BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF044L19

Length=714
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

dbj|BAB88935.1|  glucosyltransferase                                    290   5e-92   Nicotiana tabacum [American tobacco]
ref|XP_009601422.1|  PREDICTED: crocetin glucosyltransferase, chl...    286   1e-90   Nicotiana tomentosiformis
ref|XP_009790237.1|  PREDICTED: crocetin glucosyltransferase, chl...    285   8e-90   Nicotiana sylvestris
dbj|BAG80544.1|  UDP-glucose:glucosyltransferase                        279   9e-88   Lycium barbarum [Duke of Argyll's teatree]
ref|XP_006358760.1|  PREDICTED: anthocyanidin 3-O-glucoside 5-O-g...    273   2e-85   Solanum tuberosum [potatoes]
ref|XP_006368000.1|  PREDICTED: anthocyanidin 3-O-glucoside 5-O-g...    271   9e-85   Solanum tuberosum [potatoes]
gb|AAK54465.1|  cold-induced glucosyl transferase                       268   2e-83   Solanum sogarandinum
ref|XP_004247894.1|  PREDICTED: crocetin glucosyltransferase, chl...    266   9e-83   
ref|XP_011069457.1|  PREDICTED: crocetin glucosyltransferase, chl...    255   1e-79   Sesamum indicum [beniseed]
ref|XP_002263700.1|  PREDICTED: crocetin glucosyltransferase, chl...    258   2e-79   Vitis vinifera
emb|CDP15112.1|  unnamed protein product                                249   3e-76   Coffea canephora [robusta coffee]
dbj|BAM28983.1|  UDP-glucose crocetin glucosyltransferase               246   9e-75   Gardenia jasminoides
sp|F8WKW0.1|UGT1_GARJA  RecName: Full=Crocetin glucosyltransferas...    245   1e-74   Gardenia jasminoides
ref|XP_010023602.1|  PREDICTED: crocetin glucosyltransferase, chl...    244   2e-74   
ref|XP_010243149.1|  PREDICTED: crocetin glucosyltransferase, chl...    244   4e-74   Nelumbo nucifera [Indian lotus]
ref|XP_010246531.1|  PREDICTED: crocetin glucosyltransferase, chl...    244   4e-74   Nelumbo nucifera [Indian lotus]
dbj|BAA89009.1|  anthocyanin 5-O-glucosyltransferase                    241   3e-73   Petunia x hybrida [garden petunia]
ref|XP_011101592.1|  PREDICTED: crocetin glucosyltransferase, chl...    239   3e-72   Sesamum indicum [beniseed]
gb|KDP32582.1|  hypothetical protein JCGZ_13132                         238   8e-72   Jatropha curcas
ref|XP_002262883.1|  PREDICTED: crocetin glucosyltransferase, chl...    238   1e-71   Vitis vinifera
emb|CAN67608.1|  hypothetical protein VITISV_036779                     238   1e-71   Vitis vinifera
ref|XP_006349903.1|  PREDICTED: anthocyanidin 3-O-glucoside 5-O-g...    236   3e-71   Solanum tuberosum [potatoes]
ref|XP_010023603.1|  PREDICTED: crocetin glucosyltransferase, chl...    236   3e-71   Eucalyptus grandis [rose gum]
gb|EYU31587.1|  hypothetical protein MIMGU_mgv1a018203mg                235   1e-70   Erythranthe guttata [common monkey flower]
ref|XP_011081386.1|  PREDICTED: crocetin glucosyltransferase, chl...    235   2e-70   Sesamum indicum [beniseed]
gb|EYU31586.1|  hypothetical protein MIMGU_mgv1a005918mg                233   5e-70   Erythranthe guttata [common monkey flower]
ref|XP_004252978.1|  PREDICTED: crocetin glucosyltransferase, chl...    231   4e-69   Solanum lycopersicum
ref|XP_010673328.1|  PREDICTED: crocetin glucosyltransferase, chl...    229   3e-68   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010246537.1|  PREDICTED: crocetin glucosyltransferase, chl...    229   4e-68   Nelumbo nucifera [Indian lotus]
dbj|BAF75879.1|  glucosyltransferase                                    227   1e-67   Dianthus caryophyllus [carnation]
gb|EYU31588.1|  hypothetical protein MIMGU_mgv1a005398mg                226   5e-67   Erythranthe guttata [common monkey flower]
ref|XP_007034186.1|  UDP-glucose:flavonoid 7-O-glucosyltransferase      224   1e-66   
ref|XP_002301753.1|  INDOLE-3-ACETATE BETA-D-GLUCOSYLTRANSFERASE ...    223   5e-66   Populus trichocarpa [western balsam poplar]
gb|AJM89728.1|  UDP-glucosyltransferase                                 222   9e-66   Leonurus japonicus [Chinese motherwort]
emb|CDP15111.1|  unnamed protein product                                222   1e-65   Coffea canephora [robusta coffee]
ref|XP_011024782.1|  PREDICTED: crocetin glucosyltransferase, chl...    221   2e-65   Populus euphratica
ref|XP_004298223.1|  PREDICTED: crocetin glucosyltransferase, chl...    220   7e-65   Fragaria vesca subsp. vesca
ref|XP_007099701.1|  UDP-glucose:flavonoid 7-O-glucosyltransferase      218   3e-64   
ref|XP_002322699.1|  hypothetical protein POPTR_0016s05290g             216   2e-63   
ref|XP_002308970.1|  putative glucosyltransferase family protein        215   5e-63   
ref|XP_011033298.1|  PREDICTED: crocetin glucosyltransferase, chl...    214   2e-62   Populus euphratica
ref|XP_002301754.1|  hypothetical protein POPTR_0002s23770g             213   3e-62   
ref|XP_011020320.1|  PREDICTED: crocetin glucosyltransferase, chl...    213   3e-62   Populus euphratica
ref|XP_002321086.2|  INDOLE-3-ACETATE BETA-D-GLUCOSYLTRANSFERASE ...    213   3e-62   
gb|KJB28073.1|  hypothetical protein B456_005G025400                    210   4e-61   Gossypium raimondii
gb|KJB28074.1|  hypothetical protein B456_005G025500                    210   4e-61   Gossypium raimondii
gb|KJB28077.1|  hypothetical protein B456_005G025900                    209   7e-61   Gossypium raimondii
ref|XP_003552552.1|  PREDICTED: anthocyanidin 3-O-glucoside 5-O-g...    208   2e-60   Glycine max [soybeans]
ref|XP_008222736.1|  PREDICTED: anthocyanidin 3-O-glucoside 5-O-g...    206   2e-59   Prunus mume [ume]
ref|XP_004297003.2|  PREDICTED: crocetin glucosyltransferase, chl...    207   2e-59   Fragaria vesca subsp. vesca
ref|XP_010434517.1|  PREDICTED: UDP-glycosyltransferase 75D1            206   2e-59   Camelina sativa [gold-of-pleasure]
ref|XP_010246964.1|  PREDICTED: crocetin glucosyltransferase, chl...    206   2e-59   Nelumbo nucifera [Indian lotus]
ref|XP_007221319.1|  hypothetical protein PRUPE_ppa021645mg             204   5e-59   Prunus persica
ref|XP_002516389.1|  UDP-glucosyltransferase, putative                  204   7e-59   Ricinus communis
dbj|BAF03079.1|  UDP-glucose:flavonol 5-O-glucosyltransferase hom...    201   8e-59   Solanum melongena [aubergine]
gb|KJB28079.1|  hypothetical protein B456_005G026100                    205   1e-58   Gossypium raimondii
gb|EYU27003.1|  hypothetical protein MIMGU_mgv1a024986mg                202   2e-58   Erythranthe guttata [common monkey flower]
ref|XP_002266800.1|  PREDICTED: crocetin glucosyltransferase, chl...    197   2e-58   Vitis vinifera
ref|XP_007221281.1|  hypothetical protein PRUPE_ppa005161mg             203   3e-58   Prunus persica
ref|XP_007221288.1|  hypothetical protein PRUPE_ppa016890mg             202   5e-58   Prunus persica
gb|AAX16493.1|  UDP-glucose:flavonoid 7-O-glucosyltransferase           202   7e-58   Malus domestica [apple tree]
ref|XP_008380455.1|  PREDICTED: anthocyanidin 3-O-glucoside 5-O-g...    201   9e-58   
gb|KJB28080.1|  hypothetical protein B456_005G026200                    203   1e-57   Gossypium raimondii
ref|XP_008380456.1|  PREDICTED: anthocyanidin 3-O-glucoside 5-O-g...    200   4e-57   Malus domestica [apple tree]
gb|AAY27090.1|  UDP-glucose:flavonoid 7-O-glucosyltransferase           199   1e-56   Pyrus communis
ref|XP_002267330.2|  PREDICTED: crocetin glucosyltransferase, chl...    199   1e-56   Vitis vinifera
emb|CAN77410.1|  hypothetical protein VITISV_038710                     194   1e-56   Vitis vinifera
ref|XP_006285715.1|  hypothetical protein CARUB_v10007186mg             198   1e-56   Capsella rubella
ref|XP_007163802.1|  hypothetical protein PHAVU_001G265400g             199   2e-56   Phaseolus vulgaris [French bean]
ref|XP_009373578.1|  PREDICTED: crocetin glucosyltransferase, chl...    198   2e-56   
ref|XP_008348418.1|  PREDICTED: anthocyanidin 3-O-glucoside 5-O-g...    198   2e-56   Malus domestica [apple tree]
ref|XP_006282963.1|  hypothetical protein CARUB_v10007692mg             197   2e-56   Capsella rubella
emb|CAN76093.1|  hypothetical protein VITISV_027116                     197   3e-56   Vitis vinifera
emb|CBI39398.3|  unnamed protein product                                196   4e-56   Vitis vinifera
emb|CDY09068.1|  BnaC08g10220D                                          197   4e-56   Brassica napus [oilseed rape]
emb|CBI39391.3|  unnamed protein product                                195   6e-56   Vitis vinifera
ref|NP_567471.1|  UDP-glucose:indole-3-acetate beta-D-glucosyltra...    196   6e-56   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010440288.1|  PREDICTED: UDP-glycosyltransferase 75D1-like       196   6e-56   Camelina sativa [gold-of-pleasure]
gb|AAB58497.1|  UDP-glucose:indole-3-acetate beta-D-glucosyltrans...    196   7e-56   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010099953.1|  UDP-glycosyltransferase 75D1                       197   8e-56   Morus notabilis
ref|XP_008222735.1|  PREDICTED: anthocyanidin 3-O-glucoside 5-O-g...    196   9e-56   Prunus mume [ume]
ref|XP_002267526.1|  PREDICTED: crocetin glucosyltransferase, chl...    196   9e-56   Vitis vinifera
ref|XP_009373577.1|  PREDICTED: crocetin glucosyltransferase, chl...    196   1e-55   
ref|XP_002266628.2|  PREDICTED: crocetin glucosyltransferase, chl...    196   1e-55   
emb|CDP15115.1|  unnamed protein product                                195   1e-55   Coffea canephora [robusta coffee]
ref|XP_003632054.2|  PREDICTED: crocetin glucosyltransferase, chl...    195   1e-55   
ref|XP_002263498.1|  PREDICTED: crocetin glucosyltransferase, chl...    195   2e-55   Vitis vinifera
ref|XP_002266967.1|  PREDICTED: crocetin glucosyltransferase, chl...    195   2e-55   Vitis vinifera
gb|KJB28076.1|  hypothetical protein B456_005G025700                    195   2e-55   Gossypium raimondii
ref|XP_002266919.1|  PREDICTED: crocetin glucosyltransferase, chl...    195   2e-55   Vitis vinifera
ref|XP_009337747.1|  PREDICTED: crocetin glucosyltransferase, chl...    195   2e-55   Pyrus x bretschneideri [bai li]
ref|XP_002263975.1|  PREDICTED: crocetin glucosyltransferase, chl...    195   2e-55   Vitis vinifera
emb|CDP15120.1|  unnamed protein product                                195   2e-55   Coffea canephora [robusta coffee]
ref|XP_009373576.1|  PREDICTED: crocetin glucosyltransferase, chl...    197   3e-55   
ref|XP_010434952.1|  PREDICTED: UDP-glycosyltransferase 75D1-like       195   3e-55   Camelina sativa [gold-of-pleasure]
ref|XP_010023609.1|  PREDICTED: crocetin glucosyltransferase, chl...    194   6e-55   Eucalyptus grandis [rose gum]
gb|ABQ02258.1|  O-glucosyltransferase 3                                 194   6e-55   Vitis labrusca [Concord grape]
emb|CBI39388.3|  unnamed protein product                                195   2e-54   Vitis vinifera
emb|CAN62622.1|  hypothetical protein VITISV_001655                     192   2e-54   Vitis vinifera
ref|XP_008380454.1|  PREDICTED: anthocyanidin 3-O-glucoside 5-O-g...    192   2e-54   Malus domestica [apple tree]
emb|CAN75179.1|  hypothetical protein VITISV_018406                     193   2e-54   Vitis vinifera
ref|XP_010650395.1|  PREDICTED: crocetin glucosyltransferase, chl...    193   2e-54   Vitis vinifera
gb|ADG45874.1|  UDP-glucosyltransferase                                 192   3e-54   Isatis tinctoria [woad]
ref|XP_010023606.1|  PREDICTED: crocetin glucosyltransferase, chl...    192   3e-54   Eucalyptus grandis [rose gum]
emb|CDP15119.1|  unnamed protein product                                191   4e-54   Coffea canephora [robusta coffee]
ref|XP_009107847.1|  PREDICTED: UDP-glycosyltransferase 75D1-like...    192   4e-54   Brassica rapa
dbj|BAF96596.1|  UDP-glucose:anthocysnin 5-O-glucosyltransferase        189   5e-54   Rosa hybrid cultivar
ref|XP_009107846.1|  PREDICTED: UDP-glycosyltransferase 75D1-like...    191   5e-54   Brassica rapa
ref|XP_010549173.1|  PREDICTED: UDP-glycosyltransferase 75D1            191   5e-54   Tarenaya hassleriana [spider flower]
ref|XP_010650447.1|  PREDICTED: crocetin glucosyltransferase, chl...    194   6e-54   Vitis vinifera
ref|XP_004297014.1|  PREDICTED: crocetin glucosyltransferase, chl...    191   7e-54   Fragaria vesca subsp. vesca
emb|CAN62624.1|  hypothetical protein VITISV_001657                     190   1e-53   Vitis vinifera
ref|XP_010100065.1|  UDP-glycosyltransferase 75D1                       189   1e-53   
ref|XP_002263422.1|  PREDICTED: crocetin glucosyltransferase, chl...    190   1e-53   Vitis vinifera
ref|XP_008355875.1|  PREDICTED: UDP-glycosyltransferase 75D1-like       185   1e-53   
ref|XP_010023605.1|  PREDICTED: crocetin glucosyltransferase, chl...    189   2e-53   Eucalyptus grandis [rose gum]
ref|XP_006421040.1|  hypothetical protein CICLE_v10004909mg             189   3e-53   Citrus clementina [clementine]
ref|XP_010434494.1|  PREDICTED: UDP-glycosyltransferase 75D1-like       189   6e-53   Camelina sativa [gold-of-pleasure]
ref|XP_006478536.1|  PREDICTED: UDP-glycosyltransferase 75D1-like       183   8e-53   
ref|XP_010650398.1|  PREDICTED: crocetin glucosyltransferase, chl...    187   1e-52   Vitis vinifera
gb|KJB28075.1|  hypothetical protein B456_005G025600                    187   2e-52   Gossypium raimondii
ref|XP_007034187.1|  Indole-3-acetate beta-D-glucosyltransferase,...    187   2e-52   
gb|KDO43225.1|  hypothetical protein CISIN_1g036740mg                   186   2e-52   Citrus sinensis [apfelsine]
emb|CBI39411.3|  unnamed protein product                                182   2e-52   Vitis vinifera
ref|XP_006492998.1|  PREDICTED: UDP-glycosyltransferase 75D1-like       187   2e-52   Citrus sinensis [apfelsine]
ref|XP_003601706.1|  UDP-glucose glucosyltransferase                    186   6e-52   Medicago truncatula
sp|Q9ZR27.1|5GT1_PERFR  RecName: Full=Anthocyanidin 3-O-glucoside...    186   8e-52   Perilla frutescens [beefsteak-mint]
ref|XP_006442002.1|  hypothetical protein CICLE_v10019912mg             186   1e-51   Citrus clementina [clementine]
ref|XP_003601705.1|  O-glucosyltransferase                              185   1e-51   Medicago truncatula
ref|XP_003601707.1|  UDP-glucuronosyltransferase 1-6                    185   1e-51   Medicago truncatula
gb|ABL85474.1|  glycosyltransferase UGT75L4                             185   1e-51   Maclura pomifera
ref|XP_002868197.1|  indole-3-acetate beta-D-glucosyltransferase        185   2e-51   Arabidopsis lyrata subsp. lyrata
ref|XP_010434953.1|  PREDICTED: UDP-glycosyltransferase 75D1-like       184   5e-51   Camelina sativa [gold-of-pleasure]
ref|XP_002263301.1|  PREDICTED: crocetin glucosyltransferase, chl...    183   7e-51   Vitis vinifera
ref|XP_006442000.1|  hypothetical protein CICLE_v10023445mg             184   7e-51   
ref|XP_008359982.1|  PREDICTED: UDP-glycosyltransferase 75D1-like       176   1e-50   
ref|XP_004502258.1|  PREDICTED: UDP-glycosyltransferase 75D1-like       181   3e-50   Cicer arietinum [garbanzo]
emb|CBI36304.3|  unnamed protein product                                177   4e-50   Vitis vinifera
ref|XP_008380634.1|  PREDICTED: anthocyanidin 3-O-glucoside 5-O-g...    181   5e-50   Malus domestica [apple tree]
ref|XP_003629628.1|  UDP-glucose flavonoid 7-O-glucosyltransferase      180   1e-49   Medicago truncatula
ref|XP_010096066.1|  UDP-glycosyltransferase 75D1                       180   1e-49   Morus notabilis
gb|KCW45598.1|  hypothetical protein EUGRSUZ_L006311                    173   1e-49   Eucalyptus grandis [rose gum]
ref|XP_010039961.1|  PREDICTED: UDP-glycosyltransferase 75D1-like       172   1e-49   
gb|AFI71902.1|  flavonol 5-O-glucosyltransferase                        179   2e-49   Paeonia lactiflora [common garden peony]
gb|KDP32590.1|  hypothetical protein JCGZ_13140                         179   2e-49   Jatropha curcas
gb|AHL68667.1|  UDP-glucose: anthocyanin 5-O-glucosyltransferase        179   3e-49   Vitis amurensis
ref|XP_010103920.1|  UDP-glycosyltransferase 75D1                       179   3e-49   Morus notabilis
ref|XP_006414807.1|  hypothetical protein EUTSA_v10025167mg             177   7e-49   Eutrema salsugineum [saltwater cress]
gb|AFJ52962.1|  UDP-glycosyltransferase 1                               178   1e-48   Linum usitatissimum
dbj|BAG80545.1|  UDP-glucose:glucosyltransferase                        177   1e-48   Lycium barbarum [Duke of Argyll's teatree]
sp|Q9ZR26.1|5GT2_PERFR  RecName: Full=Anthocyanidin 3-O-glucoside...    177   1e-48   Perilla frutescens [beefsteak-mint]
ref|XP_004247895.1|  PREDICTED: crocetin glucosyltransferase, chl...    177   2e-48   Solanum lycopersicum
ref|XP_004298222.1|  PREDICTED: crocetin glucosyltransferase, chl...    177   2e-48   Fragaria vesca subsp. vesca
ref|XP_010915038.1|  PREDICTED: crocetin glucosyltransferase, chl...    176   2e-48   Elaeis guineensis
ref|XP_010039945.1|  PREDICTED: crocetin glucosyltransferase, chl...    176   2e-48   Eucalyptus grandis [rose gum]
gb|AAL69494.1|  putative glucosyltransferase                            176   2e-48   Arabidopsis thaliana [mouse-ear cress]
ref|NP_193146.1|  anthocyanin 5-O-glucosyltransferase                   176   2e-48   Arabidopsis thaliana [mouse-ear cress]
dbj|BAE98677.1|  glucosyltransferase like protein                       176   3e-48   Arabidopsis thaliana [mouse-ear cress]
sp|Q9ZR25.1|5GT_VERHY  RecName: Full=Anthocyanidin 3-O-glucoside ...    176   4e-48   Glandularia x hybrida [garden verbena]
ref|XP_010246963.1|  PREDICTED: crocetin glucosyltransferase, chl...    175   4e-48   Nelumbo nucifera [Indian lotus]
ref|XP_010527436.1|  PREDICTED: UDP-glycosyltransferase 75C1 isof...    175   6e-48   Tarenaya hassleriana [spider flower]
ref|XP_009787090.1|  PREDICTED: crocetin glucosyltransferase, chl...    175   6e-48   Nicotiana sylvestris
gb|KCW76863.1|  hypothetical protein EUGRSUZ_D01218                     174   6e-48   Eucalyptus grandis [rose gum]
ref|XP_002868314.1|  UDP-glucoronosyl/UDP-glucosyl transferase fa...    174   9e-48   Arabidopsis lyrata subsp. lyrata
ref|XP_010052789.1|  PREDICTED: crocetin glucosyltransferase, chl...    174   1e-47   Eucalyptus grandis [rose gum]
ref|XP_010068983.1|  PREDICTED: crocetin glucosyltransferase, chl...    174   1e-47   Eucalyptus grandis [rose gum]
ref|XP_009778637.1|  PREDICTED: crocetin glucosyltransferase, chl...    174   1e-47   Nicotiana sylvestris
ref|XP_010039940.1|  PREDICTED: crocetin glucosyltransferase, chl...    174   1e-47   Eucalyptus grandis [rose gum]
emb|CDX68805.1|  BnaC01g06480D                                          173   2e-47   
gb|KFK39474.1|  hypothetical protein AALP_AA3G248900                    174   2e-47   Arabis alpina [alpine rockcress]
gb|AFW80209.1|  hypothetical protein ZEAMMB73_447013                    174   2e-47   
ref|XP_004504379.1|  PREDICTED: UDP-glycosyltransferase 75D1-like       174   2e-47   Cicer arietinum [garbanzo]
emb|CDY22742.1|  BnaA08g05720D                                          174   2e-47   Brassica napus [oilseed rape]
dbj|BAP90370.1|  UDP-glycose: glycosyltransferase UGT75R1               173   3e-47   Fagopyrum esculentum
ref|XP_009107848.1|  PREDICTED: UDP-glycosyltransferase 75D1-like       173   3e-47   Brassica rapa
emb|CDY21979.1|  BnaC09g00850D                                          173   4e-47   Brassica napus [oilseed rape]
ref|XP_008793436.1|  PREDICTED: cyanidin 3-O-rutinoside 5-O-gluco...    172   7e-47   Phoenix dactylifera
ref|XP_008793440.1|  PREDICTED: cyanidin 3-O-rutinoside 5-O-gluco...    172   7e-47   Phoenix dactylifera
ref|XP_009146925.1|  PREDICTED: UDP-glycosyltransferase 75D1-like       172   7e-47   Brassica rapa
emb|CDX90584.1|  BnaA03g41970D                                          174   8e-47   
ref|XP_010069411.1|  PREDICTED: crocetin glucosyltransferase, chl...    172   9e-47   Eucalyptus grandis [rose gum]
ref|XP_009403483.1|  PREDICTED: cyanidin 3-O-rutinoside 5-O-gluco...    172   1e-46   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAD90935.1|  monoterpene glucosyltransferase                        171   2e-46   Eucalyptus perriniana
ref|XP_010925530.1|  PREDICTED: crocetin glucosyltransferase, chl...    167   2e-46   
emb|CDY22902.1|  BnaA01g18400D                                          171   3e-46   Brassica napus [oilseed rape]
dbj|BAC54093.1|  anthocyanin 5-glucosyltransferase                      171   3e-46   Torenia hybrid cultivar
emb|CDY65144.1|  BnaC01g41850D                                          171   3e-46   Brassica napus [oilseed rape]
ref|XP_009622554.1|  PREDICTED: crocetin glucosyltransferase, chl...    171   3e-46   Nicotiana tomentosiformis
gb|AFJ52963.1|  UDP-glycosyltransferase 1                               171   3e-46   Linum usitatissimum
ref|XP_010522273.1|  PREDICTED: UDP-glycosyltransferase 75B2-like       172   3e-46   Tarenaya hassleriana [spider flower]
emb|CDY09069.1|  BnaC08g10230D                                          170   4e-46   Brassica napus [oilseed rape]
ref|XP_008793438.1|  PREDICTED: cyanidin 3-O-rutinoside 5-O-gluco...    169   8e-46   Phoenix dactylifera
ref|XP_010039944.1|  PREDICTED: crocetin glucosyltransferase, chl...    169   9e-46   Eucalyptus grandis [rose gum]
ref|XP_010925318.1|  PREDICTED: crocetin glucosyltransferase, chl...    169   9e-46   Elaeis guineensis
ref|XP_006414486.1|  hypothetical protein EUTSA_v10027441mg             169   1e-45   Eutrema salsugineum [saltwater cress]
ref|XP_009108098.1|  PREDICTED: UDP-glycosyltransferase 75C1            169   1e-45   Brassica rapa
ref|XP_010450109.1|  PREDICTED: UDP-glycosyltransferase 75C1            169   1e-45   Camelina sativa [gold-of-pleasure]
emb|CDY27124.1|  BnaA08g07620D                                          169   1e-45   Brassica napus [oilseed rape]
ref|XP_010435193.1|  PREDICTED: UDP-glycosyltransferase 75C1-like       169   1e-45   Camelina sativa [gold-of-pleasure]
ref|XP_009590508.1|  PREDICTED: crocetin glucosyltransferase, chl...    169   1e-45   
ref|XP_010450127.1|  PREDICTED: UDP-glycosyltransferase 75C1-like       168   2e-45   Camelina sativa [gold-of-pleasure]
gb|ACM66950.1|  flavonoid glucosyltransferase                           169   2e-45   Crocus sativus [saffron crocus]
ref|XP_009612652.1|  PREDICTED: crocetin glucosyltransferase, chl...    169   2e-45   
gb|KFK36297.1|  hypothetical protein AALP_AA4G104100                    168   2e-45   Arabis alpina [alpine rockcress]
ref|XP_006282890.1|  hypothetical protein CARUB_v10007134mg             168   2e-45   Capsella rubella
emb|CDY12370.1|  BnaC08g08350D                                          168   3e-45   Brassica napus [oilseed rape]
ref|XP_003532736.2|  PREDICTED: anthocyanidin 3-O-glucoside 5-O-g...    168   4e-45   
dbj|BAF49301.1|  putative glycosyltransferase                           167   7e-45   Clitoria ternatea
ref|XP_004252977.1|  PREDICTED: crocetin glucosyltransferase, chl...    166   1e-44   Solanum lycopersicum
ref|XP_009403481.1|  PREDICTED: crocetin glucosyltransferase, chl...    166   1e-44   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004247896.2|  PREDICTED: crocetin glucosyltransferase, chl...    166   1e-44   Solanum lycopersicum
ref|XP_010023610.1|  PREDICTED: crocetin glucosyltransferase, chl...    166   2e-44   
ref|XP_008458143.1|  PREDICTED: anthocyanidin 3-O-glucoside 5-O-g...    166   2e-44   Cucumis melo [Oriental melon]
gb|EYU32718.1|  hypothetical protein MIMGU_mgv1a005538mg                166   3e-44   Erythranthe guttata [common monkey flower]
gb|KCW57186.1|  hypothetical protein EUGRSUZ_H00001                     164   3e-44   Eucalyptus grandis [rose gum]
ref|XP_008787452.1|  PREDICTED: cyanidin 3-O-rutinoside 5-O-gluco...    165   6e-44   
gb|KGN46579.1|  hypothetical protein Csa_6G109740                       164   6e-44   Cucumis sativus [cucumbers]
ref|XP_004140604.1|  PREDICTED: UDP-glycosyltransferase 75C1-like       164   6e-44   
ref|XP_010025793.1|  PREDICTED: crocetin glucosyltransferase, chl...    163   6e-44   Eucalyptus grandis [rose gum]
gb|KJB18350.1|  hypothetical protein B456_003G047900                    164   8e-44   Gossypium raimondii
ref|XP_006342284.1|  PREDICTED: anthocyanidin 3-O-glucoside 5-O-g...    164   8e-44   Solanum tuberosum [potatoes]
dbj|BAF49300.1|  putative glycosyltransferase                           164   1e-43   Clitoria ternatea
ref|XP_003531212.1|  PREDICTED: anthocyanidin 3-O-glucoside 5-O-g...    163   2e-43   Glycine max [soybeans]
dbj|BAF49286.1|  anthocyanin 5-O-glucosyltransferase                    163   2e-43   Eustoma exaltatum subsp. russellianum [bluebells]
dbj|BAF49285.1|  anthocyanin 5-O-glucosyltransferase                    163   2e-43   Eustoma exaltatum subsp. russellianum [bluebells]
ref|XP_006349902.1|  PREDICTED: anthocyanidin 3-O-glucoside 5-O-g...    162   2e-43   Solanum tuberosum [potatoes]
dbj|BAD67837.1|  putative glucosyltransferase                           162   4e-43   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001042201.2|  Os01g0179600                                       162   4e-43   
ref|XP_004162387.1|  PREDICTED: UDP-glycosyltransferase 75C1-like       162   5e-43   
ref|XP_002455067.1|  hypothetical protein SORBIDRAFT_03g003760          162   6e-43   Sorghum bicolor [broomcorn]
emb|CAB10333.1|  glucosyltransferase like protein                       161   7e-43   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008793435.1|  PREDICTED: cyanidin 3-O-rutinoside 5-O-gluco...    161   1e-42   
gb|EAY72781.1|  hypothetical protein OsI_00644                          161   1e-42   Oryza sativa Indica Group [Indian rice]
gb|EAZ10778.1|  hypothetical protein OsJ_00613                          161   1e-42   Oryza sativa Japonica Group [Japonica rice]
emb|CDY22741.1|  BnaA08g05710D                                          160   2e-42   Brassica napus [oilseed rape]
ref|XP_003524181.2|  PREDICTED: anthocyanidin 3-O-glucoside 5-O-g...    160   2e-42   Glycine max [soybeans]
ref|XP_009612650.1|  PREDICTED: crocetin glucosyltransferase, chl...    160   2e-42   Nicotiana tomentosiformis
dbj|BAA19155.1|  glucosyl transferase                                   160   3e-42   Nicotiana tabacum [American tobacco]
ref|XP_003629629.1|  UDP-glucose glucosyltransferase                    156   4e-42   
dbj|BAJ95093.1|  predicted protein                                      159   5e-42   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009765809.1|  PREDICTED: crocetin glucosyltransferase, chl...    159   5e-42   Nicotiana sylvestris
ref|XP_003524180.1|  PREDICTED: anthocyanidin 3-O-glucoside 5-O-g...    159   7e-42   Glycine max [soybeans]
gb|AFW77394.1|  hypothetical protein ZEAMMB73_095823                    159   1e-41   
ref|XP_004140483.1|  PREDICTED: UDP-glycosyltransferase 75D1-like       158   1e-41   Cucumis sativus [cucumbers]
ref|XP_008649430.1|  PREDICTED: cyanidin 3-O-rutinoside 5-O-gluco...    159   2e-41   
ref|XP_008458144.1|  PREDICTED: anthocyanidin 3-O-glucoside 5-O-g...    158   2e-41   Cucumis melo [Oriental melon]
emb|CDM81835.1|  unnamed protein product                                158   2e-41   Triticum aestivum [Canadian hard winter wheat]
emb|CDY09070.1|  BnaC08g10240D                                          157   3e-41   Brassica napus [oilseed rape]
ref|XP_004229323.2|  PREDICTED: crocetin glucosyltransferase, chl...    157   5e-41   
ref|XP_010230853.1|  PREDICTED: crocetin glucosyltransferase, chl...    157   5e-41   Brachypodium distachyon [annual false brome]
dbj|BAD90934.1|  monoterpene glucosyltransferase                        156   6e-41   Eucalyptus perriniana
dbj|BAG80537.1|  putative glycosyltransferase                           156   8e-41   Lycium barbarum [Duke of Argyll's teatree]
ref|XP_008791887.1|  PREDICTED: cyanidin 3-O-rutinoside 5-O-gluco...    155   2e-40   Phoenix dactylifera
ref|XP_010915126.1|  PREDICTED: LOW QUALITY PROTEIN: crocetin glu...    158   2e-40   
ref|XP_006373112.1|  hypothetical protein POPTR_0017s08830g             147   3e-40   
ref|NP_001057976.1|  Os06g0593200                                       154   4e-40   
emb|CDP20001.1|  unnamed protein product                                154   4e-40   Coffea canephora [robusta coffee]
ref|XP_004242781.1|  PREDICTED: crocetin glucosyltransferase, chl...    154   4e-40   Solanum lycopersicum
ref|XP_008673623.1|  PREDICTED: cyanidin 3-O-rutinoside 5-O-gluco...    154   4e-40   
gb|KCW57754.1|  hypothetical protein EUGRSUZ_H00503                     152   6e-40   Eucalyptus grandis [rose gum]
dbj|BAJ96117.1|  predicted protein                                      153   1e-39   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KFK42892.1|  hypothetical protein AALP_AA1G052200                    152   2e-39   Arabis alpina [alpine rockcress]
emb|CDP20003.1|  unnamed protein product                                152   2e-39   Coffea canephora [robusta coffee]
emb|CDP21504.1|  unnamed protein product                                152   2e-39   Coffea canephora [robusta coffee]
ref|XP_010917296.1|  PREDICTED: crocetin glucosyltransferase, chl...    152   3e-39   Elaeis guineensis
ref|XP_010039943.1|  PREDICTED: crocetin glucosyltransferase, chl...    151   4e-39   Eucalyptus grandis [rose gum]
emb|CBI39410.3|  unnamed protein product                                150   5e-39   Vitis vinifera
gb|AFJ52965.1|  UDP-glycosyltransferase 1                               150   1e-38   Linum usitatissimum
emb|CDP21505.1|  unnamed protein product                                150   1e-38   Coffea canephora [robusta coffee]
ref|NP_001142122.1|  uncharacterized protein LOC100274286               150   1e-38   Zea mays [maize]
ref|XP_002440708.1|  hypothetical protein SORBIDRAFT_09g005510          150   2e-38   Sorghum bicolor [broomcorn]
ref|XP_010485047.1|  PREDICTED: UDP-glycosyltransferase 75B1 isof...    149   2e-38   
emb|CDY09754.1|  BnaC07g33070D                                          149   4e-38   Brassica napus [oilseed rape]
emb|CDM81837.1|  unnamed protein product                                149   5e-38   Triticum aestivum [Canadian hard winter wheat]
ref|XP_003629627.1|  Indole-3-acetate beta-glucosyltransferase          148   5e-38   Medicago truncatula
gb|AAL24226.1|  AT4g15550/dl3815c                                       147   7e-38   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004253165.1|  PREDICTED: crocetin glucosyltransferase, chl...    148   7e-38   Solanum lycopersicum
ref|XP_003571494.1|  PREDICTED: cyanidin 3-O-rutinoside 5-O-gluco...    148   8e-38   Brachypodium distachyon [annual false brome]
ref|XP_002437220.1|  hypothetical protein SORBIDRAFT_10g023060          147   1e-37   Sorghum bicolor [broomcorn]
ref|XP_002892295.1|  UDP-glucosyl transferase 75B2                      146   2e-37   
ref|XP_010025795.1|  PREDICTED: crocetin glucosyltransferase, chl...    142   3e-37   
ref|XP_006307449.1|  hypothetical protein CARUB_v10009073mg             146   3e-37   
gb|EYU31585.1|  hypothetical protein MIMGU_mgv1a007491mg                145   4e-37   
dbj|BAK06770.1|  predicted protein                                      145   6e-37   
ref|XP_009604418.1|  PREDICTED: crocetin glucosyltransferase, chl...    145   6e-37   
ref|XP_003565425.1|  PREDICTED: crocetin glucosyltransferase, chl...    145   8e-37   
ref|XP_010485054.1|  PREDICTED: UDP-glycosyltransferase 75B1 isof...    145   8e-37   
ref|XP_010040348.1|  PREDICTED: crocetin glucosyltransferase, chl...    145   9e-37   
ref|NP_563742.1|  UDP-glucosyltransferase 75B1                          145   1e-36   
ref|XP_010457643.1|  PREDICTED: UDP-glycosyltransferase 75B1-like       144   1e-36   
ref|XP_002438628.1|  hypothetical protein SORBIDRAFT_10g023120          144   1e-36   
emb|CDP21497.1|  unnamed protein product                                144   3e-36   
gb|KGN45711.1|  hypothetical protein Csa_6G007450                       143   3e-36   
ref|XP_004239848.1|  PREDICTED: crocetin glucosyltransferase, chl...    143   4e-36   
ref|XP_002892298.1|  UDP-glucosyl transferase 75B1                      143   4e-36   
emb|CDP20005.1|  unnamed protein product                                143   5e-36   
gb|KCW57191.1|  hypothetical protein EUGRSUZ_H00007                     142   5e-36   
ref|XP_006418014.1|  hypothetical protein EUTSA_v10007593mg             142   5e-36   
ref|XP_008458151.1|  PREDICTED: anthocyanidin 3-O-glucoside 5-O-g...    142   7e-36   
ref|XP_003565426.1|  PREDICTED: crocetin glucosyltransferase, chl...    142   8e-36   
ref|XP_004965983.1|  PREDICTED: cyanidin 3-O-rutinoside 5-O-gluco...    142   8e-36   
ref|NP_172044.1|  UDP-glucosyl transferase 75B2                         142   9e-36   
ref|XP_008659736.1|  PREDICTED: cyanidin 3-O-rutinoside 5-O-gluco...    142   1e-35   
ref|XP_010023607.1|  PREDICTED: crocetin glucosyltransferase, chl...    141   1e-35   
ref|XP_011043909.1|  PREDICTED: crocetin glucosyltransferase, chl...    142   2e-35   
ref|NP_001057977.1|  Os06g0593800                                       141   2e-35   
dbj|BAK55743.1|  UDP-glucose glucosyltransferase                        141   2e-35   
ref|XP_006305828.1|  hypothetical protein CARUB_v10010859mg             140   6e-35   
ref|XP_002305226.2|  hypothetical protein POPTR_0004s08200g             140   7e-35   
emb|CDY10124.1|  BnaC05g03670D                                          139   7e-35   
ref|XP_009778639.1|  PREDICTED: crocetin glucosyltransferase, chl...    139   7e-35   
ref|XP_009119145.1|  PREDICTED: UDP-glycosyltransferase 75B1            139   7e-35   
ref|XP_009781303.1|  PREDICTED: crocetin glucosyltransferase, chl...    139   1e-34   
ref|XP_010233316.1|  PREDICTED: crocetin glucosyltransferase, chl...    141   2e-34   
gb|EAY84926.1|  hypothetical protein OsI_06294                          138   2e-34   
ref|XP_009622557.1|  PREDICTED: crocetin glucosyltransferase, chl...    138   2e-34   
gb|AET04105.2|  UDP-glucose:glucosyltransferase, putative               131   3e-34   
ref|XP_010943278.1|  PREDICTED: limonoid UDP-glucosyltransferase-...    138   4e-34   
ref|NP_001046237.2|  Os02g0203300                                       138   4e-34   
ref|XP_006853436.1|  hypothetical protein AMTR_s00032p00176750          137   4e-34   
ref|XP_004965984.1|  PREDICTED: UDP-glycosyltransferase 75D1-like       137   4e-34   
ref|XP_010065961.1|  PREDICTED: cinnamate beta-D-glucosyltransfer...    137   5e-34   
gb|KCW63690.1|  hypothetical protein EUGRSUZ_G01342                     137   5e-34   
ref|XP_006365463.1|  PREDICTED: anthocyanidin 3-O-glucoside 5-O-g...    137   6e-34   
ref|XP_010065962.1|  PREDICTED: cinnamate beta-D-glucosyltransfer...    137   6e-34   
dbj|BAD15509.1|  putative anthocyanin 5-O-glucosyltransferase           136   1e-33   
ref|XP_010065965.1|  PREDICTED: UDP-glycosyltransferase 84B2-like       135   2e-33   
ref|XP_010943217.1|  PREDICTED: limonoid UDP-glucosyltransferase-...    135   3e-33   
ref|XP_009381252.1|  PREDICTED: crocetin glucosyltransferase, chl...    135   3e-33   
ref|XP_009403482.1|  PREDICTED: crocetin glucosyltransferase, chl...    135   3e-33   
ref|XP_004147672.1|  PREDICTED: UDP-glycosyltransferase 75D1-like       133   4e-33   
ref|XP_002263497.1|  PREDICTED: crocetin glucosyltransferase, chl...    134   5e-33   
gb|ABH03018.1|  resveratrol/hydroxycinnamic acid O-glucosyltransf...    134   6e-33   
ref|XP_010247542.1|  PREDICTED: limonoid UDP-glucosyltransferase        134   6e-33   
gb|AEW31188.1|  glucosyltransferase                                     134   6e-33   
ref|XP_002285379.1|  PREDICTED: limonoid UDP-glucosyltransferase        134   7e-33   
ref|XP_006415092.1|  hypothetical protein EUTSA_v10007589mg             134   7e-33   
ref|XP_007041388.1|  UDP-Glycosyltransferase superfamily protein        133   1e-32   
emb|CBI39412.3|  unnamed protein product                                134   1e-32   
gb|EYU36923.1|  hypothetical protein MIMGU_mgv1a026563mg                133   2e-32   
gb|AAW57806.1|  putative glucosyl transferase                           132   2e-32   
ref|XP_008439390.1|  PREDICTED: UDP-glycosyltransferase 75D1-like       127   3e-32   
gb|EEE62540.1|  hypothetical protein OsJ_17338                          132   4e-32   
ref|XP_008236381.1|  PREDICTED: putative UDP-glucose glucosyltran...    132   5e-32   
ref|XP_004965213.1|  PREDICTED: cinnamate beta-D-glucosyltransfer...    131   9e-32   
ref|XP_009105515.1|  PREDICTED: UDP-glycosyltransferase 75B2            131   1e-31   
ref|XP_010028410.1|  PREDICTED: cinnamate beta-D-glucosyltransfer...    131   1e-31   
ref|NP_001174244.1|  Os05g0179900                                       133   1e-31   
ref|NP_001267849.1|  cinnamate beta-D-glucosyltransferase-like          130   1e-31   
ref|XP_002518668.1|  UDP-glucosyltransferase, putative                  131   1e-31   
emb|CDY71964.1|  BnaAnng39390D                                          130   1e-31   
emb|CAN70791.1|  hypothetical protein VITISV_029654                     130   1e-31   
gb|AFJ52964.1|  UDP-glycosyltransferase 1                               130   1e-31   
emb|CDY46180.1|  BnaA01g23020D                                          130   2e-31   
ref|XP_007226459.1|  hypothetical protein PRUPE_ppa024612mg             130   2e-31   
gb|KDP45909.1|  hypothetical protein JCGZ_15469                         130   2e-31   
gb|ABQ02256.1|  O-glucosyltransferase 1                                 130   2e-31   
emb|CAN73416.1|  hypothetical protein VITISV_017052                     130   2e-31   
emb|CDY47274.1|  BnaA10g03720D                                          130   2e-31   
ref|XP_006855046.1|  hypothetical protein AMTR_s00031p00082410          130   2e-31   
sp|Q66PF4.1|CGT_FRAAN  RecName: Full=Cinnamate beta-D-glucosyltra...    130   3e-31   
ref|XP_003560621.1|  PREDICTED: cyanidin 3-O-rutinoside 5-O-gluco...    129   3e-31   
dbj|BAO66179.1|  UDP-glucose dependent p-hydroxybenzoic acid gluc...    129   3e-31   
gb|EYU31602.1|  hypothetical protein MIMGU_mgv1a021119mg                129   3e-31   
emb|CBI22524.3|  unnamed protein product                                127   4e-31   
ref|XP_010673325.1|  PREDICTED: crocetin glucosyltransferase, chl...    129   4e-31   
gb|AHA54051.1|  UGT84A13                                                129   4e-31   
ref|XP_009370119.1|  PREDICTED: putative UDP-glucose glucosyltran...    129   6e-31   
ref|XP_008806065.1|  PREDICTED: cinnamate beta-D-glucosyltransfer...    128   6e-31   
gb|EPS57614.1|  hypothetical protein M569_17203                         128   7e-31   
emb|CDP15113.1|  unnamed protein product                                128   7e-31   
ref|XP_007199814.1|  hypothetical protein PRUPE_ppa005187mg             128   7e-31   
ref|XP_007042538.1|  UDP-Glycosyltransferase superfamily protein,...    128   9e-31   
gb|KDP45907.1|  hypothetical protein JCGZ_15467                         128   9e-31   
ref|XP_002438626.1|  hypothetical protein SORBIDRAFT_10g023070          128   9e-31   
ref|XP_010030631.1|  PREDICTED: limonoid UDP-glucosyltransferase-...    125   1e-30   
dbj|BAJ94810.1|  predicted protein                                      128   1e-30   
gb|ABX46223.1|  limonoid UDP glucosyltransferase                        125   1e-30   
ref|XP_009345415.1|  PREDICTED: putative UDP-glucose glucosyltran...    127   1e-30   
ref|XP_003560622.2|  PREDICTED: cyanidin 3-O-rutinoside 5-O-gluco...    127   1e-30   
sp|Q767C8.1|IH5GT_IRIHO  RecName: Full=Cyanidin 3-O-rutinoside 5-...    127   2e-30   
gb|EPS69550.1|  hypothetical protein M569_05215                         127   2e-30   
emb|CAE48291.1|  glucosyltransferase 2                                  127   2e-30   
emb|CAN59771.1|  hypothetical protein VITISV_029146                     127   2e-30   
gb|AEW31187.1|  glucosyltransferase                                     127   2e-30   
ref|XP_002274256.1|  PREDICTED: limonoid UDP-glucosyltransferase-...    127   3e-30   
ref|XP_011016669.1|  PREDICTED: limonoid UDP-glucosyltransferase-...    124   3e-30   
ref|XP_008236382.1|  PREDICTED: putative UDP-glucose glucosyltran...    126   4e-30   
gb|KCW59915.1|  hypothetical protein EUGRSUZ_H02639                     125   4e-30   
ref|XP_008649287.1|  PREDICTED: cinnamate beta-D-glucosyltransfer...    126   4e-30   
gb|ABR16243.1|  unknown                                                 126   5e-30   
ref|XP_002438625.1|  hypothetical protein SORBIDRAFT_10g023050          126   5e-30   
ref|XP_002524931.1|  UDP-glucosyltransferase, putative                  126   5e-30   
ref|XP_007199813.1|  hypothetical protein PRUPE_ppa005173mg             125   6e-30   
ref|XP_008377621.1|  PREDICTED: putative UDP-glucose glucosyltran...    125   6e-30   
ref|XP_008347487.1|  PREDICTED: putative UDP-glucose glucosyltran...    125   6e-30   
gb|ACD03260.1|  UDP-glycosyltransferase UGT75E2                         125   7e-30   
ref|XP_009396353.1|  PREDICTED: putative UDP-glucose glucosyltran...    125   7e-30   
ref|XP_010928523.1|  PREDICTED: limonoid UDP-glucosyltransferase-...    125   8e-30   
ref|XP_002438232.1|  hypothetical protein SORBIDRAFT_10g009990          125   8e-30   
ref|XP_009614247.1|  PREDICTED: cinnamate beta-D-glucosyltransfer...    125   9e-30   
gb|ACD03236.1|  UDP-glycosyltransferase UGT84C2                         125   9e-30   
ref|XP_006654752.1|  PREDICTED: cinnamate beta-D-glucosyltransfer...    125   1e-29   
ref|XP_004137096.1|  PREDICTED: limonoid UDP-glucosyltransferase-...    125   1e-29   
ref|XP_010647893.1|  PREDICTED: UDP-glycosyltransferase 84B1            125   1e-29   
ref|XP_009138617.1|  PREDICTED: UDP-glycosyltransferase 75B2-like       123   1e-29   
sp|B2NID7.1|5GT_GENTR  RecName: Full=Anthocyanidin 3-O-glucoside ...    125   1e-29   
ref|XP_002455167.1|  hypothetical protein SORBIDRAFT_03g005340          125   1e-29   
ref|XP_004978365.1|  PREDICTED: cyanidin 3-O-rutinoside 5-O-gluco...    125   1e-29   
gb|KGN43884.1|  Resveratrol/hydroxycinnamic acid O-glucosyltransf...    124   2e-29   
ref|XP_003536615.2|  PREDICTED: UDP-glycosyltransferase 84B1-like       125   2e-29   
ref|XP_008219026.1|  PREDICTED: UDP-glycosyltransferase 75C1-like       124   2e-29   
ref|XP_003571042.2|  PREDICTED: putative UDP-glucose glucosyltran...    125   2e-29   
ref|XP_006379179.1|  hypothetical protein POPTR_0009s09820g             124   2e-29   
ref|XP_009381851.1|  PREDICTED: LOW QUALITY PROTEIN: crocetin glu...    122   3e-29   
ref|XP_009790173.1|  PREDICTED: cinnamate beta-D-glucosyltransfer...    124   3e-29   
gb|ABX46238.1|  limonoid UDP glucosyltransferase                        121   3e-29   
gb|ABX46229.1|  limonoid UDP glucosyltransferase                        121   3e-29   
gb|ABX46255.1|  limonoid UDP glucosyltransferase                        121   3e-29   
ref|XP_006657100.1|  PREDICTED: UDP-glycosyltransferase 75D1-like       122   3e-29   
ref|XP_011088205.1|  PREDICTED: limonoid UDP-glucosyltransferase-...    123   3e-29   
gb|ABR17105.1|  unknown                                                 123   4e-29   
ref|XP_006379180.1|  hypothetical protein POPTR_0009s09830g             124   4e-29   
gb|ABX46260.1|  limonoid UDP glucosyltransferase                        121   4e-29   
gb|ABX46241.1|  limonoid UDP glucosyltransferase                        121   4e-29   
gb|KGN43885.1|  hypothetical protein Csa_7G072720                       123   4e-29   
gb|ABX46259.1|  limonoid UDP glucosyltransferase                        121   4e-29   
gb|ABX46231.1|  limonoid UDP glucosyltransferase                        121   4e-29   
gb|ABX46264.1|  limonoid UDP glucosyltransferase                        121   4e-29   
ref|XP_008384480.1|  PREDICTED: putative UDP-glucose glucosyltran...    123   4e-29   
ref|XP_008366168.1|  PREDICTED: LOW QUALITY PROTEIN: putative UDP...    123   4e-29   
ref|XP_004137097.1|  PREDICTED: limonoid UDP-glucosyltransferase-...    123   5e-29   
ref|XP_006373420.1|  hypothetical protein POPTR_0017s13620g             123   5e-29   
gb|ABX46254.1|  limonoid UDP glucosyltransferase                        120   6e-29   
gb|ABX46230.1|  limonoid UDP glucosyltransferase                        120   7e-29   
ref|XP_006355777.1|  PREDICTED: cinnamate beta-D-glucosyltransfer...    122   8e-29   
gb|ABX46233.1|  limonoid UDP glucosyltransferase                        120   8e-29   
ref|XP_006858835.1|  hypothetical protein AMTR_s00066p00178850          122   8e-29   
ref|XP_002313148.2|  hypothetical protein POPTR_0009s09800g             122   8e-29   
gb|ABX46237.1|  limonoid UDP glucosyltransferase                        120   8e-29   
ref|XP_006486998.1|  PREDICTED: UDP-glycosyltransferase 84B2-like       122   9e-29   
ref|XP_008454993.1|  PREDICTED: putative UDP-glucose glucosyltran...    122   9e-29   
ref|XP_006486997.1|  PREDICTED: limonoid UDP-glucosyltransferase-...    122   1e-28   
ref|XP_008454995.1|  PREDICTED: putative UDP-glucose glucosyltran...    122   1e-28   
emb|CDY31602.1|  BnaA03g54500D                                          122   1e-28   
gb|ACD14145.1|  limonoid UDP-glucosyltransferase                        122   1e-28   
gb|ABX46232.1|  limonoid UDP glucosyltransferase                        120   1e-28   
ref|XP_008384481.1|  PREDICTED: putative UDP-glucose glucosyltran...    122   1e-28   
ref|XP_006826758.1|  hypothetical protein AMTR_s00136p00072610          122   1e-28   
ref|XP_004230732.1|  PREDICTED: cinnamate beta-D-glucosyltransfer...    122   1e-28   
gb|ABX46262.1|  limonoid UDP glucosyltransferase                        120   1e-28   
gb|ABX46251.1|  limonoid UDP glucosyltransferase                        119   1e-28   
gb|EYU27002.1|  hypothetical protein MIMGU_mgv1a023035mg                121   2e-28   
gb|ABX46247.1|  limonoid UDP glucosyltransferase                        119   2e-28   
gb|EAY98947.1|  hypothetical protein OsI_20902                          121   2e-28   
ref|XP_011021104.1|  PREDICTED: crocetin glucosyltransferase, chl...    121   2e-28   
ref|XP_010247543.1|  PREDICTED: UDP-glycosyltransferase 84B2-like       121   3e-28   
gb|ABX46263.1|  limonoid UDP glucosyltransferase                        119   3e-28   
gb|AAT85196.1|  unknown protein                                         121   3e-28   
gb|EEE64621.1|  hypothetical protein OsJ_19473                          120   3e-28   
ref|XP_010040347.1|  PREDICTED: crocetin glucosyltransferase, chl...    120   3e-28   
gb|ABX46256.1|  limonoid UDP glucosyltransferase                        119   3e-28   
ref|NP_001056258.2|  Os05g0552700                                       121   4e-28   
ref|XP_004307485.1|  PREDICTED: crocetin glucosyltransferase, chl...    120   4e-28   
ref|XP_004496938.1|  PREDICTED: UDP-glycosyltransferase 84B1-like...    120   4e-28   
gb|ABX46235.1|  limonoid UDP glucosyltransferase                        118   4e-28   
ref|XP_004137099.1|  PREDICTED: limonoid UDP-glucosyltransferase-...    120   4e-28   
gb|ABX46222.1|  limonoid UDP glucosyltransferase                        118   4e-28   
ref|XP_006422922.1|  hypothetical protein CICLE_v10028247mg             120   4e-28   
gb|ABX46265.1|  limonoid UDP glucosyltransferase                        118   4e-28   
ref|XP_004244752.1|  PREDICTED: cinnamate beta-D-glucosyltransfer...    120   4e-28   
gb|ACD14144.1|  limonoid UDP-glucosyltransferase                        120   4e-28   
ref|XP_002518670.1|  UDP-glucosyltransferase, putative                  120   4e-28   
gb|ABX46226.1|  limonoid UDP glucosyltransferase                        118   4e-28   
gb|ACD14147.1|  limonoid UDP-glucosyltransferase                        120   5e-28   
ref|XP_006297509.1|  hypothetical protein CARUB_v10013531mg             120   5e-28   
gb|ABX46246.1|  limonoid UDP glucosyltransferase                        118   5e-28   
gb|ABX46224.1|  limonoid UDP glucosyltransferase                        118   5e-28   
ref|XP_010042881.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       117   5e-28   
gb|KDP45906.1|  hypothetical protein JCGZ_15466                         120   5e-28   
gb|KHN12357.1|  UDP-glycosyltransferase 75D1                            120   6e-28   
ref|XP_006346359.1|  PREDICTED: cinnamate beta-D-glucosyltransfer...    120   7e-28   
ref|XP_006422923.1|  hypothetical protein CICLE_v10028293mg             120   8e-28   
ref|XP_010530731.1|  PREDICTED: UDP-glycosyltransferase 84B2-like       119   8e-28   
gb|ACS87991.1|  UDP-glucosyltransferase family 1 protein                120   8e-28   
gb|AII32448.1|  hydroxycinnamate glycosyltransferase                    120   9e-28   
ref|XP_002453431.1|  hypothetical protein SORBIDRAFT_04g005960          119   9e-28   
ref|XP_008454994.1|  PREDICTED: limonoid UDP-glucosyltransferase-...    119   9e-28   
gb|AEM43003.1|  UDP-glucosyltransferase                                 119   1e-27   
gb|ABX46227.1|  limonoid UDP glucosyltransferase                        117   1e-27   
gb|ABQ02257.1|  O-glucosyltransferase 2                                 119   1e-27   
ref|XP_009364139.1|  PREDICTED: putative UDP-glucose glucosyltran...    118   1e-27   
ref|XP_004137100.1|  PREDICTED: limonoid UDP-glucosyltransferase-...    119   1e-27   
gb|KGN43888.1|  hypothetical protein Csa_7G072750                       119   2e-27   
dbj|BAK00341.1|  predicted protein                                      119   2e-27   
gb|ABY27084.1|  limonoid UDP-glucosyltransferase                        119   2e-27   
ref|XP_007041389.1|  UDP-Glycosyltransferase superfamily protein        118   2e-27   
ref|XP_004159932.1|  PREDICTED: limonoid UDP-glucosyltransferase-...    119   2e-27   
dbj|BAJ90555.1|  predicted protein                                      119   2e-27   
gb|KDP31143.1|  hypothetical protein JCGZ_11519                         118   2e-27   



>dbj|BAB88935.1| glucosyltransferase [Nicotiana tabacum]
Length=470

 Score =   290 bits (743),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 131/200 (66%), Positives = 162/200 (81%), Gaps = 0/200 (0%)
 Frame = +3

Query  114  MVQPHILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANGGGVPDGLNF  293
            MVQPH+LLVTFPAQGHINP LQFAKRL+R+GIEVTFATSV+AHR M+K     +  GLNF
Sbjct  1    MVQPHVLLVTFPAQGHINPCLQFAKRLIRMGIEVTFATSVFAHRRMAKTTTSTLSKGLNF  60

Query  294  TAFSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLPWVS  473
             AFSDGYD+GFK + H+  HYMSEI++RGS +LK I+  ++ +GRP+T++V++LLLPW +
Sbjct  61   AAFSDGYDDGFKADEHDSQHYMSEIKSRGSKTLKDIILKSSDEGRPVTSLVYSLLLPWAA  120

Query  474  EVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATDPNCPVQLPGLPPLFSGDLP  653
            +VAR+ ++P ALLWIQPA VLDIYYYYF+GYEDA K +  DPN  +QLP LP L S DLP
Sbjct  121  KVAREFHIPCALLWIQPATVLDIYYYYFNGYEDAIKGSTNDPNWCIQLPRLPLLKSQDLP  180

Query  654  SFLLPSGSGGDYSFAMPTFK  713
            SFLL S +   YSFA+PTFK
Sbjct  181  SFLLSSSNEEKYSFALPTFK  200



>ref|XP_009601422.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Nicotiana 
tomentosiformis]
Length=470

 Score =   286 bits (733),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 130/200 (65%), Positives = 161/200 (81%), Gaps = 0/200 (0%)
 Frame = +3

Query  114  MVQPHILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANGGGVPDGLNF  293
            MVQPH+LLVTFPAQGHINP LQFA RL+R+GIEVTFATSV+AHR M+K     +  GLNF
Sbjct  1    MVQPHVLLVTFPAQGHINPCLQFANRLIRMGIEVTFATSVFAHRRMAKTTTFTLSKGLNF  60

Query  294  TAFSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLPWVS  473
             AFSDGYD+GFK + H+  HYMSEI++RGS +LK I+  ++ +GRP+T++V++LLLPW +
Sbjct  61   AAFSDGYDDGFKADEHDSQHYMSEIKSRGSETLKDIILKSSDEGRPVTSLVYSLLLPWAA  120

Query  474  EVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATDPNCPVQLPGLPPLFSGDLP  653
            +VAR+ ++P ALLWIQPA VLDIYYYYF+GYEDA K +  DPN  +QLP LP L S DLP
Sbjct  121  KVAREFHIPCALLWIQPATVLDIYYYYFNGYEDAIKGSTNDPNWCIQLPRLPLLKSQDLP  180

Query  654  SFLLPSGSGGDYSFAMPTFK  713
            SFLL S +   YSFA+PTFK
Sbjct  181  SFLLSSSNEEKYSFALPTFK  200



>ref|XP_009790237.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Nicotiana 
sylvestris]
Length=468

 Score =   285 bits (728),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 130/201 (65%), Positives = 162/201 (81%), Gaps = 1/201 (0%)
 Frame = +3

Query  114  MVQPHILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANGGGVPDGLNF  293
            MVQPH+LLVTFPAQGHINP LQFA RL+R+GIEVTFATS++AHR M+K     +P GLNF
Sbjct  1    MVQPHVLLVTFPAQGHINPCLQFAMRLIRMGIEVTFATSLFAHRRMAKTATSTLPKGLNF  60

Query  294  TAFSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLPWVS  473
              FSDGYD+GFK + H+  HYMSEI++RGS +LK I+  ++ +GRP+T++V++LLLPW +
Sbjct  61   APFSDGYDDGFKADEHDSQHYMSEIKSRGSETLKDIILKSSDEGRPVTSLVYSLLLPWAA  120

Query  474  EVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATDPNCPVQLPGLPPLFSGDLP  653
             VAR+ ++P ALLWIQPA VLDIYYYYF+GYEDA K +  DPN  +QLP LP L S DLP
Sbjct  121  NVAREFHIPCALLWIQPATVLDIYYYYFNGYEDAIKCSTNDPNWCIQLPNLPLLKSQDLP  180

Query  654  SFLLPSGSG-GDYSFAMPTFK  713
            SFLL S +  G+YSFA+PTFK
Sbjct  181  SFLLSSSNNEGNYSFALPTFK  201



>dbj|BAG80544.1| UDP-glucose:glucosyltransferase [Lycium barbarum]
Length=469

 Score =   279 bits (714),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 131/202 (65%), Positives = 162/202 (80%), Gaps = 2/202 (1%)
 Frame = +3

Query  114  MVQPHILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANGGGVPDGLNF  293
            MV+PH+LLVTFPAQGHINPSLQFAKRL++LGIEVTFATSV+AHR M+K      P+GLNF
Sbjct  1    MVRPHVLLVTFPAQGHINPSLQFAKRLIKLGIEVTFATSVFAHRRMTKTAASTAPEGLNF  60

Query  294  TAFSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLPWVS  473
             AFSDG+D+GFK +  +   YMSEIR+RGS +L+ I+  ++  GRP+T++V+TLLLPW +
Sbjct  61   VAFSDGFDDGFKLDTDDGKRYMSEIRSRGSQTLRDIILKSSDDGRPVTSLVYTLLLPWAA  120

Query  474  EVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATDPNCPVQLPGLPPLFSGDLP  653
            EVAR+ ++P ALLWIQPAAVLDIYYYYF+GYED  K++  DP   +QLPGLP L S DLP
Sbjct  121  EVAREHHIPCALLWIQPAAVLDIYYYYFNGYEDEMKSSTDDPTWRIQLPGLPLLKSQDLP  180

Query  654  SFLLPSGS--GGDYSFAMPTFK  713
            SFL+ S S   G YS A+PTFK
Sbjct  181  SFLVASNSKLNGKYSSALPTFK  202



>ref|XP_006358760.1| PREDICTED: anthocyanidin 3-O-glucoside 5-O-glucosyltransferase 
1-like [Solanum tuberosum]
Length=473

 Score =   273 bits (698),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 129/201 (64%), Positives = 160/201 (80%), Gaps = 1/201 (0%)
 Frame = +3

Query  114  MVQPHILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANGGGVPDGLNF  293
            MVQPH+LLVTFPAQGHINPSLQFAKRL+++GIEVTF TSV+AHR M+K      P GLN 
Sbjct  1    MVQPHVLLVTFPAQGHINPSLQFAKRLIKMGIEVTFTTSVFAHRRMAKTAASNAPKGLNL  60

Query  294  TAFSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLPWVS  473
             AFSDG+D+GFK N  +   YMSEIR+RGS +L+ I+  ++ +GRP+T++V+TLLLPW +
Sbjct  61   AAFSDGFDDGFKSNVDDSKRYMSEIRSRGSQTLRDIILKSSDEGRPVTSLVYTLLLPWAA  120

Query  474  EVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATDPNCPVQLPGLPPLFSGDLP  653
            EVAR++++PSALLWIQPA VLDIYYYYF+GYED  K ++ DPN  +QLP LP L S DLP
Sbjct  121  EVARELHIPSALLWIQPATVLDIYYYYFNGYEDEMKCSSNDPNWSIQLPRLPLLKSQDLP  180

Query  654  SFLL-PSGSGGDYSFAMPTFK  713
            SFL+  S     YSFA+PTFK
Sbjct  181  SFLVSSSSKDDKYSFALPTFK  201



>ref|XP_006368000.1| PREDICTED: anthocyanidin 3-O-glucoside 5-O-glucosyltransferase 
1-like [Solanum tuberosum]
Length=473

 Score =   271 bits (694),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 128/201 (64%), Positives = 160/201 (80%), Gaps = 1/201 (0%)
 Frame = +3

Query  114  MVQPHILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANGGGVPDGLNF  293
            MVQPH+LLVTFPAQGHINPSLQFAKRL+++GIEVTF TS++AHR M+K      P GLN 
Sbjct  1    MVQPHVLLVTFPAQGHINPSLQFAKRLIKMGIEVTFTTSIFAHRRMAKTAASTAPKGLNL  60

Query  294  TAFSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLPWVS  473
             AFSDG+D+GFK N  +   YMSEIR+RGS +L+ I+  ++ +GRP+T++V+TLLLPW +
Sbjct  61   AAFSDGFDDGFKSNVDDSKCYMSEIRSRGSQTLRDIILKSSDEGRPVTSLVYTLLLPWAA  120

Query  474  EVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATDPNCPVQLPGLPPLFSGDLP  653
            EVAR++++PSALLWIQPA VLDIYYYYF+GYED  K ++ DPN  +QLP LP L S DLP
Sbjct  121  EVARELHIPSALLWIQPATVLDIYYYYFNGYEDEMKCSSNDPNWSIQLPRLPLLKSQDLP  180

Query  654  SFLL-PSGSGGDYSFAMPTFK  713
            SFL+  S     YSFA+PTFK
Sbjct  181  SFLVSSSSKDDKYSFALPTFK  201



>gb|AAK54465.1| cold-induced glucosyl transferase [Solanum sogarandinum]
Length=473

 Score =   268 bits (686),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 127/201 (63%), Positives = 159/201 (79%), Gaps = 1/201 (0%)
 Frame = +3

Query  114  MVQPHILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANGGGVPDGLNF  293
            MVQPH+LLVTFP QGHINPSLQFAK+L+++GIEVTF TSV+AHR M+K      P GLN 
Sbjct  1    MVQPHVLLVTFPTQGHINPSLQFAKKLIKMGIEVTFTTSVFAHRRMAKTATSTAPKGLNL  60

Query  294  TAFSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLPWVS  473
             AFSDG+D+GFK N  +   YMSEIR+RGS +L+ I+  ++ +GRP+T++V+TLLLPW +
Sbjct  61   AAFSDGFDDGFKSNVDDSKRYMSEIRSRGSQTLRDIILKSSDEGRPVTSLVYTLLLPWAA  120

Query  474  EVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATDPNCPVQLPGLPPLFSGDLP  653
            EVAR++++PSALLWIQPA VLDIYYYYF+GYED  K ++ DPN  +QLP LP L S DLP
Sbjct  121  EVARELHIPSALLWIQPATVLDIYYYYFNGYEDEMKCSSNDPNWSIQLPRLPLLKSQDLP  180

Query  654  SFLL-PSGSGGDYSFAMPTFK  713
            SFL+  S     YSFA+PTFK
Sbjct  181  SFLVSSSSKDDKYSFALPTFK  201



>ref|XP_004247894.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Solanum 
lycopersicum]
Length=470

 Score =   266 bits (681),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 128/202 (63%), Positives = 160/202 (79%), Gaps = 2/202 (1%)
 Frame = +3

Query  114  MVQPHILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANGGGVPDGLNF  293
            MVQPH+LLVTFPAQGHINPSLQFAKRL+ +GIEVTF TSV+AHR M+K      P GLN 
Sbjct  1    MVQPHVLLVTFPAQGHINPSLQFAKRLIEMGIEVTFTTSVFAHRRMAKIAASTAPKGLNL  60

Query  294  TAFSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLPWVS  473
             AFSDG+D+GFK N  +   YMSEIR+RGS +L+ ++  ++ +GRP+T++V+TLLLPW +
Sbjct  61   AAFSDGFDDGFKSNVDDSKRYMSEIRSRGSQTLRDVILKSSDEGRPVTSLVYTLLLPWAA  120

Query  474  EVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFK-NAATDPNCPVQLPGLPPLFSGDL  650
            EVAR++++PSALLWIQPA VLDIYYYYF+GYED  K +++ DPN  +QLP LP L S DL
Sbjct  121  EVARELHIPSALLWIQPATVLDIYYYYFNGYEDEMKCSSSNDPNWSIQLPRLPLLKSQDL  180

Query  651  PSFLL-PSGSGGDYSFAMPTFK  713
            PSFL+  S     YSFA+PTFK
Sbjct  181  PSFLVSSSSKDDKYSFALPTFK  202



>ref|XP_011069457.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like, 
partial [Sesamum indicum]
Length=372

 Score =   255 bits (652),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 125/201 (62%), Positives = 153/201 (76%), Gaps = 3/201 (1%)
 Frame = +3

Query  114  MVQPHILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANGGGVPDGLNF  293
            M + H+LLVTFPAQGHINPSLQFAKRL+ +GIEVTFATS+YA R M K     +P GL+F
Sbjct  1    MSRRHVLLVTFPAQGHINPSLQFAKRLIDMGIEVTFATSLYARRRMEKTAARDLPKGLSF  60

Query  294  TAFSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLPWVS  473
             AFSDGYD+GF  +  +   YM+EIR+RG+ +LK      A QGRP+T +++TLLLPW S
Sbjct  61   AAFSDGYDDGFTMSD-DPRKYMTEIRSRGAKTLKDTALSAAEQGRPVTCLIYTLLLPWAS  119

Query  474  EVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATDPNCPVQLPGLPPLFSG-DL  650
            EVAR+VN+PSALLWIQPA VLDIYYYYF+GY D    ++ DP+  +QLPGLP L S  DL
Sbjct  120  EVAREVNIPSALLWIQPATVLDIYYYYFNGYADEIIASSNDPSWKLQLPGLPILLSKRDL  179

Query  651  PSFLLPSGSGGDYSFAMPTFK  713
            PSF+LP+ S   YSFA+ TFK
Sbjct  180  PSFMLPNCSER-YSFALTTFK  199



>ref|XP_002263700.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Vitis 
vinifera]
Length=469

 Score =   258 bits (658),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 124/200 (62%), Positives = 155/200 (78%), Gaps = 7/200 (4%)
 Frame = +3

Query  114  MVQPHILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANGGGVPDGLNF  293
            M  PH LLVTFPAQGHINP+LQFAKR++R G +V+FATSV AHR M+K +    P+GLNF
Sbjct  1    MGSPHFLLVTFPAQGHINPALQFAKRIIRTGAQVSFATSVSAHRRMAKRS---TPEGLNF  57

Query  294  TAFSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLPWVS  473
              FSDGYD+GFK    +V HYMSEI+ RGS +L+ IV  NA +G+P T +V+TLLLPW +
Sbjct  58   VPFSDGYDDGFKPTD-DVQHYMSEIKRRGSETLREIVVRNADEGQPFTCIVYTLLLPWAA  116

Query  474  EVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATDPNCPVQLPGLPPLFSGDLP  653
            EVAR + +PSALLWIQPA VLDIYYYYF+GY D F+N + +P+C V+LPGLP L S DLP
Sbjct  117  EVARGLGVPSALLWIQPATVLDIYYYYFNGYGDVFRNISNEPSCSVELPGLPLLSSRDLP  176

Query  654  SFLLPSGSGGDYSFAMPTFK  713
            SFL+ S +   Y+F +PTF+
Sbjct  177  SFLVKSNA---YTFVLPTFQ  193



>emb|CDP15112.1| unnamed protein product [Coffea canephora]
Length=469

 Score =   249 bits (637),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 117/198 (59%), Positives = 153/198 (77%), Gaps = 2/198 (1%)
 Frame = +3

Query  120  QPHILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANGGGVPDGLNFTA  299
            Q H+LLVT+PAQGHINPSLQFAKRL+R+ ++VTFATSV+A   M+K +G  +P GL+F  
Sbjct  4    QRHVLLVTYPAQGHINPSLQFAKRLLRMDVQVTFATSVFALSRMTKFSGS-IPKGLSFAP  62

Query  300  FSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLPWVSEV  479
            FSDGYD+GF+        YMS I  +GS++L+ +++ +A QGRP+T +V+TLLLPW + V
Sbjct  63   FSDGYDDGFQPKGVEPTEYMSGIEKQGSNTLRNVINTSADQGRPVTCLVYTLLLPWAATV  122

Query  480  ARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATDPNCPVQLPGLPPLFSGDLPSF  659
            A + ++PSALLWIQPA V+DIYYYYFHGYED  KN ++DP   +Q PGLP + + DLPSF
Sbjct  123  AHECHIPSALLWIQPATVMDIYYYYFHGYEDDVKNNSSDPTWSIQFPGLPSMKTTDLPSF  182

Query  660  LLPSGSGGDYSFAMPTFK  713
            +LPS S   YSFA+PTFK
Sbjct  183  ILPS-SDAIYSFALPTFK  199



>dbj|BAM28983.1| UDP-glucose crocetin glucosyltransferase [Gardenia jasminoides]
Length=474

 Score =   246 bits (627),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 114/198 (58%), Positives = 151/198 (76%), Gaps = 2/198 (1%)
 Frame = +3

Query  120  QPHILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANGGGVPDGLNFTA  299
            Q H+LL+T+PAQGHINP+LQFA+RL+R+GI+VT ATSVYA   M+K++G   P GL F  
Sbjct  4    QRHVLLITYPAQGHINPALQFAQRLLRMGIQVTLATSVYALSRMTKSSGS-TPKGLTFAT  62

Query  300  FSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLPWVSEV  479
            FSDGYD+GF+    +   YMS +  +GS++L+ +++ +A QG P+T +V+TLLLPW + V
Sbjct  63   FSDGYDDGFRPKGVDHTEYMSSLAKQGSNTLRNVINTSADQGCPVTCLVYTLLLPWAATV  122

Query  480  ARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATDPNCPVQLPGLPPLFSGDLPSF  659
            AR+ ++PSALLWIQP AV+DIYYYYF GYED  KN + DP   +Q PGLP + + DLPSF
Sbjct  123  ARECHIPSALLWIQPVAVMDIYYYYFRGYEDDVKNNSNDPTWSIQFPGLPSMKAKDLPSF  182

Query  660  LLPSGSGGDYSFAMPTFK  713
            +LPS S   YSFA+PTFK
Sbjct  183  ILPS-SDNIYSFALPTFK  199



>sp|F8WKW0.1|UGT1_GARJA RecName: Full=Crocetin glucosyltransferase, chloroplastic; AltName: 
Full=UDP-glucose glucosyltransferase 1; Short=GjUGT1; 
AltName: Full=UDP-glycosyltransferase 75L6; Flags: Precursor 
[Gardenia jasminoides]
 dbj|BAK55736.1| UDP-glucose glucosyltransferase [Gardenia jasminoides]
Length=474

 Score =   245 bits (626),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 114/198 (58%), Positives = 150/198 (76%), Gaps = 2/198 (1%)
 Frame = +3

Query  120  QPHILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANGGGVPDGLNFTA  299
            Q H+LL+T+PAQGHINP+LQFA+RL+R+GI+VT ATSVYA   M K++G   P GL F  
Sbjct  4    QRHVLLITYPAQGHINPALQFAQRLLRMGIQVTLATSVYALSRMKKSSGS-TPKGLTFAT  62

Query  300  FSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLPWVSEV  479
            FSDGYD+GF+    +   YMS +  +GS++L+ +++ +A QG P+T +V+TLLLPW + V
Sbjct  63   FSDGYDDGFRPKGVDHTEYMSSLAKQGSNTLRNVINTSADQGCPVTCLVYTLLLPWAATV  122

Query  480  ARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATDPNCPVQLPGLPPLFSGDLPSF  659
            AR+ ++PSALLWIQP AV+DIYYYYF GYED  KN + DP   +Q PGLP + + DLPSF
Sbjct  123  ARECHIPSALLWIQPVAVMDIYYYYFRGYEDDVKNNSNDPTWSIQFPGLPSMKAKDLPSF  182

Query  660  LLPSGSGGDYSFAMPTFK  713
            +LPS S   YSFA+PTFK
Sbjct  183  ILPS-SDNIYSFALPTFK  199



>ref|XP_010023602.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Eucalyptus 
grandis]
Length=470

 Score =   244 bits (624),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 124/201 (62%), Positives = 150/201 (75%), Gaps = 5/201 (2%)
 Frame = +3

Query  114  MVQPHILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANGGGVPDGLNF  293
            M  PH LLVTFPAQGHINP+LQFAKRL+R G EVTFATSV A   MSK  G   P+GL+F
Sbjct  1    MAPPHFLLVTFPAQGHINPALQFAKRLLRSGAEVTFATSVSACHRMSK--GRASPEGLHF  58

Query  294  TAFSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLPWVS  473
              FSDGYD+GFK    NV+ +MSE+R RGS  LK +++ +A +GRP T +V++LLLPW +
Sbjct  59   APFSDGYDDGFKMGD-NVSQFMSELRHRGSEKLKDLMASSAGEGRPYTCLVYSLLLPWAA  117

Query  474  EVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATDPNCPVQLPGLPPLF-SGDL  650
            EVAR+ ++PSALLWIQPA VLD+YYYYF+GY +  +N   DP+C  QLPGLP  F S DL
Sbjct  118  EVAREFHVPSALLWIQPATVLDMYYYYFNGYGEFIENNCIDPSCSFQLPGLPYKFTSRDL  177

Query  651  PSFLLPSGSGGDYSFAMPTFK  713
            PSF LPS S   Y  A+PTFK
Sbjct  178  PSFFLPSRSDA-YDVALPTFK  197



>ref|XP_010243149.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Nelumbo 
nucifera]
Length=471

 Score =   244 bits (623),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 120/199 (60%), Positives = 148/199 (74%), Gaps = 7/199 (4%)
 Frame = +3

Query  114  MVQPHILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANGGGVPDGLNF  293
            M  PH LLVTFPAQGHINPSLQFAKRL+R+G +VTFATSV AHR MS A     PDGL F
Sbjct  1    MSHPHFLLVTFPAQGHINPSLQFAKRLIRIGAQVTFATSVSAHRRMSNACN---PDGLTF  57

Query  294  TAFSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLPWVS  473
              FSDGYD+GFK    +V H++SE++ RGS +L+ ++   A +GRP++ +VHTLLLPW +
Sbjct  58   APFSDGYDDGFKLTD-SVEHFLSELKRRGSETLRELILSLAREGRPVSCLVHTLLLPWAA  116

Query  474  EVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATDPNCPVQLPGLPPLFSGDLP  653
            +VAR++++P ALLWIQPA V DIYYY F GY D   N   D +  V+LPGLPPL S DLP
Sbjct  117  DVARNLDVPWALLWIQPATVFDIYYYNFTGYGDLICNNKNDNSYTVELPGLPPLTSRDLP  176

Query  654  SFLLPSGSGGDYSFAMPTF  710
            SFLLPS +   Y+FA+P F
Sbjct  177  SFLLPSNT---YAFALPIF  192



>ref|XP_010246531.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Nelumbo 
nucifera]
Length=471

 Score =   244 bits (623),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 120/199 (60%), Positives = 148/199 (74%), Gaps = 7/199 (4%)
 Frame = +3

Query  114  MVQPHILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANGGGVPDGLNF  293
            M  PH LLVTFPAQGHINPSLQFAKRL+R+G +VTFATSV AHR MS A     PDGL F
Sbjct  1    MSHPHFLLVTFPAQGHINPSLQFAKRLIRIGAQVTFATSVSAHRRMSNACN---PDGLTF  57

Query  294  TAFSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLPWVS  473
              FSDGYD+GFK    +V H++SE++ RGS +L+ ++   A +GRP++ +VHTLLLPW +
Sbjct  58   APFSDGYDDGFKLTD-SVEHFLSELKRRGSETLRELILSLAREGRPVSCLVHTLLLPWAA  116

Query  474  EVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATDPNCPVQLPGLPPLFSGDLP  653
            +VAR++++P ALLWIQPA V DIYYY F GY D   N   D +  V+LPGLPPL S DLP
Sbjct  117  DVARNLDVPWALLWIQPATVFDIYYYNFTGYGDLICNNKNDNSYTVELPGLPPLTSRDLP  176

Query  654  SFLLPSGSGGDYSFAMPTF  710
            SFLLPS +   Y+FA+P F
Sbjct  177  SFLLPSNT---YAFALPIF  192



>dbj|BAA89009.1| anthocyanin 5-O-glucosyltransferase [Petunia x hybrida]
Length=468

 Score =   241 bits (616),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 113/200 (57%), Positives = 147/200 (74%), Gaps = 1/200 (1%)
 Frame = +3

Query  114  MVQPHILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANGGGVPDGLNF  293
            MVQPH++L TFPAQGHINP+LQFAK LV++GIEVTF+TS+YA   M + +    P GLNF
Sbjct  1    MVQPHVILTTFPAQGHINPALQFAKNLVKMGIEVTFSTSIYAQSRMDEKSILNAPKGLNF  60

Query  294  TAFSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLPWVS  473
              FSDG+DEGF  +   V  YMS++R  GS ++K I+   +  G+PIT +++++ LPW +
Sbjct  61   IPFSDGFDEGFDHSKDPV-FYMSQLRKCGSETVKKIILTCSENGQPITCLLYSIFLPWAA  119

Query  474  EVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATDPNCPVQLPGLPPLFSGDLP  653
            EVAR+V++PSALLW QPA +LDIYY+ FHGYE A  N + DPN  +QLPGLP L + DLP
Sbjct  120  EVAREVHIPSALLWSQPATILDIYYFNFHGYEKAMANESNDPNWSIQLPGLPLLETRDLP  179

Query  654  SFLLPSGSGGDYSFAMPTFK  713
            SFLLP G+ G    A+P FK
Sbjct  180  SFLLPYGAKGSLRVALPPFK  199



>ref|XP_011101592.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Sesamum 
indicum]
Length=472

 Score =   239 bits (610),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 118/201 (59%), Positives = 148/201 (74%), Gaps = 3/201 (1%)
 Frame = +3

Query  114  MVQPHILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANGGGVPDGLNF  293
            M   H+LLVTFP QGHINP+LQFAK+L+ +GIEVTFAT+V A + M KA    +P GL F
Sbjct  1    MASHHVLLVTFPVQGHINPALQFAKKLINMGIEVTFATTVLARQRMEKAAASSLPKGLTF  60

Query  294  TAFSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLPWVS  473
             AFSDG D+GFK ++ +   YM EIR RG+ SLK  V   A QGRPIT +++TLLLPW S
Sbjct  61   AAFSDGLDDGFKASN-DPQKYMREIRRRGTKSLKDTVLSAAEQGRPITCLIYTLLLPWAS  119

Query  474  EVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATDPNCPVQLPGLPPLFS-GDL  650
            EVAR+V++PSALLWIQ A VLDIYYYYF+G+ D    ++ DP+  +QL G+P L S  DL
Sbjct  120  EVAREVHIPSALLWIQAATVLDIYYYYFNGFGDEIIASSNDPSWKLQLHGIPILLSQCDL  179

Query  651  PSFLLPSGSGGDYSFAMPTFK  713
            PSF+LP+ S  +YSFA+  FK
Sbjct  180  PSFMLPT-SSDNYSFALTVFK  199



>gb|KDP32582.1| hypothetical protein JCGZ_13132 [Jatropha curcas]
Length=463

 Score =   238 bits (606),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 119/201 (59%), Positives = 150/201 (75%), Gaps = 10/201 (5%)
 Frame = +3

Query  114  MVQPHILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANGGGVPDGLNF  293
            M+QPH LLVTFP QGHINP+LQFAKRL+R+G+EVT ATS YA R M+K +    P GL+ 
Sbjct  1    MLQPHFLLVTFPTQGHINPALQFAKRLIRIGVEVTLATSAYAKRRMTKTS---FPKGLSL  57

Query  294  TAFSDGYDEGFKKNHHNVAH--YMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLPW  467
            T FSDGYD+G+K +  + AH  YMSEIR RGS +L  ++  +A +G+P+T +V+TLLLPW
Sbjct  58   TTFSDGYDDGYKGSDSD-AHDKYMSEIRLRGSETLSDLIITSANEGKPVTCLVYTLLLPW  116

Query  468  VSEVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATDPNCPVQLPGLPPLFSGD  647
             +EVAR  +LP ALLWIQPA VLDIYYYY +GYED F +  +DP   V+LPGL PL S D
Sbjct  117  AAEVARAHHLPCALLWIQPATVLDIYYYYLNGYEDMF-SKCSDPLYRVELPGLEPLTSRD  175

Query  648  LPSFLLPSGSGGDYSFAMPTF  710
            LPSFL+PS +   Y+F +  F
Sbjct  176  LPSFLVPSNA---YAFVLSLF  193



>ref|XP_002262883.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Vitis 
vinifera]
Length=469

 Score =   238 bits (606),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 115/200 (58%), Positives = 147/200 (74%), Gaps = 7/200 (4%)
 Frame = +3

Query  114  MVQPHILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANGGGVPDGLNF  293
            M  PH LLVTFPAQGHINP+LQFAKR++R G EV+FATSV AHR M+K       +GL F
Sbjct  1    MGSPHFLLVTFPAQGHINPALQFAKRMIRTGAEVSFATSVSAHRRMAKRPN---LEGLQF  57

Query  294  TAFSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLPWVS  473
              FSDGYD+GFK +  ++  YMSEI+ RGS +L+ IV  N+ +GRP T +VHTLL+PW +
Sbjct  58   VPFSDGYDDGFKSSD-DIQQYMSEIKRRGSETLREIVVRNSDEGRPFTCIVHTLLVPWAA  116

Query  474  EVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATDPNCPVQLPGLPPLFSGDLP  653
            EVAR + +P ALLW +PA VLDIYYYYF+GY DAF+N + +P C ++LP LP L S DLP
Sbjct  117  EVARGLVVPYALLWNEPATVLDIYYYYFNGYGDAFRNISNEPTCSIELPALPLLSSRDLP  176

Query  654  SFLLPSGSGGDYSFAMPTFK  713
            SFL+ S +   Y+F +P  +
Sbjct  177  SFLVNSNA---YTFFLPMLQ  193



>emb|CAN67608.1| hypothetical protein VITISV_036779 [Vitis vinifera]
Length=469

 Score =   238 bits (606),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 115/200 (58%), Positives = 147/200 (74%), Gaps = 7/200 (4%)
 Frame = +3

Query  114  MVQPHILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANGGGVPDGLNF  293
            M  PH LLVTFPAQGHINP+LQFAKR++R G EV+FATSV AHR M+K       +GL F
Sbjct  1    MGSPHFLLVTFPAQGHINPALQFAKRMIRTGAEVSFATSVSAHRRMAKRPN---LEGLQF  57

Query  294  TAFSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLPWVS  473
              FSDGYD+GFK +  ++  YMSEI+ RGS +L+ IV  N+ +GRP T +VHTLL+PW +
Sbjct  58   VPFSDGYDDGFKSSD-DIQQYMSEIKRRGSETLREIVVRNSDEGRPFTCIVHTLLVPWAA  116

Query  474  EVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATDPNCPVQLPGLPPLFSGDLP  653
            EVAR + +P ALLW +PA VLDIYYYYF+GY DAF+N + +P C ++LP LP L S DLP
Sbjct  117  EVARGLVVPYALLWNEPATVLDIYYYYFNGYGDAFRNISNEPTCSIELPALPLLSSRDLP  176

Query  654  SFLLPSGSGGDYSFAMPTFK  713
            SFL+ S +   Y+F +P  +
Sbjct  177  SFLVNSNA---YTFFLPMLQ  193



>ref|XP_006349903.1| PREDICTED: anthocyanidin 3-O-glucoside 5-O-glucosyltransferase-like 
[Solanum tuberosum]
Length=470

 Score =   236 bits (603),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 113/202 (56%), Positives = 146/202 (72%), Gaps = 3/202 (1%)
 Frame = +3

Query  114  MVQPHILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLM-SKANGGGVPDGL-  287
            MV+PH++L TFPAQGHINP+LQFAK LV+ GI+VTF+TS+YA RLM  K +    P GL 
Sbjct  1    MVKPHVILTTFPAQGHINPALQFAKNLVKNGIQVTFSTSIYAQRLMDEKKSIDNFPKGLM  60

Query  288  NFTAFSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLPW  467
            NF  FSDG+D+GF  +   V  YMS++R  GS ++K I+ + +  G PIT +++++ LPW
Sbjct  61   NFVPFSDGFDDGFDHSKDPVC-YMSQLRKCGSETVKNIIINCSENGSPITCLLYSIFLPW  119

Query  468  VSEVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATDPNCPVQLPGLPPLFSGD  647
             +EVAR+VN+PSALLW QPA +LDIYY+ FHGYE    N + DPN  +QLPGLP L + D
Sbjct  120  AAEVAREVNIPSALLWSQPATILDIYYFNFHGYEKEMANESNDPNWSIQLPGLPQLKTKD  179

Query  648  LPSFLLPSGSGGDYSFAMPTFK  713
            LPSFLLPS   G    A+P FK
Sbjct  180  LPSFLLPSNVKGSLRVALPPFK  201



>ref|XP_010023603.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Eucalyptus 
grandis]
 gb|KCW59914.1| hypothetical protein EUGRSUZ_H02638 [Eucalyptus grandis]
Length=470

 Score =   236 bits (603),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 118/201 (59%), Positives = 145/201 (72%), Gaps = 5/201 (2%)
 Frame = +3

Query  114  MVQPHILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANGGGVPDGLNF  293
            M  PH LLVTFPAQGHINP+LQFAKRL+  G EVTFATS+ A R MSK  G   P+GL+F
Sbjct  1    MAPPHFLLVTFPAQGHINPALQFAKRLLGSGAEVTFATSISACRHMSK--GRASPEGLHF  58

Query  294  TAFSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLPWVS  473
             AFSDGYD+G K    NV+ +MSE+R RGS  L+ +++    +GRP T +V++LLLPW +
Sbjct  59   AAFSDGYDDGLKTGD-NVSQFMSELRRRGSEKLRDLIASKVGEGRPYTCLVYSLLLPWAA  117

Query  474  EVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATDPNCPVQLPGLPPLF-SGDL  650
            EVAR+  +PSALLWIQPA VLD+YYYYF+GY +  KN   DP+C  +LP LP  F S DL
Sbjct  118  EVAREFRVPSALLWIQPATVLDMYYYYFNGYGEFIKNNCIDPSCSFELPSLPYKFTSRDL  177

Query  651  PSFLLPSGSGGDYSFAMPTFK  713
            PSF +P G    Y+ AMP FK
Sbjct  178  PSFFVP-GRSDAYAHAMPIFK  197



>gb|EYU31587.1| hypothetical protein MIMGU_mgv1a018203mg [Erythranthe guttata]
Length=465

 Score =   235 bits (599),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 116/200 (58%), Positives = 145/200 (73%), Gaps = 4/200 (2%)
 Frame = +3

Query  120  QPHILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANGGGVPDGLNFTA  299
            Q H+LLVTFP QGHINPSLQFAKRL  +GI+VTFATS+YA R MS+    G+P G+ F A
Sbjct  4    QRHVLLVTFPVQGHINPSLQFAKRLTAMGIKVTFATSLYARRRMSR-TAAGLPKGVTFAA  62

Query  300  FSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLPWVSEV  479
            FSDGYD+GF   + +   YM+EIR+RGS SL+  +   A QG P+T +V+TLLLPW  EV
Sbjct  63   FSDGYDDGFNPGNDDAGKYMTEIRSRGSQSLRDTILAAAEQGCPVTQLVYTLLLPWAPEV  122

Query  480  ARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATDPNCPVQLPGLPPL-FSG-DLP  653
            AR+ ++PSALLWIQPA VL+IYYYYF+GY D     + D    +Q PG+P L FS  DLP
Sbjct  123  AREFHVPSALLWIQPATVLNIYYYYFNGYRDEIAANSNDATWQIQFPGIPALNFSKRDLP  182

Query  654  SFLLPSGSGGDYSFAMPTFK  713
            SF+LPS S   +S  +P+FK
Sbjct  183  SFILPS-SSDKHSVELPSFK  201



>ref|XP_011081386.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Sesamum 
indicum]
Length=475

 Score =   235 bits (599),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 116/196 (59%), Positives = 143/196 (73%), Gaps = 3/196 (2%)
 Frame = +3

Query  126  HILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANGGGVPDGLNFTAFS  305
            H+LLVTFPAQGHINPSLQFAKRLV +GIEVTFATSVYA R M +   G +P GL FT +S
Sbjct  5    HVLLVTFPAQGHINPSLQFAKRLVNMGIEVTFATSVYAQRRMEETADGDLPKGLKFTPYS  64

Query  306  DGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLPWVSEVAR  485
            DGYD+GF  +      YM EIR+R S +LK  V   A +GRPI+  +HTLLLPWVS+VAR
Sbjct  65   DGYDDGFTFSDDG-KKYMMEIRSRASKTLKDTVMAAAKRGRPISCFIHTLLLPWVSKVAR  123

Query  486  DVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATDPNCPVQLPGLPPLFSG-DLPSFL  662
            +V++PSALLWIQ A V + YYYYF+GY D  K  + DP   +QLPG+P L S  D+PSF+
Sbjct  124  EVHIPSALLWIQSATVFNAYYYYFNGYGDQIKAQSNDPTWKIQLPGIPILLSKHDIPSFM  183

Query  663  LPSGSGGDYSFAMPTF  710
            L + S   YS+A+ +F
Sbjct  184  LAT-SSERYSYALTSF  198



>gb|EYU31586.1| hypothetical protein MIMGU_mgv1a005918mg [Erythranthe guttata]
Length=465

 Score =   233 bits (595),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 116/200 (58%), Positives = 145/200 (73%), Gaps = 4/200 (2%)
 Frame = +3

Query  120  QPHILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANGGGVPDGLNFTA  299
            Q H+LLVTFP QGHINPSLQFAKRL  +GI+VTFATS+YA R MS+    G+P G+ F A
Sbjct  4    QRHVLLVTFPVQGHINPSLQFAKRLTAMGIKVTFATSLYARRRMSRT-AAGLPKGVTFAA  62

Query  300  FSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLPWVSEV  479
            FSDGYD+GF   + +   YM+EIR+RGS SL+  +   A QG P+T +V+TLLLPW  EV
Sbjct  63   FSDGYDDGFNPGNDDAGKYMTEIRSRGSQSLRDTILAAAEQGCPVTQLVYTLLLPWAPEV  122

Query  480  ARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATDPNCPVQLPGLPPL-FSG-DLP  653
            AR+ ++PSALLWIQPA VL+IYYYYF+GY D     + D    +Q PG+P L FS  DLP
Sbjct  123  AREFHVPSALLWIQPATVLNIYYYYFNGYGDEIAANSNDATWQIQFPGIPALNFSKRDLP  182

Query  654  SFLLPSGSGGDYSFAMPTFK  713
            SF+LPS S   +S  +P+FK
Sbjct  183  SFILPS-SSDKHSVELPSFK  201



>ref|XP_004252978.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Solanum 
lycopersicum]
Length=470

 Score =   231 bits (589),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 110/202 (54%), Positives = 146/202 (72%), Gaps = 3/202 (1%)
 Frame = +3

Query  114  MVQPHILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLM-SKANGGGVPDGL-  287
            M++PH+++ TFPAQGHINP+LQFAK LV+ GI+VTF+TS+YA RLM  K +    P GL 
Sbjct  1    MMKPHVIVTTFPAQGHINPALQFAKNLVKNGIQVTFSTSIYAQRLMDEKKSIDNFPKGLM  60

Query  288  NFTAFSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLPW  467
            NF  FSDG+D+GF  +   V  YMS++R  GS ++K I+ + +  G PIT +++++ LPW
Sbjct  61   NFVPFSDGFDDGFDHSKDPV-FYMSQLRKCGSQTVKNIIINCSENGSPITCLLYSIFLPW  119

Query  468  VSEVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATDPNCPVQLPGLPPLFSGD  647
             +EVAR+VN+PSALLW QPA +LDIYY+ FHGYE    N + DPN  +QLP LP L + D
Sbjct  120  AAEVAREVNIPSALLWSQPATILDIYYFNFHGYEKEMSNESNDPNWSIQLPHLPQLKTKD  179

Query  648  LPSFLLPSGSGGDYSFAMPTFK  713
            LPSFLLPS + G    A+P FK
Sbjct  180  LPSFLLPSNAKGSLRVALPPFK  201



>ref|XP_010673328.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Beta 
vulgaris subsp. vulgaris]
Length=478

 Score =   229 bits (584),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 110/199 (55%), Positives = 143/199 (72%), Gaps = 5/199 (3%)
 Frame = +3

Query  120  QPHILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANGGGVPDGLNFTA  299
            +PH LLVTFPAQGH+NP+LQFAKRL+R G  VTF+T+  AHR   KA    +P G++F  
Sbjct  5    KPHFLLVTFPAQGHVNPALQFAKRLLRTGAHVTFSTAASAHRCFDKAK---IPSGMSFAT  61

Query  300  FSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLPWVSEV  479
            FSDGYD GF+    +V  Y+S  R RG+ +L  ++ ++ A+GRP+T +V+TLLLPWV+EV
Sbjct  62   FSDGYDAGFRATDGDVLDYLSTFRQRGAETLATLLENSVAEGRPVTCLVYTLLLPWVAEV  121

Query  480  ARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATDPNCPVQLPGLP-PLFSGDLPS  656
            AR  ++PSALLWIQPA V DIYYYYF+GY D   +   DP   ++LP LP  L S D+PS
Sbjct  122  ARKFHVPSALLWIQPATVFDIYYYYFNGYHDIIYDCEKDPLWSLELPNLPLKLKSHDIPS  181

Query  657  FLLPSGSGGDYSFAMPTFK  713
            FLLPS     Y+FA+PTF+
Sbjct  182  FLLPSNPFL-YTFALPTFE  199



>ref|XP_010246537.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Nelumbo 
nucifera]
Length=472

 Score =   229 bits (583),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 114/199 (57%), Positives = 145/199 (73%), Gaps = 6/199 (3%)
 Frame = +3

Query  114  MVQPHILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANGGGVPDGLNF  293
            M  PH L+VTFPAQGHINPSLQFAKRL+ +G +VTFATSV AHR M  A     PDGL F
Sbjct  1    MSPPHFLVVTFPAQGHINPSLQFAKRLIGIGAQVTFATSVSAHRRMLNACN---PDGLTF  57

Query  294  TAFSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLPWVS  473
              FSDG+D+GFK    ++ H++SE++ RGS +L+ ++   A +G P+T +V+TLLLPW +
Sbjct  58   APFSDGHDDGFKP-IGSIEHFLSELKRRGSETLRELILSLAREGCPVTCLVYTLLLPWAA  116

Query  474  EVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATDPNCPVQLPGLPPLFSGDLP  653
            +VAR++++PSALLWIQ A V DIYYY F GY D   N   D +  ++LPGLPPL S DLP
Sbjct  117  DVARNLDVPSALLWIQSATVFDIYYYNFTGYGDLICNNKNDSSYTIELPGLPPLTSRDLP  176

Query  654  SFLLPSGSGGDYSFAMPTF  710
            SFLLPS +   Y FA+PTF
Sbjct  177  SFLLPSNTA--YPFALPTF  193



>dbj|BAF75879.1| glucosyltransferase [Dianthus caryophyllus]
Length=475

 Score =   227 bits (579),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 110/198 (56%), Positives = 144/198 (73%), Gaps = 5/198 (3%)
 Frame = +3

Query  120  QPHILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANGGGVPDGLNFTA  299
            +PH LLVTFPAQGHINP+L+FAKRL+R G++VT ATSV  +R + KA    VP+GL F A
Sbjct  7    KPHFLLVTFPAQGHINPALEFAKRLLRAGVDVTLATSVSGNRCLEKAK---VPEGLRFAA  63

Query  300  FSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLPWVSEV  479
            FSDGYD+GF+ N  +V  YMS+ +  GS SL  +++    +G+ +T + +TLLLPW +EV
Sbjct  64   FSDGYDDGFRPNDDSVLTYMSKFKQNGSRSLADVLNKARDEGKKVTCLAYTLLLPWAAEV  123

Query  480  ARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATDPNCPVQLPGLP-PLFSGDLPS  656
            AR+ ++PSALLWIQPAAV D+YYYYF GY D  K    +P+  + LP LP  L + DLPS
Sbjct  124  AREFHVPSALLWIQPAAVFDVYYYYFRGYGDVIKECENNPSWSINLPNLPFTLRTRDLPS  183

Query  657  FLLPSGSGGDYSFAMPTF  710
            FLLPS +   Y+FA+PTF
Sbjct  184  FLLPS-TPLPYTFAVPTF  200



>gb|EYU31588.1| hypothetical protein MIMGU_mgv1a005398mg [Erythranthe guttata]
Length=485

 Score =   226 bits (576),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 116/200 (58%), Positives = 147/200 (74%), Gaps = 6/200 (3%)
 Frame = +3

Query  120  QPHILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANGGGVPDGLNFTA  299
            Q H+LLVTFPAQGHINPSLQFAKRL  +GI+VTFATS+YA R M++   G +P G+ F A
Sbjct  23   QRHVLLVTFPAQGHINPSLQFAKRLTAIGIKVTFATSLYARRRMARTAAG-LPKGVTFAA  81

Query  300  FSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLPWVSEV  479
            FSDGYD+GF   + +   YM+EIR+RGS SL+  +   A QGRP+T +V++LLLPW  EV
Sbjct  82   FSDGYDDGFNPGNDDAGKYMTEIRSRGSQSLRDTILAAAEQGRPVTQLVYSLLLPWAPEV  141

Query  480  ARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATDPNCPVQLPGLPPL-FSG-DLP  653
            AR+ ++PSALLWIQPA VL+IYYYYF+GY D     + DP   +Q PG+P L FS  DLP
Sbjct  142  AREFHVPSALLWIQPATVLNIYYYYFNGYGDEIATNSDDPTWQIQFPGIPALNFSKRDLP  201

Query  654  SFLLPSGSGGDYSFAMPTFK  713
            SF+LPS S     + +P+FK
Sbjct  202  SFILPSSSD---KYTLPSFK  218



>ref|XP_007034186.1| UDP-glucose:flavonoid 7-O-glucosyltransferase [Theobroma cacao]
 gb|EOY05112.1| UDP-glucose:flavonoid 7-O-glucosyltransferase [Theobroma cacao]
Length=465

 Score =   224 bits (572),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 110/200 (55%), Positives = 139/200 (70%), Gaps = 7/200 (4%)
 Frame = +3

Query  114  MVQPHILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANGGGVPDGLNF  293
            M QPH LLVT+PAQGHINP+LQFAK L+R+G+ VTF T V A R M+K        GL+F
Sbjct  1    MPQPHFLLVTYPAQGHINPTLQFAKCLIRIGVRVTFTTCVSARRRMTKVPSA---QGLSF  57

Query  294  TAFSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLPWVS  473
              FSDGYD+G K       HYMSE R RG  +L  IV  +  +G+P+T +V++LLLPW  
Sbjct  58   LTFSDGYDDGLKPGDDK-DHYMSEFRRRGKENLNDIVVGSDNEGKPVTCIVYSLLLPWAM  116

Query  474  EVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATDPNCPVQLPGLPPLFSGDLP  653
            EVAR+ ++PSA+LWIQPA VLDIYYYYF+GYE+  K  A + NC ++LPGLPPL S DLP
Sbjct  117  EVAREHHIPSAMLWIQPATVLDIYYYYFNGYEETIKGQAGESNCLIELPGLPPLASRDLP  176

Query  654  SFLLPSGSGGDYSFAMPTFK  713
            SF+  S +   Y  A+  F+
Sbjct  177  SFVAASNA---YPSALSLFQ  193



>ref|XP_002301753.1| INDOLE-3-ACETATE BETA-D-GLUCOSYLTRANSFERASE family protein [Populus 
trichocarpa]
 gb|ABK96313.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|EEE81026.1| INDOLE-3-ACETATE BETA-D-GLUCOSYLTRANSFERASE family protein [Populus 
trichocarpa]
Length=472

 Score =   223 bits (568),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 112/199 (56%), Positives = 144/199 (72%), Gaps = 8/199 (4%)
 Frame = +3

Query  117  VQPHILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANGGGVPDGLNFT  296
            VQPH LL+T+PAQGHINP+LQFAK L R+G  VT  TS+ A R MSK      PDGL+F 
Sbjct  3    VQPHFLLLTYPAQGHINPALQFAKGLTRIGALVTLVTSLSAGRRMSKTL---FPDGLSFV  59

Query  297  AFSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLPWVSE  476
             FSDGYD+GFK    +  H+ SE++ RGS +L  ++ D+A +G+P+T +V+T+LL W SE
Sbjct  60   TFSDGYDDGFKP-EDDRDHFTSELKRRGSQTLNELIVDSAKEGKPVTCLVYTMLLHWASE  118

Query  477  VARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATDPNCPVQLPGLPPLFSGDLPS  656
            VAR  +LP+ALLWIQPA V DIYYYYF+GY D F N   D +  ++LPGLPPL S DLPS
Sbjct  119  VARAQHLPAALLWIQPATVFDIYYYYFNGYGDIFNN-CKDTSYAIELPGLPPLASRDLPS  177

Query  657  FLLPSGSGGDYSFAMPTFK  713
            F+LPS +   Y+FA+  F+
Sbjct  178  FVLPSNT---YTFALQMFQ  193



>gb|AJM89728.1| UDP-glucosyltransferase [Leonurus japonicus]
Length=455

 Score =   222 bits (565),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 113/200 (57%), Positives = 146/200 (73%), Gaps = 3/200 (2%)
 Frame = +3

Query  114  MVQPHILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANGGGVPDGLNF  293
            M + H+LLVT PA GHINP+LQFAKRL+ +GI VTF TSVYA R M+ A    V +GL F
Sbjct  1    MERRHVLLVTIPALGHINPALQFAKRLINMGIHVTFVTSVYARRRMAAAAH--VNNGLTF  58

Query  294  TAFSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLPWVS  473
            T+FSDGYD+GFK    +   YM EIR++GS +L+  ++  A QGRPIT +V+TLLLPW +
Sbjct  59   TSFSDGYDDGFKPGTDDAKKYMVEIRSQGSKALRDTIAAAAEQGRPITRLVYTLLLPWAA  118

Query  474  EVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATDPNCPVQLPGLPPLFSGDLP  653
            EVAR+V+LPSALLWIQPA VL +YY+ FHGY D   + + DP+  +Q+PG+  L   DLP
Sbjct  119  EVAREVHLPSALLWIQPATVLAVYYHCFHGYGDEISSCSDDPSWKIQIPGITTLAKRDLP  178

Query  654  SFLLPSGSGGDYSFAMPTFK  713
            SF+LP+ S   Y+F +P FK
Sbjct  179  SFMLPNTS-EIYNFTLPLFK  197



>emb|CDP15111.1| unnamed protein product [Coffea canephora]
Length=471

 Score =   222 bits (565),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 109/200 (55%), Positives = 144/200 (72%), Gaps = 4/200 (2%)
 Frame = +3

Query  120  QPHILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANGGGVPDGLNFTA  299
            Q HILLV++P QGHINPSLQFAKRL+R+GI+VTFATSV+A   M+K++G  +P GL+F  
Sbjct  4    QRHILLVSYPVQGHINPSLQFAKRLLRMGIQVTFATSVFALGRMTKSSGS-IPKGLSFAT  62

Query  300  FSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLP--WVS  473
            FSDGYD GF+      + +MS +   GS++LK +++ +A QG P+T +V T LLP  W +
Sbjct  63   FSDGYDNGFQPKGVGHSEHMSGMEKHGSNALKNVINTSANQGCPVTCLVCTFLLPCPWAT  122

Query  474  EVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATDPNCPVQLPGLPPLFSGDLP  653
             VAR+ ++PSALLWIQPA V+DI+Y YFHGYED  KN + DP   +Q PGLP + + DLP
Sbjct  123  TVARECHIPSALLWIQPATVMDIFYDYFHGYEDDVKNNSNDPTWSIQFPGLPSMKAKDLP  182

Query  654  SFLLPSGSGGDYSFAMPTFK  713
            SF+LPS S   Y   +  FK
Sbjct  183  SFILPS-SDAIYGSVLSAFK  201



>ref|XP_011024782.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Populus 
euphratica]
Length=468

 Score =   221 bits (563),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 109/199 (55%), Positives = 144/199 (72%), Gaps = 8/199 (4%)
 Frame = +3

Query  117  VQPHILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANGGGVPDGLNFT  296
            VQPH LL+T+PAQGHINP+LQFAK L R+G+ VT  TS+ A R MSK      PDG++F 
Sbjct  3    VQPHFLLLTYPAQGHINPALQFAKGLTRIGVLVTLVTSLSAGRRMSKTL---FPDGVSFV  59

Query  297  AFSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLPWVSE  476
             FSDGYD+GFK    +  H+ SE++ RGS +L  ++ D+A +G+P+T +V+T+LL W +E
Sbjct  60   TFSDGYDDGFKP-EDDRDHFTSELKRRGSQTLNELIVDSAKEGKPVTCLVYTMLLQWAAE  118

Query  477  VARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATDPNCPVQLPGLPPLFSGDLPS  656
            VAR  +LP+ALLWIQPA V DIYYYYF+GY D F N   D +  ++LPGLPP  S DLPS
Sbjct  119  VARAQHLPAALLWIQPATVFDIYYYYFNGYGDIFNN-CKDTSYAIELPGLPPFASRDLPS  177

Query  657  FLLPSGSGGDYSFAMPTFK  713
            F+LPS +   Y+FA+  F+
Sbjct  178  FVLPSNT---YTFAIQMFQ  193



>ref|XP_004298223.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Fragaria 
vesca subsp. vesca]
Length=473

 Score =   220 bits (560),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 112/206 (54%), Positives = 146/206 (71%), Gaps = 9/206 (4%)
 Frame = +3

Query  114  MVQPHILLVTFPAQGHINPSLQFAKRLVRL-GIEVTFATSVYAHRLMSKANGGGVPDGLN  290
            M Q   LLVTFPAQGHINPSLQF KRL+R    ++TF T++ AHR +  ANG  +P GL 
Sbjct  1    MTQHRFLLVTFPAQGHINPSLQFVKRLIRTTDADMTFVTALSAHRRI--ANGSSMPRGLT  58

Query  291  FTAFSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLPWV  470
            F  FSDGYD+GFK    ++ HYMSE+R RGS ++  IV  +A +GRP T +V+T+LL WV
Sbjct  59   FAPFSDGYDDGFKPGDIDIHHYMSELRRRGSQAITDIVMSSANEGRPYTCIVYTILLSWV  118

Query  471  SEVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATDPNCP----VQLPGLP-PL  635
            ++VA ++ LP+AL+WIQPA V DIY+YYF+GY++  +N+A   NC     VQLPGLP  L
Sbjct  119  AKVASELQLPAALVWIQPATVFDIYFYYFNGYKNLIRNSAMTNNCDPCHGVQLPGLPLSL  178

Query  636  FSGDLPSFLLPSGSGGDYSFAMPTFK  713
             S DLPSF++ S S   Y FA+P F+
Sbjct  179  KSRDLPSFMVDSNS-NPYDFALPLFE  203



>ref|XP_007099701.1| UDP-glucose:flavonoid 7-O-glucosyltransferase [Theobroma cacao]
 gb|EOY20331.1| UDP-glucose:flavonoid 7-O-glucosyltransferase [Theobroma cacao]
Length=466

 Score =   218 bits (555),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 107/200 (54%), Positives = 136/200 (68%), Gaps = 7/200 (4%)
 Frame = +3

Query  114  MVQPHILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANGGGVPDGLNF  293
            M Q H L+VT+P QGHINP+LQFAK L+R+G  VTF TSV A R M+K        GL+F
Sbjct  1    MPQRHFLVVTYPNQGHINPTLQFAKCLIRIGARVTFTTSVSARRRMTKVPSA---QGLSF  57

Query  294  TAFSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLPWVS  473
              FSDGYD+G K       HYMSE R RG  +L  +V  +  +G+P+T +VH+LLLPW  
Sbjct  58   LTFSDGYDDGLKPGDDK-GHYMSEFRRRGKENLNDLVVSSDKEGKPVTCIVHSLLLPWAM  116

Query  474  EVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATDPNCPVQLPGLPPLFSGDLP  653
            EVAR+ ++PSA+LWIQPA VL IYYYYF+GYE+  K  A +  CP++LPGLPPL S DLP
Sbjct  117  EVAREHHIPSAILWIQPATVLGIYYYYFNGYEETIKGQAGESKCPIELPGLPPLASRDLP  176

Query  654  SFLLPSGSGGDYSFAMPTFK  713
            SF+  S +   Y  A+  F+
Sbjct  177  SFVAASNA---YPSALSLFQ  193



>ref|XP_002322699.1| hypothetical protein POPTR_0016s05290g [Populus trichocarpa]
 gb|EEF04460.1| hypothetical protein POPTR_0016s05290g [Populus trichocarpa]
Length=471

 Score =   216 bits (551),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 114/204 (56%), Positives = 141/204 (69%), Gaps = 6/204 (3%)
 Frame = +3

Query  102  VGVAMVQPHILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANGGGVPD  281
            +GV  VQPHILLVTFPAQGHINP+LQFAKRLV +G  VTFATS+ A R MSK+  G  P 
Sbjct  1    MGVMGVQPHILLVTFPAQGHINPALQFAKRLVAMGAHVTFATSMGAKRRMSKS--GTYPK  58

Query  282  GLNFTAFSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLL  461
            GL F AF DG + GF+ +  ++ HY SE+R  GS SL  ++      G P T VVH+ L+
Sbjct  59   GLYFAAFDDGSEHGFRPSD-DIEHYFSELRHVGSKSLADLICQVPKNGGPFTCVVHSNLI  117

Query  462  PWVSEVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATDPNCPVQLPGLPPLFS  641
            PWV++VAR  NLPS LLW Q  A+LDI+YYYF+GY D  K    DP+  ++LPGLPPL S
Sbjct  118  PWVAKVARQHNLPSTLLWNQSPALLDIFYYYFNGYGDTIKKNINDPSFSLKLPGLPPLGS  177

Query  642  GDLPSFLLPSGSGGDYSFAMPTFK  713
             DLPSFL P  +   ++FA+P  K
Sbjct  178  RDLPSFLNPRNT---HAFALPVNK  198



>ref|XP_002308970.1| putative glucosyltransferase family protein [Populus trichocarpa]
 gb|EEE92493.1| putative glucosyltransferase family protein [Populus trichocarpa]
Length=472

 Score =   215 bits (548),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 109/201 (54%), Positives = 143/201 (71%), Gaps = 6/201 (3%)
 Frame = +3

Query  102  VGVAMVQPHILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANGGGVPD  281
            +GV  VQPHILLVTFPAQGHINP+LQFAKRLV +G  VTF+TS+ A R MSK   G  P 
Sbjct  1    MGVTGVQPHILLVTFPAQGHINPALQFAKRLVAIGAHVTFSTSMGAARRMSKT--GTYPK  58

Query  282  GLNFTAFSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLL  461
            GL+F AF DG + GF+ +  ++ HY +E+R  GS SL  +++ ++  GRP T VV++ L+
Sbjct  59   GLSFAAFDDGSEHGFRPSD-DIDHYFTELRLVGSKSLAELIAASSKNGRPFTCVVYSNLV  117

Query  462  PWVSEVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATDPNCPVQLPGLPPLFS  641
            PWV++VAR++NLPS LLW Q  A+LDI+YYYF+GY D       DP   ++LPGLPPL S
Sbjct  118  PWVAKVARELNLPSTLLWNQSPALLDIFYYYFNGYGDTISENINDPTFSLKLPGLPPLGS  177

Query  642  GDLPSFLLPSGSGGDYSFAMP  704
             DLPSF  P  +   ++FA+P
Sbjct  178  RDLPSFFNPRNT---HAFAIP  195



>ref|XP_011033298.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Populus 
euphratica]
Length=468

 Score =   214 bits (544),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 111/199 (56%), Positives = 139/199 (70%), Gaps = 6/199 (3%)
 Frame = +3

Query  117  VQPHILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANGGGVPDGLNFT  296
            VQPHILLVTFPAQGHINP+LQFAKRLV +G  VTFATS+ A R MSK+  G  P GL F 
Sbjct  3    VQPHILLVTFPAQGHINPALQFAKRLVAIGAHVTFATSMGAKRRMSKS--GTYPKGLYFA  60

Query  297  AFSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLPWVSE  476
            AF DG + GF+ +  ++ HY SE+R  GS SL  ++      G P T VV++ L+PWV++
Sbjct  61   AFDDGSEHGFRPSD-DIEHYFSELRRVGSKSLADLICQGPKNGGPFTCVVYSNLIPWVAK  119

Query  477  VARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATDPNCPVQLPGLPPLFSGDLPS  656
            VAR  NLPS LLW Q  A+LDI+YYYF+GY D  K +  DP+  ++LPGLPPL S DLPS
Sbjct  120  VARQHNLPSTLLWNQSPALLDIFYYYFNGYGDTIKKSINDPSFSLKLPGLPPLGSRDLPS  179

Query  657  FLLPSGSGGDYSFAMPTFK  713
            FL P  +   ++FA+P  K
Sbjct  180  FLNPRNT---HAFALPVNK  195



>ref|XP_002301754.1| hypothetical protein POPTR_0002s23770g [Populus trichocarpa]
 gb|EEE81027.1| hypothetical protein POPTR_0002s23770g [Populus trichocarpa]
Length=469

 Score =   213 bits (543),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 107/199 (54%), Positives = 141/199 (71%), Gaps = 8/199 (4%)
 Frame = +3

Query  117  VQPHILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANGGGVPDGLNFT  296
            VQPH LL+T+PAQGHINP+LQFAK L R+G  VT  TS+ A R MSK      PDGL+F 
Sbjct  3    VQPHFLLLTYPAQGHINPALQFAKGLTRIGALVTLVTSLSAGRRMSKTL---FPDGLSFV  59

Query  297  AFSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLPWVSE  476
             FSDGYD+GFK    +  H+ SE++ RGS +L  ++ D+A +G+P+T +V+T+ L W +E
Sbjct  60   TFSDGYDDGFKP-EDDREHFKSELKRRGSQTLNELIVDSAKEGKPVTCLVYTMFLHWAAE  118

Query  477  VARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATDPNCPVQLPGLPPLFSGDLPS  656
            VAR  +LP+ALLWIQ A V DIYYYYF+GY D F N   D +  ++LPGLPPL S DLPS
Sbjct  119  VARAQHLPAALLWIQLATVFDIYYYYFNGYGDIFNN-CKDTSYAIELPGLPPLASRDLPS  177

Query  657  FLLPSGSGGDYSFAMPTFK  713
             +LPS +   Y++A+  F+
Sbjct  178  LVLPSNT---YAWALQMFQ  193



>ref|XP_011020320.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Populus 
euphratica]
Length=472

 Score =   213 bits (543),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 108/201 (54%), Positives = 143/201 (71%), Gaps = 6/201 (3%)
 Frame = +3

Query  102  VGVAMVQPHILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANGGGVPD  281
            +GV  VQPHILLVTFPAQGHINP+LQFAKRLV +G  VTF+TS+ A R MSK   G  P+
Sbjct  1    MGVMGVQPHILLVTFPAQGHINPALQFAKRLVAIGAHVTFSTSMGAARRMSKT--GTYPE  58

Query  282  GLNFTAFSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLL  461
            GL+F AF DG + GF+ +  ++ HY +E+R  GS SL  ++  ++  GRP T VV++ L+
Sbjct  59   GLSFAAFDDGSEHGFRPSD-DINHYFTELRLVGSKSLAELIVASSKNGRPFTRVVYSNLI  117

Query  462  PWVSEVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATDPNCPVQLPGLPPLFS  641
            PWV++VAR++ LPS LLW Q  A+LDI+YYYF+GY D  +    DP   ++LPGLPPL S
Sbjct  118  PWVAKVARELKLPSTLLWNQSPALLDIFYYYFNGYGDTIRENINDPTFSLKLPGLPPLGS  177

Query  642  GDLPSFLLPSGSGGDYSFAMP  704
             DLPSF  P  +   ++FA+P
Sbjct  178  RDLPSFFNPRNT---HAFAIP  195



>ref|XP_002321086.2| INDOLE-3-ACETATE BETA-D-GLUCOSYLTRANSFERASE family protein [Populus 
trichocarpa]
 gb|EEE99401.2| INDOLE-3-ACETATE BETA-D-GLUCOSYLTRANSFERASE family protein [Populus 
trichocarpa]
Length=467

 Score =   213 bits (542),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 106/186 (57%), Positives = 129/186 (69%), Gaps = 5/186 (3%)
 Frame = +3

Query  120  QPHILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANGGGVPDGLNFTA  299
            QPH LLVT P QGHINPS+QFAKRL  +G  VT AT++ A R MSK      PDGL+F  
Sbjct  4    QPHFLLVTLPLQGHINPSVQFAKRLTLIGARVTLATALSAQRRMSKTL---FPDGLSFVT  60

Query  300  FSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLPWVSEV  479
            FSDGYD+G K     V HYMSE++ RGS +L  ++ D+A +G+PIT +V+T+LLPW  EV
Sbjct  61   FSDGYDDGLKPEDDRV-HYMSELKRRGSQTLNELIVDSAKEGKPITCLVYTVLLPWAVEV  119

Query  480  ARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATDPNCPVQLPGLPPLFSGDLPSF  659
            AR  +LP+A LWIQPA V DIY+YYF+ Y D F N     N  + LPGLP   S DLPSF
Sbjct  120  ARAQHLPAAFLWIQPATVFDIYFYYFNCYGDIFSNCKDTSNV-IALPGLPQFASRDLPSF  178

Query  660  LLPSGS  677
            LLPS +
Sbjct  179  LLPSNT  184



>gb|KJB28073.1| hypothetical protein B456_005G025400 [Gossypium raimondii]
Length=469

 Score =   210 bits (535),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 105/204 (51%), Positives = 141/204 (69%), Gaps = 13/204 (6%)
 Frame = +3

Query  114  MVQPHILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANGGGVP--DGL  287
            M QPH ++VT+PAQGHINP+LQFAK L+RLG+ VT+ TS+ A R M+K     VP  +GL
Sbjct  1    MPQPHFIVVTYPAQGHINPTLQFAKHLIRLGVRVTYITSISASRRMTK-----VPTAEGL  55

Query  288  NFTAFSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLPW  467
            +F  FSDGYD G K    +  HY+SE + RG  ++   ++ +  +G+PIT +V++L L W
Sbjct  56   SFLPFSDGYDYGIKPGD-DTDHYLSEFKRRGKDAISEYITSSENEGKPITCIVYSLCLHW  114

Query  468  VSEVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAA--TDPNCPVQLPGLPPLFS  641
             +EVAR  ++PSALLWIQPA V DIYY+YF+GYE A K  A  T+P C ++LPGLPPLF 
Sbjct  115  AAEVARKHHIPSALLWIQPATVFDIYYFYFNGYESAIKAQADETNPKCSIKLPGLPPLFP  174

Query  642  GDLPSFLLPSGSGGDYSFAMPTFK  713
             DLPSF++ S     Y  A+  F+
Sbjct  175  RDLPSFVIASNV---YQSALSLFQ  195



>gb|KJB28074.1| hypothetical protein B456_005G025500 [Gossypium raimondii]
Length=469

 Score =   210 bits (535),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 102/204 (50%), Positives = 143/204 (70%), Gaps = 13/204 (6%)
 Frame = +3

Query  114  MVQPHILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANGGGVP--DGL  287
            M  PH ++VT+PAQGHINP+LQFA+ L+R+G+ VT+ TS+ A R M+K     VP  +GL
Sbjct  1    MPHPHFIVVTYPAQGHINPTLQFAQHLIRIGVRVTYITSISASRRMTK-----VPTAEGL  55

Query  288  NFTAFSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLPW  467
            +F  FSDGYD+G K    ++ HY+SE + RG  ++   ++ +  +G+PIT +V++L L W
Sbjct  56   SFLPFSDGYDDGIKPGD-DIDHYLSEFKRRGKDAISEFITSSENEGKPITCIVYSLCLHW  114

Query  468  VSEVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAA--TDPNCPVQLPGLPPLFS  641
             +EVAR  ++PSALLWIQPA V DIYY+YF+GYE A K  A  T+P C ++LPGLPPLF+
Sbjct  115  AAEVARKHHIPSALLWIQPATVFDIYYFYFNGYESAIKAQADETNPKCSIKLPGLPPLFT  174

Query  642  GDLPSFLLPSGSGGDYSFAMPTFK  713
             DLPSF++ S     Y  A+  F+
Sbjct  175  RDLPSFVIASNV---YQSALSLFQ  195



>gb|KJB28077.1| hypothetical protein B456_005G025900 [Gossypium raimondii]
Length=469

 Score =   209 bits (533),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 102/202 (50%), Positives = 137/202 (68%), Gaps = 9/202 (4%)
 Frame = +3

Query  114  MVQPHILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANGGGVPDGLNF  293
            M QPH LLVTFPAQGHINP+LQFAK L+R+G+ VTF T + AHR M+K        GL F
Sbjct  1    MSQPHFLLVTFPAQGHINPTLQFAKHLIRIGVRVTFITCISAHRRMTKV---PTAQGLTF  57

Query  294  TAFSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLPWVS  473
              FSDGYD+GF+    ++ HY+SE+R RG  ++   ++ +  +G+P+T +V+TL + W S
Sbjct  58   LPFSDGYDDGFQPGD-DIEHYLSELRRRGKEAISEFITSSENEGKPVTCIVYTLFIHWAS  116

Query  474  EVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKN--AATDPNCPVQLPGLPPLFSGD  647
            EVAR  ++P+ALLWIQPA V DIYY+YF+GYE   K     T+P   ++LPGLP L + D
Sbjct  117  EVARKHHIPTALLWIQPATVFDIYYFYFNGYESTIKAPVDETNPKRSIKLPGLPLLATRD  176

Query  648  LPSFLLPSGSGGDYSFAMPTFK  713
            LPSF+  S     Y +A+  FK
Sbjct  177  LPSFVTASNV---YRWALSLFK  195



>ref|XP_003552552.1| PREDICTED: anthocyanidin 3-O-glucoside 5-O-glucosyltransferase-like 
[Glycine max]
Length=465

 Score =   208 bits (530),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 107/202 (53%), Positives = 145/202 (72%), Gaps = 11/202 (5%)
 Frame = +3

Query  114  MVQPHILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANGGGVPDGLNF  293
            MVQ   LL+T+P QGHINPS+QFAKRLV +G+ VTFATS+Y HR M K     +P GL+F
Sbjct  1    MVQHRFLLITYPIQGHINPSIQFAKRLVSMGVHVTFATSLYLHRRMLKKPT--IP-GLSF  57

Query  294  TAFSDGYDEGFK-KNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLPWV  470
              FSDGYD+G+K  +  +++ YMSE++ RGS  L+ I++    +G+P T + +T+LLPW 
Sbjct  58   ATFSDGYDDGYKATDDSSLSSYMSELKRRGSEFLRNIITAAKQEGQPFTCLAYTILLPWA  117

Query  471  SEVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATDPNCPVQLPGLP-PLFSGD  647
            ++VAR++++P ALLWIQ A V DIYYYYFH Y D+F N  +DP   ++LPGLP  L + D
Sbjct  118  AKVARELHIPGALLWIQAATVFDIYYYYFHEYGDSF-NYKSDPT--IELPGLPFSLTARD  174

Query  648  LPSFLLPSGSGGDYSFAMPTFK  713
            +PSFLLPS     Y FA+PT +
Sbjct  175  VPSFLLPSNI---YRFALPTLQ  193



>ref|XP_008222736.1| PREDICTED: anthocyanidin 3-O-glucoside 5-O-glucosyltransferase-like 
[Prunus mume]
Length=474

 Score =   206 bits (524),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 105/207 (51%), Positives = 141/207 (68%), Gaps = 14/207 (7%)
 Frame = +3

Query  114  MVQPHILLVTFPAQGHINPSLQFAKRLVRL-GIEVTFATSVYAHRLMSKANGGGVPDGLN  290
            MVQ   L+VTFPAQGHINPSLQFAK LVR  G  VT+ TS+ AH   S+   G  P GL 
Sbjct  1    MVQHRFLIVTFPAQGHINPSLQFAKHLVRTTGAHVTYVTSLSAH---SRIGNGSTPYGLT  57

Query  291  FTAFSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLPWV  470
            ++ +SDGYD GFK +  ++ HYMSEIR RG+ ++  ++  +A +GRP T +++T+LLPW 
Sbjct  58   YSLYSDGYDNGFK-DGDDIDHYMSEIRRRGAQAITDLIVSSAKEGRPYTCLIYTILLPWA  116

Query  471  SEVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATDPN-----CPVQLPGLP-P  632
            +  AR+++LPS L+WIQPA V DIYYYYF GY+D  +N  +  +     C ++LPGLP  
Sbjct  117  AVAARELHLPSVLVWIQPATVFDIYYYYFRGYKDLIRNGTSTTHTNGALCSIELPGLPLS  176

Query  633  LFSGDLPSFLLPSGSGGDYSFAMPTFK  713
            L S DLPSF++ S     Y FA+P F+
Sbjct  177  LASRDLPSFMVDSNP---YGFALPLFE  200



>ref|XP_004297003.2| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Fragaria 
vesca subsp. vesca]
Length=516

 Score =   207 bits (526),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 109/204 (53%), Positives = 141/204 (69%), Gaps = 12/204 (6%)
 Frame = +3

Query  120  QPHILLVTFPAQGHINPSLQFAKRLVRL-GIEVTFATSVYAHRLMSKANGGGVPDGLNFT  296
            Q   LLVT+PAQGHINPSLQF K L+R  G EVT+ T++ AHR +   N    P GL F 
Sbjct  48   QHRFLLVTYPAQGHINPSLQFVKCLIRTTGAEVTYVTALSAHRRI--GNSSSKPRGLTFA  105

Query  297  AFSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLPWVSE  476
             FSDGYD+G K    ++ HY+SE+R RGS +L  IV  +A +GRP T +V+T+LLPWV++
Sbjct  106  PFSDGYDDGLKPGD-DIPHYLSELRRRGSHALADIVVSSANEGRPYTCIVYTILLPWVAQ  164

Query  477  VARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATDPNCP----VQLPGLP-PLFS  641
            VA +++LP+AL+WIQPA V DIYYYY +GY+D  +N AT  +C     V+LPGLP  L S
Sbjct  165  VASELHLPAALVWIQPATVFDIYYYYLNGYKDLIRNNATAKSCDPCHGVELPGLPLALKS  224

Query  642  GDLPSFLLPSGSGGDYSFAMPTFK  713
             DLPSF++ S     Y FA+P FK
Sbjct  225  RDLPSFMVDSNP---YDFALPLFK  245



>ref|XP_010434517.1| PREDICTED: UDP-glycosyltransferase 75D1 [Camelina sativa]
Length=474

 Score =   206 bits (523),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 104/209 (50%), Positives = 138/209 (66%), Gaps = 19/209 (9%)
 Frame = +3

Query  123  PHILLVTFPAQGHINPSLQFAKRL---VRLGIEVTFAT--SVYAHRLMSKANGGGVPDGL  287
            PH L VT+PAQGHINPSLQ AKRL   +  G  VTFA   S Y  R+ S+ N   VP+ L
Sbjct  12   PHFLFVTYPAQGHINPSLQLAKRLAGTISNG-RVTFAAPISAYNRRMFSQEN---VPETL  67

Query  288  NFTAFSDGYDEGFKKN-------HHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVV  446
             F+ +SDG+D+GFK +          VA+YMS++R RG  +L  ++ DN  Q RP T VV
Sbjct  68   TFSTYSDGHDDGFKSSTSFDKSPQEAVANYMSDMRRRGKETLTELIEDNRKQNRPFTCVV  127

Query  447  HTLLLPWVSEVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATDPNCPVQLPGL  626
            +T+LL WVSE+AR+++LPSALLW+QP  V  I+Y+YFHGYEDA      +P+  +QLP L
Sbjct  128  YTILLTWVSELAREIHLPSALLWVQPVTVFSIFYHYFHGYEDAISEMGNNPSSSIQLPSL  187

Query  627  PPLFSGDLPSFLLPSGSGGDYSFAMPTFK  713
            P L   DLPSF++ S +   Y+F +P F+
Sbjct  188  PLLCVRDLPSFIVSSNA---YAFLLPAFR  213



>ref|XP_010246964.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Nelumbo 
nucifera]
Length=476

 Score =   206 bits (523),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 101/184 (55%), Positives = 130/184 (71%), Gaps = 4/184 (2%)
 Frame = +3

Query  126  HILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANGGGVPDGLNFTAFS  305
            H LLVTFPAQGHINP+LQFAKRL   G++VTF TSV A RLM+        D L +  FS
Sbjct  6    HFLLVTFPAQGHINPALQFAKRLTLTGVQVTFVTSVSAFRLMTNLP---TQDALTYFPFS  62

Query  306  DGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLPWVSEVAR  485
            DGYD+G K +  +  ++MSE+R RGS +L   V  +A + RP+T +++T+LLPW +EVA 
Sbjct  63   DGYDDGCKSSD-DFDNFMSELRCRGSQALTDYVESSAKERRPVTCLIYTILLPWAAEVAS  121

Query  486  DVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATDPNCPVQLPGLPPLFSGDLPSFLL  665
            ++ +PSALLWIQPAAVLDIYY+YF+GY D   N   DP   ++LPGLP L   D+PSF L
Sbjct  122  NLGVPSALLWIQPAAVLDIYYFYFNGYGDLMANFKNDPLYAIELPGLPLLTGRDVPSFFL  181

Query  666  PSGS  677
            PS +
Sbjct  182  PSSA  185



>ref|XP_007221319.1| hypothetical protein PRUPE_ppa021645mg [Prunus persica]
 gb|EMJ22518.1| hypothetical protein PRUPE_ppa021645mg [Prunus persica]
Length=474

 Score =   204 bits (520),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 107/207 (52%), Positives = 142/207 (69%), Gaps = 14/207 (7%)
 Frame = +3

Query  114  MVQPHILLVTFPAQGHINPSLQFAKRLVRL-GIEVTFATSVYAHRLMSKANGGGVPDGLN  290
            MVQ   LL+TFPAQGHINPSLQFAK L+R  G  VT+ T + AHR   +   G  P GL 
Sbjct  1    MVQHRFLLLTFPAQGHINPSLQFAKHLIRTTGAHVTYVTCLSAHR---RLGNGSTPHGLT  57

Query  291  FTAFSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLPWV  470
            ++ FSDGYD GFK +  +  HYMSE+R RG+ ++  ++  +A +GRP T +++T+LLPW 
Sbjct  58   YSLFSDGYDNGFK-DGDDYDHYMSELRRRGAQAITDLIVSSAKEGRPYTCLIYTILLPWA  116

Query  471  SEVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKN--AATDPN---CPVQLPGLP-P  632
            + VAR+++LPS L+WIQPA V DIYYYYF GY+D  +N  +AT  N   C ++LPGLP  
Sbjct  117  AVVARELHLPSVLVWIQPATVFDIYYYYFSGYKDLIQNSTSATHTNGALCSIELPGLPQS  176

Query  633  LFSGDLPSFLLPSGSGGDYSFAMPTFK  713
            L S DLPSF++ S     YSFA+  F+
Sbjct  177  LTSRDLPSFMVDSNL---YSFALLLFE  200



>ref|XP_002516389.1| UDP-glucosyltransferase, putative [Ricinus communis]
 gb|EEF46006.1| UDP-glucosyltransferase, putative [Ricinus communis]
Length=460

 Score =   204 bits (519),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 99/201 (49%), Positives = 134/201 (67%), Gaps = 4/201 (2%)
 Frame = +3

Query  114  MVQPHILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKAN-GGGVPDGLN  290
            M  PHIL+VTFP+QGHINP LQ AKRLV LG++VTFAT++  HR MS+ +   G+   L+
Sbjct  1    MGHPHILVVTFPSQGHINPGLQLAKRLVTLGLKVTFATTISTHRRMSRTDDSNGL---LS  57

Query  291  FTAFSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLPWV  470
            F  FSDG+D+G+     + AH +SE+   G  +   I+  +A  G P+T ++++LL+ WV
Sbjct  58   FATFSDGHDDGYNLLGGDFAHCLSELTHYGQQTFPKIILRSAKDGHPVTCIIYSLLVSWV  117

Query  471  SEVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATDPNCPVQLPGLPPLFSGDL  650
            ++VARD +LPS  LW QPA VLD+YY+YFHGYE   + +   P   V LPGLPPL S DL
Sbjct  118  AKVARDFHLPSIFLWNQPATVLDVYYHYFHGYEGDIEKSINSPTISVNLPGLPPLRSSDL  177

Query  651  PSFLLPSGSGGDYSFAMPTFK  713
            PSF  P  +   + FA+P  K
Sbjct  178  PSFFSPKSNTKLHGFALPALK  198



>dbj|BAF03079.1| UDP-glucose:flavonol 5-O-glucosyltransferase homolog [Solanum 
melongena]
Length=360

 Score =   201 bits (511),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 96/183 (52%), Positives = 131/183 (72%), Gaps = 3/183 (2%)
 Frame = +3

Query  171  SLQFAKRLVRLGIEVTFATSVYAHRLM-SKANGGGVPDGL-NFTAFSDGYDEGFKKNHHN  344
            +LQFAK LV++GI+VTF+TS+YA +LM  K +    P GL NF  FSDG+D+GF  +   
Sbjct  1    ALQFAKNLVKIGIQVTFSTSIYAQKLMDEKKSIDNFPKGLMNFVPFSDGFDDGFDHSKDP  60

Query  345  VAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLPWVSEVARDVNLPSALLWIQP  524
            V  YMS++R  GS ++K I+ + +  G PIT +++++ LPW +EVAR+VN+PS+LLW QP
Sbjct  61   V-FYMSQLRKCGSETVKNIIMNCSENGSPITCLLYSIFLPWAAEVAREVNIPSSLLWSQP  119

Query  525  AAVLDIYYYYFHGYEDAFKNAATDPNCPVQLPGLPPLFSGDLPSFLLPSGSGGDYSFAMP  704
            A +LDIYY+ FHGYE+   N + DPN  +QLPGLP L + DLPSFLLPS + G    A+P
Sbjct  120  ATILDIYYFNFHGYEEQMSNESNDPNWSIQLPGLPQLKTKDLPSFLLPSSAKGSLKVALP  179

Query  705  TFK  713
             FK
Sbjct  180  PFK  182



>gb|KJB28079.1| hypothetical protein B456_005G026100, partial [Gossypium raimondii]
Length=535

 Score =   205 bits (522),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 99/186 (53%), Positives = 130/186 (70%), Gaps = 6/186 (3%)
 Frame = +3

Query  111  AMVQPHILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANGGGVPDGLN  290
             M Q H LLVTFPAQGHINP+LQFAK L+R+G+ VTF T + A R MSK        GL 
Sbjct  62   TMSQLHFLLVTFPAQGHINPTLQFAKHLIRIGVRVTFITCISARRRMSKVPTA---QGLT  118

Query  291  FTAFSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLPWV  470
            F  FSDGYD+GF+    ++ HY+SE+R RG  ++   ++ +  +G+P+T +V+TL + W 
Sbjct  119  FLPFSDGYDDGFQPCD-DIDHYLSELRRRGKEAISEFITSSENEGKPVTCIVYTLFIHWA  177

Query  471  SEVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAA--TDPNCPVQLPGLPPLFSG  644
            SEVAR  ++P+ALLWIQPA V DIYY+YF+GYE  FK  A  T+P   ++LPGLP L + 
Sbjct  178  SEVARKHHIPTALLWIQPATVFDIYYFYFNGYETTFKAQADETNPQRSIKLPGLPLLATR  237

Query  645  DLPSFL  662
            DLPSFL
Sbjct  238  DLPSFL  243



>gb|EYU27003.1| hypothetical protein MIMGU_mgv1a024986mg [Erythranthe guttata]
Length=450

 Score =   202 bits (515),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 107/201 (53%), Positives = 134/201 (67%), Gaps = 20/201 (10%)
 Frame = +3

Query  117  VQPHILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANGGGVPDGLNFT  296
            +Q H+LLVTFPAQGHI+PS QFAKR   +GI+VTFATS+YA R MS+    G+P G+ F 
Sbjct  1    MQRHVLLVTFPAQGHISPSFQFAKRPTAMGIKVTFATSLYARRRMSR-TAAGLPKGVTFA  59

Query  297  AFSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLPWVSE  476
            AFS GYD+G                ++GS SL+  +   A Q RP+T +V+TLLLPW  E
Sbjct  60   AFSGGYDDG----------------SKGSQSLRDTILAAADQDRPVTQLVYTLLLPWAPE  103

Query  477  VARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATDPNCPVQLPGLPPL--FSGDL  650
            VAR+ ++PSALLWIQPA VL IYYYYF+GY D     + D    +Q PG+P L     DL
Sbjct  104  VAREFHVPSALLWIQPATVLIIYYYYFNGYGDEIATNSDDTTWQIQSPGIPALNFAKRDL  163

Query  651  PSFLLPSGSGGDYSFAMPTFK  713
            PSF+LPS S   YSFA+P+FK
Sbjct  164  PSFVLPS-SSDKYSFALPSFK  183



>ref|XP_002266800.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Vitis 
vinifera]
Length=257

 Score =   197 bits (500),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 101/201 (50%), Positives = 136/201 (68%), Gaps = 7/201 (3%)
 Frame = +3

Query  114  MVQPHILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANGGGVPDGLNF  293
            M Q H L+++ P QGHINP+LQ AKRL+R G  VTFA SV AHR M K     +P GL  
Sbjct  1    MGQHHFLIISHPLQGHINPALQLAKRLIRTGAHVTFAVSVSAHRRMPK--DPTLP-GLTL  57

Query  294  TAFSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLPWVS  473
              FSDGYD+G K ++ +  HYMSEI+  GS +L+ I + +A QGRP+T ++HT+LL W +
Sbjct  58   VPFSDGYDDGLKYSNDHAQHYMSEIKRCGSETLRRITAMSADQGRPVTCLLHTILLTWAA  117

Query  474  EVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATDPNCPVQLPGLPPLFSG-DL  650
            E+AR + +PSALLWIQ A V  IYY+YF+GY D   + + + + P++LPGLP L S  D+
Sbjct  118  ELARSLQVPSALLWIQSATVFTIYYHYFNGYGDVVGDCSNEGSSPIELPGLPILLSSCDI  177

Query  651  PSFLLPSGSGGDYSFAMPTFK  713
            PSFLL   S   Y+  + TF+
Sbjct  178  PSFLL---SSNIYASLLSTFQ  195



>ref|XP_007221281.1| hypothetical protein PRUPE_ppa005161mg [Prunus persica]
 gb|EMJ22480.1| hypothetical protein PRUPE_ppa005161mg [Prunus persica]
Length=474

 Score =   203 bits (516),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 106/207 (51%), Positives = 140/207 (68%), Gaps = 14/207 (7%)
 Frame = +3

Query  114  MVQPHILLVTFPAQGHINPSLQFAKRLVRL-GIEVTFATSVYAHRLMSKANGGGVPDGLN  290
            MVQ   LLVTFPAQGHINPSLQFAK LVR  G  VT+ TS+ A    S+   G  P GL 
Sbjct  1    MVQHRFLLVTFPAQGHINPSLQFAKHLVRTTGAHVTYVTSLSAQ---SRIGNGSTPHGLT  57

Query  291  FTAFSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLPWV  470
            ++ +SDGYD GFK +  ++ HYMSE+R  G+ ++  ++  +A +GRP T +++T+LLPW 
Sbjct  58   YSLYSDGYDNGFK-DGDDIDHYMSELRRCGAQAITDLIVSSAKEGRPYTCLIYTILLPWA  116

Query  471  SEVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKN--AATDPN---CPVQLPGLP-P  632
            +E AR+++LPS L+WIQPA V DIYYYYF GY+D  +     T PN   C ++LPGLP  
Sbjct  117  AEAARELHLPSVLVWIQPATVFDIYYYYFSGYKDLIRKNTCTTHPNGALCSIELPGLPLS  176

Query  633  LFSGDLPSFLLPSGSGGDYSFAMPTFK  713
            L S DLPSF++ S     Y FA+P F+
Sbjct  177  LASRDLPSFMVGSNP---YGFALPLFE  200



>ref|XP_007221288.1| hypothetical protein PRUPE_ppa016890mg [Prunus persica]
 gb|EMJ22487.1| hypothetical protein PRUPE_ppa016890mg [Prunus persica]
Length=474

 Score =   202 bits (514),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 101/206 (49%), Positives = 142/206 (69%), Gaps = 13/206 (6%)
 Frame = +3

Query  114  MVQPHILLVTFPAQGHINPSLQFAKRLVR-LGIEVTFATSVYAHRLMSKANGGGVPDGLN  290
            MVQ   L +T+PAQGHINP+LQ AKRL+R  G +VT+ TS+YA+R   +   G  P+GL 
Sbjct  1    MVQHRFLFLTYPAQGHINPALQLAKRLIRNTGAQVTYVTSLYAYR---RIVNGSTPNGLT  57

Query  291  FTAFSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLPWV  470
            +  +SDGYD+GFK +  +V HYMSE+R  GS  +  +V+ +A +G P T +V+T+LLPW 
Sbjct  58   YAPYSDGYDDGFKFSD-DVDHYMSELRRAGSQVITDLVASSAKEGHPYTCLVYTILLPWA  116

Query  471  SEVARDVNLPSALLWIQPAAVLDIYYYYFHGYED----AFKNAATDPNCPVQLPGLP-PL  635
            +++AR+++LPS L WIQ A + D+YYYY  GY+D    +F     DP+C +QLPGLP  L
Sbjct  117  ADLARELHLPSVLAWIQAATLFDVYYYYLSGYKDLIRESFGTDTNDPSCSIQLPGLPLDL  176

Query  636  FSGDLPSFLLPSGSGGDYSFAMPTFK  713
             S DLPSF++   S   Y+FA+P F+
Sbjct  177  ASRDLPSFMVAENS---YNFALPLFE  199



>gb|AAX16493.1| UDP-glucose:flavonoid 7-O-glucosyltransferase [Malus domestica]
Length=481

 Score =   202 bits (513),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 108/207 (52%), Positives = 142/207 (69%), Gaps = 14/207 (7%)
 Frame = +3

Query  114  MVQPHILLVTFPAQGHINPSLQFAKRLVRL-GIEVTFATSVYAHRLMSKANGGGVPDGLN  290
            MVQ   LLVTFPAQGHINPSLQFAKRL+   G  VT+ TS+ AHR   +   G +PDGL 
Sbjct  1    MVQHRFLLVTFPAQGHINPSLQFAKRLINTTGAHVTYVTSLSAHR---RIGNGSIPDGLT  57

Query  291  FTAFSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLPWV  470
            +  FSDGYD+GFK    NV  YMSE+R RG  ++  +V  +A +G P T +V++LLLPW 
Sbjct  58   YAPFSDGYDDGFKPGD-NVDDYMSELRRRGVQAITDLVVASANEGHPYTCLVYSLLLPWS  116

Query  471  SEVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFK-NAATDPN----CPVQLPGLPPL  635
            + +A +++LPS LLWIQPA V DIYYYYF+GY+D  + N ++  N    C ++LPGLP  
Sbjct  117  AGMAHELHLPSVLLWIQPATVFDIYYYYFNGYKDLIRDNTSSGTNNVLPCSIELPGLPLS  176

Query  636  F-SGDLPSFLLPSGSGGDYSFAMPTFK  713
            F S DLPSF++ +     Y+FA+P F+
Sbjct  177  FTSRDLPSFMVDTNP---YNFALPLFQ  200



>ref|XP_008380455.1| PREDICTED: anthocyanidin 3-O-glucoside 5-O-glucosyltransferase 
2-like [Malus domestica]
Length=481

 Score =   201 bits (512),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 107/207 (52%), Positives = 142/207 (69%), Gaps = 14/207 (7%)
 Frame = +3

Query  114  MVQPHILLVTFPAQGHINPSLQFAKRLVRL-GIEVTFATSVYAHRLMSKANGGGVPDGLN  290
            MVQ   LLVTFPAQGHINPSLQFAKRL+   G  VT+ TS+ AHR   +   G +PDGL 
Sbjct  1    MVQHRFLLVTFPAQGHINPSLQFAKRLINTTGAHVTYVTSLSAHR---RIGNGSIPDGLT  57

Query  291  FTAFSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLPWV  470
            +  FSDGYD+GFK    N+  YMSE+R RG  ++  +V  +A +G P T +V++LLLPW 
Sbjct  58   YAPFSDGYDDGFKPGD-NIDDYMSELRRRGVQAITDLVVASANEGHPYTCLVYSLLLPWS  116

Query  471  SEVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFK-NAATDPN----CPVQLPGLPPL  635
            + +A +++LPS LLWIQPA V DIYYYYF+GY+D  + N ++  N    C ++LPGLP  
Sbjct  117  AGMAHELHLPSVLLWIQPATVFDIYYYYFNGYKDLIRDNTSSGTNNVLPCSIELPGLPLS  176

Query  636  F-SGDLPSFLLPSGSGGDYSFAMPTFK  713
            F S DLPSF++ +     Y+FA+P F+
Sbjct  177  FTSRDLPSFMVDTNP---YNFALPLFQ  200



>gb|KJB28080.1| hypothetical protein B456_005G026200 [Gossypium raimondii]
Length=542

 Score =   203 bits (516),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 97/185 (52%), Positives = 129/185 (70%), Gaps = 6/185 (3%)
 Frame = +3

Query  114  MVQPHILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANGGGVPDGLNF  293
            M QPH LLVTFPAQGHINP+LQFAK L+R+G+ VTF T + AHR MSK        GL F
Sbjct  67   MSQPHFLLVTFPAQGHINPTLQFAKHLIRIGVRVTFITCISAHRRMSKVPTA---QGLTF  123

Query  294  TAFSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLPWVS  473
              FSDGYD+  +    ++ HY+SE+R RG  ++   ++ +  +G+P+T +V+TL + W S
Sbjct  124  LPFSDGYDDECQPGD-DIDHYLSELRRRGKEAVSEFITSSENEGKPVTCIVYTLFIHWAS  182

Query  474  EVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATD--PNCPVQLPGLPPLFSGD  647
            EVAR  ++P+ALLWIQPA V DIYY+YF+G+E  FK  A +  P   ++LPGLP L + D
Sbjct  183  EVARKHHIPTALLWIQPATVFDIYYFYFNGHESTFKAQADEKNPKRSIKLPGLPLLATRD  242

Query  648  LPSFL  662
            LPSFL
Sbjct  243  LPSFL  247



>ref|XP_008380456.1| PREDICTED: anthocyanidin 3-O-glucoside 5-O-glucosyltransferase 
2-like [Malus domestica]
Length=474

 Score =   200 bits (508),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 104/207 (50%), Positives = 140/207 (68%), Gaps = 14/207 (7%)
 Frame = +3

Query  114  MVQPHILLVTFPAQGHINPSLQFAKRLVRL-GIEVTFATSVYAHRLMSKANGGGVPDGLN  290
            MVQ   LLVT+PAQGHINPSLQFAKRL+   G  VTF TS  AH    +   G +PDGL 
Sbjct  1    MVQHRFLLVTYPAQGHINPSLQFAKRLINTTGAHVTFVTSFSAHH---RIGNGSIPDGLT  57

Query  291  FTAFSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLPWV  470
            +  FSDGYD+GFK    N+ HY SE+R RG+ ++  +V  +A +G P T +V+T+LLPW 
Sbjct  58   YAPFSDGYDDGFKPGD-NIDHYWSELRRRGAQAITDLVVSSANEGHPYTCLVYTILLPWA  116

Query  471  SEVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFK-NAATDPN----CPVQLPGLP-P  632
            ++VA +++LP+ LLWIQPA V DIYYYYF+GY+D  + N ++  N    C ++LPGLP  
Sbjct  117  ADVAHELHLPNVLLWIQPATVFDIYYYYFNGYKDLIRDNTSSGTNDALPCAIELPGLPLS  176

Query  633  LFSGDLPSFLLPSGSGGDYSFAMPTFK  713
            L S DLPSF++ +     Y+F +P  +
Sbjct  177  LTSQDLPSFMVDTNP---YTFVLPLLQ  200



>gb|AAY27090.1| UDP-glucose:flavonoid 7-O-glucosyltransferase [Pyrus communis]
Length=481

 Score =   199 bits (505),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 105/207 (51%), Positives = 142/207 (69%), Gaps = 14/207 (7%)
 Frame = +3

Query  114  MVQPHILLVTFPAQGHINPSLQFAKRLVRL-GIEVTFATSVYAHRLMSKANGGGVPDGLN  290
            MVQ   LLVT+PAQGHINPSLQFAKRL    G  VT+ TS+ AHR   +   G +PDGL 
Sbjct  1    MVQHRFLLVTYPAQGHINPSLQFAKRLTNTTGAHVTYVTSLSAHR---RIGNGSIPDGLT  57

Query  291  FTAFSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLPWV  470
            +  FSDGYD+GFK    N+  YMSE+R RG+ ++  +V  +A +G P T +V++L++PW 
Sbjct  58   YAPFSDGYDDGFKPGD-NIDDYMSELRHRGAQAITDLVVASANEGHPYTCLVYSLIVPWS  116

Query  471  SEVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFK-NAATDPN----CPVQLPGLPPL  635
            + VA +++LPS LLWIQPA V DIYYYYF+GY+D  + N ++  N    C ++LPGLP  
Sbjct  117  AGVAHELHLPSVLLWIQPATVFDIYYYYFNGYKDLIRDNTSSGTNNVLPCSIELPGLPLS  176

Query  636  F-SGDLPSFLLPSGSGGDYSFAMPTFK  713
            F S DLPSF++ +     Y+FA+P F+
Sbjct  177  FTSRDLPSFMVDTNP---YNFALPLFQ  200



>ref|XP_002267330.2| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Vitis 
vinifera]
Length=497

 Score =   199 bits (506),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 95/200 (48%), Positives = 135/200 (68%), Gaps = 5/200 (3%)
 Frame = +3

Query  114  MVQPHILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANGGGVPDGLNF  293
            M QPH +++T+PAQGHINPSLQ AKRL+R G  VTF TS YA   M+K       DGL F
Sbjct  33   MTQPHFIVITYPAQGHINPSLQLAKRLIRAGAHVTFVTSTYAGERMAKTP---TMDGLKF  89

Query  294  TAFSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLPWVS  473
              F DG D G K++   +  +MSE+   GS +L G++  +A +GRP+T +++ +L+PWV+
Sbjct  90   VTFPDGCDSGLKQSDA-LQGFMSELERLGSQALIGLLIASANEGRPVTCIIYGILIPWVA  148

Query  474  EVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATDPNCPVQLPGLPPLFSGDLP  653
            EVAR +++PSAL W QP +V +IYYYYF GY +  +   +D +  ++LPGLP L S D+P
Sbjct  149  EVARSLHIPSALFWSQPVSVFNIYYYYFCGYGELIRKKVSDSSPSIELPGLPLLSSRDIP  208

Query  654  SFLLPSGSGGDYSFAMPTFK  713
             FLLPS +  +Y+F +  F+
Sbjct  209  CFLLPS-NANEYNFVLSAFQ  227



>emb|CAN77410.1| hypothetical protein VITISV_038710 [Vitis vinifera]
Length=299

 Score =   194 bits (492),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 101/201 (50%), Positives = 133/201 (66%), Gaps = 8/201 (4%)
 Frame = +3

Query  114  MVQPHILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANGGGVPDGLNF  293
            M Q H L+++ P QGHINP+LQFAKRL+R+G  VTF  SV AHR M K   G +  GL  
Sbjct  1    MGQHHFLIISHPLQGHINPALQFAKRLIRIGAHVTFVVSVSAHRHMPK---GPILPGLTL  57

Query  294  TAFSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLPWVS  473
              FSDGYD+G     H   HY+SEI+  GS +L+ I++ +A QGRP+T +VHT+LL WV+
Sbjct  58   VPFSDGYDDGINLEDH-AQHYLSEIKRCGSETLRRIIAISADQGRPVTCLVHTILLAWVA  116

Query  474  EVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATDPNCPVQLPGLPPLFSG-DL  650
            E+AR + L  ALLWIQ A V  IY++YF GY D  +N + + + P++LPGLP L S  D+
Sbjct  117  ELARSLQLSFALLWIQSATVFIIYHHYFDGYGDVVENYSNEGSNPIELPGLPMLLSSHDI  176

Query  651  PSFLLPSGSGGDYSFAMPTFK  713
            PSFLL S     Y   +P F+
Sbjct  177  PSFLLSSNI---YDSWIPAFQ  194



>ref|XP_006285715.1| hypothetical protein CARUB_v10007186mg [Capsella rubella]
 gb|EOA18613.1| hypothetical protein CARUB_v10007186mg [Capsella rubella]
Length=475

 Score =   198 bits (504),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 100/208 (48%), Positives = 133/208 (64%), Gaps = 17/208 (8%)
 Frame = +3

Query  123  PHILLVTFPAQGHINPSLQFAKRLVRL--GIEVTFA--TSVYAHRLMSKANGGGVPDGLN  290
            PH L VTFPAQGHINP L+ AKR      G  VTFA   S Y  R+ S+ N   VP+ L 
Sbjct  12   PHFLFVTFPAQGHINPCLELAKRFAGTIPGARVTFAAPVSAYNRRMFSQEN---VPETLT  68

Query  291  FTAFSDGYDEGFKKN-------HHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVH  449
            F  +SDGYD+G+K +           A+YMS++R RG  +L  ++ DN  Q RP T +V+
Sbjct  69   FATYSDGYDDGYKSSTSTDKSRQDAAANYMSDMRRRGKETLAELIEDNRRQNRPFTCLVY  128

Query  450  TLLLPWVSEVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATDPNCPVQLPGLP  629
            T+LL WV+E+AR+++LPSALLW+QP  VL I+Y+YF+GYEDA      +P+  +QLP LP
Sbjct  129  TILLTWVAELAREIHLPSALLWVQPVTVLSIFYHYFNGYEDALSELGNNPSGSIQLPSLP  188

Query  630  PLFSGDLPSFLLPSGSGGDYSFAMPTFK  713
             L   DLPSF+L S     Y+F +P F+
Sbjct  189  LLCLRDLPSFILSSNV---YAFLIPAFR  213



>ref|XP_007163802.1| hypothetical protein PHAVU_001G265400g [Phaseolus vulgaris]
 gb|ESW35796.1| hypothetical protein PHAVU_001G265400g [Phaseolus vulgaris]
Length=531

 Score =   199 bits (507),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 102/201 (51%), Positives = 132/201 (66%), Gaps = 8/201 (4%)
 Frame = +3

Query  108  VAMVQPHILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANGGGVPDGL  287
            V MV    LLVT+P QGHINP++QFAKRL  +G+ VTFATS + HR M   N   VP GL
Sbjct  59   VTMVHHRFLLVTYPVQGHINPAIQFAKRLTAIGVHVTFATSTFLHRRM--INKLTVP-GL  115

Query  288  NFTAFSDGYDEGFK-KNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLP  464
             F  FSDGYD+G++  N  NV  YM+E++ RGS   + I++    +G+P T V +TL+LP
Sbjct  116  TFVTFSDGYDDGYEGTNDSNVISYMAELKLRGSEFFRNIITSAKQEGKPFTCVAYTLMLP  175

Query  465  WVSEVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATDPNCPVQLPGLPPLFSG  644
            WV++VAR+  +P  LLWIQ A VLDIYY+YFH Y D         +  ++ PGLP  F+ 
Sbjct  176  WVAKVAREFRIPGVLLWIQAATVLDIYYHYFHEYRDYINIIHKKEDPTIEFPGLPFSFAA  235

Query  645  -DLPSFLLPSGSGGDYSFAMP  704
             D+PSFLLPS     YSFA+P
Sbjct  236  RDIPSFLLPSNI---YSFAIP  253



>ref|XP_009373578.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Pyrus 
x bretschneideri]
Length=481

 Score =   198 bits (503),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 104/207 (50%), Positives = 143/207 (69%), Gaps = 14/207 (7%)
 Frame = +3

Query  114  MVQPHILLVTFPAQGHINPSLQFAKRLVRL-GIEVTFATSVYAHRLMSKANGGGVPDGLN  290
            MVQ   LLVT+PAQGHINPSLQFAKRL+   G  VT+ TS+ A+R +   +   +PDGL 
Sbjct  1    MVQHRFLLVTYPAQGHINPSLQFAKRLINTTGAHVTYVTSLSANRRIGNVS---IPDGLT  57

Query  291  FTAFSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLPWV  470
            +  FSDGYD+GFK    N+  YMSE+R RG  ++  +V  +A +G P T +V++L++PW 
Sbjct  58   YAPFSDGYDDGFKPGD-NIDDYMSELRRRGVQAITDLVVASANEGHPYTCLVYSLIVPWA  116

Query  471  SEVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFK-NAATDPN----CPVQLPGLPPL  635
            + VA +++LPS LLWIQPA V DIYYYYF+GY+D  + N ++  N    C ++LPGLP  
Sbjct  117  AGVAHELHLPSVLLWIQPATVFDIYYYYFNGYKDLIRDNTSSGTNNVLPCSIELPGLPLS  176

Query  636  F-SGDLPSFLLPSGSGGDYSFAMPTFK  713
            F SGDLPSF++ +     Y+FA+P F+
Sbjct  177  FTSGDLPSFMVDTNP---YNFALPLFQ  200



>ref|XP_008348418.1| PREDICTED: anthocyanidin 3-O-glucoside 5-O-glucosyltransferase 
2-like [Malus domestica]
Length=474

 Score =   198 bits (503),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 103/207 (50%), Positives = 142/207 (69%), Gaps = 14/207 (7%)
 Frame = +3

Query  114  MVQPHILLVTFPAQGHINPSLQFAKRLVRL-GIEVTFATSVYAHRLMSKANGGGVPDGLN  290
            MVQ   LLVT+PAQGHINPSLQFAKRL+   G  VTF TS+ AH    +   G +PDGL 
Sbjct  1    MVQHRFLLVTYPAQGHINPSLQFAKRLINTTGAHVTFITSLSAHH---RIGNGSIPDGLT  57

Query  291  FTAFSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLPWV  470
            +  FSDGYD+GFK    N+ HY+SE+R  G+ ++  +V  +  +G P T +V+T+LLPW 
Sbjct  58   YAPFSDGYDDGFKPGD-NIDHYLSELRHHGAQAITDLVVSSENEGHPYTCMVYTILLPWA  116

Query  471  SEVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFK-NAATDPN----CPVQLPGLP-P  632
            ++VA +++LP+ LLWIQPA V DIYYYYF+G++D  + N ++  N    C ++LPGLP  
Sbjct  117  ADVAHELHLPNVLLWIQPATVFDIYYYYFNGFKDLIRDNTSSGTNDALPCSIELPGLPLS  176

Query  633  LFSGDLPSFLLPSGSGGDYSFAMPTFK  713
            L S DLPSF++ +     Y+FA+P F+
Sbjct  177  LTSRDLPSFMVDTNP---YNFALPLFQ  200



>ref|XP_006282963.1| hypothetical protein CARUB_v10007692mg [Capsella rubella]
 gb|EOA15861.1| hypothetical protein CARUB_v10007692mg [Capsella rubella]
Length=474

 Score =   197 bits (502),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 100/212 (47%), Positives = 136/212 (64%), Gaps = 17/212 (8%)
 Frame = +3

Query  111  AMVQPHILLVTFPAQGHINPSLQFAKRLVRL--GIEVTFAT--SVYAHRLMSKANGGGVP  278
            + V P+ L VTFP QGHINPSL+ AKRL     G  VT+A   S Y  R+ S+ N   VP
Sbjct  8    STVAPNFLFVTFPTQGHINPSLELAKRLAGTISGARVTYAAPISAYNRRMFSQEN---VP  64

Query  279  DGLNFTAFSDGYDEGFKKNHHN-------VAHYMSEIRTRGSSSLKGIVSDNAAQGRPIT  437
            + L F  +SDGYD+G+K +  +        A++MSE++  G  +L  ++ DN  Q RP T
Sbjct  65   ETLTFATYSDGYDDGYKSSTSSDKSLKDATANFMSEMKRLGRETLTELIEDNRRQNRPFT  124

Query  438  AVVHTLLLPWVSEVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATDPNCPVQL  617
             VV+T+LL WV+E+AR+++LPSALLW+QP  V  I Y+YF GYEDA     TDP+  V+L
Sbjct  125  CVVYTILLTWVAELAREIHLPSALLWVQPVTVFSISYHYFSGYEDAISEMGTDPSSSVKL  184

Query  618  PGLPPLFSGDLPSFLLPSGSGGDYSFAMPTFK  713
            P LP L   DLPSF++PSG+   Y+F +P  +
Sbjct  185  PSLPLLCLRDLPSFIVPSGA---YAFILPVLR  213



>emb|CAN76093.1| hypothetical protein VITISV_027116 [Vitis vinifera]
Length=466

 Score =   197 bits (501),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 101/201 (50%), Positives = 136/201 (68%), Gaps = 7/201 (3%)
 Frame = +3

Query  114  MVQPHILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANGGGVPDGLNF  293
            M Q H L+++ P QGHINP+LQ AKRL+R G  VTFA SV AHR M K     +P GL  
Sbjct  1    MGQHHFLIISHPLQGHINPALQLAKRLIRTGAHVTFAVSVSAHRRMPK--DPTLP-GLTL  57

Query  294  TAFSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLPWVS  473
              FSDGYD+G K ++ +  HYMSEI+  GS +L+ I + +A QGRP+T ++HT+LL W +
Sbjct  58   VPFSDGYDDGLKYSNDHAQHYMSEIKRCGSETLRRITAMSADQGRPVTCLLHTILLTWAA  117

Query  474  EVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATDPNCPVQLPGLPPLFSG-DL  650
            E+AR + +PSALLWIQ A V  IYY+YF+GY D   + + + + P++LPGLP L S  D+
Sbjct  118  ELARSLQVPSALLWIQSATVFTIYYHYFNGYGDVVGDCSNEGSSPIELPGLPILLSSCDI  177

Query  651  PSFLLPSGSGGDYSFAMPTFK  713
            PSFLL S     Y+  + TF+
Sbjct  178  PSFLLSSNI---YASLLSTFQ  195



>emb|CBI39398.3| unnamed protein product [Vitis vinifera]
Length=409

 Score =   196 bits (497),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 98/201 (49%), Positives = 132/201 (66%), Gaps = 8/201 (4%)
 Frame = +3

Query  114  MVQPHILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANGGGVPDGLNF  293
            M  PH LLV++PAQGHINP+L+ AKRL++ G +VTF T+VYA R M K        GL+F
Sbjct  1    MAPPHFLLVSYPAQGHINPTLRLAKRLIQTGAQVTFVTTVYAQRRMVKPLSVC---GLSF  57

Query  294  TAFSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLPWVS  473
              FSDGYD+G + N  N+ H +SEI+ +G+  L  +V + A QGRP+  +V+T++  W  
Sbjct  58   APFSDGYDDGCE-NKDNLHHVLSEIKRQGTLKLTELVLECADQGRPVACIVYTMIFDWAQ  116

Query  474  EVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATDPNCPVQLPGLPPLF-SGDL  650
            EVAR V + SA  W Q   V DIYYYYF+GY D  +N + DP+  ++LPGL PLF S DL
Sbjct  117  EVARRVQVLSAYFWNQATTVFDIYYYYFNGYGDEVRNKSIDPSSSIELPGLEPLFTSRDL  176

Query  651  PSFLLPSGSGGDYSFAMPTFK  713
            PSFLL S      +F + +F+
Sbjct  177  PSFLLSSNK---LTFVLESFQ  194



>emb|CDY09068.1| BnaC08g10220D [Brassica napus]
Length=462

 Score =   197 bits (500),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 99/213 (46%), Positives = 135/213 (63%), Gaps = 18/213 (8%)
 Frame = +3

Query  111  AMVQPHILLVTFPAQGHINPSLQFAKRLVRL--GIEVTFAT--SVYAHRLMSKANGGGVP  278
            ++  PH L VTFPAQGHINPSL+ AKRL     G+ VTFA   S Y HR+ SK N   VP
Sbjct  10   SLTGPHFLFVTFPAQGHINPSLELAKRLAGTIAGVRVTFAAPISAYNHRMFSKEN---VP  66

Query  279  DGLNFTAFSDGYDEGFKKN-------HHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPIT  437
            + L F  +SDG+D+GFK +             YMSE++ RG  +L  ++ DN  Q RP T
Sbjct  67   ENLIFATYSDGHDDGFKSSTSSDKARQDTAGRYMSEMKRRGRETLTELIEDNRRQNRPFT  126

Query  438  AVVHTLLLPWVSEVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAA-TDPNCPVQ  614
             VV+T+LL WV+E+ R+ ++PSALLW+QP  V  I+Y+YF+GY DA    A  DP+  ++
Sbjct  127  CVVYTILLTWVAELVREFHIPSALLWVQPVTVFSIFYHYFNGYADAISEMANNDPSGSIK  186

Query  615  LPGLPPLFSGDLPSFLLPSGSGGDYSFAMPTFK  713
            LP LP     DLP+F++P+ +   YSF +P F+
Sbjct  187  LPSLPQFRLRDLPTFIVPANT---YSFLLPAFR  216



>emb|CBI39391.3| unnamed protein product [Vitis vinifera]
Length=403

 Score =   195 bits (495),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 98/202 (49%), Positives = 134/202 (66%), Gaps = 5/202 (2%)
 Frame = +3

Query  108  VAMVQPHILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANGGGVPDGL  287
            +  + PHIL+VT P+QGHINP+LQ AK L+R G  VTF TS  A   MSK+      DGL
Sbjct  76   LTTMHPHILIVTLPSQGHINPTLQLAKLLIRAGAHVTFFTSTSAGTRMSKSPN---LDGL  132

Query  288  NFTAFSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLPW  467
             F  FSDGYD G K+   +V  +MS+I   GS +L  ++  +A +GRP   +++ + +PW
Sbjct  133  EFATFSDGYDHGLKQGD-DVEKFMSQIERLGSQALIELIMASANEGRPFACLLYGVQIPW  191

Query  468  VSEVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATDPNCPVQLPGLPPLFSGD  647
            V+EVA  +++PSAL+W QPAAV DIYYYYF+GY +  +N    P+  ++LPGLP L + D
Sbjct  192  VAEVAHSLHIPSALVWTQPAAVFDIYYYYFNGYGELIQNKGDHPSSTIELPGLPLLNNSD  251

Query  648  LPSFLLPSGSGGDYSFAMPTFK  713
            LPSFL+P   G  Y FA+P F+
Sbjct  252  LPSFLIPP-KGNTYKFALPGFQ  272



>ref|NP_567471.1| UDP-glucose:indole-3-acetate beta-D-glucosyltransferase [Arabidopsis 
thaliana]
 sp|O23406.2|U75D1_ARATH RecName: Full=UDP-glycosyltransferase 75D1 [Arabidopsis thaliana]
 gb|AEE83624.1| UDP-glucose:indole-3-acetate beta-D-glucosyltransferase [Arabidopsis 
thaliana]
 gb|AHL38691.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=474

 Score =   196 bits (499),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 99/208 (48%), Positives = 134/208 (64%), Gaps = 17/208 (8%)
 Frame = +3

Query  123  PHILLVTFPAQGHINPSLQFAKRLVRL--GIEVTFATSV--YAHRLMSKANGGGVPDGLN  290
            PH L VTFPAQGHINPSL+ AKRL     G  VTFA S+  Y  R+ S  N   VP+ L 
Sbjct  12   PHFLFVTFPAQGHINPSLELAKRLAGTISGARVTFAASISAYNRRMFSTEN---VPETLI  68

Query  291  FTAFSDGYDEGFKKNHHN-------VAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVH  449
            F  +SDG+D+GFK + ++         ++MSE+R RG  +L  ++ DN  Q RP T VV+
Sbjct  69   FATYSDGHDDGFKSSAYSDKSRQDATGNFMSEMRRRGKETLTELIEDNRKQNRPFTCVVY  128

Query  450  TLLLPWVSEVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATDPNCPVQLPGLP  629
            T+LL WV+E+AR+ +LPSALLW+QP  V  I+Y+YF+GYEDA    A  P+  ++LP LP
Sbjct  129  TILLTWVAELAREFHLPSALLWVQPVTVFSIFYHYFNGYEDAISEMANTPSSSIKLPSLP  188

Query  630  PLFSGDLPSFLLPSGSGGDYSFAMPTFK  713
             L   D+PSF++ S     Y+F +P F+
Sbjct  189  LLTVRDIPSFIVSSNV---YAFLLPAFR  213



>ref|XP_010440288.1| PREDICTED: UDP-glycosyltransferase 75D1-like [Camelina sativa]
Length=473

 Score =   196 bits (499),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 100/209 (48%), Positives = 137/209 (66%), Gaps = 19/209 (9%)
 Frame = +3

Query  123  PHILLVTFPAQGHINPSLQFAKRL---VRLGIEVTFAT--SVYAHRLMSKANGGGVPDGL  287
            PH L VT+PAQGHINPSL+ AKRL   +  G  VTFA   S Y  R+ S+ N   VP+ L
Sbjct  12   PHFLFVTYPAQGHINPSLELAKRLAGTISNG-RVTFAAPISAYHRRMFSQEN---VPETL  67

Query  288  NFTAFSDGYDEGFKKN-------HHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVV  446
             F  +SDG+D+GFK +          +A+YMS++R RG  +L  ++ DN  Q RP T VV
Sbjct  68   TFATYSDGHDDGFKSSNSFDKSPQDAIANYMSDMRRRGKETLTELIEDNRRQNRPFTCVV  127

Query  447  HTLLLPWVSEVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATDPNCPVQLPGL  626
            +T+LL WV+E+AR+++LPSALLW+QP  V  I+Y+YF+GYEDA      +P+  ++LP L
Sbjct  128  YTILLTWVAELAREIHLPSALLWVQPVTVFSIFYHYFNGYEDAISEMGDNPSSSIKLPSL  187

Query  627  PPLFSGDLPSFLLPSGSGGDYSFAMPTFK  713
            P L   DLPSFL+ S +   Y+F +P F+
Sbjct  188  PLLTLRDLPSFLVSSNA---YAFLLPAFR  213



>gb|AAB58497.1| UDP-glucose:indole-3-acetate beta-D-glucosyltransferase [Arabidopsis 
thaliana]
Length=474

 Score =   196 bits (499),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 99/208 (48%), Positives = 134/208 (64%), Gaps = 17/208 (8%)
 Frame = +3

Query  123  PHILLVTFPAQGHINPSLQFAKRLVRL--GIEVTFATSV--YAHRLMSKANGGGVPDGLN  290
            PH L VTFPAQGHINPSL+ AKRL     G  VTFA S+  Y  R+ S  N   VP+ L 
Sbjct  12   PHFLFVTFPAQGHINPSLELAKRLAGTISGARVTFAASISAYNRRMFSTEN---VPETLI  68

Query  291  FTAFSDGYDEGFKKNHHN-------VAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVH  449
            F  +SDG+D+GFK + ++         ++MSE+R RG  +L  ++ DN  Q RP T VV+
Sbjct  69   FATYSDGHDDGFKSSAYSDKSRQDATGNFMSEMRRRGKETLTELIEDNRKQNRPFTCVVY  128

Query  450  TLLLPWVSEVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATDPNCPVQLPGLP  629
            T+LL WV+E+AR+ +LPSALLW+QP  V  I+Y+YF+GYEDA    A  P+  ++LP LP
Sbjct  129  TILLTWVAELAREFHLPSALLWVQPVTVFSIFYHYFNGYEDAISEMANTPSSSIKLPSLP  188

Query  630  PLFSGDLPSFLLPSGSGGDYSFAMPTFK  713
             L   D+PSF++ S     Y+F +P F+
Sbjct  189  LLTVRDIPSFIVSSNV---YAFLLPAFR  213



>ref|XP_010099953.1| UDP-glycosyltransferase 75D1 [Morus notabilis]
 gb|EXB80936.1| UDP-glycosyltransferase 75D1 [Morus notabilis]
Length=493

 Score =   197 bits (500),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 108/211 (51%), Positives = 136/211 (64%), Gaps = 19/211 (9%)
 Frame = +3

Query  123  PHILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSK--------ANGGGVP  278
            P  LLVT+PAQGHINP LQFAKRLV  G +VTF T+ +AHR M+K        AN  GV 
Sbjct  5    PRFLLVTYPAQGHINPCLQFAKRLVGAGADVTFVTTYFAHRHMTKSRGDTTAAANRNGVV  64

Query  279  DGLNFTAFSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLL  458
              +++  FSDG+D+GFK    +V HY++EIR RGS ++  +V   A +G P T +V++LL
Sbjct  65   -SISYVPFSDGHDDGFKPGD-SVDHYLNEIRRRGSQAISDLVISAAKEGHPYTCLVYSLL  122

Query  459  LPWVSEVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAF-----KNAATDPNCPVQLPG  623
            LPW +  A ++ LPS LLWIQPA V DIYYYYFHGYED       K+ +TD N    LPG
Sbjct  123  LPWAALTAEELCLPSVLLWIQPATVFDIYYYYFHGYEDIIIENSTKDPSTDHNSSTTLPG  182

Query  624  LP-PLFSGDLPSFLLPSGSGGDYSFAMPTFK  713
            L   L   DLPSF+    +   YSFA+P FK
Sbjct  183  LSLTLTRRDLPSFM---DAANTYSFAIPLFK  210



>ref|XP_008222735.1| PREDICTED: anthocyanidin 3-O-glucoside 5-O-glucosyltransferase-like 
[Prunus mume]
Length=473

 Score =   196 bits (498),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 102/206 (50%), Positives = 138/206 (67%), Gaps = 13/206 (6%)
 Frame = +3

Query  114  MVQPHILLVTFPAQGHINPSLQFAKRLVRL-GIEVTFATSVYAHRLMSKANGGGVPDGLN  290
            MVQ   LLVTFPAQGHINPSLQFAK L+R  G  VT+ TS+ AH  +     G  P GL 
Sbjct  1    MVQHRFLLVTFPAQGHINPSLQFAKHLIRTTGAHVTYVTSLSAHGCIGN---GSTPHGLT  57

Query  291  FTAFSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLPWV  470
            ++ FS GYD GFK +  ++ HYM E++ RG+ ++  ++  +A +GRP T +++T+LLPW 
Sbjct  58   YSLFSHGYDNGFK-DGDDIDHYMLELKRRGAQAITDLIVSSAKEGRPYTCLIYTILLPWA  116

Query  471  SEVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATDPN----CPVQLPGLP-PL  635
            + VA +++LPS L+WIQPA V DIYYYYF GY+D  +N +T       C ++LPGLP  L
Sbjct  117  AVVASELHLPSVLMWIQPATVFDIYYYYFGGYKDLIQNISTTHTNGALCSIELPGLPQSL  176

Query  636  FSGDLPSFLLPSGSGGDYSFAMPTFK  713
             S DLPS ++ S     YSFA+P F+
Sbjct  177  ASRDLPSLMVDSNL---YSFALPLFE  199



>ref|XP_002267526.1| PREDICTED: crocetin glucosyltransferase, chloroplastic [Vitis 
vinifera]
Length=465

 Score =   196 bits (498),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 98/199 (49%), Positives = 133/199 (67%), Gaps = 5/199 (3%)
 Frame = +3

Query  117  VQPHILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANGGGVPDGLNFT  296
            + PHIL+VT P+QGHINP+LQ AK L+R G  VTF TS  A   MSK+      DGL F 
Sbjct  1    MHPHILIVTLPSQGHINPTLQLAKLLIRAGAHVTFFTSTSAGTRMSKSPN---LDGLEFA  57

Query  297  AFSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLPWVSE  476
             FSDGYD G K+   +V  +MS+I   GS +L  ++  +A +GRP   +++ + +PWV+E
Sbjct  58   TFSDGYDHGLKQGD-DVEKFMSQIERLGSQALIELIMASANEGRPFACLLYGVQIPWVAE  116

Query  477  VARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATDPNCPVQLPGLPPLFSGDLPS  656
            VA  +++PSAL+W QPAAV DIYYYYF+GY +  +N    P+  ++LPGLP L + DLPS
Sbjct  117  VAHSLHIPSALVWTQPAAVFDIYYYYFNGYGELIQNKGDHPSSTIELPGLPLLNNSDLPS  176

Query  657  FLLPSGSGGDYSFAMPTFK  713
            FL+P   G  Y FA+P F+
Sbjct  177  FLIPP-KGNTYKFALPGFQ  194



>ref|XP_009373577.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Pyrus 
x bretschneideri]
Length=474

 Score =   196 bits (498),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 103/208 (50%), Positives = 142/208 (68%), Gaps = 16/208 (8%)
 Frame = +3

Query  114  MVQPHILLVTFPAQGHINPSLQFAKRLVRL-GIEVTFATSVYA-HRLMSKANGGGVPDGL  287
            MVQ   L++TFPAQGHINPSLQFAKRL+   G  VTF T + A HR+    +   +PDGL
Sbjct  1    MVQHRFLVLTFPAQGHINPSLQFAKRLINTTGAHVTFVTCLSARHRI----DNDSIPDGL  56

Query  288  NFTAFSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLPW  467
             ++ FSDGYD GF  +  N+  YMSE+R RG+ ++  +V  +A +G P T +V+T+LLPW
Sbjct  57   TYSLFSDGYDNGFN-SADNIDDYMSELRRRGAQAISDLVVSSAKEGHPYTCLVYTILLPW  115

Query  468  VSEVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFK-NAATDPN----CPVQLPGLP-  629
             ++VA +++LP+ LLWIQPA V DIYYYYF+GY+D  + N ++  N    C ++LPGL  
Sbjct  116  AADVAHELHLPNVLLWIQPATVFDIYYYYFNGYKDLIRDNTSSGTNDVLPCSIELPGLSL  175

Query  630  PLFSGDLPSFLLPSGSGGDYSFAMPTFK  713
             L S DLPSF++ +     YSFA+P F+
Sbjct  176  SLTSRDLPSFMVDTNP---YSFALPLFQ  200



>ref|XP_002266628.2| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Vitis 
vinifera]
Length=498

 Score =   196 bits (499),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 101/202 (50%), Positives = 136/202 (67%), Gaps = 7/202 (3%)
 Frame = +3

Query  111  AMVQPHILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANGGGVPDGLN  290
            AM Q H L+++ P QGHINP+LQFAKRL+R G  VTFA SV AHR M K     +P GL 
Sbjct  32   AMGQHHFLIISLPLQGHINPALQFAKRLIRTGAHVTFAVSVSAHRRMPK--DPTLP-GLT  88

Query  291  FTAFSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLPWV  470
               FSDGYD+G K +  +V H MSEI+  G  +L+ I + +A QGRP+T ++HT+LL W 
Sbjct  89   LVLFSDGYDDGIKYSDDHVQHSMSEIKRCGPETLRRITAMSADQGRPVTCLLHTILLTWA  148

Query  471  SEVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATDPNCPVQLPGLPPLFSG-D  647
            +E+AR + +PSALLWIQ A V  I+Y+YF+GY D   + + + + P++LPGLP L S  D
Sbjct  149  AELARSLQVPSALLWIQSATVFTIFYHYFNGYGDVVGDCSNEGSSPIELPGLPILLSSCD  208

Query  648  LPSFLLPSGSGGDYSFAMPTFK  713
            +PSFLL S     Y+  + TF+
Sbjct  209  IPSFLLSSNI---YASVLSTFQ  227



>emb|CDP15115.1| unnamed protein product [Coffea canephora]
Length=451

 Score =   195 bits (496),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 95/188 (51%), Positives = 135/188 (72%), Gaps = 3/188 (2%)
 Frame = +3

Query  114  MVQPHILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANGGGVPDGLNF  293
            M QPHIL+V++PAQGHINPSLQ A +L+++G+EVTFATS +A  ++ KA+   V +  +F
Sbjct  1    MAQPHILIVSYPAQGHINPSLQLANKLIKIGVEVTFATSHFALPVVPKASCK-VSNDFHF  59

Query  294  TAFSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLPWVS  473
             A SDGY +GFK    +V H ++ ++  G  +L+ ++  +A  GRP+T +VHTL L W +
Sbjct  60   AAISDGYPDGFKPQGLDVNH-VNALKKYGPETLRNVIQASAETGRPVTCIVHTLTLTWAA  118

Query  474  EVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATDPNCPVQLPGLPPLFSGDLP  653
            EVAR+ ++P  LLWIQPA VL I YYYF+GYED  +N   +P+  +Q+PG+P L + DLP
Sbjct  119  EVAREYHIPWTLLWIQPATVLGITYYYFNGYEDEIRN-CYEPSWSIQMPGVPLLTTLDLP  177

Query  654  SFLLPSGS  677
            SF+LPS S
Sbjct  178  SFMLPSSS  185



>ref|XP_003632054.2| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Vitis 
vinifera]
Length=465

 Score =   195 bits (496),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 93/200 (47%), Positives = 133/200 (67%), Gaps = 5/200 (3%)
 Frame = +3

Query  114  MVQPHILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANGGGVPDGLNF  293
            M QPH +++T+PAQGHINPSLQ AKRL+R G  VTF TS YA   M+K       DGL F
Sbjct  1    MTQPHFIVITYPAQGHINPSLQLAKRLIRAGAHVTFVTSTYASERMTKTP---TMDGLKF  57

Query  294  TAFSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLPWVS  473
              F DG D G K++   +  +MSE+   GS +L  ++  +A +GRP+T +++ +L+PWV+
Sbjct  58   VTFPDGCDSGLKQSDA-LQGFMSELERLGSQALTDLLIASANEGRPVTCIIYGILIPWVA  116

Query  474  EVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATDPNCPVQLPGLPPLFSGDLP  653
            EVA  +++PSAL W QP +V +IYYYYF GY +  +   +D +  ++LPGLP L S D+P
Sbjct  117  EVAHSLHIPSALFWSQPVSVFNIYYYYFCGYGEVIRKKVSDSSPSIELPGLPLLGSRDIP  176

Query  654  SFLLPSGSGGDYSFAMPTFK  713
             FLLPS +  +Y+F +  F+
Sbjct  177  CFLLPS-NANEYNFVLSAFQ  195



>ref|XP_002263498.1| PREDICTED: crocetin glucosyltransferase, chloroplastic [Vitis 
vinifera]
Length=463

 Score =   195 bits (496),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 98/201 (49%), Positives = 132/201 (66%), Gaps = 8/201 (4%)
 Frame = +3

Query  114  MVQPHILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANGGGVPDGLNF  293
            M  PH LLV++PAQGHINP+L+ AKRL++ G +VTF T+VYA R M K        GL+F
Sbjct  1    MAPPHFLLVSYPAQGHINPTLRLAKRLIQTGAQVTFVTTVYAQRHMVKPLSVC---GLSF  57

Query  294  TAFSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLPWVS  473
              FSDGYD+G + N  N+ H +SEI+ +G+  L  +V + A QGRP+  +V+T++  W  
Sbjct  58   APFSDGYDDGCE-NKDNLHHVLSEIKRQGTRKLTELVLECADQGRPVACIVYTMIFDWAQ  116

Query  474  EVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATDPNCPVQLPGLPPLF-SGDL  650
            EVAR V + SA  W Q   V DIYYYYF+GY D  +N + DP+  ++LPGL PLF S DL
Sbjct  117  EVARRVQVLSAYFWNQATTVFDIYYYYFNGYGDEVRNKSIDPSSSIELPGLEPLFTSRDL  176

Query  651  PSFLLPSGSGGDYSFAMPTFK  713
            PSFLL S      +F + +F+
Sbjct  177  PSFLLSSNK---LTFVLESFQ  194



>ref|XP_002266967.1| PREDICTED: crocetin glucosyltransferase, chloroplastic [Vitis 
vinifera]
Length=465

 Score =   195 bits (496),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 102/201 (51%), Positives = 134/201 (67%), Gaps = 8/201 (4%)
 Frame = +3

Query  114  MVQPHILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANGGGVPDGLNF  293
            M Q H L+++ P QGHINP+LQFAKRL+R G  VTFA SV AHR M K  G  +P GL  
Sbjct  1    MGQHHFLIISLPLQGHINPALQFAKRLIRTGAHVTFAVSVSAHRRMPK--GPTLP-GLTL  57

Query  294  TAFSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLPWVS  473
              FSDGYD+G K   H   HY+SEI+  GS +L+ I + ++ QGRP+T +VHT+LL W +
Sbjct  58   VPFSDGYDDGIKLEDH-AQHYLSEIKRCGSETLRRITAISSDQGRPVTCLVHTMLLAWAA  116

Query  474  EVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATDPNCPVQLPGLPPLFSG-DL  650
            E+AR + LPSALLWIQ A V  I+++YF GY D   N + + + P++LPGLP L S  D+
Sbjct  117  ELARSLQLPSALLWIQSATVFIIFHHYFDGYGDVVGNCSNEGSDPIELPGLPMLLSSRDI  176

Query  651  PSFLLPSGSGGDYSFAMPTFK  713
            PSF L S     Y+  +P F+
Sbjct  177  PSFFLSSNI---YASWIPAFQ  194



>gb|KJB28076.1| hypothetical protein B456_005G025700 [Gossypium raimondii]
Length=469

 Score =   195 bits (496),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 99/204 (49%), Positives = 134/204 (66%), Gaps = 13/204 (6%)
 Frame = +3

Query  114  MVQPHILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANGGGVP--DGL  287
            M QPH LLVT+PAQGHINP+LQFA+ L+R+G+ VTF T + A R M+K     VP   GL
Sbjct  1    MSQPHFLLVTYPAQGHINPTLQFARHLIRIGVRVTFITCISARRRMTK-----VPTAQGL  55

Query  288  NFTAFSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLPW  467
             F  FSDGYD+GF+    +V HY SE   RG  ++   ++    +G+P+T +V+TL + W
Sbjct  56   TFLPFSDGYDDGFQPGD-DVDHYRSEFTRRGKEAISEFITSGENEGKPVTCIVYTLFIHW  114

Query  468  VSEVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAA--TDPNCPVQLPGLPPLFS  641
             +EVAR  ++P+ALLWIQPA+V DIYY+YF+GYE   K  A  T+P   ++LPGL  L +
Sbjct  115  ATEVARKHHIPTALLWIQPASVFDIYYFYFNGYESTIKAQAEETNPERSIKLPGLLLLAT  174

Query  642  GDLPSFLLPSGSGGDYSFAMPTFK  713
             DLPSF   S     Y +A+  F+
Sbjct  175  RDLPSFFTASNV---YRWALSLFQ  195



>ref|XP_002266919.1| PREDICTED: crocetin glucosyltransferase, chloroplastic [Vitis 
vinifera]
Length=463

 Score =   195 bits (495),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 98/201 (49%), Positives = 132/201 (66%), Gaps = 8/201 (4%)
 Frame = +3

Query  114  MVQPHILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANGGGVPDGLNF  293
            M  PH LLV++PAQGHINP+L+ AKRL++ G +VTF T+VYA R M K        GL+F
Sbjct  1    MAPPHFLLVSYPAQGHINPTLRLAKRLIQTGAQVTFVTTVYAQRRMVKPLSVC---GLSF  57

Query  294  TAFSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLPWVS  473
              FSDGYD+G + N  N+ H +SEI+ +G+  L  +V + A QGRP+  +V+T++  W  
Sbjct  58   APFSDGYDDGCE-NKDNLHHVLSEIKRQGTLKLTELVLECADQGRPVACIVYTMIFDWAQ  116

Query  474  EVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATDPNCPVQLPGLPPLF-SGDL  650
            EVAR V + SA  W Q   V DIYYYYF+GY D  +N + DP+  ++LPGL PLF S DL
Sbjct  117  EVARRVQVLSAYFWNQATTVFDIYYYYFNGYGDEVRNKSIDPSSSIELPGLEPLFTSRDL  176

Query  651  PSFLLPSGSGGDYSFAMPTFK  713
            PSFLL S      +F + +F+
Sbjct  177  PSFLLSSNK---LTFVLESFQ  194



>ref|XP_009337747.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Pyrus 
x bretschneideri]
Length=474

 Score =   195 bits (496),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 102/207 (49%), Positives = 142/207 (69%), Gaps = 14/207 (7%)
 Frame = +3

Query  114  MVQPHILLVTFPAQGHINPSLQFAKRLVR-LGIEVTFATSVYAHRLMSKANGGGVPDGLN  290
            MVQ   LLVT+PAQGHINPSLQFAKRL+   G  VTF TS+ AH    +   G +PDGL 
Sbjct  1    MVQHRFLLVTYPAQGHINPSLQFAKRLINATGAHVTFITSLSAHH---RIGNGSIPDGLT  57

Query  291  FTAFSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLPWV  470
            +  FSDGYD+GFK +  N+ HY SE+R  G+ ++  +V  +A +G P T +V+T+LLPW 
Sbjct  58   YAPFSDGYDDGFKPDD-NIDHYFSELRRCGAQAITDLVVSSANEGHPYTCLVYTILLPWA  116

Query  471  SEVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKN---AATDPNCP--VQLPGLP-P  632
            ++VA +++LP+ LLWIQPA V D+YYYYF+GY+D  ++   + T+   P  ++LPGLP  
Sbjct  117  ADVAHELHLPNVLLWIQPATVFDVYYYYFNGYKDIIRDNTSSGTNDALPYSIELPGLPLS  176

Query  633  LFSGDLPSFLLPSGSGGDYSFAMPTFK  713
            L S DLPSF++ +     Y+FA+P  +
Sbjct  177  LTSRDLPSFMVDTNP---YNFALPLLQ  200



>ref|XP_002263975.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Vitis 
vinifera]
Length=463

 Score =   195 bits (495),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 98/185 (53%), Positives = 127/185 (69%), Gaps = 4/185 (2%)
 Frame = +3

Query  117  VQPHILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANGGGVPDGLNFT  296
            +QP ILLVT+PAQGHINPSLQ AK L+R G  VTF TS  A   MSK+      DGL F 
Sbjct  1    MQPQILLVTYPAQGHINPSLQLAKLLIRAGAHVTFVTSSSAGTRMSKSP---TLDGLEFV  57

Query  297  AFSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLPWVSE  476
             FSDGYD GF  +   + ++MSE+   GS +L  ++   A +GRP T +++ +L+PWV+E
Sbjct  58   TFSDGYDHGFD-HGDGLQNFMSELERLGSPALTKLIMARANEGRPFTCLLYGMLIPWVAE  116

Query  477  VARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATDPNCPVQLPGLPPLFSGDLPS  656
            VAR ++LPSAL+W QPAAV DIYYYYF+GY +   N     +  ++LPGLP + S DLPS
Sbjct  117  VARSLHLPSALVWSQPAAVFDIYYYYFNGYGELIGNKGNGSSSSIELPGLPLISSSDLPS  176

Query  657  FLLPS  671
            FL+PS
Sbjct  177  FLVPS  181



>emb|CDP15120.1| unnamed protein product [Coffea canephora]
Length=466

 Score =   195 bits (495),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 97/199 (49%), Positives = 137/199 (69%), Gaps = 5/199 (3%)
 Frame = +3

Query  114  MVQPHILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANGGGVPDGLNF  293
            M   H L+VTFP QGHINP+LQFAKRL +LG+  TF+TS+ A   MS+A+   +P+ L+ 
Sbjct  1    MENCHFLVVTFPGQGHINPTLQFAKRLAKLGVRTTFSTSLGAINRMSRASDS-LPEKLSI  59

Query  294  TAFSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLPWVS  473
             AFSDGYD+G+  +  +V  YM+ + TRGS +LK ++   + +GRPIT VV+ +L+PWV 
Sbjct  60   VAFSDGYDQGWTTDD-DVQEYMTSLVTRGSQTLKELIMAQSNEGRPITHVVYAILMPWVG  118

Query  474  EVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATDPNCPVQLPGLPPLFSGDLP  653
            +VAR + +PS LLWIQPAA+  +YY +F+G  +   + ++     ++LPGLP L S DLP
Sbjct  119  QVARQLQIPSTLLWIQPAALFQLYYCFFNGCGEVIGDISSSK--AIKLPGLPTLASRDLP  176

Query  654  SFLLPSGSGGDYSFAMPTF  710
            +FLL S     YSFA+PT 
Sbjct  177  TFLLASNPDV-YSFALPTI  194



>ref|XP_009373576.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Pyrus 
x bretschneideri]
Length=572

 Score =   197 bits (500),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 106/209 (51%), Positives = 140/209 (67%), Gaps = 16/209 (8%)
 Frame = +3

Query  111  AMVQPHILLVTFPAQGHINPSLQFAKRLVRL-GIEVTFATSVYA-HRLMSKANGGGVPDG  284
            AMVQ   LLVT+PAQGHINPS QFAKRL+   G +VTF T + A HR+        +PDG
Sbjct  98   AMVQHRFLLVTYPAQGHINPSFQFAKRLINTTGAQVTFVTCLSASHRV----GNDSIPDG  153

Query  285  LNFTAFSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLP  464
            L +  FSDGYD+GFK    N+ HYMSE+R RG+ ++  +V  +A +G P T +V T+LLP
Sbjct  154  LTYALFSDGYDDGFKPGD-NIDHYMSELRRRGTQAITDLVVSSANEGHPYTCLVCTILLP  212

Query  465  WVSEVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFK-NAATDPN----CPVQLPGLP  629
            W + VA +++LP+ LLWIQPA V DIYYYYF+GY+D  + N  +  N    C +QLPGLP
Sbjct  213  WAANVAHELHLPNVLLWIQPATVFDIYYYYFNGYKDLIRDNTGSGTNDALPCSIQLPGLP  272

Query  630  -PLFSGDLPSFLLPSGSGGDYSFAMPTFK  713
              L S DLPSF++ +     Y+FA+  F+
Sbjct  273  LSLTSRDLPSFMVDTNP---YTFALLLFQ  298



>ref|XP_010434952.1| PREDICTED: UDP-glycosyltransferase 75D1-like [Camelina sativa]
Length=474

 Score =   195 bits (495),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 98/208 (47%), Positives = 134/208 (64%), Gaps = 17/208 (8%)
 Frame = +3

Query  123  PHILLVTFPAQGHINPSLQFAKRLVRL--GIEVTFAT--SVYAHRLMSKANGGGVPDGLN  290
            PH L VT+PAQGHINPSL+ AKRL        VTFA   S Y  R+ S+     VP+ L 
Sbjct  12   PHFLFVTYPAQGHINPSLELAKRLAGTISNARVTFAAPISAYNRRMFSQE---IVPETLT  68

Query  291  FTAFSDGYDEGFKKN-------HHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVH  449
            F  +SDG+D+GFK +          VA+YMS++R RG  +L  ++ DN  Q RP T VV+
Sbjct  69   FATYSDGHDDGFKSSTSFDKSPQDAVANYMSDMRRRGKETLTELIEDNRRQNRPFTCVVY  128

Query  450  TLLLPWVSEVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATDPNCPVQLPGLP  629
            T+LL W++E+AR+++LPSALLW+QP  V  I+Y+YF+GYEDA      +P+  ++LP LP
Sbjct  129  TILLTWIAELAREIHLPSALLWVQPVTVFSIFYHYFNGYEDAISEMGNNPSSSIKLPSLP  188

Query  630  PLFSGDLPSFLLPSGSGGDYSFAMPTFK  713
             L   DLPSFL+ S +   Y+F +P F+
Sbjct  189  LLTLRDLPSFLVSSNA---YAFLLPAFR  213



>ref|XP_010023609.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Eucalyptus 
grandis]
 gb|KCW59919.1| hypothetical protein EUGRSUZ_H02643 [Eucalyptus grandis]
Length=465

 Score =   194 bits (492),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 103/200 (52%), Positives = 141/200 (71%), Gaps = 6/200 (3%)
 Frame = +3

Query  114  MVQPHILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANGGGVPDGLNF  293
            M  PH LLVTFP QGHINPSLQFAKRLVR+G  VTFAT++ A   M+++    +P+GL+F
Sbjct  1    MAPPHFLLVTFPGQGHINPSLQFAKRLVRVGAHVTFATAIRARPRMAESES--IPEGLSF  58

Query  294  TAFSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLPWVS  473
             +FSDGYD+GF  N   +  YM +I+ RG+ +L  +++ N   GR  + V++T+LLPW +
Sbjct  59   ASFSDGYDDGFD-NWDEMEEYMDKIKRRGTETLSDLIASNLKSGRRFSGVLYTILLPWAA  117

Query  474  EVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATDPNCPVQLPGLPPLFSGDLP  653
            EVAR   +PS  +WIQPA VLD YYYYFHGY D  ++   +P+ P+QLPGLPPL + D+P
Sbjct  118  EVARSHGIPSTFVWIQPATVLDFYYYYFHGYGDLIRSTGGNPSVPIQLPGLPPLMACDIP  177

Query  654  SFLLPSGSGGDYSFAMPTFK  713
            SF     S  +Y+F++P F+
Sbjct  178  SFF---NSKNEYNFSLPLFQ  194



>gb|ABQ02258.1| O-glucosyltransferase 3 [Vitis labrusca]
Length=464

 Score =   194 bits (492),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 97/187 (52%), Positives = 129/187 (69%), Gaps = 4/187 (2%)
 Frame = +3

Query  114  MVQPHILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANGGGVPDGLNF  293
            M Q H L+++ P QGHINP+LQ AKRL+R G  VTFA SV AH  M K     +P GL  
Sbjct  1    MGQHHFLIISHPLQGHINPALQLAKRLIRTGAHVTFAVSVSAHCRMPK--DPTLP-GLTL  57

Query  294  TAFSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLPWVS  473
              FSDGYD+G K ++ +  HYMSEI+  GS +L+ I + +A QGRP+T ++HT+LL W +
Sbjct  58   VPFSDGYDDGLKYSNDHAQHYMSEIKRCGSETLRRITAMSADQGRPVTCLLHTILLTWAA  117

Query  474  EVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATDPNCPVQLPGLPPLFSG-DL  650
            E+AR + +PSALLWIQ A V  IYY+YF+GY D   + + + + P++LPGLP L S  D+
Sbjct  118  ELARSLQVPSALLWIQSATVFTIYYHYFNGYGDVVGDCSNEGSSPIELPGLPILLSSCDI  177

Query  651  PSFLLPS  671
            PSFLL S
Sbjct  178  PSFLLSS  184



>emb|CBI39388.3| unnamed protein product [Vitis vinifera]
Length=597

 Score =   195 bits (495),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 93/201 (46%), Positives = 133/201 (66%), Gaps = 5/201 (2%)
 Frame = +3

Query  111  AMVQPHILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANGGGVPDGLN  290
             M QPH +++T+PAQGHINPSLQ AKRL+R G  VTF TS YA   M+K       DGL 
Sbjct  105  TMTQPHFIVITYPAQGHINPSLQLAKRLIRAGAHVTFVTSTYASERMTKT---PTMDGLK  161

Query  291  FTAFSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLPWV  470
            F  F DG D G K++   +  +MSE+   GS +L  ++  +A +GRP+T +++ +L+PWV
Sbjct  162  FVTFPDGCDSGLKQSD-ALQGFMSELERLGSQALTDLLIASANEGRPVTCIIYGILIPWV  220

Query  471  SEVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATDPNCPVQLPGLPPLFSGDL  650
            +EVA  +++PSAL W QP +V +IYYYYF GY +  +   +D +  ++LPGLP L S D+
Sbjct  221  AEVAHSLHIPSALFWSQPVSVFNIYYYYFCGYGEVIRKKVSDSSPSIELPGLPLLGSRDI  280

Query  651  PSFLLPSGSGGDYSFAMPTFK  713
            P FLLPS +  +Y+F +  F+
Sbjct  281  PCFLLPS-NANEYNFVLSAFQ  300



>emb|CAN62622.1| hypothetical protein VITISV_001655 [Vitis vinifera]
Length=463

 Score =   192 bits (488),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 97/201 (48%), Positives = 131/201 (65%), Gaps = 8/201 (4%)
 Frame = +3

Query  114  MVQPHILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANGGGVPDGLNF  293
            M  PH LLV++PAQGHINP+L+ AK L++ G +VTF T+VYA R M K        GL+F
Sbjct  1    MAPPHFLLVSYPAQGHINPTLRLAKXLIQTGAQVTFVTTVYAQRHMVKPLSVC---GLSF  57

Query  294  TAFSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLPWVS  473
              FSDGYD+G + N  N+ H +SEI+ +G+  L  +V + A QGRP+  +V+T++  W  
Sbjct  58   APFSDGYDDGCE-NKDNLHHVLSEIKRQGTRKLTELVLECADQGRPVACIVYTMIFDWAQ  116

Query  474  EVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATDPNCPVQLPGLPPLF-SGDL  650
            EVAR V + SA  W Q   V DIYYYYF+GY D  +N + DP+  ++LPGL PLF S DL
Sbjct  117  EVARRVQVLSAYFWNQATTVFDIYYYYFNGYGDEVRNKSIDPSSSIELPGLEPLFTSRDL  176

Query  651  PSFLLPSGSGGDYSFAMPTFK  713
            PSFLL S      +F + +F+
Sbjct  177  PSFLLSSNK---LTFVLESFQ  194



>ref|XP_008380454.1| PREDICTED: anthocyanidin 3-O-glucoside 5-O-glucosyltransferase 
2-like [Malus domestica]
Length=474

 Score =   192 bits (489),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 102/208 (49%), Positives = 142/208 (68%), Gaps = 16/208 (8%)
 Frame = +3

Query  114  MVQPHILLVTFPAQGHINPSLQFAKRLVRL-GIEVTFATSVYA-HRLMSKANGGGVPDGL  287
            MVQ   LLVTFPAQGHINPSLQFAKRL+   G  VTF T + A HR+ + +    +PDGL
Sbjct  1    MVQHRFLLVTFPAQGHINPSLQFAKRLINTTGAHVTFVTCLSARHRIGNDS----IPDGL  56

Query  288  NFTAFSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLPW  467
             ++ FSDGYD+GF + ++N  HY  E+R RG+ ++  +V  +A +G P T +V+T  LPW
Sbjct  57   TYSLFSDGYDDGFNRTNNN-DHYALELRRRGAQAITDLVVSSANEGHPYTCLVYTTFLPW  115

Query  468  VSEVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFK-NAATDPN----CPVQLPGLP-  629
             ++VA +++L + LLWIQPA V DIYYYYF+GY+D  + N ++  N    C ++LPGLP 
Sbjct  116  AADVAYELHLQNVLLWIQPATVFDIYYYYFNGYKDLIRDNTSSGTNDVLPCSIELPGLPL  175

Query  630  PLFSGDLPSFLLPSGSGGDYSFAMPTFK  713
             L S DLPSF++ +     Y+FA+P F+
Sbjct  176  SLTSRDLPSFMVDTNP---YNFALPLFQ  200



>emb|CAN75179.1| hypothetical protein VITISV_018406 [Vitis vinifera]
Length=497

 Score =   193 bits (490),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 92/200 (46%), Positives = 132/200 (66%), Gaps = 5/200 (3%)
 Frame = +3

Query  114  MVQPHILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANGGGVPDGLNF  293
            M QPH +++T+PAQGHINPSLQ AKRL+R G  VTF TS YA   M+K       DGL F
Sbjct  33   MTQPHFIVITYPAQGHINPSLQLAKRLIRAGAHVTFVTSTYASERMAKTP---TMDGLKF  89

Query  294  TAFSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLPWVS  473
              F DG D G K++   +  +MSE+   GS +L  ++  +A +GRP+  +++ +L+PWV+
Sbjct  90   VTFPDGCDSGLKQSDA-LQGFMSELERLGSQALTDLLIASANEGRPVACIIYGILIPWVA  148

Query  474  EVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATDPNCPVQLPGLPPLFSGDLP  653
            EVA  +++PSAL W QP +V +IYYYYF GY +  +   +D +  ++LPGLP L S D+P
Sbjct  149  EVAHSLHIPSALFWSQPVSVFNIYYYYFCGYGELIRKKVSDSSPSIELPGLPLLSSRDIP  208

Query  654  SFLLPSGSGGDYSFAMPTFK  713
             FLLPS +  +Y+F +  F+
Sbjct  209  CFLLPS-NANEYNFVLSAFE  227



>ref|XP_010650395.1| PREDICTED: crocetin glucosyltransferase, chloroplastic [Vitis 
vinifera]
Length=497

 Score =   193 bits (490),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 92/200 (46%), Positives = 132/200 (66%), Gaps = 5/200 (3%)
 Frame = +3

Query  114  MVQPHILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANGGGVPDGLNF  293
            M QPH +++T+PAQGHINPSLQ AKRL+R+G  VTF TS YA   M+K       DGL F
Sbjct  33   MTQPHFIVITYPAQGHINPSLQLAKRLIRVGAHVTFVTSTYASERMAKTP---TMDGLKF  89

Query  294  TAFSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLPWVS  473
              F DG D G K++   +  +MSE+   GS +L  ++  +A +GRP+  +++ +L+PWV+
Sbjct  90   VTFPDGCDSGLKQSDA-LQGFMSELERLGSQALTDLLIASANEGRPVACIIYGILIPWVA  148

Query  474  EVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATDPNCPVQLPGLPPLFSGDLP  653
            EVA  +++PSAL W QP +V +IYYYYF GY +  +    D +  ++LPGLP L S D+P
Sbjct  149  EVAHSLHIPSALFWSQPVSVFNIYYYYFCGYGELIRKKVRDSSPSIELPGLPLLSSRDIP  208

Query  654  SFLLPSGSGGDYSFAMPTFK  713
             FLLPS +  +Y+F +  F+
Sbjct  209  CFLLPS-NANEYNFVLSAFE  227



>gb|ADG45874.1| UDP-glucosyltransferase [Isatis tinctoria]
Length=476

 Score =   192 bits (488),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 99/209 (47%), Positives = 133/209 (64%), Gaps = 18/209 (9%)
 Frame = +3

Query  123  PHILLVTFPAQGHINPSLQFAKRLVRL--GIEVTFAT--SVYAHRLMSKANGGGVPDGLN  290
            PH L VT+P QGHINPSL+ AKRL     G  VTFA   S Y  R+ SK N   VP+ L 
Sbjct  14   PHFLFVTYPTQGHINPSLELAKRLAATITGARVTFAAPISAYNRRMFSKEN---VPETLI  70

Query  291  FTAFSDGYDEGFK------KNHHNVA-HYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVH  449
            F  +SDG+D+G+K      K+  + A  YMSE+R RG  +L  ++ DN  Q RP T VV+
Sbjct  71   FATYSDGHDDGYKASTSSDKSRQDTARQYMSEMRRRGRETLTELIEDNRRQNRPFTCVVY  130

Query  450  TLLLPWVSEVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAA-TDPNCPVQLPGL  626
            T+LL WV+E+ARD ++PSALLW+QP  V  I+Y+YF GY DA    A  +P+  ++LP L
Sbjct  131  TILLTWVAELARDFHIPSALLWVQPVTVFSIFYHYFSGYADAISEMARNNPSGSIELPSL  190

Query  627  PPLFSGDLPSFLLPSGSGGDYSFAMPTFK  713
            PPL   DLP+F++P  +   Y+F +  F+
Sbjct  191  PPLRLRDLPTFIVPENT---YAFLLSAFR  216



>ref|XP_010023606.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Eucalyptus 
grandis]
 gb|KCW59917.1| hypothetical protein EUGRSUZ_H02641 [Eucalyptus grandis]
Length=463

 Score =   192 bits (487),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 104/200 (52%), Positives = 139/200 (70%), Gaps = 6/200 (3%)
 Frame = +3

Query  114  MVQPHILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANGGGVPDGLNF  293
            M  PH LLVTFP QGHINPSLQFAKRLVR+G  VTF T++ AH  +  A     P+GL+F
Sbjct  1    MAPPHFLLVTFPGQGHINPSLQFAKRLVRVGAHVTFVTAIRAH--LRTAESKSPPEGLSF  58

Query  294  TAFSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLPWVS  473
             +FSDGYDEG K+   ++  YM +++ RGS +L  +++ N   GR +  V +T LLPWV+
Sbjct  59   ASFSDGYDEGVKEGQ-DLEVYMDDLKRRGSETLSDLIASNLENGRRLLGVFYTTLLPWVA  117

Query  474  EVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATDPNCPVQLPGLPPLFSGDLP  653
            +VAR   +PS L+WIQPA VLD YYYYFHGY D  ++   +P+ P+QLPGLPPL + D+P
Sbjct  118  DVARSHGIPSTLVWIQPATVLDFYYYYFHGYGDLIRSTGDNPSLPIQLPGLPPLMASDIP  177

Query  654  SFLLPSGSGGDYSFAMPTFK  713
            SF     S  +Y+F++P F+
Sbjct  178  SF---CNSKNEYNFSLPLFQ  194



>emb|CDP15119.1| unnamed protein product [Coffea canephora]
Length=466

 Score =   191 bits (486),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 98/199 (49%), Positives = 135/199 (68%), Gaps = 5/199 (3%)
 Frame = +3

Query  114  MVQPHILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANGGGVPDGLNF  293
            M + H L+VTFPAQGHINP+LQFAKRL +LG++ TF+TS+ A   M+KA+G  +P+ L+ 
Sbjct  1    MEKCHFLIVTFPAQGHINPTLQFAKRLAKLGVKTTFSTSLGAINRMNKASGS-LPEKLSI  59

Query  294  TAFSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLPWVS  473
             AFSDGYD G+  N  +   YM+   TRGS +LK ++   + +G PIT VV+T+L+ WV 
Sbjct  60   VAFSDGYDHGWNPND-DFGRYMTSAATRGSQTLKELIMAQSNEGHPITHVVYTILMSWVG  118

Query  474  EVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATDPNCPVQLPGLPPLFSGDLP  653
            +VAR + +PS LLWIQPAAV  +YY +F+G  +   + ++     ++LPGLP L S DLP
Sbjct  119  QVARQLQIPSTLLWIQPAAVFQLYYCFFNGCAEIIGDISSSKT--IKLPGLPTLASRDLP  176

Query  654  SFLLPSGSGGDYSFAMPTF  710
            S LL S     YSFA+P  
Sbjct  177  SVLLASNPDV-YSFALPAI  194



>ref|XP_009107847.1| PREDICTED: UDP-glycosyltransferase 75D1-like isoform X2 [Brassica 
rapa]
Length=476

 Score =   192 bits (487),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 97/208 (47%), Positives = 131/208 (63%), Gaps = 18/208 (9%)
 Frame = +3

Query  126  HILLVTFPAQGHINPSLQFAKRLVRL--GIEVTFAT--SVYAHRLMSKANGGGVPDGLNF  293
            H L VTFPAQGHINPSL+ AKRL     G+ VTFA   S Y  R+ SK N   VP+ L F
Sbjct  15   HFLFVTFPAQGHINPSLELAKRLAGTIAGVRVTFAAPISAYNRRMFSKEN---VPENLIF  71

Query  294  TAFSDGYDEGFKKN-------HHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHT  452
              +SDG+D+GFK +             YMSE++ RG  +L  ++ DN  Q RP T VV+T
Sbjct  72   ATYSDGHDDGFKSSTSSDKARQDTAGRYMSEMKRRGRETLTELIEDNRLQNRPFTCVVYT  131

Query  453  LLLPWVSEVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAA-TDPNCPVQLPGLP  629
            +LL WV+E+ R+ ++PSALLW+QP  V  I+Y+YF+GY DA    A  DP+  ++LP LP
Sbjct  132  ILLTWVAELVREFHIPSALLWVQPVTVFSIFYHYFNGYADAISEMANNDPSGSIKLPALP  191

Query  630  PLFSGDLPSFLLPSGSGGDYSFAMPTFK  713
                 DLP+F++P+ +   YSF +P F+
Sbjct  192  QFCLRDLPTFIVPANT---YSFLLPAFR  216



>dbj|BAF96596.1| UDP-glucose:anthocysnin 5-O-glucosyltransferase [Rosa hybrid 
cultivar]
Length=364

 Score =   189 bits (479),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 102/183 (56%), Positives = 124/183 (68%), Gaps = 9/183 (5%)
 Frame = +3

Query  141  TFPAQGHINPSLQFAKRLVRL-GIEVTFATSVYAHRLMSKANGGGVPDGLNFTAFSDGYD  317
            TFPAQGH+NPSLQ AKRL+R  G  VTF TSV AHR     NG  VP GL F  FSDGYD
Sbjct  1    TFPAQGHMNPSLQLAKRLIRTTGALVTFVTSVSAHRRF--GNGSTVPTGLTFAPFSDGYD  58

Query  318  EGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLPWVSEVARDVNL  497
            +G K    N  H  SE+++R S ++  +V     +G+P T +V+TLLL WV+EVA +++L
Sbjct  59   DGAKPEDDN-QHVFSELKSRSSQAIVDLVESGRNEGQPYTCMVYTLLLSWVAEVATELHL  117

Query  498  PSALLWIQPAAVLDIYYYYFHGYEDAFKNAA----TDPNCPVQLPGLPPLF-SGDLPSFL  662
            PSAL WIQPA V DIYYYYF+GYED  +N       DP+  V+LPGLP L  S DLPSF+
Sbjct  118  PSALAWIQPATVFDIYYYYFNGYEDIIRNNTGADNNDPSFAVELPGLPLLLKSRDLPSFV  177

Query  663  LPS  671
            L S
Sbjct  178  LAS  180



>ref|XP_009107846.1| PREDICTED: UDP-glycosyltransferase 75D1-like isoform X1 [Brassica 
rapa]
Length=477

 Score =   191 bits (486),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 97/208 (47%), Positives = 131/208 (63%), Gaps = 18/208 (9%)
 Frame = +3

Query  126  HILLVTFPAQGHINPSLQFAKRLVRL--GIEVTFAT--SVYAHRLMSKANGGGVPDGLNF  293
            H L VTFPAQGHINPSL+ AKRL     G+ VTFA   S Y  R+ SK N   VP+ L F
Sbjct  15   HFLFVTFPAQGHINPSLELAKRLAGTIAGVRVTFAAPISAYNRRMFSKEN---VPENLIF  71

Query  294  TAFSDGYDEGFKKN-------HHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHT  452
              +SDG+D+GFK +             YMSE++ RG  +L  ++ DN  Q RP T VV+T
Sbjct  72   ATYSDGHDDGFKSSTSSDKARQDTAGRYMSEMKRRGRETLTELIEDNRLQNRPFTCVVYT  131

Query  453  LLLPWVSEVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAA-TDPNCPVQLPGLP  629
            +LL WV+E+ R+ ++PSALLW+QP  V  I+Y+YF+GY DA    A  DP+  ++LP LP
Sbjct  132  ILLTWVAELVREFHIPSALLWVQPVTVFSIFYHYFNGYADAISEMANNDPSGSIKLPALP  191

Query  630  PLFSGDLPSFLLPSGSGGDYSFAMPTFK  713
                 DLP+F++P+ +   YSF +P F+
Sbjct  192  QFCLRDLPTFIVPANT---YSFLLPAFR  216



>ref|XP_010549173.1| PREDICTED: UDP-glycosyltransferase 75D1 [Tarenaya hassleriana]
Length=478

 Score =   191 bits (486),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 104/207 (50%), Positives = 131/207 (63%), Gaps = 14/207 (7%)
 Frame = +3

Query  120  QPHILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANGGGVPDGLNFTA  299
            + H L VT PAQGHI P+L+FAKRL   G +VTFA  VYA R M     G VPD L+F  
Sbjct  8    EAHFLFVTLPAQGHITPALEFAKRLAVAGADVTFAACVYAFRRM--VVKGSVPDRLSFAT  65

Query  300  FSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSD---NAAQG--RPITAVVHTLLLP  464
            FSDG+D+GFK +  N   Y S ++ RGS ++  ++ D   NAAQ   RP T VV TLLLP
Sbjct  66   FSDGFDDGFKPDEKNPNKYASVMKLRGSETVAELIRDHNENAAQRGRRPFTCVVFTLLLP  125

Query  465  WVSEVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATDPNCP----VQLPGLPP  632
            WV  VAR+ +LP ALLW+QPA + DI YYY +GY D  K    D +      ++LPGLPP
Sbjct  126  WVITVAREFHLPVALLWVQPATLFDILYYYVNGYADVIKGTDHDHDHDDDGLIRLPGLPP  185

Query  633  LFSGDLPSFLLPSGSGGDYSFAMPTFK  713
            L   DLP+F+LPS S    S+ +P F+
Sbjct  186  LRRRDLPTFVLPSNSS---SYFLPEFQ  209



>ref|XP_010650447.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Vitis 
vinifera]
Length=665

 Score =   194 bits (494),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 103/184 (56%), Positives = 132/184 (72%), Gaps = 4/184 (2%)
 Frame = +3

Query  114  MVQPHILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANGGGVPDGLNF  293
            M+  H LL+T+PAQGHINP+LQFAKRL+R+G+EVT  T V A   M+KA       GL F
Sbjct  1    MLHHHFLLITYPAQGHINPTLQFAKRLIRMGMEVTLVTGVSALSRMAKAPSSA---GLTF  57

Query  294  TAFSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLPWVS  473
            T F DGY E + K   + +H +SEI+  GS +L  I+  +A QGRP+T +VHTLLLPWV+
Sbjct  58   TTFPDGYAE-WDKARADFSHQLSEIKRSGSQALTDIILRSAEQGRPVTCLVHTLLLPWVT  116

Query  474  EVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATDPNCPVQLPGLPPLFSGDLP  653
             VAR +++PSALLWIQ A VLDIYYYYF+ Y D  +  + +P+C ++LPGLP L  GDLP
Sbjct  117  GVARRLHVPSALLWIQTATVLDIYYYYFNYYGDVVRKNSNNPSCSIELPGLPLLTCGDLP  176

Query  654  SFLL  665
            SFLL
Sbjct  177  SFLL  180



>ref|XP_004297014.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Fragaria 
vesca subsp. vesca]
Length=475

 Score =   191 bits (485),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 101/192 (53%), Positives = 131/192 (68%), Gaps = 9/192 (5%)
 Frame = +3

Query  114  MVQPHILLVTFPAQGHINPSLQFAKRLVRL-GIEVTFATSVYAHRLMSKANGGGVPDGLN  290
            MVQ   +++ FPAQGHINP+LQ AK L+R  G  VTF T+V A R M  ANG   P GL 
Sbjct  1    MVQHRFIMIAFPAQGHINPALQLAKCLIRTTGAHVTFVTAVSALRRM--ANGSTTPSGLT  58

Query  291  FTAFSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLPWV  470
            F+ FSDGYD+G K    +  H ++E++   S ++ G+V   A +GRP T +V+TLLL WV
Sbjct  59   FSPFSDGYDDGVKP-EDDKQHVLNELKHGSSQAIVGLVHSGANEGRPYTCIVYTLLLSWV  117

Query  471  SEVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAA----TDPNCPVQLPGLPPLF  638
            +EVA +++LP+AL WIQPA V DIYYYYF+GY+D  KN       DP+  ++LPGLP LF
Sbjct  118  AEVATELHLPTALAWIQPATVFDIYYYYFNGYKDLIKNNTGADNNDPSFALELPGLPLLF  177

Query  639  -SGDLPSFLLPS  671
             S DLPSF+L S
Sbjct  178  KSRDLPSFILAS  189



>emb|CAN62624.1| hypothetical protein VITISV_001657 [Vitis vinifera]
Length=456

 Score =   190 bits (483),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 97/187 (52%), Positives = 127/187 (68%), Gaps = 5/187 (3%)
 Frame = +3

Query  114  MVQPHILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANGGGVPDGLNF  293
            M Q H L+++ P QGHINP+L FAKRL+R G  VTFA SV AHR M +  G  +P GL  
Sbjct  1    MEQHHFLIISHPMQGHINPALLFAKRLIRTGAHVTFAVSVSAHRRMPR--GPALP-GLTL  57

Query  294  TAFSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLPWVS  473
              FSDGYD+GFK   H   HY+SEI+  GS +L+ I + +A QGRP+T +VHT+LL W +
Sbjct  58   VPFSDGYDDGFKLEDHP-QHYLSEIKRCGSETLRRITAISADQGRPVTCLVHTILLAWAA  116

Query  474  EVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATDPNCPVQLPGLPPLFSG-DL  650
            E+AR + +PS LLWIQ A V  IYY+YF+GY     + + + + P+QLPGLP L S  D+
Sbjct  117  ELARSLQVPSVLLWIQRATVFTIYYHYFNGYGYVVGDCSNEDSSPIQLPGLPMLLSSRDI  176

Query  651  PSFLLPS  671
            PS L+ S
Sbjct  177  PSLLVSS  183



>ref|XP_010100065.1| UDP-glycosyltransferase 75D1 [Morus notabilis]
 gb|EXB81236.1| UDP-glycosyltransferase 75D1 [Morus notabilis]
Length=402

 Score =   189 bits (479),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 103/212 (49%), Positives = 134/212 (63%), Gaps = 21/212 (10%)
 Frame = +3

Query  123  PHILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANG---------GGV  275
            P  LLVT+PAQGHINP LQFAKRLV  G +VTF T+ +AHR M+K  G         GGV
Sbjct  5    PRFLLVTYPAQGHINPVLQFAKRLVGAGADVTFVTTYFAHRCMAKGRGDTTAAANRNGGV  64

Query  276  PDGLNFTAFSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTL  455
               +++  FSDG+D+GFK    +  HY++EIR RGS ++  +V   A +G P T +V++L
Sbjct  65   --SISYVPFSDGHDDGFKPGD-DFGHYLNEIRRRGSQAISDLVISAAKEGHPYTCLVYSL  121

Query  456  LLPWVSEVARDVNLPSALLWIQPAAVLDIYYYYFHGY-----EDAFKNAATDPNCPVQLP  620
            L+ W    A ++ LPS LLWIQPA V DIYYYYFHGY     E++ ++ +TD N    LP
Sbjct  122  LITWAVLTAEELCLPSVLLWIQPATVFDIYYYYFHGYGDIIRENSTEDPSTDHNSSTTLP  181

Query  621  GLPPLF-SGDLPSFLLPSGSGGDYSFAMPTFK  713
            GL   F   DLPSF+    +   YSFA+P FK
Sbjct  182  GLSLTFPRRDLPSFM---DAANTYSFAIPLFK  210



>ref|XP_002263422.1| PREDICTED: crocetin glucosyltransferase, chloroplastic [Vitis 
vinifera]
Length=456

 Score =   190 bits (482),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 97/187 (52%), Positives = 127/187 (68%), Gaps = 5/187 (3%)
 Frame = +3

Query  114  MVQPHILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANGGGVPDGLNF  293
            M Q H L+++ P QGHINP+L FAKRL+R G  VTFA SV AHR M +  G  +P GL  
Sbjct  1    MEQHHFLIISHPMQGHINPALLFAKRLIRTGAHVTFAVSVSAHRRMPR--GPALP-GLTL  57

Query  294  TAFSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLPWVS  473
              FSDGYD+GFK   H   HY+SEI+  GS +L+ I + +A QGRP+T +VHT+LL W +
Sbjct  58   VPFSDGYDDGFKLEDHP-QHYLSEIKRCGSETLRRITAISADQGRPVTCLVHTILLAWAA  116

Query  474  EVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATDPNCPVQLPGLPPLFSG-DL  650
            E+AR + +PS LLWIQ A V  IYY+YF+GY     + + + + P+QLPGLP L S  D+
Sbjct  117  ELARSLQVPSVLLWIQRATVFTIYYHYFNGYGYVVGDCSNEDSSPIQLPGLPMLLSSRDI  176

Query  651  PSFLLPS  671
            PS L+ S
Sbjct  177  PSLLVSS  183



>ref|XP_008355875.1| PREDICTED: UDP-glycosyltransferase 75D1-like [Malus domestica]
Length=260

 Score =   185 bits (469),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 95/189 (50%), Positives = 127/189 (67%), Gaps = 10/189 (5%)
 Frame = +3

Query  114  MVQPHILLVTFPAQGHINPSLQFAKRLVRL-GIEVTFATSVYAHRLMSKANGGGVPDGLN  290
            MVQ   LLVT+P QGHINPSLQ+AKRL+   G  VTF TS+ AH  +     G +PDGL 
Sbjct  1    MVQHRFLLVTYPTQGHINPSLQYAKRLINTTGAHVTFVTSLLAHHHIGN---GSIPDGLT  57

Query  291  FTAFSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLPWV  470
            +  FSDGYD+ FK    N+ HYMSE+R  G+ ++  +V  +A +G P T +V++LLLPW 
Sbjct  58   YAPFSDGYDDRFKPGD-NIDHYMSELRHHGAQAITDLVVASANEGHPYTCLVYSLLLPWS  116

Query  471  SEVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFK-NAATDPN----CPVQLPGLPPL  635
            + +A +++LP  LLWIQPA V DIYYYYF+GY+D  + N ++  N    CP++LPGLP +
Sbjct  117  AGMAHELHLPRVLLWIQPATVFDIYYYYFNGYKDLIRDNTSSGTNNVLPCPIELPGLPFI  176

Query  636  FSGDLPSFL  662
            F    PS L
Sbjct  177  FHKPRPSLL  185



>ref|XP_010023605.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Eucalyptus 
grandis]
 gb|KCW59916.1| hypothetical protein EUGRSUZ_H02640 [Eucalyptus grandis]
Length=463

 Score =   189 bits (481),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 103/200 (52%), Positives = 140/200 (70%), Gaps = 6/200 (3%)
 Frame = +3

Query  114  MVQPHILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANGGGVPDGLNF  293
            M  PH LLVTFP QGHINPSLQFAKRLVR+G  VTFAT++ AH  M+++     P+GL+F
Sbjct  1    MAPPHFLLVTFPGQGHINPSLQFAKRLVRVGAHVTFATAIRAHLRMAESKSP--PEGLSF  58

Query  294  TAFSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLPWVS  473
             +FSDGYDEG K+   ++  YM +++ RGS +L  +++ N   G  +  V +T +LPWV+
Sbjct  59   ASFSDGYDEGVKEGQ-DIEVYMDDLKRRGSETLSDLIASNLENGLRLLGVFYTTVLPWVA  117

Query  474  EVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATDPNCPVQLPGLPPLFSGDLP  653
            +VAR   +PS L+WIQPA VLD YYYYFHGY D  ++   +P+ P+QLPGLPPL + D+P
Sbjct  118  DVARSHGIPSTLVWIQPATVLDFYYYYFHGYGDLIRSTGDNPSLPIQLPGLPPLMASDIP  177

Query  654  SFLLPSGSGGDYSFAMPTFK  713
            SF     S  +Y+F +P F+
Sbjct  178  SF---CNSKDEYNFTLPLFQ  194



>ref|XP_006421040.1| hypothetical protein CICLE_v10004909mg [Citrus clementina]
 gb|ESR34280.1| hypothetical protein CICLE_v10004909mg [Citrus clementina]
 gb|KDO49186.1| hypothetical protein CISIN_1g041902mg [Citrus sinensis]
Length=470

 Score =   189 bits (481),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 107/199 (54%), Positives = 139/199 (70%), Gaps = 6/199 (3%)
 Frame = +3

Query  120  QPHILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANGGGVPDGLNFTA  299
            QPH LLVTFPAQGHINP+LQ A+RL+R+G  VTFAT+++A+R M  AN     DGL+F +
Sbjct  10   QPHFLLVTFPAQGHINPALQLARRLIRIGTRVTFATTIFAYRRM--ANSPTPEDGLSFAS  67

Query  300  FSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQG-RPITAVVHTLLLPWVSE  476
            FSDGYD+GF    ++   Y+SE + R S +L  I++ +  QG +P T +V++LLLPW +E
Sbjct  68   FSDGYDDGFNSKQNDPRRYVSEFKRRSSEALTEIITGSENQGAQPFTCLVYSLLLPWTAE  127

Query  477  VARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATDPNCPVQLPGLPPLFSGDLPS  656
            VAR  +LPSALLWIQPA V D+YYYYF+GY D  +    D    ++LPGLPPL   DLPS
Sbjct  128  VARAYHLPSALLWIQPALVFDVYYYYFYGYGDLIEEKVND---LIELPGLPPLTGWDLPS  184

Query  657  FLLPSGSGGDYSFAMPTFK  713
            F+ P  S   YSF +  FK
Sbjct  185  FMDPRKSNDAYSFILTCFK  203



>ref|XP_010434494.1| PREDICTED: UDP-glycosyltransferase 75D1-like [Camelina sativa]
Length=474

 Score =   189 bits (479),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 97/208 (47%), Positives = 131/208 (63%), Gaps = 17/208 (8%)
 Frame = +3

Query  123  PHILLVTFPAQGHINPSLQFAKRLVRL--GIEVTFAT--SVYAHRLMSKANGGGVPDGLN  290
            PH L VTFP QGHINPSL+ AKRL     G  VT+A   S Y  R+ S+ N   VP+ L 
Sbjct  12   PHFLFVTFPTQGHINPSLELAKRLAGTISGARVTYAAPISAYNRRMFSQEN---VPETLT  68

Query  291  FTAFSDGYDEGFKKN-------HHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVH  449
            F  +SDGYD+G+K +           A++MS++R  G  +L  ++ DN  Q RP T VV+
Sbjct  69   FATYSDGYDDGYKSSTSSKKSLQDATANFMSDMRRHGKETLTELIEDNRRQNRPFTCVVY  128

Query  450  TLLLPWVSEVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATDPNCPVQLPGLP  629
            T+LL WV+E+AR+++LPSALLW+QP  V  I Y+YF+GYEDA      +P+  +QLP LP
Sbjct  129  TILLTWVAELAREIHLPSALLWVQPVTVFSISYHYFNGYEDAISEMGNNPSGSIQLPSLP  188

Query  630  PLFSGDLPSFLLPSGSGGDYSFAMPTFK  713
             L   DLPSFL+ S +   Y+F +P  +
Sbjct  189  LLTLRDLPSFLVSSNA---YAFLLPVLR  213



>ref|XP_006478536.1| PREDICTED: UDP-glycosyltransferase 75D1-like, partial [Citrus 
sinensis]
Length=263

 Score =   183 bits (464),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 104/199 (52%), Positives = 136/199 (68%), Gaps = 6/199 (3%)
 Frame = +3

Query  120  QPHILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANGGGVPDGLNFTA  299
            QPH LL+TFP QGHINPSLQFA+RL R+G  VTFAT++ A+R M   N     DGL+F +
Sbjct  6    QPHFLLLTFPIQGHINPSLQFARRLTRIGTRVTFATAISAYRRM--PNNPTAEDGLSFAS  63

Query  300  FSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQG-RPITAVVHTLLLPWVSE  476
            FSDGYD+GF    ++  H+MSE + R S +L  +++ +  +G +P T +V+  LL W +E
Sbjct  64   FSDGYDDGFNSKQNDRTHFMSEFKRRSSEALAELITASQNEGGQPFTCLVYPQLLTWAAE  123

Query  477  VARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATDPNCPVQLPGLPPLFSGDLPS  656
            VAR  +LPSALLW+QPA V D+YYYYF+GY D  +    D    ++LPGLPPL   DLPS
Sbjct  124  VARAYHLPSALLWLQPALVFDVYYYYFYGYGDLIEGKVND---LIELPGLPPLTGRDLPS  180

Query  657  FLLPSGSGGDYSFAMPTFK  713
            FL P  S   YSF +P+FK
Sbjct  181  FLDPRNSNDAYSFVLPSFK  199



>ref|XP_010650398.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Vitis 
vinifera]
Length=463

 Score =   187 bits (476),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 99/186 (53%), Positives = 128/186 (69%), Gaps = 6/186 (3%)
 Frame = +3

Query  117  VQPHILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANGGGVPDGLNFT  296
            +QP ILLVT+PAQGHINPSLQ AK L+R G  VTF TS  A   MS +      DGL F 
Sbjct  1    MQPQILLVTYPAQGHINPSLQLAKLLIRAGAHVTFVTSSSAGTRMSISP---TLDGLEFV  57

Query  297  AFSDGYDEGFKKNHHN-VAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLPWVS  473
             FSDGYD  F  NH + + ++MSE+   GS +L  ++   A +GRP T +++ +L+PWV+
Sbjct  58   TFSDGYDHRF--NHGDGLQNFMSELERLGSPALTELIMARANEGRPFTCLLYGMLIPWVA  115

Query  474  EVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATDPNCPVQLPGLPPLFSGDLP  653
            EVAR ++LPSAL+W QPAAV DIYYYYF+GY +   N +   +  ++LPGLP L S DLP
Sbjct  116  EVARSLHLPSALVWSQPAAVFDIYYYYFNGYRELIGNKSNGSSSSIELPGLPLLSSSDLP  175

Query  654  SFLLPS  671
            SFL+PS
Sbjct  176  SFLVPS  181



>gb|KJB28075.1| hypothetical protein B456_005G025600 [Gossypium raimondii]
Length=467

 Score =   187 bits (476),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 93/190 (49%), Positives = 127/190 (67%), Gaps = 10/190 (5%)
 Frame = +3

Query  114  MVQPHILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANGGGVP--DGL  287
            M QPH LLV  PAQGHINP+LQFAK L+R+G+ VTF T + A   M+K     VP   GL
Sbjct  1    MSQPHFLLVASPAQGHINPTLQFAKHLIRIGVRVTFITCISARSRMTK-----VPTAQGL  55

Query  288  NFTAFSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLPW  467
             F  FSDGYD+GF+    ++ HY+SE+R RG  ++   ++ +  +G+P+T +V++    W
Sbjct  56   TFLPFSDGYDDGFQL-RDDIDHYLSELRRRGKEAISEFLTSSENEGKPVTCIVYSPFNHW  114

Query  468  VSEVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAA--TDPNCPVQLPGLPPLFS  641
             +EVAR  ++P+ LLWIQPA V DIYY+YF+GYE   K  A  T+P   ++LPGLP L +
Sbjct  115  ATEVARKHHIPTTLLWIQPATVFDIYYFYFNGYESTIKAQADETNPKRAIKLPGLPLLAT  174

Query  642  GDLPSFLLPS  671
             DLPSF+  S
Sbjct  175  RDLPSFVTAS  184



>ref|XP_007034187.1| Indole-3-acetate beta-D-glucosyltransferase, putative isoform 
1 [Theobroma cacao]
 ref|XP_007034188.1| Indole-3-acetate beta-D-glucosyltransferase, putative isoform 
1 [Theobroma cacao]
 ref|XP_007034189.1| Indole-3-acetate beta-D-glucosyltransferase, putative isoform 
1 [Theobroma cacao]
 gb|EOY05113.1| Indole-3-acetate beta-D-glucosyltransferase, putative isoform 
1 [Theobroma cacao]
 gb|EOY05114.1| Indole-3-acetate beta-D-glucosyltransferase, putative isoform 
1 [Theobroma cacao]
 gb|EOY05115.1| Indole-3-acetate beta-D-glucosyltransferase, putative isoform 
1 [Theobroma cacao]
Length=463

 Score =   187 bits (475),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 95/201 (47%), Positives = 130/201 (65%), Gaps = 8/201 (4%)
 Frame = +3

Query  114  MVQPHILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANGGGVPDGLNF  293
            M QPH+LLVT P QGHINPSLQFAKRL+ LG+ VTFAT+V A R M   +     +GL +
Sbjct  2    MAQPHVLLVTLPGQGHINPSLQFAKRLIHLGLRVTFATAVSAIRRMKPMSP---LEGLTY  58

Query  294  TA-FSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLPWV  470
             A +SDGYD+G K    ++  Y+ E R +G  +L   +  +  +G   T +V+ +++PWV
Sbjct  59   VAAYSDGYDDGLKPGD-DIDRYILESRRKGLETLSEFIGASIEEGIRFTCIVYGIMMPWV  117

Query  471  SEVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATDPNCPVQLPGLPPLFSGDL  650
            + VAR+ ++PS LLW QPA+V   YYYYF  Y D  +    DP+  V+LPGLPPL S D+
Sbjct  118  ALVAREFHIPSTLLWNQPASVFVTYYYYFKDYGDIIRKTVKDPSSIVELPGLPPLASRDM  177

Query  651  PSFLLPSGSGGDYSFAMPTFK  713
            PSF LP+    +Y  A+P+ K
Sbjct  178  PSFFLPA---NEYDCALPSLK  195



>gb|KDO43225.1| hypothetical protein CISIN_1g036740mg, partial [Citrus sinensis]
Length=424

 Score =   186 bits (473),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 106/199 (53%), Positives = 137/199 (69%), Gaps = 6/199 (3%)
 Frame = +3

Query  120  QPHILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANGGGVPDGLNFTA  299
            QPH LL+TFP QGHINPSLQFA+RL R+G  VTFA ++ A+R M  AN     DGL+F +
Sbjct  6    QPHFLLLTFPIQGHINPSLQFARRLTRIGTRVTFAIAISAYRRM--ANNPTPEDGLSFAS  63

Query  300  FSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQG-RPITAVVHTLLLPWVSE  476
            FSDGYD+GF    ++  HYMSE + R S +L  +++ +  +G +P T +V+  LLPW +E
Sbjct  64   FSDGYDDGFNSKQNDRKHYMSEFKRRSSEALAELITASQNEGGQPFTCLVYPQLLPWAAE  123

Query  477  VARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATDPNCPVQLPGLPPLFSGDLPS  656
            VAR  +LPSALLW+QPA V D+YYYYF+GY D  +    D    ++LPGLPPL   DLPS
Sbjct  124  VARAYHLPSALLWLQPALVFDVYYYYFYGYGDLIEGKVND---LIELPGLPPLTGRDLPS  180

Query  657  FLLPSGSGGDYSFAMPTFK  713
            FL P  S   YSF +P+FK
Sbjct  181  FLDPRNSNDAYSFVLPSFK  199



>emb|CBI39411.3| unnamed protein product [Vitis vinifera]
Length=290

 Score =   182 bits (463),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 92/178 (52%), Positives = 120/178 (67%), Gaps = 4/178 (2%)
 Frame = +3

Query  138  VTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANGGGVPDGLNFTAFSDGYD  317
            +T+PAQGHINPSLQ AK L+R G  VTF TS  A   MSK+      DGL F  FSDGYD
Sbjct  12   LTYPAQGHINPSLQLAKLLIRAGAHVTFVTSSSAGTRMSKSP---TLDGLEFVTFSDGYD  68

Query  318  EGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLPWVSEVARDVNL  497
             GF      + ++MSE+   GS +L  ++   A +GRP T +++ +L+PWV+EVAR ++L
Sbjct  69   HGFDHGD-GLQNFMSELERLGSPALTKLIMARANEGRPFTCLLYGMLIPWVAEVARSLHL  127

Query  498  PSALLWIQPAAVLDIYYYYFHGYEDAFKNAATDPNCPVQLPGLPPLFSGDLPSFLLPS  671
            PSAL+W QPAAV DIYYYYF+GY +   N     +  ++LPGLP + S DLPSFL+PS
Sbjct  128  PSALVWSQPAAVFDIYYYYFNGYGELIGNKGNGSSSSIELPGLPLISSSDLPSFLVPS  185



>ref|XP_006492998.1| PREDICTED: UDP-glycosyltransferase 75D1-like [Citrus sinensis]
Length=470

 Score =   187 bits (475),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 106/198 (54%), Positives = 138/198 (70%), Gaps = 6/198 (3%)
 Frame = +3

Query  123  PHILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANGGGVPDGLNFTAF  302
            PH LLVTFPAQGHINP+LQ A+RL+R+G  VTFAT+++A+R M  AN     DGL+F +F
Sbjct  11   PHFLLVTFPAQGHINPALQLARRLIRIGTRVTFATTIFAYRRM--ANSPTPEDGLSFASF  68

Query  303  SDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQG-RPITAVVHTLLLPWVSEV  479
            SDGYD+GF     +   Y+SE + R S +L  +++ +  QG +P T +V++LLLPW +EV
Sbjct  69   SDGYDDGFNSKQIDPRRYVSEFKRRSSEALTELITGSENQGAQPFTCLVYSLLLPWTAEV  128

Query  480  ARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATDPNCPVQLPGLPPLFSGDLPSF  659
            AR  +LPSALLWIQPA V D+YYYYF+GY D  +    D    ++LPGLPPL   DLPSF
Sbjct  129  ARAYHLPSALLWIQPALVFDVYYYYFYGYGDLIEEKVND---LIELPGLPPLTGCDLPSF  185

Query  660  LLPSGSGGDYSFAMPTFK  713
            + P  S   YSF +P FK
Sbjct  186  MDPRKSNDAYSFILPYFK  203



>ref|XP_003601706.1| UDP-glucose glucosyltransferase [Medicago truncatula]
 gb|AES71957.1| flavonoid glucosyltransferase [Medicago truncatula]
Length=472

 Score =   186 bits (472),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 95/199 (48%), Positives = 131/199 (66%), Gaps = 10/199 (5%)
 Frame = +3

Query  126  HILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAH-RLMSKANGGGVPDGLNFTAF  302
            H L++T+P  GHINP+LQFAKRL+ LG +VTFAT++Y H RL +K+       GL+F  F
Sbjct  6    HFLIITYPLHGHINPALQFAKRLISLGAQVTFATTIYLHTRLTNKS----TISGLSFATF  61

Query  303  SDGYDEGFK-KNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLPWVSEV  479
            SDG+D+G K +++ +   Y  E++ R S  L  I+     +GRP T + + +++PWV++V
Sbjct  62   SDGHDDGPKFESNEDFVTYEYELKRRCSEFLTNIILSGKQEGRPFTCLAYGIIIPWVAKV  121

Query  480  ARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATDPNCPVQLPGLP-PLFSGDLPS  656
            AR+++LPSALLWIQ A V DIYYYYFH + D   N + D  C + LPGL   L S DLPS
Sbjct  122  ARELHLPSALLWIQAATVFDIYYYYFHEHGDYVTNKSKDETCSISLPGLSFSLESRDLPS  181

Query  657  FLLPSGSGGDYSFAMPTFK  713
            FLL S     Y+ A  +FK
Sbjct  182  FLLSSNI---YTIATQSFK  197



>sp|Q9ZR27.1|5GT1_PERFR RecName: Full=Anthocyanidin 3-O-glucoside 5-O-glucosyltransferase 
1; AltName: Full=UDP-glucose:anthocyanin 5-O-glucosyltransferase 
3R4; Short=p3R4; Flags: Precursor [Perilla frutescens]
 dbj|BAA36421.1| UDP-glucose:anthocysnin 5-O-glucosyltransferase [Perilla frutescens 
var. crispa]
Length=460

 Score =   186 bits (471),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 97/188 (52%), Positives = 128/188 (68%), Gaps = 11/188 (6%)
 Frame = +3

Query  114  MVQPHILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSK--ANGGGVPDGL  287
            MV+  +LL TFPAQGHINP+LQFAKRL++ G +VTF TSVYA R M+   +   G P GL
Sbjct  1    MVRRRVLLATFPAQGHINPALQFAKRLLKAGTDVTFFTSVYAWRRMANTASAAAGNPPGL  60

Query  288  NFTAFSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLPW  467
            +F AFSDGYD+G K        YMSE++ RGS +L+ ++ +N      +T VV++ L  W
Sbjct  61   DFVAFSDGYDDGLKPCGDG-KRYMSEMKARGSEALRNLLLNN----HDVTFVVYSHLFAW  115

Query  468  VSEVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATDPNCPVQLPGLPPLFSGD  647
             +EVAR+  +PSALLW++PA VL IYY+YF+GY D   +A +D    +QLP LPPL    
Sbjct  116  AAEVARESQVPSALLWVEPATVLCIYYFYFNGYADEI-DAGSD---EIQLPRLPPLEQRS  171

Query  648  LPSFLLPS  671
            LP+FLLP 
Sbjct  172  LPTFLLPE  179



>ref|XP_006442002.1| hypothetical protein CICLE_v10019912mg [Citrus clementina]
 gb|ESR55242.1| hypothetical protein CICLE_v10019912mg [Citrus clementina]
Length=484

 Score =   186 bits (471),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 105/199 (53%), Positives = 137/199 (69%), Gaps = 6/199 (3%)
 Frame = +3

Query  120  QPHILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANGGGVPDGLNFTA  299
            QPH LL+TFP QGHINPSLQFA+RL R+G  VTFA ++ A+R +  AN     DGL+F +
Sbjct  22   QPHFLLLTFPIQGHINPSLQFARRLTRIGTRVTFAIAISAYRRI--ANNPTPEDGLSFAS  79

Query  300  FSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQG-RPITAVVHTLLLPWVSE  476
            FSDGYD+GF    ++  HYMSE + R S +L  +++ +  +G +P T +V+  LLPW +E
Sbjct  80   FSDGYDDGFNSKQNDRTHYMSEFKRRSSEALAELITTSQNEGGQPFTCLVYPQLLPWAAE  139

Query  477  VARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATDPNCPVQLPGLPPLFSGDLPS  656
            VAR  +LPSALLW+QPA V D+YYYYF+GY D  +    D    ++LPGLPPL   DLPS
Sbjct  140  VARAYHLPSALLWLQPALVFDVYYYYFYGYGDLIEGKVND---LIELPGLPPLTGRDLPS  196

Query  657  FLLPSGSGGDYSFAMPTFK  713
            FL P  S   YSF +P+FK
Sbjct  197  FLDPRNSNDAYSFVLPSFK  215



>ref|XP_003601705.1| O-glucosyltransferase [Medicago truncatula]
 gb|AES71956.1| flavonoid glucosyltransferase [Medicago truncatula]
Length=478

 Score =   185 bits (470),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 95/199 (48%), Positives = 131/199 (66%), Gaps = 10/199 (5%)
 Frame = +3

Query  126  HILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAH-RLMSKANGGGVPDGLNFTAF  302
            H L++T+P QGHINP+LQF KRL+ LG +VTFAT+++ + RL++K     +P GL+F  F
Sbjct  6    HFLIITYPLQGHINPALQFTKRLISLGAKVTFATTIHLYSRLINKPT---IP-GLSFATF  61

Query  303  SDGYDEGFKK-NHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLPWVSEV  479
            SDGYD+G K     ++  YMSE   RGS  L  I+  +  +  P T +++TL+L W  +V
Sbjct  62   SDGYDDGQKSFGDEDIVSYMSEFTRRGSEFLTNIILSSKQENHPFTCLIYTLILSWAPKV  121

Query  480  ARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATDPNCPVQLPGLP-PLFSGDLPS  656
            A +++LPS LLWIQ A V DI+YYYFH + D   N + D  C + LPGL   L S DLPS
Sbjct  122  AHELHLPSTLLWIQAATVFDIFYYYFHEHGDYITNKSKDETCLISLPGLSFSLKSRDLPS  181

Query  657  FLLPSGSGGDYSFAMPTFK  713
            FLL S +   Y+FA+P+ K
Sbjct  182  FLLASNT---YTFALPSLK  197



>ref|XP_003601707.1| UDP-glucuronosyltransferase 1-6 [Medicago truncatula]
 gb|AES71958.1| flavonoid glucosyltransferase [Medicago truncatula]
Length=479

 Score =   185 bits (470),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 96/199 (48%), Positives = 129/199 (65%), Gaps = 10/199 (5%)
 Frame = +3

Query  126  HILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANGGGVPDGLNFTAFS  305
            H L++T+P  GHINP+LQFAKRL+  G +VTFAT++Y H  +   N   +P GL+F  FS
Sbjct  6    HFLIITYPLHGHINPALQFAKRLISFGAQVTFATTIYLHTGL--INKPTIP-GLSFATFS  62

Query  306  DGYDEG--FKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLPWVSEV  479
            DGYD+G  F+ N   +A Y SE++   S  L  I+     +GRP T + + +++PWV++V
Sbjct  63   DGYDDGKNFESNEDFIA-YRSELKCHCSEFLTNIILSGKQEGRPFTCLAYGIIIPWVAKV  121

Query  480  ARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATDPNCPVQLPGLP-PLFSGDLPS  656
            AR+++LPSALLWIQ A V DIYYYYFH + D   N + D  C + LPGL   L S DLPS
Sbjct  122  ARELHLPSALLWIQAATVFDIYYYYFHEHGDYITNKSKDETCSISLPGLSFSLESRDLPS  181

Query  657  FLLPSGSGGDYSFAMPTFK  713
            FLL S     Y+ A  +FK
Sbjct  182  FLLSSNI---YTIATRSFK  197



>gb|ABL85474.1| glycosyltransferase UGT75L4 [Maclura pomifera]
Length=472

 Score =   185 bits (470),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 102/208 (49%), Positives = 132/208 (63%), Gaps = 12/208 (6%)
 Frame = +3

Query  114  MVQPHILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANGGGVPDG--L  287
            M +P  LLVT+PAQGHINP LQFAKRL R G ++TF T+ YAHR M   +   + +G  L
Sbjct  1    MTKPRFLLVTYPAQGHINPGLQFAKRLARAGADITFVTANYAHRQMINRSDPTIQNGTSL  60

Query  288  NFTAFS-DGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLP  464
            +   FS DGY++GFK    +  HY+SE R  GS +L  ++     +GRP T + +T+LLP
Sbjct  61   SHAPFSVDGYEDGFKPGG-DPDHYLSEFRRCGSQALTDLILTAVNEGRPYTCLAYTILLP  119

Query  465  WVSEVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFK-NAATDPNCP---VQLPGLPP  632
            W +  A +  LPS LLWIQPA V DIYYYYFHGY D  + N+  DP+       LPGLP 
Sbjct  120  WAALTAEEHGLPSVLLWIQPATVFDIYYYYFHGYGDIIRTNSTKDPSSDDSLTTLPGLPW  179

Query  633  LFS-GDLPSFLLPSGSGGDYSFAMPTFK  713
             FS  DLPSF+ P+ +   Y+FA+P  K
Sbjct  180  KFSRSDLPSFMDPANT---YTFAIPLLK  204



>ref|XP_002868197.1| indole-3-acetate beta-D-glucosyltransferase [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH44456.1| indole-3-acetate beta-D-glucosyltransferase [Arabidopsis lyrata 
subsp. lyrata]
Length=475

 Score =   185 bits (469),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 99/208 (48%), Positives = 134/208 (64%), Gaps = 17/208 (8%)
 Frame = +3

Query  123  PHILLVTFPAQGHINPSLQFAKRLVRL--GIEVTFATSV--YAHRLMSKANGGGVPDGLN  290
            PH L VTFPAQGHINPSL+ AKRL     G  VTFA S+  Y  R+ S+ N   VP+ L 
Sbjct  13   PHFLFVTFPAQGHINPSLELAKRLAGTISGARVTFAASISAYNRRMFSQEN---VPETLI  69

Query  291  FTAFSDGYDEGFKKN-------HHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVH  449
            F  +SDG+D+GFK +            ++MSE+R RG  +L  ++ DN  Q RP T VV+
Sbjct  70   FATYSDGHDDGFKSSTSSAKSRQDATGNFMSEMRRRGKETLTELIEDNRNQNRPFTCVVY  129

Query  450  TLLLPWVSEVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATDPNCPVQLPGLP  629
            T+LL WV+E+AR+ +LPSALLW+QP  V  I+Y+YF+GYE+A    A +P+  ++LP LP
Sbjct  130  TILLTWVAELAREFHLPSALLWVQPVTVFSIFYHYFNGYEEAISEMANNPSSSIKLPSLP  189

Query  630  PLFSGDLPSFLLPSGSGGDYSFAMPTFK  713
             L   DLPSF++ S     Y+F +P F+
Sbjct  190  LLSLRDLPSFMVSSSV---YAFLLPAFR  214



>ref|XP_010434953.1| PREDICTED: UDP-glycosyltransferase 75D1-like [Camelina sativa]
Length=474

 Score =   184 bits (466),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 95/208 (46%), Positives = 129/208 (62%), Gaps = 17/208 (8%)
 Frame = +3

Query  123  PHILLVTFPAQGHINPSLQFAKRLVRL--GIEVTFAT--SVYAHRLMSKANGGGVPDGLN  290
            PH L VTFP QGHINPSL+ AKRL     G  VT+A   S Y  R+ S+ N   VP+ L 
Sbjct  12   PHFLFVTFPTQGHINPSLELAKRLAGTISGARVTYAAPISAYNRRMFSQEN---VPETLT  68

Query  291  FTAFSDGYDEGFKKN-------HHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVH  449
            F  +SDGYD+G+K +           A++M ++R  G  +L  ++ DN  Q RP T VV+
Sbjct  69   FATYSDGYDDGYKSSASSKKSLQDATANFMFDMRRHGKETLTELIEDNLRQNRPFTCVVY  128

Query  450  TLLLPWVSEVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATDPNCPVQLPGLP  629
             +LL WV+E+AR+++LPSALLW+QP  V  I Y+YF+GYEDA      +P+  +QLP LP
Sbjct  129  RILLTWVAELAREIHLPSALLWVQPVTVFSISYHYFNGYEDAISEMGNNPSGSIQLPSLP  188

Query  630  PLFSGDLPSFLLPSGSGGDYSFAMPTFK  713
             L   DLPSFL+ S +   Y+F +P  +
Sbjct  189  LLTVRDLPSFLVSSNA---YAFLLPVLR  213



>ref|XP_002263301.1| PREDICTED: crocetin glucosyltransferase, chloroplastic [Vitis 
vinifera]
Length=464

 Score =   183 bits (464),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 94/185 (51%), Positives = 122/185 (66%), Gaps = 4/185 (2%)
 Frame = +3

Query  117  VQPHILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANGGGVPDGLNFT  296
            +Q  ILLVT+PAQGHINPSLQ AK L R G  VTF TS  A   MSK       +GL F 
Sbjct  1    MQAQILLVTYPAQGHINPSLQLAKLLTRAGAHVTFVTSSSASTRMSKPP---TLEGLEFV  57

Query  297  AFSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLPWVSE  476
             FSDGYD GFK +  ++ ++MSE+   GS +L  ++   A +GRP T +++ +++PWV+E
Sbjct  58   TFSDGYDHGFK-HGDDLQNFMSELDRLGSQALTELIVARANEGRPFTCLLYGIIIPWVAE  116

Query  477  VARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATDPNCPVQLPGLPPLFSGDLPS  656
            VA+  +LPSAL+W Q A V DIYYYYF+GY +   N     +  ++LPGLP L S DLPS
Sbjct  117  VAQSFHLPSALVWSQAATVFDIYYYYFNGYGELIGNKGNGSSSSIELPGLPLLSSSDLPS  176

Query  657  FLLPS  671
            FL PS
Sbjct  177  FLEPS  181



>ref|XP_006442000.1| hypothetical protein CICLE_v10023445mg [Citrus clementina]
 gb|ESR55240.1| hypothetical protein CICLE_v10023445mg [Citrus clementina]
Length=500

 Score =   184 bits (466),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 104/199 (52%), Positives = 136/199 (68%), Gaps = 6/199 (3%)
 Frame = +3

Query  120  QPHILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANGGGVPDGLNFTA  299
            QPH LL+TFP QGHINPSLQFA+RL R+G  VTFAT++ A+RLM   N     DGL+F +
Sbjct  22   QPHFLLLTFPIQGHINPSLQFARRLTRIGTRVTFATAISAYRLM--PNNPTAEDGLSFAS  79

Query  300  FSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQG-RPITAVVHTLLLPWVSE  476
            FSDGYD+GF    ++  H+MSE + R S +L  +++ +  +G +P T +V+  LL W +E
Sbjct  80   FSDGYDDGFNSKQNDQTHFMSEFKRRSSEALAELITASRNEGGQPFTCLVYPQLLIWAAE  139

Query  477  VARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATDPNCPVQLPGLPPLFSGDLPS  656
            VAR  +LPSALLW+QP  V D+YYYYF+GY D  +    D    ++LPGLPPL   DLPS
Sbjct  140  VARAYHLPSALLWLQPVLVFDVYYYYFYGYGDLIEGKVND---LIELPGLPPLTGRDLPS  196

Query  657  FLLPSGSGGDYSFAMPTFK  713
            FL P  S   YSF +P+FK
Sbjct  197  FLDPRNSNDAYSFVLPSFK  215



>ref|XP_008359982.1| PREDICTED: UDP-glycosyltransferase 75D1-like [Malus domestica]
Length=218

 Score =   176 bits (445),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 89/177 (50%), Positives = 121/177 (68%), Gaps = 10/177 (6%)
 Frame = +3

Query  114  MVQPHILLVTFPAQGHINPSLQFAKRLVRLGI-EVTFATSVYAHRLMSKANGGGVPDGLN  290
            MVQ   LLVT+PAQGHINPSLQ+AKRL+      VTF TS+ AH  +     G +PDGL 
Sbjct  1    MVQHRFLLVTYPAQGHINPSLQYAKRLINTTCAHVTFVTSLSAHHHIGN---GSIPDGLT  57

Query  291  FTAFSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLPWV  470
            +  FSDGYD+GFK    N+ HYMSE+R  G+ ++  +V  +A +G P T +V++LLLPW 
Sbjct  58   YAPFSDGYDDGFKPGD-NIDHYMSELRHHGAQAITDLVVASANEGHPYTCLVYSLLLPWS  116

Query  471  SEVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFK-NAATDPN----CPVQLPGL  626
            + +A +++LP  LLWIQPA V DIYYYYF+GY+D  + N ++  N    CP++LP +
Sbjct  117  AGMAHELHLPRVLLWIQPATVFDIYYYYFNGYKDLIRDNTSSGTNNVLPCPIELPDI  173



>ref|XP_004502258.1| PREDICTED: UDP-glycosyltransferase 75D1-like [Cicer arietinum]
 gb|AGU14117.1| UDP-glycosyltransferase [Cicer arietinum]
Length=471

 Score =   181 bits (460),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 95/198 (48%), Positives = 127/198 (64%), Gaps = 8/198 (4%)
 Frame = +3

Query  126  HILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANGGGVPDGLNFTAFS  305
            + L+VT+P QGHINP+LQFAKRLV +G  VTF T++Y HR +   N   +P+ L+F AFS
Sbjct  6    NFLIVTYPLQGHINPALQFAKRLVTMGAHVTFTTTIYLHRRL--INKPTIPN-LSFAAFS  62

Query  306  DGYDEGFKKNHH-NVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLPWVSEVA  482
            DGYD+G+  N   +++ YM E+ +RGS  L+ I+        P T + +TLLLPW + VA
Sbjct  63   DGYDDGYNSNAIVDLSTYMLELSSRGSEFLRNIILSAKHGNHPFTCLAYTLLLPWAANVA  122

Query  483  RDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATDPNCPVQLPGLP-PLFSGDLPSF  659
            R++ LP ALLWIQ A V DIYYYY H + D   N + D  C ++LPGL   L S DLPSF
Sbjct  123  RELQLPYALLWIQAATVFDIYYYYLHEHGDYITNKSKDATCNIELPGLSFSLKSRDLPSF  182

Query  660  LLPSGSGGDYSFAMPTFK  713
            L  S     Y+F + + K
Sbjct  183  LQASNI---YTFILSSMK  197



>emb|CBI36304.3| unnamed protein product [Vitis vinifera]
Length=333

 Score =   177 bits (450),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 83/183 (45%), Positives = 128/183 (70%), Gaps = 7/183 (4%)
 Frame = +3

Query  123  PHILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANGGGVPDGLNFTAF  302
            PH L++TFPAQGHINP+L+ AKRL+ +G +VTFAT+++A   + K       DGL F+ F
Sbjct  6    PHFLIITFPAQGHINPALELAKRLIGVGADVTFATTIHAKSRLVK---NPTVDGLRFSTF  62

Query  303  SDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLPWVSEVA  482
            SDG +EG K+  +++  +    +   S +L  ++  +A +GRPI+ +++++++P  +E+A
Sbjct  63   SDGQEEGVKRGPNDLPVF----QRLASENLSELIMASANEGRPISCLIYSIVIPGAAELA  118

Query  483  RDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATDPNCPVQLPGLPPLFSGDLPSFL  662
            R  N+PSA LWIQPA VLDIYYYYF+G+ D  ++ ++DP+  ++LPGLP L   DLPSF 
Sbjct  119  RSFNIPSAFLWIQPATVLDIYYYYFNGFGDLIRSKSSDPSFSIELPGLPSLSRQDLPSFF  178

Query  663  LPS  671
            + S
Sbjct  179  VGS  181



>ref|XP_008380634.1| PREDICTED: anthocyanidin 3-O-glucoside 5-O-glucosyltransferase-like 
[Malus domestica]
Length=472

 Score =   181 bits (459),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 95/206 (46%), Positives = 136/206 (66%), Gaps = 13/206 (6%)
 Frame = +3

Query  114  MVQPHILLVTFPAQGHINPSLQFAKRLVRL-GIEVTFATSVYAHRLMSKANGGGVPDGLN  290
            MV+   LLVT+PAQG INPSLQF KRL+   G  VT+ TS+ A   +   + G +PDGL 
Sbjct  1    MVRHRFLLVTYPAQGQINPSLQFVKRLINTTGAHVTYVTSLSARHCL---DNGSIPDGLT  57

Query  291  FTAFSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLPWV  470
            +  FSDGYD+GF     ++ +Y+SE+R RG+ ++  +V  +A +G P T +V+T  LPWV
Sbjct  58   YAPFSDGYDDGFMPGD-SIDNYLSELRRRGAQAITDLVVSSANEGHPYTCLVYTSFLPWV  116

Query  471  SEVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFK-NAATDPN---CPVQLPGLP-PL  635
            +EVA +++LP+ L WIQPA V DI+YYYF+GY+D  + N  +  N   C ++LPGLP  L
Sbjct  117  AEVAHELHLPNVLFWIQPATVFDIHYYYFNGYKDLIRDNTNSGTNNVPCSIELPGLPLAL  176

Query  636  FSGDLPSFLLPSGSGGDYSFAMPTFK  713
             S DLPSF++ +     Y+F +  F+
Sbjct  177  TSRDLPSFMVDTNL---YNFVLSLFQ  199



>ref|XP_003629628.1| UDP-glucose flavonoid 7-O-glucosyltransferase [Medicago truncatula]
 gb|AET04104.1| flavonoid glucosyltransferase [Medicago truncatula]
Length=465

 Score =   180 bits (456),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 94/186 (51%), Positives = 127/186 (68%), Gaps = 10/186 (5%)
 Frame = +3

Query  123  PH-ILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANGGGVPDGLNFTA  299
            PH ILLV +P QGHINP+ +FAKRL+ LG  VT +T+V+ H  ++  N   +P+ L++  
Sbjct  2    PHRILLVPYPVQGHINPAFEFAKRLITLGAHVTISTTVHMHNRIT--NKPTLPN-LSYYP  58

Query  300  FSDGYDEGFKKNHHNV-AHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLPWVSE  476
            FSDGYD+GFK    +    Y +E + RGS  +  I+  N+ +G P T +VH+LLL W +E
Sbjct  59   FSDGYDDGFKGTGSDAYLEYHAEFQRRGSEFVSDIILKNSQEGTPFTCLVHSLLLQWAAE  118

Query  477  VARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATDPNCPVQLPGLPPLFSG-DLP  653
             AR+ +LP+ALLW+QPA V DI YYYFHG+ D+ KN    P+  ++LPGLP LFS  DLP
Sbjct  119  AAREFHLPTALLWVQPATVFDILYYYFHGFSDSIKN----PSSSIELPGLPLLFSSRDLP  174

Query  654  SFLLPS  671
            SFLL S
Sbjct  175  SFLLAS  180



>ref|XP_010096066.1| UDP-glycosyltransferase 75D1 [Morus notabilis]
 gb|EXC42235.1| UDP-glycosyltransferase 75D1 [Morus notabilis]
Length=475

 Score =   180 bits (456),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 91/199 (46%), Positives = 124/199 (62%), Gaps = 11/199 (6%)
 Frame = +3

Query  114  MVQPHILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANGGGV------  275
            M +P  LLV FPA GH+NP+LQ A+RLV +G EVTF T+V AHR M    GG        
Sbjct  1    MAKPRFLLVVFPAHGHVNPALQLARRLVLIGCEVTFVTTVRAHRRMITKGGGTDDNNDNN  60

Query  276  ---PDGLNFTAFSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVV  446
               P+G++FT FSDGYD+GF     +   Y  E+R+RGS +L  +V  +  +GRP T ++
Sbjct  61   FTPPNGMSFTQFSDGYDDGFGPKAIDFTVYSLELRSRGSQALIDLVDSSKNEGRPYTCMI  120

Query  447  HTLLLPWVSEVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNA-ATDPNCPVQLPG  623
            +T ++PWV++VA  + +P AL  +Q A V D+ YYYFHGY D  ++    D +C +  PG
Sbjct  121  YTFIMPWVADVAAKLGIPVALFCVQTATVFDLCYYYFHGYGDLIRDKMVNDISCSLGFPG  180

Query  624  LPPLFS-GDLPSFLLPSGS  677
            LP  F+  DLPSFL  S S
Sbjct  181  LPLDFAVRDLPSFLDASDS  199



>gb|KCW45598.1| hypothetical protein EUGRSUZ_L006311, partial [Eucalyptus grandis]
Length=211

 Score =   173 bits (438),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 86/203 (42%), Positives = 128/203 (63%), Gaps = 11/203 (5%)
 Frame = +3

Query  114  MVQPHILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANGGGVPDGLNF  293
            M  PH LLV    +  +NP+LQ A+RL R+G  VTF ++VYAHR M        P+G+ F
Sbjct  1    MAPPHFLLVALSTRSAMNPALQLAERLARVGSRVTFLSTVYAHRCMIDPV---CPEGVTF  57

Query  294  TAFSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLPWVS  473
            T FSDGYD+G+     ++  Y +E++ RGS +L+G++  ++ QG   T V+HT++ PWV 
Sbjct  58   TTFSDGYDDGYVPGD-DLERYRAEMKRRGSEALRGLIEHSSGQGLSFTCVLHTIV-PWVH  115

Query  474  EVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAAT---DPNCPVQLPGLPPLFSG  644
            +VAR + + S L+WIQPA V DIYY+YF+GYED  K+  +   D    ++LPG+PPL + 
Sbjct  116  DVARSLQIKSVLVWIQPATVFDIYYHYFNGYEDVIKSVTSQRCDTTSLIRLPGVPPLTNR  175

Query  645  DLPSFLLPSGSGGDYSFAMPTFK  713
            ++PS L        Y+F +P  +
Sbjct  176  NIPSIL---HIEDKYAFVLPEIQ  195



>ref|XP_010039961.1| PREDICTED: UDP-glycosyltransferase 75D1-like [Eucalyptus grandis]
Length=210

 Score =   172 bits (437),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 86/203 (42%), Positives = 128/203 (63%), Gaps = 11/203 (5%)
 Frame = +3

Query  114  MVQPHILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANGGGVPDGLNF  293
            M  PH LLV    +  +NP+LQ A+RL R+G  VTF ++VYAHR M        P+G+ F
Sbjct  1    MAPPHFLLVALSTRSAMNPALQLAERLARVGSRVTFLSTVYAHRCMIDPV---CPEGVTF  57

Query  294  TAFSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLPWVS  473
            T FSDGYD+G+     ++  Y +E++ RGS +L+G++  ++ QG   T V+HT++ PWV 
Sbjct  58   TTFSDGYDDGYVPGD-DLERYRAEMKRRGSEALRGLIEHSSGQGLSFTCVLHTIV-PWVH  115

Query  474  EVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAAT---DPNCPVQLPGLPPLFSG  644
            +VAR + + S L+WIQPA V DIYY+YF+GYED  K+  +   D    ++LPG+PPL + 
Sbjct  116  DVARSLQIKSVLVWIQPATVFDIYYHYFNGYEDVIKSVTSQRCDTTSLIRLPGVPPLTNR  175

Query  645  DLPSFLLPSGSGGDYSFAMPTFK  713
            ++PS L        Y+F +P  +
Sbjct  176  NIPSIL---HIEDKYAFVLPEIQ  195



>gb|AFI71902.1| flavonol 5-O-glucosyltransferase [Paeonia lactiflora]
Length=465

 Score =   179 bits (454),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 101/202 (50%), Positives = 137/202 (68%), Gaps = 12/202 (6%)
 Frame = +3

Query  114  MVQPHILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANGGGVPDGLNF  293
            M   H LL+TFPAQGHINP+LQFAKRL++L   VTF TS+ AHR ++K         L+F
Sbjct  1    MAHHHFLLITFPAQGHINPALQFAKRLIKLDAHVTFVTSISAHRQITKTTPS--LGNLSF  58

Query  294  TAFSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLPWVS  473
              FSDGYDEG K  + +  HYMSE+R R S +L  ++ + A +GRP+T ++++LLLPW  
Sbjct  59   ATFSDGYDEGTKAGY-DARHYMSELRRRSSEALPELIENCANEGRPVTCLIYSLLLPWAG  117

Query  474  EVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNA--ATDPNCPVQLPGLPPLFSGD  647
            +VAR++++PSALLWIQPA +LDIYYYYF+GY +   +     D  C ++LPGLP L   D
Sbjct  118  KVARELHIPSALLWIQPATILDIYYYYFNGYGNVISDNIHKKDSGC-IKLPGLPLLTVHD  176

Query  648  LPSFLLPSGSGGDYSFAMPTFK  713
            LPS  + +       FA+P+FK
Sbjct  177  LPSHFITT------PFALPSFK  192



>gb|KDP32590.1| hypothetical protein JCGZ_13140 [Jatropha curcas]
Length=455

 Score =   179 bits (453),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 96/201 (48%), Positives = 136/201 (68%), Gaps = 6/201 (3%)
 Frame = +3

Query  114  MVQPHILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANGGGVPDGLNF  293
            M  PH+L+ +FPAQGHINPSLQFA+RL  +G++VTFAT++ A R M+K    G+PD L+F
Sbjct  1    MKNPHVLVASFPAQGHINPSLQFAQRLATMGLKVTFATTIGADRRMAKT---GIPDNLSF  57

Query  294  TAFSDGYDEGFKKNHHNVAHYMS-EIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLPWV  470
             A SDG D+GFK    N+ +YM+ ++R  GS +L+ ++   +  G P T VV+++L+PWV
Sbjct  58   AALSDGNDDGFKP-IVNIGNYMTHDLRLHGSQTLRRLIQQASNDGHPFTFVVYSILIPWV  116

Query  471  SEVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATDPNCPVQLPGLPPLFSGDL  650
            ++VAR+ +LPSALLW QPA V  IYY+YF+GY +  +         + LP LP L   DL
Sbjct  117  AKVAREFHLPSALLWSQPATVFSIYYHYFNGYGEIIEKTINSATLLLNLPNLPVLSVYDL  176

Query  651  PSFLLPSGSGGDYSFAMPTFK  713
            PSF  P+ S  +Y+F +P  K
Sbjct  177  PSFFSPAKS-NEYAFVLPVVK  196



>gb|AHL68667.1| UDP-glucose: anthocyanin 5-O-glucosyltransferase [Vitis amurensis]
Length=464

 Score =   179 bits (453),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 84/183 (46%), Positives = 127/183 (69%), Gaps = 7/183 (4%)
 Frame = +3

Query  123  PHILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANGGGVPDGLNFTAF  302
            PH L++TFPAQGHINP+L+ AKRL+ +G +VTFAT+++A   + K       DGL F+ F
Sbjct  6    PHFLIITFPAQGHINPALELAKRLIGVGADVTFATTIHAKSRLVK---NPTVDGLRFSTF  62

Query  303  SDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLPWVSEVA  482
            SDG +EG K+  + +  +    +   S +L  ++  +A +GRPI+ +++++L+P  +E+A
Sbjct  63   SDGQEEGVKRGPNELPVF----QRLASENLSELIMASANEGRPISCLIYSILIPGAAELA  118

Query  483  RDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATDPNCPVQLPGLPPLFSGDLPSFL  662
            R  N+PSA LWIQPA VLDIYYYYF+G+ D  ++ ++DP+  ++LPGLP L   DLPSF 
Sbjct  119  RSFNIPSAFLWIQPATVLDIYYYYFNGFGDLIRSKSSDPSFSIELPGLPSLSRQDLPSFF  178

Query  663  LPS  671
            + S
Sbjct  179  VGS  181



>ref|XP_010103920.1| UDP-glycosyltransferase 75D1 [Morus notabilis]
 gb|EXB97437.1| UDP-glycosyltransferase 75D1 [Morus notabilis]
Length=475

 Score =   179 bits (453),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 90/199 (45%), Positives = 124/199 (62%), Gaps = 11/199 (6%)
 Frame = +3

Query  114  MVQPHILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANGGGV------  275
            M +P  LLV  PA GH+NP+LQ A+RLV +G EVTF T+V AHR M    GG        
Sbjct  1    MAKPRFLLVVLPAHGHVNPALQLARRLVLIGCEVTFVTTVRAHRRMITKGGGTDDNNDNN  60

Query  276  ---PDGLNFTAFSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVV  446
               P+G++FT FSDGYD+GF     +   Y  E+R+RGS +L  +V  +  +GRP T ++
Sbjct  61   FTPPNGMSFTQFSDGYDDGFGPKAIDFTVYSLELRSRGSQALIDLVDSSKNEGRPYTCMI  120

Query  447  HTLLLPWVSEVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNA-ATDPNCPVQLPG  623
            +T ++PWV++VA  + +P AL ++Q A V D+ YYYFHGY D  ++    D +C +  PG
Sbjct  121  YTFIMPWVADVAAKLGIPVALFYVQTATVFDLCYYYFHGYGDLIRDKMVNDRSCSLGFPG  180

Query  624  LPPLFS-GDLPSFLLPSGS  677
            LP  F+  DLPSFL  S S
Sbjct  181  LPLDFAVRDLPSFLDASDS  199



>ref|XP_006414807.1| hypothetical protein EUTSA_v10025167mg [Eutrema salsugineum]
 gb|ESQ56260.1| hypothetical protein EUTSA_v10025167mg [Eutrema salsugineum]
Length=455

 Score =   177 bits (450),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 97/188 (52%), Positives = 128/188 (68%), Gaps = 12/188 (6%)
 Frame = +3

Query  111  AMVQPHILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANGGGVPDGLN  290
            A  +PH LLVTFPAQGHINP+LQ A RL+  G  VT+AT+V A R M +        GL+
Sbjct  7    ACRRPHYLLVTFPAQGHINPALQLANRLIHHGATVTYATAVSALRRMGEPPSA---QGLS  63

Query  291  FTAFSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQG-RPITAVVHTLLLPW  467
            +  FSDG+D+G K +  +   YMSE++ RGS +L  I+  N   G   IT V++++L+PW
Sbjct  64   YAWFSDGFDDGLK-SFEDQKIYMSELKRRGSDALSDIIRANLHDGATTITTVIYSVLVPW  122

Query  468  VSEVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNA-ATDPNCPVQLPGLPPLFSG  644
            VS VARD +LP+ LLWI+PA VLDIYYYYF+   D+ K+   TD   P++LP LPP+ +G
Sbjct  123  VSTVARDFHLPTTLLWIEPATVLDIYYYYFN---DSHKHLFETD---PIKLPNLPPISTG  176

Query  645  DLPSFLLP  668
            DLPSFL P
Sbjct  177  DLPSFLQP  184



>gb|AFJ52962.1| UDP-glycosyltransferase 1 [Linum usitatissimum]
Length=505

 Score =   178 bits (451),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 90/192 (47%), Positives = 125/192 (65%), Gaps = 5/192 (3%)
 Frame = +3

Query  105  GVAMVQPHILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANGGGVPDG  284
             V   QPHI++VTF A GH+NPSL F++RL+ LG  VT  T+V  H L++      +PDG
Sbjct  3    AVTKQQPHIVVVTFAAHGHLNPSLHFSERLLLLGCRVTLVTTVSGHSLLANKKSS-LPDG  61

Query  285  LNFTAFSDGYD--EGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLL  458
            L+   FSDGYD     +K+  +      ++ TRG+  L  +++ N+ +G PI  +V+TLL
Sbjct  62   LSIATFSDGYDIPGSHQKSKDDENKQWVQMNTRGAEFLNELIATNSDEGTPICCLVYTLL  121

Query  459  LPWVSEVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATDPNCPVQLPGLPPLF  638
            L WV++VARD NLPS LLWIQPA V DIYYY  +GYE+AF+    +P+  ++LPG+P  F
Sbjct  122  LTWVADVARDNNLPSVLLWIQPATVFDIYYYLANGYEEAFEK-CRNPSFRLELPGIPVSF  180

Query  639  SGD-LPSFLLPS  671
            + D LPSF  P 
Sbjct  181  TNDELPSFASPC  192



>dbj|BAG80545.1| UDP-glucose:glucosyltransferase [Lycium barbarum]
Length=467

 Score =   177 bits (449),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 93/196 (47%), Positives = 124/196 (63%), Gaps = 10/196 (5%)
 Frame = +3

Query  126  HILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANGGGVP--DGLNFTA  299
            H+LLVTFP QGHINPSLQFAKRLV LG++VTF+TS+ A   +SK     +P  +GL+F  
Sbjct  9    HVLLVTFPGQGHINPSLQFAKRLVNLGVKVTFSTSLSAFNRISK-----LPNIEGLSFAP  63

Query  300  FSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLPWVSEV  479
            FSDGYD  FK + +    + S + + GS  +  I+    A+G P T +++T ++ WV  V
Sbjct  64   FSDGYDGKFKGSMNEFDSFYSSLMSHGSEFVTQIIKSRVAEGHPFTRIIYTTIMAWVGVV  123

Query  480  ARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATDPNCPVQLPGLPPLFSGDLPSF  659
            A+ +N+PS   WIQPA VLDIYYY F  Y D FKN + D    V+LPGLP L   D PS 
Sbjct  124  AKSINVPSTFFWIQPATVLDIYYYCFTDYADYFKNCSQDQ--VVELPGLPRLSPRDFPSL  181

Query  660  LLPSGSGGDYSFAMPT  707
            +L S     Y +A+ +
Sbjct  182  VL-SDVNSTYGWAVKS  196



>sp|Q9ZR26.1|5GT2_PERFR RecName: Full=Anthocyanidin 3-O-glucoside 5-O-glucosyltransferase 
2; AltName: Full=UDP-glucose:anthocyanin 5-O-glucosyltransferase 
3R6; Short=p3R6; Flags: Precursor [Perilla frutescens]
 dbj|BAA36422.1| UDP-glucose:anthocyanin 5-O-glucosyltransferase homologue [Perilla 
frutescens var. crispa]
Length=443

 Score =   177 bits (448),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 92/188 (49%), Positives = 126/188 (67%), Gaps = 11/188 (6%)
 Frame = +3

Query  114  MVQPHILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSK--ANGGGVPDGL  287
            MV+  +LL TFPAQGHINP+LQFAKRL++ G +VTF TSVYA R M+   +   G P GL
Sbjct  1    MVRRRVLLATFPAQGHINPALQFAKRLLKAGTDVTFFTSVYAWRRMANTASAAAGNPPGL  60

Query  288  NFTAFSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLPW  467
            +F AFSDGYD+G K        YMSE++ RGS +L+ ++ +N      +T VV++ L  W
Sbjct  61   DFVAFSDGYDDGLKPGGDG-KRYMSEMKARGSEALRNLLLNN----DDVTFVVYSHLFAW  115

Query  468  VSEVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATDPNCPVQLPGLPPLFSGD  647
             +EVAR  ++P+ALLW++PA VL IY++YF+GY D     + +    +QLP LP L    
Sbjct  116  AAEVARLSHVPTALLWVEPATVLCIYHFYFNGYADEIDAGSNE----IQLPRLPSLEQRS  171

Query  648  LPSFLLPS  671
            LP+FLLP+
Sbjct  172  LPTFLLPA  179



>ref|XP_004247895.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Solanum 
lycopersicum]
Length=468

 Score =   177 bits (448),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 90/182 (49%), Positives = 116/182 (64%), Gaps = 9/182 (5%)
 Frame = +3

Query  126  HILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANGGGVP--DGLNFTA  299
            H+LLVTFP QGHINPSLQFAK+LV LG+ VTF+TS+ A   +SK     +P  +GL+FT 
Sbjct  9    HVLLVTFPGQGHINPSLQFAKKLVNLGLNVTFSTSLTAFNRISK-----LPNIEGLSFTP  63

Query  300  FSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLPWVSEV  479
            FSDGYD  F+ +      + S + + GS  +  I+   A +GRP   V++T L+ WV  V
Sbjct  64   FSDGYDGKFEGSLDEFESFYSSLVSHGSEFMTQIIESRAVEGRPFKRVIYTTLMAWVGIV  123

Query  480  ARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATDPNCPVQLPGLPPLFSGDLPSF  659
            A+ +N+PS   WIQPA V+DIYYY F  Y D FKN + D    V LPGLP L   D PSF
Sbjct  124  AKGINVPSTFFWIQPATVMDIYYYCFTDYADCFKNCSEDQ--VVDLPGLPQLSPRDFPSF  181

Query  660  LL  665
            + 
Sbjct  182  VF  183



>ref|XP_004298222.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Fragaria 
vesca subsp. vesca]
Length=473

 Score =   177 bits (448),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 99/206 (48%), Positives = 126/206 (61%), Gaps = 12/206 (6%)
 Frame = +3

Query  114  MVQPHILLVTFPAQGHINPSLQFAKRLVRL-GIEVTFATSVYAHRLMSKANGGGVPDGLN  290
            MVQ   +++ +PAQGHINPSLQ AKRL+R  G  VTF  +VYAHR M  AN   +P  L 
Sbjct  1    MVQHRFIVIAYPAQGHINPSLQLAKRLIRTTGAHVTFVNTVYAHRRM--ANSLTIPCRLT  58

Query  291  FTAFSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLPWV  470
            F  FSDGYD+G  K   +  H +SE+R+R S ++  +V   A +G P T +V+TLLL WV
Sbjct  59   FAPFSDGYDDG-TKPEDDSEHVLSELRSRSSKAIVDLVKTGANEGHPYTCIVYTLLLSWV  117

Query  471  SEVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATDPN-----CPVQLPGLPPL  635
              VA +++LPSAL WIQPA V DIYYYYF+GY+D  +N   D N               L
Sbjct  118  GGVATELHLPSALAWIQPATVFDIYYYYFNGYKDLIRNNTGDENNDPSFALELPGLPLLL  177

Query  636  FSGDLPSFLLPSGSGGDYSFAMPTFK  713
               DLPSF+L S     YS A+P F+
Sbjct  178  KKRDLPSFILASNP---YSSALPLFE  200



>ref|XP_010915038.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Elaeis 
guineensis]
Length=467

 Score =   176 bits (447),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 91/187 (49%), Positives = 121/187 (65%), Gaps = 5/187 (3%)
 Frame = +3

Query  117  VQPHILLVTFPAQGHINPSLQFAKRLVRL--GIEVTFATSVYAHRLM--SKANGGGVPDG  284
            +Q HIL+ T+  QGHINP+L+ A +L R   G  VTF+T+VY HR M  S A+ G V DG
Sbjct  5    IQQHILVATYAGQGHINPALRLATQLARTIPGARVTFSTTVYGHRRMFPSAASDGEVSDG  64

Query  285  -LNFTAFSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLL  461
             L++  FSDGYD+GFK        YM + +  GS +L  ++ D  A+GR +T +++T+LL
Sbjct  65   RLSYLPFSDGYDDGFKDLIPKFDQYMIQAKLNGSRNLSNLLGDLTARGRRVTCLIYTILL  124

Query  462  PWVSEVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATDPNCPVQLPGLPPLFS  641
            PW ++VAR+  + S L WIQPAAV  IYY+YFHGYE    +   DP   V+ PGLPPL  
Sbjct  125  PWAADVAREHGIRSFLHWIQPAAVFAIYYHYFHGYEGVVASHREDPLFEVEFPGLPPLRM  184

Query  642  GDLPSFL  662
             DLPSF 
Sbjct  185  RDLPSFF  191



>ref|XP_010039945.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Eucalyptus 
grandis]
 gb|KCW45604.1| hypothetical protein EUGRSUZ_L00636 [Eucalyptus grandis]
Length=460

 Score =   176 bits (447),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 90/201 (45%), Positives = 130/201 (65%), Gaps = 8/201 (4%)
 Frame = +3

Query  114  MVQPHILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANGGGVPDGLNF  293
            M   + L+V FP+QG INP+LQFAKRL+  G  VTFAT+  A+R M+K+N    P+GL F
Sbjct  1    MAPVNYLVVAFPSQGLINPALQFAKRLLHTGAHVTFATAGSAYRRMAKSN---PPEGLFF  57

Query  294  TAFSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLPWVS  473
             +FSDG DEG      ++  YM+++   GS +L+ +V  +  +GR    + +T ++PWV+
Sbjct  58   ASFSDGSDEGLMPGI-DIEKYMADVERLGSETLRDLVITSLNRGRTFACIFYTTIVPWVA  116

Query  474  EVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAAT-DPNCPVQLPGLPPLFSGDL  650
            +VA  + +PS L+W QPA +LDIYYYYF+GY D  KN    DP+  +QLPGLPPL   D+
Sbjct  117  QVAHSLEIPSTLIWAQPATLLDIYYYYFNGYGDIIKNLGNGDPSASLQLPGLPPLTPRDV  176

Query  651  PSFLLPSGSGGDYSFAMPTFK  713
            PSF     +   Y+F++P  +
Sbjct  177  PSFFT---AKNQYAFSLPLMR  194



>gb|AAL69494.1| putative glucosyltransferase [Arabidopsis thaliana]
Length=466

 Score =   176 bits (447),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 92/188 (49%), Positives = 127/188 (68%), Gaps = 14/188 (7%)
 Frame = +3

Query  120  QPHILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANGGGVPDGLNFTA  299
            +PH LLVTFPAQGHINP+LQ A RL+  G  VT++T+V AHR M +        GL+F  
Sbjct  21   RPHYLLVTFPAQGHINPALQLANRLIHHGATVTYSTAVSAHRRMGEPPS---TKGLSFAW  77

Query  300  FSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVS---DNAAQGRPITAVVHTLLLPWV  470
            F+DG+D+G K +  +   YMSE++  GS++L+ I+    D   +  PIT V++++L+PWV
Sbjct  78   FTDGFDDGLK-SFEDQKIYMSELKRCGSNALRDIIKANLDATTETEPITGVIYSVLVPWV  136

Query  471  SEVARDVNLPSALLWIQPAAVLDIYYYYFH-GYEDAFKNAATDPNCPVQLPGLPPLFSGD  647
            S VAR+ +LP+ LLWI+PA VLDIYYYYF+  Y+  F         P++LP LP + +GD
Sbjct  137  STVAREFHLPTTLLWIEPATVLDIYYYYFNTSYKHLFDVE------PIKLPKLPLITTGD  190

Query  648  LPSFLLPS  671
            LPSFL PS
Sbjct  191  LPSFLQPS  198



>ref|NP_193146.1| anthocyanin 5-O-glucosyltransferase [Arabidopsis thaliana]
 sp|Q0WW21.2|U75C1_ARATH RecName: Full=UDP-glycosyltransferase 75C1; AltName: Full=Anthocyanin 
5-O-glucosyltransferase; AltName: Full=UDP glucose:anthocyanin 
5-O-glucosyltransferase [Arabidopsis thaliana]
 emb|CAB10189.1| glucosyltransferase like protein [Arabidopsis thaliana]
 emb|CAB78452.1| glucosyltransferase like protein [Arabidopsis thaliana]
 gb|AAL32667.1| glucosyltransferase [Arabidopsis thaliana]
 gb|AAM47973.1| glucosyltransferase [Arabidopsis thaliana]
 gb|AAM91686.1| putative glucosyltransferase [Arabidopsis thaliana]
 gb|AEE83370.1| anthocyanin 5-O-glucosyltransferase [Arabidopsis thaliana]
 gb|AHL38699.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=456

 Score =   176 bits (446),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 92/188 (49%), Positives = 127/188 (68%), Gaps = 14/188 (7%)
 Frame = +3

Query  120  QPHILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANGGGVPDGLNFTA  299
            +PH LLVTFPAQGHINP+LQ A RL+  G  VT++T+V AHR M +        GL+F  
Sbjct  11   RPHYLLVTFPAQGHINPALQLANRLIHHGATVTYSTAVSAHRRMGEPPS---TKGLSFAW  67

Query  300  FSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVS---DNAAQGRPITAVVHTLLLPWV  470
            F+DG+D+G K +  +   YMSE++  GS++L+ I+    D   +  PIT V++++L+PWV
Sbjct  68   FTDGFDDGLK-SFEDQKIYMSELKRCGSNALRDIIKANLDATTETEPITGVIYSVLVPWV  126

Query  471  SEVARDVNLPSALLWIQPAAVLDIYYYYFH-GYEDAFKNAATDPNCPVQLPGLPPLFSGD  647
            S VAR+ +LP+ LLWI+PA VLDIYYYYF+  Y+  F         P++LP LP + +GD
Sbjct  127  STVAREFHLPTTLLWIEPATVLDIYYYYFNTSYKHLFDVE------PIKLPKLPLITTGD  180

Query  648  LPSFLLPS  671
            LPSFL PS
Sbjct  181  LPSFLQPS  188



>dbj|BAE98677.1| glucosyltransferase like protein [Arabidopsis thaliana]
Length=456

 Score =   176 bits (446),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 92/188 (49%), Positives = 127/188 (68%), Gaps = 14/188 (7%)
 Frame = +3

Query  120  QPHILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANGGGVPDGLNFTA  299
            +PH LLVTFPAQGHINP+LQ A RL+  G  VT++T+V AHR M +        GL+F  
Sbjct  11   RPHYLLVTFPAQGHINPALQLANRLIHHGATVTYSTAVSAHRRMGEPPS---TKGLSFAW  67

Query  300  FSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVS---DNAAQGRPITAVVHTLLLPWV  470
            F+DG+D+G K +  +   YMSE++  GS++L+ I+    D   +  PIT V++++L+PWV
Sbjct  68   FTDGFDDGLK-SFEDQKIYMSELKRCGSNALRDIIKANLDATTETEPITGVIYSVLVPWV  126

Query  471  SEVARDVNLPSALLWIQPAAVLDIYYYYFH-GYEDAFKNAATDPNCPVQLPGLPPLFSGD  647
            S VAR+ +LP+ LLWI+PA VLDIYYYYF+  Y+  F         P++LP LP + +GD
Sbjct  127  STVAREFHLPTTLLWIEPATVLDIYYYYFNTSYKHLFDVE------PIKLPKLPLITTGD  180

Query  648  LPSFLLPS  671
            LPSFL PS
Sbjct  181  LPSFLQPS  188



>sp|Q9ZR25.1|5GT_VERHY RecName: Full=Anthocyanidin 3-O-glucoside 5-O-glucosyltransferase; 
AltName: Full=UDP-glucose:anthocyanin 5-O-glucosyltransferase 
HGT8; Flags: Precursor [Glandularia x hybrida]
 dbj|BAA36423.1| UDP-glucose:anthocyanin 5-O-glucosyltransferase [Glandularia 
x hybrida]
Length=461

 Score =   176 bits (445),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 98/190 (52%), Positives = 128/190 (67%), Gaps = 11/190 (6%)
 Frame = +3

Query  114  MVQPHILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANGGGVPDGL-N  290
            M + H+LL TFPAQGHINP+LQFAKRL    I+VTF TSVYA R MS+   G   +GL N
Sbjct  1    MSRAHVLLATFPAQGHINPALQFAKRLANADIQVTFFTSVYAWRRMSRTAAG--SNGLIN  58

Query  291  FTAFSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGR--PITAVVHTLLLP  464
            F +FSDGYD+G +       +YMSE+++RG  +L   ++ N    +   IT VV++ L  
Sbjct  59   FVSFSDGYDDGLQPGDDG-KNYMSEMKSRGIKALSDTLAANNVDQKSSKITFVVYSHLFA  117

Query  465  WVSEVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATDPNCPVQLP-GLPPLFS  641
            W ++VAR+ +L SALLWI+PA VLDI+Y+YF+GY D   +A +D    + LP GLP L  
Sbjct  118  WAAKVAREFHLRSALLWIEPATVLDIFYFYFNGYSDEI-DAGSD---AIHLPGGLPVLAQ  173

Query  642  GDLPSFLLPS  671
             DLPSFLLPS
Sbjct  174  RDLPSFLLPS  183



>ref|XP_010246963.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Nelumbo 
nucifera]
Length=459

 Score =   175 bits (444),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 89/183 (49%), Positives = 123/183 (67%), Gaps = 8/183 (4%)
 Frame = +3

Query  126  HILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANGGGVP-DGLNFTAF  302
            H LLVT P QGHINP+LQFAKRL+R G +VTFA S  A+R + K++    P  GL F  F
Sbjct  7    HFLLVTLPMQGHINPTLQFAKRLLRTGAQVTFAISFSAYRRLMKSS---TPIHGLTFAPF  63

Query  303  SDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLPWVSEVA  482
            SDG+D+G++          SE + R S +L  ++   + + RP+T +++TLLL W ++VA
Sbjct  64   SDGFDDGYRVFFDEP----SEFKLRASQALADLILAASKEHRPVTCLIYTLLLSWAADVA  119

Query  483  RDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATDPNCPVQLPGLPPLFSGDLPSFL  662
             ++ + SALLWIQ AAV DIYY+YF+G+ +   N+  DP   ++LPGLP L S D+PSFL
Sbjct  120  NNLGVASALLWIQSAAVFDIYYHYFNGFRELIANSEDDPLSSIELPGLPRLTSQDVPSFL  179

Query  663  LPS  671
            LPS
Sbjct  180  LPS  182



>ref|XP_010527436.1| PREDICTED: UDP-glycosyltransferase 75C1 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010527437.1| PREDICTED: UDP-glycosyltransferase 75C1 isoform X2 [Tarenaya 
hassleriana]
Length=466

 Score =   175 bits (444),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 94/192 (49%), Positives = 126/192 (66%), Gaps = 16/192 (8%)
 Frame = +3

Query  120  QPHILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANGGGVP----DGL  287
            +PH LLVTFPAQGHINP+L+ A RL+  G  VTF+T+V A R M      G P    DGL
Sbjct  13   RPHFLLVTFPAQGHINPALELANRLISHGATVTFSTTVNALRRM------GTPPSAVDGL  66

Query  288  NFTAFSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLPW  467
            +F   SDG+D+G K +  +   YMSE + RGS++L  ++        PITAV++++L+PW
Sbjct  67   SFAWLSDGFDDGVK-SPEDGKIYMSEFKRRGSAALSDVID---TSDPPITAVIYSILVPW  122

Query  468  VSEVARDVNLPSALLWIQPAAVLDIYYYYF-HGYEDAF-KNAATDPNCPVQLPGLPPLFS  641
             + VAR+ +LP+ LLWI+PA VLD+YYYYF   +   F K A  DP+  V LPGLPPL +
Sbjct  123  AAAVAREFHLPATLLWIEPATVLDVYYYYFTDSFRHVFDKGADNDPSDSVNLPGLPPLAA  182

Query  642  GDLPSFLLPSGS  677
            GDLPS + P  +
Sbjct  183  GDLPSLIQPEKT  194



>ref|XP_009787090.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Nicotiana 
sylvestris]
Length=466

 Score =   175 bits (444),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 95/196 (48%), Positives = 125/196 (64%), Gaps = 15/196 (8%)
 Frame = +3

Query  126  HILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANGGGVPDGLNFTAFS  305
            H+LLVTFP+QG INPSLQFAKRL++LG+ VTF+TS+ A   MS  N      GL F  FS
Sbjct  9    HVLLVTFPSQGQINPSLQFAKRLIKLGVNVTFSTSLSALNCMS--NNLSSIKGLTFAPFS  66

Query  306  DGYDEGFKKNHHNVAHYMSEIR-------TRGSSSLKGIVSDNAAQGRPITAVVHTLLLP  464
            DGYD G+     NV   + E R         GS  +  I +D A +GRP + +++T +L 
Sbjct  67   DGYDNGYP----NVGKSLDEYREFYASFIALGSEFVSEIFADRAKEGRPFSRIIYTTVLS  122

Query  465  WVSEVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATDPNCPVQLPGLPPLFS-  641
            WV  VA+ +N P+ LLWIQPA +LD+YYYYF  Y+DAFKN   D +  +++PGLP L S 
Sbjct  123  WVGIVAKRLNAPATLLWIQPATLLDLYYYYFTSYKDAFKNCP-DEDKSLEIPGLPFLVSI  181

Query  642  GDLPSFLLPSGSGGDY  689
             ++PSFLL S    D+
Sbjct  182  REIPSFLLSSDGLMDW  197



>gb|KCW76863.1| hypothetical protein EUGRSUZ_D01218 [Eucalyptus grandis]
Length=430

 Score =   174 bits (442),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 101/198 (51%), Positives = 139/198 (70%), Gaps = 7/198 (4%)
 Frame = +3

Query  111  AMVQPHILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANGGGVPDGLN  290
            +M  PH LLVTFP+QGHINPSLQFAKRLVR+G  VTFAT+++AH  M+++     P GL+
Sbjct  10   SMAPPHFLLVTFPSQGHINPSLQFAKRLVRVGAHVTFATAIHAHHRMAESKSP--PVGLS  67

Query  291  FTAFSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLPWV  470
            F +FSDGYD+    +  ++  YM E++ +GS +L  +++ N   GR    V +T LLPWV
Sbjct  68   FASFSDGYDD--GIDKDDLDGYMDELKRQGSETLSNLIASNLENGRRFLGVFYTTLLPWV  125

Query  471  SEVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATDPNCPVQLPGLPPLFSGDL  650
            ++VAR   +PS L+WIQPA VLD YYYYFHGY D  ++ + +P+ P+QLPGLPPL + D+
Sbjct  126  ADVARSHGIPSTLVWIQPATVLDFYYYYFHGYGDLIQSTSDNPSVPIQLPGLPPLMACDI  185

Query  651  PSFLLPSGSGGDYSFAMP  704
            PSF     S   Y+F++P
Sbjct  186  PSF---CNSKNVYNFSLP  200



>ref|XP_002868314.1| UDP-glucoronosyl/UDP-glucosyl transferase family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH44573.1| UDP-glucoronosyl/UDP-glucosyl transferase family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=453

 Score =   174 bits (442),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 90/185 (49%), Positives = 125/185 (68%), Gaps = 11/185 (6%)
 Frame = +3

Query  120  QPHILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANGGGVPDGLNFTA  299
            +PH LLVTFPAQGHINP+LQ A RL+  G  VT++T++ AHR M +        GL+F  
Sbjct  10   RPHYLLVTFPAQGHINPALQLANRLIHHGATVTYSTAISAHRRMGEPPS---TKGLSFAW  66

Query  300  FSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLPWVSEV  479
            F+DG+D+G K +  +   YMSE++  GS++L+ I+  N     PIT V++++L+PWVS V
Sbjct  67   FTDGFDDGLK-SLEDQKIYMSELKRCGSNALRDIIRANLDATEPITGVIYSVLVPWVSTV  125

Query  480  ARDVNLPSALLWIQPAAVLDIYYYYFHG-YEDAFKNAATDPNCPVQLPGLPPLFSGDLPS  656
            AR+ +LP+ LLWI+PA VLDIYYYYF+  Y+  F         P++LP LP + + DLPS
Sbjct  126  AREFHLPTTLLWIEPATVLDIYYYYFNASYKHLFHVE------PIKLPKLPLITTEDLPS  179

Query  657  FLLPS  671
            FL PS
Sbjct  180  FLQPS  184



>ref|XP_010052789.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Eucalyptus 
grandis]
Length=472

 Score =   174 bits (442),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 101/198 (51%), Positives = 139/198 (70%), Gaps = 7/198 (4%)
 Frame = +3

Query  111  AMVQPHILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANGGGVPDGLN  290
            +M  PH LLVTFP+QGHINPSLQFAKRLVR+G  VTFAT+++AH  M+++     P GL+
Sbjct  10   SMAPPHFLLVTFPSQGHINPSLQFAKRLVRVGAHVTFATAIHAHHRMAESKSP--PVGLS  67

Query  291  FTAFSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLPWV  470
            F +FSDGYD+    +  ++  YM E++ +GS +L  +++ N   GR    V +T LLPWV
Sbjct  68   FASFSDGYDD--GIDKDDLDGYMDELKRQGSETLSNLIASNLENGRRFLGVFYTTLLPWV  125

Query  471  SEVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATDPNCPVQLPGLPPLFSGDL  650
            ++VAR   +PS L+WIQPA VLD YYYYFHGY D  ++ + +P+ P+QLPGLPPL + D+
Sbjct  126  ADVARSHGIPSTLVWIQPATVLDFYYYYFHGYGDLIQSTSDNPSVPIQLPGLPPLMACDI  185

Query  651  PSFLLPSGSGGDYSFAMP  704
            PSF     S   Y+F++P
Sbjct  186  PSF---CNSKNVYNFSLP  200



>ref|XP_010068983.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Eucalyptus 
grandis]
 gb|KCW57189.1| hypothetical protein EUGRSUZ_H00004 [Eucalyptus grandis]
Length=465

 Score =   174 bits (442),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 89/200 (45%), Positives = 123/200 (62%), Gaps = 11/200 (6%)
 Frame = +3

Query  114  MVQPHILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANGGGVPDGLNF  293
            M  PH LL+ FP++G INP+LQ A+RL   G  VTF T+V AHR M +       DG+ F
Sbjct  1    MAPPHFLLIAFPSRGAINPALQLAERLTHAGSRVTFFTTVSAHRRMIEPV---CLDGVTF  57

Query  294  TAFSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLPWVS  473
              FSDGYD G++    +V H+M+E++ RGS +L+G++  ++ +G   T  +HT+   W  
Sbjct  58   ATFSDGYDNGYELGD-DVDHFMAELKRRGSEALRGLIEYSSGRGLRFTCALHTMF-RWAD  115

Query  474  EVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNA---ATDPNCPVQLPGLPPLFSG  644
            EVAR   + S L+WIQPA V  IYY+YF+GYED  K+    + D    ++LPGLPPL   
Sbjct  116  EVARSFQIQSVLVWIQPATVFGIYYHYFNGYEDVIKSVTSQSCDTTSLIRLPGLPPLTDR  175

Query  645  DLPSFLLPSGSGGDYSFAMP  704
            DLPSF  P      Y+F +P
Sbjct  176  DLPSFFNPDNK---YAFGLP  192



>ref|XP_009778637.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Nicotiana 
sylvestris]
 ref|XP_009778638.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Nicotiana 
sylvestris]
Length=463

 Score =   174 bits (442),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 87/182 (48%), Positives = 120/182 (66%), Gaps = 9/182 (5%)
 Frame = +3

Query  126  HILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANGGGVP--DGLNFTA  299
            H+LLVTFP QG+INP +QF+KRLV+LG+ VTF+TS+ A   ++      +P  +GL F  
Sbjct  9    HVLLVTFPGQGNINPCIQFSKRLVKLGVNVTFSTSLTAFNRIA-----NLPTIEGLTFAP  63

Query  300  FSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLPWVSEV  479
            FSDG+D  FK + +N   + +  RT+GS  +  +V   A +G P   +V+T L  WV  +
Sbjct  64   FSDGFDGNFKGSMNNFHEFNNSFRTQGSEFVINLVKTRAKEGNPFKRIVYTTLTGWVGLL  123

Query  480  ARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATDPNCPVQLPGLPPLFSGDLPSF  659
            A+++N+PS  LWIQPA VLDIYYY+F+GYED  KN   D    ++L GLP LF  DLPSF
Sbjct  124  AKNINVPSTFLWIQPATVLDIYYYFFNGYEDTIKNCPKDQ--FLELHGLPLLFPRDLPSF  181

Query  660  LL  665
            + 
Sbjct  182  VF  183



>ref|XP_010039940.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Eucalyptus 
grandis]
 gb|KCW45599.1| hypothetical protein EUGRSUZ_L00632 [Eucalyptus grandis]
Length=456

 Score =   174 bits (441),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 87/203 (43%), Positives = 128/203 (63%), Gaps = 11/203 (5%)
 Frame = +3

Query  114  MVQPHILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANGGGVPDGLNF  293
            M  PH LLV    +  +NP+LQ A+RL R+G  VTF ++VYAHR M        P+G+ F
Sbjct  1    MAPPHFLLVALSTRSAMNPALQLAERLARVGSRVTFLSTVYAHRCMIDPV---CPEGVTF  57

Query  294  TAFSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLPWVS  473
            T FSDGYD+G+     +   YM+E++ RGS +L+G++  ++ QG   T V+HT++ PWV 
Sbjct  58   TTFSDGYDDGYVPGD-DPERYMAEMKRRGSEALRGLIEHSSGQGLSFTCVLHTIV-PWVH  115

Query  474  EVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAAT---DPNCPVQLPGLPPLFSG  644
            +VAR + + S L+WIQPA V DIYY+YF+GYED  K+  +   D    ++LPG+PPL + 
Sbjct  116  DVARSLQIKSVLVWIQPATVFDIYYHYFNGYEDVIKSVTSQRCDTTSLIRLPGVPPLTNR  175

Query  645  DLPSFLLPSGSGGDYSFAMPTFK  713
            ++PS L        Y+F +P  +
Sbjct  176  NIPSLLHVENK---YAFFLPEIQ  195



>emb|CDX68805.1| BnaC01g06480D [Brassica napus]
Length=433

 Score =   173 bits (439),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 91/208 (44%), Positives = 126/208 (61%), Gaps = 13/208 (6%)
 Frame = +3

Query  111  AMVQPHILLVTFPAQGHINPSLQFAKRL--VRLGIEVTFAT--SVYAHRLMSKANGGGVP  278
            ++  PH L VTFPAQGHINPSL+ AKRL     G+ VTFA   S Y   ++SK N   VP
Sbjct  10   SLTGPHFLFVTFPAQGHINPSLELAKRLAGTIAGVRVTFAATDSAYNRCMLSKEN---VP  66

Query  279  DGLNFTAFSDGYDEGFKKNH--HNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHT  452
            + L F  +S+ + +  K +        YMS  R RG  +L  ++ DN  Q RP T VV+T
Sbjct  67   ETLVFATYSEAHKDDIKSSTSTDRSREYMSATRRRGRETLTELIEDNRRQNRPFTCVVYT  126

Query  453  LLLPWVSEVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAAT-DPNCPVQLPGLP  629
            + LPWV+E+AR+ ++PSALLW+QP  V  I+Y+YF+GY DA    AT DP+  ++LP LP
Sbjct  127  IFLPWVAELAREFHIPSALLWVQPVTVFSIFYHYFNGYADAISEIATNDPSGSIKLPSLP  186

Query  630  PLFSGDLPSFLLPSGSGGDYSFAMPTFK  713
                 DLP+ +    +   YSF +P ++
Sbjct  187  QFRLRDLPTIIFRPDA---YSFLVPAYQ  211



>gb|KFK39474.1| hypothetical protein AALP_AA3G248900 [Arabis alpina]
Length=475

 Score =   174 bits (441),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 99/212 (47%), Positives = 137/212 (65%), Gaps = 17/212 (8%)
 Frame = +3

Query  111  AMVQPHILLVTFPAQGHINPSLQFAKRLVRL--GIEVTFATSV--YAHRLMSKANGGGVP  278
            ++  PH L VTFPAQGHINPSL+ AKRL     G  VTFA S+  Y  R+ S  N   VP
Sbjct  10   SLTGPHFLFVTFPAQGHINPSLELAKRLAGTIAGARVTFAASISAYNRRMFSTEN---VP  66

Query  279  DGLNFTAFSDGYDEGFKKN------HHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITA  440
            + L F  +SDG+D+GFKK+        +   +MSE+R RG  +L  ++ DN  Q RPIT 
Sbjct  67   ETLIFATYSDGHDDGFKKSSSDKTLKDDSGKFMSEMRRRGRETLTELIEDNRRQNRPITC  126

Query  441  VVHTLLLPWVSEVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAA-TDPNCPVQL  617
            VV+T+LL WV+E+AR+ +LPSALLW+QP  V  I+Y+YF+GYE+     A  +P+  ++L
Sbjct  127  VVYTILLTWVAELAREFHLPSALLWVQPITVFSIFYHYFNGYEEVITEMANNNPSGSIKL  186

Query  618  PGLPPLFSGDLPSFLLPSGSGGDYSFAMPTFK  713
            P LP L   +LPSF++P+     Y+F +P F+
Sbjct  187  PSLPLLRLRELPSFIVPNNH---YAFLLPAFQ  215



>gb|AFW80209.1| hypothetical protein ZEAMMB73_447013 [Zea mays]
Length=500

 Score =   174 bits (442),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 91/207 (44%), Positives = 131/207 (63%), Gaps = 9/207 (4%)
 Frame = +3

Query  120  QPHILLVTFPAQGHINPSLQFAKRLVR-LGIEVTFATSVYAHRLM---SKANGGGVPD--  281
            +PH+L+VTFPAQGHINP+   A+RL+R  G  VT +T+V A R M    +A   G  D  
Sbjct  21   EPHLLVVTFPAQGHINPARHLARRLLRATGARVTVSTAVSALRKMFPGEQAGAEGHRDAA  80

Query  282  GLNFTAFSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLL  461
            G+ +  +SDGYD+GF ++ H+  HYM +I+  G+++L  ++      GRP+T VV+TLLL
Sbjct  81   GVWYVPYSDGYDDGFDRDAHDATHYMEQIKLVGAATLGAVLDRLHGVGRPVTLVVYTLLL  140

Query  462  PWVSEVARDVNLPSALLWIQPAAVLDIYYYYFH---GYEDAFKNAATDPNCPVQLPGLPP  632
             WV++VAR  ++P+AL WIQPA VL +Y ++F    G + A   A  DP   V+ PGLPP
Sbjct  141  SWVADVARARSVPAALYWIQPATVLAVYLHFFRATDGVDRAIAAAGGDPWASVRFPGLPP  200

Query  633  LFSGDLPSFLLPSGSGGDYSFAMPTFK  713
            L   DLPSF++ +     Y+F    F+
Sbjct  201  LRVRDLPSFIVSTPENDPYAFVADAFR  227



>ref|XP_004504379.1| PREDICTED: UDP-glycosyltransferase 75D1-like [Cicer arietinum]
 gb|AGU14114.1| UDP-glycosyltransferase [Cicer arietinum]
Length=471

 Score =   174 bits (441),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 93/201 (46%), Positives = 130/201 (65%), Gaps = 13/201 (6%)
 Frame = +3

Query  126  HILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAH-RLMSKANGGGVPDGLNFTAF  302
            HILL+ +P QGHINP+ QFAKRL+ LG  VT +T+++ H R+  K     +P+ L++  F
Sbjct  6    HILLIPYPVQGHINPAFQFAKRLISLGAHVTLSTTLHMHNRITHKPT---LPN-LSYLPF  61

Query  303  SDGYDEGFKKNHHNV-AHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLPWVSEV  479
            SDGYD+GF+    +    Y SE + RGS  +  ++  N+ +G P T +V++LLLPW +E 
Sbjct  62   SDGYDDGFQSTGTDAYLLYTSEFKRRGSEFIANLILSNSQKGTPFTCLVYSLLLPWAAET  121

Query  480  ARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATDPNCPVQLPGLPPLFSGDLPSF  659
            AR  +LP+ALLW+QPA + DI Y+YFHGY ++ KN    P+  ++LPGLP L + DLPSF
Sbjct  122  ARGFHLPTALLWVQPATMFDILYHYFHGYSESIKN----PSVSIKLPGLPLLSARDLPSF  177

Query  660  LL---PSGSGGDYSFAMPTFK  713
            LL   PS      SF    FK
Sbjct  178  LLDTCPSSYALMLSFFEEQFK  198



>emb|CDY22742.1| BnaA08g05720D [Brassica napus]
Length=463

 Score =   174 bits (440),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 91/208 (44%), Positives = 126/208 (61%), Gaps = 13/208 (6%)
 Frame = +3

Query  111  AMVQPHILLVTFPAQGHINPSLQFAKRL--VRLGIEVTFAT--SVYAHRLMSKANGGGVP  278
            ++  PH L VTFPAQGHINPSL+ AKRL     G+ VTFA   S Y   ++SK N   VP
Sbjct  10   SLTGPHFLFVTFPAQGHINPSLELAKRLAGTITGVRVTFAATDSAYNRCMLSKEN---VP  66

Query  279  DGLNFTAFSDGYDEGFKKNH--HNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHT  452
            + L F  +S+ + +  K +        YMS  R RG  +L  ++ DN  Q RP T VV+T
Sbjct  67   ETLVFATYSEAHKDDIKSSTSTDRSREYMSATRRRGRETLTELIEDNRRQNRPFTCVVYT  126

Query  453  LLLPWVSEVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAAT-DPNCPVQLPGLP  629
            + LPWV+E+AR+ ++PSALLW+QP  V  I+Y+YF+GY DA    AT DP+  ++LP LP
Sbjct  127  IFLPWVAELAREFHIPSALLWVQPVTVFSIFYHYFNGYADAISEIATNDPSGSIKLPSLP  186

Query  630  PLFSGDLPSFLLPSGSGGDYSFAMPTFK  713
                 DLP+ +    +   YSF +P ++
Sbjct  187  QFRLRDLPTIIFRPDA---YSFLVPAYQ  211



>dbj|BAP90370.1| UDP-glycose: glycosyltransferase UGT75R1 [Fagopyrum esculentum]
Length=471

 Score =   173 bits (439),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 95/201 (47%), Positives = 123/201 (61%), Gaps = 9/201 (4%)
 Frame = +3

Query  123  PHILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANGGGVPDGLNFTAF  302
            PHILLV +P Q H+NP+LQFA   +  G  VT  T+V   + M K+ GG  P GL+F   
Sbjct  7    PHILLVAYPLQSHMNPALQFANYFLNSGAHVTLVTTVSGVKRMKKS-GGAAPTGLSFATI  65

Query  303  SDGYDEGFKK---NHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLPWVS  473
            SDGYD+GF     +   +  YM   + RGS +L  +++   A   P T VV+T+LLPWV+
Sbjct  66   SDGYDDGFTSAISDESALDGYMLNFKRRGSETLSDLIAAGTAVP-PYTCVVYTILLPWVA  124

Query  474  EVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNA-ATDPNCPVQLPGLPPLFSGDL  650
             VAR  NLPSALLW+Q AA+L IYY+YF+GY D        DP   + LP LPPL + DL
Sbjct  125  NVARRHNLPSALLWLQNAALLSIYYHYFNGYGDIIHQCDENDPQWCLNLPSLPPLHARDL  184

Query  651  PSFLLPSGSGGDYSFAMPTFK  713
            PSFL PS +   Y+FA  + K
Sbjct  185  PSFLTPSNT---YTFAEVSLK  202



>ref|XP_009107848.1| PREDICTED: UDP-glycosyltransferase 75D1-like [Brassica rapa]
Length=464

 Score =   173 bits (439),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 91/208 (44%), Positives = 126/208 (61%), Gaps = 13/208 (6%)
 Frame = +3

Query  111  AMVQPHILLVTFPAQGHINPSLQFAKRL--VRLGIEVTFAT--SVYAHRLMSKANGGGVP  278
            ++  PH L VTFPAQGHINPSL+ AKRL     G+ VTFA   S Y   ++SK N   VP
Sbjct  10   SLTGPHFLFVTFPAQGHINPSLELAKRLAGTITGVRVTFAATDSAYNRCMLSKEN---VP  66

Query  279  DGLNFTAFSDGYDEGFKKNH--HNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHT  452
            + L F  +S+ + +  K +        YMS  R RG  +L  ++ DN  Q RP T VV+T
Sbjct  67   ETLVFATYSEAHKDDIKSSTSTDRSREYMSATRRRGRETLTELIEDNRRQNRPFTCVVYT  126

Query  453  LLLPWVSEVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAAT-DPNCPVQLPGLP  629
            + LPWV+E+AR+ ++PSALLW+QP  V  I+Y+YF+GY DA    AT DP+  ++LP LP
Sbjct  127  IFLPWVAELAREFHIPSALLWVQPVTVFSIFYHYFNGYADAISEIATNDPSGSIKLPSLP  186

Query  630  PLFSGDLPSFLLPSGSGGDYSFAMPTFK  713
                 DLP+ +    +   YSF +P ++
Sbjct  187  QFRLRDLPTIIFRPDA---YSFLVPAYQ  211



>emb|CDY21979.1| BnaC09g00850D [Brassica napus]
 emb|CDX92022.1| BnaC03g33240D [Brassica napus]
Length=472

 Score =   173 bits (439),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 91/208 (44%), Positives = 126/208 (61%), Gaps = 13/208 (6%)
 Frame = +3

Query  111  AMVQPHILLVTFPAQGHINPSLQFAKRLVRL--GIEVTFAT--SVYAHRLMSKANGGGVP  278
            ++  PH L VTFPAQGHINPSL+ AKRL     G+ VTFA   S Y   ++SK N   VP
Sbjct  10   SLTGPHFLFVTFPAQGHINPSLELAKRLAGTIAGVRVTFAATDSAYNRCMLSKEN---VP  66

Query  279  DGLNFTAFSDGYDEGFKKNH--HNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHT  452
            + L F  +S+ + +  K +        YMS  R RG  +L  ++ DN  Q RP T VV+T
Sbjct  67   ETLVFATYSEAHKDDIKSSTSTDRSREYMSATRRRGRETLTELIEDNRRQNRPFTCVVYT  126

Query  453  LLLPWVSEVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAAT-DPNCPVQLPGLP  629
            + LPWV+E+AR+ ++PSALLW+QP  V  I+Y+YF+GY DA    AT DP+  ++LP LP
Sbjct  127  IFLPWVAELAREFHIPSALLWVQPVTVFSIFYHYFNGYADAISEIATNDPSGSIKLPSLP  186

Query  630  PLFSGDLPSFLLPSGSGGDYSFAMPTFK  713
                 DLP+ +    +   YSF +P ++
Sbjct  187  QFRLRDLPTIIFRPDA---YSFLVPAYQ  211



>ref|XP_008793436.1| PREDICTED: cyanidin 3-O-rutinoside 5-O-glucosyltransferase-like 
[Phoenix dactylifera]
Length=467

 Score =   172 bits (437),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 90/187 (48%), Positives = 121/187 (65%), Gaps = 5/187 (3%)
 Frame = +3

Query  117  VQPHILLVTFPAQGHINPSLQFAKRLVRL--GIEVTFATSVYAHRLM--SKANGGGVPDG  284
             Q H LL T+  QGHINP+L+ A +L R   G  VTF+TSV  HR M  S A+ G + DG
Sbjct  5    TQQHFLLATYAGQGHINPALRLATQLARTIPGARVTFSTSVSGHRRMFPSAASDGEISDG  64

Query  285  -LNFTAFSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLL  461
             L++  FSDG D+GFK      + +M++ +  GS +L  ++ D  A+GRP+T +++T+LL
Sbjct  65   RLSYLPFSDGCDDGFKGGIPGFSDFMAQSKLHGSRNLSNLLGDLTARGRPVTCLIYTILL  124

Query  462  PWVSEVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATDPNCPVQLPGLPPLFS  641
            PW ++VAR+  + S L WIQPA V  IYY+YFHGYED   +   DP   V+ PGLPPL  
Sbjct  125  PWAADVAREHGIRSFLHWIQPAFVFAIYYHYFHGYEDLVASNRGDPLFQVEFPGLPPLRI  184

Query  642  GDLPSFL  662
             DLPSFL
Sbjct  185  RDLPSFL  191



>ref|XP_008793440.1| PREDICTED: cyanidin 3-O-rutinoside 5-O-glucosyltransferase-like 
[Phoenix dactylifera]
 ref|XP_008793441.1| PREDICTED: cyanidin 3-O-rutinoside 5-O-glucosyltransferase-like 
[Phoenix dactylifera]
Length=474

 Score =   172 bits (437),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 90/186 (48%), Positives = 123/186 (66%), Gaps = 5/186 (3%)
 Frame = +3

Query  120  QPHILLVTFPAQGHINPSLQFAKRLVRL-GIEVTFATSVYAHRLM--SKAN-GGGVPDGL  287
            Q H LLVT+PAQGH+NP+L  AKRL R  G  VTF+T++  HR M  S A     V DGL
Sbjct  5    QQHFLLVTYPAQGHVNPALHLAKRLARTTGSRVTFSTAISGHRRMFPSLAKPDEEVEDGL  64

Query  288  -NFTAFSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLP  464
             ++  +SDGYD+G+K    +V  +MS+I+  GS ++  +V D AA+ RP++ +++TLL+ 
Sbjct  65   VSYIPYSDGYDDGYKATTDDVNTFMSKIKLAGSRTVSTLVQDLAARDRPVSCLIYTLLMA  124

Query  465  WVSEVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATDPNCPVQLPGLPPLFSG  644
            W ++VARD  +PSAL WIQ A V   YY+YFHGY++   + + DP   V LPGL PL   
Sbjct  125  WAADVARDHGVPSALYWIQTATVFATYYHYFHGYDELITSHSHDPAFTVNLPGLLPLQIR  184

Query  645  DLPSFL  662
            DLPSF 
Sbjct  185  DLPSFF  190



>ref|XP_009146925.1| PREDICTED: UDP-glycosyltransferase 75D1-like [Brassica rapa]
Length=477

 Score =   172 bits (437),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 97/213 (46%), Positives = 134/213 (63%), Gaps = 18/213 (8%)
 Frame = +3

Query  111  AMVQPHILLVTFPAQGHINPSLQFAKRL--VRLGIEVTFATSV--YAHRLMSKANGGGVP  278
            ++  PH L VT+PAQGHINPSL+ AKRL    +G  VTFA  V  Y  R++SK     V 
Sbjct  10   SLTGPHFLFVTYPAQGHINPSLELAKRLAGTFIGSRVTFAAPVAAYNRRMLSKET---VL  66

Query  279  DGLNFTAFSDGYDEGF-------KKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPIT  437
            + L F  +SDG+D+GF       K   H+   YMSE+R RG  +L  ++ DN  Q RP T
Sbjct  67   ENLTFATYSDGHDDGFRPSTSSDKSRQHSSGQYMSEMRKRGRETLTELIEDNRRQNRPFT  126

Query  438  AVVHTLLLPWVSEVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAA-TDPNCPVQ  614
             VV+T+LL WV+E+AR+  +PSALLW+QP  V  I+Y+YF+GY D     A  +P+  ++
Sbjct  127  CVVYTILLTWVAELAREFQIPSALLWVQPVTVFSIFYHYFNGYADTISEMADNNPSGSIK  186

Query  615  LPGLPPLFSGDLPSFLLPSGSGGDYSFAMPTFK  713
            LP LP L   DLPSF++P+ +   Y+F +P F+
Sbjct  187  LPSLPLLRLRDLPSFIVPTNA---YAFVLPAFR  216



>emb|CDX90584.1| BnaA03g41970D [Brassica napus]
Length=575

 Score =   174 bits (440),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 95/215 (44%), Positives = 132/215 (61%), Gaps = 20/215 (9%)
 Frame = +3

Query  111  AMVQPHILLVTFPAQGHINPSLQFAKRLVRL--GIEVTFAT--SVYAHRLMSKANGGGVP  278
            +++ PH L VTF A GHINPSL+ AKRL     G  VTFA   S Y   + SK N    P
Sbjct  11   SLIGPHFLFVTFGAHGHINPSLELAKRLAVTITGARVTFAAPISAYNRGMFSKENS---P  67

Query  279  DGLNFTAFSDGYDEGFK------KNHHNVA-HYMSEIRTRGSSSLKGIVSDNAAQGRPIT  437
            + L F  +SDG+D+G K      K+  + +  YMSE+R RG  +L  ++ DN  Q RP T
Sbjct  68   ETLIFATYSDGHDDGIKSSTSSDKSRQDASGQYMSEMRRRGIETLTELIEDNRRQNRPFT  127

Query  438  AVVHTL-LLPWVSEVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAA--TDPNCP  608
             VV+T+ LL WV+E+AR+ ++PSALLWIQP  +  I+Y+YF+GY DA        +P+  
Sbjct  128  CVVYTMILLTWVAELAREFHIPSALLWIQPVTIFSIFYHYFNGYADAISEMVINNNPSGS  187

Query  609  VQLPGLPPLFSGDLPSFLLPSGSGGDYSFAMPTFK  713
            ++LP LP     DLP+FL+P+ +   YSF +P F+
Sbjct  188  IKLPSLPLFRLRDLPTFLVPTNA---YSFLLPAFR  219



>ref|XP_010069411.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Eucalyptus 
grandis]
Length=456

 Score =   172 bits (435),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 86/203 (42%), Positives = 127/203 (63%), Gaps = 11/203 (5%)
 Frame = +3

Query  114  MVQPHILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANGGGVPDGLNF  293
            M  PH LLV    +  +NP+LQ A+RL R+G  VTF ++V AHR M        P+G+ F
Sbjct  1    MAPPHFLLVALSTRSAMNPALQLAERLARVGSRVTFLSTVCAHRCMIDPV---CPEGVTF  57

Query  294  TAFSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLPWVS  473
            T FSDGYD+G+     ++  Y +E++ RGS +L+ ++  ++ QG   T V+HT++ PWV 
Sbjct  58   TTFSDGYDDGYVPGD-DLERYRAEMKRRGSEALRDLIEHSSGQGLSFTCVLHTIV-PWVH  115

Query  474  EVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAAT---DPNCPVQLPGLPPLFSG  644
            +VAR + + S L+WIQPA V DIYY+YF GYED  K+  +   D    ++LPG+PPL + 
Sbjct  116  DVARSLQIKSVLVWIQPATVFDIYYHYFSGYEDVIKSVTSQRCDTTSLIRLPGVPPLTNR  175

Query  645  DLPSFLLPSGSGGDYSFAMPTFK  713
            ++PSFL        Y+FA+P  +
Sbjct  176  NIPSFLHVENK---YAFALPEIQ  195



>ref|XP_009403483.1| PREDICTED: cyanidin 3-O-rutinoside 5-O-glucosyltransferase-like 
[Musa acuminata subsp. malaccensis]
Length=473

 Score =   172 bits (435),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 84/185 (45%), Positives = 119/185 (64%), Gaps = 3/185 (2%)
 Frame = +3

Query  117  VQPHILLVTFPAQGHINPSLQFAKRLVRL-GIEVTFATSVYAHRLMSKANGGG-VPDGL-  287
            ++PH L+VT+ AQGH+NP+LQ  +RL R+ G  VTF+TS+  HR M  ++    V DG+ 
Sbjct  1    MEPHFLVVTYAAQGHVNPALQLCRRLARVAGARVTFSTSISGHRRMFPSSADQEVDDGVV  60

Query  288  NFTAFSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLPW  467
             +  +SDG+D GF +   +   +   +++ G+ +L  IV     +GRP+T ++ TLLLPW
Sbjct  61   CYVPYSDGFDGGFDRETGDRDEFRLRVKSVGTRTLAAIVRSLQERGRPVTCIIQTLLLPW  120

Query  468  VSEVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATDPNCPVQLPGLPPLFSGD  647
            V +VARD  +PSA  WIQPA V  +YY+YFHGY+    +   DP   V LPGLPP+   D
Sbjct  121  VVDVARDHGIPSAHYWIQPATVFAMYYHYFHGYDGLIASHGHDPQFEVSLPGLPPVKICD  180

Query  648  LPSFL  662
            LPSFL
Sbjct  181  LPSFL  185



>dbj|BAD90935.1| monoterpene glucosyltransferase [Eucalyptus perriniana]
Length=467

 Score =   171 bits (433),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 86/195 (44%), Positives = 123/195 (63%), Gaps = 8/195 (4%)
 Frame = +3

Query  132  LLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANGGGVPDGLNFTAFSDG  311
            L+V FPAQG INP+LQFAKRL+  G  VTFAT+  A+R M+K++    P GL+F +FSDG
Sbjct  7    LVVAFPAQGLINPALQFAKRLLHAGAHVTFATAASAYRRMAKSD---PPQGLSFASFSDG  63

Query  312  YDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLPWVSEVARDV  491
             +EG +    +   YM++    GS +L+ +V  +  +GR    + +T ++PW  +VA  +
Sbjct  64   SEEGLRPGI-DFEQYMADAERLGSETLRDLVVTSLNEGRKFECMFYTTIVPWAGQVAHSL  122

Query  492  NLPSALLWIQPAAVLDIYYYYFHGYEDAFKN-AATDPNCPVQLPGLPPLFSGDLPSFLLP  668
             +PS L+W QPA +LDIYYYYF+GY D  +N    DP+  + LPGLPPL S D+PSF  P
Sbjct  123  QIPSTLIWAQPATLLDIYYYYFNGYGDIIRNLGKDDPSASLHLPGLPPLTSRDVPSFFTP  182

Query  669  SGSGGDYSFAMPTFK  713
                  Y+F +   +
Sbjct  183  ENQ---YAFTLSLMR  194



>ref|XP_010925530.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Elaeis 
guineensis]
Length=322

 Score =   167 bits (424),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 92/196 (47%), Positives = 126/196 (64%), Gaps = 6/196 (3%)
 Frame = +3

Query  120  QPHILLVTFPAQGHINPSLQFAKRLVRL-GIEVTFATSVYAHRLM--SKAN-GGGVPDGL  287
            Q H L+VT+PAQGH+NPSL+ AKRL +  G  VTF+T++ AHR M  S A     V DGL
Sbjct  5    QQHFLVVTYPAQGHVNPSLRLAKRLAQTTGGHVTFSTAISAHRHMFPSLAKPDEEVEDGL  64

Query  288  -NFTAFSDGYDEGFKKNHH-NVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLL  461
              +  FS+GYD+GFK +   ++  ++S+ +  G+ +L GIV D AA+ RP++ ++ T+LL
Sbjct  65   LTYIPFSNGYDDGFKVDTDGDLDDFLSQFKLVGTRTLAGIVHDLAARDRPVSCIICTILL  124

Query  462  PWVSEVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATDPNCPVQLPGLPPLFS  641
             W + VARD  +P AL WIQPA V   +Y+YFHGYE+   +   DP   V LPGLPPL  
Sbjct  125  SWAAGVARDHGIPCALYWIQPATVFTTFYHYFHGYEELITSHGHDPLFTVDLPGLPPLQI  184

Query  642  GDLPSFLLPSGSGGDY  689
             DLPS +  + S   Y
Sbjct  185  RDLPSLISSTNSDDPY  200



>emb|CDY22902.1| BnaA01g18400D [Brassica napus]
Length=462

 Score =   171 bits (432),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 96/213 (45%), Positives = 134/213 (63%), Gaps = 18/213 (8%)
 Frame = +3

Query  111  AMVQPHILLVTFPAQGHINPSLQFAKRL--VRLGIEVTFATSV--YAHRLMSKANGGGVP  278
            ++  PH L VT+PAQGHINPSL+ AKRL    +G  VTFA  V  Y  R++SK     V 
Sbjct  10   SLTGPHFLFVTYPAQGHINPSLELAKRLAGTFIGSRVTFAAPVAAYNRRMLSKET---VL  66

Query  279  DGLNFTAFSDGYDEGF-------KKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPIT  437
            + L F  +SDG+D+GF       K   H+   Y+SE+R RG  +L  ++ DN  Q RP T
Sbjct  67   ENLTFATYSDGHDDGFRPSTSSDKSRQHSSRQYLSEMRQRGRETLTELIEDNRRQNRPFT  126

Query  438  AVVHTLLLPWVSEVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAA-TDPNCPVQ  614
             VV+T+LL WV+E+AR+  +PSALLW+QP  V  I+Y+YF+GY D     A  +P+  ++
Sbjct  127  CVVYTILLTWVAELAREFQIPSALLWVQPVTVFSIFYHYFNGYADTISEMADNNPSGTIK  186

Query  615  LPGLPPLFSGDLPSFLLPSGSGGDYSFAMPTFK  713
            LP LP L   DLPSF++P+ +   Y+F +P F+
Sbjct  187  LPSLPLLRLRDLPSFIVPTNA---YAFVLPAFR  216



>dbj|BAC54093.1| anthocyanin 5-glucosyltransferase [Torenia hybrid cultivar]
Length=478

 Score =   171 bits (433),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 97/192 (51%), Positives = 125/192 (65%), Gaps = 15/192 (8%)
 Frame = +3

Query  120  QPHILLVTFPAQGHINPSLQFAKRLVRLGI--EVTFATSVYAHRLMSKANGGGVPDGLNF  293
            + HILL TFPAQGHINPSL+FAKRL+  G   +VTF TSVYA R M           ++F
Sbjct  4    KRHILLATFPAQGHINPSLEFAKRLLNTGYVDQVTFFTSVYALRRMRFETDPS--SRIDF  61

Query  294  TAFSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKG--IVSDNAAQGRP----ITAVVHTL  455
             A  D YD+G KK      +YMSE+R RG+ +LK   I  ++AA G      ++ VV++ 
Sbjct  62   VAXXDSYDDGLKKGDDG-KNYMSEMRKRGTKALKDTLIKLNDAAMGSECYNRVSFVVYSH  120

Query  456  LLPWVSEVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATDPNCPVQLPGLPPL  635
            L  W +EVAR+V++PSALLWI+PA V D+YY+YF+GY D   +A +D    +QLP LP L
Sbjct  121  LFSWAAEVAREVDVPSALLWIEPATVFDVYYFYFNGYADDI-DAGSD---QIQLPNLPQL  176

Query  636  FSGDLPSFLLPS  671
               DLPSFLLPS
Sbjct  177  SKQDLPSFLLPS  188



>emb|CDY65144.1| BnaC01g41850D [Brassica napus]
Length=462

 Score =   171 bits (432),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 97/213 (46%), Positives = 134/213 (63%), Gaps = 18/213 (8%)
 Frame = +3

Query  111  AMVQPHILLVTFPAQGHINPSLQFAKRL--VRLGIEVTFATSV--YAHRLMSKANGGGVP  278
            ++  PH L VT+PAQGHINPSL+ AKRL    +G  VTFA  V  Y  R++SK N   V 
Sbjct  10   SLTGPHFLFVTYPAQGHINPSLELAKRLAGTFIGARVTFAAPVAAYNRRMLSKEN---VL  66

Query  279  DGLNFTAFSDGYDEGF-------KKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPIT  437
              L F  +SDG+D+GF       K    +   Y+SE+R RG  +L  ++ DN  Q RP T
Sbjct  67   QNLTFATYSDGHDDGFRPSTSSDKSRQQSSRQYLSEMRRRGRETLTELIEDNRRQNRPFT  126

Query  438  AVVHTLLLPWVSEVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAA-TDPNCPVQ  614
             VV+T+LL WV+E+AR+  +PSALLW+QP  V  I+Y+YF+GY DA    A  +P+  ++
Sbjct  127  CVVYTILLTWVAELAREFQIPSALLWVQPVTVFSIFYHYFNGYADAISEMADNNPSGIIK  186

Query  615  LPGLPPLFSGDLPSFLLPSGSGGDYSFAMPTFK  713
            LP LP L   DLPSF++P+ +   Y+F +P F+
Sbjct  187  LPSLPLLRLRDLPSFIVPTNA---YAFVLPAFR  216



>ref|XP_009622554.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Nicotiana 
tomentosiformis]
Length=467

 Score =   171 bits (432),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 94/197 (48%), Positives = 125/197 (63%), Gaps = 17/197 (9%)
 Frame = +3

Query  126  HILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANGGGVPDGLNFTAFS  305
            H+LLVTFP+QG INPSLQFAKRL++LG+ VTF+TS+ A   +S  N     +GL    FS
Sbjct  9    HVLLVTFPSQGQINPSLQFAKRLIKLGVNVTFSTSLSALNCIS--NNLPSVEGLTLAPFS  66

Query  306  DGYDEGFKKNHHNVAHYMSEIR-------TRGSSSLKGIVSDNAAQGRPITAVVHTLLLP  464
            DGYD G+     NV   + E R         GS  +  I +D A +GRP + +++T +L 
Sbjct  67   DGYDNGYP----NVGKSLDEYREFYASFIALGSEFVSEIFTDRAKEGRPFSRIIYTAVLS  122

Query  465  WVSEVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATDPNCPVQLPGLPPLFSG  644
            WV  VAR +N P+ LLWIQPA +LDIYYYYF  Y++AFKN   D +  +++PGL P F G
Sbjct  123  WVGIVARRLNAPATLLWIQPATLLDIYYYYFTSYKEAFKNCP-DEDKSLEIPGL-PFFVG  180

Query  645  --DLPSFLLPSGSGGDY  689
              ++PSFLL S    D+
Sbjct  181  TREIPSFLLSSNGLMDW  197



>gb|AFJ52963.1| UDP-glycosyltransferase 1 [Linum usitatissimum]
Length=509

 Score =   171 bits (434),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 85/186 (46%), Positives = 122/186 (66%), Gaps = 5/186 (3%)
 Frame = +3

Query  123  PHILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANGGGVPDGLNFTAF  302
            PHI++VTF A GH+NP+L F++RL+ LG  VT  T++  H L++      +PDGL+   F
Sbjct  12   PHIVVVTFAAHGHLNPTLHFSERLLLLGSRVTLVTTISGHSLLTNKKRS-LPDGLSIATF  70

Query  303  SDGYD--EGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLPWVSE  476
            SDGYD     KK+  + +    ++ TRG+  L   ++ N+ +  P+  +V+TLLL WV++
Sbjct  71   SDGYDIPGSHKKSKDDQSKQWVQMSTRGAEFLNEFIATNSKEETPVCCLVYTLLLTWVAD  130

Query  477  VARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATDPNCPVQLPGLPPLFSGD-LP  653
            VARD  LPS LLWIQPA V DIYYY  +G+E+AF+    DP+  ++LPG+P  F+ D LP
Sbjct  131  VARDNTLPSVLLWIQPATVFDIYYYLTNGFEEAFEKCK-DPSFELELPGIPVSFTNDELP  189

Query  654  SFLLPS  671
            SF  PS
Sbjct  190  SFASPS  195



>ref|XP_010522273.1| PREDICTED: UDP-glycosyltransferase 75B2-like [Tarenaya hassleriana]
Length=548

 Score =   172 bits (435),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 95/204 (47%), Positives = 123/204 (60%), Gaps = 10/204 (5%)
 Frame = +3

Query  114  MVQPHILLVTFPAQGHINPSLQFAKRLVRL-GIEVTFATSVYAHRLMSKANGGGVPDGLN  290
            M QPHIL+VTFPA+GHINPSL F+ RL+R  G  VTFAT V A R           D L+
Sbjct  60   MPQPHILIVTFPARGHINPSLHFSGRLIRTTGARVTFATCVSAFRRSMIPPAAA--DSLS  117

Query  291  FTAFSDGYDEGF---KKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLL  461
            F +FSDG+D+G      + ++   +M  IR  G+ +L   +  N     P+T +V+TLLL
Sbjct  118  FLSFSDGFDDGHVSSTSSDYDHDQWMDRIRVDGTKTLSDFIESNRRGESPVTCLVYTLLL  177

Query  462  PWVSEVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATDPNCPVQLPGLPPLFS  641
             W   VAR  ++PS+LLWIQPA V DIYYYYF+GY +    A    + PV+LP LP L +
Sbjct  178  TWAPAVARRFHIPSSLLWIQPALVFDIYYYYFNGYAEVVSKALARSD-PVELPKLPLLAA  236

Query  642  GDLPSFLLPSGSGGDYSFAMPTFK  713
             DLPSFL PS     Y +A   F+
Sbjct  237  RDLPSFLTPSNM---YKYACAAFQ  257



>emb|CDY09069.1| BnaC08g10230D [Brassica napus]
Length=472

 Score =   170 bits (431),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 89/208 (43%), Positives = 125/208 (60%), Gaps = 13/208 (6%)
 Frame = +3

Query  111  AMVQPHILLVTFPAQGHINPSLQFAKRLVRL--GIEVTFAT--SVYAHRLMSKANGGGVP  278
            ++  PH L VTFPAQGHINPSL+ AKRL     G+ VTFA   S Y   ++SK N   VP
Sbjct  10   SLTGPHFLFVTFPAQGHINPSLELAKRLAGTIAGVRVTFAATDSAYNRCMLSKEN---VP  66

Query  279  DGLNFTAFSDGYDEGFKKNH--HNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHT  452
            + L F  +S+ + +  K +        YMS  R RG  +L  ++ DN  Q RP T VV+T
Sbjct  67   ETLVFATYSEAHKDDIKSSTSTDRSREYMSATRRRGRETLTELIEDNRRQNRPFTCVVYT  126

Query  453  LLLPWVSEVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAA-TDPNCPVQLPGLP  629
            + LPWV+E+AR+ ++PSA+LW+QP  V  I+Y+YF+GY DA    A  DP+  ++LP LP
Sbjct  127  IFLPWVAELAREFHIPSAILWVQPVTVFSIFYHYFNGYADAISEMANNDPSGSIKLPSLP  186

Query  630  PLFSGDLPSFLLPSGSGGDYSFAMPTFK  713
                 DLP+ +    +   YSF +P ++
Sbjct  187  QFRLRDLPTIIFRPDA---YSFLVPAYQ  211



>ref|XP_008793438.1| PREDICTED: cyanidin 3-O-rutinoside 5-O-glucosyltransferase-like 
[Phoenix dactylifera]
Length=468

 Score =   169 bits (429),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 89/187 (48%), Positives = 118/187 (63%), Gaps = 5/187 (3%)
 Frame = +3

Query  117  VQPHILLVTFPAQGHINPSLQFAKRLVRL--GIEVTFATSVYAHRLM--SKANGGGVPDG  284
             Q H LL T+  QGHINP+L+ A +L R   G  VTF+T+V  HR M  S A+ G V DG
Sbjct  5    TQQHFLLATYAGQGHINPALRLATQLARTIPGARVTFSTTVSGHRRMFPSAASDGEVSDG  64

Query  285  -LNFTAFSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLL  461
             L++  FSDGYD+GFK     +   M++ +  GS +L  ++ D  A GRP+T +++T+LL
Sbjct  65   RLSYLPFSDGYDDGFKGGTTGLNDCMAQSKLHGSRNLSNLLGDLTASGRPVTCLIYTILL  124

Query  462  PWVSEVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATDPNCPVQLPGLPPLFS  641
            PW ++VAR+  + S L WIQPA V  IYY+YFHGYE    +   DP   V+ PGLPPL  
Sbjct  125  PWAADVAREHGIRSFLHWIQPAIVFAIYYHYFHGYEGLVASNRGDPLFEVEFPGLPPLRI  184

Query  642  GDLPSFL  662
             DLPS L
Sbjct  185  RDLPSLL  191



>ref|XP_010039944.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Eucalyptus 
grandis]
 gb|KCW45603.1| hypothetical protein EUGRSUZ_L00635 [Eucalyptus grandis]
Length=467

 Score =   169 bits (429),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 85/195 (44%), Positives = 126/195 (65%), Gaps = 8/195 (4%)
 Frame = +3

Query  132  LLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANGGGVPDGLNFTAFSDG  311
            L+V FPAQG INP+LQ AKRL+  G  VTFAT+  A+  M+K++    P+GL+F +FSDG
Sbjct  7    LVVAFPAQGLINPALQLAKRLLHTGAHVTFATAGSAYHRMAKSDP---PEGLSFASFSDG  63

Query  312  YDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLPWVSEVARDV  491
             +EG +    ++  YM++I   GS +L+ +V  +  +G     + +T ++PWV++VA  +
Sbjct  64   SEEGLRPGI-DLEQYMADIVRLGSETLRDLVVTSLNEGCKFACIFYTTIIPWVAQVAHSL  122

Query  492  NLPSALLWIQPAAVLDIYYYYFHGYEDAFKN-AATDPNCPVQLPGLPPLFSGDLPSFLLP  668
             +PS L+W+QPA +LDIYYYYF  Y D  +N    DP+  + LPGLPPL S D+PSF  P
Sbjct  123  QIPSTLVWVQPATLLDIYYYYFDSYGDIIRNLGKDDPSASLHLPGLPPLTSRDVPSFFTP  182

Query  669  SGSGGDYSFAMPTFK  713
                  Y+F++P  +
Sbjct  183  ENQ---YAFSLPLMR  194



>ref|XP_010925318.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Elaeis 
guineensis]
Length=474

 Score =   169 bits (429),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 92/196 (47%), Positives = 127/196 (65%), Gaps = 6/196 (3%)
 Frame = +3

Query  120  QPHILLVTFPAQGHINPSLQFAKRLVRL-GIEVTFATSVYAHRLM--SKAN-GGGVPDGL  287
            Q H L+VT+PAQGH+NPSL+ AKRL +  G  VTF+T++ AHRLM  S A     V DGL
Sbjct  5    QQHFLVVTYPAQGHVNPSLRLAKRLAQTTGGHVTFSTAISAHRLMFPSLAKPDEEVEDGL  64

Query  288  -NFTAFSDGYDEGFKKNHH-NVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLL  461
              +  FS+GYD+GFK +   ++  ++ + +  G+ +L GIV D AA+GRP++ +++T+ L
Sbjct  65   LTYIPFSNGYDDGFKVDTDGDLDDFLYQFKLVGTRTLDGIVHDLAARGRPVSCIIYTIFL  124

Query  462  PWVSEVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATDPNCPVQLPGLPPLFS  641
             W ++VARD  +PSAL WIQPA V   YY+YFHGYE+   +   DP   V L GLP L  
Sbjct  125  SWAADVARDHGIPSALYWIQPATVFTTYYHYFHGYEELITSHGHDPFFTVDLSGLPHLQI  184

Query  642  GDLPSFLLPSGSGGDY  689
             DLPS +  + S   Y
Sbjct  185  RDLPSLITSTNSDDPY  200



>ref|XP_006414486.1| hypothetical protein EUTSA_v10027441mg [Eutrema salsugineum]
 gb|ESQ55939.1| hypothetical protein EUTSA_v10027441mg [Eutrema salsugineum]
Length=478

 Score =   169 bits (429),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 97/209 (46%), Positives = 135/209 (65%), Gaps = 18/209 (9%)
 Frame = +3

Query  123  PHILLVTFPAQGHINPSLQFAKRL--VRLGIEVTFAT--SVYAHRLMSKANGGGVPDGLN  290
            PH L VTFP QGHINPSL+ AKRL     G  VTFA   S Y  R+ SK N   VP+ L 
Sbjct  15   PHFLFVTFPVQGHINPSLELAKRLAGTITGARVTFAAPISAYNRRMFSKEN---VPETLI  71

Query  291  FTAFSDGYDEGFKKN-------HHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVH  449
            F+ +SDG+D+G+K +         +   YMS+IR RG  +L  ++ DN +Q RP T VV+
Sbjct  72   FSTYSDGHDDGYKSSTASDKSRRDSAGQYMSDIRRRGKKTLTELIEDNRSQNRPFTCVVY  131

Query  450  TLLLPWVSEVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAA-TDPNCPVQLPGL  626
            TLLL WV+E+AR+ ++PSALLW+QP  V  I+Y+YF+GYE+A    A  +P+  ++LP L
Sbjct  132  TLLLTWVAELAREFHIPSALLWVQPITVFSIFYHYFNGYEEAISEMANNNPSGYIKLPSL  191

Query  627  PPLFSGDLPSFLLPSGSGGDYSFAMPTFK  713
            P L   DLP+F++P+ +   Y+F +  F+
Sbjct  192  PLLRLRDLPTFIVPTNA---YAFILAAFR  217



>ref|XP_009108098.1| PREDICTED: UDP-glycosyltransferase 75C1 [Brassica rapa]
Length=454

 Score =   169 bits (428),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 87/187 (47%), Positives = 122/187 (65%), Gaps = 12/187 (6%)
 Frame = +3

Query  120  QPHILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANGGGVPDGLNFTA  299
            +PH L+VTFPAQGHINP+L+ A RL+  G  +T+AT++ A R M +       +GL++  
Sbjct  11   RPHYLIVTFPAQGHINPALKLANRLIHHGATITYATTISALRRMGEPPS---TEGLSYAW  67

Query  300  FSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVS---DNAAQGRPITAVVHTLLLPWV  470
            FSDG+DEG  K+  +  +YMSE + RGS +L  ++    D  A   PIT V++++L+PW 
Sbjct  68   FSDGFDEG-PKSFEDQKNYMSEFKRRGSDALSDLIRANLDGNAAKHPITGVIYSVLVPWA  126

Query  471  SEVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATDPNCPVQLPGLPPLFSGDL  650
            S VAR+ +LP+ LLWI+PA VLDIYYYYF+       +       P++LP LPP  + DL
Sbjct  127  STVAREFHLPTTLLWIEPATVLDIYYYYFNASHSHLFDKE-----PIKLPKLPPFSTRDL  181

Query  651  PSFLLPS  671
            PSFL PS
Sbjct  182  PSFLQPS  188



>ref|XP_010450109.1| PREDICTED: UDP-glycosyltransferase 75C1 [Camelina sativa]
Length=454

 Score =   169 bits (427),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 92/185 (50%), Positives = 123/185 (66%), Gaps = 12/185 (6%)
 Frame = +3

Query  123  PHILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANGGGVPDGLNFTAF  302
            PH LLVTFPAQGHINP+LQ A RL+  G  VT++T++ AHR M +        GL+F  F
Sbjct  12   PHYLLVTFPAQGHINPALQLANRLIHHGATVTYSTAISAHRRMGEPPST---KGLSFAWF  68

Query  303  SDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNA-AQGRPITAVVHTLLLPWVSEV  479
            +DG+D+G K +      YMSE++  GS+ L  I+  N  A   PIT V++++L+PW + V
Sbjct  69   TDGFDDGVKSSKDQKI-YMSELKRCGSNGLSDIIRVNLDANTEPITGVIYSVLVPWAATV  127

Query  480  ARDVNLPSALLWIQPAAVLDIYYYYFH-GYEDAFKNAATDPNCPVQLPGLPPLFSGDLPS  656
            AR  +LP+ LLWI+PA VLDIYYYYF+  Y+  F    TD   P++LP LP + +GDLPS
Sbjct  128  ARKFHLPTTLLWIEPATVLDIYYYYFNTSYKHLFD---TD---PIKLPKLPLITTGDLPS  181

Query  657  FLLPS  671
            FL PS
Sbjct  182  FLQPS  186



>emb|CDY27124.1| BnaA08g07620D [Brassica napus]
Length=454

 Score =   169 bits (427),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 87/187 (47%), Positives = 122/187 (65%), Gaps = 12/187 (6%)
 Frame = +3

Query  120  QPHILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANGGGVPDGLNFTA  299
            +PH L+VTFPAQGHINP+L+ A RL+  G  +T+AT++ A R M +       +GL++  
Sbjct  11   RPHYLIVTFPAQGHINPALKLANRLIHHGATITYATTISALRRMGEPPS---TEGLSYAW  67

Query  300  FSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVS---DNAAQGRPITAVVHTLLLPWV  470
            FSDG+DEG  K+  +  +YMSE + RGS +L  ++    D  A   PIT V++++L+PW 
Sbjct  68   FSDGFDEG-PKSFEDQKNYMSEFKRRGSDALSDLIRANLDGNAAKHPITGVIYSVLVPWA  126

Query  471  SEVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATDPNCPVQLPGLPPLFSGDL  650
            S VAR+ +LP+ LLWI+PA VLDIYYYYF+       +       P++LP LPP  + DL
Sbjct  127  STVAREFHLPATLLWIEPATVLDIYYYYFNASHSHLFDKE-----PIKLPKLPPFSTRDL  181

Query  651  PSFLLPS  671
            PSFL PS
Sbjct  182  PSFLQPS  188



>ref|XP_010435193.1| PREDICTED: UDP-glycosyltransferase 75C1-like [Camelina sativa]
Length=454

 Score =   169 bits (427),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 91/186 (49%), Positives = 123/186 (66%), Gaps = 12/186 (6%)
 Frame = +3

Query  120  QPHILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANGGGVPDGLNFTA  299
             PH LLVTFPAQGHINP+LQ A RL+  G  VT++T++ AHR M +        GL+F  
Sbjct  11   HPHYLLVTFPAQGHINPALQLANRLIHHGATVTYSTAISAHRRMGEPPS---TKGLSFAW  67

Query  300  FSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNA-AQGRPITAVVHTLLLPWVSE  476
            F+DG+D+G K +      YMSE++  GS+ L  I+  N  A   PIT V++++L+PW + 
Sbjct  68   FTDGFDDGVKSSKDQKI-YMSELKRFGSNGLSDIIRANLDASTEPITGVIYSVLVPWAAT  126

Query  477  VARDVNLPSALLWIQPAAVLDIYYYYFH-GYEDAFKNAATDPNCPVQLPGLPPLFSGDLP  653
            VAR  +LP+ LLW++PA VLDIYYYYF+  Y+  F    TD   P++LP LP + +GDLP
Sbjct  127  VARKFHLPTTLLWVEPATVLDIYYYYFNTSYKHLFD---TD---PIKLPKLPLITTGDLP  180

Query  654  SFLLPS  671
            SFL PS
Sbjct  181  SFLQPS  186



>ref|XP_009590508.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Nicotiana 
tomentosiformis]
Length=463

 Score =   169 bits (427),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 85/182 (47%), Positives = 115/182 (63%), Gaps = 9/182 (5%)
 Frame = +3

Query  126  HILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANGGGVP--DGLNFTA  299
            H+LLVTFP QG+INP +QF+KRLV+LG+ VTF+TS+ A   ++      +P  +GL F  
Sbjct  9    HVLLVTFPGQGNINPCIQFSKRLVKLGVNVTFSTSLTAFNRIT-----NLPTIEGLTFAP  63

Query  300  FSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLPWVSEV  479
            FSDG+D  FK + +N   +    RT GS  +  +V     QG P   +++T L  WV  +
Sbjct  64   FSDGFDGNFKGSTNNFHEFNKSFRTNGSEFVTDLVKTRKNQGNPFKRIIYTTLTGWVGLL  123

Query  480  ARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATDPNCPVQLPGLPPLFSGDLPSF  659
            A+ +N+PS  LWIQPA VLDIYYY+F+GYED  KN   D    ++L GLP L   DLPSF
Sbjct  124  AKSINVPSTFLWIQPATVLDIYYYFFNGYEDTIKNCPKDK--FLELHGLPLLSPRDLPSF  181

Query  660  LL  665
            + 
Sbjct  182  VF  183



>ref|XP_010450127.1| PREDICTED: UDP-glycosyltransferase 75C1-like [Camelina sativa]
Length=454

 Score =   168 bits (426),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 91/185 (49%), Positives = 123/185 (66%), Gaps = 12/185 (6%)
 Frame = +3

Query  123  PHILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANGGGVPDGLNFTAF  302
            PH LLVTFPAQGHINP+LQ A RL+  G  VT++T++ AHR M +        GL+F  F
Sbjct  12   PHYLLVTFPAQGHINPALQLANRLIHHGATVTYSTAISAHRRMREPPS---TKGLSFAWF  68

Query  303  SDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNA-AQGRPITAVVHTLLLPWVSEV  479
            +DG+D+G K +      YMSE++  GS+ L  I+  N  A   PIT V++++ +PW + V
Sbjct  69   TDGFDDGVKSSKDQKI-YMSELKRCGSNGLSDIIRANLDANLEPITGVIYSVFVPWAATV  127

Query  480  ARDVNLPSALLWIQPAAVLDIYYYYFH-GYEDAFKNAATDPNCPVQLPGLPPLFSGDLPS  656
            AR+ +LP+ LLWI+PA VLDIYYYYF+  Y+  F    TD   P++LP LP + +GDLPS
Sbjct  128  AREFHLPTTLLWIEPATVLDIYYYYFNTSYKHLFD---TD---PIKLPKLPLITTGDLPS  181

Query  657  FLLPS  671
            FL PS
Sbjct  182  FLQPS  186



>gb|ACM66950.1| flavonoid glucosyltransferase [Crocus sativus]
Length=497

 Score =   169 bits (428),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 84/187 (45%), Positives = 120/187 (64%), Gaps = 6/187 (3%)
 Frame = +3

Query  120  QPHILLVTFPAQGHINPSLQFAKRLV--RLGIEVTFATSVYAHRLM---SKANGGGVPDG  284
            QP+IL+VT+PAQGHINP+L  AK L     G+ +TF+T++ AHR M   S      V DG
Sbjct  5    QPNILVVTYPAQGHINPALHLAKHLAADTKGLLITFSTAISAHRKMFPESTEPDQEVEDG  64

Query  285  -LNFTAFSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLL  461
             + +  FSDGYD+GF+++ H+   + S  +T GS++L  I+ +   +GR ++ V++T  +
Sbjct  65   PITYIPFSDGYDDGFQRDKHDGKQFRSRFKTVGSNTLSAIIQNLEHRGRKVSCVIYTFFV  124

Query  462  PWVSEVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATDPNCPVQLPGLPPLFS  641
             W ++VAR   +PS   WIQPA V  IYY+YFHGYE      + DP+ P+ LPGL P+  
Sbjct  125  SWAADVARQHAIPSVQYWIQPATVFAIYYHYFHGYESVVAAHSHDPSYPINLPGLSPVQV  184

Query  642  GDLPSFL  662
             DLPSFL
Sbjct  185  RDLPSFL  191



>ref|XP_009612652.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Nicotiana 
tomentosiformis]
Length=481

 Score =   169 bits (427),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 89/197 (45%), Positives = 119/197 (60%), Gaps = 20/197 (10%)
 Frame = +3

Query  120  QPHILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANGGGVPDGLNFTA  299
            + H+LLVTFP QGHINPSLQF+KRLV LG++VTF+TS+ A    ++ N     +GL F  
Sbjct  7    ECHVLLVTFPGQGHINPSLQFSKRLVNLGVKVTFSTSLTA---FNRINNLPTIEGLTFAP  63

Query  300  FSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLPWVSEV  479
            FSDGYD  FK +   +  + S + + GS  +  +V+   A+GRP T +++T L+ WV  V
Sbjct  64   FSDGYDGKFKGSVDELHSFYSSLISHGSEFVTRLVTFRTAEGRPFTRIIYTTLMAWVGLV  123

Query  480  ARDVNLPSALLWIQPAAVLDIYYYYFHGYE---------------DAFKNAATDPNCPVQ  614
            A+++N+PS L WIQPA V DIYYY F  Y                D FKN + D    V+
Sbjct  124  AKNINVPSTLFWIQPATVFDIYYYCFTDYNNNIPSIFLQVGSNYVDYFKNCSQDQ--VVE  181

Query  615  LPGLPPLFSGDLPSFLL  665
            LPGLP L   D PSF+ 
Sbjct  182  LPGLPQLSRRDFPSFVF  198



>gb|KFK36297.1| hypothetical protein AALP_AA4G104100 [Arabis alpina]
Length=456

 Score =   168 bits (426),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 95/190 (50%), Positives = 122/190 (64%), Gaps = 18/190 (9%)
 Frame = +3

Query  123  PHILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANGGGVP---DGLNF  293
            PH LLVTFP QGHINP+LQ A RL+  G  VT++T+V A R M      G P    GL++
Sbjct  11   PHYLLVTFPGQGHINPALQLANRLIHHGATVTYSTAVSALRRM------GEPPSVKGLSY  64

Query  294  TAFSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQG-RPITAVVHTLLLPWV  470
              F+DG+D+G K       H MSE++  GS +L  I+  N   G  PIT V+++LL+PWV
Sbjct  65   AWFTDGFDDGLKSFEDQKIH-MSELKRHGSDALSNIIKTNLDGGTEPITGVIYSLLVPWV  123

Query  471  SEVARDVNLPSALLWIQPAAVLDIYYYYFH-GYEDAFKNAATDPNCPVQLPGLPPLFSGD  647
            S VAR  +LP+ LLWI+PA VL+IYYYYF+  Y   F     D N P+ LPGLPPL + D
Sbjct  124  STVARSFHLPTTLLWIEPATVLNIYYYYFNTSYNHLF-----DIN-PITLPGLPPLSTDD  177

Query  648  LPSFLLPSGS  677
            LPSF+ PS +
Sbjct  178  LPSFIQPSKT  187



>ref|XP_006282890.1| hypothetical protein CARUB_v10007134mg [Capsella rubella]
 gb|EOA15788.1| hypothetical protein CARUB_v10007134mg [Capsella rubella]
Length=456

 Score =   168 bits (426),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 90/183 (49%), Positives = 127/183 (69%), Gaps = 10/183 (5%)
 Frame = +3

Query  123  PHILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANGGGVPDGLNFTAF  302
            PH LLVTFPAQGHINP+LQ A RL+  G  VT++T++ AHR M +        GL+F  F
Sbjct  12   PHYLLVTFPAQGHINPALQLANRLIHHGATVTYSTAISAHRRMGEPPS---TKGLSFAWF  68

Query  303  SDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDN-AAQGRPITAVVHTLLLPWVSEV  479
            +DG+D+G K +  +   Y SE++  GS++L+ I+  N  ++  PIT V++++L+PWVS V
Sbjct  69   TDGFDDGLK-SFEDQKIYTSELKRCGSNALRDIIRANLDSKTEPITGVIYSVLVPWVSSV  127

Query  480  ARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATDPNCPVQLPGLPPLFSGDLPSF  659
            AR+ +LP+ LLWI+PA VLDIYYYYF+    +FK+   D N P++LP LP + + DLPSF
Sbjct  128  AREFHLPTTLLWIEPATVLDIYYYYFN---TSFKHLF-DVN-PIKLPKLPLITTEDLPSF  182

Query  660  LLP  668
            L P
Sbjct  183  LQP  185



>emb|CDY12370.1| BnaC08g08350D [Brassica napus]
Length=457

 Score =   168 bits (425),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 87/187 (47%), Positives = 122/187 (65%), Gaps = 12/187 (6%)
 Frame = +3

Query  120  QPHILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANGGGVPDGLNFTA  299
            +PH L+VTFPAQGHINP+++ A RL+  G  +T+AT++ A R M +       +GL++  
Sbjct  11   RPHYLIVTFPAQGHINPAIKLANRLIHHGATITYATTISALRRMGEPPS---TEGLSYAW  67

Query  300  FSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVS---DNAAQGRPITAVVHTLLLPWV  470
            FSDG+DEG  K+  +  +YMSE + RGS +L  I+    D  A   PIT V++++L+PW 
Sbjct  68   FSDGFDEG-PKSFEDQKNYMSEFKRRGSDALSDIIRANLDGNAATEPITGVIYSVLVPWA  126

Query  471  SEVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATDPNCPVQLPGLPPLFSGDL  650
            S VAR+ +LP+ LLWI+PA VLDIYYYYF+       +       P++L  LPPL + DL
Sbjct  127  STVAREFHLPATLLWIEPATVLDIYYYYFNASHSHLFDTE-----PIKLQKLPPLSTRDL  181

Query  651  PSFLLPS  671
            PSFL PS
Sbjct  182  PSFLQPS  188



>ref|XP_003532736.2| PREDICTED: anthocyanidin 3-O-glucoside 5-O-glucosyltransferase 
1-like [Glycine max]
Length=512

 Score =   168 bits (426),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 99/210 (47%), Positives = 134/210 (64%), Gaps = 17/210 (8%)
 Frame = +3

Query  105  GVAMVQPHILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANGGGVPDG  284
            G  MV    LLVT+PAQ HINP+LQ AKRL+ +G  VT   +++ +R +S  N   +P G
Sbjct  32   GKLMVLQRFLLVTYPAQSHINPALQLAKRLIAMGAHVTILLTLHVYRRIS--NKPTIP-G  88

Query  285  LNFTAFSDGYDEGFKKNHHNVAH---YMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTL  455
            L+F  FSDGYD GF   H   +    Y S+++ R S  L  ++  +A++GRP T +++TL
Sbjct  89   LSFLPFSDGYDAGFDALHATDSDFFLYESQLKHRTSDLLSNLILSSASEGRPFTCLLYTL  148

Query  456  LLPWVSEVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATDPNCPVQLPGLP-P  632
            LLPWV++VAR   LP+ALLWI+PA VLDI Y++FHGY D F N  T  N  + LPGL   
Sbjct  149  LLPWVADVARQFYLPTALLWIEPATVLDILYHFFHGYAD-FINDETKEN--IVLPGLSFS  205

Query  633  LFSGDLPSFLL---PSGSGGDYSFAMPTFK  713
            L   D+PSFLL   PS     +SF +P+F+
Sbjct  206  LSPRDVPSFLLLWKPSV----FSFTLPSFE  231



>dbj|BAF49301.1| putative glycosyltransferase [Clitoria ternatea]
Length=469

 Score =   167 bits (423),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 93/204 (46%), Positives = 128/204 (63%), Gaps = 11/204 (5%)
 Frame = +3

Query  114  MVQPHILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANGGGVPDGLNF  293
            M   H L+VTFPAQGHINP+LQ AK+L+ +G +VT   ++Y +  +  AN   +P GL+ 
Sbjct  1    MALQHFLIVTFPAQGHINPALQLAKKLIAMGAQVTLPITLYVYNRI--ANKTTIP-GLSL  57

Query  294  TAFSDGYDEGFKK--NHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLPW  467
              FSDG   G+       N   Y+SE+R RGS  +  ++  +A +G+P T +V+TLLLP 
Sbjct  58   LPFSDG---GYNTAGGGANYKLYVSELRRRGSEFVSNLILSSAKEGQPFTCLVYTLLLPC  114

Query  468  VSEVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAF-KNAATDPNCPVQLPGLP-PLFS  641
             ++VAR  NLP ALLWI+PAAVLDI YYYFH Y D   +      +C + LPGLP  L S
Sbjct  115  AADVARSFNLPFALLWIEPAAVLDILYYYFHDYRDYINQKTQKSSSCSISLPGLPFSLSS  174

Query  642  GDLPSFLLPSGSGGDYSFAMPTFK  713
             D+PSFLL   +   +SF + +F+
Sbjct  175  CDIPSFLLVWKTSV-FSFVLESFQ  197



>ref|XP_004252977.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Solanum 
lycopersicum]
Length=463

 Score =   166 bits (421),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 80/182 (44%), Positives = 117/182 (64%), Gaps = 9/182 (5%)
 Frame = +3

Query  126  HILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANGGGVP--DGLNFTA  299
            H+L+V+F  QG+INP +QF+K L++LG+ VTF+TS+ A   +S      +P   GL F  
Sbjct  9    HVLVVSFTGQGNINPCIQFSKNLIKLGVNVTFSTSLTAFNRIS-----NLPTIQGLTFAP  63

Query  300  FSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLPWVSEV  479
            FSDGYD  FK   + +  + + +RT G+  +  +V D A QG P   +++T L  W+  +
Sbjct  64   FSDGYDGNFKGPMNRIHEFNASLRTHGTEFVTNLVEDRAKQGCPFKRIIYTTLTAWIGLL  123

Query  480  ARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATDPNCPVQLPGLPPLFSGDLPSF  659
            A+ +N+PS  LWIQPA+VL+IYYY+F+GYED+ KN + D +   +LPGLP L   D PS 
Sbjct  124  AKKINVPSTFLWIQPASVLNIYYYFFNGYEDSIKNCSKDQS--FELPGLPLLSRRDFPSI  181

Query  660  LL  665
            L 
Sbjct  182  LF  183



>ref|XP_009403481.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Musa 
acuminata subsp. malaccensis]
Length=469

 Score =   166 bits (421),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 87/202 (43%), Positives = 121/202 (60%), Gaps = 3/202 (1%)
 Frame = +3

Query  117  VQPHILLVTFPAQGHINPSLQFAKRLVRL-GIEVTFATSVYAHRLMSKANGGG-VPDGL-  287
            ++ H L+VT+P QGHINP+L  A+RL R+ G  +TF+ ++  HR M  ++  G V DGL 
Sbjct  1    MEQHFLVVTYPLQGHINPALHLARRLARVAGARITFSIALSGHRRMFPSSADGEVDDGLI  60

Query  288  NFTAFSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLPW  467
            ++   SDGYD+GF  +  +V  Y    R+  S +L  I+     +GRP+T V++TLLL W
Sbjct  61   SYVPHSDGYDDGFNPDVDDVKAYPLRTRSVSSKTLSAIIRSLEERGRPVTCVIYTLLLSW  120

Query  468  VSEVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATDPNCPVQLPGLPPLFSGD  647
             ++VA +  LPS L WIQPA V  +YY+YFHGY+    +   DP   V LPGLPP    D
Sbjct  121  AADVAHEHGLPSVLYWIQPATVFALYYHYFHGYDGLIASHRQDPLFQVNLPGLPPFRICD  180

Query  648  LPSFLLPSGSGGDYSFAMPTFK  713
            LPSFL  +     Y   +  FK
Sbjct  181  LPSFLRITSPDDPYFIVIEMFK  202



>ref|XP_004247896.2| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Solanum 
lycopersicum]
Length=476

 Score =   166 bits (421),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 83/191 (43%), Positives = 120/191 (63%), Gaps = 4/191 (2%)
 Frame = +3

Query  120  QPHILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANGGGVPDGLNFTA  299
            + H+L+V FPAQGHINPSLQ +KRL+ LGI+VT +TS+ A    +K       +GL+F  
Sbjct  27   KSHVLIVIFPAQGHINPSLQLSKRLIDLGIKVTLSTSLSA---FNKIKILPNIEGLSFAP  83

Query  300  FSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLPWVSEV  479
            FSDGYD  FK + +    Y S I++ GS  +  ++  NA    P T V++T+++ W + V
Sbjct  84   FSDGYDGNFKGSFNEFHLYYSSIKSHGSEFIFNLIKSNAKNCTPFTHVIYTVVMEWTALV  143

Query  480  ARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATDPNCPVQLPGLPPLFSGDLPSF  659
            A+++N PS L WIQPA V DIYYY +  Y D FKN  ++    ++LPGLPPL   D PSF
Sbjct  144  AKELNTPSTLFWIQPATVFDIYYYRYTDYSDYFKNCDSNDKI-IELPGLPPLSPIDFPSF  202

Query  660  LLPSGSGGDYS  692
            +  +    +++
Sbjct  203  VFDNVECNNWA  213



>ref|XP_010023610.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Eucalyptus 
grandis]
 ref|XP_010023611.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Eucalyptus 
grandis]
 gb|KCW59920.1| hypothetical protein EUGRSUZ_H02644 [Eucalyptus grandis]
Length=462

 Score =   166 bits (419),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 99/201 (49%), Positives = 134/201 (67%), Gaps = 9/201 (4%)
 Frame = +3

Query  114  MVQPHILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYA-HRLMSKANGGGVPDGLN  290
            M  PH LLVTFP QGHINPSLQFAKRL+R+G  VTFAT+++A HR+   A     P+GL+
Sbjct  1    MAPPHFLLVTFPGQGHINPSLQFAKRLMRVGAHVTFATAIHALHRM---AESKSPPEGLS  57

Query  291  FTAFSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLPWV  470
            F +FSDGYD+    +  ++  Y  E + RGS +L  +++ N   GR    V +T LLPWV
Sbjct  58   FASFSDGYDD--GFDWDDLDKYADEFKRRGSETLSDLIASNLENGRRFLGVFYTTLLPWV  115

Query  471  SEVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATDPNCPVQLPGLPPLFSGDL  650
            ++VA    +PS L+WIQPA VLD YYYYFHGY D  ++   +P+ P+QLPGLPPL + D+
Sbjct  116  ADVACSHGIPSTLVWIQPATVLDFYYYYFHGYGDLIQSTGDNPSVPIQLPGLPPLMACDI  175

Query  651  PSFLLPSGSGGDYSFAMPTFK  713
            PSF     +   Y+F++P  +
Sbjct  176  PSF---CNTKNVYNFSLPLLQ  193



>ref|XP_008458143.1| PREDICTED: anthocyanidin 3-O-glucoside 5-O-glucosyltransferase-like 
[Cucumis melo]
Length=469

 Score =   166 bits (419),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 90/195 (46%), Positives = 122/195 (63%), Gaps = 11/195 (6%)
 Frame = +3

Query  114  MVQPHILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANGGGVPDGLNF  293
            M   H L+V FP+QG INPSLQ A +L  L IEVTFAT+V A R M+       P  L+F
Sbjct  1    MRNHHFLIVCFPSQGCINPSLQLANKLTSLNIEVTFATTVTASRRMNITQQIPSPSTLSF  60

Query  294  TAFSDGYDEGFKKNHH--NVAHYMSEIRTRGSSSLKGIVS---DNAAQGRPITAVVHTLL  458
              FSDG+D+   +NH   +  HY SE++  GS SL  +++   D+  + RP T ++++LL
Sbjct  61   ATFSDGFDD---ENHKTSDFNHYFSELKRCGSQSLTDLIASLRDDRHRRRPFTFLIYSLL  117

Query  459  LPWVSEVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATD--PNCPVQLPGLPP  632
            L W ++VA   N+PSAL   QPA VL +YYYYFHG+ED   N   +  P+  ++LPGLP 
Sbjct  118  LNWAADVATSFNIPSALFSTQPATVLALYYYYFHGFEDEITNKLQNDGPSLSIELPGLPL  177

Query  633  LF-SGDLPSFLLPSG  674
            LF S ++PSF  PS 
Sbjct  178  LFKSHEMPSFFSPSS  192



>gb|EYU32718.1| hypothetical protein MIMGU_mgv1a005538mg [Erythranthe guttata]
Length=480

 Score =   166 bits (419),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 92/201 (46%), Positives = 125/201 (62%), Gaps = 14/201 (7%)
 Frame = +3

Query  126  HILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANGGGVPDGLNFTAFS  305
            H+LLVTFPAQGHINPSLQFAKRL +LG+ VTF TS  A R M+          +NF +FS
Sbjct  8    HVLLVTFPAQGHINPSLQFAKRLAKLGVAVTFLTSSSAVRRMTTTAAA-----INFASFS  62

Query  306  DGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLPWVSEVAR  485
            DG+D G+  +     ++M+ +RT GS +++  V+  AA+ RP + V++TLL+PW  +VA 
Sbjct  63   DGFDGGWSNDE--TQNFMAALRTHGSKAVEDAVAAAAAENRPFSRVIYTLLVPWAGQVAH  120

Query  486  DVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATDPNCP------VQLPGLPPLFSGD  647
             + +P  LLWIQPA +  +Y+YYF+ Y DA      D          ++LPGLPP    D
Sbjct  121  RLRVPVTLLWIQPAILFGVYFYYFNKYFDAAAMNEEDDGNNNNNNKIIELPGLPPFAPSD  180

Query  648  LPSFLLPSGSGGDYSFAMPTF  710
            LPSF+  S     Y FA+PTF
Sbjct  181  LPSFMSASNPSM-YDFALPTF  200



>gb|KCW57186.1| hypothetical protein EUGRSUZ_H00001, partial [Eucalyptus grandis]
Length=388

 Score =   164 bits (414),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 85/203 (42%), Positives = 123/203 (61%), Gaps = 11/203 (5%)
 Frame = +3

Query  114  MVQPHILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANGGGVPDGLNF  293
            M  PH LLV       +NP+LQ A+RL R+G  VTF ++VYA R M        P G+ F
Sbjct  1    MAPPHFLLVALSTCSAMNPALQLAERLARVGSRVTFLSTVYALRCMIDPV---CPGGVTF  57

Query  294  TAFSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLPWVS  473
            T FSDGYD+G+     ++  Y +E+  RGS +L+ ++  ++ QG   T V+HT++ PWV 
Sbjct  58   TTFSDGYDDGYVPGD-DLERYRAEMNRRGSEALRDLIEHSSGQGLSFTCVLHTIV-PWVH  115

Query  474  EVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAAT---DPNCPVQLPGLPPLFSG  644
            +VAR + +   L+WIQPA V DIYY+YF GYED  K+  +   D    ++LPG+PPL + 
Sbjct  116  DVARSLQIKLVLVWIQPATVFDIYYHYFSGYEDVIKSVTSQRCDTTSLIRLPGVPPLTNR  175

Query  645  DLPSFLLPSGSGGDYSFAMPTFK  713
            ++PSFL        Y+FA+P  +
Sbjct  176  NIPSFLHVENK---YAFALPEIQ  195



>ref|XP_008787452.1| PREDICTED: cyanidin 3-O-rutinoside 5-O-glucosyltransferase-like 
[Phoenix dactylifera]
Length=493

 Score =   165 bits (417),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 96/219 (44%), Positives = 129/219 (59%), Gaps = 25/219 (11%)
 Frame = +3

Query  108  VAMVQPHILLVTFPAQGHINPSLQFAKRLVRL-GIEVTFATSVYAHRLM--SKAN-GGGV  275
            +   Q H L+ T+PAQGHINPSL  AKRL +  G  VTF+TS+ AHR M  S A     V
Sbjct  1    MEQCQQHFLVATYPAQGHINPSLHLAKRLAQTTGGRVTFSTSISAHRRMFPSLAKPDEEV  60

Query  276  PDGL-NFTAFSDGYDEGFKKNHH-NVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVH  449
             DGL ++  FSDGYD GF+ +   ++  +M++ +  G+ +L GIV D AA+ RP++ V++
Sbjct  61   EDGLLSYIPFSDGYDTGFEADTDGDLDDFMTQFKLVGTRTLSGIVHDLAARDRPVSCVIY  120

Query  450  TLLLPWVSEVARDVNLPSALLWI-------------------QPAAVLDIYYYYFHGYED  572
            ++ L W ++VARD  +PSAL WI                   QPA V   YY+YFHGYE+
Sbjct  121  SVWLSWAADVARDHGIPSALYWIIWAADVARDHGIPSVLYWIQPATVFTTYYHYFHGYEE  180

Query  573  AFKNAATDPNCPVQLPGLPPLFSGDLPSFLLPSGSGGDY  689
               +   DP   V LPGLPPL + DLPSFL  + S   Y
Sbjct  181  LITSHGHDPLFTVDLPGLPPLQNRDLPSFLTVTSSDDPY  219



>gb|KGN46579.1| hypothetical protein Csa_6G109740 [Cucumis sativus]
Length=464

 Score =   164 bits (416),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 91/207 (44%), Positives = 125/207 (60%), Gaps = 13/207 (6%)
 Frame = +3

Query  114  MVQPHILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANGGGVPDGLNF  293
            M   H L+V FP+QG+INPSLQ A +L  L IEVTFAT+V A R M        P  L+F
Sbjct  1    MRNHHFLIVCFPSQGYINPSLQLANKLTSLNIEVTFATTVTASRRMKITQQISSPSTLSF  60

Query  294  TAFSDGYDEGFKKNHH--NVAHYMSEIRTRGSSSLKGIVSD-NAAQGRPITAVVHTLLLP  464
              FSDG+D+   +NH   +  H+ SE++  GS SL  +++       RP T V+++LLL 
Sbjct  61   ATFSDGFDD---ENHKTSDFNHFFSELKRCGSQSLTDLITSFRDRHRRPFTFVIYSLLLN  117

Query  465  WVSEVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATD---PNCPVQLPGLPPL  635
            W ++VA   N+PSAL   QPA VL +YYYYFHG+ED   N   +    +  ++LPGLP L
Sbjct  118  WAADVATSFNIPSALFSAQPATVLALYYYYFHGFEDEITNKLQNDGPSSLSIELPGLPLL  177

Query  636  F-SGDLPSFLLPSGSGGDYSFAMPTFK  713
            F S ++PSF  PSG    ++F +P  +
Sbjct  178  FKSHEMPSFFSPSGQ---HAFIIPWMR  201



>ref|XP_004140604.1| PREDICTED: UDP-glycosyltransferase 75C1-like [Cucumis sativus]
Length=464

 Score =   164 bits (416),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 91/207 (44%), Positives = 125/207 (60%), Gaps = 13/207 (6%)
 Frame = +3

Query  114  MVQPHILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANGGGVPDGLNF  293
            M   H L+V FP+QG+INPSLQ A +L  L IEVTFAT+V A R M        P  L+F
Sbjct  1    MRNHHFLIVCFPSQGYINPSLQLANKLTSLNIEVTFATTVTASRRMKITQQISSPSTLSF  60

Query  294  TAFSDGYDEGFKKNHH--NVAHYMSEIRTRGSSSLKGIVSD-NAAQGRPITAVVHTLLLP  464
              FSDG+D+   +NH   +  H+ SE++  GS SL  +++       RP T V+++LLL 
Sbjct  61   ATFSDGFDD---ENHKTSDFNHFFSELKRCGSQSLTDLITSFRDRHRRPFTFVIYSLLLN  117

Query  465  WVSEVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATD---PNCPVQLPGLPPL  635
            W ++VA   N+PSAL   QPA VL +YYYYFHG+ED   N   +    +  ++LPGLP L
Sbjct  118  WAADVATSFNIPSALFSAQPATVLALYYYYFHGFEDEITNKLQNDGPSSLSIELPGLPLL  177

Query  636  F-SGDLPSFLLPSGSGGDYSFAMPTFK  713
            F S ++PSF  PSG    ++F +P  +
Sbjct  178  FKSHEMPSFFSPSGQ---HAFIIPWMR  201



>ref|XP_010025793.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Eucalyptus 
grandis]
Length=413

 Score =   163 bits (413),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 85/203 (42%), Positives = 123/203 (61%), Gaps = 11/203 (5%)
 Frame = +3

Query  114  MVQPHILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANGGGVPDGLNF  293
            M  PH LLV       +NP+LQ A+RL R+G  VTF ++VYA R M        P G+ F
Sbjct  20   MAPPHFLLVALSTCSAMNPALQLAERLARVGSRVTFLSTVYALRCMIDPV---CPGGVTF  76

Query  294  TAFSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLPWVS  473
            T FSDGYD+G+     ++  Y +E+  RGS +L+ ++  ++ QG   T V+HT++ PWV 
Sbjct  77   TTFSDGYDDGYVPGD-DLERYRAEMNRRGSEALRDLIEHSSGQGLSFTCVLHTIV-PWVH  134

Query  474  EVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAAT---DPNCPVQLPGLPPLFSG  644
            +VAR + +   L+WIQPA V DIYY+YF GYED  K+  +   D    ++LPG+PPL + 
Sbjct  135  DVARSLQIKLVLVWIQPATVFDIYYHYFSGYEDVIKSVTSQRCDTTSLIRLPGVPPLTNR  194

Query  645  DLPSFLLPSGSGGDYSFAMPTFK  713
            ++PSFL        Y+FA+P  +
Sbjct  195  NIPSFLHVENK---YAFALPEIQ  214



>gb|KJB18350.1| hypothetical protein B456_003G047900 [Gossypium raimondii]
Length=453

 Score =   164 bits (415),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 82/183 (45%), Positives = 117/183 (64%), Gaps = 7/183 (4%)
 Frame = +3

Query  123  PHILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANGGGVPDGLNFTAF  302
            P +LLVTF +QGHINPSLQFA  L+  G+ VT  +   A  ++ + N      GL++  +
Sbjct  9    PQVLLVTFASQGHINPSLQFANNLINNGVHVTLMS---ASSMIHRFNKASPVHGLSYAYY  65

Query  303  SDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLPWVSEVA  482
            SDGYD  F+ +  +  HY+SE +  G+ SL+  ++D   QG   T++V+  LLPWV+ VA
Sbjct  66   SDGYDHAFQLSG-DTNHYLSETKRHGTQSLREFLAD---QGTRFTSIVYCTLLPWVATVA  121

Query  483  RDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATDPNCPVQLPGLPPLFSGDLPSFL  662
            R+ ++P+ LLW QPA++L+I Y+YF GY +       DP   VQ+PGLPPL   DLPSF 
Sbjct  122  REFHIPATLLWFQPASLLNICYHYFKGYHEIITKNIDDPMFTVQMPGLPPLSRHDLPSFF  181

Query  663  LPS  671
            +PS
Sbjct  182  IPS  184



>ref|XP_006342284.1| PREDICTED: anthocyanidin 3-O-glucoside 5-O-glucosyltransferase 
1-like [Solanum tuberosum]
Length=467

 Score =   164 bits (415),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 82/194 (42%), Positives = 120/194 (62%), Gaps = 9/194 (5%)
 Frame = +3

Query  120  QPHILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANGGGVP--DGLNF  293
            +PH+L+  FP QG INP LQF+K+L+ LGIEVT  TS+ A   + K     +P  +GL+F
Sbjct  8    KPHVLIALFPGQGQINPCLQFSKQLINLGIEVTLTTSLSAFSKIKK-----LPNVEGLSF  62

Query  294  TAFSDGYDEGFK-KNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLPWV  470
              FSDGYD  F+  +  +   + S +++RGS  +  ++  NA  G P + V++T+++ WV
Sbjct  63   APFSDGYDGKFQLSSVDDFYLFYSSVKSRGSKFIFNLIQSNAKNGTPFSHVIYTIIMEWV  122

Query  471  SEVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATDPNCPVQLPGLPPLFSGDL  650
              VA+ +N+PS L WIQPA V D+YYY F  Y D FKN  T  +  ++LPGLPPL   D 
Sbjct  123  GLVAKKINVPSTLFWIQPATVFDVYYYRFTNYSDYFKN-CTAKDKIIELPGLPPLSPIDF  181

Query  651  PSFLLPSGSGGDYS  692
            PSF+       +++
Sbjct  182  PSFVFDDMESTNWA  195



>dbj|BAF49300.1| putative glycosyltransferase [Clitoria ternatea]
Length=472

 Score =   164 bits (415),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 88/192 (46%), Positives = 122/192 (64%), Gaps = 9/192 (5%)
 Frame = +3

Query  126  HILLVTFPAQGHINPSLQFAKRLV-RLGIEVTFATSVYAHRLMSKANGGGVPDGLNFTAF  302
            H +LV FPAQGHINP+ Q AKRL+   G  VT +T++  HR ++  N   +P  L+F  F
Sbjct  5    HFILVLFPAQGHINPAFQLAKRLIISFGARVTISTTLRMHRRLT--NKPSLP-SLSFLPF  61

Query  303  SDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLPWVSEVA  482
            SDG+D+     + + + Y SE++ RGS  L  ++  +A +G P T +++T LLPW +EVA
Sbjct  62   SDGFDDTAATANQS-SLYASELKRRGSQFLTNLILSHAQEGHPFTCLLYTPLLPWAAEVA  120

Query  483  RDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKN-AATDPNCPVQLPGLPPLFS---GDL  650
            R  +LP+A+LW QPA VLDI Y+YFHGY D   +    DP+C ++LPGLP +      DL
Sbjct  121  RGFHLPTAILWTQPATVLDILYHYFHGYRDYINDKTKEDPSCSIELPGLPRVLMLTPRDL  180

Query  651  PSFLLPSGSGGD  686
            PSFLL S    D
Sbjct  181  PSFLLNSNPSLD  192



>ref|XP_003531212.1| PREDICTED: anthocyanidin 3-O-glucoside 5-O-glucosyltransferase 
1-like [Glycine max]
Length=465

 Score =   163 bits (413),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 94/201 (47%), Positives = 134/201 (67%), Gaps = 7/201 (3%)
 Frame = +3

Query  114  MVQPHILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANGGGVPDGLNF  293
            M +   LL+ +PAQGHI+P+ Q AKRLV LG  VT +T+V+ HR ++  N   +P  L+F
Sbjct  1    MFRHRFLLILYPAQGHIHPAFQLAKRLVSLGAHVTVSTTVHMHRRIT--NKPTLPH-LSF  57

Query  294  TAFSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLPWVS  473
              FSDGYD+GF  +  ++  + S  + RGS  +  ++  NA +G P T +V+T LL WV+
Sbjct  58   LPFSDGYDDGFTSSDFSL--HASVFKRRGSEFVTNLILSNAQEGHPFTCLVYTTLLSWVA  115

Query  474  EVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATDPNCPVQLPGLPPLFSG-DL  650
            EVAR+ +LP+A+LW QPA +LDI+YYYFH + +  K+   DP+C ++LPGLP L +  DL
Sbjct  116  EVAREFHLPTAMLWTQPATILDIFYYYFHEHGEYIKDKIKDPSCFIELPGLPLLLAPRDL  175

Query  651  PSFLLPSGSGGDYSFAMPTFK  713
            PSFLL S    D SF +P F+
Sbjct  176  PSFLLGSNPTID-SFIVPMFE  195



>dbj|BAF49286.1| anthocyanin 5-O-glucosyltransferase [Eustoma grandiflorum]
 dbj|BAF49287.1| anthocyanin 5-O-glucosyltransferase [Eustoma grandiflorum]
Length=463

 Score =   163 bits (413),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 92/203 (45%), Positives = 118/203 (58%), Gaps = 21/203 (10%)
 Frame = +3

Query  114  MVQPHILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANGGGVPDGLNF  293
            M  PHILLV FPAQGHI+P+LQ A +LV  GI++TF TS +A   MSK        GLNF
Sbjct  1    MSTPHILLVVFPAQGHISPALQLAMKLVAQGIQLTFLTSSFAEARMSKPTN---ISGLNF  57

Query  294  TAF---SDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLP  464
              F   + G D            YM E+R  GS +LK I+  +   G PI+ +++T LLP
Sbjct  58   VYFPEVTKGKD------------YMFELRKHGSQTLKDIILSSINVGLPISRILYTTLLP  105

Query  465  WVSEVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATDPNCPVQLPGLPPLFSG  644
            W +++AR+ ++PS LLW QP   L  ++YYF+GYED  KN     N  +QLP LP L   
Sbjct  106  WAADIARESHIPSILLWTQPVTTLVTFHYYFNGYEDVIKNICNHENSTLQLPRLPLLSRR  165

Query  645  DLPSFLLPSGSGGDYSFAMPTFK  713
            DL SFLLPS     Y   + TFK
Sbjct  166  DLHSFLLPSNP---YKGVLRTFK  185



>dbj|BAF49285.1| anthocyanin 5-O-glucosyltransferase [Eustoma grandiflorum]
Length=463

 Score =   163 bits (412),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 92/203 (45%), Positives = 118/203 (58%), Gaps = 21/203 (10%)
 Frame = +3

Query  114  MVQPHILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANGGGVPDGLNF  293
            M  PHILLV FPAQGHI+P+LQ A +LV  GI++TF TS +A   MSK        GLNF
Sbjct  1    MSTPHILLVVFPAQGHISPALQLAMKLVAQGIQLTFLTSSFAEARMSKPTN---ISGLNF  57

Query  294  TAF---SDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLP  464
              F   + G D            YM E+R  GS +LK I+  +   G PI+ +++T LLP
Sbjct  58   VYFPEVTKGKD------------YMFELRKHGSQTLKDIILSSINVGLPISRILYTTLLP  105

Query  465  WVSEVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATDPNCPVQLPGLPPLFSG  644
            W +++AR+ ++PS LLW QP   L  ++YYF+GYED  KN     N  +QLP LP L   
Sbjct  106  WAADIARESHIPSILLWTQPVTTLVTFHYYFNGYEDVIKNICNHENSTLQLPRLPLLSRR  165

Query  645  DLPSFLLPSGSGGDYSFAMPTFK  713
            DL SFLLPS     Y   + TFK
Sbjct  166  DLHSFLLPSNP---YKGVLRTFK  185



>ref|XP_006349902.1| PREDICTED: anthocyanidin 3-O-glucoside 5-O-glucosyltransferase 
1-like [Solanum tuberosum]
Length=459

 Score =   162 bits (411),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 77/182 (42%), Positives = 117/182 (64%), Gaps = 9/182 (5%)
 Frame = +3

Query  126  HILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANGGGVP--DGLNFTA  299
            H+L+V+F  QG+INP +QF+K L++LG+ VTF+TS+ A   +S      +P   GL F  
Sbjct  9    HVLVVSFTGQGNINPCIQFSKNLIKLGVNVTFSTSLTAFNRIS-----NLPTIQGLTFAP  63

Query  300  FSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLPWVSEV  479
            FSDG+D  F  + ++   + + +RT G+  +  +V D A QG P   +++T L  W+  +
Sbjct  64   FSDGFDGNFNGSTNSFREFNASLRTHGTEFVTNLVEDRAKQGCPFKRIIYTTLTAWIGLL  123

Query  480  ARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATDPNCPVQLPGLPPLFSGDLPSF  659
            A+ +N+PS  LWIQPA+VL+IYYY+F+GYED+ KN + D +   +LPGLP L   D PS 
Sbjct  124  AKSINVPSTFLWIQPASVLNIYYYFFNGYEDSIKNCSKDQS--FELPGLPLLSRRDFPSI  181

Query  660  LL  665
            + 
Sbjct  182  VF  183



>dbj|BAD67837.1| putative glucosyltransferase [Oryza sativa Japonica Group]
Length=484

 Score =   162 bits (411),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 94/214 (44%), Positives = 127/214 (59%), Gaps = 22/214 (10%)
 Frame = +3

Query  126  HILLVTFPAQGHINPSLQFAKRLVRL--GIEVTFATSVYAHRLM-----------SKANG  266
            H L+VT+PAQGHINP+   A+RL R   G  VT +T+V A R M              + 
Sbjct  12   HFLVVTYPAQGHINPARHLARRLARAAPGARVTISTAVSACRKMFGDAAAAGAGGELVDE  71

Query  267  GGVPDGLNFTAFSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVV  446
            GGV     +  +SDGYD+GF +  H+ A YM+++R  G+ +L  ++    A GRP+T VV
Sbjct  72   GGV----RYAPYSDGYDDGFDRAVHDSASYMTQVRVVGARTLAAVIEGFRAAGRPVTRVV  127

Query  447  HTLLLPWVSEVARDVNLPSALLWIQPAAVLDIYYYYFHG-----YEDAFKNAATDPNCPV  611
            +TLLL WV++VARD  +P AL WIQPAAVL  Y++YF G      + A   AA D   PV
Sbjct  128  YTLLLTWVADVARDHGVPVALYWIQPAAVLAAYFHYFRGTGGVDRDIAAAAAARDRMAPV  187

Query  612  QLPGLPPLFSGDLPSFLLPSGSGGDYSFAMPTFK  713
            ++PGLPPL   DLPSFL  +     Y+F +  F+
Sbjct  188  RVPGLPPLRLRDLPSFLAIADDDDPYAFVLDAFR  221



>ref|NP_001042201.2| Os01g0179600 [Oryza sativa Japonica Group]
 dbj|BAH01690.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAF04115.2| Os01g0179600 [Oryza sativa Japonica Group]
Length=487

 Score =   162 bits (411),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 94/214 (44%), Positives = 127/214 (59%), Gaps = 22/214 (10%)
 Frame = +3

Query  126  HILLVTFPAQGHINPSLQFAKRLVRL--GIEVTFATSVYAHRLM-----------SKANG  266
            H L+VT+PAQGHINP+   A+RL R   G  VT +T+V A R M              + 
Sbjct  15   HFLVVTYPAQGHINPARHLARRLARAAPGARVTISTAVSACRKMFGDAAAAGAGGELVDE  74

Query  267  GGVPDGLNFTAFSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVV  446
            GGV     +  +SDGYD+GF +  H+ A YM+++R  G+ +L  ++    A GRP+T VV
Sbjct  75   GGV----RYAPYSDGYDDGFDRAVHDSASYMTQVRVVGARTLAAVIEGFRAAGRPVTRVV  130

Query  447  HTLLLPWVSEVARDVNLPSALLWIQPAAVLDIYYYYFHG-----YEDAFKNAATDPNCPV  611
            +TLLL WV++VARD  +P AL WIQPAAVL  Y++YF G      + A   AA D   PV
Sbjct  131  YTLLLTWVADVARDHGVPVALYWIQPAAVLAAYFHYFRGTGGVDRDIAAAAAARDRMAPV  190

Query  612  QLPGLPPLFSGDLPSFLLPSGSGGDYSFAMPTFK  713
            ++PGLPPL   DLPSFL  +     Y+F +  F+
Sbjct  191  RVPGLPPLRLRDLPSFLAIADDDDPYAFVLDAFR  224



>ref|XP_004162387.1| PREDICTED: UDP-glycosyltransferase 75C1-like [Cucumis sativus]
Length=464

 Score =   162 bits (410),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 90/207 (43%), Positives = 124/207 (60%), Gaps = 13/207 (6%)
 Frame = +3

Query  114  MVQPHILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANGGGVPDGLNF  293
            M   H L+V  P+QG+INPSLQ A +L  L IEVTFAT+V A R M        P  L+F
Sbjct  1    MRNHHFLIVCLPSQGYINPSLQLANKLTSLNIEVTFATTVTASRRMKITQQISSPSTLSF  60

Query  294  TAFSDGYDEGFKKNHH--NVAHYMSEIRTRGSSSLKGIVSD-NAAQGRPITAVVHTLLLP  464
              FSDG+D+   +NH   +  H+ SE++  GS SL  +++       RP T V+++LLL 
Sbjct  61   ATFSDGFDD---ENHKTSDFNHFFSELKRCGSQSLTDLITSFRDRHRRPFTFVIYSLLLN  117

Query  465  WVSEVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATD---PNCPVQLPGLPPL  635
            W ++VA   N+PSAL   QPA VL +YYYYFHG+ED   N   +    +  ++LPGLP L
Sbjct  118  WAADVATSFNIPSALFSAQPATVLALYYYYFHGFEDEITNKLQNDGPSSLSIELPGLPLL  177

Query  636  F-SGDLPSFLLPSGSGGDYSFAMPTFK  713
            F S ++PSF  PSG    ++F +P  +
Sbjct  178  FKSHEMPSFFSPSGQ---HAFIIPWMR  201



>ref|XP_002455067.1| hypothetical protein SORBIDRAFT_03g003760 [Sorghum bicolor]
 gb|EES00187.1| hypothetical protein SORBIDRAFT_03g003760 [Sorghum bicolor]
Length=492

 Score =   162 bits (410),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 90/209 (43%), Positives = 125/209 (60%), Gaps = 11/209 (5%)
 Frame = +3

Query  120  QPHILLVTFPAQGHINPSLQFAKRLVR-LGIEVTFATSVYAHRLM-------SKANGGGV  275
            +PH L+VTFPA GHINP+   A+RL+R  G  VT +TSV+A R M       ++  G   
Sbjct  21   EPHFLVVTFPAMGHINPARHLARRLLRATGARVTVSTSVFALRKMFPGAAAETEPEGHRD  80

Query  276  PDGLNFTAFSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTL  455
              G+ +  +SDGYD+GF K  H+  HYM +I+  GS +L  ++      GRP+T VV+TL
Sbjct  81   ASGVWYVPYSDGYDDGFDKAVHDATHYMDQIKLEGSRTLGNVLDRLRDAGRPVTLVVYTL  140

Query  456  LLPWVSEVARDVNLPSALLWIQPAAVLDIYYYYFHG---YEDAFKNAATDPNCPVQLPGL  626
            LL WV++VAR   +P+AL WIQPA VL  Y ++F      + A   A  DP   V+ PGL
Sbjct  141  LLSWVADVARAHAVPAALYWIQPATVLAAYLHFFRATDGVDAAIAAAGGDPWATVRFPGL  200

Query  627  PPLFSGDLPSFLLPSGSGGDYSFAMPTFK  713
            PPL   DLPSF++ +     Y+F +  F+
Sbjct  201  PPLRVRDLPSFIVSTSENDPYAFVVDAFR  229



>emb|CAB10333.1| glucosyltransferase like protein [Arabidopsis thaliana]
 emb|CAB78597.1| glucosyltransferase like protein [Arabidopsis thaliana]
Length=458

 Score =   161 bits (408),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 88/208 (42%), Positives = 121/208 (58%), Gaps = 33/208 (16%)
 Frame = +3

Query  123  PHILLVTFPAQGHINPSLQFAKRLVRL--GIEVTFATSV--YAHRLMSKANGGGVPDGLN  290
            PH L VTFPAQGHINPSL+ AKRL     G  VTFA S+  Y  R+ S  N   VP+ L 
Sbjct  12   PHFLFVTFPAQGHINPSLELAKRLAGTISGARVTFAASISAYNRRMFSTEN---VPETLI  68

Query  291  FTAFSDGYDEGFKKNHHN-------VAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVH  449
            F  +SDG+D+GFK + ++         ++MSE+R RG  +L  ++ DN  Q RP T VV+
Sbjct  69   FATYSDGHDDGFKSSAYSDKSRQDATGNFMSEMRRRGKETLTELIEDNRKQNRPFTCVVY  128

Query  450  TLLLPWVSEVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATDPNCPVQLPGLP  629
            T+LL WV+E+A                +  I+Y+YF+GYEDA    A  P+  ++LP LP
Sbjct  129  TILLTWVAELA----------------LFSIFYHYFNGYEDAISEMANTPSSSIKLPSLP  172

Query  630  PLFSGDLPSFLLPSGSGGDYSFAMPTFK  713
             L   D+PSF++ S     Y+F +P F+
Sbjct  173  LLTVRDIPSFIVSSNV---YAFLLPAFR  197



>ref|XP_008793435.1| PREDICTED: cyanidin 3-O-rutinoside 5-O-glucosyltransferase-like 
[Phoenix dactylifera]
Length=485

 Score =   161 bits (408),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 91/196 (46%), Positives = 120/196 (61%), Gaps = 7/196 (4%)
 Frame = +3

Query  126  HILLVTFPAQGHINPSLQFAKRLVRL-GIEVTFATSVYAHRLM---SKANGGGVPDGL-N  290
            H L+VT+P QGHINP+L  A RL+++ G  +TF+T+V AHR M   S A    + DGL +
Sbjct  15   HFLVVTYPVQGHINPALHLATRLIQIAGAHITFSTAVSAHRRMFPFSAAPDQEIEDGLIS  74

Query  291  FTAFSDGYDEGFKKNHH--NVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLP  464
            +  FSDGYD+GF   H    V ++MS      S +L  +V+  AA+GRP+T +++TL  P
Sbjct  75   YIPFSDGYDDGFHGYHSRPEVDNFMSRSMQIASENLSTLVASLAARGRPVTFIIYTLFSP  134

Query  465  WVSEVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATDPNCPVQLPGLPPLFSG  644
            WV  VAR   +PS L WIQ A V  IYY+YFHGY+       ++P   V+LPGLPPL   
Sbjct  135  WVVGVARHHGIPSILYWIQSATVFAIYYHYFHGYDGLVAAHRSEPLFTVRLPGLPPLHIR  194

Query  645  DLPSFLLPSGSGGDYS  692
            DLPS L  S     YS
Sbjct  195  DLPSLLTISADDLLYS  210



>gb|EAY72781.1| hypothetical protein OsI_00644 [Oryza sativa Indica Group]
Length=484

 Score =   161 bits (407),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 94/214 (44%), Positives = 126/214 (59%), Gaps = 22/214 (10%)
 Frame = +3

Query  126  HILLVTFPAQGHINPSLQFAKRLVRL--GIEVTFATSVYAHRLM-----------SKANG  266
            H L+VT+PAQGHINP+   A+RL R   G  VT +T+V A R M              + 
Sbjct  12   HFLVVTYPAQGHINPARHLARRLARAAPGARVTISTAVSACRKMFGDAAAAGAGGELVDE  71

Query  267  GGVPDGLNFTAFSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVV  446
            GGV     +  +SDGYD+GF +  H+ A YM+++R  G+ +L  ++    A GRP+T VV
Sbjct  72   GGV----RYAPYSDGYDDGFDRAVHDSASYMTQVRVVGARTLAAVIEGFRAAGRPVTRVV  127

Query  447  HTLLLPWVSEVARDVNLPSALLWIQPAAVLDIYYYYFHG-----YEDAFKNAATDPNCPV  611
            +TLLL WV++VARD  +P AL WIQPAAVL  Y +YF G      + A   AA D   PV
Sbjct  128  YTLLLTWVADVARDHGVPVALYWIQPAAVLAAYLHYFRGTGGVDRDIAAAAAARDRMAPV  187

Query  612  QLPGLPPLFSGDLPSFLLPSGSGGDYSFAMPTFK  713
            ++PGLPPL   DLPSFL  +     Y+F +  F+
Sbjct  188  RVPGLPPLRLRDLPSFLAIADDDDPYAFVLDAFR  221



>gb|EAZ10778.1| hypothetical protein OsJ_00613 [Oryza sativa Japonica Group]
Length=484

 Score =   161 bits (407),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 94/214 (44%), Positives = 126/214 (59%), Gaps = 22/214 (10%)
 Frame = +3

Query  126  HILLVTFPAQGHINPSLQFAKRLVRL--GIEVTFATSVYAHRLM-----------SKANG  266
            H L+VT+PAQGHINP+   A+RL R   G  VT +T+V A R M              + 
Sbjct  12   HFLVVTYPAQGHINPARHLARRLARAAPGARVTISTAVSACRKMFGDAAAAGAGGELVDE  71

Query  267  GGVPDGLNFTAFSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVV  446
            GGV     +  +SDGYD+GF +  H+ A YM ++R  G+ +L  ++    A GRP+T VV
Sbjct  72   GGV----RYAPYSDGYDDGFDRAVHDSASYMIQVRVVGARTLAAVIEGFRAAGRPVTRVV  127

Query  447  HTLLLPWVSEVARDVNLPSALLWIQPAAVLDIYYYYFHG-----YEDAFKNAATDPNCPV  611
            +TLLL WV++VARD  +P AL WIQPAAVL  Y++YF G      + A   AA D   PV
Sbjct  128  YTLLLTWVADVARDHGVPVALYWIQPAAVLAAYFHYFRGTGGVDRDIAAAAAARDRMAPV  187

Query  612  QLPGLPPLFSGDLPSFLLPSGSGGDYSFAMPTFK  713
            ++PGLPPL   DLPSFL  +     Y+F +  F+
Sbjct  188  RVPGLPPLRLRDLPSFLAIADDDDPYAFVLDAFR  221



>emb|CDY22741.1| BnaA08g05710D [Brassica napus]
Length=444

 Score =   160 bits (405),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 79/180 (44%), Positives = 112/180 (62%), Gaps = 16/180 (9%)
 Frame = +3

Query  204  GIEVTFAT--SVYAHRLMSKANGGGVPDGLNFTAFSDGYDEGFKKN-------HHNVAHY  356
            G+ VTFA   S Y  R+ SK N   VP+ L F  +SDG+D+GFK +             Y
Sbjct  26   GVRVTFAAPISAYNRRMFSKEN---VPENLIFATYSDGHDDGFKSSTSSDKARQDTAGRY  82

Query  357  MSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLPWVSEVARDVNLPSALLWIQPAAVL  536
            MSE++ RG  +L  ++ DN  Q RP T VV+T+LL WV+E+ R+ ++PSALLW+QP  V 
Sbjct  83   MSEMKRRGRETLTELIEDNRLQNRPFTCVVYTILLTWVAELVREFHIPSALLWVQPVTVF  142

Query  537  DIYYYYFHGYEDAFKNAAT-DPNCPVQLPGLPPLFSGDLPSFLLPSGSGGDYSFAMPTFK  713
             I+Y+YF+GY DA    AT DP+  ++LP LP     DLP+F++P+ +   YSF +P F+
Sbjct  143  SIFYHYFNGYADAISEMATNDPSGSIKLPALPQFCLRDLPTFIVPANT---YSFLLPAFR  199



>ref|XP_003524181.2| PREDICTED: anthocyanidin 3-O-glucoside 5-O-glucosyltransferase 
1-like [Glycine max]
Length=488

 Score =   160 bits (406),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 93/204 (46%), Positives = 124/204 (61%), Gaps = 11/204 (5%)
 Frame = +3

Query  114  MVQPHILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANGGGVPDGLNF  293
            M+    LLV +P QG INP+LQFAKRL  +G  VT   ++  HR M+  N   VP GL+ 
Sbjct  27   MLHHRFLLVIYPGQGQINPALQFAKRLTAMGARVTIPITLDMHRRMT--NTTAVP-GLSL  83

Query  294  TAFSDGYDEGF---KKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLP  464
              FSDGYD+GF   +    +   Y SE++ R S  +  ++  +A +G P T +++TLL+P
Sbjct  84   APFSDGYDDGFHAIRGTDSDYNLYASELKRRASVFVSNLILSSANEGHPFTCLLYTLLVP  143

Query  465  WVSEVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATDPNCPVQLPGLP-PLFS  641
            W  +VAR +NLP+A+LWIQPA VLDI Y+YFHGY D + N  T  N  + LPGL   L  
Sbjct  144  WAPQVARGLNLPTAMLWIQPATVLDILYHYFHGYAD-YINDETKEN--IVLPGLSFSLSP  200

Query  642  GDLPSFLLPSGSGGDYSFAMPTFK  713
             D+PSFLL S      SF  P F+
Sbjct  201  RDIPSFLLTSKPSL-LSFVFPLFE  223



>ref|XP_009612650.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like isoform 
X1 [Nicotiana tomentosiformis]
Length=467

 Score =   160 bits (405),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 79/191 (41%), Positives = 112/191 (59%), Gaps = 8/191 (4%)
 Frame = +3

Query  126  HILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANGGGVP--DGLNFTA  299
            H+L+  FP QGHINPS QF+K+L+ LG++VT + S+ A   +       +P  +GL F  
Sbjct  9    HVLIAIFPGQGHINPSFQFSKKLINLGVKVTLSCSLTAFNRIK-----NLPKIEGLTFAP  63

Query  300  FSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLPWVSEV  479
            FSDGYD  FK +  +     S I+T GS  +  ++  NA  G P T V++T+L+ W   V
Sbjct  64   FSDGYDGNFKGSFDDYHLLNSAIKTHGSEFIANLIKSNAENGCPFTRVIYTILMDWAGSV  123

Query  480  ARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATDPNCPVQLPGLPPLFSGDLPSF  659
            A+  N+PS L WIQPA V DIYYY F  + + FKN  +     ++LPGLP L S + PSF
Sbjct  124  AKKFNIPSTLFWIQPATVFDIYYYRFTNFANYFKNFDSQDQI-IELPGLPSLSSSEFPSF  182

Query  660  LLPSGSGGDYS  692
            +       D++
Sbjct  183  VFDDVKSNDWA  193



>dbj|BAA19155.1| glucosyl transferase [Nicotiana tabacum]
Length=467

 Score =   160 bits (404),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 78/193 (40%), Positives = 116/193 (60%), Gaps = 8/193 (4%)
 Frame = +3

Query  120  QPHILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANGGGVP--DGLNF  293
            + H+L+  FP QGHINPSLQF+K+L+ LG++VT ++S+ A   +       +P  +GL F
Sbjct  7    ECHVLIALFPGQGHINPSLQFSKKLINLGVKVTLSSSLSAFNRIK-----NLPKIEGLTF  61

Query  294  TAFSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLPWVS  473
              FSDGYD  FK +  +   + S I++ GS  +  ++   A  G P T V++T+L+ W  
Sbjct  62   APFSDGYDGNFKGSFDDYHLFNSAIKSHGSEFIANLIKSKAKNGYPFTRVIYTILMDWAG  121

Query  474  EVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATDPNCPVQLPGLPPLFSGDLP  653
             VA+ +++PS L WIQPA V DIYYY F  + + FKN  +     ++LPGLP L S D P
Sbjct  122  SVAKKLHIPSTLFWIQPATVFDIYYYRFTNFANYFKNYDSQDQI-IELPGLPSLSSSDFP  180

Query  654  SFLLPSGSGGDYS  692
            SF+       D++
Sbjct  181  SFVFDDVKSNDWA  193



>ref|XP_003629629.1| UDP-glucose glucosyltransferase [Medicago truncatula]
Length=304

 Score =   156 bits (395),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 89/220 (40%), Positives = 125/220 (57%), Gaps = 46/220 (21%)
 Frame = +3

Query  129  ILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANGGGVPDGLNFTAFSD  308
            ILL+ +P QGHINP+ QFAKRLV LG  VT +T+++ H  ++  N   +P+ L++  FSD
Sbjct  8    ILLIPYPVQGHINPTFQFAKRLVALGAHVTLSTTLHMHNRLT--NKPTLPN-LSYLPFSD  64

Query  309  GYDEGFKKN-HHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLPWVSEVAR  485
            GYD+GFK     N  HY SE+   GS  +K ++  N+ +G+P T +VH++LL W ++ AR
Sbjct  65   GYDDGFKATGTENYLHYSSELTRCGSEFIKNLILKNSQEGKPFTFLVHSILLQWAAKTAR  124

Query  486  DVNLPSALLWIQPAA-------------------------------------VLDIYYYY  554
            + +L +ALLW+QPA                                      V DI Y+Y
Sbjct  125  EFHLSTALLWVQPATVFDEKFLDGNVTNMSCINSAVGETIPENNGGRRAKFLVFDIIYHY  184

Query  555  FHGYEDAFKNAATDPNCPVQLPGLP-PLFSGDLPSFLLPS  671
            FHG+ D+ KN    P+C ++LPGLP  L   DLPSFLL S
Sbjct  185  FHGHSDSIKN----PSCSIELPGLPLSLSPRDLPSFLLES  220



>dbj|BAJ95093.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=480

 Score =   159 bits (403),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 87/208 (42%), Positives = 125/208 (60%), Gaps = 11/208 (5%)
 Frame = +3

Query  123  PHILLVTFPAQGHINPSLQFAKRLVRL--GIEVTFATSVYAHRLM------SKANGGGVP  278
            PH L+VT+PAQGHINP+   A RL+R   G  VT +T+V A R M      + A      
Sbjct  11   PHFLVVTYPAQGHINPARHLALRLLRATPGARVTVSTAVSACRKMFPDDADAAAVDHVDA  70

Query  279  DGLNFTAFSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLL  458
             G+ +  +SDGYD GF K+ H+   YMS ++  G+ +L G+++     G P+T VV+T+L
Sbjct  71   AGVRYVPYSDGYDGGFDKSAHDSTDYMSNLKVVGARTLDGVLARLRDAGTPVTQVVYTVL  130

Query  459  LPWVSEVARDVNLPSALLWIQPAAVLDIYYYYFH---GYEDAFKNAATDPNCPVQLPGLP  629
            L WV++VAR   +P+AL WIQPA VL  Y+++F    G + A   AA+DP   V++ GLP
Sbjct  131  LSWVADVARARGVPAALYWIQPATVLAAYFHFFRGTDGLDQAVVTAASDPWADVRVRGLP  190

Query  630  PLFSGDLPSFLLPSGSGGDYSFAMPTFK  713
            P+   DLPSFL  +     Y+F +  F+
Sbjct  191  PMRVRDLPSFLTIASDDHPYAFVLAAFR  218



>ref|XP_009765809.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like isoform 
X1 [Nicotiana sylvestris]
Length=485

 Score =   159 bits (403),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 78/193 (40%), Positives = 116/193 (60%), Gaps = 8/193 (4%)
 Frame = +3

Query  120  QPHILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANGGGVP--DGLNF  293
            + H+L+  FP QGHINPSLQF+K+L+ LG++VT ++S+ A   +       +P  +GL F
Sbjct  25   ECHVLIALFPGQGHINPSLQFSKKLINLGVKVTLSSSLSAFNRIK-----NLPKIEGLTF  79

Query  294  TAFSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLPWVS  473
              FSDGYD  FK +  +   + S I++ GS  +  ++   A  G P T V++T+L+ W  
Sbjct  80   APFSDGYDGNFKGSFDDYHLFNSAIKSHGSEFIANLIKSKAKNGYPFTRVIYTILMDWAG  139

Query  474  EVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATDPNCPVQLPGLPPLFSGDLP  653
             VA+ +++PS L WIQPA V DIYYY F  + + FKN  +     ++LPGLP L S D P
Sbjct  140  SVAKKLHIPSTLFWIQPATVFDIYYYRFTNFANYFKNYDSQDQI-IELPGLPSLSSSDFP  198

Query  654  SFLLPSGSGGDYS  692
            SF+       D++
Sbjct  199  SFVFDDVKSNDWA  211



>ref|XP_003524180.1| PREDICTED: anthocyanidin 3-O-glucoside 5-O-glucosyltransferase-like 
[Glycine max]
Length=460

 Score =   159 bits (401),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 94/201 (47%), Positives = 128/201 (64%), Gaps = 7/201 (3%)
 Frame = +3

Query  114  MVQPHILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANGGGVPDGLNF  293
            M +   L+V +PAQGHINP+ QFAKRLV LG  VT +T+V+ HR ++  N   +P  L+F
Sbjct  1    MFRHRFLIVMYPAQGHINPAFQFAKRLVSLGAHVTVSTTVHMHRRIT--NKPTLPH-LSF  57

Query  294  TAFSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLPWVS  473
              FSDGYD+G+     + A   SE + RGS  +  +++  A +G P T +VHT+LLPW +
Sbjct  58   LPFSDGYDDGYTST--DYALQASEFKRRGSEFVTNLIASKAQEGHPFTCLVHTVLLPWAA  115

Query  474  EVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATDPNCPVQLPGLPPLFSG-DL  650
              AR  +LP+ALLW QPA +LDI+Y YFH + D  K    DP+  ++LPGLP L +  DL
Sbjct  116  RAARGFHLPTALLWTQPATILDIFYCYFHEHGDYIKGKIKDPSSSIELPGLPLLLAPRDL  175

Query  651  PSFLLPSGSGGDYSFAMPTFK  713
            PSFLL S    D S A+  F+
Sbjct  176  PSFLLGSNPTID-SLAVSMFE  195



>gb|AFW77394.1| hypothetical protein ZEAMMB73_095823 [Zea mays]
Length=491

 Score =   159 bits (401),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 91/211 (43%), Positives = 117/211 (55%), Gaps = 14/211 (7%)
 Frame = +3

Query  120  QPHILLVTFPAQGHINPSLQFAKRL--VRLGIEVTFATSVYAHRLM---------SKANG  266
            Q H L+VT+PAQGHI P+   A+RL  V  G  VT    + A R M         ++   
Sbjct  8    QHHFLIVTYPAQGHITPARHLARRLGSVCRGARVTICAPLSAFRKMFPGAAGVTVTEEEC  67

Query  267  GGVPDGLNFTAFSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVV  446
            G     + + A+SDGYD GF     + A YM + R  GS SL G++      GRP+T  V
Sbjct  68   GDGDAKVKYVAYSDGYDGGFDIAVDSYARYMEQARMAGSRSLAGVLRRLRDDGRPVTCAV  127

Query  447  HTLLLPWVSEVARDVNL-PSALLWIQPAAVLDIYYYYFHGYEDAFKNAAT--DPNCPVQL  617
            +TLLLPWV+ VARD  +  +A+ WIQPA  L  YY+YF G+ DA   AA   DP   V L
Sbjct  128  YTLLLPWVAGVARDHGVAATAVFWIQPATALTAYYHYFRGHRDAVVAAAASGDPCAEVGL  187

Query  618  PGLPPLFSGDLPSFLLPSGSGGDYSFAMPTF  710
            PGLPPL   DLPSFL  +     ++F +P F
Sbjct  188  PGLPPLRVRDLPSFLAVTSEDDPFAFVLPEF  218



>ref|XP_004140483.1| PREDICTED: UDP-glycosyltransferase 75D1-like [Cucumis sativus]
 ref|XP_004162374.1| PREDICTED: UDP-glycosyltransferase 75D1-like [Cucumis sativus]
 gb|KGN46580.1| UDP-glucose:flavonoid 7-O-glucosyltransferase [Cucumis sativus]
Length=467

 Score =   158 bits (399),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 95/202 (47%), Positives = 134/202 (66%), Gaps = 15/202 (7%)
 Frame = +3

Query  126  HILLVTFPAQGHINPSLQFAKRLVRLG-IEVTFATSVYAHRLMSKANGGGVPD--GLNFT  296
            H+LLVT  AQGHINP+LQ AKRL R G + VTF  S+ A+R M     G  P    + F 
Sbjct  12   HVLLVTHCAQGHINPTLQLAKRLTRHGDLHVTFLISLSAYRRM-----GHTPTLPHITFA  66

Query  297  AFSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLPWVSE  476
            +FSDGYD+GFK +  ++  Y+SE+  RGS +LK I+ ++  +G+P T +V+++L+PWV+ 
Sbjct  67   SFSDGYDDGFKPSD-DIKLYISELERRGSDALKNIIQESRNKGQPFTCIVYSILIPWVAT  125

Query  477  VARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAAT--DP-NCPVQLPGLPPLFSGD  647
            VAR +++ S  LWIQPA V  +YYYY +GY D  +  A+  DP +  ++LPGLP L + D
Sbjct  126  VARSLDVASVHLWIQPAVVFALYYYYNNGYYDEIQRIASGDDPSSTSIKLPGLPLLSARD  185

Query  648  LPSFLLPSGSGGDYSFAMPTFK  713
            LPSF    G+   YSFA+P F+
Sbjct  186  LPSFF---GASDGYSFALPMFR  204



>ref|XP_008649430.1| PREDICTED: cyanidin 3-O-rutinoside 5-O-glucosyltransferase-like 
[Zea mays]
Length=518

 Score =   159 bits (401),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 91/211 (43%), Positives = 117/211 (55%), Gaps = 14/211 (7%)
 Frame = +3

Query  120  QPHILLVTFPAQGHINPSLQFAKRL--VRLGIEVTFATSVYAHRLM---------SKANG  266
            Q H L+VT+PAQGHI P+   A+RL  V  G  VT    + A R M         ++   
Sbjct  35   QHHFLIVTYPAQGHITPARHLARRLGSVCRGARVTICAPLSAFRKMFPGAAGVTVTEEEC  94

Query  267  GGVPDGLNFTAFSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVV  446
            G     + + A+SDGYD GF     + A YM + R  GS SL G++      GRP+T  V
Sbjct  95   GDGDAKVKYVAYSDGYDGGFDIAVDSYARYMEQARMAGSRSLAGVLRRLRDDGRPVTCAV  154

Query  447  HTLLLPWVSEVARDVNL-PSALLWIQPAAVLDIYYYYFHGYEDAFKNAAT--DPNCPVQL  617
            +TLLLPWV+ VARD  +  +A+ WIQPA  L  YY+YF G+ DA   AA   DP   V L
Sbjct  155  YTLLLPWVAGVARDHGVAATAVFWIQPATALTAYYHYFRGHRDAVVAAAASGDPCAEVGL  214

Query  618  PGLPPLFSGDLPSFLLPSGSGGDYSFAMPTF  710
            PGLPPL   DLPSFL  +     ++F +P F
Sbjct  215  PGLPPLRVRDLPSFLAVTSEDDPFAFVLPEF  245



>ref|XP_008458144.1| PREDICTED: anthocyanidin 3-O-glucoside 5-O-glucosyltransferase 
1-like [Cucumis melo]
Length=468

 Score =   158 bits (399),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 96/203 (47%), Positives = 135/203 (67%), Gaps = 16/203 (8%)
 Frame = +3

Query  126  HILLVTFPAQGHINPSLQFAKRLVRLG-IEVTFATSVYAHRLMSKANGGGVPD--GLNFT  296
             +LL+T+ AQGHINP+LQ AKRL+R G + VTF TS+ A+R M     G  P    L+F 
Sbjct  11   RVLLITYSAQGHINPTLQLAKRLIRHGDLHVTFLTSLSAYRRM-----GQTPTLPHLSFA  65

Query  297  AFSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLPWVSE  476
            +FSDGYD+GFK    ++ HY+SE+   GS +LK I+ ++  QG+P T +V+++LLPWV+ 
Sbjct  66   SFSDGYDDGFKPGD-DIDHYVSELERCGSDALKNIIQESRNQGQPFTCIVYSILLPWVAT  124

Query  477  VARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKN--AATDP--NCPVQLPGLPPLFSG  644
            VAR +++ S LLWIQPA V  +YYYYF+GY D  +   +  DP  +  ++LPGLP L + 
Sbjct  125  VARSLDVASVLLWIQPAVVFALYYYYFNGYYDEIQRIISGDDPGSSMSIKLPGLPLLSAR  184

Query  645  DLPSFLLPSGSGGDYSFAMPTFK  713
            DLPSF    G    Y+FA+  F+
Sbjct  185  DLPSFF---GGSDVYAFALIIFR  204



>emb|CDM81835.1| unnamed protein product [Triticum aestivum]
Length=479

 Score =   158 bits (399),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 88/208 (42%), Positives = 123/208 (59%), Gaps = 11/208 (5%)
 Frame = +3

Query  123  PHILLVTFPAQGHINPSLQFAKRLVRL--GIEVTFATSVYAHRLM------SKANGGGVP  278
            PH L+VT+PAQGHINP+   A RL+R   G  VT +T+V A R M      + A      
Sbjct  8    PHFLVVTYPAQGHINPARHLALRLLRATPGARVTVSTAVSACRKMFPDDADAAAVDHVDA  67

Query  279  DGLNFTAFSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLL  458
             G+ +  +SDGYD GF K+ H+  HYMS ++  G+ +L G+++     G P+T VV+T+L
Sbjct  68   AGVRYVPYSDGYDGGFDKSAHDNMHYMSNLKVVGARTLDGVLARLRDAGTPVTQVVYTVL  127

Query  459  LPWVSEVARDVNLPSALLWIQPAAVLDIYYYYFH---GYEDAFKNAATDPNCPVQLPGLP  629
            L WV++VAR   +P+AL WIQPA VL  Y+++F    G + A   A  DP   V + GLP
Sbjct  128  LSWVADVARGHGVPAALYWIQPATVLAAYFHFFRGTDGLDQAVTAATGDPWADVPVRGLP  187

Query  630  PLFSGDLPSFLLPSGSGGDYSFAMPTFK  713
            P+   DLPSFL  +     YSF +  F+
Sbjct  188  PMRVRDLPSFLTIASDDHPYSFVLAAFR  215



>emb|CDY09070.1| BnaC08g10240D [Brassica napus]
Length=437

 Score =   157 bits (396),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 86/204 (42%), Positives = 117/204 (57%), Gaps = 24/204 (12%)
 Frame = +3

Query  111  AMVQPHILLVTFPAQGHINPSLQFAKRLV--RLGIEVTFATSVYAHRLMSKANGGGVPDG  284
            ++  PH LLVTFPAQGHINPSL+ AKRLV    G  VTFA +  A+    +       D 
Sbjct  10   SLTGPHFLLVTFPAQGHINPSLELAKRLVGTITGARVTFAATDSAYNRSHE-------DY  62

Query  285  LNFTAFSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLP  464
            +  +  SD               YMS  R RG  +L G++ DN  Q RP T VV+T+ LP
Sbjct  63   IKSSTSSD-----------RSRQYMSATRRRGRETLTGLIEDNRRQNRPFTCVVYTIFLP  111

Query  465  WVSEVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAAT-DPNCPVQLPGLPPLFS  641
            WV+E+AR+ ++PSALLW+QP  V  I+Y+YF+GY DA     T +P+  + LP LP    
Sbjct  112  WVAELAREFHIPSALLWVQPVTVFSIFYHYFNGYADAISEMTTNNPSGAINLPSLPQFSL  171

Query  642  GDLPSFLLPSGSGGDYSFAMPTFK  713
             DLP+ + PS     Y+F +P ++
Sbjct  172  RDLPTIIFPSDP---YTFLVPAYQ  192



>ref|XP_004229323.2| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Solanum 
lycopersicum]
Length=467

 Score =   157 bits (396),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 80/192 (42%), Positives = 116/192 (60%), Gaps = 5/192 (3%)
 Frame = +3

Query  120  QPHILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLMSKANGGGVPDGLNFTA  299
            + H+L+  FP QG INP LQF+K+L+ LGI VT  TS+ A    SK       +GL+F  
Sbjct  8    KSHVLIALFPGQGQINPCLQFSKQLINLGIGVTLTTSLSA---FSKLKCLPNVEGLSFAP  64

Query  300  FSDGYDEGFKKNHHNVAH-YMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLPWVSE  476
            FSDGYD  F+ +  +  H + S +++ GS  +  ++  NA  G P + V++T+++ WV  
Sbjct  65   FSDGYDGQFQLSSVDDFHMFYSSVKSHGSKFIFNLIQSNAKNGTPFSHVIYTIIMEWVGL  124

Query  477  VARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATDPNCPVQLPGLPPLFSGDLPS  656
            VA+ +N+PS L WIQPA V D+YYY F  Y D FKN     N  ++LPGLPPL   D PS
Sbjct  125  VAKKINIPSTLFWIQPATVFDVYYYRFTDYSDYFKNNDA-KNKIIELPGLPPLSPIDFPS  183

Query  657  FLLPSGSGGDYS  692
            F+  +    +++
Sbjct  184  FVFDNVESSNWA  195



>ref|XP_010230853.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Brachypodium 
distachyon]
Length=495

 Score =   157 bits (396),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 83/187 (44%), Positives = 111/187 (59%), Gaps = 6/187 (3%)
 Frame = +3

Query  120  QPHILLVTFPAQGHINPSLQFAKRLVRLGIEVTFATSVYAHRLM-----SKANGGGVPDG  284
            QPH+L VT P QGHINP  + A R+    + VT +T+V  HR M     S        +G
Sbjct  13   QPHLLFVTSPLQGHINPVRRLAARVAGAAL-VTVSTAVSGHRRMFPSLASPDEEAIEGNG  71

Query  285  LNFTAFSDGYDEGFKKNHHNVAHYMSEIRTRGSSSLKGIVSDNAAQGRPITAVVHTLLLP  464
            +    +SDG+DEGF    H+V  Y    R  G  +L G+V+  A +GRP+T VV+T L+P
Sbjct  72   MLHAPYSDGFDEGFDPEIHDVRSYGPRARAVGCETLSGVVARLARRGRPVTRVVYTFLVP  131

Query  465  WVSEVARDVNLPSALLWIQPAAVLDIYYYYFHGYEDAFKNAATDPNCPVQLPGLPPLFSG  644
            W  +VAR   +P+AL WIQPAAV  +YY++FHG+E    + A D +  V LPGLPPL   
Sbjct  132  WAPDVARAHGVPAALFWIQPAAVFAVYYHFFHGHEAVLASCADDEDGIVSLPGLPPLRPR  191

Query  645  DLPSFLL  665
             LPS +L
Sbjct  192  ALPSIVL  198



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1246782646395