BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF044L10

Length=809
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009781070.1|  PREDICTED: F-box protein SKIP14-like             75.9    3e-22   Nicotiana sylvestris
ref|XP_009601967.1|  PREDICTED: F-box protein SKIP14-like             73.2    8e-21   Nicotiana tomentosiformis
ref|XP_006338669.1|  PREDICTED: F-box protein SKIP14-like             63.5    3e-18   Solanum tuberosum [potatoes]
ref|XP_009609002.1|  PREDICTED: F-box protein SKIP14-like             61.2    8e-17   Nicotiana tomentosiformis
ref|XP_004231801.1|  PREDICTED: F-box protein SKIP14-like             55.8    2e-15   Solanum lycopersicum
ref|XP_009762551.1|  PREDICTED: F-box protein SKIP14-like             54.3    2e-14   Nicotiana sylvestris
emb|CDP16655.1|  unnamed protein product                              63.9    2e-11   Coffea canephora [robusta coffee]
gb|KDP46340.1|  hypothetical protein JCGZ_10180                       46.6    1e-08   Jatropha curcas
ref|XP_007044981.1|  Ribonuclease inhibitor                           45.1    3e-07   
emb|CBI40086.3|  unnamed protein product                              44.7    5e-07   Vitis vinifera
ref|XP_002270874.1|  PREDICTED: F-box protein SKIP14                  44.7    5e-07   Vitis vinifera
ref|XP_010250852.1|  PREDICTED: F-box protein SKIP14                  43.9    3e-06   Nelumbo nucifera [Indian lotus]
ref|XP_006338882.1|  PREDICTED: F-box protein SKIP14-like             40.0    2e-05   Solanum tuberosum [potatoes]
gb|KDO82040.1|  hypothetical protein CISIN_1g011064mg                 40.0    8e-05   Citrus sinensis [apfelsine]
ref|XP_006484028.1|  PREDICTED: F-box protein SKIP14-like             40.0    8e-05   Citrus sinensis [apfelsine]
emb|CDX83577.1|  BnaC07g23170D                                        42.7    9e-05   
ref|XP_004237240.1|  PREDICTED: F-box protein SKIP14-like             37.7    1e-04   
ref|XP_006438126.1|  hypothetical protein CICLE_v10031334mg           40.0    2e-04   Citrus clementina [clementine]
gb|KJB31017.1|  hypothetical protein B456_005G172600                  38.5    4e-04   Gossypium raimondii
ref|XP_010554227.1|  PREDICTED: F-box protein SKIP14-like             39.3    4e-04   Tarenaya hassleriana [spider flower]
ref|XP_010248857.1|  PREDICTED: F-box protein SKIP14                  40.0    5e-04   Nelumbo nucifera [Indian lotus]
ref|XP_009359303.1|  PREDICTED: F-box protein SKIP14                  35.8    7e-04   Pyrus x bretschneideri [bai li]
ref|XP_008368270.1|  PREDICTED: F-box protein SKIP14-like             36.2    7e-04   
ref|XP_008340160.1|  PREDICTED: F-box protein SKIP14-like             36.2    8e-04   



>ref|XP_009781070.1| PREDICTED: F-box protein SKIP14-like [Nicotiana sylvestris]
Length=503

 Score = 75.9 bits (185),  Expect(2) = 3e-22, Method: Compositional matrix adjust.
 Identities = 50/117 (43%), Positives = 68/117 (58%), Gaps = 3/117 (3%)
 Frame = +3

Query  453  KVDDQLFAGFDFVLNGSKRIHPESGAEKMNENSGVGAMDFGNGEFDGHVFSDCEMDETMD  632
            +VD Q+F   + VLNGS RIH + G + + ENS    +D G G  D     D EM+E ++
Sbjct  137  EVDTQMFTELNIVLNGSMRIHQDVGVQNIGENSYASEIDIGEGLHDSFGCMDVEMEEIIN  196

Query  633  FSYEKYWIFYDEINKReglpgegfqgeggsppDALPLALYRLGVEDLLFVEQVCKSF  803
             S   YW+F D  +K +    +   G+GG+P DAL LAL  LG+ DLL VE+VCK  
Sbjct  197  SS---YWVFRDAAHKDQSGVNDHRNGDGGAPSDALFLALSYLGLRDLLSVERVCKPL  250


 Score = 57.0 bits (136),  Expect(2) = 3e-22, Method: Compositional matrix adjust.
 Identities = 37/108 (34%), Positives = 50/108 (46%), Gaps = 33/108 (31%)
 Frame = +2

Query  191  MALNQGGSFCSGINFQ--NRRFSEDRPDKNRDCFGKSWGL--------------------  304
            MA+NQ   F +G+ F   NR F  + P++  DCFG  WGL                    
Sbjct  1    MAVNQHEQFLAGLEFDRCNRYFDRECPNEKLDCFGDFWGLNCEIENLHDHNKAGKTKMVS  60

Query  305  ----------DCGKGNFQGNRKEEIRNAS-DDVADLLPQDPFDMNIDT  415
                      +C KG+F+    E+ +  S DD+ DLLPQDPF M+I T
Sbjct  61   DDISDFWGLKNCEKGSFRDREDEKTKMVSDDDIVDLLPQDPFGMDIST  108



>ref|XP_009601967.1| PREDICTED: F-box protein SKIP14-like [Nicotiana tomentosiformis]
Length=503

 Score = 73.2 bits (178),  Expect(2) = 8e-21, Method: Compositional matrix adjust.
 Identities = 49/117 (42%), Positives = 67/117 (57%), Gaps = 3/117 (3%)
 Frame = +3

Query  453  KVDDQLFAGFDFVLNGSKRIHPESGAEKMNENSGVGAMDFGNGEFDGHVFSDCEMDETMD  632
            +VD Q+FA  + VLNG+ RIH + G + + ENS    +D G G  D     D EM+E ++
Sbjct  137  EVDAQMFAELNIVLNGAMRIHQDVGVQNIGENSYASEIDIGEGLCDSFGCMDVEMEEIIN  196

Query  633  FSYEKYWIFYDEINKReglpgegfqgeggsppDALPLALYRLGVEDLLFVEQVCKSF  803
             S   YW+F D   K +    +   G+GG+P DAL LAL  L + DLL VE+VCK  
Sbjct  197  SS---YWVFRDAAQKDQSGMNDHRNGDGGTPSDALFLALSYLCLRDLLSVERVCKPL  250


 Score = 55.1 bits (131),  Expect(2) = 8e-21, Method: Compositional matrix adjust.
 Identities = 38/108 (35%), Positives = 47/108 (44%), Gaps = 33/108 (31%)
 Frame = +2

Query  191  MALNQGGSFCSGINFQ--NRRFSEDRPDKNRDCFGKSWGLDCGKGNFQGNRK--------  340
            MALNQ   F +G+ F   NR F  + P++  DC G  WGL+C   NF  + K        
Sbjct  1    MALNQHERFLAGLEFDRCNRYFDRECPNEKLDCSGDFWGLNCEVENFHDHNKTGKTKMVS  60

Query  341  ----------------------EEIRNAS-DDVADLLPQDPFDMNIDT  415
                                  EE +  S DD+ DLLPQDPF M I T
Sbjct  61   DDISDFWGLKNCEKGSFRDPEDEETKMVSDDDIVDLLPQDPFGMGIST  108



>ref|XP_006338669.1| PREDICTED: F-box protein SKIP14-like [Solanum tuberosum]
Length=491

 Score = 63.5 bits (153),  Expect(2) = 3e-18, Method: Compositional matrix adjust.
 Identities = 37/109 (34%), Positives = 52/109 (48%), Gaps = 28/109 (26%)
 Frame = +2

Query  191  MALNQGGSFCSGINFQNRRFSEDRPDKNRDCFGKSWGLD---------------------  307
            M+LN+   F +G    N  F ++ P++  D FG  WGL+                     
Sbjct  3    MSLNREEGFLAGTKLDNNYFDKEYPNEKLDRFGDFWGLNREIDKFHDHKSGKTEMVSDDI  62

Query  308  -------CGKGNFQGNRKEEIRNASDDVADLLPQDPFDMNIDTIEIGFV  433
                   C KGNFQ ++ E  +  SDD+ DLLPQDPFDM+I T   G++
Sbjct  63   SDFWELNCEKGNFQDHKDENTKMGSDDIVDLLPQDPFDMDISTKITGWL  111


 Score = 55.8 bits (133),  Expect(2) = 3e-18, Method: Compositional matrix adjust.
 Identities = 43/117 (37%), Positives = 65/117 (56%), Gaps = 13/117 (11%)
 Frame = +3

Query  453  KVDDQLFAGFDFVLNGSKRIHPESGAEKMNENSGVGAMDFGNGEFDGHVFSDCEMDETMD  632
            +VD QL+A F+ V+ G+ R+H + G     ENS V  +D G G     +  D E+++ M+
Sbjct  131  EVDVQLYAEFNIVVKGAIRVHQDVG-----ENSYVSEIDIGEG-----LPMDVEIEDVMN  180

Query  633  FSYEKYWIFYDEINKReglpgegfqgeggsppDALPLALYRLGVEDLLFVEQVCKSF  803
              Y   W+F D   + +    +    +GG+P DAL L+L  LG+ DLL VE VCK+ 
Sbjct  181  SCY---WVFRDAAQEDQSGMNDLCDADGGAPSDALYLSLNYLGLRDLLSVEGVCKAL  234



>ref|XP_009609002.1| PREDICTED: F-box protein SKIP14-like [Nicotiana tomentosiformis]
Length=473

 Score = 61.2 bits (147),  Expect(2) = 8e-17, Method: Compositional matrix adjust.
 Identities = 36/77 (47%), Positives = 45/77 (58%), Gaps = 3/77 (4%)
 Frame = +3

Query  438  KIGVGKVDDQLFAGFDFVLNGSKRIHPESGAEKMNENSGVGAMDFGNGEFDGHVFSDCEM  617
            +I V  VDD L A  DFVL+G+ RIH ++G  K + N  +  MD   G   GH   + E 
Sbjct  105  EIEVKGVDDHLLAELDFVLSGTVRIHQDAG--KTDGNCELFGMDLSEGLEGGHGLMN-EK  161

Query  618  DETMDFSYEKYWIFYDE  668
             E MDFSYEKYWI  D+
Sbjct  162  TEIMDFSYEKYWILRDD  178


 Score = 53.5 bits (127),  Expect(2) = 8e-17, Method: Compositional matrix adjust.
 Identities = 30/80 (38%), Positives = 41/80 (51%), Gaps = 0/80 (0%)
 Frame = +2

Query  191  MALNQGGSFCSGINFQNRRFSEDRPDKNRDCFGKSWGLDCGKGNFQGNRKEEIRNASDDV  370
            MALNQ   + + I F N    E   +   D F   WGL+C  G     +  +    SD++
Sbjct  1    MALNQEEGYLTRIGFDNGCSVERCLNDKVDGFSDFWGLNCEMGELYDYKGGKANKGSDNI  60

Query  371  ADLLPQDPFDMNIDTIEIGF  430
            ADLLPQDPF+M++ T   G 
Sbjct  61   ADLLPQDPFNMDVTTKGTGL  80



>ref|XP_004231801.1| PREDICTED: F-box protein SKIP14-like [Solanum lycopersicum]
Length=489

 Score = 55.8 bits (133),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 50/109 (46%), Gaps = 28/109 (26%)
 Frame = +2

Query  191  MALNQGGSFCSGINFQNRRFSEDRPDKNRDCFGKSWGL----------------------  304
            M+LN+     +G    N  F ++ P++  D FG  WGL                      
Sbjct  1    MSLNREERILAGTKLDNSYFDKEYPNEKLDRFGDFWGLKREIDKVHDHKSEKIEMVSDDI  60

Query  305  ------DCGKGNFQGNRKEEIRNASDDVADLLPQDPFDMNIDTIEIGFV  433
                  +C KG+F  ++ E  +  SDD+ DLLPQDPFDM+I T   G++
Sbjct  61   SDFWDLNCEKGSFPDHKDENSKMGSDDIVDLLPQDPFDMDISTKITGWL  109


 Score = 54.3 bits (129),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 44/117 (38%), Positives = 64/117 (55%), Gaps = 13/117 (11%)
 Frame = +3

Query  453  KVDDQLFAGFDFVLNGSKRIHPESGAEKMNENSGVGAMDFGNGEFDGHVFSDCEMDETMD  632
            +VD QL+A F+ V+ G+ R+H + G     ENS V  +D G G     +  D E+++ M+
Sbjct  129  EVDVQLYAEFNIVVKGAIRVHHDVG-----ENSYVSEIDLGEG-----LPMDVEIEDIMN  178

Query  633  FSYEKYWIFYDEINKReglpgegfqgeggsppDALPLALYRLGVEDLLFVEQVCKSF  803
              Y   W F D   + +    +    +GGSP DAL L+L  LG+ DLL VE VCK+ 
Sbjct  179  SCY---WAFRDAAQEDQSGMNDHCDADGGSPSDALYLSLNYLGLRDLLSVEGVCKAL  232



>ref|XP_009762551.1| PREDICTED: F-box protein SKIP14-like [Nicotiana sylvestris]
 ref|XP_009762558.1| PREDICTED: F-box protein SKIP14-like [Nicotiana sylvestris]
Length=473

 Score = 54.3 bits (129),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 33/77 (43%), Positives = 42/77 (55%), Gaps = 3/77 (4%)
 Frame = +3

Query  438  KIGVGKVDDQLFAGFDFVLNGSKRIHPESGAEKMNENSGVGAMDFGNGEFDGHVFSDCEM  617
            +I V  VDD L A  DFVL+G+ RIH ++G  K + N  +  MD   G   GH   +   
Sbjct  105  EIEVKGVDDHLLAELDFVLSGTVRIHQDAG--KTDGNCELFGMDLSEGLEGGHGLMNGNT  162

Query  618  DETMDFSYEKYWIFYDE  668
             E M FSYE YWI  D+
Sbjct  163  -EIMGFSYENYWILRDD  178


 Score = 52.4 bits (124),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 41/81 (51%), Gaps = 0/81 (0%)
 Frame = +2

Query  191  MALNQGGSFCSGINFQNRRFSEDRPDKNRDCFGKSWGLDCGKGNFQGNRKEEIRNASDDV  370
            MALNQ   + + I F N    E   +     FG  WGL+C        +  +    SDD+
Sbjct  1    MALNQEEGYLTRIGFDNGCSVERCLNDKVGGFGDFWGLNCEMEELYDYKGGKANKGSDDI  60

Query  371  ADLLPQDPFDMNIDTIEIGFV  433
            ADLLPQDPF+M++ T   G +
Sbjct  61   ADLLPQDPFNMDVTTKGTGLM  81



>emb|CDP16655.1| unnamed protein product [Coffea canephora]
Length=458

 Score = 63.9 bits (154),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 46/121 (38%), Positives = 62/121 (51%), Gaps = 9/121 (7%)
 Frame = +3

Query  447  VGKVDDQLFAGFDFVLNGSKRIHPESGAEKMNENSGVGAMDFGNGEFDGHVFSDCEMDET  626
            V KVDDQ  A  + V N + R+HP+ G  K  + S V +M+ G       + +D   ++ 
Sbjct  92   VEKVDDQFLAELNIVWNSATRLHPDLGDIKAYKESSVSSMELG-------LCNDPNKEDF  144

Query  627  MDFSYEKYWIFYDEINKReglpgegfqge--ggsppDALPLALYRLGVEDLLFVEQVCKS  800
            M FS+EKY   +D  NK +             G PPDAL  +L  LG  DLL VE+VCKS
Sbjct  145  MGFSFEKYCTPWDAANKHKSASPAKNVSSGVRGPPPDALFFSLGYLGARDLLSVEKVCKS  204

Query  801  F  803
             
Sbjct  205  L  205


 Score = 32.7 bits (73),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 43/87 (49%), Gaps = 15/87 (17%)
 Frame = +2

Query  221  SGINFQ-NRRFSEDRPDKNRDCFGKSWGLDCGKGNFQGNRKEEIRNASDDVADLLPQDPF  397
            SGI+F  N    E  P +N      S G D    N +  + +++ ++ D++ DLLP+DPF
Sbjct  6    SGIHFHTNGSLVERCPGEN------SKGFDSYDYNNREGKGDKL-SSDDEIVDLLPRDPF  58

Query  398  DMNIDTIEIG-------FVIENWGWES  457
             M+I             F +EN G+ES
Sbjct  59   GMDISATFTAITGWIEDFGLENLGFES  85



>gb|KDP46340.1| hypothetical protein JCGZ_10180 [Jatropha curcas]
Length=445

 Score = 46.6 bits (109),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 42/120 (35%), Positives = 55/120 (46%), Gaps = 21/120 (18%)
 Frame = +3

Query  456  VDDQLFAGFDFVLNGSKRIHPESGAEKMNENSGVGAMDFGNGEFDG----HVFSDCEMDE  623
            VDD+LF G D  LNG+  + PE G      N   GA+   +   +G    H  ++C  D 
Sbjct  88   VDDELFEGLDLFLNGAMEMQPEKG------NLTFGAISIRDHGLEGFLVDHGLNNCGFDS  141

Query  624  TMDFSYEKYWIFYDEINKReglpgegfqgeggsppDALPLALYRLGVEDLLFVEQVCKSF  803
              +   E  +    E+             EGG P DAL  AL  LGV+DLL VE+VCK  
Sbjct  142  KYNLGDEGVFDKRKELQ-----------VEGGDPHDALFFALSYLGVKDLLVVERVCKPL  190


 Score = 40.8 bits (94),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/73 (40%), Positives = 35/73 (48%), Gaps = 13/73 (18%)
 Frame = +2

Query  269  KNRDCFGKSWG-------LDCGKGNFQGNRKEEIRNAS----DDVADLLPQDPFDMNIDT  415
            KN D  G SW        L+  K N QG  K E+   S    DD+ADLLP DPF M+I +
Sbjct  3    KNLDKVGSSWSFRSFDLNLNVEKSNNQGMEKPELEGCSKVFSDDIADLLPVDPFGMDIKS  62

Query  416  IEIGFVIENWGWE  454
                  I+ W  E
Sbjct  63   TVTA--IKGWLQE  73



>ref|XP_007044981.1| Ribonuclease inhibitor [Theobroma cacao]
 gb|EOY00813.1| Ribonuclease inhibitor [Theobroma cacao]
Length=496

 Score = 45.1 bits (105),  Expect(2) = 3e-07, Method: Compositional matrix adjust.
 Identities = 27/72 (38%), Positives = 35/72 (49%), Gaps = 7/72 (10%)
 Frame = +2

Query  221  SGINFQNRRFSEDRPDKNRDCFGKSWGLDCGKGNF-------QGNRKEEIRNASDDVADL  379
            S +   N    E  P+KN D F KSW L+C   +         G R     + S+D+ DL
Sbjct  22   SPMRIANGYLVEGIPEKNGDGFSKSWHLNCEVEDCFDYGRDRSGERCGSQESVSNDILDL  81

Query  380  LPQDPFDMNIDT  415
            LP DPF M+I T
Sbjct  82   LPSDPFGMDITT  93


 Score = 37.0 bits (84),  Expect(2) = 3e-07, Method: Compositional matrix adjust.
 Identities = 41/133 (31%), Positives = 57/133 (43%), Gaps = 15/133 (11%)
 Frame = +3

Query  438  KIGVGKVDDQLFAGFDFVLNGSKRIHPESGAEKMNENSGV-----GAMDFGNGEFDGHVF  602
            ++G G    QLFAG +F+ N + R     G+        V     G      GE   HV 
Sbjct  116  EVGTGDGSYQLFAGLNFIWNNAMRFQTFPGSMGFECKGSVSGGFGGCSQVKEGE---HVP  172

Query  603  ------SDCEMDETMDFSYEKYWIFYDEINKReglpgegfqgeggsppDALPLALYRLGV  764
                  S C +++   F  E   +  D+ N+          G+ G+P +AL LAL  LGV
Sbjct  173  GCAGLGSACNVEDIFAFGNEDL-VSVDQENEEFQDCEVCSDGDEGAPHEALILALGYLGV  231

Query  765  EDLLFVEQVCKSF  803
             DL  VE+VC S 
Sbjct  232  RDLFAVEKVCTSL  244



>emb|CBI40086.3| unnamed protein product [Vitis vinifera]
Length=489

 Score = 44.7 bits (104),  Expect(2) = 5e-07, Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 42/89 (47%), Gaps = 9/89 (10%)
 Frame = +2

Query  191  MALNQGGS---FCSGINFQNRRFSEDRPDKNRDCFGKSWGLDCGKGNFQGNR-----KE-  343
            M LN GG      S +NF N  F +   DK+ D FG    +DC   N Q  R     KE 
Sbjct  1    MELNFGGEGKGMFSSVNFINGYFVDGFGDKSLDGFGNLLNMDCESDNPQDRRMGKSEKEG  60

Query  344  EIRNASDDVADLLPQDPFDMNIDTIEIGF  430
                 SDD+ D LP DPF+M+I T    F
Sbjct  61   SCEAVSDDIVDRLPADPFNMDIRTTFTAF  89


 Score = 36.6 bits (83),  Expect(2) = 5e-07, Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 53/121 (44%), Gaps = 15/121 (12%)
 Frame = +3

Query  459  DDQLFAGFDFVLNGSKRIHPE-SGAEKMNENSGVGAMDFGNGEFDGHV----FSDCEMDE  623
            D  L+A  + V +G+ R  PE S AEK               EFDG +      D    E
Sbjct  117  DRGLYANLNLVWSGAMRFQPEFSNAEK----------SVPCNEFDGLLMDKDLCDGGFSE  166

Query  624  TMDFSYEKYWIFYDEINKReglpgegfqgeggsppDALPLALYRLGVEDLLFVEQVCKSF  803
             + FS     I  ++  + +         E G P DAL  +L  LGV+DLL VE+VC+S 
Sbjct  167  FLSFSRHGNRINGNQEKEFQACTKVHPDDETGEPHDALFFSLAYLGVQDLLVVERVCRSL  226

Query  804  A  806
             
Sbjct  227  C  227



>ref|XP_002270874.1| PREDICTED: F-box protein SKIP14 [Vitis vinifera]
Length=480

 Score = 44.7 bits (104),  Expect(2) = 5e-07, Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 42/89 (47%), Gaps = 9/89 (10%)
 Frame = +2

Query  191  MALNQGGS---FCSGINFQNRRFSEDRPDKNRDCFGKSWGLDCGKGNFQGNR-----KE-  343
            M LN GG      S +NF N  F +   DK+ D FG    +DC   N Q  R     KE 
Sbjct  1    MELNFGGEGKGMFSSVNFINGYFVDGFGDKSLDGFGNLLNMDCESDNPQDRRMGKSEKEG  60

Query  344  EIRNASDDVADLLPQDPFDMNIDTIEIGF  430
                 SDD+ D LP DPF+M+I T    F
Sbjct  61   SCEAVSDDIVDRLPADPFNMDIRTTFTAF  89


 Score = 36.6 bits (83),  Expect(2) = 5e-07, Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 53/121 (44%), Gaps = 15/121 (12%)
 Frame = +3

Query  459  DDQLFAGFDFVLNGSKRIHPE-SGAEKMNENSGVGAMDFGNGEFDGHV----FSDCEMDE  623
            D  L+A  + V +G+ R  PE S AEK               EFDG +      D    E
Sbjct  117  DRGLYANLNLVWSGAMRFQPEFSNAEK----------SVPCNEFDGLLMDKDLCDGGFSE  166

Query  624  TMDFSYEKYWIFYDEINKReglpgegfqgeggsppDALPLALYRLGVEDLLFVEQVCKSF  803
             + FS     I  ++  + +         E G P DAL  +L  LGV+DLL VE+VC+S 
Sbjct  167  FLSFSRHGNRINGNQEKEFQACTKVHPDDETGEPHDALFFSLAYLGVQDLLVVERVCRSL  226

Query  804  A  806
             
Sbjct  227  C  227



>ref|XP_010250852.1| PREDICTED: F-box protein SKIP14 [Nelumbo nucifera]
Length=498

 Score = 43.9 bits (102),  Expect(2) = 3e-06, Method: Compositional matrix adjust.
 Identities = 41/124 (33%), Positives = 56/124 (45%), Gaps = 11/124 (9%)
 Frame = +3

Query  453  KVDDQLFAGFDFVLNGSKRIHPESGAEKMNENSGVGAMDFG---------NGEFDGHVFS  605
            K D QL AG +F+ N + + H E G   ++E S     +FG         +G  DG   S
Sbjct  121  KGDYQLVAGLNFIWNQAMKFHMEPGNAWIDERSNPCG-EFGGTLYEKESEDGSCDGGFVS  179

Query  606  DCEMDETMDFSYEKYWIFYDEINKReglpgegfqgeggsppDALPLALYRLGVEDLLFVE  785
             C MDE + F  +  W    +  +          G GG+P +AL  AL  LGV DLL   
Sbjct  180  VCNMDEFLSFG-DDAWPASHQAKESTEGTDSCSDGAGGAPHEALLYALSYLGVRDLLSAG  238

Query  786  QVCK  797
             VC+
Sbjct  239  SVCR  242


 Score = 35.0 bits (79),  Expect(2) = 3e-06, Method: Compositional matrix adjust.
 Identities = 22/71 (31%), Positives = 30/71 (42%), Gaps = 6/71 (8%)
 Frame = +2

Query  221  SGINFQNRRFSEDRPDKNRDCFGKSWGLDCGKGNF------QGNRKEEIRNASDDVADLL  382
            S +   N    E  P+K+ D F K W  +    N       + +R       S+D+ DLL
Sbjct  23   SSVRIANGYVVEGIPEKSADSFAKPWRFNWEFENSYDYTRDRADRGGSCEPISNDILDLL  82

Query  383  PQDPFDMNIDT  415
            P DPF M I  
Sbjct  83   PSDPFGMEISA  93



>ref|XP_006338882.1| PREDICTED: F-box protein SKIP14-like [Solanum tuberosum]
Length=480

 Score = 40.0 bits (92),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 40/129 (31%), Positives = 57/129 (44%), Gaps = 9/129 (7%)
 Frame = +3

Query  444  GVGKVDDQLFAGFDFVLNGSKR-----IHPESGAEKMNE----NSGVGAMDFGNGEFDGH  596
            G    D  LFAGFDF+ N S R     I+     +K+N     N  +G  D  +      
Sbjct  119  GPSNEDYGLFAGFDFIWNDSMRFQSFPINHVRSDDKLNRGDPVNWLIGERDMRDALAHVG  178

Query  597  VFSDCEMDETMDFSYEKYWIFYDEINKReglpgegfqgeggsppDALPLALYRLGVEDLL  776
            + S C + +T  F+      F  +  +           + G+P +AL  AL  LGV+DLL
Sbjct  179  LGSACNVGDTAGFNNVGSVSFLPQTMETGSGAMSCSGEDEGAPHEALSFALGYLGVKDLL  238

Query  777  FVEQVCKSF  803
             VE VC+S 
Sbjct  239  MVESVCRSL  247


 Score = 35.4 bits (80),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/73 (32%), Positives = 34/73 (47%), Gaps = 8/73 (11%)
 Frame = +2

Query  221  SGINFQNRRFSEDRPDKNRDCFGKSW--------GLDCGKGNFQGNRKEEIRNASDDVAD  376
            S +   N    E  P+ N + F  SW        G + G G  + ++ +     S+D+ D
Sbjct  22   SPMRIVNGCLVEGVPENNVENFPWSWRVCREPHDGFEYGYGGKRRDKCDYSELVSEDIID  81

Query  377  LLPQDPFDMNIDT  415
            LLP DPF M+I T
Sbjct  82   LLPADPFGMDIST  94



>gb|KDO82040.1| hypothetical protein CISIN_1g011064mg [Citrus sinensis]
Length=494

 Score = 40.0 bits (92),  Expect(2) = 8e-05, Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 39/85 (46%), Gaps = 12/85 (14%)
 Frame = +2

Query  221  SGINFQNRRFSEDRPDKNRDCFGKSWGL-----DC---GKGNFQGNRKEEIRNASDDVAD  376
            S +   N    E  P+KN D + K+W L     DC   G+   + NR     + S D+ D
Sbjct  22   SPMRIANGYLVEGIPEKNGDGYAKNWHLNQEIDDCFDYGRDRAE-NRCGSQESVSTDIID  80

Query  377  LLPQDPFDMNIDTIEIGFVIENWGW  451
            LLP DPF M+I T    F     GW
Sbjct  81   LLPSDPFGMDISTT---FTAAITGW  102


 Score = 33.9 bits (76),  Expect(2) = 8e-05, Method: Compositional matrix adjust.
 Identities = 38/132 (29%), Positives = 59/132 (45%), Gaps = 9/132 (7%)
 Frame = +3

Query  438  KIGVGKVDDQLFAGFDFVLNGSKRIH--PESGAEKMNENSGVGAMD-FGNGEF------D  590
            ++G    + QLFAG +F  N + R+   P +   +   N   G+ + F   E        
Sbjct  117  EVGTSDGNCQLFAGLNFFWNNAMRLQGFPNNMGYEHYLNVASGSSERFQAKEVVEEVSCH  176

Query  591  GHVFSDCEMDETMDFSYEKYWIFYDEINKReglpgegfqgeggsppDALPLALYRLGVED  770
            G + S C +D+   F  +   +   +        G    GE G+P  AL  +L  LGV+D
Sbjct  177  GGLASTCNVDDMFGFGNDNVGLVDQQSEALLEGNGSCCDGEEGAPHAALIFSLGYLGVQD  236

Query  771  LLFVEQVCKSFA  806
            LL VE+VC+S  
Sbjct  237  LLVVEKVCRSLC  248



>ref|XP_006484028.1| PREDICTED: F-box protein SKIP14-like [Citrus sinensis]
Length=494

 Score = 40.0 bits (92),  Expect(2) = 8e-05, Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 39/85 (46%), Gaps = 12/85 (14%)
 Frame = +2

Query  221  SGINFQNRRFSEDRPDKNRDCFGKSWGL-----DC---GKGNFQGNRKEEIRNASDDVAD  376
            S +   N    E  P+KN D + K+W L     DC   G+   + NR     + S D+ D
Sbjct  22   SPMRIANGYLVEGIPEKNGDGYAKNWHLNQEIDDCFDYGRDRAE-NRCGSQESVSTDIID  80

Query  377  LLPQDPFDMNIDTIEIGFVIENWGW  451
            LLP DPF M+I T    F     GW
Sbjct  81   LLPSDPFGMDISTT---FTAAITGW  102


 Score = 33.9 bits (76),  Expect(2) = 8e-05, Method: Compositional matrix adjust.
 Identities = 38/132 (29%), Positives = 59/132 (45%), Gaps = 9/132 (7%)
 Frame = +3

Query  438  KIGVGKVDDQLFAGFDFVLNGSKRIH--PESGAEKMNENSGVGAMD-FGNGEF------D  590
            ++G    + QLFAG +F  N + R+   P +   +   N   G+ + F   E        
Sbjct  117  EVGTSDGNCQLFAGLNFFWNNAMRLQGFPNNMGYEHYLNVASGSSERFQPKEVVEEVSCH  176

Query  591  GHVFSDCEMDETMDFSYEKYWIFYDEINKReglpgegfqgeggsppDALPLALYRLGVED  770
            G + S C +D+   F  +   +   +        G    GE G+P  AL  +L  LGV+D
Sbjct  177  GGLASTCNVDDMFGFGNDNVGLVDQQSEALLEGNGSCCDGEEGAPHAALIFSLGYLGVQD  236

Query  771  LLFVEQVCKSFA  806
            LL VE+VC+S  
Sbjct  237  LLVVEKVCRSLC  248



>emb|CDX83577.1| BnaC07g23170D [Brassica napus]
Length=429

 Score = 42.7 bits (99),  Expect(2) = 9e-05, Method: Compositional matrix adjust.
 Identities = 38/123 (31%), Positives = 53/123 (43%), Gaps = 14/123 (11%)
 Frame = +3

Query  441  IGVGKVDDQLFAGFDFVLNGSKRIHPESGAEKMNENSGV-GAMD-FGNGEFDGHVFSDCE  614
            IG G    QLFAG  F+ N + R H      +  E+S V G+++ FG+G   G   S   
Sbjct  96   IGDGNHHHQLFAGLSFIWNNAMRFH------EFPESSNVWGSLNGFGDGSCHGSFVSPGS  149

Query  615  MDETMDFSYEKYWIFYDEINKReglpgegfqgeggsppDALPLALYRLGVEDLLFVEQVC  794
            +D+ +D           E+ +  G                   +LY LGV+DLL V  VC
Sbjct  150  VDQVLDVRNGG------EVAESSGCCTNDGGENANVVHPGFGFSLYHLGVKDLLSVSMVC  203

Query  795  KSF  803
            KS 
Sbjct  204  KSL  206


 Score = 31.2 bits (69),  Expect(2) = 9e-05, Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 26/62 (42%), Gaps = 8/62 (13%)
 Frame = +2

Query  227  INFQNRRFSEDRPDKNRDCFGKSWGLDCGKGNFQGNRKEEIRNASDDVADLLPQDPFDMN  406
            +   N    E   D+  D F   W     KG+           +S D+ D+LP DPF M+
Sbjct  19   MKIANGYLVEGVSDRKDDVFSHPWCSSLAKGDSAA--------SSVDILDVLPSDPFGMD  70

Query  407  ID  412
            I+
Sbjct  71   IN  72



>ref|XP_004237240.1| PREDICTED: F-box protein SKIP14-like [Solanum lycopersicum]
Length=480

 Score = 37.7 bits (86),  Expect(2) = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/73 (32%), Positives = 34/73 (47%), Gaps = 8/73 (11%)
 Frame = +2

Query  221  SGINFQNRRFSEDRPDKNRDCFGKSW--------GLDCGKGNFQGNRKEEIRNASDDVAD  376
            S +   N    E  P+ N + F  SW        G + G G    ++ +   + S+D+ D
Sbjct  22   SPMRIVNGCLVEGVPENNVENFAWSWRVCREPRDGFEYGYGRETVDKCDYSESVSEDIID  81

Query  377  LLPQDPFDMNIDT  415
            LLP DPF M+I T
Sbjct  82   LLPADPFGMDIST  94


 Score = 35.4 bits (80),  Expect(2) = 1e-04, Method: Compositional matrix adjust.
 Identities = 38/124 (31%), Positives = 52/124 (42%), Gaps = 9/124 (7%)
 Frame = +3

Query  459  DDQLFAGFDFVLNGSKR-----IHPESGAEKMNENSGV----GAMDFGNGEFDGHVFSDC  611
            D  L AGFDFV N S R     I+     +K+N    V    G  D  +      + S C
Sbjct  124  DCGLIAGFDFVWNDSMRFQSFPINHVQSDDKLNRGEPVSLLIGERDMRDALAHVGLGSAC  183

Query  612  EMDETMDFSYEKYWIFYDEINKReglpgegfqgeggsppDALPLALYRLGVEDLLFVEQV  791
             + +T   +      F+                + G+P +AL  AL  LGV+DLL VE V
Sbjct  184  NVGDTAGLNNVGSVSFFPLTMGTGSGATSCSGKDEGAPHEALSFALGYLGVKDLLTVESV  243

Query  792  CKSF  803
            C+S 
Sbjct  244  CRSL  247



>ref|XP_006438126.1| hypothetical protein CICLE_v10031334mg [Citrus clementina]
 gb|ESR51366.1| hypothetical protein CICLE_v10031334mg [Citrus clementina]
Length=494

 Score = 40.0 bits (92),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 39/85 (46%), Gaps = 12/85 (14%)
 Frame = +2

Query  221  SGINFQNRRFSEDRPDKNRDCFGKSWGL-----DC---GKGNFQGNRKEEIRNASDDVAD  376
            S +   N    E  P+KN D + K+W L     DC   G+   + NR     + S D+ D
Sbjct  22   SPMRIANGYLVEGIPEKNGDGYAKNWHLNQEIDDCFDYGRDRAE-NRCGSQESVSTDIID  80

Query  377  LLPQDPFDMNIDTIEIGFVIENWGW  451
            LLP DPF M+I T    F     GW
Sbjct  81   LLPSDPFGMDISTT---FTAAITGW  102


 Score = 33.1 bits (74),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 38/132 (29%), Positives = 58/132 (44%), Gaps = 9/132 (7%)
 Frame = +3

Query  438  KIGVGKVDDQLFAGFDFVLNGSKRIH--PESGAEKMNENSGVGAMD-FGNGEF------D  590
            ++G    + QLFAG +F  N + R+   P +   +   N   G+ + F   E        
Sbjct  117  EVGTSDGNCQLFAGLNFFWNNAMRLQGFPNNMGYEHYLNVASGSSERFQPKEVVEEVSCH  176

Query  591  GHVFSDCEMDETMDFSYEKYWIFYDEINKReglpgegfqgeggsppDALPLALYRLGVED  770
            G + S C +D+   F  +   +   +        G    GE G+P  AL  +L  LGV D
Sbjct  177  GVLASTCNVDDMFGFGNDNVGLVDQQSEALLEGNGSCCDGEEGAPHAALIFSLGYLGVRD  236

Query  771  LLFVEQVCKSFA  806
            LL VE+VC+S  
Sbjct  237  LLVVEKVCRSLC  248



>gb|KJB31017.1| hypothetical protein B456_005G172600 [Gossypium raimondii]
Length=496

 Score = 38.5 bits (88),  Expect(2) = 4e-04, Method: Compositional matrix adjust.
 Identities = 26/73 (36%), Positives = 35/73 (48%), Gaps = 9/73 (12%)
 Frame = +2

Query  221  SGINFQNRRFSEDRPDKNRDCFGKSW--------GLDCGKGNFQGNRKEEIRNASDDVAD  376
            S +   N    E  P++N D   KSW          D G+    G+R     ++SDD+ D
Sbjct  22   SPMRIANGYLVEGIPERNGDGCSKSWFSNLELEGCFDYGRDK-SGDRGGSQESSSDDIVD  80

Query  377  LLPQDPFDMNIDT  415
            LLP DPF M+I T
Sbjct  81   LLPSDPFGMDITT  93


 Score = 33.1 bits (74),  Expect(2) = 4e-04, Method: Compositional matrix adjust.
 Identities = 38/130 (29%), Positives = 59/130 (45%), Gaps = 9/130 (7%)
 Frame = +3

Query  438  KIGVGKVDDQLFAGFDFVLNGSK--RIHPESGAEKMNENSGVGAMDFGNGEFDGHVF---  602
            ++G G    QLFAG +F+ N +   +  P S   +   +   G   F + +  G V    
Sbjct  116  EVGTGDGSYQLFAGLNFIWNNAMWFQTFPGSMGFECKGSMSGGFGGFSHAKEGGDVSGCA  175

Query  603  ---SDCEMDETMDFSYEKYWIFYDEINKReglpgegfqgeggsppDALPLALYRLGVEDL  773
               S C +++ + F  E   +  D+ N+         +G  G+P +AL LAL  LGV DL
Sbjct  176  GHGSPCNVEDVLSFGDEDM-VSVDQENEEFQDCEVRAEGHEGAPHEALILALGYLGVRDL  234

Query  774  LFVEQVCKSF  803
              +E VC S 
Sbjct  235  FVIENVCTSL  244



>ref|XP_010554227.1| PREDICTED: F-box protein SKIP14-like [Tarenaya hassleriana]
Length=472

 Score = 39.3 bits (90),  Expect(2) = 4e-04, Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 35/71 (49%), Gaps = 6/71 (8%)
 Frame = +2

Query  221  SGINFQNRRFSEDRPDKNRDCFGKSWGLDCGKGNF------QGNRKEEIRNASDDVADLL  382
            S +   N    E RP++N D F + W     KG+        G+R     +AS D+ D+L
Sbjct  22   SPMRIANGYLVEGRPERNGDIFTRPWCSLHEKGDCFDYARGWGDRCGSQDSASVDILDIL  81

Query  383  PQDPFDMNIDT  415
            P DPF M+I T
Sbjct  82   PSDPFGMDIST  92


 Score = 32.3 bits (72),  Expect(2) = 4e-04, Method: Compositional matrix adjust.
 Identities = 35/122 (29%), Positives = 47/122 (39%), Gaps = 14/122 (11%)
 Frame = +3

Query  438  KIGVGKVDDQLFAGFDFVLNGSKRIHPESGAEKMNENSGVGAMDFGNGEFDGHVFSDCEM  617
            +IG+   + QLFAG +F+ N          A K  E S   +  F N    G   S   +
Sbjct  115  EIGIDVGNYQLFAGLNFIWNN---------AMKFQEFSQTRSRGFDNESCHGAFLSASSV  165

Query  618  DETMDFSYEKYWIFYDEINKReglpgegfqgeggsppDALPLALYRLGVEDLLFVEQVCK  797
            D  +  S E      D  N            E  +   A   +L  LG++DLL V  VCK
Sbjct  166  DNAVCISGE-----VDSRNGPCEDNEVCMSREDETLHPAFNYSLSYLGIKDLLSVGMVCK  220

Query  798  SF  803
            S 
Sbjct  221  SL  222



>ref|XP_010248857.1| PREDICTED: F-box protein SKIP14 [Nelumbo nucifera]
 ref|XP_010248858.1| PREDICTED: F-box protein SKIP14 [Nelumbo nucifera]
Length=499

 Score = 40.0 bits (92),  Expect(2) = 5e-04, Method: Compositional matrix adjust.
 Identities = 37/126 (29%), Positives = 56/126 (44%), Gaps = 8/126 (6%)
 Frame = +3

Query  444  GVGKVDDQLFAGFDFVLNGSKRIHPESGAEKMNENSGV-GAMD-------FGNGEFDGHV  599
            G  K D QL AG +F+ N + +   E    + ++ S   G  D        G+G  DG  
Sbjct  118  GGKKEDYQLVAGLNFIWNRTMKFQAEPENTRTDDRSNPFGKFDVMLDDKELGDGSCDGGF  177

Query  600  FSDCEMDETMDFSYEKYWIFYDEINKReglpgegfqgeggsppDALPLALYRLGVEDLLF  779
             S C M+E + F  +   +   +           + G  G+P +AL   L  LGV+DLL 
Sbjct  178  TSVCNMEEFLSFGDDDLCVASHQAKDSVESSKTCYDGADGAPHEALLYVLGYLGVQDLLS  237

Query  780  VEQVCK  797
            V +VC+
Sbjct  238  VGRVCR  243


 Score = 31.6 bits (70),  Expect(2) = 5e-04, Method: Compositional matrix adjust.
 Identities = 24/71 (34%), Positives = 31/71 (44%), Gaps = 6/71 (8%)
 Frame = +2

Query  221  SGINFQNRRFSEDRPDKNRDCFGK----SWGLDCGKGNFQ--GNRKEEIRNASDDVADLL  382
            S I   N    E  P+K  D FGK    +W  +      +  G R       S+D+ DLL
Sbjct  23   SSIRIANGYVVEGIPEKRGDGFGKPRHFNWEFENSYDYVRDRGERGGSREPISNDILDLL  82

Query  383  PQDPFDMNIDT  415
            P DPF M+I  
Sbjct  83   PPDPFGMDISA  93



>ref|XP_009359303.1| PREDICTED: F-box protein SKIP14 [Pyrus x bretschneideri]
Length=496

 Score = 35.8 bits (81),  Expect(2) = 7e-04, Method: Compositional matrix adjust.
 Identities = 38/130 (29%), Positives = 59/130 (45%), Gaps = 8/130 (6%)
 Frame = +3

Query  438  KIGVGKVDDQLFAGFDFVLNGSKRIHPESGA----EKMNENSGVGAMDFGNGEFDGHVFS  605
            ++G    + +LFAG +F+ N + +     G      K N  SG G      G  D  + S
Sbjct  115  EVGTSNGNYELFAGLNFIWNNAMKFQAFPGNIGVDHKSNVASGFGGCSKEKGVDDSPLHS  174

Query  606  D----CEMDETMDFSYEKYWIFYDEINKReglpgegfqgeggsppDALPLALYRLGVEDL  773
                 C + + ++F  E       +  + +   G    G+GG+P  AL  AL  LGV+DL
Sbjct  175  GFGSACPVADVLNFGNESCGFSNQQNVEVQHGDGICGGGDGGAPHGALMFALSYLGVQDL  234

Query  774  LFVEQVCKSF  803
            L V+ VC+S 
Sbjct  235  LVVDGVCRSL  244


 Score = 35.0 bits (79),  Expect(2) = 7e-04, Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 34/76 (45%), Gaps = 12/76 (16%)
 Frame = +2

Query  215  FCSGINFQNRRFSEDRPDKNRDCFGKSWG----LDCGKGNFQGNRKEEIRN-----ASDD  367
              S +   N    E  P++N D FG+ W     +D   G F   R    R       S+D
Sbjct  20   LVSPMRIANGYLVEGMPERNGDGFGRPWHSNREVD---GCFDYGRDRCDRGCSQDPVSND  76

Query  368  VADLLPQDPFDMNIDT  415
            + DLLP DPF M+I T
Sbjct  77   ILDLLPSDPFGMDIST  92



>ref|XP_008368270.1| PREDICTED: F-box protein SKIP14-like [Malus domestica]
Length=496

 Score = 36.2 bits (82),  Expect(2) = 7e-04, Method: Compositional matrix adjust.
 Identities = 39/130 (30%), Positives = 59/130 (45%), Gaps = 8/130 (6%)
 Frame = +3

Query  438  KIGVGKVDDQLFAGFDFVLNGSKRIHPESGA----EKMNENSGVGAMDFGNGEFDGHVFS  605
            ++G    + +LFAG +F+ N + +     G      K N  SG G      G  D  + S
Sbjct  115  EVGTSNGNYELFAGLNFIWNNAMKFQAFXGNIGVDHKSNVASGFGGCSKEKGVDDSSLHS  174

Query  606  D----CEMDETMDFSYEKYWIFYDEINKReglpgegfqgeggsppDALPLALYRLGVEDL  773
                 C + + ++F  E       +  + +   G    G+GG+P  AL  AL  LGV+DL
Sbjct  175  GFGSACPVADILNFGNESCGFSNQQNVEVQHGDGICAGGDGGAPHGALMFALSYLGVQDL  234

Query  774  LFVEQVCKSF  803
            L VE VC+S 
Sbjct  235  LVVEGVCRSL  244


 Score = 34.7 bits (78),  Expect(2) = 7e-04, Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 34/76 (45%), Gaps = 12/76 (16%)
 Frame = +2

Query  215  FCSGINFQNRRFSEDRPDKNRDCFGKSWG----LDCGKGNFQGNRKEEIRN-----ASDD  367
              S +   N    E  P++N D FG+ W     +D   G F   R    R       S+D
Sbjct  20   LVSPMRIANGYLVEGMPERNGDGFGRLWHSNREVD---GCFDYGRDRCDRGCSQDPVSND  76

Query  368  VADLLPQDPFDMNIDT  415
            + DLLP DPF M+I T
Sbjct  77   ILDLLPSDPFGMDIST  92



>ref|XP_008340160.1| PREDICTED: F-box protein SKIP14-like [Malus domestica]
Length=496

 Score = 36.2 bits (82),  Expect(2) = 8e-04, Method: Compositional matrix adjust.
 Identities = 39/130 (30%), Positives = 59/130 (45%), Gaps = 8/130 (6%)
 Frame = +3

Query  438  KIGVGKVDDQLFAGFDFVLNGSKRIHPESGA----EKMNENSGVGAMDFGNGEFDGHVFS  605
            ++G    + +LFAG +F+ N + +     G      K N  SG G      G  D  + S
Sbjct  115  EVGTSNGNYELFAGLNFIWNNAMKFQAFPGNIGVDHKSNVASGFGGCSKEKGVDDSSLHS  174

Query  606  D----CEMDETMDFSYEKYWIFYDEINKReglpgegfqgeggsppDALPLALYRLGVEDL  773
                 C + + ++F  E       +  + +   G    G+GG+P  AL  AL  LGV+DL
Sbjct  175  GFGSACPVADILNFGNESCGFSNQQNVEVQHGDGICAGGDGGAPHGALMFALSYLGVQDL  234

Query  774  LFVEQVCKSF  803
            L VE VC+S 
Sbjct  235  LVVEGVCRSL  244


 Score = 34.3 bits (77),  Expect(2) = 8e-04, Method: Compositional matrix adjust.
 Identities = 23/75 (31%), Positives = 33/75 (44%), Gaps = 10/75 (13%)
 Frame = +2

Query  215  FCSGINFQNRRFSEDRPDKNRDCFGKSWG--------LDCGKGNFQGNRKEEIRNASDDV  370
              S +   N    E  P++N D FG+ W          D G+        ++    S+D+
Sbjct  20   LVSPMRIANGYLVEGMPERNGDGFGRLWHSNREVDGCFDYGRDRCDXGCSQD--PVSNDI  77

Query  371  ADLLPQDPFDMNIDT  415
             DLLP DPF M+I T
Sbjct  78   LDLLPSDPFGMDIST  92



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1620118203410