRQCSSGLQAVADVAASIRAGYYDIGIGAGVESMSTDSMPGGGFQ  179

Query  590  SVNPRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
            + NPRA    +A++CLLPMG+TSENVA R+G+TRQEQD 
Sbjct  180  TSNPRALEFPKARDCLLPMGVTSENVAERYGITRQEQDM  218



>ref|XP_009129750.1| PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxisomal isoform X1 
[Brassica rapa]
Length=456

 Score =   261 bits (666),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 140/217 (65%), Positives = 176/217 (81%), Gaps = 7/217 (3%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  241
            A ERQ++LL+HL P ++ S      + +SA  CAA  S      + +GDD+VIVAAYRT 
Sbjct  4    ATERQKILLRHLYPLSS-SPPPYKPTLLSAVNCAAELSPM----ASFGDDVVIVAAYRTA  58

Query  242  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  421
            +CK+KRGGFKDT PDDLLASVLKA++E+T+L+PSEVGDI+VGTV+APGS RA ECR+AA+
Sbjct  59   ICKAKRGGFKDTLPDDLLASVLKAVVERTSLDPSEVGDIVVGTVIAPGSQRAMECRVAAY  118

Query  422  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEG--SV  595
            +AGFP+TVP+RTVNRQCSSGLQAVADVAA+I+AG+YDIGIGAG+ESM+ + +   G  + 
Sbjct  119  FAGFPDTVPIRTVNRQCSSGLQAVADVAASIRAGYYDIGIGAGVESMSTDHIPGGGFNTT  178

Query  596  NPRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
            NPRA     A++CLLPMGITSENVA R+GVTR+EQD 
Sbjct  179  NPRAQEFPGARDCLLPMGITSENVAERYGVTREEQDM  215



>ref|XP_010482154.1| PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxisomal-like isoform 
X1 [Camelina sativa]
Length=458

 Score =   260 bits (665),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 143/217 (66%), Positives = 180/217 (83%), Gaps = 6/217 (3%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTN-AASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRT  238
            A ERQ++LL+HL P   ++SS  + ESSV   V  A + +     + +GDDIVIVAAYRT
Sbjct  4    AAERQKILLRHLNPIPCSSSSSLNHESSVLYPVNCASEVSPM---AAFGDDIVIVAAYRT  60

Query  239  PLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAA  418
             +CK+KRGGFKDT PDDLLASVLKA++E+T+L+PSEVGDI+VGTVLAPGS RA ECR+AA
Sbjct  61   AICKAKRGGFKDTLPDDLLASVLKAVVERTSLDPSEVGDIVVGTVLAPGSQRAMECRVAA  120

Query  419  FYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEG--S  592
            ++AGFP+TVP+RTVNRQCSSGLQAVADVAA+I+AG+YDIGIGAG+ESM+ ++M   G  +
Sbjct  121  YFAGFPDTVPIRTVNRQCSSGLQAVADVAASIRAGYYDIGIGAGVESMSTDSMPGGGFQT  180

Query  593  VNPRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQD  703
             NPRA    +A++CLLPMG+TSENVA R+G+TRQEQD
Sbjct  181  SNPRALEFPKARDCLLPMGVTSENVAERYGITRQEQD  217



>gb|ADE77908.1| unknown [Picea sitchensis]
Length=444

 Score =   259 bits (661),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 140/215 (65%), Positives = 166/215 (77%), Gaps = 4/215 (2%)
 Frame = +2

Query  71   RQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSA---AYQRNSVYGDDIVIVAAYRTP  241
            RQ+VL+ HL   + A  L +    VS SVC  GDS    A    S   DD+VIVAAYRTP
Sbjct  2    RQQVLMGHLTGFSTAP-LVAHNLLVSPSVCMGGDSGIDHARAAESCNDDDVVIVAAYRTP  60

Query  242  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  421
             C++KRGGFKDT P+DLL  VLKA++E+T + P EVGDI+VGTVLAPGS RA ECRMAAF
Sbjct  61   QCRAKRGGFKDTRPEDLLDPVLKAVVERTGIRPDEVGDIVVGTVLAPGSRRAMECRMAAF  120

Query  422  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  601
            YAGFPE+VP+RTVNRQCSSGLQAVADVA+AIK G+YDIGIGAGLE M+ +++ W    NP
Sbjct  121  YAGFPESVPIRTVNRQCSSGLQAVADVASAIKCGYYDIGIGAGLEFMSEHSIGWGPVDNP  180

Query  602  RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
            R  T QQ Q+CLLPMGITSENVA R+GV+R+ QD+
Sbjct  181  RIQTNQQVQDCLLPMGITSENVAERYGVSRESQDE  215



>ref|XP_010482155.1| PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxisomal-like isoform 
X2 [Camelina sativa]
Length=414

 Score =   254 bits (650),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 126/172 (73%), Positives = 155/172 (90%), Gaps = 2/172 (1%)
 Frame = +2

Query  194  SVYGDDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTV  373
            + +GDDIVIVAAYRT +CK+KRGGFKDT PDDLLASVLKA++E+T+L+PSEVGDI+VGTV
Sbjct  2    AAFGDDIVIVAAYRTAICKAKRGGFKDTLPDDLLASVLKAVVERTSLDPSEVGDIVVGTV  61

Query  374  LAPGSIRASECRMAAFYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGL  553
            LAPGS RA ECR+AA++AGFP+TVP+RTVNRQCSSGLQAVADVAA+I+AG+YDIGIGAG+
Sbjct  62   LAPGSQRAMECRVAAYFAGFPDTVPIRTVNRQCSSGLQAVADVAASIRAGYYDIGIGAGV  121

Query  554  ESMTVNTMAWEG--SVNPRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQD  703
            ESM+ ++M   G  + NPRA    +A++CLLPMG+TSENVA R+G+TRQEQD
Sbjct  122  ESMSTDSMPGGGFQTSNPRALEFPKARDCLLPMGVTSENVAERYGITRQEQD  173



>emb|CDY05657.1| BnaC02g38800D [Brassica napus]
Length=462

 Score =   256 bits (653),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 136/217 (63%), Positives = 178/217 (82%), Gaps = 2/217 (1%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  241
            A ERQ++L++HL P +++ SL SI  +    + A   +A     + +GDD+VIVAAYRT 
Sbjct  4    ATERQKILIRHLNPLSSSPSLPSINDNKPTLLSAVNCAAELSPMAAFGDDVVIVAAYRTA  63

Query  242  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  421
            +CK+KRGGFKDT PDDLLASVLKA++E+T+L+PSEVGDI+VGTV+APGS RA ECR+AA+
Sbjct  64   ICKAKRGGFKDTLPDDLLASVLKAVVERTSLDPSEVGDIVVGTVIAPGSQRAMECRVAAY  123

Query  422  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEG--SV  595
            +AGFP++VP+RTVNRQCSSGLQAVADVAA+I+AG+YDIGIGAG+ESM+++  A  G  + 
Sbjct  124  FAGFPDSVPIRTVNRQCSSGLQAVADVAASIRAGYYDIGIGAGVESMSIDHTAGGGFHTT  183

Query  596  NPRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
            NPRA   + A++CLLPMGITSENVA R+ VTR++QD 
Sbjct  184  NPRAQEFRGARDCLLPMGITSENVAERYCVTREDQDM  220



>ref|XP_010442338.1| PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxisomal-like isoform 
X2 [Camelina sativa]
Length=414

 Score =   254 bits (649),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 126/173 (73%), Positives = 155/173 (90%), Gaps = 2/173 (1%)
 Frame = +2

Query  194  SVYGDDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTV  373
            + +GDDIVIVAAYRT +CK+KRGGFKDT PDDLLASVLKA++E+T+L+PSEVGDI+VGTV
Sbjct  2    AAFGDDIVIVAAYRTAICKAKRGGFKDTLPDDLLASVLKAVVERTSLDPSEVGDIVVGTV  61

Query  374  LAPGSIRASECRMAAFYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGL  553
            LAPGS RA ECR+AA++AGFP+TVP+RTVNRQCSSGLQAVADVAA+I+AG+YDIGIGAG+
Sbjct  62   LAPGSQRAMECRVAAYFAGFPDTVPIRTVNRQCSSGLQAVADVAASIRAGYYDIGIGAGV  121

Query  554  ESMTVNTMAWEG--SVNPRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
            ESM+ ++M   G  + NPRA    +A++CLLPMG+TSENVA R+G+TRQEQD 
Sbjct  122  ESMSTDSMPGGGFQTSNPRALEFPKARDCLLPMGVTSENVAERYGITRQEQDM  174



>ref|XP_010439770.1| PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxisomal isoform X2 
[Camelina sativa]
Length=414

 Score =   253 bits (647),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 126/173 (73%), Positives = 155/173 (90%), Gaps = 2/173 (1%)
 Frame = +2

Query  194  SVYGDDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTV  373
            + +GDDIVIVAAYRT +CK+KRGGFKDT PDDLLASVLKA++E+T+L+PSEVGDI+VGTV
Sbjct  2    AAFGDDIVIVAAYRTAICKAKRGGFKDTLPDDLLASVLKAVVERTSLDPSEVGDIVVGTV  61

Query  374  LAPGSIRASECRMAAFYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGL  553
            LAPGS RA ECR+AA++AGFP+TVP+RTVNRQCSSGLQAVADVAA+I+AG+YDIGIGAG+
Sbjct  62   LAPGSQRAMECRVAAYFAGFPDTVPIRTVNRQCSSGLQAVADVAASIRAGYYDIGIGAGV  121

Query  554  ESMTVNTMAWEG--SVNPRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
            ESM+ ++M   G  + NPRA    +A++CLLPMG+TSENVA R+GVTR+EQD 
Sbjct  122  ESMSTDSMPGGGFQTSNPRALEFPKARDCLLPMGVTSENVAKRYGVTREEQDM  174



>ref|XP_006395130.1| hypothetical protein EUTSA_v10004174mg [Eutrema salsugineum]
 gb|ESQ32416.1| hypothetical protein EUTSA_v10004174mg [Eutrema salsugineum]
Length=414

 Score =   253 bits (645),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 126/172 (73%), Positives = 155/172 (90%), Gaps = 2/172 (1%)
 Frame = +2

Query  194  SVYGDDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTV  373
            + +GDDIVIVAAYRT +CK+KRGGFKDT PDDLLASVLKA++E+T+L+PSEVGDI+VGTV
Sbjct  2    AAFGDDIVIVAAYRTAICKAKRGGFKDTRPDDLLASVLKAVVERTSLDPSEVGDIVVGTV  61

Query  374  LAPGSIRASECRMAAFYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGL  553
            +APGS RA ECR+AA++AGFP+TVP+RTVNRQCSSGLQAVADVAA+I+AG+Y+IGIGAG+
Sbjct  62   IAPGSQRAMECRVAAYFAGFPDTVPIRTVNRQCSSGLQAVADVAASIRAGYYEIGIGAGV  121

Query  554  ESMTVNTMAWEG--SVNPRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQD  703
            ESM+++  A  G  S NPRA    +A++CLLPMGITSENVA R+GVTR+EQD
Sbjct  122  ESMSIDHTAGGGFQSTNPRAQDFPKARDCLLPMGITSENVAERYGVTREEQD  173



>dbj|BAF02017.1| peroxisomal-3-keto-acyl-CoA thiolase 1 [Arabidopsis thaliana]
Length=414

 Score =   251 bits (640),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 126/174 (72%), Positives = 155/174 (89%), Gaps = 4/174 (2%)
 Frame = +2

Query  194  SVYGDDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTV  373
            + +GDDIVIVAAYRT +CK++RGGFKDT PDDLLASVLKA++E+T+L+PSEVGDI+VGTV
Sbjct  2    AAFGDDIVIVAAYRTAICKARRGGFKDTLPDDLLASVLKAVVERTSLDPSEVGDIVVGTV  61

Query  374  LAPGSIRASECRMAAFYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGL  553
            +APGS RA ECR+AA++AGFP++VPVRTVNRQCSSGLQAVADVAA+I+AG+YDIGIGAG+
Sbjct  62   IAPGSQRAMECRVAAYFAGFPDSVPVRTVNRQCSSGLQAVADVAASIRAGYYDIGIGAGV  121

Query  554  ESMTVNTM---AWEGSVNPRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
            ESM+ + +    + GS NPRA    +A++CLLPMGITSENVA RFGVTR+EQD 
Sbjct  122  ESMSTDHIPGGGFHGS-NPRAQDFPKARDCLLPMGITSENVAERFGVTREEQDM  174



>ref|XP_005646163.1| thiolase [Coccomyxa subellipsoidea C-169]
 gb|EIE21619.1| thiolase [Coccomyxa subellipsoidea C-169]
Length=470

 Score =   252 bits (644),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 122/213 (57%), Positives = 170/213 (80%), Gaps = 3/213 (1%)
 Frame = +2

Query  71   RQRVLLQHLRPT-NAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTPLC  247
            RQ+VLL HLRP  N  ++ + ++  + AS CAAGDSAAY+R +   DD+VIV+A RTP+ 
Sbjct  13   RQQVLLNHLRPAGNTEAAFERMQ--LQASACAAGDSAAYERRASGPDDVVIVSALRTPIT  70

Query  248  KSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAFYA  427
            K+KRGGFKDT PDDL+A+V +A +++T +NP+++GDI++G+VL   S RA + R+A F A
Sbjct  71   KAKRGGFKDTLPDDLMAAVFQATLDRTGINPADIGDIVIGSVLGDSSQRAIQVRIAGFLA  130

Query  428  GFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNPRA  607
            G PE V V TVNRQCSSGLQA+A VAAAI+AG+Y+IG+  G+E+M+ N MAW+G VNP+ 
Sbjct  131  GIPENVAVHTVNRQCSSGLQAIASVAAAIQAGYYEIGLAGGVETMSTNPMAWDGGVNPKI  190

Query  608  STLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
            +  Q+AQ+CLLPMG+TSENVA ++G+TR++QD+
Sbjct  191  ADNQKAQDCLLPMGVTSENVAEKYGITRKDQDE  223



>ref|NP_851157.1| 3-keto-acyl-CoA thiolase 2 [Arabidopsis thaliana]
 gb|AAC17876.1| 3-keto-acyl-CoA-thiolase 1 [Arabidopsis thaliana]
 gb|AAC19122.1| peroxisomal-3-keto-acyl-CoA thiolase 1 [Arabidopsis thaliana]
 gb|AAM97120.1| 3-keto-acyl-CoA thiolase 2 [Arabidopsis thaliana]
 gb|AAO00954.1| 3-keto-acyl-CoA thiolase 2 [Arabidopsis thaliana]
 gb|AED95736.1| 3-keto-acyl-CoA thiolase 2 [Arabidopsis thaliana]
Length=414

 Score =   251 bits (640),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 126/174 (72%), Positives = 155/174 (89%), Gaps = 4/174 (2%)
 Frame = +2

Query  194  SVYGDDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTV  373
            + +GDDIVIVAAYRT +CK++RGGFKDT PDDLLASVLKA++E+T+L+PSEVGDI+VGTV
Sbjct  2    AAFGDDIVIVAAYRTAICKARRGGFKDTLPDDLLASVLKAVVERTSLDPSEVGDIVVGTV  61

Query  374  LAPGSIRASECRMAAFYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGL  553
            +APGS RA ECR+AA++AGFP++VPVRTVNRQCSSGLQAVADVAA+I+AG+YDIGIGAG+
Sbjct  62   IAPGSQRAMECRVAAYFAGFPDSVPVRTVNRQCSSGLQAVADVAASIRAGYYDIGIGAGV  121

Query  554  ESMTVNTM---AWEGSVNPRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
            ESM+ + +    + GS NPRA    +A++CLLPMGITSENVA RFGVTR+EQD 
Sbjct  122  ESMSTDHIPGGGFHGS-NPRAQDFPKARDCLLPMGITSENVAERFGVTREEQDM  174



>ref|XP_009129751.1| PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxisomal isoform X2 
[Brassica rapa]
Length=415

 Score =   249 bits (636),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 124/171 (73%), Positives = 152/171 (89%), Gaps = 2/171 (1%)
 Frame = +2

Query  200  YGDDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLA  379
            +GDD+VIVAAYRT +CK+KRGGFKDT PDDLLASVLKA++E+T+L+PSEVGDI+VGTV+A
Sbjct  4    FGDDVVIVAAYRTAICKAKRGGFKDTLPDDLLASVLKAVVERTSLDPSEVGDIVVGTVIA  63

Query  380  PGSIRASECRMAAFYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLES  559
            PGS RA ECR+AA++AGFP+TVP+RTVNRQCSSGLQAVADVAA+I+AG+YDIGIGAG+ES
Sbjct  64   PGSQRAMECRVAAYFAGFPDTVPIRTVNRQCSSGLQAVADVAASIRAGYYDIGIGAGVES  123

Query  560  MTVNTMAWEG--SVNPRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
            M+ + +   G  + NPRA     A++CLLPMGITSENVA R+GVTR+EQD 
Sbjct  124  MSTDHIPGGGFNTTNPRAQEFPGARDCLLPMGITSENVAERYGVTREEQDM  174



>gb|AIB06952.1| 3-ketoacyl-CoA thiolase [Vanda hybrid cultivar]
Length=450

 Score =   247 bits (631),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 152/215 (71%), Positives = 181/215 (84%), Gaps = 5/215 (2%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  241
            AI+RQ VL +HL+    +SS D   +S+SASV AAGDS+AYQ+N  + DD+VIVAA RT 
Sbjct  4    AIDRQGVLRRHLQ----SSSYDH-PTSLSASVGAAGDSSAYQKNHGFDDDVVIVAACRTA  58

Query  242  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  421
            + K+ RGGFKDT+ +DLLA +LKAL+EKT LNP EVGDI+VGTVLAPGS RA ECRMAAF
Sbjct  59   IGKANRGGFKDTHAEDLLAPLLKALLEKTKLNPYEVGDIVVGTVLAPGSQRAIECRMAAF  118

Query  422  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  601
            YAGFPETVP+RTVNRQCSSGLQAVADVAAAIKAG+Y IGIGAGLESM+ N + WEG  NP
Sbjct  119  YAGFPETVPLRTVNRQCSSGLQAVADVAAAIKAGYYGIGIGAGLESMSSNKVGWEGPPNP  178

Query  602  RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
            +A +LQQ Q+C LPMG+TSENVA R+G+T++EQDQ
Sbjct  179  KAKSLQQVQDCYLPMGMTSENVAERYGITKEEQDQ  213



>ref|XP_010547052.1| PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxisomal isoform X3 
[Tarenaya hassleriana]
Length=426

 Score =   244 bits (623),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 122/172 (71%), Positives = 152/172 (88%), Gaps = 2/172 (1%)
 Frame = +2

Query  194  SVYGDDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTV  373
            + +GDDIVIVAA+RT +CK++RGGFKDT  DDLLA+VLKA++E+T+L+PSEVGDI+VGTV
Sbjct  2    AAFGDDIVIVAAHRTAICKARRGGFKDTLADDLLATVLKAMVERTSLDPSEVGDIVVGTV  61

Query  374  LAPGSIRASECRMAAFYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGL  553
            +APGS RA ECR+AA+YAGFP++VP+RTVNRQCSSGLQAVADVAA+IKAGFYDIGI AG+
Sbjct  62   IAPGSQRAMECRVAAYYAGFPDSVPIRTVNRQCSSGLQAVADVAASIKAGFYDIGIAAGV  121

Query  554  ESMTVNTMAWEG--SVNPRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQD  703
            ESM+ + +A  G   VNP+     +A++CLLPMGITSENVA R+GVTR+EQD
Sbjct  122  ESMSTDHVAGGGFRVVNPKVEDFPKARDCLLPMGITSENVAERYGVTREEQD  173



>ref|XP_002946078.1| hypothetical protein VOLCADRAFT_102696 [Volvox carteri f. nagariensis]
 gb|EFJ53073.1| hypothetical protein VOLCADRAFT_102696 [Volvox carteri f. nagariensis]
Length=462

 Score =   241 bits (615),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 121/213 (57%), Positives = 160/213 (75%), Gaps = 8/213 (4%)
 Frame = +2

Query  71   RQRVLLQHLRPT-NAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTPLC  247
            R  VL +H+ P  N    L       S   C+AGDSAAY+R++   DD+VIVAA RTPL 
Sbjct  10   RLSVLAKHICPVPNGVQGL-------SLQGCSAGDSAAYERHNTADDDVVIVAALRTPLT  62

Query  248  KSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAFYA  427
            K++RGG KDT   DLLA+V KA++++T + P  +GDI++G+VL P S RA+ECR+A+F+A
Sbjct  63   KARRGGLKDTDAVDLLATVFKAVLDRTGVEPQAIGDIVIGSVLGPSSQRANECRIASFFA  122

Query  428  GFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNPRA  607
            G PETVPVRTVNRQCSSGLQA+ADVAAAI+AGFY +G+  G+E+M++N MAWEG +NPR 
Sbjct  123  GIPETVPVRTVNRQCSSGLQAIADVAAAIRAGFYTVGLAGGVETMSLNPMAWEGGINPRI  182

Query  608  STLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
                 AQ C++PMG+TSENVA +FG+ R+ QD+
Sbjct  183  ENFPGAQGCMMPMGVTSENVAAKFGIDRKSQDE  215



>gb|ACJ84675.1| unknown [Medicago truncatula]
Length=234

 Score =   233 bits (593),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 124/215 (58%), Positives = 145/215 (67%), Gaps = 47/215 (22%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  241
            AI RQ+VLLQHL P++ +S+  S  +S++AS C AGDSAAY R + +GDD+VIVAAYRT 
Sbjct  4    AINRQKVLLQHLNPSSFSSND-SSSTSLNASACLAGDSAAYHRTAAFGDDVVIVAAYRTA  62

Query  242  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  421
            LCK KRGGFKDT+ DD+LA VLKA+IEKTNLNPSEVGDI+VG+VL               
Sbjct  63   LCKVKRGGFKDTHADDILAPVLKAVIEKTNLNPSEVGDIVVGSVLG--------------  108

Query  422  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  601
                                            AGFYDIGIGAGLESMT N MAW+GSVNP
Sbjct  109  --------------------------------AGFYDIGIGAGLESMTTNPMAWDGSVNP  136

Query  602  RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
            R    +QAQNCLLPMGITSENVA RFGV+R+EQD+
Sbjct  137  RVKMFEQAQNCLLPMGITSENVASRFGVSRKEQDE  171



>gb|KDO43604.1| hypothetical protein CISIN_1g012506mg [Citrus sinensis]
Length=388

 Score =   233 bits (595),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 119/134 (89%), Positives = 128/134 (96%), Gaps = 0/134 (0%)
 Frame = +2

Query  305  LKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAFYAGFPETVPVRTVNRQCSSGL  484
            L+A+IEKTN++PSEVGDI+VGTVLAPGS RASECRMAAFYAGFPETVPVRTVNRQCSSGL
Sbjct  9    LQAVIEKTNVDPSEVGDIVVGTVLAPGSQRASECRMAAFYAGFPETVPVRTVNRQCSSGL  68

Query  485  QavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNPRASTLQQAQNCLLPMGITSEN  664
            QAVADVAAAIKAGFYDIGIGAGLESMTVN MAWEGSVNP+    +QAQNCLLPMG+TSEN
Sbjct  69   QAVADVAAAIKAGFYDIGIGAGLESMTVNPMAWEGSVNPKVKAFEQAQNCLLPMGVTSEN  128

Query  665  VAHRFGVTRQEQDQ  706
            VAHRFGVTR+EQDQ
Sbjct  129  VAHRFGVTRKEQDQ  142



>ref|XP_005845320.1| hypothetical protein CHLNCDRAFT_25846 [Chlorella variabilis]
 gb|EFN53218.1| hypothetical protein CHLNCDRAFT_25846 [Chlorella variabilis]
Length=354

 Score =   231 bits (588),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 124/215 (58%), Positives = 162/215 (75%), Gaps = 3/215 (1%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  241
            A  RQ+VLL HL    ++++      S   +  +AGDSAAY+R ++  DD+VIV+A RT 
Sbjct  4    AAHRQQVLLGHLEAAVSSAAPAPPPMSAHPT--SAGDSAAYERRNLACDDVVIVSACRTA  61

Query  242  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  421
            LCK+KRGGFKDT  DDL+A+VLK  I ++ + P  VGD+  G+V+ P S RA+ECR+A F
Sbjct  62   LCKAKRGGFKDTPVDDLIATVLKETIRRSGVEPEAVGDVCFGSVMGPSSQRANECRIAMF  121

Query  422  YAGFPETVPVRTVNRQCSS-GLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVN  598
             AGFP +VPV TVNRQCSS GLQA+A VAA+IKAG+Y++GI  G+ESMT N MAWEG++N
Sbjct  122  LAGFPTSVPVHTVNRQCSSAGLQAIAQVAASIKAGYYEVGIAGGVESMTTNPMAWEGAIN  181

Query  599  PRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQD  703
            PR +  Q AQ+CLLPMGITSENVA ++GV+R+ QD
Sbjct  182  PRVAENQCAQDCLLPMGITSENVAAQYGVSREVQD  216



>ref|XP_001697225.1| acetyl-CoA acyltransferase [Chlamydomonas reinhardtii]
 gb|EDP00480.1| acetyl-CoA acyltransferase [Chlamydomonas reinhardtii]
Length=461

 Score =   233 bits (594),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 112/189 (59%), Positives = 150/189 (79%), Gaps = 0/189 (0%)
 Frame = +2

Query  140  SVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLKALI  319
            S+S   C+AGDSAAY+R +   DD+VIVA+ RTPL K+KRGG +DT   DLL+++ KA++
Sbjct  25   SLSLQTCSAGDSAAYERRNTADDDVVIVASLRTPLTKAKRGGLRDTDAADLLSTLFKAVL  84

Query  320  EKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAFYAGFPETVPVRTVNRQCSSGLQavad  499
            E+T + P  +GDI++G+VL P S RA+ECR+A+F+AG P+ VPVRTVNRQCSSGLQA+AD
Sbjct  85   ERTGVEPQAIGDIVIGSVLGPSSQRANECRIASFFAGIPDVVPVRTVNRQCSSGLQAIAD  144

Query  500  vaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNPRASTLQQAQNCLLPMGITSENVAHRF  679
            VAAAIKAGFY +G+  G+E+M+ N MAWEG +NPR      A +C+LPMG+TSENVA ++
Sbjct  145  VAAAIKAGFYTVGLAGGVETMSSNPMAWEGGINPRVGDFPGAASCMLPMGVTSENVAAKY  204

Query  680  GVTRQEQDQ  706
            GV R+ QD+
Sbjct  205  GVDRKTQDE  213



>ref|XP_002989683.1| hypothetical protein SELMODRAFT_447769 [Selaginella moellendorffii]
 gb|EFJ09160.1| hypothetical protein SELMODRAFT_447769 [Selaginella moellendorffii]
Length=408

 Score =   228 bits (580),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 113/168 (67%), Positives = 144/168 (86%), Gaps = 1/168 (1%)
 Frame = +2

Query  206  DDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPG  385
            DD+VIVAA+RTP+CK+KRGGFKD++P+DLL  VLKA++  T + P+EVGDI+VGTV+APG
Sbjct  16   DDVVIVAAFRTPICKAKRGGFKDSFPEDLLVPVLKAVVAHTGVIPAEVGDIVVGTVIAPG  75

Query  386  SIRASECRMAAFYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMT  565
            S RA+ECR+AA  AGFP+TVPVRTVNRQCSSGLQAV DVAAAIK+GFY+IGIGAG+E M+
Sbjct  76   SHRAAECRIAALLAGFPDTVPVRTVNRQCSSGLQAVGDVAAAIKSGFYEIGIGAGVECMS  135

Query  566  VN-TMAWEGSVNPRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
            ++  +  +  VNP+      A++CLLPMGITSENVA R+G+TR+EQD+
Sbjct  136  IDFGVQQQPRVNPQVELNSMAKDCLLPMGITSENVAERYGITREEQDE  183



>gb|KIY92728.1| acetyl-CoA acyltransferase 1 [Monoraphidium neglectum]
Length=323

 Score =   224 bits (572),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 112/182 (62%), Positives = 145/182 (80%), Gaps = 0/182 (0%)
 Frame = +2

Query  158  CAAGDSAAYQRNSVYGDDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLN  337
            C+AGDS+AYQR     DD+VIV+A RTPL K++RGG +DT   DLLA+V +A +++T + 
Sbjct  30   CSAGDSSAYQRQGAALDDVVIVSALRTPLTKARRGGLRDTDAVDLLATVYRATLDRTRVE  89

Query  338  PSEVGDIIVGTVLAPGSIRASECRMAAFYAGFPETVPVRTVNRQCSSGLQavadvaaaik  517
            P+ +GD++VG+VL P S RA+E R+A F AG PETVPVRTVNRQCSSGLQAVADVAAAIK
Sbjct  90   PAALGDVVVGSVLGPSSQRANEARIAMFIAGIPETVPVRTVNRQCSSGLQAVADVAAAIK  149

Query  518  aGFYDIGIGAGLESMTVNTMAWEGSVNPRASTLQQAQNCLLPMGITSENVAHRFGVTRQE  697
            AG+Y +G+  G+E+M+ + M+WEG VNPR +   QAQ CL+PMG+TSENVA +FGV R+ 
Sbjct  150  AGYYSVGLACGVETMSAHPMSWEGGVNPRIADFPQAQGCLMPMGVTSENVAAKFGVDRRA  209

Query  698  QD  703
            QD
Sbjct  210  QD  211



>ref|XP_002991797.1| hypothetical protein SELMODRAFT_236388 [Selaginella moellendorffii]
 gb|EFJ07201.1| hypothetical protein SELMODRAFT_236388 [Selaginella moellendorffii]
Length=395

 Score =   226 bits (577),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 112/168 (67%), Positives = 144/168 (86%), Gaps = 1/168 (1%)
 Frame = +2

Query  206  DDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPG  385
            DD+VIVAA+RTP+CK+KRGGFKD++P+DLL  VLKA++  T + P++VGDI+VGTV+APG
Sbjct  6    DDVVIVAAFRTPICKAKRGGFKDSFPEDLLVPVLKAVVAHTGVIPADVGDIVVGTVIAPG  65

Query  386  SIRASECRMAAFYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMT  565
            S RA+ECR+AA  AGFP+TVPVRTVNRQCSSGLQAV DVAAAIK+GFY+IGIGAG+E M+
Sbjct  66   SHRAAECRIAALLAGFPDTVPVRTVNRQCSSGLQAVGDVAAAIKSGFYEIGIGAGVECMS  125

Query  566  VN-TMAWEGSVNPRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
            ++  +  +  VNP+      A++CLLPMGITSENVA R+G+TR+EQD+
Sbjct  126  IDFGVQQQPRVNPQVELNSMAKDCLLPMGITSENVAERYGITREEQDE  173



>ref|XP_011400620.1| 3-ketoacyl-CoA thiolase 2, peroxisomal [Auxenochlorella protothecoides]
 gb|KFM27633.1| 3-ketoacyl-CoA thiolase 2, peroxisomal [Auxenochlorella protothecoides]
Length=455

 Score =   217 bits (553),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 114/214 (53%), Positives = 149/214 (70%), Gaps = 10/214 (5%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  241
            A +RQ+VLL HL   +    +    +S  +    AGD           DD+VIV+  RT 
Sbjct  4    AAQRQKVLLSHLASAHGTPEVAPQPTSAESHDRRAGDL----------DDVVIVSTCRTA  53

Query  242  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  421
            LC+++RGGFKDT  DDL+A+VLK  + +T + P  VGDI+ G+V+ P S RA+E RMA  
Sbjct  54   LCRARRGGFKDTPVDDLIAAVLKDTLRRTGIEPEAVGDIVFGSVMGPSSQRANELRMAML  113

Query  422  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  601
            +AGFP TVPV T+NRQCSSGLQA+A VAA+IKAG+Y + I  G+E MT N M WEG+VNP
Sbjct  114  FAGFPHTVPVHTLNRQCSSGLQAMASVAASIKAGYYTMAIAGGVEHMTSNPMNWEGTVNP  173

Query  602  RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQD  703
            R +T Q+A +CL+PMGITSENV+ +FG+TR EQD
Sbjct  174  RVATCQEAADCLIPMGITSENVSAQFGMTRAEQD  207



>gb|AFW74043.1| hypothetical protein ZEAMMB73_080325, partial [Zea mays]
Length=145

 Score =   207 bits (527),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 96/138 (70%), Positives = 120/138 (87%), Gaps = 3/138 (2%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  241
            AI+RQRVLL HL P+ +A+S    +  ++AS CAAGDSAAYQR+S +GDD+V+VAAYRTP
Sbjct  4    AIDRQRVLLAHLLPSPSAAS---SQPQLAASACAAGDSAAYQRSSSFGDDVVVVAAYRTP  60

Query  242  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  421
            +CK+KRGGFKDTYP+DLL  VLKA+++ T +NP+++GDI+VGTVL PGS RA+ECRMAA 
Sbjct  61   ICKAKRGGFKDTYPEDLLTVVLKAVLDNTRINPADIGDIVVGTVLGPGSQRANECRMAAL  120

Query  422  YAGFPETVPVRTVNRQCS  475
            +AGFPETVPVRTVNRQCS
Sbjct  121  FAGFPETVPVRTVNRQCS  138



>emb|CEF98532.1| Thiolase-like, subgroup [Ostreococcus tauri]
Length=424

 Score =   213 bits (541),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 101/166 (61%), Positives = 134/166 (81%), Gaps = 0/166 (0%)
 Frame = +2

Query  206  DDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPG  385
            DD+V+VAA RTP+ ++K+GG   T  DDL+A+VL+A   + N++PSEVGD++VG+VL   
Sbjct  41   DDVVVVAACRTPITRAKKGGLAKTPADDLVAAVLQAATRRANIDPSEVGDVVVGSVLGSS  100

Query  386  SIRASECRMAAFYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMT  565
            S RA+ECR+A F AGFP+ VPVRT NRQCSSG+QA AD+AA IKAG+YD+GIGAG+E+MT
Sbjct  101  SQRANECRIAMFLAGFPKEVPVRTTNRQCSSGIQACADIAAGIKAGYYDVGIGAGVETMT  160

Query  566  VNTMAWEGSVNPRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQD  703
             N M WEG  NPR ++   AQNCL+PMG+TSENVA ++G++R+ QD
Sbjct  161  SNPMKWEGGFNPRVASSSDAQNCLIPMGVTSENVAEKYGISRETQD  206



>gb|KDO65879.1| hypothetical protein CISIN_1g0125222mg, partial [Citrus sinensis]
Length=335

 Score =   206 bits (525),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 111/138 (80%), Positives = 121/138 (88%), Gaps = 1/138 (1%)
 Frame = +2

Query  290  LLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAFYAGFPETVPVRTVNRQ  469
            LL SV +A+IEKT LNPSEVGDI+VGTVLAPGS RA ECRMAAFYAGFPETVP+RTVNRQ
Sbjct  16   LLFSV-QAVIEKTRLNPSEVGDIVVGTVLAPGSTRAMECRMAAFYAGFPETVPLRTVNRQ  74

Query  470  CSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNPRASTLQQAQNCLLPMG  649
            CSSGLQAVADVA AIKAG YDIGI AGLESMTVN+++  G VNP+     QA++CLLPMG
Sbjct  75   CSSGLQAVADVATAIKAGLYDIGIAAGLESMTVNSISVVGQVNPKVEIFTQARDCLLPMG  134

Query  650  ITSENVAHRFGVTRQEQD  703
            ITSENVA RFGVTRQEQD
Sbjct  135  ITSENVAQRFGVTRQEQD  152



>ref|XP_001418570.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO96863.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=417

 Score =   207 bits (527),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 101/166 (61%), Positives = 133/166 (80%), Gaps = 0/166 (0%)
 Frame = +2

Query  206  DDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPG  385
            DD+VIV+A RTP+ ++KRGG   T  DDL+A+VL+A + +  ++ ++VGDI+VG+VL   
Sbjct  27   DDVVIVSACRTPITRAKRGGLAATPADDLIAAVLQASVARGKIDVNDVGDIVVGSVLGAS  86

Query  386  SIRASECRMAAFYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMT  565
            S RA+ECR+  F AGFP+ VPVRT NRQCSSGLQA AD+AA IKAG+YD+GIGAG+E+MT
Sbjct  87   SQRANECRIGMFLAGFPKEVPVRTTNRQCSSGLQACADIAAGIKAGYYDMGIGAGVETMT  146

Query  566  VNTMAWEGSVNPRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQD  703
             N M WEG +NPR ++   AQNCL+PMGITSENVA ++G+TR+ QD
Sbjct  147  ANPMKWEGGINPRIASSSDAQNCLIPMGITSENVAEKWGITREAQD  192



>gb|KJB42403.1| hypothetical protein B456_007G152600 [Gossypium raimondii]
Length=372

 Score =   201 bits (511),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 106/135 (79%), Positives = 120/135 (89%), Gaps = 1/135 (1%)
 Frame = +2

Query  305  LKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAFYAGFPETVPVRTVNRQCSSGL  484
            ++A+I++T LNPSEVGDI+VGTVLAPGS RA ECRMAAFYAGFP+TVP+RTVNRQCSSGL
Sbjct  1    MQAVIDRTKLNPSEVGDIVVGTVLAPGSQRAMECRMAAFYAGFPDTVPIRTVNRQCSSGL  60

Query  485  QavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGS-VNPRASTLQQAQNCLLPMGITSE  661
            QAVADVAA IKAGFYDIGIGAGLESMT N  A + S VNP+  +  QA++CLLPMGITSE
Sbjct  61   QAVADVAACIKAGFYDIGIGAGLESMTTNGSAPDQSKVNPKVKSFAQARDCLLPMGITSE  120

Query  662  NVAHRFGVTRQEQDQ  706
            NVA R+GVTRQEQDQ
Sbjct  121  NVAQRYGVTRQEQDQ  135



>ref|XP_007513169.1| unknown [Bathycoccus prasinos]
 emb|CCO16727.1| unknown [Bathycoccus prasinos]
Length=448

 Score =   201 bits (510),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 97/169 (57%), Positives = 136/169 (80%), Gaps = 1/169 (1%)
 Frame = +2

Query  200  YGDDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKT-NLNPSEVGDIIVGTVL  376
            + DD+VIV A RTP+ ++++GG KDT  DDL+A+VL A + +T N+N +++GD++VG+VL
Sbjct  56   HPDDVVIVCALRTPITRARKGGLKDTTADDLVATVLAAALRETENINANDIGDVVVGSVL  115

Query  377  APGSIRASECRMAAFYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLE  556
               S RA+ECR+  F AGFP  VPVRTVNRQCSSGLQA ADVA+AIKAG+Y++GI AG+E
Sbjct  116  GDSSQRANECRIGMFLAGFPVKVPVRTVNRQCSSGLQACADVASAIKAGYYEVGIAAGVE  175

Query  557  SMTVNTMAWEGSVNPRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQD  703
            +M+ N M W+G  NP+A+++  AQNCL+PMG+TSENVA ++ ++R+ QD
Sbjct  176  TMSKNPMKWDGGFNPKAASVTNAQNCLIPMGVTSENVAAKWHISRETQD  224



>ref|XP_003080093.1| Dynein 1-alpha heavy chain, flagellar inner arm (IC) [Ostreococcus 
tauri]
Length=5068

 Score =   210 bits (535),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 101/166 (61%), Positives = 134/166 (81%), Gaps = 0/166 (0%)
 Frame = +2

Query  206   DDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPG  385
             DD+V+VAA RTP+ ++K+GG   T  DDL+A+VL+A   + N++PSEVGD++VG+VL   
Sbjct  4685  DDVVVVAACRTPITRAKKGGLAKTPADDLVAAVLQAATRRANIDPSEVGDVVVGSVLGSS  4744

Query  386   SIRASECRMAAFYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMT  565
             S RA+ECR+A F AGFP+ VPVRT NRQCSSG+QA AD+AA IKAG+YD+GIGAG+E+MT
Sbjct  4745  SQRANECRIAMFLAGFPKEVPVRTTNRQCSSGIQACADIAAGIKAGYYDVGIGAGVETMT  4804

Query  566   VNTMAWEGSVNPRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQD  703
              N M WEG  NPR ++   AQNCL+PMG+TSENVA ++G++R+ QD
Sbjct  4805  SNPMKWEGGFNPRVASSSDAQNCLIPMGVTSENVAEKYGISRETQD  4850



>ref|XP_008349049.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Malus 
domestica]
Length=129

 Score =   188 bits (478),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 89/126 (71%), Positives = 107/126 (85%), Gaps = 0/126 (0%)
 Frame = +2

Query  62   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  241
            A+ RQRVLLQHLRP ++ SS +    ++SAS+CAAG+SAAY R + +GDD+VIVAAYRT 
Sbjct  4    AMNRQRVLLQHLRPNSSVSSSNFESVALSASICAAGNSAAYHRTAAFGDDVVIVAAYRTA  63

Query  242  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  421
            +CK+KRGGFKDT PDDLLA VLK +IE+TNLNPSEVGDI+VGTV APGS+RA+ECRMAAF
Sbjct  64   ICKAKRGGFKDTLPDDLLAPVLKEVIERTNLNPSEVGDIVVGTVRAPGSLRATECRMAAF  123

Query  422  YAGFPE  439
            YA  P 
Sbjct  124  YASLPR  129



>ref|XP_002500295.1| acetyl-coa acyltransferase [Micromonas sp. RCC299]
 gb|ACO61553.1| acetyl-coa acyltransferase [Micromonas sp. RCC299]
Length=425

 Score =   193 bits (490),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 104/166 (63%), Positives = 139/166 (84%), Gaps = 0/166 (0%)
 Frame = +2

Query  206  DDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPG  385
            DDIV+V+A RTP+ ++K+GG KDT  DDL+A++LKA +++T L+ ++VGD++VG+VL   
Sbjct  36   DDIVVVSALRTPITRAKKGGLKDTPADDLVATLLKATVDRTGLDVNDVGDVVVGSVLGNS  95

Query  386  SIRASECRMAAFYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMT  565
            S RA+ECR+A F AGFP+ VPVRTVNRQCSSGLQA ADVAAAIKAG+YD+GI AG+E+MT
Sbjct  96   SQRANECRIAMFLAGFPQEVPVRTVNRQCSSGLQACADVAAAIKAGYYDVGIAAGVETMT  155

Query  566  VNTMAWEGSVNPRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQD  703
             N M WEG +NPR ++   AQ+CL+PMG+TSENVA R+ +TR++QD
Sbjct  156  SNPMKWEGGMNPRVASSSDAQSCLIPMGVTSENVAERWEITREQQD  201



>ref|XP_002591918.1| hypothetical protein BRAFLDRAFT_284464 [Branchiostoma floridae]
 gb|EEN47929.1| hypothetical protein BRAFLDRAFT_284464 [Branchiostoma floridae]
Length=430

 Score =   188 bits (477),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 101/167 (60%), Positives = 125/167 (75%), Gaps = 2/167 (1%)
 Frame = +2

Query  206  DDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPG  385
            DD+VI++A RTP+ K+ RG FKDT PDDLL SVLKA +E+TN+NPSE+GDI VG VL PG
Sbjct  39   DDVVIISALRTPIGKAARGSFKDTTPDDLLVSVLKATLERTNVNPSEIGDICVGNVLQPG  98

Query  386  SIRASECRMAAFYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMT  565
            +  A   R+A F AG PETVP+   NRQCSSGLQAV  VA +IKAG  D+ IGAG+ESM+
Sbjct  99   AGPAV-FRIAQFAAGIPETVPLSACNRQCSSGLQAVMHVANSIKAGVCDMAIGAGVESMS  157

Query  566  VNTMAWE-GSVNPRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQD  703
                  E G +NP     ++A++C++PMGITSENVA RFGVTR+ QD
Sbjct  158  KRKQGGEPGDLNPDNFKFEKARDCIIPMGITSENVAERFGVTRETQD  204



>ref|XP_643924.1| acetyl-CoA C-acyltransferase [Dictyostelium discoideum AX4]
 gb|EAL70062.1| acetyl-CoA C-acyltransferase [Dictyostelium discoideum AX4]
Length=416

 Score =   187 bits (474),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 97/168 (58%), Positives = 123/168 (73%), Gaps = 0/168 (0%)
 Frame = +2

Query  203  GDDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAP  382
            GDDIVIVA +RT +CK+KRG FK+T PDDLLA V+K +I+ T L+P  +GD+++G VL  
Sbjct  32   GDDIVIVAPFRTAICKAKRGAFKETAPDDLLAPVIKHIIKVTKLDPKLIGDVVMGAVLPR  91

Query  383  GSIRASECRMAAFYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESM  562
             S  A+E R+A   AG P+ VP  TVNRQCSSGLQA+A+ AAA+KAGFYDIG+  G+ESM
Sbjct  92   SSQGATEVRVATLLAGLPKEVPCYTVNRQCSSGLQAIANCAAAVKAGFYDIGLAGGVESM  151

Query  563  TVNTMAWEGSVNPRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
            ++N MAW+G  N  A        C   MG TSENVA RFGVTR++QD+
Sbjct  152  SLNPMAWDGGFNEVAQEDPIISGCYNTMGQTSENVAERFGVTRKDQDE  199



>ref|NP_001072686.1| 3-ketoacyl-CoA thiolase, peroxisomal [Xenopus (Silurana) tropicalis]
 gb|AAI24020.1| acetyl-Coenzyme A acyltransferase 1 [Xenopus (Silurana) tropicalis]
Length=419

 Score =   186 bits (473),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 101/213 (47%), Positives = 141/213 (66%), Gaps = 18/213 (8%)
 Frame = +2

Query  65   IERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTPL  244
            + R RV+L HL P N            S  + A   SAA  ++     DIVIVA  RTP+
Sbjct  1    MHRVRVVLGHL-PAN------------SRGIWAENSSAAADKS----QDIVIVAGRRTPI  43

Query  245  CKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAFY  424
            CK+KRGGFK+T PD+LL++V+ A++   NLNP  +GDI VG VL PG+  A   R+  F 
Sbjct  44   CKAKRGGFKETTPDELLSAVMTAVLNDVNLNPELLGDICVGNVLQPGA-GALVARIGQFL  102

Query  425  AGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNPR  604
            +G PE+VP+  VNRQCSSGLQA+ ++A  I+ G YD+G+  G+ESM++ ++   G ++ R
Sbjct  103  SGIPESVPLHVVNRQCSSGLQAIINIAGGIRNGSYDVGLACGVESMSLRSVGNPGDISSR  162

Query  605  ASTLQQAQNCLLPMGITSENVAHRFGVTRQEQD  703
                 +A++CL+PMGITSENVA RFG+TR++QD
Sbjct  163  TMDFSKARDCLIPMGITSENVAERFGITREKQD  195



>gb|ACF24566.1| acetyl-CoA acyltransferase [Gymnochlora stellata]
Length=269

 Score =   182 bits (461),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 92/166 (55%), Positives = 122/166 (73%), Gaps = 0/166 (0%)
 Frame = +2

Query  206  DDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPG  385
            + +VIV+A RT + ++++G FKDT  ++LLA V+KA + K  + PS VGD+IVG+VL P 
Sbjct  35   EKVVIVSALRTAIGRARKGSFKDTGVEELLAPVIKAALAKARVPPSMVGDVIVGSVLGPN  94

Query  386  SIRASECRMAAFYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMT  565
              RA+E R+A F AG P  VPV  VNRQCSSGLQA+A VAA IKAG+YD G+GAG+ESM+
Sbjct  95   VQRANEARIACFMAGLPHEVPVHVVNRQCSSGLQAIAHVAANIKAGYYDAGVGAGVESMS  154

Query  566  VNTMAWEGSVNPRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQD  703
            +  M WEG +NP+     + + CLLPMGITSENVA +F V R++ D
Sbjct  155  LAKMGWEGRINPKIFMDPKTKACLLPMGITSENVAKKFNVNRKDMD  200



>ref|XP_003724378.1| PREDICTED: 3-ketoacyl-CoA thiolase B, peroxisomal-like [Strongylocentrotus 
purpuratus]
Length=451

 Score =   186 bits (471),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 89/167 (53%), Positives = 123/167 (74%), Gaps = 1/167 (1%)
 Frame = +2

Query  206  DDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPG  385
            DD+V+V+A RTP+ K+++G FKDT PDDLLA+  K ++++T ++P  +GDI+VG VL PG
Sbjct  63   DDVVVVSALRTPIGKARKGSFKDTRPDDLLAAAFKGVLDETKISPDRLGDIVVGNVLLPG  122

Query  386  SIRASECRMAAFYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMT  565
               A   R A FY+G PE+VP+ TVNRQCSSGLQA  + A  IK+G YD+ + +G+ESM+
Sbjct  123  G-GAIHARFAQFYSGIPESVPINTVNRQCSSGLQAFMNAAGGIKSGVYDVAMASGVESMS  181

Query  566  VNTMAWEGSVNPRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
             + M     +NP+    Q  ++CL+PMGITSENVA +FGVTRQ+QDQ
Sbjct  182  RSPMYQGEDLNPKVMLDQTTKDCLIPMGITSENVAEKFGVTRQQQDQ  228



>gb|KDD73648.1| beta-ketoacyl-ACP synthase, partial [Helicosporidium sp. ATCC 
50920]
Length=427

 Score =   184 bits (468),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 89/167 (53%), Positives = 126/167 (75%), Gaps = 0/167 (0%)
 Frame = +2

Query  206  DDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPG  385
            DD+ IV+A RTPL KS RGG KDT   DL+A+VL   + +T ++P +VGD+++G+V+   
Sbjct  16   DDVCIVSACRTPLTKSNRGGLKDTPAHDLVAAVLAETVRRTGVDPKDVGDVVLGSVMGHS  75

Query  386  SIRASECRMAAFYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMT  565
            S RA+ECR+  F AGFP+TVPV TVNRQCSSGLQA+A VAAAIK+G+Y +GI  G+E+M+
Sbjct  76   SQRANECRIGMFLAGFPDTVPVHTVNRQCSSGLQAIASVAAAIKSGYYSVGIAGGVETMS  135

Query  566  VNTMAWEGSVNPRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
             + M WEG +    +   QA++C +PMG+TSENVA ++ ++R+ QD+
Sbjct  136  ADPMRWEGEIAENVAEHPQARDCFIPMGVTSENVAAQYHLSREVQDR  182



>ref|XP_005082434.1| PREDICTED: 3-ketoacyl-CoA thiolase B, peroxisomal-like [Mesocricetus 
auratus]
Length=286

 Score =   180 bits (457),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 102/215 (47%), Positives = 147/215 (68%), Gaps = 17/215 (8%)
 Frame = +2

Query  65   IERQRVLLQHL--RPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRT  238
            + R +V+L HL  RP ++        S++ A+ C+AG   A+        D+V+V   RT
Sbjct  1    MHRLQVVLGHLAGRPESS--------SALQAAPCSAGFRQAW------ASDVVVVHGRRT  46

Query  239  PLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAA  418
            P+ ++ RGGFKDT PD+LL++VL A+++   L P E+GDI VG VL PG+  A   R+A 
Sbjct  47   PIGRAGRGGFKDTTPDELLSAVLTAVLQDVKLKPEELGDISVGNVLQPGA-GAIMARIAQ  105

Query  419  FYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVN  598
            F +G PETVP+ T+NRQCSSGLQAVA++A  I+ G YDIG+  G+ESM+++     G+V+
Sbjct  106  FLSGIPETVPLSTINRQCSSGLQAVANIAGGIRNGSYDIGMACGVESMSLSDRGNPGNVS  165

Query  599  PRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQD  703
             R    ++A++CL+PMGITSENVA RFG++RQ+QD
Sbjct  166  SRLLENEKARDCLIPMGITSENVAERFGISRQKQD  200



>gb|AAL65399.1| 3-ketoacyl-CoA thiolase, partial [Oryza sativa Japonica Group]
Length=177

 Score =   176 bits (446),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 91/109 (83%), Positives = 98/109 (90%), Gaps = 0/109 (0%)
 Frame = +2

Query  380  PGSIRASECRMAAFYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLES  559
            PGS RA ECR AAFY G PE VPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLES
Sbjct  1    PGSQRAIECRAAAFYVGVPENVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLES  60

Query  560  MTVNTMAWEGSVNPRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
            M+VN M WEG VNP+ + +Q+AQ+CLLPMGITSENVAHR+GVTRQEQDQ
Sbjct  61   MSVNAMGWEGQVNPKVNEVQKAQDCLLPMGITSENVAHRYGVTRQEQDQ  109



>ref|XP_004349337.1| peroxisomal 3-ketoacyl-CoA thiolase B [Capsaspora owczarzaki 
ATCC 30864]
 gb|KJE91455.1| peroxisomal 3-ketoacyl-CoA thiolase B [Capsaspora owczarzaki 
ATCC 30864]
Length=423

 Score =   183 bits (464),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 93/168 (55%), Positives = 127/168 (76%), Gaps = 3/168 (2%)
 Frame = +2

Query  206  DDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPG  385
            DD+VIV+A RTP+ K+KRGGF+DT PDDLLA+ ++A +++ N++P  +GDI+VG VL PG
Sbjct  35   DDVVIVSAVRTPITKAKRGGFRDTPPDDLLAAAMQAAVQRANVDPKLIGDIVVGNVLQPG  94

Query  386  SIRASECRMAAFYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMT  565
            +  A   R A F+AG PET P+  VNRQCSSGLQA A++A++I+ G  DIG+ AG+ESMT
Sbjct  95   A-GALTSRFAQFFAGIPETTPIVAVNRQCSSGLQACANIASSIRFGTIDIGLAAGVESMT  153

Query  566  VNTM--AWEGSVNPRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQD  703
               M  +   ++NPR  T  +A +CL+PMGITSENVA R+GV+R +QD
Sbjct  154  QAPMTASVPENLNPRVGTNDKASDCLIPMGITSENVAARYGVSRADQD  201



>ref|NP_001080604.1| 3-ketoacyl-CoA thiolase, peroxisomal [Xenopus laevis]
 gb|AAH54299.1| Acaa1-prov protein [Xenopus laevis]
Length=419

 Score =   182 bits (461),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 100/213 (47%), Positives = 141/213 (66%), Gaps = 18/213 (8%)
 Frame = +2

Query  65   IERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTPL  244
            + R RV+L HL P N            S  V A   SA+  ++     DIVIVA  RTP+
Sbjct  1    MHRVRVVLGHL-PAN------------SRGVWAENSSASADKS----QDIVIVAGRRTPI  43

Query  245  CKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAFY  424
            CK+KRG FK+T PD+LL++V+ A+++  N++P  +GDI VG VL PG+  A   R+  F 
Sbjct  44   CKAKRGAFKETTPDELLSTVMTAVLKDVNVSPELLGDICVGNVLQPGA-GALVARIGQFL  102

Query  425  AGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNPR  604
            +G PE+VP+  VNRQCSSGLQA+ +VA  I+ G YDIG+  G+ESM++ ++   G ++ R
Sbjct  103  SGIPESVPIHVVNRQCSSGLQAIINVAGGIRNGSYDIGLACGMESMSLRSVGSPGDISSR  162

Query  605  ASTLQQAQNCLLPMGITSENVAHRFGVTRQEQD  703
                 +A++CL+PMGITSENVA +FGVTR++QD
Sbjct  163  TMDFSKARDCLIPMGITSENVAEKFGVTREKQD  195



>ref|XP_006512179.1| PREDICTED: 3-ketoacyl-CoA thiolase B, peroxisomal isoform X3 
[Mus musculus]
 gb|EDL09238.1| mCG21883, isoform CRA_c [Mus musculus]
Length=242

 Score =   176 bits (446),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 102/215 (47%), Positives = 145/215 (67%), Gaps = 17/215 (8%)
 Frame = +2

Query  65   IERQRVLLQHL--RPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRT  238
            + R +V+L HL  RP ++        S++ A+ C+AG   A         D+V+V   RT
Sbjct  1    MHRLQVVLGHLAGRPESS--------SALQAAPCSAGFLQAS------ASDVVVVHGRRT  46

Query  239  PLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAA  418
            P+ ++ RG FKDT PD+LL++VL A+++   L P ++GDI VG VL PG+  A   R+A 
Sbjct  47   PIGRASRGCFKDTTPDELLSAVLTAVLQDVKLKPEQLGDISVGNVLQPGA-GAIMARIAQ  105

Query  419  FYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVN  598
            F +G PETVP+ TVNRQCSSGLQAVA++A  I+ G YDIG+  G+ESMT++     G+++
Sbjct  106  FLSGIPETVPLSTVNRQCSSGLQAVANIAGGIRNGSYDIGMACGVESMTLSQRGNHGNIS  165

Query  599  PRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQD  703
             R    ++A++CL+PMGITSENVA RFGV+RQ+QD
Sbjct  166  SRLLENEKARDCLIPMGITSENVAERFGVSRQKQD  200



>ref|XP_008844714.1| PREDICTED: 3-ketoacyl-CoA thiolase B, peroxisomal [Nannospalax 
galili]
 ref|XP_008844715.1| PREDICTED: 3-ketoacyl-CoA thiolase B, peroxisomal [Nannospalax 
galili]
Length=424

 Score =   181 bits (459),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 102/213 (48%), Positives = 145/213 (68%), Gaps = 17/213 (8%)
 Frame = +2

Query  71   RQRVLLQHL--RPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTPL  244
            R +V+L HL  RP ++        S++ A+ C+AG   A        DD+V+V   RTP+
Sbjct  3    RLQVVLGHLAGRPGSS--------SALQAAPCSAGFPQAS------ADDVVVVHGRRTPI  48

Query  245  CKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAFY  424
             + +RGGFKDT PD+LL++VL A+++   L P ++GDI VG VL PG+  A   R+A F 
Sbjct  49   GRGRRGGFKDTTPDELLSAVLTAVLQDVKLKPEQLGDISVGNVLQPGA-GALMARIAQFL  107

Query  425  AGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNPR  604
            +G PETVP+ TVNRQCSSGLQAVA++A  I+ G YDIG+  G+ESM+++     G++  R
Sbjct  108  SGIPETVPLSTVNRQCSSGLQAVANIAGGIRNGSYDIGMACGVESMSLSDRGNPGNITSR  167

Query  605  ASTLQQAQNCLLPMGITSENVAHRFGVTRQEQD  703
                ++A++CL+PMGITSENVA RFG++RQ+QD
Sbjct  168  LLENEKAKDCLIPMGITSENVAERFGISRQKQD  200



>ref|XP_002742159.1| PREDICTED: 3-ketoacyl-CoA thiolase A, peroxisomal-like [Saccoglossus 
kowalevskii]
Length=428

 Score =   181 bits (458),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 95/214 (44%), Positives = 144/214 (67%), Gaps = 9/214 (4%)
 Frame = +2

Query  65   IERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTPL  244
            ++R R +  H       +++ ++  +  +++ +A  S          DD+VIV+A RTP+
Sbjct  1    MQRMRTIAGHFVAPAVGANISTLHPNDVSALASAALSGP--------DDVVIVSAKRTPI  52

Query  245  CKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAFY  424
            CK++RG FKDT PD LL +V+  ++++T ++P  +GDI VG VLA GS  A+  RMA F 
Sbjct  53   CKARRGSFKDTVPDALLEAVITRVLKETGIDPKYIGDIAVGNVLAEGS-GAAMARMAQFR  111

Query  425  AGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNPR  604
             G PETVP+  VNR CSSGLQAV ++AA IKAG YD G+G G+ESM+V     + ++NP+
Sbjct  112  CGLPETVPLHGVNRMCSSGLQAVMNIAAGIKAGLYDAGLGCGMESMSVYKQGSDTNINPK  171

Query  605  ASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
            +    +A++C++PMGITSENVA ++G+TR+ QD+
Sbjct  172  SFEFDKARDCMIPMGITSENVAEQYGITREMQDK  205



>gb|EDL76922.1| rCG25918, isoform CRA_a [Rattus norvegicus]
Length=232

 Score =   175 bits (444),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 100/213 (47%), Positives = 144/213 (68%), Gaps = 13/213 (6%)
 Frame = +2

Query  65   IERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTPL  244
            + R +V+L HL   + +SS      ++ A+ C+AG   A         D+V+V   RTP+
Sbjct  1    MHRLQVVLGHLAGRSESSS------ALQAAPCSAGFPQAS------ASDVVVVHGRRTPI  48

Query  245  CKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAFY  424
             ++ RGGFKDT PD+LL++VL A+++   L P  +GDI VG VL PG+  A+  R+A F 
Sbjct  49   GRAGRGGFKDTTPDELLSAVLTAVLQDVKLKPECLGDISVGNVLQPGA-GAAMARIAQFL  107

Query  425  AGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNPR  604
            +G PETVP+  VNRQCSSGLQAVA++A  I+ G YDIG+  G+ESMT++     G+++ R
Sbjct  108  SGIPETVPLSAVNRQCSSGLQAVANIAGGIRNGSYDIGMACGVESMTLSERGNPGNISSR  167

Query  605  ASTLQQAQNCLLPMGITSENVAHRFGVTRQEQD  703
                ++A++CL+PMGITSENVA RFG++RQ+QD
Sbjct  168  LLENEKARDCLIPMGITSENVAERFGISRQKQD  200



>ref|XP_005348140.1| PREDICTED: 3-ketoacyl-CoA thiolase B, peroxisomal-like isoform 
X1 [Microtus ochrogaster]
Length=424

 Score =   180 bits (456),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 102/215 (47%), Positives = 146/215 (68%), Gaps = 17/215 (8%)
 Frame = +2

Query  65   IERQRVLLQHL--RPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRT  238
            + R +V+L HL  RP ++        S++ A+ C+AG   A         D+V+V   RT
Sbjct  1    MHRLQVVLGHLAGRPESS--------SALQAAPCSAGFPQAS------ASDVVVVHGRRT  46

Query  239  PLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAA  418
            P+ +S RGGFKDT PD+LL++VL A+++  NL P ++GDI VG VL PG+  A   R+  
Sbjct  47   PIGRSGRGGFKDTTPDELLSAVLTAVLQDLNLRPEQLGDISVGNVLQPGA-GAVMARIGQ  105

Query  419  FYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVN  598
            F +G PETVP+ TVNRQCSSGLQAVA++A  I+ G YDIG+  G+ESM+++     G+++
Sbjct  106  FLSGIPETVPLSTVNRQCSSGLQAVANIAGGIRNGSYDIGMACGVESMSLSERGNPGNIS  165

Query  599  PRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQD  703
             R    ++A++CL+PMGITSENVA RFG++RQ+QD
Sbjct  166  SRLLENEKARDCLIPMGITSENVAERFGISRQKQD  200



>ref|XP_006986814.1| PREDICTED: 3-ketoacyl-CoA thiolase B, peroxisomal-like, partial 
[Peromyscus maniculatus bairdii]
Length=234

 Score =   175 bits (443),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 100/215 (47%), Positives = 144/215 (67%), Gaps = 17/215 (8%)
 Frame = +2

Query  65   IERQRVLLQHL--RPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRT  238
            + R +V+L HL  RP ++        S++ A+ C+AG   A         D+V+V   RT
Sbjct  1    MHRLQVVLGHLASRPESS--------SALQAAPCSAGFPQAS------ASDVVVVHGRRT  46

Query  239  PLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAA  418
            P+ ++ RGGFKDT PD+LL++V+ A+++   L P  +GDI VG VL PG+  A   R+A 
Sbjct  47   PIGRAGRGGFKDTTPDELLSAVMTAVLQDVKLKPELLGDISVGNVLQPGA-GAIPARIAQ  105

Query  419  FYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVN  598
            F +  PETVP+ TVNRQCSSGLQAVA++A  I+ G YDIG+  G+ESMT++     G+++
Sbjct  106  FLSDIPETVPLSTVNRQCSSGLQAVANIAGGIRNGSYDIGMACGVESMTLSQRGNPGNIS  165

Query  599  PRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQD  703
             R    ++A++CL+PMGITSENVA RFG++RQ+QD
Sbjct  166  SRLLENEKARDCLIPMGITSENVAERFGISRQKQD  200



>ref|XP_002111185.1| expressed hypothetical protein [Trichoplax adhaerens]
 gb|EDV27189.1| expressed hypothetical protein [Trichoplax adhaerens]
Length=433

 Score =   180 bits (456),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 94/178 (53%), Positives = 129/178 (72%), Gaps = 2/178 (1%)
 Frame = +2

Query  173  SAAYQRNSVYGDDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVG  352
            S+A + +  + DD+V+V+A RT +CK+ RG FKDT+P DLLA+   A++ +T ++P  +G
Sbjct  28   SSASKFSQPHPDDVVVVSAKRTAICKANRGSFKDTHPADLLAAAFNAVMNETKVDPEIIG  87

Query  353  DIIVGTVLAPGSIRASECRMAAFYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYD  532
            DI VG VL  GS  A   RM  FY G PET+P+ T NRQC+SGLQAVA++   IK G  D
Sbjct  88   DIQVGNVLHTGS-GAVLARMTQFYCGLPETIPLSTCNRQCASGLQAVANIIGEIKTGAID  146

Query  533  IGIGAGLESMTVNTMAWEGSV-NPRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQD  703
            +GIGAGLE+MT+  +A + +V  P+    + A++CL+PMGITSENVAHRFG+TRQ+QD
Sbjct  147  VGIGAGLENMTLQKVAADDTVLYPKLLENELAKDCLIPMGITSENVAHRFGITRQQQD  204



>ref|XP_007034451.1| Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 3 [Theobroma cacao]
 gb|EOY05377.1| Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 3 [Theobroma cacao]
Length=326

 Score =   177 bits (448),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 91/99 (92%), Positives = 94/99 (95%), Gaps = 0/99 (0%)
 Frame = +2

Query  410  MAAFYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEG  589
            MAAFYAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMT N MAWEG
Sbjct  1    MAAFYAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTTNPMAWEG  60

Query  590  SVNPRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQ  706
            SVNPR   ++QAQNCLLPMG+TSENVAHRFGVTRQEQDQ
Sbjct  61   SVNPRVKQMEQAQNCLLPMGVTSENVAHRFGVTRQEQDQ  99



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1401010927050