BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF044I16

Length=746
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009588943.1|  PREDICTED: uncharacterized protein At4g06744...    144   6e-36   Nicotiana tomentosiformis
ref|XP_009793223.1|  PREDICTED: uncharacterized protein At4g06744...    134   1e-32   Nicotiana sylvestris
emb|CDP02527.1|  unnamed protein product                                132   4e-32   Coffea canephora [robusta coffee]
emb|CDP02523.1|  unnamed protein product                                131   1e-31   Coffea canephora [robusta coffee]
gb|EYU44430.1|  hypothetical protein MIMGU_mgv1a005057mg                130   2e-31   Erythranthe guttata [common monkey flower]
ref|XP_006360245.1|  PREDICTED: uncharacterized protein At4g06744...    123   4e-29   
ref|XP_004233445.1|  PREDICTED: uncharacterized protein At4g06744...    122   1e-28   Solanum lycopersicum
ref|XP_011099103.1|  PREDICTED: uncharacterized protein At4g06744...    120   5e-28   Sesamum indicum [beniseed]
ref|XP_008456145.1|  PREDICTED: uncharacterized protein At4g06744...    115   4e-26   Cucumis melo [Oriental melon]
ref|XP_010555995.1|  PREDICTED: uncharacterized protein At4g06744...    112   4e-25   Tarenaya hassleriana [spider flower]
gb|AEI72268.1|  leucine-rich repeat family protein                      111   7e-25   Citrus trifoliata [hardy orange]
ref|XP_010519298.1|  PREDICTED: uncharacterized protein At4g06744...    111   8e-25   Tarenaya hassleriana [spider flower]
gb|KDO59787.1|  hypothetical protein CISIN_1g011101mg                   111   1e-24   Citrus sinensis [apfelsine]
ref|XP_006422961.1|  hypothetical protein CICLE_v10028242mg             110   3e-24   Citrus clementina [clementine]
ref|XP_010932202.1|  PREDICTED: uncharacterized protein At4g06744...    109   5e-24   Elaeis guineensis
ref|XP_010107857.1|  Uncharacterized protein L484_027444                108   5e-24   Morus notabilis
ref|XP_004167460.1|  PREDICTED: uncharacterized protein At4g06744...    108   5e-24   
ref|XP_004141388.1|  PREDICTED: uncharacterized protein At4g06744...    108   7e-24   Cucumis sativus [cucumbers]
ref|XP_007160878.1|  hypothetical protein PHAVU_001G024400g             108   1e-23   Phaseolus vulgaris [French bean]
ref|XP_008452581.1|  PREDICTED: uncharacterized protein At4g06744...    107   1e-23   Cucumis melo [Oriental melon]
ref|XP_003545325.1|  PREDICTED: uncharacterized protein At4g06744...    107   1e-23   Glycine max [soybeans]
gb|KHN22492.1|  Hypothetical protein glysoja_041167                     107   2e-23   Glycine soja [wild soybean]
ref|XP_009107284.1|  PREDICTED: uncharacterized protein At4g06744       107   2e-23   Brassica rapa
emb|CDY29337.1|  BnaA05g16040D                                          107   4e-23   Brassica napus [oilseed rape]
ref|XP_002518710.1|  serine-threonine protein kinase, plant-type,...    106   5e-23   
emb|CDY16514.1|  BnaA08g02530D                                          106   7e-23   Brassica napus [oilseed rape]
ref|XP_004140807.1|  PREDICTED: uncharacterized protein LOC101203557    108   8e-23   
gb|KDO59786.1|  hypothetical protein CISIN_1g048561mg                   105   9e-23   Citrus sinensis [apfelsine]
ref|XP_007042489.1|  Leucine-rich repeat family protein, putative       106   9e-23   
ref|XP_008236575.1|  PREDICTED: uncharacterized protein At4g06744...    105   1e-22   Prunus mume [ume]
emb|CDY20865.1|  BnaC05g26270D                                          106   1e-22   Brassica napus [oilseed rape]
ref|XP_004291077.1|  PREDICTED: uncharacterized protein At4g06744...    105   1e-22   Fragaria vesca subsp. vesca
ref|XP_009592678.1|  PREDICTED: uncharacterized protein At4g06744...    105   1e-22   Nicotiana tomentosiformis
ref|XP_006297641.1|  hypothetical protein CARUB_v10013659mg             105   1e-22   Capsella rubella
ref|XP_006487027.1|  PREDICTED: uncharacterized protein At4g06744...    104   1e-22   Citrus sinensis [apfelsine]
ref|XP_010466072.1|  PREDICTED: uncharacterized protein At4g06744...    105   1e-22   Camelina sativa [gold-of-pleasure]
ref|XP_006472980.1|  PREDICTED: uncharacterized protein At4g06744...    104   2e-22   
gb|KFK39280.1|  hypothetical protein AALP_AA3G224000                    105   2e-22   Arabis alpina [alpine rockcress]
ref|XP_004499033.1|  PREDICTED: uncharacterized protein At4g06744...    104   2e-22   Cicer arietinum [garbanzo]
ref|XP_008220262.1|  PREDICTED: uncharacterized protein At4g06744...    104   2e-22   Prunus mume [ume]
ref|XP_009784047.1|  PREDICTED: uncharacterized protein At4g06744...    104   2e-22   Nicotiana sylvestris
ref|XP_008798694.1|  PREDICTED: uncharacterized protein At4g06744...    104   3e-22   
ref|XP_003550327.1|  PREDICTED: uncharacterized protein At4g06744...    104   3e-22   Glycine max [soybeans]
ref|XP_010094650.1|  Uncharacterized protein L484_008882                103   3e-22   Morus notabilis
ref|XP_010438766.1|  PREDICTED: uncharacterized protein At4g06744       103   3e-22   Camelina sativa [gold-of-pleasure]
ref|XP_010455221.1|  PREDICTED: uncharacterized protein At4g06744...    103   3e-22   Camelina sativa [gold-of-pleasure]
ref|XP_007227115.1|  hypothetical protein PRUPE_ppa025707mg             104   4e-22   
gb|KDO37099.1|  hypothetical protein CISIN_1g037101mg                   103   4e-22   Citrus sinensis [apfelsine]
ref|XP_010507626.1|  PREDICTED: uncharacterized protein At4g06744...    103   4e-22   Camelina sativa [gold-of-pleasure]
ref|XP_006433575.1|  hypothetical protein CICLE_v10003526mg             103   5e-22   Citrus clementina [clementine]
ref|NP_188563.1|  leucine-rich repeat-containing protein                103   6e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011074595.1|  PREDICTED: uncharacterized protein At4g06744...    103   6e-22   
ref|XP_006289202.1|  hypothetical protein CARUB_v10002650mg             102   6e-22   Capsella rubella
emb|CDX99236.1|  BnaC05g33510D                                          103   6e-22   
emb|CDP01296.1|  unnamed protein product                                102   7e-22   Coffea canephora [robusta coffee]
ref|XP_009145802.1|  PREDICTED: uncharacterized protein At4g06744       103   8e-22   Brassica rapa
emb|CDX92324.1|  BnaA05g20830D                                          103   8e-22   
emb|CDY32853.1|  BnaC08g02750D                                          103   8e-22   Brassica napus [oilseed rape]
ref|XP_008236564.1|  PREDICTED: uncharacterized protein At4g06744...    102   9e-22   Prunus mume [ume]
ref|XP_007201495.1|  hypothetical protein PRUPE_ppa014775mg             102   9e-22   
ref|NP_849339.1|  Leucine-rich repeat-containing protein                102   1e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006406513.1|  hypothetical protein EUTSA_v10020680mg             102   1e-21   Eutrema salsugineum [saltwater cress]
ref|XP_010688602.1|  PREDICTED: uncharacterized protein At4g06744       102   1e-21   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009145107.1|  PREDICTED: uncharacterized protein At4g06744...    103   1e-21   Brassica rapa
ref|XP_004231393.1|  PREDICTED: uncharacterized protein At4g06744       102   1e-21   Solanum lycopersicum
ref|XP_011000139.1|  PREDICTED: uncharacterized protein At4g06744...    102   1e-21   Populus euphratica
ref|XP_010421726.1|  PREDICTED: uncharacterized protein At4g06744       102   1e-21   Camelina sativa [gold-of-pleasure]
ref|XP_009359966.1|  PREDICTED: uncharacterized protein At4g06744...    102   1e-21   Pyrus x bretschneideri [bai li]
ref|XP_009417193.1|  PREDICTED: uncharacterized protein At4g06744...    102   1e-21   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002313863.2|  hypothetical protein POPTR_0009s10140g             102   2e-21   
ref|XP_006346520.1|  PREDICTED: uncharacterized protein At4g06744...    101   2e-21   Solanum tuberosum [potatoes]
gb|KDP24991.1|  hypothetical protein JCGZ_23974                         101   2e-21   Jatropha curcas
ref|XP_006397360.1|  hypothetical protein EUTSA_v10028721mg             101   2e-21   Eutrema salsugineum [saltwater cress]
ref|XP_004960235.1|  PREDICTED: uncharacterized protein At4g06744...    102   2e-21   
ref|XP_011088225.1|  PREDICTED: uncharacterized protein At4g06744...    102   2e-21   Sesamum indicum [beniseed]
ref|XP_011000899.1|  PREDICTED: uncharacterized protein At4g06744...    101   2e-21   Populus euphratica
ref|XP_010487869.1|  PREDICTED: uncharacterized protein At4g06744...    102   2e-21   Camelina sativa [gold-of-pleasure]
ref|XP_011029410.1|  PREDICTED: uncharacterized protein At4g06744...    101   3e-21   Populus euphratica
gb|KDP41695.1|  hypothetical protein JCGZ_16102                         101   3e-21   Jatropha curcas
gb|KDP24986.1|  hypothetical protein JCGZ_23969                         100   3e-21   Jatropha curcas
ref|XP_006374888.1|  hypothetical protein POPTR_0014s02430g             101   3e-21   Populus trichocarpa [western balsam poplar]
ref|XP_007199295.1|  hypothetical protein PRUPE_ppa023082mg             100   4e-21   
ref|XP_006393218.1|  hypothetical protein EUTSA_v10011424mg             101   4e-21   Eutrema salsugineum [saltwater cress]
ref|XP_003589141.1|  hypothetical protein MTR_1g018910                  100   4e-21   Medicago truncatula
ref|XP_009768848.1|  PREDICTED: uncharacterized protein At4g06744...    100   4e-21   Nicotiana sylvestris
ref|XP_002874478.1|  leucine-rich repeat family protein                 100   5e-21   
ref|XP_008393778.1|  PREDICTED: uncharacterized protein At4g06744...    100   5e-21   
ref|XP_007201703.1|  hypothetical protein PRUPE_ppa004109mg             101   6e-21   Prunus persica
gb|EMS59107.1|  hypothetical protein TRIUR3_04108                       100   6e-21   Triticum urartu
ref|XP_002282482.2|  PREDICTED: uncharacterized protein At4g06744...    101   6e-21   Vitis vinifera
ref|XP_002510174.1|  serine-threonine protein kinase, plant-type,...    100   7e-21   Ricinus communis
ref|XP_010061722.1|  PREDICTED: uncharacterized protein At4g06744...    100   8e-21   Eucalyptus grandis [rose gum]
ref|XP_002300228.2|  hypothetical protein POPTR_0001s30990g           99.8    8e-21   
gb|KJB32334.1|  hypothetical protein B456_005G236100                  99.4    1e-20   Gossypium raimondii
gb|EPS58531.1|  hypothetical protein M569_16282                       98.6    1e-20   Genlisea aurea
gb|EYU25462.1|  hypothetical protein MIMGU_mgv1a024676mg              98.6    2e-20   Erythranthe guttata [common monkey flower]
gb|KFK39606.1|  hypothetical protein AALP_AA3G265800                  98.6    2e-20   Arabis alpina [alpine rockcress]
gb|KJB14612.1|  hypothetical protein B456_002G134000                  99.0    2e-20   Gossypium raimondii
ref|XP_006422962.1|  hypothetical protein CICLE_v10028712mg           97.8    2e-20   
gb|KDP47120.1|  hypothetical protein JCGZ_22116                       99.0    2e-20   Jatropha curcas
ref|XP_009617390.1|  PREDICTED: uncharacterized protein At4g06744...  98.6    2e-20   
dbj|BAJ91151.1|  predicted protein                                    99.8    3e-20   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010263447.1|  PREDICTED: uncharacterized protein At4g06744...  99.0    3e-20   Nelumbo nucifera [Indian lotus]
ref|XP_009141276.1|  PREDICTED: uncharacterized protein At4g06744...  97.4    3e-20   Brassica rapa
gb|EMT08852.1|  hypothetical protein F775_11606                       99.4    3e-20   
ref|XP_008342943.1|  PREDICTED: uncharacterized protein At4g06744...  98.2    3e-20   
ref|XP_011467740.1|  PREDICTED: uncharacterized protein At4g06744     99.0    3e-20   Fragaria vesca subsp. vesca
ref|XP_009141268.1|  PREDICTED: uncharacterized protein At4g06744...  97.4    4e-20   Brassica rapa
ref|XP_008236576.1|  PREDICTED: uncharacterized protein At4g06744...  98.2    5e-20   
ref|XP_011004883.1|  PREDICTED: uncharacterized protein At4g06744...  97.1    6e-20   Populus euphratica
ref|XP_010523006.1|  PREDICTED: uncharacterized protein At4g06744...  97.4    7e-20   Tarenaya hassleriana [spider flower]
ref|XP_011069732.1|  PREDICTED: uncharacterized protein At4g06744...  97.1    7e-20   Sesamum indicum [beniseed]
emb|CDY29128.1|  BnaA09g53810D                                        96.3    8e-20   Brassica napus [oilseed rape]
emb|CDX75185.1|  BnaC09g24970D                                        96.3    8e-20   
ref|XP_009605357.1|  PREDICTED: uncharacterized protein At4g06744...  96.7    8e-20   Nicotiana tomentosiformis
gb|KDP47121.1|  hypothetical protein JCGZ_22117                       97.4    1e-19   Jatropha curcas
ref|NP_001053250.1|  Os04g0505200                                     95.1    2e-19   
ref|XP_002514194.1|  serine-threonine protein kinase, plant-type,...  95.9    2e-19   Ricinus communis
ref|XP_010928365.1|  PREDICTED: uncharacterized protein At4g06744...  96.3    2e-19   Elaeis guineensis
ref|XP_010927582.1|  PREDICTED: uncharacterized protein At4g06744...  96.3    3e-19   
ref|XP_007017157.1|  Leucine-rich repeat family protein               95.9    3e-19   
ref|XP_010488556.1|  PREDICTED: leucine-rich repeat extensin-like...  95.9    3e-19   
ref|XP_008796513.1|  PREDICTED: uncharacterized protein At4g06744...  95.1    3e-19   
ref|XP_006653579.1|  PREDICTED: uncharacterized protein At4g06744...  95.9    3e-19   Oryza brachyantha
gb|KCW63737.1|  hypothetical protein EUGRSUZ_G01385                   94.4    3e-19   Eucalyptus grandis [rose gum]
ref|XP_010066095.1|  PREDICTED: uncharacterized protein At4g06744...  94.7    3e-19   Eucalyptus grandis [rose gum]
ref|XP_003580786.1|  PREDICTED: uncharacterized protein At4g06744     95.5    4e-19   Brachypodium distachyon [annual false brome]
ref|XP_002885307.1|  leucine-rich repeat family protein               95.9    4e-19   Arabidopsis lyrata subsp. lyrata
gb|EEE61292.1|  hypothetical protein OsJ_15379                        95.1    4e-19   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009413340.1|  PREDICTED: uncharacterized protein At4g06744...  95.5    5e-19   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009762067.1|  PREDICTED: uncharacterized protein At4g06744...  95.5    5e-19   Nicotiana sylvestris
emb|CAE02949.1|  OSJNBa0014K14.21                                     95.1    5e-19   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011004900.1|  PREDICTED: uncharacterized protein At4g06744...  94.7    5e-19   Populus euphratica
ref|XP_006300268.1|  hypothetical protein CARUB_v100163570mg          95.1    5e-19   
ref|XP_008799889.1|  PREDICTED: uncharacterized protein At4g06744...  95.1    5e-19   Phoenix dactylifera
ref|XP_009345138.1|  PREDICTED: uncharacterized protein At4g06744...  94.7    6e-19   Pyrus x bretschneideri [bai li]
ref|XP_010664552.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  95.1    7e-19   Vitis vinifera
ref|XP_006848210.1|  hypothetical protein AMTR_s00029p00242610        92.8    7e-19   
ref|XP_006653860.1|  PREDICTED: uncharacterized protein At4g06744...  94.7    7e-19   Oryza brachyantha
emb|CAN61023.1|  hypothetical protein VITISV_001143                   95.1    7e-19   Vitis vinifera
ref|XP_002282474.2|  PREDICTED: uncharacterized protein At4g06744     94.4    8e-19   Vitis vinifera
ref|XP_004304027.1|  PREDICTED: uncharacterized protein At4g06744...  94.0    9e-19   Fragaria vesca subsp. vesca
ref|XP_009622015.1|  PREDICTED: uncharacterized protein At4g06744...  94.7    9e-19   Nicotiana tomentosiformis
gb|EQB58412.1|  RAM signaling pathway protein                         93.2    9e-19   Colletotrichum gloeosporioides Cg-14
ref|XP_010065987.1|  PREDICTED: uncharacterized protein At4g06744...  94.0    1e-18   Eucalyptus grandis [rose gum]
emb|CDO97205.1|  unnamed protein product                              94.0    1e-18   Coffea canephora [robusta coffee]
gb|KCW54905.1|  hypothetical protein EUGRSUZ_I00883                   94.0    1e-18   Eucalyptus grandis [rose gum]
dbj|BAJ86489.1|  predicted protein                                    93.6    2e-18   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AEV40972.1|  uncharacterized protein At4g06744 precursor           93.6    2e-18   Oryza punctata
ref|XP_002885650.1|  predicted protein                                93.6    2e-18   
ref|XP_007285579.1|  aldo/keto reductase, putative                    94.4    2e-18   
ref|XP_010028214.1|  PREDICTED: uncharacterized protein At4g06744...  94.0    2e-18   Eucalyptus grandis [rose gum]
gb|KJB54313.1|  hypothetical protein B456_009G028700                  92.0    3e-18   Gossypium raimondii
ref|XP_010513507.1|  PREDICTED: leucine-rich repeat extensin-like...  94.4    3e-18   
gb|ENH81556.1|  leucine-rich repeat family protein                    91.7    3e-18   
ref|XP_003528523.1|  PREDICTED: uncharacterized protein At4g06744...  92.8    3e-18   Glycine max [soybeans]
tpg|DAA58808.1|  TPA: leucine-rich repeat (LRR) family protein        94.0    3e-18   
ref|XP_006285388.1|  hypothetical protein CARUB_v10006785mg           94.4    3e-18   Capsella rubella
ref|XP_010270768.1|  PREDICTED: uncharacterized protein At4g06744...  93.2    4e-18   Nelumbo nucifera [Indian lotus]
emb|CDX94809.1|  BnaC03g43790D                                        93.2    4e-18   
gb|EPS72402.1|  hypothetical protein M569_02357                       92.0    4e-18   Genlisea aurea
ref|XP_002867981.1|  hypothetical protein ARALYDRAFT_492992           93.6    5e-18   
gb|EYU37650.1|  hypothetical protein MIMGU_mgv11b016249mg             92.0    6e-18   Erythranthe guttata [common monkey flower]
ref|XP_001767662.1|  predicted protein                                90.9    6e-18   
emb|CAB37452.1|  extensin-like protein                                93.6    7e-18   Arabidopsis thaliana [mouse-ear cress]
emb|CDX93014.1|  BnaA03g37360D                                        92.0    7e-18   
gb|KFK35980.1|  hypothetical protein AALP_AA4G062700                  92.4    7e-18   Arabis alpina [alpine rockcress]
ref|NP_193602.4|  leucine-rich repeat extensin-like protein 5         93.2    8e-18   Arabidopsis thaliana [mouse-ear cress]
ref|NP_189091.1|  leucine-rich repeat extensin-like protein 4         92.0    8e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007601154.1|  crisp-1                                          90.1    8e-18   
ref|XP_004142874.1|  PREDICTED: uncharacterized protein At4g06744...  91.7    8e-18   Cucumis sativus [cucumbers]
ref|XP_008663372.1|  PREDICTED: uncharacterized protein At4g06744...  92.4    9e-18   
gb|KEH30896.1|  Serine/Threonine kinase, plant-type protein, puta...  91.3    1e-17   Medicago truncatula
gb|ADN33724.1|  LRR-family protein                                    91.3    1e-17   Cucumis melo subsp. melo
ref|XP_004505255.1|  PREDICTED: uncharacterized protein At4g06744...  90.9    1e-17   Cicer arietinum [garbanzo]
ref|XP_008444596.1|  PREDICTED: uncharacterized protein At4g06744...  91.7    1e-17   
ref|XP_007042487.1|  Leucine-rich repeat family protein, putative     90.5    1e-17   
ref|XP_010461823.1|  PREDICTED: uncharacterized protein At4g06744...  91.3    1e-17   Camelina sativa [gold-of-pleasure]
ref|XP_009135898.1|  PREDICTED: leucine-rich repeat extensin-like...  92.4    2e-17   Brassica rapa
ref|XP_010434500.1|  PREDICTED: leucine-rich repeat extensin-like...  92.0    2e-17   
ref|XP_010434501.1|  PREDICTED: leucine-rich repeat extensin-like...  92.0    2e-17   Camelina sativa [gold-of-pleasure]
ref|XP_006414071.1|  hypothetical protein EUTSA_v10024510mg           92.0    2e-17   
ref|XP_010479447.1|  PREDICTED: leucine-rich repeat extensin-like...  91.3    2e-17   Camelina sativa [gold-of-pleasure]
ref|XP_010439825.1|  PREDICTED: leucine-rich repeat extensin-like...  92.0    2e-17   
gb|EMT04546.1|  hypothetical protein F775_44003                       89.7    2e-17   
gb|EAZ32358.1|  hypothetical protein OsJ_16568                        90.9    2e-17   Oryza sativa Japonica Group [Japonica rice]
emb|CAJ86091.1|  H0818H01.13                                          90.9    2e-17   Oryza sativa [red rice]
gb|AEV41070.1|  uncharacterized protein At4g06744 precursor           90.9    2e-17   Oryza minuta
ref|XP_010449482.1|  PREDICTED: leucine-rich repeat extensin-like...  92.0    2e-17   Camelina sativa [gold-of-pleasure]
gb|KDP24107.1|  hypothetical protein JCGZ_25764                       90.1    2e-17   Jatropha curcas
gb|AEV41116.1|  uncharacterized protein At4g06744 precursor           90.5    2e-17   Oryza officinalis
gb|AEV41023.1|  uncharacterized protein At4g06744 precursor           90.5    2e-17   Oryza minuta
ref|XP_010094651.1|  Uncharacterized protein L484_008883              90.1    2e-17   Morus notabilis
ref|XP_010227187.1|  PREDICTED: probable LRR receptor-like serine...  92.0    3e-17   
gb|ACG34018.1|  protein binding protein                               90.1    3e-17   Zea mays [maize]
ref|NP_001054210.2|  Os04g0670100                                     90.1    3e-17   
gb|AIE88270.1|  hypothetical protein OG_BBa0063K01.1                  90.5    3e-17   Oryza glaberrima
gb|EMS61305.1|  hypothetical protein TRIUR3_11917                     89.7    3e-17   Triticum urartu
ref|XP_002518709.1|  serine-threonine protein kinase, plant-type,...  90.5    3e-17   Ricinus communis
gb|KJB12465.1|  hypothetical protein B456_002G019800                  89.4    3e-17   Gossypium raimondii
ref|XP_004955608.1|  PREDICTED: leucine-rich repeat extensin-like...  89.7    3e-17   
gb|AGE09569.1|  LRRK-like protein                                     89.7    3e-17   Eucalyptus cladocalyx
dbj|BAJ86461.1|  predicted protein                                    89.7    3e-17   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008794093.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...  89.7    4e-17   
ref|XP_010228296.1|  PREDICTED: leucine-rich repeat extensin-like...  89.0    4e-17   Brachypodium distachyon [annual false brome]
gb|KJB77660.1|  hypothetical protein B456_012G149500                  89.7    4e-17   Gossypium raimondii
gb|EMT03089.1|  hypothetical protein F775_11041                       89.7    4e-17   
ref|XP_007017156.1|  LRR-family protein                               89.7    4e-17   
ref|XP_006389336.1|  hypothetical protein POPTR_0028s00200g           90.1    4e-17   
ref|XP_010049599.1|  PREDICTED: leucine-rich repeat extensin-like...  89.7    4e-17   
ref|XP_006389464.1|  hypothetical protein POPTR_0024s00730g           90.5    4e-17   Populus trichocarpa [western balsam poplar]
ref|XP_006451102.1|  hypothetical protein CICLE_v100107081mg          86.7    4e-17   
ref|XP_011093658.1|  PREDICTED: leucine-rich repeat extensin-like...  89.0    4e-17   
ref|XP_003566833.2|  PREDICTED: leucine-rich repeat extensin-like...  90.1    4e-17   
ref|XP_002447298.1|  hypothetical protein SORBIDRAFT_06g032310        89.7    5e-17   Sorghum bicolor [broomcorn]
ref|XP_003555862.1|  PREDICTED: uncharacterized protein At4g06744...  89.7    5e-17   Glycine max [soybeans]
ref|XP_004157952.1|  PREDICTED: leucine-rich repeat extensin-like...  89.0    5e-17   
ref|NP_001141186.1|  leucine-rich repeat (LRR) family protein pre...  89.4    5e-17   Zea mays [maize]
gb|KCW82299.1|  hypothetical protein EUGRSUZ_C03706                   89.0    5e-17   Eucalyptus grandis [rose gum]
ref|XP_004141032.1|  PREDICTED: leucine-rich repeat extensin-like...  89.0    5e-17   Cucumis sativus [cucumbers]
ref|XP_001759047.1|  predicted protein                                89.4    6e-17   
gb|ACG42798.1|  leucine-rich repeat, plant specific                   89.0    6e-17   Zea mays [maize]
ref|XP_007043626.1|  Leucine-rich repeat family protein               89.0    6e-17   
ref|XP_008775577.1|  PREDICTED: LOW QUALITY PROTEIN: pollen-speci...  90.5    6e-17   Phoenix dactylifera
ref|NP_193070.1|  leucine-rich repeat extensin-like protein 3         90.5    7e-17   Arabidopsis thaliana [mouse-ear cress]
gb|KJB12258.1|  hypothetical protein B456_002G008600                  89.4    8e-17   Gossypium raimondii
ref|XP_006354850.1|  PREDICTED: uncharacterized protein At4g06744...  88.2    8e-17   Solanum tuberosum [potatoes]
ref|XP_007012977.1|  Leucine-rich repeat family protein / extensi...  88.6    8e-17   
ref|XP_009132101.1|  PREDICTED: leucine-rich repeat extensin-like...  90.1    9e-17   Brassica rapa
ref|XP_010532845.1|  PREDICTED: leucine-rich repeat extensin-like...  89.7    9e-17   Tarenaya hassleriana [spider flower]
ref|XP_009395500.1|  PREDICTED: uncharacterized protein At4g06744...  88.6    9e-17   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006838987.1|  hypothetical protein AMTR_s00002p00271610        89.0    1e-16   
ref|XP_010435287.1|  PREDICTED: leucine-rich repeat extensin-like...  89.7    1e-16   Camelina sativa [gold-of-pleasure]
ref|XP_002455880.1|  hypothetical protein SORBIDRAFT_03g026730        89.4    1e-16   Sorghum bicolor [broomcorn]
ref|XP_009144429.1|  PREDICTED: pollen-specific leucine-rich repe...  88.2    1e-16   Brassica rapa
ref|XP_011078360.1|  PREDICTED: leucine-rich repeat extensin-like...  89.0    1e-16   Sesamum indicum [beniseed]
ref|XP_010450227.1|  PREDICTED: leucine-rich repeat extensin-like...  89.4    1e-16   Camelina sativa [gold-of-pleasure]
ref|XP_010450229.1|  PREDICTED: leucine-rich repeat extensin-like...  89.4    1e-16   Camelina sativa [gold-of-pleasure]
ref|XP_010450228.1|  PREDICTED: leucine-rich repeat extensin-like...  89.4    1e-16   
gb|KDP43798.1|  hypothetical protein JCGZ_23006                       89.4    1e-16   Jatropha curcas
ref|XP_009795730.1|  PREDICTED: leucine-rich repeat extensin-like...  87.8    1e-16   Nicotiana sylvestris
ref|XP_002446758.1|  hypothetical protein SORBIDRAFT_06g021870        88.2    2e-16   Sorghum bicolor [broomcorn]
gb|EYU25784.1|  hypothetical protein MIMGU_mgv1a026389mg              87.4    2e-16   Erythranthe guttata [common monkey flower]
ref|XP_010047660.1|  PREDICTED: leucine-rich repeat extensin-like...  87.8    2e-16   Eucalyptus grandis [rose gum]
ref|XP_004140710.1|  PREDICTED: uncharacterized protein At4g06744...  87.8    2e-16   Cucumis sativus [cucumbers]
ref|XP_006414930.1|  hypothetical protein EUTSA_v100275740mg          87.4    2e-16   
ref|XP_004168435.1|  PREDICTED: uncharacterized protein At4g06744...  87.8    2e-16   
ref|XP_010500525.1|  PREDICTED: leucine-rich repeat extensin-like...  88.2    2e-16   Camelina sativa [gold-of-pleasure]
ref|XP_006372265.1|  hypothetical protein POPTR_0018s14790g           87.8    2e-16   
ref|XP_010433232.1|  PREDICTED: pollen-specific leucine-rich repe...  87.0    2e-16   Camelina sativa [gold-of-pleasure]
ref|XP_010664550.1|  PREDICTED: uncharacterized protein At4g06744...  87.4    2e-16   Vitis vinifera
ref|XP_010263446.1|  PREDICTED: uncharacterized protein At4g06744...  87.8    2e-16   Nelumbo nucifera [Indian lotus]
gb|EYU27248.1|  hypothetical protein MIMGU_mgv1a007527mg              87.0    2e-16   Erythranthe guttata [common monkey flower]
ref|XP_010440602.1|  PREDICTED: leucine-rich repeat extensin-like...  88.6    2e-16   Camelina sativa [gold-of-pleasure]
ref|XP_011078162.1|  PREDICTED: leucine-rich repeat extensin-like...  88.6    2e-16   Sesamum indicum [beniseed]
ref|XP_007198810.1|  hypothetical protein PRUPE_ppa026805mg           87.0    2e-16   
emb|CDY18974.1|  BnaC01g20940D                                        87.0    2e-16   Brassica napus [oilseed rape]
emb|CDY72552.1|  BnaCnng78240D                                        87.0    2e-16   Brassica napus [oilseed rape]
gb|EPS66537.1|  extensin-like protein                                 86.7    2e-16   Genlisea aurea
ref|XP_009396708.1|  PREDICTED: uncharacterized protein At4g06744...  87.4    2e-16   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008229070.1|  PREDICTED: leucine-rich repeat extensin-like...  87.4    2e-16   Prunus mume [ume]
ref|XP_002284965.1|  PREDICTED: uncharacterized protein At4g06744...  87.4    2e-16   Vitis vinifera
gb|KJB06895.1|  hypothetical protein B456_001G004000                  87.8    3e-16   Gossypium raimondii
ref|XP_008459038.1|  PREDICTED: leucine-rich repeat extensin-like...  87.0    3e-16   Cucumis melo [Oriental melon]
ref|XP_004248758.1|  PREDICTED: uncharacterized protein At4g06744...  87.0    4e-16   Solanum lycopersicum
gb|KJB06897.1|  hypothetical protein B456_001G004000                  87.8    4e-16   Gossypium raimondii
emb|CDP03355.1|  unnamed protein product                              88.2    4e-16   Coffea canephora [robusta coffee]
ref|XP_011019927.1|  PREDICTED: leucine-rich repeat extensin-like...  88.2    4e-16   Populus euphratica
ref|XP_004976154.1|  PREDICTED: uncharacterized protein At4g06744...  87.0    4e-16   Setaria italica
gb|KJB06894.1|  hypothetical protein B456_001G004000                  87.4    4e-16   Gossypium raimondii
ref|XP_007013226.1|  Leucine-rich repeat family protein               87.8    4e-16   
emb|CDY49661.1|  BnaC09g41390D                                        86.3    4e-16   Brassica napus [oilseed rape]
gb|KFK28537.1|  hypothetical protein AALP_AA7G009800                  87.8    4e-16   Arabis alpina [alpine rockcress]
ref|XP_010251730.1|  PREDICTED: pollen-specific leucine-rich repe...  87.4    4e-16   Nelumbo nucifera [Indian lotus]
gb|EMT28947.1|  hypothetical protein F775_27022                       84.7    4e-16   
gb|KJB06896.1|  hypothetical protein B456_001G004000                  87.8    4e-16   Gossypium raimondii
ref|XP_004137106.1|  PREDICTED: uncharacterized protein At4g06744...  86.3    4e-16   
ref|XP_006469927.1|  PREDICTED: pollen-specific leucine-rich repe...  86.3    5e-16   Citrus sinensis [apfelsine]
ref|XP_004171357.1|  PREDICTED: uncharacterized protein At4g06744...  87.0    5e-16   
ref|XP_011093910.1|  PREDICTED: leucine-rich repeat extensin-like...  87.8    5e-16   
ref|XP_009602497.1|  PREDICTED: leucine-rich repeat extensin-like...  86.3    5e-16   
gb|KDO42769.1|  hypothetical protein CISIN_1g036320mg                 86.3    5e-16   
ref|XP_002517887.1|  serine-threonine protein kinase, plant-type,...  86.3    5e-16   
ref|XP_006476103.1|  PREDICTED: leucine-rich repeat extensin-like...  87.8    5e-16   
ref|XP_010914722.1|  PREDICTED: pollen-specific leucine-rich repe...  87.8    5e-16   
ref|XP_003567675.1|  PREDICTED: pollen-specific leucine-rich repe...  87.0    5e-16   
ref|XP_004503826.1|  PREDICTED: leucine-rich repeat extensin-like...  85.9    5e-16   
ref|XP_010527189.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...  87.4    5e-16   
ref|XP_002863246.1|  hypothetical protein ARALYDRAFT_497051           87.0    5e-16   
ref|XP_006447273.1|  hypothetical protein CICLE_v10018109mg           85.9    5e-16   
gb|KGN43905.1|  hypothetical protein Csa_7G073410                     86.7    6e-16   
ref|XP_006356575.1|  PREDICTED: uncharacterized protein At4g06744...  86.3    6e-16   
ref|XP_006307323.1|  hypothetical protein CARUB_v10008944mg           86.7    6e-16   
ref|XP_002964014.1|  hypothetical protein SELMODRAFT_81544            85.9    6e-16   
gb|KJB14611.1|  hypothetical protein B456_002G133900                  86.3    7e-16   
ref|XP_010932003.1|  PREDICTED: pollen-specific leucine-rich repe...  87.0    7e-16   
gb|EPS61338.1|  hypothetical protein M569_13456                       85.5    7e-16   
ref|NP_001043463.1|  Os01g0594300                                     86.7    7e-16   
ref|XP_002516600.1|  serine-threonine protein kinase, plant-type,...  86.7    7e-16   
dbj|BAB91812.1|  extensin precursor-like                              86.7    7e-16   
gb|EPS58069.1|  hypothetical protein M569_16746                       84.7    8e-16   
ref|XP_002308630.2|  hypothetical protein POPTR_0006s26190g           86.3    8e-16   
ref|XP_010431693.1|  PREDICTED: leucine-rich repeat extensin-like...  87.0    8e-16   
ref|XP_011019702.1|  PREDICTED: leucine-rich repeat extensin-like...  86.3    8e-16   
ref|XP_010473462.1|  PREDICTED: leucine-rich repeat extensin-like...  87.0    8e-16   
ref|XP_006282938.1|  hypothetical protein CARUB_v100074500mg          86.3    8e-16   
ref|XP_010473463.1|  PREDICTED: leucine-rich repeat extensin-like...  87.0    9e-16   
ref|XP_011019700.1|  PREDICTED: leucine-rich repeat extensin-like...  86.3    9e-16   
ref|XP_010438472.1|  PREDICTED: pollen-specific leucine-rich repe...  85.1    9e-16   
ref|XP_011019699.1|  PREDICTED: leucine-rich repeat extensin-like...  86.3    9e-16   
ref|XP_011092901.1|  PREDICTED: pollen-specific leucine-rich repe...  87.0    1e-15   
ref|XP_010447991.1|  PREDICTED: pollen-specific leucine-rich repe...  85.1    1e-15   
ref|XP_006286011.1|  hypothetical protein CARUB_v10007539mg           85.1    1e-15   
ref|XP_006849391.1|  hypothetical protein AMTR_s00160p00027170        85.1    1e-15   
ref|XP_008361263.1|  PREDICTED: leucine-rich repeat extensin-like...  83.6    1e-15   
gb|KEH30699.1|  LRR/extensin                                          85.5    1e-15   
ref|XP_009348443.1|  PREDICTED: leucine-rich repeat extensin-like...  86.7    1e-15   
ref|XP_011043443.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...  86.3    1e-15   
ref|XP_009394537.1|  PREDICTED: uncharacterized protein At4g06744...  85.5    1e-15   
ref|XP_002308303.1|  hypothetical protein POPTR_0006s15750g           85.1    1e-15   
ref|XP_008344101.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...  85.9    1e-15   
ref|XP_007157716.1|  hypothetical protein PHAVU_002G092300g           85.1    1e-15   
ref|XP_010418239.1|  PREDICTED: leucine-rich repeat extensin-like...  86.3    1e-15   
ref|XP_010050506.1|  PREDICTED: leucine-rich repeat extensin-like...  85.1    1e-15   
gb|EYU28282.1|  hypothetical protein MIMGU_mgv1a024954mg              82.0    1e-15   
ref|XP_006855188.1|  hypothetical protein AMTR_s00051p00142580        85.1    1e-15   
ref|XP_009117517.1|  PREDICTED: leucine-rich repeat extensin-like...  84.7    2e-15   
ref|XP_011007265.1|  PREDICTED: leucine-rich repeat extensin-like...  84.7    2e-15   
emb|CDY68356.1|  BnaA09g55960D                                        84.7    2e-15   
dbj|BAJ86997.1|  predicted protein                                    84.3    2e-15   
ref|XP_009406957.1|  PREDICTED: pollen-specific leucine-rich repe...  84.7    2e-15   
emb|CDY03339.1|  BnaC09g10090D                                        84.3    2e-15   
ref|XP_002310403.2|  hypothetical protein POPTR_0007s01000g           84.0    2e-15   
ref|XP_009336235.1|  PREDICTED: leucine-rich repeat extensin-like...  84.7    2e-15   
ref|XP_006371912.1|  hypothetical protein POPTR_0018s06150g           85.5    2e-15   
gb|KGN43906.1|  hypothetical protein Csa_7G073420                     85.1    2e-15   
emb|CDO97126.1|  unnamed protein product                              85.9    2e-15   
ref|XP_008454973.1|  PREDICTED: uncharacterized protein At4g06744...  85.5    2e-15   
ref|XP_008337109.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...  85.1    2e-15   
ref|XP_002982230.1|  hypothetical protein SELMODRAFT_54019            84.7    2e-15   
ref|XP_002888025.1|  hypothetical protein ARALYDRAFT_475099           85.9    2e-15   
ref|XP_004173680.1|  PREDICTED: leucine-rich repeat extensin-like...  85.1    2e-15   
ref|XP_006412962.1|  hypothetical protein EUTSA_v10027136mg           84.3    2e-15   
ref|XP_009409048.1|  PREDICTED: leucine-rich repeat extensin-like...  84.7    2e-15   
ref|XP_006842252.1|  hypothetical protein AMTR_s00078p00197410        85.9    2e-15   
ref|XP_006375015.1|  hypothetical protein POPTR_0014s03600g           84.7    2e-15   
ref|XP_004139428.1|  PREDICTED: leucine-rich repeat extensin-like...  85.5    2e-15   
ref|XP_008342893.1|  PREDICTED: leucine-rich repeat extensin-like...  84.3    2e-15   
ref|NP_172668.1|  leucine-rich repeat extensin-like protein 1         85.5    2e-15   
ref|XP_008798585.1|  PREDICTED: leucine-rich repeat extensin-like...  84.3    2e-15   
gb|KGN60627.1|  hypothetical protein Csa_2G004760                     85.5    2e-15   
ref|XP_010092426.1|  Leucine-rich repeat extensin-like protein 6      84.3    2e-15   
gb|KJB54163.1|  hypothetical protein B456_009G023700                  85.5    3e-15   
sp|O48809.1|LRX2_ARATH  RecName: Full=Leucine-rich repeat extensi...  85.5    3e-15   
gb|KJB54162.1|  hypothetical protein B456_009G023700                  84.7    3e-15   
ref|NP_176434.1|  leucine-rich repeat extensin-like protein 2         85.5    3e-15   
ref|XP_002894215.1|  hypothetical protein ARALYDRAFT_474107           84.3    3e-15   
ref|XP_010915366.1|  PREDICTED: leucine-rich repeat extensin-like...  84.0    3e-15   
ref|XP_011018198.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...  84.7    3e-15   
gb|EMD88368.1|  hypothetical protein COCHEDRAFT_1216289               82.4    3e-15   
ref|XP_009336917.1|  PREDICTED: leucine-rich repeat extensin-like...  85.1    3e-15   
ref|XP_008224557.1|  PREDICTED: leucine-rich repeat extensin-like...  85.1    3e-15   
gb|KFK36221.1|  hypothetical protein AALP_AA4G093700                  85.1    3e-15   
gb|KJB32335.1|  hypothetical protein B456_005G236200                  84.0    4e-15   
ref|XP_009408506.1|  PREDICTED: leucine-rich repeat extensin-like...  83.6    4e-15   
ref|XP_009800281.1|  PREDICTED: pollen-specific leucine-rich repe...  84.7    4e-15   
ref|XP_008219840.1|  PREDICTED: leucine-rich repeat extensin-like...  84.3    4e-15   
ref|NP_001043006.1|  Os01g0356900                                     84.3    4e-15   
gb|KDP32304.1|  hypothetical protein JCGZ_13229                       84.7    4e-15   
ref|NP_194567.1|  leucine-rich repeat (LRR) family protein            83.2    4e-15   
ref|NP_175397.1|  leucine-rich repeat (LRR) family protein            84.0    4e-15   
ref|XP_002889910.1|  hypothetical protein ARALYDRAFT_312231           84.3    4e-15   
gb|EEC70617.1|  hypothetical protein OsI_01869                        84.0    5e-15   
ref|XP_006346494.1|  PREDICTED: pollen-specific leucine-rich repe...  84.7    5e-15   
ref|XP_010925512.1|  PREDICTED: leucine-rich repeat extensin-like...  83.6    5e-15   
ref|XP_004170987.1|  PREDICTED: uncharacterized protein At4g06744...  82.8    5e-15   
ref|XP_006299675.1|  hypothetical protein CARUB_v10015862mg           83.2    5e-15   
emb|CDX81947.1|  BnaC08g36540D                                        83.2    5e-15   
ref|XP_007227690.1|  hypothetical protein PRUPE_ppa1027218m2g         83.2    6e-15   
ref|XP_010554947.1|  PREDICTED: leucine-rich repeat extensin-like...  82.8    6e-15   
ref|XP_002967908.1|  hypothetical protein SELMODRAFT_87965            83.2    6e-15   
emb|CDP07600.1|  unnamed protein product                              84.0    6e-15   
ref|XP_010088853.1|  Leucine-rich repeat extensin-like protein 4      84.3    6e-15   
gb|KJB27056.1|  hypothetical protein B456_004G274900                  83.6    6e-15   
ref|XP_002867451.1|  leucine-rich repeat family protein               82.8    6e-15   
ref|XP_007225572.1|  hypothetical protein PRUPE_ppa019759m1g          83.6    6e-15   
ref|XP_011030760.1|  PREDICTED: pollen-specific leucine-rich repe...  84.0    7e-15   
emb|CDY48727.1|  BnaA09g10020D                                        82.4    7e-15   
ref|XP_004238131.2|  PREDICTED: probable inactive receptor kinase...  84.3    7e-15   
ref|XP_002281292.2|  PREDICTED: leucine-rich repeat extensin-like...  84.3    7e-15   
ref|XP_008242638.1|  PREDICTED: leucine-rich repeat extensin-like...  84.0    7e-15   
ref|XP_004303132.1|  PREDICTED: leucine-rich repeat extensin-like...  82.8    8e-15   
ref|XP_008458246.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...  84.0    8e-15   
ref|XP_010476158.1|  PREDICTED: leucine-rich repeat extensin-like...  84.0    8e-15   
ref|XP_010458626.1|  PREDICTED: leucine-rich repeat extensin-like...  84.0    8e-15   
ref|XP_008454972.1|  PREDICTED: uncharacterized protein At4g06744...  82.8    8e-15   
gb|AEK28682.1|  leucine rich repeat family protein                    80.1    8e-15   
ref|XP_009118117.1|  PREDICTED: leucine-rich repeat extensin-like...  83.6    9e-15   
ref|XP_010689048.1|  PREDICTED: leucine-rich repeat extensin-like...  82.4    9e-15   
emb|CDP14813.1|  unnamed protein product                              82.4    9e-15   
ref|NP_194653.1|  leucine-rich repeat-containing protein              82.8    9e-15   
gb|KJB74832.1|  hypothetical protein B456_012G009700                  83.6    9e-15   
ref|XP_009606354.1|  PREDICTED: pollen-specific leucine-rich repe...  83.6    1e-14   
gb|KJB74831.1|  hypothetical protein B456_012G009700                  83.6    1e-14   
ref|XP_008347715.1|  PREDICTED: leucine-rich repeat extensin-like...  82.4    1e-14   
ref|XP_004296668.1|  PREDICTED: leucine-rich repeat extensin-like...  82.0    1e-14   
ref|XP_006391867.1|  hypothetical protein EUTSA_v10023291mg           83.6    1e-14   
ref|XP_004968723.1|  PREDICTED: pollen-specific leucine-rich repe...  82.8    1e-14   
gb|EPS67596.1|  hypothetical protein M569_07180                       82.4    1e-14   
ref|XP_010270780.1|  PREDICTED: uncharacterized protein At4g06744...  82.8    1e-14   
ref|XP_002869445.1|  leucine-rich repeat family protein               82.4    1e-14   
ref|XP_008800833.1|  PREDICTED: pollen-specific leucine-rich repe...  83.6    1e-14   
ref|XP_004137107.1|  PREDICTED: uncharacterized protein At4g06744...  82.8    1e-14   
gb|EAY92168.1|  hypothetical protein OsI_13881                        82.0    1e-14   
ref|NP_001051547.1|  Os03g0795300                                     82.0    1e-14   
emb|CDY31235.1|  BnaC08g15300D                                        83.2    1e-14   
emb|CDY26536.1|  BnaA09g47410D                                        83.2    1e-14   
gb|KHN05611.1|  Hypothetical protein glysoja_047056                   82.0    1e-14   
gb|KFK29358.1|  hypothetical protein AALP_AA7G123800                  82.0    1e-14   
ref|XP_009408826.1|  PREDICTED: leucine-rich repeat extensin-like...  82.8    1e-14   
ref|XP_009112629.1|  PREDICTED: leucine-rich repeat extensin-like...  82.4    1e-14   
emb|CDY15964.1|  BnaC08g41590D                                        82.8    1e-14   
gb|EEE60089.1|  hypothetical protein OsJ_12940                        82.0    1e-14   
ref|XP_003538630.1|  PREDICTED: uncharacterized protein At4g06744...  82.4    1e-14   
ref|XP_010690992.1|  PREDICTED: pollen-specific leucine-rich repe...  82.8    1e-14   
gb|KEH27082.1|  LRR extensin-like protein                             83.2    2e-14   
ref|XP_004512856.1|  PREDICTED: leucine-rich repeat extensin-like...  82.8    2e-14   
ref|XP_004287084.1|  PREDICTED: leucine-rich repeat extensin-like...  82.8    2e-14   
ref|XP_003620502.1|  Extensin-like protein                            83.2    2e-14   
ref|NP_179568.1|  leucine-rich repeat-containing protein              81.6    2e-14   
ref|XP_010249819.1|  PREDICTED: leucine-rich repeat extensin-like...  82.8    2e-14   
ref|XP_002991811.1|  hypothetical protein SELMODRAFT_134330           80.1    2e-14   
ref|XP_010035772.1|  PREDICTED: leucine-rich repeat extensin-like...  81.6    2e-14   
ref|XP_008357497.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...  82.4    2e-14   
ref|XP_009417528.1|  PREDICTED: leucine-rich repeat extensin-like...  82.8    2e-14   
ref|XP_009376329.1|  PREDICTED: leucine-rich repeat extensin-like...  82.8    2e-14   
ref|XP_001769850.1|  predicted protein                                80.5    2e-14   
ref|XP_008378297.1|  PREDICTED: leucine-rich repeat extensin-like...  82.4    2e-14   
ref|XP_004230831.1|  PREDICTED: pollen-specific leucine-rich repe...  82.8    2e-14   
ref|XP_007013716.1|  Leucine-rich repeat family protein               82.4    2e-14   
ref|XP_007014601.1|  Leucine-rich repeat/extensin 2                   82.4    2e-14   
ref|XP_009801066.1|  PREDICTED: pollen-specific leucine-rich repe...  82.0    2e-14   
ref|XP_002992971.1|  hypothetical protein SELMODRAFT_136258           79.7    2e-14   
ref|NP_001175075.1|  Os07g0176400                                     80.1    3e-14   
gb|KDP41694.1|  hypothetical protein JCGZ_16101                       81.3    3e-14   
ref|XP_009775306.1|  PREDICTED: pollen-specific leucine-rich repe...  82.4    3e-14   
ref|XP_006351117.1|  PREDICTED: leucine-rich repeat extensin-like...  82.0    3e-14   
gb|KJB65054.1|  hypothetical protein B456_010G078700                  80.9    4e-14   
emb|CDY19550.1|  BnaC09g13530D                                        82.0    4e-14   
gb|EAZ02952.1|  hypothetical protein OsI_25092                        80.5    4e-14   
dbj|BAK04234.1|  predicted protein                                    81.6    4e-14   
gb|KDO79655.1|  hypothetical protein CISIN_1g041736mg                 81.3    4e-14   
ref|XP_006476177.1|  PREDICTED: leucine-rich repeat extensin-like...  81.3    4e-14   
emb|CDY12948.1|  BnaA09g13260D                                        81.6    4e-14   
dbj|BAJ91841.1|  predicted protein                                    81.6    4e-14   
ref|XP_010107567.1|  Leucine-rich repeat extensin-like protein 2      81.6    4e-14   
gb|EYU21900.1|  hypothetical protein MIMGU_mgv1a006829mg              80.9    4e-14   
emb|CDY21028.1|  BnaA08g24970D                                        81.6    4e-14   
ref|XP_010251965.1|  PREDICTED: leucine-rich repeat extensin-like...  81.6    4e-14   
dbj|BAO45886.1|  leucine-rich repeat extensin-like protein            80.9    4e-14   
ref|XP_003602966.1|  Serine/threonine protein kinase BRI1-like pr...  81.6    4e-14   
gb|EYU24926.1|  hypothetical protein MIMGU_mgv1a006719mg              80.9    4e-14   
ref|XP_009773829.1|  PREDICTED: leucine-rich repeat extensin-like...  80.5    4e-14   
ref|XP_008225431.1|  PREDICTED: pollen-specific leucine-rich repe...  82.0    5e-14   
ref|XP_006408895.1|  hypothetical protein EUTSA_v10002007mg           80.5    5e-14   
ref|XP_006450582.1|  hypothetical protein CICLE_v10010264mg           81.3    5e-14   
ref|XP_010251729.1|  PREDICTED: pollen-specific leucine-rich repe...  81.6    5e-14   
ref|XP_004252054.1|  PREDICTED: leucine-rich repeat extensin-like...  81.6    5e-14   
ref|XP_009110677.1|  PREDICTED: leucine-rich repeat extensin-like...  81.6    5e-14   
gb|KHN37158.1|  Pollen-specific leucine-rich repeat extensin-like...  81.6    5e-14   
ref|XP_010921838.1|  PREDICTED: pollen-specific leucine-rich repe...  80.9    5e-14   
gb|KHN43047.1|  Hypothetical protein glysoja_007577                   80.9    5e-14   
ref|XP_003529407.1|  PREDICTED: uncharacterized protein At4g06744...  80.5    5e-14   
ref|XP_006584319.1|  PREDICTED: pollen-specific leucine-rich repe...  81.3    5e-14   
ref|XP_009113078.1|  PREDICTED: leucine-rich repeat extensin-like...  81.3    5e-14   
ref|NP_001168621.1|  leucine-rich repeat (LRR) family protein pre...  78.2    6e-14   
gb|AAD55979.1|AF159296_1  extensin-like protein                       81.3    6e-14   
gb|KDP40220.1|  hypothetical protein JCGZ_02218                       79.7    6e-14   
ref|XP_006304470.1|  hypothetical protein CARUB_v10011166mg           81.3    6e-14   
ref|XP_007202178.1|  hypothetical protein PRUPE_ppa006630mg           80.1    6e-14   
ref|XP_009113077.1|  PREDICTED: leucine-rich repeat extensin-like...  81.3    6e-14   
ref|XP_003629650.1|  Receptor-like protein kinase                     81.3    6e-14   
ref|XP_010091486.1|  hypothetical protein L484_010328                 80.1    6e-14   
ref|XP_006645883.1|  PREDICTED: pollen-specific leucine-rich repe...  80.5    6e-14   
ref|XP_009377376.1|  PREDICTED: leucine-rich repeat extensin-like...  81.3    6e-14   
ref|XP_009608702.1|  PREDICTED: leucine-rich repeat extensin-like...  81.3    6e-14   
ref|XP_002437554.1|  hypothetical protein SORBIDRAFT_10g029260        81.3    6e-14   
ref|XP_003630813.1|  Extensin-like protein                            81.3    7e-14   
ref|XP_009599187.1|  PREDICTED: pollen-specific leucine-rich repe...  80.9    7e-14   
ref|XP_004496690.1|  PREDICTED: leucine-rich repeat extensin-like...  80.1    7e-14   
ref|XP_010541003.1|  PREDICTED: leucine-rich repeat extensin-like...  80.1    7e-14   
ref|XP_009622388.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...  80.1    7e-14   
ref|NP_001147644.1|  receptor protein kinase CLAVATA1 precursor       79.7    7e-14   
ref|XP_002457818.1|  hypothetical protein SORBIDRAFT_03g014350        80.1    7e-14   
ref|XP_006494306.1|  PREDICTED: pollen-specific leucine-rich repe...  81.3    7e-14   
ref|XP_010064140.1|  PREDICTED: pollen-specific leucine-rich repe...  80.9    7e-14   
ref|XP_004248904.1|  PREDICTED: pollen-specific leucine-rich repe...  80.9    7e-14   
dbj|BAF48665.1|  leucine-rich repeat/extensin 1                       80.9    7e-14   
gb|KHM99821.1|  Leucine-rich repeat extensin-like protein 6           80.1    7e-14   
ref|XP_010655031.1|  PREDICTED: leucine-rich repeat extensin-like...  80.9    7e-14   



>ref|XP_009588943.1| PREDICTED: uncharacterized protein At4g06744-like [Nicotiana 
tomentosiformis]
Length=515

 Score =   144 bits (362),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 89/148 (60%), Positives = 105/148 (71%), Gaps = 10/148 (7%)
 Frame = +2

Query  245  IRKSIKAIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfn  424
            +RK IK I+ FKK+IT DP  VT++W GN++C   +KY GF CY      K  V  I FN
Sbjct  151  LRKVIKVIQNFKKTITSDPFGVTKTWVGNDIC---RKYVGFTCY------KNHVVAIDFN  201

Query  425  gynfngnglslnsFVESFNDLVVIHVNSNNFTGA-PGIPVQKFPTLFELDLSNNKLAGAF  601
            G+ FNG+ LSL  F+E    LV+IH+NSNNFTG+ P I  +  P LFELDLSNNKLAG F
Sbjct  202  GFRFNGSQLSLRKFIEEIKTLVIIHLNSNNFTGSVPEISTKTLPKLFELDLSNNKLAGPF  261

Query  602  PTAVLEATNLTYLDLRFNMLTGPVHPQV  685
            P AVL ATNLTYLD+RFN LTGPV PQV
Sbjct  262  PKAVLGATNLTYLDVRFNQLTGPVDPQV  289



>ref|XP_009793223.1| PREDICTED: uncharacterized protein At4g06744-like [Nicotiana 
sylvestris]
Length=511

 Score =   134 bits (336),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 102/172 (59%), Positives = 121/172 (70%), Gaps = 11/172 (6%)
 Frame = +2

Query  233  LDPVIRKSIKAIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVgg  412
            L   +R+ IK I+ FKK+IT DP  VT++W GN++C     Y+G+ CY      K  V  
Sbjct  147  LTAELREVIKVIQKFKKTITSDPFGVTRTWVGNDVCC----YKGYTCY------KNHVVA  196

Query  413  iyfngynfngnglslnsFVESFNDLVVIHVNSNNFTG-APGIPVQKFPTLFELDLSNNKL  589
            I FNG++ NGN L+LN+F+E    LVVIH+NSNNFT   P I  +  P LFE DLSNNKL
Sbjct  197  IDFNGFHLNGNQLALNNFIEKIKTLVVIHLNSNNFTSPVPEISTKTHPKLFEFDLSNNKL  256

Query  590  AGAFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLP  745
            AG FP AVL ATNLTYLD+RFN LTGPV PQVFTLDLD LFLNNN FSG +P
Sbjct  257  AGPFPKAVLGATNLTYLDVRFNQLTGPVDPQVFTLDLDVLFLNNNGFSGEIP  308



>emb|CDP02527.1| unnamed protein product [Coffea canephora]
Length=436

 Score =   132 bits (332),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 95/174 (55%), Positives = 115/174 (66%), Gaps = 3/174 (2%)
 Frame = +2

Query  233  LDPVIRKSIKAIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVgg  412
            L   ++ +I+ I+ FK+ I  DP  VT++W GN +C +K KY+GF C      +K RV G
Sbjct  115  LSEELKMAIQVIQRFKRRIKSDPFCVTKTWTGNRICYDKSKYKGFVCDRSTKDNKFRVVG  174

Query  413  iyfngynfngng---lslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNN  583
            + FNG+NF+G     L    FVE   DLV+ HVNSNNFTG     + K P  FE DLSNN
Sbjct  175  VNFNGFNFDGGPGCPLVATDFVEDLKDLVIFHVNSNNFTGDIPFGISKLPNFFEFDLSNN  234

Query  584  KLAGAFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLP  745
            KL GAFP A L ATNLTYLD+RFN LTG + PQ FTLDLD LFLNNN FSG +P
Sbjct  235  KLVGAFPAAALGATNLTYLDVRFNQLTGTIPPQAFTLDLDVLFLNNNAFSGKIP  288



>emb|CDP02523.1| unnamed protein product [Coffea canephora]
Length=488

 Score =   131 bits (330),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 78/154 (51%), Positives = 97/154 (63%), Gaps = 3/154 (2%)
 Frame = +2

Query  233  LDPVIRKSIKAIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVgg  412
            L   ++ +I+ I+ FK+ I YDP  +T++W G  +C +  KY+GF C      +K RV G
Sbjct  110  LSKELKMAIQVIQRFKRRIKYDPFGITKTWTGKRICFDNSKYKGFVCDRSTKDNKFRVVG  169

Query  413  iyfngynfngng---lslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNN  583
            + FNGYNFNG     L    F+E   DLV+ HVNSNNFTG     + K P  FE DLSNN
Sbjct  170  VNFNGYNFNGGPGCPLVATDFIEDLKDLVIFHVNSNNFTGDIPFGISKLPNFFEFDLSNN  229

Query  584  KLAGAFPTAVLEATNLTYLDLRFNMLTGPVHPQV  685
            KL GAFP A L ATNLTYLD+RFN LTG + PQ 
Sbjct  230  KLVGAFPAAALGATNLTYLDVRFNQLTGTIPPQA  263



>gb|EYU44430.1| hypothetical protein MIMGU_mgv1a005057mg [Erythranthe guttata]
Length=498

 Score =   130 bits (327),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 77/151 (51%), Positives = 102/151 (68%), Gaps = 1/151 (1%)
 Frame = +2

Query  233  LDPVIRKSIKAIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVgg  412
            L P +  ++K I  F+++IT DP  VT++W+G  +C +K  Y+GF C       K RV  
Sbjct  123  LTPELLVAVKVIEKFRQTITKDPLGVTKTWKG-RICADKSAYRGFTCDTTISDGKVRVAL  181

Query  413  iyfngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLA  592
            + FNG+NF+GN L+L +F++   DL+V HVN+NNF G     + K PTL+ELDLSNNKLA
Sbjct  182  VNFNGFNFSGNPLALTNFIDGLTDLIVFHVNTNNFAGQVPAGISKLPTLYELDLSNNKLA  241

Query  593  GAFPTAVLEATNLTYLDLRFNMLTGPVHPQV  685
            G FP  VL ATNLT+LDLRFN LTG + P V
Sbjct  242  GEFPKPVLAATNLTFLDLRFNQLTGKLPPAV  272



>ref|XP_006360245.1| PREDICTED: uncharacterized protein At4g06744-like, partial [Solanum 
tuberosum]
Length=387

 Score =   123 bits (309),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 76/150 (51%), Positives = 95/150 (63%), Gaps = 8/150 (5%)
 Frame = +2

Query  242  VIRKSIKAIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyf  421
            ++  +I  I+ F+K+IT DP  +T++WEGN++C +  KY GF C      +  +V  + F
Sbjct  17   LLASAISVIKRFRKTITSDPSGITKTWEGNDICKDPTKYIGFIC------NNNKVVAVNF  70

Query  422  ngynfngnglslnsFVESFNDLVVIHVNSNNFTGA--PGIPVQKFPTLFELDLSNNKLAG  595
            NG NF GN LSL  F+     L + H NSNNFTG     I  Q  P LFELDLSNNK  G
Sbjct  71   NGRNFKGNPLSLKDFINGIPTLEIFHSNSNNFTGEIPNNISTQSIPNLFELDLSNNKYVG  130

Query  596  AFPTAVLEATNLTYLDLRFNMLTGPVHPQV  685
             FP AVL AT LTYLDLRFN + GPV+PQV
Sbjct  131  FFPKAVLGATRLTYLDLRFNQIKGPVNPQV  160



>ref|XP_004233445.1| PREDICTED: uncharacterized protein At4g06744-like [Solanum lycopersicum]
Length=464

 Score =   122 bits (306),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 92/172 (53%), Positives = 111/172 (65%), Gaps = 8/172 (5%)
 Frame = +2

Query  236  DPVIRKSIKAIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggi  415
            + ++  +I  I+ FKK+IT DP  +T++W G ++C +  KY GF C      +K +V  +
Sbjct  93   NDLLTSAISVIQRFKKTITSDPSGITKTWVGKDICKDSTKYVGFIC------NKNKVVAV  146

Query  416  yfngynfngnglslnsFVESFNDLVVIHVNSNNFTGA--PGIPVQKFPTLFELDLSNNKL  589
             FNG NF GN LSL  F+     L + H NSNNFTG     I  Q  P LFELDLSNNK 
Sbjct  147  NFNGRNFKGNPLSLKDFINGIPTLEIFHSNSNNFTGEIPNNISTQSIPNLFELDLSNNKY  206

Query  590  AGAFPTAVLEATNLTYLDLRFNMLTGPVHPQVftldldalflnnnffSGPLP  745
             G FP AVL AT LTYLDLRFN + GPV PQVFTLDLD LFLNNN FSG +P
Sbjct  207  VGLFPRAVLGATRLTYLDLRFNQIEGPVDPQVFTLDLDILFLNNNQFSGKIP  258



>ref|XP_011099103.1| PREDICTED: uncharacterized protein At4g06744-like [Sesamum indicum]
Length=487

 Score =   120 bits (302),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 69/147 (47%), Positives = 96/147 (65%), Gaps = 1/147 (1%)
 Frame = +2

Query  245  IRKSIKAIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfn  424
            ++ ++K I  F+++IT DP N+T++W G  +C +K  Y+GF C      +K  V  + FN
Sbjct  118  LQMAVKVIERFRRTITEDPFNITKTWTG-RICKDKHAYRGFACDTTIRDNKTVVAYVLFN  176

Query  425  gynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFP  604
            G+ F G  L L +F+    DL+V H N+N FTG     + K P+LFE DLSNN+L+G FP
Sbjct  177  GFRFKGKPLKLENFLGGLKDLIVFHANTNFFTGGVPSGISKIPSLFEFDLSNNRLSGGFP  236

Query  605  TAVLEATNLTYLDLRFNMLTGPVHPQV  685
             AVL ATNLT+LDLRFN LTG + P+V
Sbjct  237  RAVLAATNLTFLDLRFNQLTGKLPPEV  263



>ref|XP_008456145.1| PREDICTED: uncharacterized protein At4g06744-like [Cucumis melo]
Length=424

 Score =   115 bits (287),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 64/151 (42%), Positives = 90/151 (60%), Gaps = 5/151 (3%)
 Frame = +2

Query  233  LDPVIRKSIKAIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVgg  412
            LD  +  +   I+TFK  IT DP NVTQ+W G+++C    KYQGF+C  P   +K  V  
Sbjct  57   LDQRLAVAYPIIQTFKALITSDPLNVTQTWVGSDIC----KYQGFYCDNPPD-NKSAVAI  111

Query  413  iyfngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLA  592
               +   F     +L+ F++S  DL + H NSNNF+G     +   P L+ELDLSNN+L+
Sbjct  112  AGIDFNGFQLTASTLDGFIDSLPDLAIFHANSNNFSGTITPKIASLPYLYELDLSNNQLS  171

Query  593  GAFPTAVLEATNLTYLDLRFNMLTGPVHPQV  685
            G FP A+L  T+L++ D+RFN  TG V  Q+
Sbjct  172  GTFPVAILSVTDLSFFDIRFNFFTGFVPQQL  202



>ref|XP_010555995.1| PREDICTED: uncharacterized protein At4g06744-like [Tarenaya hassleriana]
Length=481

 Score =   112 bits (280),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 68/148 (46%), Positives = 99/148 (67%), Gaps = 4/148 (3%)
 Frame = +2

Query  245  IRKSIKAIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfn  424
            IRK+I  I+ F+  I  DP+++T++W G ++C + K Y GF C +  G     V  + FN
Sbjct  110  IRKAIPVIQRFRGLIECDPKDITRTWNGTDVCADDK-YVGFDCAIYPGTKDLAVASVRFN  168

Query  425  gynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIP-VQKFPTLFELDLSNNKLAGAF  601
             +NF+G  L L++F++   ++ + H NSN F G+  +P V+    LFELDLSNNKL+G F
Sbjct  169  EFNFSGKNLRLDNFLDKLEEVTIFHANSNQFVGS--VPRVENLKYLFELDLSNNKLSGEF  226

Query  602  PTAVLEATNLTYLDLRFNMLTGPVHPQV  685
            P++VL+A NLT+LDLRFN L+G V PQV
Sbjct  227  PSSVLQAKNLTFLDLRFNSLSGSVPPQV  254



>gb|AEI72268.1| leucine-rich repeat family protein [Citrus trifoliata]
Length=448

 Score =   111 bits (278),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 71/147 (48%), Positives = 92/147 (63%), Gaps = 3/147 (2%)
 Frame = +2

Query  245  IRKSIKAIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfn  424
            I+ + K I+ FKK ITYDPQ + ++W G ++C    KY+GF C V     KK V G+ FN
Sbjct  81   IQLAFKVIQRFKKRITYDPQGIAKTWVGPDVC---NKYKGFVCDVRPDIKKKAVAGVDFN  137

Query  425  gynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFP  604
            GY FNG   SL+ F+E   DL + H NSNNFT +      K   L+ELD+SNNKL G FP
Sbjct  138  GYRFNGPDFSLSDFLEKLEDLAIFHANSNNFTKSIPKMTSKLKFLYELDVSNNKLFGGFP  197

Query  605  TAVLEATNLTYLDLRFNMLTGPVHPQV  685
              V+   NLT+LDLRFN  +GPV  ++
Sbjct  198  MEVVNIKNLTFLDLRFNSFSGPVPAEI  224



>ref|XP_010519298.1| PREDICTED: uncharacterized protein At4g06744-like [Tarenaya hassleriana]
Length=451

 Score =   111 bits (277),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 66/152 (43%), Positives = 98/152 (64%), Gaps = 4/152 (3%)
 Frame = +2

Query  233  LDPVIRKSIKAIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVgg  412
            + P+I K    I+ F+K + YDP+N  ++WEG ++C  K KY G  C +  G +   V  
Sbjct  78   VSPLIEKVFPVIKRFQKLVEYDPKNKLKTWEGYDVCA-KDKYVGLECAIYPGTNYLAVAS  136

Query  413  iyfngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIP-VQKFPTLFELDLSNNKL  589
            + FN +N  G  L L++F++   ++ + H NSNNF G+  +P V K   L+ELD+S+NKL
Sbjct  137  VQFNEFNLAGKQLRLDNFLDKLEEVTIFHANSNNFVGS--VPRVDKLKYLYELDISSNKL  194

Query  590  AGAFPTAVLEATNLTYLDLRFNMLTGPVHPQV  685
            +G FP++VL+A NLT+LDLRFN  +G V PQV
Sbjct  195  SGEFPSSVLQAKNLTFLDLRFNSFSGMVPPQV  226



>gb|KDO59787.1| hypothetical protein CISIN_1g011101mg [Citrus sinensis]
Length=493

 Score =   111 bits (278),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 71/147 (48%), Positives = 91/147 (62%), Gaps = 3/147 (2%)
 Frame = +2

Query  245  IRKSIKAIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfn  424
            I+ + K I+ FKK ITYDPQ +  +W G ++C    KY+GF C V     KK V G+ FN
Sbjct  126  IQLAFKVIQRFKKRITYDPQGIANTWMGPDVC---NKYKGFVCDVRPDIKKKAVAGVDFN  182

Query  425  gynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFP  604
            GY FNG   SL+ F+E   DL + H NSNNFT +      K   L+ELD+SNNKL G FP
Sbjct  183  GYRFNGPDFSLSDFLEKLEDLAIFHANSNNFTKSIPKMTSKLKFLYELDVSNNKLFGGFP  242

Query  605  TAVLEATNLTYLDLRFNMLTGPVHPQV  685
              V+   NLT+LDLRFN  +GPV  ++
Sbjct  243  MEVVNIKNLTFLDLRFNSFSGPVPAEI  269



>ref|XP_006422961.1| hypothetical protein CICLE_v10028242mg [Citrus clementina]
 gb|ESR36201.1| hypothetical protein CICLE_v10028242mg [Citrus clementina]
Length=504

 Score =   110 bits (275),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 70/147 (48%), Positives = 91/147 (62%), Gaps = 3/147 (2%)
 Frame = +2

Query  245  IRKSIKAIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfn  424
            I+ + K I+ FKK ITYDPQ + ++W G ++C    KY+GF C V     KK V G+ FN
Sbjct  137  IQLAFKVIQRFKKRITYDPQGIAKTWVGPDVC---NKYKGFVCDVRPDIKKKAVAGVDFN  193

Query  425  gynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFP  604
            GY FNG   SL+ F+E   DL + H NSNNFT +      K   L+ELD+SNNKL G FP
Sbjct  194  GYRFNGPDFSLSDFLEKLEDLAIFHANSNNFTKSIPKMTSKLKYLYELDVSNNKLFGGFP  253

Query  605  TAVLEATNLTYLDLRFNMLTGPVHPQV  685
               +   NLT+LDLRFN  +GPV  ++
Sbjct  254  LEAVNIKNLTFLDLRFNSFSGPVPAEI  280



>ref|XP_010932202.1| PREDICTED: uncharacterized protein At4g06744-like [Elaeis guineensis]
Length=465

 Score =   109 bits (272),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 64/149 (43%), Positives = 87/149 (58%), Gaps = 7/149 (5%)
 Frame = +2

Query  242  VIRKSIKAIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyf  421
            ++ ++ K I+ FK +IT DPQ +T SW+G  +C     Y GFFC +P      R      
Sbjct  88   LLYRAYKVIQKFKSTITCDPQGITNSWQGYNIC---STYNGFFCGIPPSRTTMR-NVASI  143

Query  422  ngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIP-VQKFPTLFELDLSNNKLAGA  598
            +   +N    ++N FV+   DL + H NSNNF+G   +P + K P  +ELDLSNN L G+
Sbjct  144  DFNGYNLAAPTINGFVDQMPDLAIFHANSNNFSGT--VPDLTKLPFFYELDLSNNILMGS  201

Query  599  FPTAVLEATNLTYLDLRFNMLTGPVHPQV  685
            FPT VL   NLT+LDLRFN  +G V P V
Sbjct  202  FPTTVLPLANLTFLDLRFNQFSGCVPPGV  230



>ref|XP_010107857.1| Uncharacterized protein L484_027444 [Morus notabilis]
 gb|EXC17257.1| Uncharacterized protein L484_027444 [Morus notabilis]
Length=420

 Score =   108 bits (271),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 59/140 (42%), Positives = 75/140 (54%), Gaps = 5/140 (4%)
 Frame = +2

Query  266  IRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfngn  445
            I+TFK  IT DP  +T++W G++LC    KY GF+C  P   D   V             
Sbjct  60   IQTFKNIITSDPLGITKTWVGSDLC----KYAGFYCGTPPDNDTATVIASIDFNGFGLSA  115

Query  446  glslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEAT  625
                  F++   DL + H NSNNFTG     +     LFELDLSNN L G FPTAVL  T
Sbjct  116  PTLDG-FLDQLPDLAIFHANSNNFTGTISPKIANLRYLFELDLSNNNLVGTFPTAVLSMT  174

Query  626  NLTYLDLRFNMLTGPVHPQV  685
            +L++LD+RFN   G V P +
Sbjct  175  SLSFLDIRFNSFAGVVPPHI  194



>ref|XP_004167460.1| PREDICTED: uncharacterized protein At4g06744-like [Cucumis sativus]
 gb|KGN57510.1| hypothetical protein Csa_3G200700 [Cucumis sativus]
Length=429

 Score =   108 bits (271),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 62/151 (41%), Positives = 86/151 (57%), Gaps = 5/151 (3%)
 Frame = +2

Query  233  LDPVIRKSIKAIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVgg  412
            LD  +      I+TFK  IT DP  VTQ+W G+++C    KYQGF+C  P   +K  V  
Sbjct  62   LDQRLAVVYPIIQTFKALITSDPLGVTQTWVGSDIC----KYQGFYCDHPPD-NKSAVTI  116

Query  413  iyfngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLA  592
               +   F     +L+ F++   DL + H NSNNF G     +   P L+ELDLSNN+L+
Sbjct  117  AAIDFNGFQLTASTLDGFIDGLPDLAIFHANSNNFFGTITPKIASLPYLYELDLSNNQLS  176

Query  593  GAFPTAVLEATNLTYLDLRFNMLTGPVHPQV  685
            G FP A+L  T+L++ D+RFN  TG V  Q+
Sbjct  177  GTFPVAILSVTDLSFFDIRFNFFTGFVPQQL  207



>ref|XP_004141388.1| PREDICTED: uncharacterized protein At4g06744-like [Cucumis sativus]
 ref|XP_004172481.1| PREDICTED: uncharacterized protein At4g06744-like [Cucumis sativus]
 gb|KGN55219.1| hypothetical protein Csa_4G641530 [Cucumis sativus]
Length=433

 Score =   108 bits (270),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 60/141 (43%), Positives = 85/141 (60%), Gaps = 5/141 (4%)
 Frame = +2

Query  263  AIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfng  442
             I+ FK  IT DP  +T++W G+++C     Y+GF+C  P   +K        +   F  
Sbjct  87   VIQKFKSIITSDPLGITKTWVGSDIC----NYKGFYCDNPPD-NKSATAVASIDFNGFQL  141

Query  443  nglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEA  622
            +  SL+ F++   D+ V H NSNNF+G     + K P L+ELD+SNN+L+G FPTAV+  
Sbjct  142  SAPSLDGFLDQLPDIAVFHANSNNFSGTISTNIAKLPYLYELDVSNNRLSGPFPTAVIGM  201

Query  623  TNLTYLDLRFNMLTGPVHPQV  685
             +LT+LDLRFN  TG V PQV
Sbjct  202  NSLTFLDLRFNFFTGSVPPQV  222



>ref|XP_007160878.1| hypothetical protein PHAVU_001G024400g [Phaseolus vulgaris]
 gb|ESW32872.1| hypothetical protein PHAVU_001G024400g [Phaseolus vulgaris]
Length=427

 Score =   108 bits (269),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 57/140 (41%), Positives = 84/140 (60%), Gaps = 5/140 (4%)
 Frame = +2

Query  266  IRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfngn  445
            I+ FK +IT DP  VT +W G+++C     Y+GF+C  P   +         +   F   
Sbjct  92   IQKFKSTITSDPLGVTNTWVGSDIC----SYKGFYCDTPPD-NTSATALASIDFNGFQLA  146

Query  446  glslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEAT  625
              +L+ F+++  D+ + H NSNNF G     + K P L+ELD+SNN+L+G FP+AVL  +
Sbjct  147  ASTLDGFIDNLPDIALFHANSNNFGGTISPQIAKLPYLYELDVSNNQLSGPFPSAVLGLS  206

Query  626  NLTYLDLRFNMLTGPVHPQV  685
             LT+LDLRFN  +GPV PQ+
Sbjct  207  TLTFLDLRFNFFSGPVPPQI  226



>ref|XP_008452581.1| PREDICTED: uncharacterized protein At4g06744-like [Cucumis melo]
Length=433

 Score =   107 bits (268),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 60/141 (43%), Positives = 85/141 (60%), Gaps = 5/141 (4%)
 Frame = +2

Query  263  AIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfng  442
             I+ FK  IT DP  +T++W G+++C     Y+GF+C  P   +K        +   F  
Sbjct  87   VIQKFKSIITSDPLGITKTWVGSDIC----NYKGFYCDNPPD-NKSATAVASIDFNGFQL  141

Query  443  nglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEA  622
            +  SL+ F++   D+ V H NSNNF+G     + K P L+ELD+SNN+L+G FPTAV+  
Sbjct  142  SAPSLDGFLDQLPDIAVFHANSNNFSGTISTNIAKLPYLYELDVSNNQLSGPFPTAVIGM  201

Query  623  TNLTYLDLRFNMLTGPVHPQV  685
             +LT+LDLRFN  TG V PQV
Sbjct  202  NSLTFLDLRFNFFTGSVPPQV  222



>ref|XP_003545325.1| PREDICTED: uncharacterized protein At4g06744-like [Glycine max]
Length=435

 Score =   107 bits (268),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 57/140 (41%), Positives = 86/140 (61%), Gaps = 5/140 (4%)
 Frame = +2

Query  266  IRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfngn  445
            I+ FK +IT DP  VT++W G+++C     Y+GF+C +P   +         +   F  +
Sbjct  99   IQKFKSTITSDPLGVTKTWVGSDIC----SYKGFYCDIPPD-NSSATALASIDLNGFQLS  153

Query  446  glslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEAT  625
              +L+ F+++  D+ + H NSNNF G     + K P L+ELD+SNN+L+G FPTAVL   
Sbjct  154  ASTLDGFIDNLPDIALFHANSNNFGGTISPQIAKLPYLYELDVSNNQLSGPFPTAVLGMN  213

Query  626  NLTYLDLRFNMLTGPVHPQV  685
            +LT+LDLRFN  +G V PQ+
Sbjct  214  SLTFLDLRFNSFSGEVPPQI  233



>gb|KHN22492.1| Hypothetical protein glysoja_041167 [Glycine soja]
Length=410

 Score =   107 bits (267),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 57/140 (41%), Positives = 86/140 (61%), Gaps = 5/140 (4%)
 Frame = +2

Query  266  IRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfngn  445
            I+ FK +IT DP  VT++W G+++C     Y+GF+C +P   +         +   F  +
Sbjct  74   IQKFKSTITSDPLGVTKTWVGSDIC----SYKGFYCDIPPD-NSSATALASIDLNGFQLS  128

Query  446  glslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEAT  625
              +L+ F+++  D+ + H NSNNF G     + K P L+ELD+SNN+L+G FPTAVL   
Sbjct  129  ASTLDGFIDNLPDIALFHANSNNFGGTISPQIAKLPYLYELDVSNNQLSGPFPTAVLGMN  188

Query  626  NLTYLDLRFNMLTGPVHPQV  685
            +LT+LDLRFN  +G V PQ+
Sbjct  189  SLTFLDLRFNSFSGEVPPQI  208



>ref|XP_009107284.1| PREDICTED: uncharacterized protein At4g06744 [Brassica rapa]
Length=475

 Score =   107 bits (267),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 67/150 (45%), Positives = 98/150 (65%), Gaps = 4/150 (3%)
 Frame = +2

Query  239  PVIRKSIKAIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiy  418
            P+++K    ++ F+K +T DP ++ ++WEG ++C NK KY G  C +      K +  I 
Sbjct  101  PLLKKVFPVLKAFQKLVTRDPMHILKTWEGTDIC-NKYKYLGLECAIFPNTTDKALASIQ  159

Query  419  fngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIP-VQKFPTLFELDLSNNKLAG  595
            FNG+NF G+ L L++F++  + + + H NSN+F G+  +P V     LFELDLSNNKL G
Sbjct  160  FNGFNFGGDKLVLHNFLDKLDTVTIFHANSNDFLGS--VPEVTNLKYLFELDLSNNKLTG  217

Query  596  AFPTAVLEATNLTYLDLRFNMLTGPVHPQV  685
             FP +VL+A NLT+LDLRFN  +G V PQV
Sbjct  218  DFPASVLKAKNLTFLDLRFNTFSGCVPPQV  247



>emb|CDY29337.1| BnaA05g16040D [Brassica napus]
Length=475

 Score =   107 bits (266),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 67/150 (45%), Positives = 97/150 (65%), Gaps = 6/150 (4%)
 Frame = +2

Query  239  PVIRKSIKAIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiy  418
            P+++K    ++ FKK +  DP+N+  SW G+++C    KY+G  C +  G   + V  + 
Sbjct  103  PLLKKVYPVLQAFKKLVEVDPKNILASWNGSDIC---GKYRGLECAMFPGTKYQAVASVQ  159

Query  419  fngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIP-VQKFPTLFELDLSNNKLAG  595
            FNG+NF+G  L L++F++  + + + H NSNNF G+  +P V     LFELDLSNNKL G
Sbjct  160  FNGFNFSGKNLRLDNFLDKLDTVTIFHANSNNFLGS--VPKVSNLKYLFELDLSNNKLTG  217

Query  596  AFPTAVLEATNLTYLDLRFNMLTGPVHPQV  685
             FP +VL+ATNLT+LDLRFN  +G V  QV
Sbjct  218  EFPASVLKATNLTFLDLRFNTFSGSVPRQV  247



>ref|XP_002518710.1| serine-threonine protein kinase, plant-type, putative [Ricinus 
communis]
 gb|EEF43635.1| serine-threonine protein kinase, plant-type, putative [Ricinus 
communis]
Length=418

 Score =   106 bits (264),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 61/151 (40%), Positives = 84/151 (56%), Gaps = 5/151 (3%)
 Frame = +2

Query  233  LDPVIRKSIKAIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVgg  412
            LD  +      I++FK  +T DP N+TQSW G+++C     Y+GF+C  P   +   +  
Sbjct  51   LDQRLATVYPIIQSFKAIVTSDPLNITQSWVGSDIC----NYRGFYCDNPPD-NLSAIAL  105

Query  413  iyfngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLA  592
               +   F     SL+ F++   DL + H NSNNF+G     +     L+ELDLSNN  +
Sbjct  106  AAIDFNGFQLAAPSLDGFIDQLPDLAIFHANSNNFSGTISPKIANLQYLYELDLSNNNFS  165

Query  593  GAFPTAVLEATNLTYLDLRFNMLTGPVHPQV  685
            G FPTAVL  T L +LD+RFN  TG V PQV
Sbjct  166  GNFPTAVLSITGLFFLDIRFNFFTGSVPPQV  196



>emb|CDY16514.1| BnaA08g02530D [Brassica napus]
Length=475

 Score =   106 bits (264),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 68/150 (45%), Positives = 96/150 (64%), Gaps = 4/150 (3%)
 Frame = +2

Query  239  PVIRKSIKAIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiy  418
            P++ K    ++ FKK +T DP  + ++WEG ++C NK KY G  C +      K +  I 
Sbjct  101  PLLEKVFPVLKAFKKLVTRDPMLILKTWEGTDIC-NKYKYLGLECAIFPNTTDKALASIQ  159

Query  419  fngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIP-VQKFPTLFELDLSNNKLAG  595
            FNG+NF G+ L L++F++  + + + H NSN+F G+  +P V     LFELDLSNNKL G
Sbjct  160  FNGFNFGGDKLVLHNFLDKLDTVTIFHANSNDFLGS--VPEVTNLKYLFELDLSNNKLTG  217

Query  596  AFPTAVLEATNLTYLDLRFNMLTGPVHPQV  685
             FP +VL+A NLT+LDLRFN  +G V PQV
Sbjct  218  DFPASVLKAKNLTFLDLRFNTFSGCVPPQV  247



>ref|XP_004140807.1| PREDICTED: uncharacterized protein LOC101203557 [Cucumis sativus]
Length=1406

 Score =   108 bits (270),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 60/140 (43%), Positives = 83/140 (59%), Gaps = 5/140 (4%)
 Frame = +2

Query  266  IRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfngn  445
            I+TFK  IT DP  VTQ+W G+++C    KYQGF+C  P   +K  V     +   F   
Sbjct  716  IQTFKALITSDPLGVTQTWVGSDIC----KYQGFYCDHP-PDNKSAVTIAAIDFNGFQLT  770

Query  446  glslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEAT  625
              +L+ F++   DL + H NSNNF G     +   P L+ELDLSNN+L+G FP A+L  T
Sbjct  771  ASTLDGFIDGLPDLAIFHANSNNFFGTITPKIASLPYLYELDLSNNQLSGTFPVAILSVT  830

Query  626  NLTYLDLRFNMLTGPVHPQV  685
            +L++ D+RFN  TG V  Q+
Sbjct  831  DLSFFDIRFNFFTGFVPQQL  850



>gb|KDO59786.1| hypothetical protein CISIN_1g048561mg, partial [Citrus sinensis]
Length=382

 Score =   105 bits (261),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 58/151 (38%), Positives = 87/151 (58%), Gaps = 5/151 (3%)
 Frame = +2

Query  233  LDPVIRKSIKAIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVgg  412
            LD  +      I+TFK +IT DP N+T +W G+++C    KY+GF+C  P   +   +  
Sbjct  15   LDQRLAAIYPIIQTFKNTITSDPFNITSTWIGSDIC----KYKGFYCGHPPD-NLTAIAL  69

Query  413  iyfngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLA  592
               +   F     +L+ F++   DL + H NSN F+G     + + P L+ELD+SNNK +
Sbjct  70   ASIDFNGFELAAPTLDGFIDQLPDLSLFHANSNKFSGTISPKLAQLPYLYELDISNNKFS  129

Query  593  GAFPTAVLEATNLTYLDLRFNMLTGPVHPQV  685
            G FP A+L   +L++LD+RFN  TG V PQV
Sbjct  130  GTFPVAILGKNDLSFLDIRFNFFTGSVPPQV  160



>ref|XP_007042489.1| Leucine-rich repeat family protein, putative [Theobroma cacao]
 gb|EOX98320.1| Leucine-rich repeat family protein, putative [Theobroma cacao]
Length=497

 Score =   106 bits (264),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 66/151 (44%), Positives = 87/151 (58%), Gaps = 6/151 (4%)
 Frame = +2

Query  239  PVIRKSIKAIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiy  418
            P+I K+   I+ FK  I  DP+   ++W+GN +C    KY+GF C        K V  + 
Sbjct  124  PLIAKAYPVIQNFKTQIFSDPKGYAKTWKGNNVC----KYKGFTCATRPDLKLKAVAAVD  179

Query  419  fngynfngnglsl--nsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLA  592
            FN     G+G  L  + F++  +DL + H NSNNFTG     V K   L+ELDLSNNK+ 
Sbjct  180  FNAALLAGHGSCLPLDGFIDKLDDLAIFHANSNNFTGTVPFGVSKIKYLYELDLSNNKIN  239

Query  593  GAFPTAVLEATNLTYLDLRFNMLTGPVHPQV  685
            G FP  VL A+NLT+LD+RFN L G V  QV
Sbjct  240  GDFPMEVLGASNLTFLDIRFNSLKGEVPQQV  270



>ref|XP_008236575.1| PREDICTED: uncharacterized protein At4g06744-like [Prunus mume]
Length=423

 Score =   105 bits (261),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 56/140 (40%), Positives = 82/140 (59%), Gaps = 5/140 (4%)
 Frame = +2

Query  266  IRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfngn  445
            I  FK +IT DP  +TQ+W G+++C     Y+GF+C +P   +K  V     +   F  +
Sbjct  76   INAFKNTITSDPLGITQTWVGSDIC----TYKGFYCDIPPD-NKSAVALASIDFNGFQLS  130

Query  446  glslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEAT  625
              S++ F++   DL + H NSNNF+G     +     L+ELD+SNN   G FPTAVL   
Sbjct  131  APSIDGFIDQLPDLALFHANSNNFSGIISPKIANLKYLYELDISNNNFFGTFPTAVLTMN  190

Query  626  NLTYLDLRFNMLTGPVHPQV  685
            +L++LD+RFN  TG V PQ+
Sbjct  191  SLSFLDIRFNSFTGSVPPQI  210



>emb|CDY20865.1| BnaC05g26270D [Brassica napus]
Length=516

 Score =   106 bits (264),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 67/150 (45%), Positives = 96/150 (64%), Gaps = 6/150 (4%)
 Frame = +2

Query  239  PVIRKSIKAIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiy  418
            P+++K    ++ FKK +  DP+N+  SW G+++C    KY+G  C +  G   + V  + 
Sbjct  145  PLLKKVYPVLQAFKKLVEVDPKNILASWNGSDIC---GKYRGLECAIFPGTKYQAVASVQ  201

Query  419  fngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIP-VQKFPTLFELDLSNNKLAG  595
            FNG+NF+G  L L++F++    + + H NSNNF G+  +P V     LFELDLSNNKL G
Sbjct  202  FNGFNFSGKKLRLDNFLDKLETVTIFHANSNNFLGS--VPKVSNLNYLFELDLSNNKLTG  259

Query  596  AFPTAVLEATNLTYLDLRFNMLTGPVHPQV  685
             FP +VL+ATNLT+LDLRFN  +G V  QV
Sbjct  260  EFPASVLKATNLTFLDLRFNTFSGSVPRQV  289



>ref|XP_004291077.1| PREDICTED: uncharacterized protein At4g06744-like [Fragaria vesca 
subsp. vesca]
Length=430

 Score =   105 bits (261),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 57/140 (41%), Positives = 83/140 (59%), Gaps = 5/140 (4%)
 Frame = +2

Query  266  IRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfngn  445
            I+ FK  IT DP N+T+SW G+++C     Y+GF+C  P   +   +     +   F   
Sbjct  88   IQKFKSIITSDPLNITKSWVGSDIC----NYKGFYCDNPPY-NSSAIALASIDFNGFQLG  142

Query  446  glslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEAT  625
              SL+ F++   D+ + H NSNNF+G     +   P L+ELD+SNN  +G+FPTAVL   
Sbjct  143  ASSLDGFLDQLPDIALFHANSNNFSGTISSKIANLPYLYELDISNNLFSGSFPTAVLGMN  202

Query  626  NLTYLDLRFNMLTGPVHPQV  685
            +L++LDLRFN  TG V PQ+
Sbjct  203  SLSFLDLRFNFFTGSVPPQI  222



>ref|XP_009592678.1| PREDICTED: uncharacterized protein At4g06744-like [Nicotiana 
tomentosiformis]
Length=425

 Score =   105 bits (261),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 58/151 (38%), Positives = 84/151 (56%), Gaps = 5/151 (3%)
 Frame = +2

Query  233  LDPVIRKSIKAIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVgg  412
            LD  +      I+ FK +IT DP  VTQSW G ++C     Y+GF+C  P   +   +  
Sbjct  60   LDQRLALIFPIIQNFKSTITLDPLGVTQSWTGPDIC----NYKGFYCDNPPY-NTSAISL  114

Query  413  iyfngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLA  592
               +   F     +L+ F++   DL V H NSNNF+G     + + P L+ELDLSNNK  
Sbjct  115  ASIDFNGFQLTAPTLDGFIDQLPDLAVFHANSNNFSGIISSKITQLPYLYELDLSNNKFI  174

Query  593  GAFPTAVLEATNLTYLDLRFNMLTGPVHPQV  685
            G FP ++L    LT+LD+R+N+ TG + PQ+
Sbjct  175  GTFPLSILNIKTLTFLDIRYNLFTGIIPPQI  205



>ref|XP_006297641.1| hypothetical protein CARUB_v10013659mg [Capsella rubella]
 gb|EOA30539.1| hypothetical protein CARUB_v10013659mg [Capsella rubella]
Length=458

 Score =   105 bits (261),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 66/150 (44%), Positives = 94/150 (63%), Gaps = 4/150 (3%)
 Frame = +2

Query  239  PVIRKSIKAIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiy  418
            P+I+K    I+ F+  I  DP+ + ++W G ++C  K KY G  C    G +   +  I 
Sbjct  87   PLIKKVYPVIKNFQMLIEDDPKKILKTWVGTDICA-KDKYIGLECAKFPGTNHLALASIQ  145

Query  419  fngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIP-VQKFPTLFELDLSNNKLAG  595
            FN +N  G  L L++F+   +++ + H NSNNF G+  +P V     LFELDLSNNKL+G
Sbjct  146  FNNFNLGGKKLRLDNFLNKLDEVTIFHANSNNFVGS--VPKVSNLKYLFELDLSNNKLSG  203

Query  596  AFPTAVLEATNLTYLDLRFNMLTGPVHPQV  685
             FP++VL+ATNLT+LDLRFN  +G V PQV
Sbjct  204  EFPSSVLKATNLTFLDLRFNSFSGSVPPQV  233



>ref|XP_006487027.1| PREDICTED: uncharacterized protein At4g06744-like [Citrus sinensis]
Length=418

 Score =   104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 58/151 (38%), Positives = 87/151 (58%), Gaps = 5/151 (3%)
 Frame = +2

Query  233  LDPVIRKSIKAIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVgg  412
            LD  +      I+TFK +IT DP N+T +W G+++C    KY+GF+C  P   +   +  
Sbjct  51   LDQRLAAIYPIIQTFKNTITSDPFNITSTWIGSDIC----KYKGFYCGHPPD-NLTAIAL  105

Query  413  iyfngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLA  592
               +   F     +L+ F++   DL + H NSN F+G     + + P L+ELD+SNNK +
Sbjct  106  ASIDFNGFELAAPTLDGFIDQLPDLSLFHANSNKFSGTISPKLAQLPYLYELDISNNKFS  165

Query  593  GAFPTAVLEATNLTYLDLRFNMLTGPVHPQV  685
            G FP A+L   +L++LD+RFN  TG V PQV
Sbjct  166  GTFPVAILGKNDLSFLDIRFNFFTGSVPPQV  196



>ref|XP_010466072.1| PREDICTED: uncharacterized protein At4g06744-like [Camelina sativa]
Length=469

 Score =   105 bits (262),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 67/150 (45%), Positives = 97/150 (65%), Gaps = 4/150 (3%)
 Frame = +2

Query  239  PVIRKSIKAIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiy  418
            P+I+K    I+ F+K I  DP+ + ++W G ++C  + KY G  C    G +   +G I 
Sbjct  98   PLIKKVFPVIKNFQKLIEDDPKKILKTWVGTDICA-QDKYIGLECAKFPGTNDDALGSIQ  156

Query  419  fngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIP-VQKFPTLFELDLSNNKLAG  595
            FN +NF G  L L++F++   ++ + H NSNNF G+  +P +     LFELDLSNNKL+G
Sbjct  157  FNNFNFRGKKLRLDNFLDKLEEVTIFHANSNNFLGS--VPKLNNLKYLFELDLSNNKLSG  214

Query  596  AFPTAVLEATNLTYLDLRFNMLTGPVHPQV  685
             FP++VL+ATNLT+LDLRFN  +G V PQV
Sbjct  215  EFPSSVLKATNLTFLDLRFNSFSGSVPPQV  244



>ref|XP_006472980.1| PREDICTED: uncharacterized protein At4g06744-like [Citrus sinensis]
Length=429

 Score =   104 bits (260),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 56/141 (40%), Positives = 82/141 (58%), Gaps = 5/141 (4%)
 Frame = +2

Query  263  AIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfng  442
             I+ FK  IT DP  +T++W G+++C     Y+GF+C  P   +K  +     +   F  
Sbjct  91   VIQEFKSIITSDPLGITKTWVGSDIC----DYKGFYCESPPD-NKTAIAVASIDFNGFQL  145

Query  443  nglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEA  622
            +  +L+ F++   D+ + H NSNNF G     + K P L+ELD+SNNK +G FP AVL  
Sbjct  146  SAPTLDGFLDQLPDIALFHANSNNFAGTISSNIAKLPYLYELDISNNKFSGPFPAAVLGM  205

Query  623  TNLTYLDLRFNMLTGPVHPQV  685
             NL +LD+RFN  TG V PQ+
Sbjct  206  NNLEFLDIRFNYFTGSVPPQI  226



>gb|KFK39280.1| hypothetical protein AALP_AA3G224000 [Arabis alpina]
Length=480

 Score =   105 bits (261),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 65/150 (43%), Positives = 94/150 (63%), Gaps = 4/150 (3%)
 Frame = +2

Query  239  PVIRKSIKAIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiy  418
            P+I+K    I+ F+K I  DP+ + ++W G ++C  + KY G  C    G +   +  I 
Sbjct  109  PLIKKVYPVIKNFQKLIEDDPKKILKTWVGTDICA-EDKYIGLECAKFPGTNNLALASIQ  167

Query  419  fngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIP-VQKFPTLFELDLSNNKLAG  595
            FN +N  G  + L++F++   ++ + H NSNNF G+  +P V     LFELDLSNNKL+G
Sbjct  168  FNQFNLGGKKIRLDNFLDKLEEVTIFHANSNNFVGS--VPKVSNLKYLFELDLSNNKLSG  225

Query  596  AFPTAVLEATNLTYLDLRFNMLTGPVHPQV  685
             FP +VL+ATNLT+LDLRFN  +G V PQV
Sbjct  226  EFPRSVLKATNLTFLDLRFNSFSGSVPPQV  255



>ref|XP_004499033.1| PREDICTED: uncharacterized protein At4g06744-like [Cicer arietinum]
Length=382

 Score =   104 bits (259),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 59/150 (39%), Positives = 86/150 (57%), Gaps = 5/150 (3%)
 Frame = +2

Query  236  DPVIRKSIKAIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggi  415
            D  + K    I+ FK  IT DP  VT+SW G+ +C     Y+GF+C  P   +   +   
Sbjct  29   DQRLAKVYPVIQKFKSLITSDPLGVTKSWVGSNIC----NYKGFYCDNPPDNNSA-IALA  83

Query  416  yfngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAG  595
              +   F  +  +L+ F++   D+ + H NSNNF G+    ++  P L+ELDLSNNKL+G
Sbjct  84   SIDFNGFQLSASTLDGFIDKLPDIALFHANSNNFVGSITPLIRNLPYLYELDLSNNKLSG  143

Query  596  AFPTAVLEATNLTYLDLRFNMLTGPVHPQV  685
             FP +VL   +LT+LDLRFN  +G V PQ+
Sbjct  144  PFPNSVLGMNSLTFLDLRFNFFSGGVPPQI  173



>ref|XP_008220262.1| PREDICTED: uncharacterized protein At4g06744-like [Prunus mume]
Length=464

 Score =   104 bits (260),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 55/140 (39%), Positives = 83/140 (59%), Gaps = 5/140 (4%)
 Frame = +2

Query  266  IRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfngn  445
            I+ FK +IT DP  +T++W G+ +C     Y+GF+C  P   +   +     +   F   
Sbjct  120  IQKFKSTITSDPLGITKTWVGSNIC----SYRGFYCDNPPN-NSSAIALASIDFNGFQLG  174

Query  446  glslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEAT  625
              SL+ F++   D+ + H NSNNF+G     + K P L+ELDLSNN+ +G FP+ VL  +
Sbjct  175  ASSLDGFLDQLPDIALFHANSNNFSGTISANIAKLPYLYELDLSNNQFSGPFPSVVLGMS  234

Query  626  NLTYLDLRFNMLTGPVHPQV  685
            +LT+LD+RFN  TG V PQ+
Sbjct  235  SLTFLDIRFNFFTGSVPPQI  254



>ref|XP_009784047.1| PREDICTED: uncharacterized protein At4g06744-like [Nicotiana 
sylvestris]
Length=426

 Score =   104 bits (259),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 58/151 (38%), Positives = 83/151 (55%), Gaps = 5/151 (3%)
 Frame = +2

Query  233  LDPVIRKSIKAIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVgg  412
            LD  +      I+ FK +IT DP  VTQSW G  +C     Y+GF+C  P   +   +  
Sbjct  61   LDQRLALIFPIIQNFKNTITLDPLGVTQSWTGPNIC----NYKGFYCDNPPY-NTSAISL  115

Query  413  iyfngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLA  592
               +   F     +L+ F++   DL + H NSNNF+G     + + P L+ELDLSNNK  
Sbjct  116  ASIDFNGFQLTAPTLDGFIDQLPDLAIFHANSNNFSGIISSKITQLPYLYELDLSNNKFI  175

Query  593  GAFPTAVLEATNLTYLDLRFNMLTGPVHPQV  685
            G FP +VL    LT+LD+R+N+ TG + PQ+
Sbjct  176  GTFPLSVLNIKTLTFLDIRYNLFTGIIPPQI  206



>ref|XP_008798694.1| PREDICTED: uncharacterized protein At4g06744-like [Phoenix dactylifera]
Length=469

 Score =   104 bits (260),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 60/147 (41%), Positives = 84/147 (57%), Gaps = 6/147 (4%)
 Frame = +2

Query  248  RKSIKAIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfng  427
            R++   I+ FKK+IT DP+ VT++W G ++C    KY+GFFC  P    KK       + 
Sbjct  87   RRAYYVIQRFKKTITSDPRGVTRTWRGAKVC----KYKGFFCETP-PNRKKMPTIASVDF  141

Query  428  ynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPV-QKFPTLFELDLSNNKLAGAFP  604
              F     S+  FV+   DL + H NSNN +    IP+  K    +ELD+SNN + G+FP
Sbjct  142  NTFRLAAPSVKKFVDQLPDLALFHANSNNLSARDTIPLLSKLRFFYELDVSNNNIPGSFP  201

Query  605  TAVLEATNLTYLDLRFNMLTGPVHPQV  685
              VL   N+T+LDLRFN  +GP+ P V
Sbjct  202  INVLPLQNVTFLDLRFNKFSGPLPPAV  228



>ref|XP_003550327.1| PREDICTED: uncharacterized protein At4g06744-like [Glycine max]
Length=443

 Score =   104 bits (259),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 55/141 (39%), Positives = 84/141 (60%), Gaps = 5/141 (4%)
 Frame = +2

Query  263  AIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfng  442
             ++ FK +IT DP  VT++W G+++C     Y+GF+C  P   +         +   F  
Sbjct  106  TVQKFKSTITSDPLGVTKTWVGSDIC----SYKGFYCDTPPD-NSSATALASIDLNGFQL  160

Query  443  nglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEA  622
            +  +L+ F+++  D+ + H NSNNF G     + K   L+ELD+SNN+L+G FPTAVL  
Sbjct  161  SASTLDGFIDNLPDIALFHANSNNFGGTISPQIAKLSYLYELDVSNNQLSGPFPTAVLGM  220

Query  623  TNLTYLDLRFNMLTGPVHPQV  685
            + LT+LDLRFN  +G V PQ+
Sbjct  221  STLTFLDLRFNFFSGAVPPQI  241



>ref|XP_010094650.1| Uncharacterized protein L484_008882 [Morus notabilis]
 gb|EXB56501.1| Uncharacterized protein L484_008882 [Morus notabilis]
Length=415

 Score =   103 bits (258),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 56/141 (40%), Positives = 85/141 (60%), Gaps = 5/141 (4%)
 Frame = +2

Query  263  AIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfng  442
             I+ FK  IT DP N+T+SW G+++C     Y GF+C  P   +   +     +   F  
Sbjct  63   VIQKFKSIITSDPLNITKSWVGSDIC----NYTGFYCESP-PDNASAMAVASVDFNGFQL  117

Query  443  nglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEA  622
            +  +L+ F++   D+ + H NSNNF+G     + K   L+ELD+SNNKL+G+FP AVL  
Sbjct  118  SAPTLDGFLDQLPDIALFHANSNNFSGTLSPNIAKLKYLYELDVSNNKLSGSFPNAVLGM  177

Query  623  TNLTYLDLRFNMLTGPVHPQV  685
             +L++LD+RFN+ TG V PQ+
Sbjct  178  ESLSFLDIRFNLFTGSVPPQI  198



>ref|XP_010438766.1| PREDICTED: uncharacterized protein At4g06744 [Camelina sativa]
Length=407

 Score =   103 bits (258),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 60/151 (40%), Positives = 84/151 (56%), Gaps = 5/151 (3%)
 Frame = +2

Query  233  LDPVIRKSIKAIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVgg  412
            LD  +      I+ FK  IT DP  VTQ+W G+++C     Y+GF C  P   +K  V  
Sbjct  44   LDQRLAVVYPVIQRFKSLITLDPYKVTQTWTGSDIC----SYRGFHCDNPPD-NKTAVTV  98

Query  413  iyfngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLA  592
               +   F  +  S+  F++ F DL + HVNSNNF G     +     L+ELD+SNN+  
Sbjct  99   ASIDFNGFQLSAPSIEGFIDQFPDLALFHVNSNNFGGTVPSKIVNLKYLYELDISNNRFT  158

Query  593  GAFPTAVLEATNLTYLDLRFNMLTGPVHPQV  685
            G FPTAV+  + LT+LD+RFN  +G V PQ+
Sbjct  159  GQFPTAVVGMSGLTFLDIRFNSFSGSVPPQI  189



>ref|XP_010455221.1| PREDICTED: uncharacterized protein At4g06744-like [Camelina sativa]
Length=407

 Score =   103 bits (257),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 60/151 (40%), Positives = 84/151 (56%), Gaps = 5/151 (3%)
 Frame = +2

Query  233  LDPVIRKSIKAIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVgg  412
            LD  +      I+ FK  IT DP  VTQ+W G+++C     Y+GF C  P   +K  V  
Sbjct  44   LDQRLAVVYPVIQRFKSLITLDPYKVTQTWTGSDIC----SYRGFHCDNPPD-NKTAVTV  98

Query  413  iyfngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLA  592
               +   F  +  S+  F++ F DL + HVNSNNF G     +     L+ELD+SNN+  
Sbjct  99   ASIDFNGFQLSAPSIEGFIDQFPDLALFHVNSNNFGGTVPSQIVNLKYLYELDISNNRFT  158

Query  593  GAFPTAVLEATNLTYLDLRFNMLTGPVHPQV  685
            G FPTAV+  + LT+LD+RFN  +G V PQ+
Sbjct  159  GQFPTAVVGMSGLTFLDIRFNSFSGSVPPQI  189



>ref|XP_007227115.1| hypothetical protein PRUPE_ppa025707mg, partial [Prunus persica]
 gb|EMJ28314.1| hypothetical protein PRUPE_ppa025707mg, partial [Prunus persica]
Length=482

 Score =   104 bits (259),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 57/151 (38%), Positives = 86/151 (57%), Gaps = 5/151 (3%)
 Frame = +2

Query  233  LDPVIRKSIKAIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVgg  412
            LD  +      I+ FK +IT DP  +T++W G+ +C     Y+GF+C  P   +   +  
Sbjct  74   LDQKLEIVYPIIQKFKSTITSDPLGITKTWVGSNIC----SYRGFYCDNPPN-NGSAIAL  128

Query  413  iyfngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLA  592
               +   F     SL+ F++   D+ + H NSNNF+G     + K P L+ELDLSNN+ +
Sbjct  129  ASIDFNGFQLGASSLDGFLDQLPDIALFHANSNNFSGTISANIAKLPYLYELDLSNNQFS  188

Query  593  GAFPTAVLEATNLTYLDLRFNMLTGPVHPQV  685
            G FP+ VL  ++LT+LD+RFN  TG V PQ+
Sbjct  189  GPFPSVVLGMSSLTFLDIRFNFFTGSVPPQI  219



>gb|KDO37099.1| hypothetical protein CISIN_1g037101mg, partial [Citrus sinensis]
Length=395

 Score =   103 bits (256),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 55/140 (39%), Positives = 82/140 (59%), Gaps = 5/140 (4%)
 Frame = +2

Query  266  IRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfngn  445
            I+ FK  IT DP  +T++W G+++C     Y+GF+C  P   ++  +     +   F  +
Sbjct  71   IQEFKSIITSDPLGITKTWVGSDIC----NYKGFYCESPPD-NETAIAVASIDFNGFQLS  125

Query  446  glslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEAT  625
              +L+ F++   D+ + H NSNNF G     + K P L+ELD+SNNK +G FP AVL   
Sbjct  126  APTLDGFLDQLPDIALFHANSNNFAGTISSNIAKLPYLYELDISNNKFSGPFPAAVLGMN  185

Query  626  NLTYLDLRFNMLTGPVHPQV  685
            NL +LD+RFN  TG V PQ+
Sbjct  186  NLEFLDIRFNYFTGSVPPQI  205



>ref|XP_010507626.1| PREDICTED: uncharacterized protein At4g06744-like [Camelina sativa]
Length=458

 Score =   103 bits (258),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 67/149 (45%), Positives = 96/149 (64%), Gaps = 4/149 (3%)
 Frame = +2

Query  242  VIRKSIKAIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyf  421
            +I+K    I+ F+K I  DP+ + ++W G ++C  + KY G  C    G +   +G I F
Sbjct  88   LIKKVFPVIKNFQKLIEDDPKKILKTWVGTDICA-QDKYIGLECAKFPGTNDDALGSIQF  146

Query  422  ngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIP-VQKFPTLFELDLSNNKLAGA  598
            N +NF G  L L++F++   ++ + H NSNNF G+  +P V     LFELDLSNNKL+G 
Sbjct  147  NNFNFRGKKLRLDNFLDKLEEVTIFHANSNNFLGS--VPKVSNLKYLFELDLSNNKLSGE  204

Query  599  FPTAVLEATNLTYLDLRFNMLTGPVHPQV  685
            FP++VL+ATNLT+LDLRFN  +G V PQV
Sbjct  205  FPSSVLKATNLTFLDLRFNSFSGSVPPQV  233



>ref|XP_006433575.1| hypothetical protein CICLE_v10003526mg [Citrus clementina]
 gb|ESR46815.1| hypothetical protein CICLE_v10003526mg [Citrus clementina]
Length=429

 Score =   103 bits (256),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 55/140 (39%), Positives = 82/140 (59%), Gaps = 5/140 (4%)
 Frame = +2

Query  266  IRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfngn  445
            I+ FK  IT DP  +T++W G+++C     Y+GF+C  P   ++  +     +   F  +
Sbjct  92   IQEFKSIITSDPLGITKTWVGSDIC----NYKGFYCESPPD-NETAIAVASIDFNGFQLS  146

Query  446  glslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEAT  625
              +L+ F++   D+ + H NSNNF G     + K P L+ELD+SNNK +G FP AVL   
Sbjct  147  APTLDGFLDQLPDIALFHANSNNFAGTISSNIAKLPYLYELDISNNKFSGPFPAAVLGMN  206

Query  626  NLTYLDLRFNMLTGPVHPQV  685
            NL +LD+RFN  TG V PQ+
Sbjct  207  NLEFLDIRFNYFTGSVPPQI  226



>ref|NP_188563.1| leucine-rich repeat-containing protein [Arabidopsis thaliana]
 dbj|BAB02456.1| unnamed protein product [Arabidopsis thaliana]
 gb|AEE76223.1| leucine-rich repeat-containing protein [Arabidopsis thaliana]
Length=493

 Score =   103 bits (258),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 65/150 (43%), Positives = 94/150 (63%), Gaps = 4/150 (3%)
 Frame = +2

Query  239  PVIRKSIKAIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiy  418
            P+I+K    I+ F+  I  DP+++ ++W G ++C  + KY G  C    G +   +  I 
Sbjct  122  PLIKKVYPVIKNFQTLIEDDPKSILKTWVGTDICA-QDKYIGLECAKLPGTNDLALASIQ  180

Query  419  fngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIP-VQKFPTLFELDLSNNKLAG  595
            FN +N  G  L L++F+    ++ + H NSNNF G+  +P   K   LFELDLSNNKL+G
Sbjct  181  FNNFNLGGKKLRLDNFLNKLEEVTIFHANSNNFVGS--VPNFSKLKYLFELDLSNNKLSG  238

Query  596  AFPTAVLEATNLTYLDLRFNMLTGPVHPQV  685
             FP++VL+ATNLT+LDLRFN  +G V PQV
Sbjct  239  EFPSSVLKATNLTFLDLRFNSFSGSVPPQV  268



>ref|XP_011074595.1| PREDICTED: uncharacterized protein At4g06744-like [Sesamum indicum]
Length=411

 Score =   103 bits (256),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 55/140 (39%), Positives = 82/140 (59%), Gaps = 5/140 (4%)
 Frame = +2

Query  266  IRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfngn  445
            I+ FK  IT DP N+T SW G ++C    KY+GF+C  P   +K  +     +   F  +
Sbjct  69   IQRFKNLITSDPLNITSSWIGTDIC----KYKGFYCESPPD-NKSAIALASIDFNGFQLS  123

Query  446  glslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEAT  625
              +L  F++   DL + H NSNNF G     + K P L+ELD+SNN+ +G FPTA+L   
Sbjct  124  SPTLVGFLDLLPDLALFHANSNNFAGTIPGNIVKLPYLYELDISNNRFSGPFPTAILAME  183

Query  626  NLTYLDLRFNMLTGPVHPQV  685
             L++LD+R+N  +G V P++
Sbjct  184  GLSFLDIRYNFFSGSVPPEL  203



>ref|XP_006289202.1| hypothetical protein CARUB_v10002650mg [Capsella rubella]
 gb|EOA22100.1| hypothetical protein CARUB_v10002650mg [Capsella rubella]
Length=407

 Score =   102 bits (255),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 59/151 (39%), Positives = 84/151 (56%), Gaps = 5/151 (3%)
 Frame = +2

Query  233  LDPVIRKSIKAIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVgg  412
            LD  +      I+ FK  IT DP NVT++W G+++C     Y+GF C  P   +   V  
Sbjct  44   LDQRLAVVYPVIQRFKSLITLDPYNVTKTWTGSDIC----SYRGFHCDNPPD-NNTAVTV  98

Query  413  iyfngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLA  592
               +   F  +  S+  F++ F DL + HVNSNNF G     +     L+ELD+SNN+  
Sbjct  99   ASIDFNGFQLSAPSIEGFIDQFPDLALFHVNSNNFGGTVPSKIVNLKYLYELDISNNRFT  158

Query  593  GAFPTAVLEATNLTYLDLRFNMLTGPVHPQV  685
            G FPTAV+  + LT+LD+RFN  +G V PQ+
Sbjct  159  GQFPTAVVGMSGLTFLDIRFNFFSGSVPPQI  189



>emb|CDX99236.1| BnaC05g33510D [Brassica napus]
Length=458

 Score =   103 bits (257),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 65/150 (43%), Positives = 92/150 (61%), Gaps = 4/150 (3%)
 Frame = +2

Query  239  PVIRKSIKAIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiy  418
            P+I K    I+ F+  +  DP+ + ++W G ++C  + KY G  C    G +   +  I 
Sbjct  87   PLIEKVYPVIKKFQNLVENDPKKILKTWVGTDICA-EDKYIGLECAKFPGTNDLALASIQ  145

Query  419  fngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIP-VQKFPTLFELDLSNNKLAG  595
            FN +N  G  L L++F+    ++ + H NSNNF GA  +P V     LFELDLSNNKL+G
Sbjct  146  FNQFNLGGKKLRLDNFLNKLEEVTIFHANSNNFVGA--VPEVSNLKYLFELDLSNNKLSG  203

Query  596  AFPTAVLEATNLTYLDLRFNMLTGPVHPQV  685
             FP++VL+ATNLT+LDLRFN  +G V PQV
Sbjct  204  EFPSSVLKATNLTFLDLRFNSFSGSVPPQV  233



>emb|CDP01296.1| unnamed protein product [Coffea canephora]
Length=418

 Score =   102 bits (255),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 59/157 (38%), Positives = 88/157 (56%), Gaps = 11/157 (7%)
 Frame = +2

Query  233  LDPVIRKSIK------AIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGD  394
            L+P+I   ++       I  FKK I  DP  +T+SW G ++C     Y GF+C  P   +
Sbjct  56   LEPLIFADLRLAVVYPIILKFKKIINSDPLGITKSWVGADIC----NYTGFYCTSPPD-N  110

Query  395  KKRVggiyfngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDL  574
               +     +   F  +  +L+ F++   DL + H NSNNF+G     + K P L+ELD+
Sbjct  111  CSAIALASIDFNGFRLSAPTLDGFLDQLPDLALFHANSNNFSGTVSADISKLPYLYELDI  170

Query  575  SNNKLAGAFPTAVLEATNLTYLDLRFNMLTGPVHPQV  685
            SNN+ +G FPTAVL   +L++LD+RFN  TG V PQ+
Sbjct  171  SNNQFSGPFPTAVLGMNSLSFLDIRFNFFTGSVPPQL  207



>ref|XP_009145802.1| PREDICTED: uncharacterized protein At4g06744 [Brassica rapa]
Length=459

 Score =   103 bits (256),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 66/150 (44%), Positives = 93/150 (62%), Gaps = 4/150 (3%)
 Frame = +2

Query  239  PVIRKSIKAIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiy  418
            P+I K    I+ F+  +  DP+ + ++W G ++C  + KY G  C    G +   +  I 
Sbjct  88   PLIEKVYPVIKKFQNLVENDPKKILKTWVGTDICA-EDKYIGLECAKFPGTNDLALASIQ  146

Query  419  fngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIP-VQKFPTLFELDLSNNKLAG  595
            FN +NF G  L L++F+    ++ + H NSNNF GA  +P V     LFELDLSNNKL+G
Sbjct  147  FNQFNFGGKKLRLDNFLNKLEEVTIFHANSNNFVGA--VPEVSNLKYLFELDLSNNKLSG  204

Query  596  AFPTAVLEATNLTYLDLRFNMLTGPVHPQV  685
             FP++VL+ATNLT+LDLRFN  +G V PQV
Sbjct  205  EFPSSVLKATNLTFLDLRFNSFSGSVPPQV  234



>emb|CDX92324.1| BnaA05g20830D [Brassica napus]
Length=459

 Score =   103 bits (256),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 66/150 (44%), Positives = 93/150 (62%), Gaps = 4/150 (3%)
 Frame = +2

Query  239  PVIRKSIKAIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiy  418
            P+I K    I+ F+  +  DP+ + ++W G ++C  + KY G  C    G +   +  I 
Sbjct  88   PLIEKVYPVIKKFQNLVENDPKKILKTWVGTDICA-EDKYIGLECAKFPGTNDLALASIQ  146

Query  419  fngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIP-VQKFPTLFELDLSNNKLAG  595
            FN +NF G  L L++F+    ++ + H NSNNF GA  +P V     LFELDLSNNKL+G
Sbjct  147  FNQFNFGGKKLRLDNFLNKLEEVTIFHANSNNFVGA--VPEVSNLKYLFELDLSNNKLSG  204

Query  596  AFPTAVLEATNLTYLDLRFNMLTGPVHPQV  685
             FP++VL+ATNLT+LDLRFN  +G V PQV
Sbjct  205  EFPSSVLKATNLTFLDLRFNSFSGSVPPQV  234



>emb|CDY32853.1| BnaC08g02750D [Brassica napus]
Length=481

 Score =   103 bits (256),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 67/150 (45%), Positives = 94/150 (63%), Gaps = 6/150 (4%)
 Frame = +2

Query  239  PVIRKSIKAIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiy  418
            P++ K    ++ FKK +T+DP ++ ++W G ++C    KY G  C +      K +  I 
Sbjct  109  PLLEKVFPVLQAFKKLVTHDPMHILKTWNGPDIC---NKYLGLECAIFPNTTDKALASIQ  165

Query  419  fngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIP-VQKFPTLFELDLSNNKLAG  595
            FNGYNF G  L L++F++  N + + H NSNNF G+  +P V     LFELDLS+NKL G
Sbjct  166  FNGYNFGGKKLVLHNFLDKLNTVTIFHANSNNFLGS--VPEVTNLKYLFELDLSHNKLTG  223

Query  596  AFPTAVLEATNLTYLDLRFNMLTGPVHPQV  685
             FP +VL+A NLT+LDLRFN  +G V PQV
Sbjct  224  DFPASVLKAKNLTFLDLRFNTFSGCVPPQV  253



>ref|XP_008236564.1| PREDICTED: uncharacterized protein At4g06744-like [Prunus mume]
Length=416

 Score =   102 bits (254),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 68/149 (46%), Positives = 84/149 (56%), Gaps = 6/149 (4%)
 Frame = +2

Query  245  IRKSIKAIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfn  424
            +R +   I+ FK+ I  DP+N T +W GN +C    KY+GF C V     K  V G+ FN
Sbjct  37   LRNAFNVIQAFKRRIQSDPKNYTGTWVGNNVC----KYKGFTCAVVPDLKKLTVIGVSFN  92

Query  425  gynfngnglsl--nsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGA  598
            G  F G    L  N F++   DLV  H NSNNFTG       +    +ELDLSNNKL+G 
Sbjct  93   GALFGGFNNRLPLNGFIDKLEDLVFFHANSNNFTGTVPRGTARHRFFYELDLSNNKLSGG  152

Query  599  FPTAVLEATNLTYLDLRFNMLTGPVHPQV  685
            FP   L ATNLT+LDLRFN     V P+V
Sbjct  153  FPNETLGATNLTFLDLRFNSFRATVPPKV  181



>ref|XP_007201495.1| hypothetical protein PRUPE_ppa014775mg [Prunus persica]
 gb|EMJ02694.1| hypothetical protein PRUPE_ppa014775mg [Prunus persica]
Length=427

 Score =   102 bits (254),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 68/149 (46%), Positives = 83/149 (56%), Gaps = 6/149 (4%)
 Frame = +2

Query  245  IRKSIKAIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfn  424
            +R +   I+ FK+ I  DP+N T +W GN +C    KY+GF C V     K  V G+ FN
Sbjct  48   LRNAFNVIQAFKRRIQSDPKNYTGTWVGNNVC----KYKGFTCAVVPDLKKLTVIGVSFN  103

Query  425  gynfngnglsl--nsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGA  598
            G  F G    L  N F++   DLV  H NSNNFTG       +    +ELDLSNNKL G 
Sbjct  104  GALFGGFNNRLPLNGFIDRLEDLVFFHANSNNFTGTVPRGTARHRFFYELDLSNNKLTGG  163

Query  599  FPTAVLEATNLTYLDLRFNMLTGPVHPQV  685
            FP   L ATNLT+LDLRFN     V P+V
Sbjct  164  FPNETLAATNLTFLDLRFNSFNATVPPKV  192



>ref|NP_849339.1| Leucine-rich repeat-containing protein [Arabidopsis thaliana]
 sp|Q8W3M4.1|Y4744_ARATH RecName: Full=Uncharacterized protein At4g06744; Flags: Precursor 
[Arabidopsis thaliana]
 dbj|BAB83614.1| extensin-like protein [Arabidopsis thaliana]
 gb|AEE82560.1| Leucine-rich repeat-containing protein [Arabidopsis thaliana]
Length=404

 Score =   102 bits (254),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 58/151 (38%), Positives = 85/151 (56%), Gaps = 5/151 (3%)
 Frame = +2

Query  233  LDPVIRKSIKAIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVgg  412
            LD  +      I+ FK  IT DP NVT++W G+++C     Y+GF C  P   +K  V  
Sbjct  41   LDQRLAVVYPVIQRFKSLITLDPYNVTKTWIGSDIC----SYRGFHCDNPPH-NKTAVTV  95

Query  413  iyfngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLA  592
               +   F  +  S+  F++ F DL + HVNSNNF G     +     L+ELD+SNN+  
Sbjct  96   ASIDFNGFQLSAPSIEGFIDQFADLALFHVNSNNFGGTVPSKIVNLRYLYELDISNNRFT  155

Query  593  GAFPTAVLEATNLTYLDLRFNMLTGPVHPQV  685
            G FPTAV+  + LT++D+RFN  +G + PQ+
Sbjct  156  GQFPTAVVGMSGLTFIDIRFNSFSGSIPPQI  186



>ref|XP_006406513.1| hypothetical protein EUTSA_v10020680mg [Eutrema salsugineum]
 gb|ESQ47966.1| hypothetical protein EUTSA_v10020680mg [Eutrema salsugineum]
Length=464

 Score =   102 bits (255),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 66/150 (44%), Positives = 92/150 (61%), Gaps = 4/150 (3%)
 Frame = +2

Query  239  PVIRKSIKAIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiy  418
            P+I K    I+ F+  I  DP+ + +SW G ++C + K Y G  C    G +   +  I 
Sbjct  93   PLIEKVYPVIKNFQNLIEDDPKKILKSWVGTDICADDK-YIGLECAKFPGTNNLALASIQ  151

Query  419  fngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIP-VQKFPTLFELDLSNNKLAG  595
            FN +N  G  L L++F+    ++ + H NSNNF G+  +P V     LFELDLSNNKL+G
Sbjct  152  FNQFNLGGKKLRLDNFLYKLEEVTIFHANSNNFVGS--VPKVSHLKYLFELDLSNNKLSG  209

Query  596  AFPTAVLEATNLTYLDLRFNMLTGPVHPQV  685
             FP++VL+ATNLT+LDLRFN  +G V PQV
Sbjct  210  EFPSSVLKATNLTFLDLRFNSFSGSVPPQV  239



>ref|XP_010688602.1| PREDICTED: uncharacterized protein At4g06744 [Beta vulgaris subsp. 
vulgaris]
Length=461

 Score =   102 bits (255),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 53/140 (38%), Positives = 82/140 (59%), Gaps = 5/140 (4%)
 Frame = +2

Query  266  IRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfngn  445
            I+ FK  IT DP  +T++W G+++C     Y+GFFC VP   +   +     +   +  +
Sbjct  131  IQNFKNIITSDPLGITKTWVGSDIC----SYKGFFCDVPPN-NASAIAVASIDFNGYGLS  185

Query  446  glslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEAT  625
              +L+ F++   DL + H NSNNFTG     + K P L+ELD+SNNK  G FP AV+   
Sbjct  186  APTLDGFIDQLPDLALFHANSNNFTGTLSSNIAKLPYLYELDISNNKFTGPFPLAVVGMD  245

Query  626  NLTYLDLRFNMLTGPVHPQV  685
            +L +LD+RFN+ +G + P +
Sbjct  246  SLIFLDIRFNLFSGSIPPAI  265



>ref|XP_009145107.1| PREDICTED: uncharacterized protein At4g06744-like [Brassica rapa]
Length=555

 Score =   103 bits (257),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 66/150 (44%), Positives = 95/150 (63%), Gaps = 6/150 (4%)
 Frame = +2

Query  239  PVIRKSIKAIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiy  418
            P+++K    ++ FKK +  D +N+  SW G+++C    KY+G  C    G   + V  + 
Sbjct  183  PLLKKVYPVLQAFKKLVEVDSKNILASWNGSDIC---GKYRGLECATFPGTKYQAVASVQ  239

Query  419  fngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIP-VQKFPTLFELDLSNNKLAG  595
            FNG+NF+G  L L++F++  + + + H NSNNF G+  +P V     LFELDLSNNKL G
Sbjct  240  FNGFNFSGKNLRLDNFLDKLDTVTIFHANSNNFLGS--VPKVSNLKYLFELDLSNNKLTG  297

Query  596  AFPTAVLEATNLTYLDLRFNMLTGPVHPQV  685
             FP +VL+ATNLT+LDLRFN  +G V  QV
Sbjct  298  EFPASVLKATNLTFLDLRFNTFSGSVPRQV  327



>ref|XP_004231393.1| PREDICTED: uncharacterized protein At4g06744 [Solanum lycopersicum]
Length=394

 Score =   102 bits (253),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 52/140 (37%), Positives = 82/140 (59%), Gaps = 5/140 (4%)
 Frame = +2

Query  266  IRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfngn  445
            I+ FK +IT DP  VT++W G ++C     Y+GF+C  P   +   +     +   F  +
Sbjct  43   IQNFKNTITLDPFGVTKTWTGPDIC----NYKGFYCDNPPN-NSSAISLASIDFNGFQLS  97

Query  446  glslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEAT  625
              +L+ F++   DL + H N+NNF+G     +   P L+ELDLSNN+  G FP ++L   
Sbjct  98   APTLDGFIDQLPDLAIFHANTNNFSGIISSKISNLPYLYELDLSNNQFIGTFPMSILNIK  157

Query  626  NLTYLDLRFNMLTGPVHPQV  685
             LT+LD+R+N+LTG + PQ+
Sbjct  158  TLTFLDIRYNLLTGIIPPQI  177



>ref|XP_011000139.1| PREDICTED: uncharacterized protein At4g06744-like [Populus euphratica]
Length=421

 Score =   102 bits (253),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 57/151 (38%), Positives = 83/151 (55%), Gaps = 5/151 (3%)
 Frame = +2

Query  233  LDPVIRKSIKAIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVgg  412
            LD  +      I+ FK +IT DP N+TQ+W G ++C     Y+GF+C  P   +   V  
Sbjct  53   LDQRLASVYPIIQVFKDTITSDPFNITQTWVGPDIC----NYEGFYCTSPPDNNSA-VAV  107

Query  413  iyfngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLA  592
               +   F  +  +L+ F++   DL + H NSN F+G     + K P L+ELD+SNN   
Sbjct  108  ASIDFNGFQLSAPTLDGFIDQLPDLALFHANSNKFSGTISPKITKLPFLYELDISNNNFH  167

Query  593  GAFPTAVLEATNLTYLDLRFNMLTGPVHPQV  685
            G+FP  +L    L++LD+RFN  TG V PQV
Sbjct  168  GSFPMEILGIPGLSFLDIRFNFFTGTVPPQV  198



>ref|XP_010421726.1| PREDICTED: uncharacterized protein At4g06744 [Camelina sativa]
Length=407

 Score =   102 bits (253),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 59/151 (39%), Positives = 83/151 (55%), Gaps = 5/151 (3%)
 Frame = +2

Query  233  LDPVIRKSIKAIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVgg  412
            LD  +      I+ FK  IT DP  VTQ+W G+++C     Y+GF C  P   +K  V  
Sbjct  44   LDQRLAVVYPVIQRFKSLITLDPYKVTQTWTGSDIC----SYRGFHCDNPPD-NKTAVTV  98

Query  413  iyfngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLA  592
               +   F  +  S+  F++ F DL + HVNSNNF G     +     L+ELD+SNN+  
Sbjct  99   ASIDFNGFQLSAPSIEGFIDQFPDLALFHVNSNNFGGTVPSKIVNLKYLYELDISNNRFT  158

Query  593  GAFPTAVLEATNLTYLDLRFNMLTGPVHPQV  685
            G FPTAV+  + L +LD+RFN  +G V PQ+
Sbjct  159  GQFPTAVVGMSGLKFLDIRFNSFSGSVPPQI  189



>ref|XP_009359966.1| PREDICTED: uncharacterized protein At4g06744-like [Pyrus x bretschneideri]
Length=468

 Score =   102 bits (254),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 55/140 (39%), Positives = 81/140 (58%), Gaps = 5/140 (4%)
 Frame = +2

Query  266  IRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfngn  445
            I+ FK  IT DP N+T++W G+ +C     Y+GF+C  P   +   +     +   F   
Sbjct  126  IQNFKSLITSDPLNITKTWVGSNIC----SYKGFYCDSPPN-NSSAIALASIDFNGFQLG  180

Query  446  glslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEAT  625
              SL+ F++   D+ + H NSNNF+G     +   P L+ELD+SNN+ +GAFP+AVL   
Sbjct  181  APSLDGFLDQLPDIALFHANSNNFSGTVSPAIANLPYLYELDISNNQFSGAFPSAVLGMN  240

Query  626  NLTYLDLRFNMLTGPVHPQV  685
             L +LD+RFN  TG V PQ+
Sbjct  241  TLGFLDIRFNFFTGAVPPQI  260



>ref|XP_009417193.1| PREDICTED: uncharacterized protein At4g06744-like [Musa acuminata 
subsp. malaccensis]
Length=456

 Score =   102 bits (254),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 57/142 (40%), Positives = 77/142 (54%), Gaps = 5/142 (4%)
 Frame = +2

Query  266  IRTFKKSITYDPQNVTQSWEGNELCINKKK-YQGFFCYVPRGGDKKRVggiyfngynfng  442
            I+ FK+++T DP+N T SW G  +C N  + YQGF+C  P G    R             
Sbjct  82   IQRFKQTVTCDPKNKTGSWTGFRICNNDGRGYQGFYCETPPGLSNMRTIASVDFNGFTLS  141

Query  443  nglslnsFVESFNDLVVIHVNSNNFTGAPGIP-VQKFPTLFELDLSNNKLAGAFPTAVLE  619
                   FV+   DL + H NSN+F G   +P +   P  +ELDLSNN+L+G FP +VL 
Sbjct  142  APTVCG-FVDQLPDLALFHANSNSFGGT--VPALASLPFFYELDLSNNRLSGGFPASVLP  198

Query  620  ATNLTYLDLRFNMLTGPVHPQV  685
              +L +LDLR+N   GPV P V
Sbjct  199  LVDLAFLDLRYNGYAGPVPPAV  220



>ref|XP_002313863.2| hypothetical protein POPTR_0009s10140g [Populus trichocarpa]
 gb|EEE87818.2| hypothetical protein POPTR_0009s10140g [Populus trichocarpa]
Length=424

 Score =   102 bits (253),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 55/140 (39%), Positives = 80/140 (57%), Gaps = 5/140 (4%)
 Frame = +2

Query  266  IRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfngn  445
            I+ FK +IT DP ++TQ+W G ++C     Y+GF+C  P   D   +     +   F  +
Sbjct  64   IQDFKNTITSDPLDITQTWVGADIC----NYKGFYCTSPPDNDSA-ITLASIDFNGFQLS  118

Query  446  glslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEAT  625
              +L+ F++   DL + H NSN F+G     + K P L+ELD+SNN   G+FP  VL   
Sbjct  119  APTLDGFIDQLPDLALFHANSNKFSGTISPKITKLPFLYELDISNNNFFGSFPMEVLAIP  178

Query  626  NLTYLDLRFNMLTGPVHPQV  685
             L++LD+RFN  TG V PQV
Sbjct  179  ALSFLDIRFNFFTGTVPPQV  198



>ref|XP_006346520.1| PREDICTED: uncharacterized protein At4g06744-like [Solanum tuberosum]
Length=397

 Score =   101 bits (252),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 52/140 (37%), Positives = 82/140 (59%), Gaps = 5/140 (4%)
 Frame = +2

Query  266  IRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfngn  445
            I+ FK +IT DP  VT++W G ++C     Y+GF+C  P   +   +     +   F  +
Sbjct  43   IQNFKNTITLDPFGVTKTWTGPDIC----NYKGFYCDNPPN-NSSAISLASIDFNGFQLS  97

Query  446  glslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEAT  625
              +L+ F++   DL + H N+NNF+G     +   P L+ELDLSNN+  G FP ++L   
Sbjct  98   APTLDGFIDQLPDLAIFHANTNNFSGIISSKISNLPYLYELDLSNNQFIGTFPMSILNIK  157

Query  626  NLTYLDLRFNMLTGPVHPQV  685
             LT+LD+R+N+LTG + PQ+
Sbjct  158  TLTFLDIRYNLLTGIIPPQI  177



>gb|KDP24991.1| hypothetical protein JCGZ_23974 [Jatropha curcas]
Length=413

 Score =   101 bits (252),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 59/140 (42%), Positives = 81/140 (58%), Gaps = 5/140 (4%)
 Frame = +2

Query  266  IRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfngn  445
            I+TFKK+IT DP N+TQ+W G ++C     Y+GF C  P   +         +   F  +
Sbjct  60   IQTFKKAITSDPLNITQTWVGPDIC----NYKGFSCDHPPD-NISATPLAAIDFNGFRLS  114

Query  446  glslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEAT  625
              SL+ F++   DL + H NSNNF+G     +   P L+ELDLSNN   G FP A+L  T
Sbjct  115  APSLDGFIDQLPDLAIFHANSNNFSGTISPKLADLPFLYELDLSNNFFFGNFPMAILSIT  174

Query  626  NLTYLDLRFNMLTGPVHPQV  685
             L++LD+RFN  TG V PQ+
Sbjct  175  GLSFLDIRFNFFTGSVPPQI  194



>ref|XP_006397360.1| hypothetical protein EUTSA_v10028721mg [Eutrema salsugineum]
 gb|ESQ38813.1| hypothetical protein EUTSA_v10028721mg [Eutrema salsugineum]
Length=391

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 61/151 (40%), Positives = 84/151 (56%), Gaps = 5/151 (3%)
 Frame = +2

Query  233  LDPVIRKSIKAIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVgg  412
            LD  +      I+ FK  IT DP  VTQ+W G+++C     Y+GF C  P   +K  V  
Sbjct  31   LDQRLAVVYPVIQRFKSLITLDPFKVTQTWFGSDIC----SYRGFHCDNPPD-NKTAVTV  85

Query  413  iyfngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLA  592
               +  +F  +  S+  F++ F DL + HVNSNNF G     +     L+ELD+SNNK  
Sbjct  86   ASIDFNDFQLSAPSIEGFIDQFPDLALFHVNSNNFGGTVPSKIVNLKYLYELDISNNKFT  145

Query  593  GAFPTAVLEATNLTYLDLRFNMLTGPVHPQV  685
            G FPTAV+    LT+LD+RFN  +G V PQ+
Sbjct  146  GPFPTAVVGMPGLTFLDIRFNSFSGSVPPQI  176



>ref|XP_004960235.1| PREDICTED: uncharacterized protein At4g06744-like [Setaria italica]
Length=512

 Score =   102 bits (255),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 62/144 (43%), Positives = 81/144 (56%), Gaps = 7/144 (5%)
 Frame = +2

Query  266  IRTFKKSITYDPQNVTQSWEGNELC---INKKKYQGFFCYVPRGGDKKRVggiyfngynf  436
            I+ FKK+IT DP  VT +WEG +LC    N  KY+GF+C  P   +   +     +   F
Sbjct  156  IQAFKKTITCDPLGVTATWEGPDLCSSFFNGTKYRGFYCEYPPNANAT-LTVASIDFNGF  214

Query  437  ngnglslnsFVESFNDLVVIHVNSNNFTGAPGIP-VQKFPTLFELDLSNNKLAGAFPTAV  613
                 SL  FV+ F DL + H NSNNF+G   +P +   P  +ELDLSNN  +G+FP AV
Sbjct  215  GLCAPSLVGFVDQFPDLALFHANSNNFSG--DVPDLTHLPFFYELDLSNNNFSGSFPDAV  272

Query  614  LEATNLTYLDLRFNMLTGPVHPQV  685
            +    L +LDLRFN   G V P V
Sbjct  273  VPLGGLLFLDLRFNRYAGAVPPAV  296



>ref|XP_011088225.1| PREDICTED: uncharacterized protein At4g06744-like [Sesamum indicum]
Length=460

 Score =   102 bits (253),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 67/142 (47%), Positives = 93/142 (65%), Gaps = 7/142 (5%)
 Frame = +2

Query  266  IRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFC--YVPRGGDKKRVggiyfngynfn  439
            I+ FK+ I YDP  +T++W G ++C    KY+GF C   +P G  +K + G+ FNG+N +
Sbjct  97   IQKFKQKIKYDPYGITKTWIGPDIC---NKYKGFICDTLIPLG--EKALAGVKFNGFNLD  151

Query  440  gnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLE  619
            G  L+L+SF++   D++V H NSNNF GA  + + K   L+ELDLSNNK +  FP  VL 
Sbjct  152  GPDLNLDSFIDELPDIMVFHANSNNFKGAFPLKISKIKYLYELDLSNNKYSCEFPYEVLG  211

Query  620  ATNLTYLDLRFNMLTGPVHPQV  685
            AT LT+LDLRFN   G + PQV
Sbjct  212  ATKLTFLDLRFNSFYGMLPPQV  233



>ref|XP_011000899.1| PREDICTED: uncharacterized protein At4g06744-like [Populus euphratica]
Length=423

 Score =   101 bits (252),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 58/151 (38%), Positives = 83/151 (55%), Gaps = 5/151 (3%)
 Frame = +2

Query  233  LDPVIRKSIKAIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVgg  412
            LD  +      I+ FK +IT DP N+TQ+W G ++C     Y+GF+C  P   D   +  
Sbjct  53   LDQRLALVYPIIQDFKNTITSDPLNITQTWVGADIC----NYRGFYCTSPPDNDSA-ITL  107

Query  413  iyfngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLA  592
               +   F  +  +L+ F++   DL + H NSN F+GA    + K   L+ELD+SNN   
Sbjct  108  ASIDFNGFQLSAPTLDGFIDQLPDLALFHANSNKFSGAISPKITKLQFLYELDISNNNFF  167

Query  593  GAFPTAVLEATNLTYLDLRFNMLTGPVHPQV  685
            G+FP  VL    L++LD+RFN  TG V PQV
Sbjct  168  GSFPMEVLGIPALSFLDIRFNFFTGTVPPQV  198



>ref|XP_010487869.1| PREDICTED: uncharacterized protein At4g06744-like [Camelina sativa]
Length=459

 Score =   102 bits (253),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 66/149 (44%), Positives = 95/149 (64%), Gaps = 4/149 (3%)
 Frame = +2

Query  242  VIRKSIKAIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyf  421
            +I+K    I+ F+K I  DP+ + ++W G ++C  +  Y G  C    G +   +G I F
Sbjct  88   LIKKVFPVIKNFQKLIEDDPKKILKTWVGTDICA-QDTYIGLECAKFPGTNDDALGSIQF  146

Query  422  ngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIP-VQKFPTLFELDLSNNKLAGA  598
            N +NF G  L L++F++   ++ + H NSNNF G+  +P V     LFELDLSNNKL+G 
Sbjct  147  NNFNFRGKKLRLDNFLDKLEEVTIFHANSNNFLGS--VPKVSNLKYLFELDLSNNKLSGE  204

Query  599  FPTAVLEATNLTYLDLRFNMLTGPVHPQV  685
            FP++VL+ATNLT+LDLRFN  +G V PQV
Sbjct  205  FPSSVLKATNLTFLDLRFNSFSGSVPPQV  233



>ref|XP_011029410.1| PREDICTED: uncharacterized protein At4g06744-like [Populus euphratica]
Length=430

 Score =   101 bits (251),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 54/140 (39%), Positives = 81/140 (58%), Gaps = 5/140 (4%)
 Frame = +2

Query  266  IRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfngn  445
            I+ FK  IT DP  +T++W G+++C     Y+GFFC  P   +         +   F+  
Sbjct  88   IQKFKSLITSDPLGITKTWVGSDIC----NYKGFFCDSPPD-NNSATAVASIDFNGFHLA  142

Query  446  glslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEAT  625
              +L+ F++   D+ + H NSNNF G     + + P L+ELD+SNN  +G+FPTAVL   
Sbjct  143  APTLDGFLDQLPDVALFHANSNNFAGTLSSNIARLPYLYELDISNNLFSGSFPTAVLGMD  202

Query  626  NLTYLDLRFNMLTGPVHPQV  685
             LT+LD+RFN  +G V PQ+
Sbjct  203  GLTFLDIRFNFFSGAVPPQI  222



>gb|KDP41695.1| hypothetical protein JCGZ_16102 [Jatropha curcas]
Length=424

 Score =   101 bits (251),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 55/140 (39%), Positives = 82/140 (59%), Gaps = 5/140 (4%)
 Frame = +2

Query  266  IRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfngn  445
            I+ FK  IT DP  +T++W G++LC     Y+GF+C  P   +K  V     +   F   
Sbjct  82   IQKFKSIITSDPLGITKTWVGSDLC----NYKGFYCDNPPD-NKSAVAVASIDFNGFQLA  136

Query  446  glslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEAT  625
              +L+ F++   D+ + H NSN F+G+    + K P L+ELD+SNN  +G FPTAVL   
Sbjct  137  APTLDGFLDQLPDIALFHANSNFFSGSISPNIAKLPYLYELDISNNLFSGLFPTAVLSMN  196

Query  626  NLTYLDLRFNMLTGPVHPQV  685
             LT+LD+RFN  +G + PQ+
Sbjct  197  GLTFLDIRFNFFSGSIPPQL  216



>gb|KDP24986.1| hypothetical protein JCGZ_23969 [Jatropha curcas]
Length=413

 Score =   100 bits (250),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 58/140 (41%), Positives = 80/140 (57%), Gaps = 5/140 (4%)
 Frame = +2

Query  266  IRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfngn  445
            I+TFK SIT DP N+TQ+W G ++C     Y+GF+C  P   +         +   F  +
Sbjct  60   IQTFKNSITSDPFNITQTWVGPDIC----NYKGFYCDHPPD-NISATALAAIDFNGFRLS  114

Query  446  glslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEAT  625
              SL+  ++   DL + H NSNNF+G     +   P L+ELDLSNN   G FP A+L  T
Sbjct  115  APSLDGLIDQLPDLAIFHANSNNFSGTISPKLADLPFLYELDLSNNFFFGNFPMAILSIT  174

Query  626  NLTYLDLRFNMLTGPVHPQV  685
             L++LD+RFN  TG V PQ+
Sbjct  175  GLSFLDIRFNFFTGSVPPQI  194



>ref|XP_006374888.1| hypothetical protein POPTR_0014s02430g [Populus trichocarpa]
 gb|ERP52685.1| hypothetical protein POPTR_0014s02430g [Populus trichocarpa]
Length=430

 Score =   101 bits (251),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 54/140 (39%), Positives = 79/140 (56%), Gaps = 5/140 (4%)
 Frame = +2

Query  266  IRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfngn  445
            I+ FK  IT DP  +T++W G+++C     Y+GFFC  P   +         +   F   
Sbjct  88   IQKFKSLITSDPLGITKTWVGSDIC----NYKGFFCDSPPD-NNSATAVASIDFNGFQLA  142

Query  446  glslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEAT  625
              +L+ F++   D+ + H NSNNF G     + + P L+ELD+SNN  +G+FPTAVL   
Sbjct  143  APTLDGFLDQLPDVALFHANSNNFAGTISSNIARLPYLYELDISNNLFSGSFPTAVLGMN  202

Query  626  NLTYLDLRFNMLTGPVHPQV  685
             LT+LD+RFN   G V PQ+
Sbjct  203  GLTFLDIRFNFFAGAVPPQI  222



>ref|XP_007199295.1| hypothetical protein PRUPE_ppa023082mg, partial [Prunus persica]
 gb|EMJ00494.1| hypothetical protein PRUPE_ppa023082mg, partial [Prunus persica]
Length=398

 Score =   100 bits (249),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 55/140 (39%), Positives = 80/140 (57%), Gaps = 5/140 (4%)
 Frame = +2

Query  266  IRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfngn  445
            I  FK +IT DP  +TQ+W G+++C     Y+GF+C  P   ++        +   F  +
Sbjct  42   INAFKNTITSDPLGITQTWVGSDICT----YKGFYCDRPPD-NQSAFALASIDFNGFQLS  96

Query  446  glslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEAT  625
              S++ F++   DL + H NSNNF+G     +     L+ELD+SNN   G FPTAVL   
Sbjct  97   APSIDGFIDQLPDLALFHANSNNFSGIISPKIANLKYLYELDISNNNFFGPFPTAVLTMN  156

Query  626  NLTYLDLRFNMLTGPVHPQV  685
            NL++LD+RFN  TG V PQ+
Sbjct  157  NLSFLDIRFNSFTGSVPPQI  176



>ref|XP_006393218.1| hypothetical protein EUTSA_v10011424mg [Eutrema salsugineum]
 gb|ESQ30504.1| hypothetical protein EUTSA_v10011424mg [Eutrema salsugineum]
Length=496

 Score =   101 bits (252),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 64/149 (43%), Positives = 92/149 (62%), Gaps = 7/149 (5%)
 Frame = +2

Query  242  VIRKSIKAIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyf  421
            ++ K+   ++ FK  +  DP+NV  SW G+++C    KY+G  C +  G     V  + F
Sbjct  126  LLEKAYPILQAFKNLVEDDPKNVLDSWNGSDIC----KYRGLECAIFPGTKDLAVASVQF  181

Query  422  ngynfngnglslnsFVESFNDLVVIHVNSNNFTGA-PGIPVQKFPTLFELDLSNNKLAGA  598
            N +NF G  L L++F++    + + H NSNNF G+ P +   K+  LFELDLSNNKL G 
Sbjct  182  NEFNFAGKKLRLDNFLDKLETVTIFHANSNNFLGSVPDVSNLKY--LFELDLSNNKLTGD  239

Query  599  FPTAVLEATNLTYLDLRFNMLTGPVHPQV  685
            FP +VL+A +LT+LDLRFN  +G V PQV
Sbjct  240  FPASVLKAKDLTFLDLRFNTFSGSVPPQV  268



>ref|XP_003589141.1| hypothetical protein MTR_1g018910 [Medicago truncatula]
 gb|ABD32635.1| Leucine-rich repeat, plant specific [Medicago truncatula]
 gb|ACJ86225.1| unknown [Medicago truncatula]
 gb|AES59392.1| Serine/Threonine kinase, plant-type protein, putative [Medicago 
truncatula]
 gb|AFK35532.1| unknown [Medicago truncatula]
Length=378

 Score =   100 bits (248),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 57/141 (40%), Positives = 80/141 (57%), Gaps = 5/141 (4%)
 Frame = +2

Query  263  AIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfng  442
             I+ FK  IT DP  VT+SW G+++C     Y+GF+C  P   +   +     +   F  
Sbjct  38   VIQKFKSLITSDPLGVTKSWIGSDIC----NYKGFYCDHPPDNNSA-IALASIDFNGFQL  92

Query  443  nglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEA  622
            +  +LN F++   D+ + H NSNNF G     + K P L+ELDLSNNK +G FP AVL  
Sbjct  93   SASTLNGFIDKLPDIALFHANSNNFIGTITSQISKLPYLYELDLSNNKFSGPFPMAVLGM  152

Query  623  TNLTYLDLRFNMLTGPVHPQV  685
              LT+LD+RFN  +G V  Q+
Sbjct  153  NTLTFLDIRFNSFSGGVPQQI  173



>ref|XP_009768848.1| PREDICTED: uncharacterized protein At4g06744-like [Nicotiana 
sylvestris]
Length=408

 Score =   100 bits (249),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 55/140 (39%), Positives = 80/140 (57%), Gaps = 5/140 (4%)
 Frame = +2

Query  266  IRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfngn  445
            I+ FK  IT DP  VT+SW G  +C     Y GF+C  P   DK  +     +   F  +
Sbjct  67   IQKFKNIITSDPLGVTKSWVGPNIC----NYTGFYCDTPPD-DKSAIAVASIDFNGFQLS  121

Query  446  glslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEAT  625
              +L+ F++   D+ + H NSNNF+G     +   P L+ELD+SNN+ +G FP A+L   
Sbjct  122  APNLDGFLDQLPDIALFHANSNNFSGTLSANIANLPYLYELDISNNQFSGPFPPAILGMN  181

Query  626  NLTYLDLRFNMLTGPVHPQV  685
            +L++LD+RFN  TG V PQ+
Sbjct  182  SLSFLDIRFNSFTGSVPPQL  201



>ref|XP_002874478.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50737.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=409

 Score =   100 bits (249),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 56/141 (40%), Positives = 81/141 (57%), Gaps = 5/141 (4%)
 Frame = +2

Query  263  AIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfng  442
             I+ FK  IT DP NVT++W G+++C     Y+GF C  P   +   V     +   F  
Sbjct  54   VIQRFKSLITLDPYNVTKTWIGSDIC----SYRGFHCDNPPD-NTTAVTVASIDFNGFQL  108

Query  443  nglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEA  622
            +  S+  F++ F DL + HVNSNNF G     +     L+ELD+SNN+  G FPTAV+  
Sbjct  109  SAPSIEGFIDQFPDLALFHVNSNNFGGTVPSKIVNLRYLYELDISNNRFTGQFPTAVVGM  168

Query  623  TNLTYLDLRFNMLTGPVHPQV  685
            + LT+LD+RFN  +G + PQ+
Sbjct  169  SGLTFLDIRFNSFSGSIPPQI  189



>ref|XP_008393778.1| PREDICTED: uncharacterized protein At4g06744-like [Malus domestica]
Length=463

 Score =   100 bits (250),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 54/140 (39%), Positives = 81/140 (58%), Gaps = 5/140 (4%)
 Frame = +2

Query  266  IRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfngn  445
            I+ FK  IT DP N+T++W G+ +C     Y+GF+C  P   +   +     +   F   
Sbjct  121  IQNFKSLITSDPLNITKTWVGSNIC----XYKGFYCDSPPN-NSSAIALASIDFNGFQLG  175

Query  446  glslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEAT  625
              SL+ F++   D+ + H NSNNF+G     +   P L+ELD+SNN+ +GAFP+AVL   
Sbjct  176  APSLDGFLDQLPDIALFHANSNNFSGTVSPAIANLPYLYELDISNNQFSGAFPSAVLGMN  235

Query  626  NLTYLDLRFNMLTGPVHPQV  685
             L +LD+RFN  TG V P++
Sbjct  236  TLGFLDIRFNFFTGAVPPEI  255



>ref|XP_007201703.1| hypothetical protein PRUPE_ppa004109mg [Prunus persica]
 gb|EMJ02902.1| hypothetical protein PRUPE_ppa004109mg [Prunus persica]
Length=529

 Score =   101 bits (251),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 64/149 (43%), Positives = 85/149 (57%), Gaps = 6/149 (4%)
 Frame = +2

Query  245  IRKSIKAIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfn  424
            I  +    + F+  IT DP+++ +SW+G  +C    KY+G  C +     +K V G+  N
Sbjct  163  IELAYHVFQNFRPLITSDPKHIAKSWQGPHVC----KYKGVVCAMHPTYKQKAVAGLDIN  218

Query  425  gynfngnglsl--nsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGA  598
            G  F G+   L  + F++   DL   H NSNNFTG+    V K    +ELDLSNNKL G 
Sbjct  219  GALFGGDNAKLPLDGFLDKLEDLAFFHANSNNFTGSVPKDVSKLKFFYELDLSNNKLIGG  278

Query  599  FPTAVLEATNLTYLDLRFNMLTGPVHPQV  685
            FP  VL ATNLT+LDLRFN   G V P+V
Sbjct  279  FPNEVLAATNLTFLDLRFNYFAGSVTPEV  307



>gb|EMS59107.1| hypothetical protein TRIUR3_04108 [Triticum urartu]
Length=442

 Score =   100 bits (249),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 61/155 (39%), Positives = 85/155 (55%), Gaps = 9/155 (6%)
 Frame = +2

Query  242  VIRKSIKAIR---TFKKSITYDPQNVTQSWEGNELCINKK---KYQGFFCYVPRGGDKKR  403
            V+R  + A R    FK++IT DP NVT +W G  +C + K    Y+GF+C  P     K 
Sbjct  57   VVRDHVPASRVSVAFKRTITSDPLNVTATWVGANICDSAKGGGAYKGFYCDTPPDDANKT  116

Query  404  VggiyfngynfngnglslnsFVESFNDLVVIHVNSNNFTGA-PGIPVQKFPTLFELDLSN  580
            +     +   F+    +L  F+++F DL + H NSNNF+G  P +   ++   +ELDLSN
Sbjct  117  LTVASIDFNGFHLCAPTLAGFIDAFPDLALFHANSNNFSGVLPELTSLRY--FYELDLSN  174

Query  581  NKLAGAFPTAVLEATNLTYLDLRFNMLTGPVHPQV  685
            N  +GAFP AV     L +LDLRFN   G V P V
Sbjct  175  NAFSGAFPAAVPPLGRLAFLDLRFNGFAGEVPPSV  209



>ref|XP_002282482.2| PREDICTED: uncharacterized protein At4g06744-like [Vitis vinifera]
Length=507

 Score =   101 bits (251),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 67/148 (45%), Positives = 89/148 (60%), Gaps = 5/148 (3%)
 Frame = +2

Query  245  IRKSIKAIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfn  424
            ++ ++KAIR F+  IT DP N+ + W+GN  C    K++GF C      +   V G+ FN
Sbjct  147  LKIALKAIRIFQAKITVDPFNIAKGWKGNNPC----KFKGFVCSTVPDKNLNAVAGVDFN  202

Query  425  gynfngnglslnsFVESFNDLVVIHVNSNNFTGA-PGIPVQKFPTLFELDLSNNKLAGAF  601
            G+NF G  L+L+ F+    D+ + H NSN+F G  P I   K   L+ELDLSNNKL G F
Sbjct  203  GFNFGGPNLALDGFLNGLPDITIFHANSNDFNGRIPKIDTTKLRYLYELDLSNNKLHGEF  262

Query  602  PTAVLEATNLTYLDLRFNMLTGPVHPQV  685
            P  VL A  LT+LDLRFN  +G V P V
Sbjct  263  PYEVLAAKQLTFLDLRFNSFSGVVPPHV  290



>ref|XP_002510174.1| serine-threonine protein kinase, plant-type, putative [Ricinus 
communis]
 gb|EEF52361.1| serine-threonine protein kinase, plant-type, putative [Ricinus 
communis]
Length=437

 Score =   100 bits (248),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 54/140 (39%), Positives = 82/140 (59%), Gaps = 5/140 (4%)
 Frame = +2

Query  266  IRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfngn  445
            I+ FK  IT DP  +T++W G+++C     Y+GFFC  P   +K  +     +   F  +
Sbjct  97   IQKFKSIITSDPLGITKTWVGSDIC----SYKGFFCDNPPD-NKSAIAVASIDFNGFQLS  151

Query  446  glslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEAT  625
              +L+ F++   D+ + H NSN F+G     + K P L+ELD+SNN  +G FPTAVL   
Sbjct  152  AATLDGFLDQLPDIALFHANSNFFSGTISPDIAKLPYLYELDISNNLFSGPFPTAVLGMN  211

Query  626  NLTYLDLRFNMLTGPVHPQV  685
             LT+LD+RFN  +G + PQ+
Sbjct  212  GLTFLDIRFNFFSGAIPPQL  231



>ref|XP_010061722.1| PREDICTED: uncharacterized protein At4g06744-like [Eucalyptus 
grandis]
Length=455

 Score =   100 bits (248),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 58/140 (41%), Positives = 80/140 (57%), Gaps = 5/140 (4%)
 Frame = +2

Query  266  IRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfngn  445
            I+ FK +IT DP  +T SW G ++C    KY+GF+C  P   +K        +   F  +
Sbjct  111  IQLFKSTITSDPLGITNSWVGGDIC----KYKGFYCDSPPD-NKSATALASIDFNGFGLS  165

Query  446  glslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEAT  625
              SL+ F++   D+ + H NSN F G     + K   L+ELDLSNNKL+G FPT VL  T
Sbjct  166  APSLDGFLDQLPDIALFHANSNKFAGTISPNIAKLRYLYELDLSNNKLSGPFPTVVLGMT  225

Query  626  NLTYLDLRFNMLTGPVHPQV  685
            +L +LDLRFN  +G V  Q+
Sbjct  226  DLIFLDLRFNSFSGAVPAQI  245



>ref|XP_002300228.2| hypothetical protein POPTR_0001s30990g [Populus trichocarpa]
 gb|EEE85033.2| hypothetical protein POPTR_0001s30990g [Populus trichocarpa]
Length=421

 Score = 99.8 bits (247),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 56/151 (37%), Positives = 82/151 (54%), Gaps = 5/151 (3%)
 Frame = +2

Query  233  LDPVIRKSIKAIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVgg  412
            LD  +      I+ FK +IT DP N+TQ+W G ++C     Y+GF+C  P   +   V  
Sbjct  53   LDQRLASVFPIIQVFKDTITSDPFNITQTWVGPDIC----NYKGFYCTSPPD-NNSAVAL  107

Query  413  iyfngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLA  592
               +   F  +  +L+ F++   DL + H NSN F+G     + K P L+ELD+SNN   
Sbjct  108  ASIDFNGFQLSAPTLDGFIDQLPDLALFHANSNKFSGTISPKITKLPFLYELDISNNNFL  167

Query  593  GAFPTAVLEATNLTYLDLRFNMLTGPVHPQV  685
            G FP  +L    L++LD+RFN  TG V P+V
Sbjct  168  GNFPMEILGIPGLSFLDIRFNFFTGTVPPEV  198



>gb|KJB32334.1| hypothetical protein B456_005G236100 [Gossypium raimondii]
Length=433

 Score = 99.4 bits (246),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 70/193 (36%), Positives = 100/193 (52%), Gaps = 20/193 (10%)
 Frame = +2

Query  119  IMPGEEESKETSPPASLVYNVDCGCYVpppppppcpppLDPVIRKSIKAIRTFKKSITYD  298
            ++ G  E+ E +      +    GC+             +  + K+   I+TFK  I  D
Sbjct  32   VIRGNRETLEIANGGGGKFKTKSGCF------------RNQRLAKTHDVIQTFKSKILVD  79

Query  299  --PQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfn--gnglslnsF  466
               +  T++W G E+C     Y+GF C +    ++  V  + FNG  F      L L+ F
Sbjct  80   DNSKKYTETWRGTEIC----NYKGFTCDIRPDVNETAVASVDFNGAKFAGPNGYLPLDGF  135

Query  467  VESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEATNLTYLDL  646
            ++  +DL + H NSNNFTG     V K   L+ELDLSNN+L+G FP  VL+ATNLT+LDL
Sbjct  136  IDKLDDLAIFHANSNNFTGTIPYEVSKIKYLYELDLSNNQLSGDFPMNVLKATNLTFLDL  195

Query  647  RFNMLTGPVHPQV  685
            RFN + G V  QV
Sbjct  196  RFNSIKGLVPQQV  208



>gb|EPS58531.1| hypothetical protein M569_16282, partial [Genlisea aurea]
Length=344

 Score = 98.6 bits (244),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 52/141 (37%), Positives = 79/141 (56%), Gaps = 5/141 (4%)
 Frame = +2

Query  263  AIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfng  442
            AI+ FK  ++ DP+NVT SW G ++C    +Y+GF+C  P   +   V     +   F+ 
Sbjct  14   AIQKFKSLVSSDPRNVTVSWVGADVC----RYRGFYCDSPPD-NSSAVAVASVDFNGFHL  68

Query  443  nglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEA  622
               +L  F++   D+ + H NSN F+G   + + + P L+ELDLSNN L+G FP  +L  
Sbjct  69   TAPTLAGFIDQLPDIAIFHANSNFFSGGVPVGIARLPYLYELDLSNNLLSGDFPAEILAM  128

Query  623  TNLTYLDLRFNMLTGPVHPQV  685
               + LD+RFN  TG V P +
Sbjct  129  GGFSLLDIRFNFFTGAVPPAI  149



>gb|EYU25462.1| hypothetical protein MIMGU_mgv1a024676mg, partial [Erythranthe 
guttata]
Length=400

 Score = 98.6 bits (244),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 59/141 (42%), Positives = 78/141 (55%), Gaps = 6/141 (4%)
 Frame = +2

Query  266  IRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfngn  445
            I+ FK  I  DP N+T +W G+++C     Y+GF+C  P   +K        +   F   
Sbjct  43   IQKFKNIIISDPFNITVTWVGSDIC----SYRGFYCESPPD-NKSATALASIDFNGFQLT  97

Query  446  glslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFP-TAVLEA  622
              +L  F++S  DL + H NSNNF GA    +     L+ELDLSNNK  GAFP  AVL  
Sbjct  98   APTLVGFLDSLPDLALFHANSNNFAGAISPAIGNLKYLYELDLSNNKFTGAFPAAAVLGM  157

Query  623  TNLTYLDLRFNMLTGPVHPQV  685
            T L +LDLRFN  +G V PQ+
Sbjct  158  TGLFFLDLRFNFFSGSVPPQL  178



>gb|KFK39606.1| hypothetical protein AALP_AA3G265800 [Arabis alpina]
Length=403

 Score = 98.6 bits (244),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 56/151 (37%), Positives = 83/151 (55%), Gaps = 5/151 (3%)
 Frame = +2

Query  233  LDPVIRKSIKAIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVgg  412
            LD  +      I+ F+  IT DP  +T +W G+++C     Y+GF+C  P   +K  +  
Sbjct  41   LDQRLAVVYPIIQRFRLLITLDPFKITHTWTGSDIC----SYRGFYCDNPPD-NKTALTV  95

Query  413  iyfngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLA  592
               +   +  +  S+  FV+   DL + HVNSNNF G     +     L+ELD+SNN+  
Sbjct  96   ASIDFNGYQLSAPSIEGFVDQLPDLGLFHVNSNNFGGTVPSKIVNLKYLYELDISNNRFT  155

Query  593  GAFPTAVLEATNLTYLDLRFNMLTGPVHPQV  685
            G FPTAVL+   LTYLD+RFN  +G + PQ+
Sbjct  156  GQFPTAVLDMPGLTYLDIRFNSFSGSIPPQI  186



>gb|KJB14612.1| hypothetical protein B456_002G134000 [Gossypium raimondii]
Length=422

 Score = 99.0 bits (245),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 55/140 (39%), Positives = 82/140 (59%), Gaps = 5/140 (4%)
 Frame = +2

Query  266  IRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfngn  445
            I+ FK  IT DP  +TQ+W G+++C     Y+GF+C  P   +K  +     +   F  +
Sbjct  81   IQKFKSLITSDPLGITQTWVGSDIC----SYKGFYCDNPPD-NKSAIAVASIDFNGFQLS  135

Query  446  glslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEAT  625
              SL+ F++   D+ + H NSNNF+G+    + K   L+ELD+SNN+ +G FP AVL   
Sbjct  136  APSLDGFLDQLPDIALFHANSNNFSGSLSPNIAKLRYLYELDISNNRFSGPFPDAVLNMP  195

Query  626  NLTYLDLRFNMLTGPVHPQV  685
             LT+LD+RFN  TG V  Q+
Sbjct  196  GLTFLDIRFNFFTGSVPSQI  215



>ref|XP_006422962.1| hypothetical protein CICLE_v10028712mg [Citrus clementina]
 gb|ESR36202.1| hypothetical protein CICLE_v10028712mg [Citrus clementina]
Length=360

 Score = 97.8 bits (242),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 53/136 (39%), Positives = 80/136 (59%), Gaps = 5/136 (4%)
 Frame = +2

Query  278  KKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfngnglsl  457
            K +IT DP N+T +W G+++C    KY+GF+C  P   +   +     +   F     +L
Sbjct  8    KNTITSDPFNITSTWIGSDIC----KYKGFYCGHPPD-NLTAIALASIDFNGFELAAPTL  62

Query  458  nsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEATNLTY  637
            + F++   DL + H NSN F+G     + + P L+ELD+SNNK +G FP A+L   +L++
Sbjct  63   DGFIDQLPDLSLFHANSNKFSGTISPRLAQLPYLYELDISNNKFSGTFPVAILGKNDLSF  122

Query  638  LDLRFNMLTGPVHPQV  685
            LD+RFN  TG V PQV
Sbjct  123  LDIRFNFFTGSVPPQV  138



>gb|KDP47120.1| hypothetical protein JCGZ_22116 [Jatropha curcas]
Length=455

 Score = 99.0 bits (245),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 66/149 (44%), Positives = 85/149 (57%), Gaps = 4/149 (3%)
 Frame = +2

Query  245  IRKSIKAIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfn  424
            I +  K+I+ FK  ITYDP  VT+SW  N+   N   Y+GF C          V    FN
Sbjct  83   IVRDFKSIQQFKNQITYDPLEVTKSW--NQDNFNICTYKGFTCAHRPDSGVLSVAATDFN  140

Query  425  gynfngnglslnsFVESFNDLVVIHVNSNNFTGA--PGIPVQKFPTLFELDLSNNKLAGA  598
            GYNFNG  L +  F++   DL + H NSNNFTG     I +Q    L+E D+SNNK  G 
Sbjct  141  GYNFNGPNLEIKDFIDKLKDLTIFHANSNNFTGIVPNDISIQNINFLYEFDISNNKYTGG  200

Query  599  FPTAVLEATNLTYLDLRFNMLTGPVHPQV  685
            FP  +L A NLT+LD+RFN  +GP+  +V
Sbjct  201  FPFPLLSARNLTFLDIRFNQFSGPIPREV  229



>ref|XP_009617390.1| PREDICTED: uncharacterized protein At4g06744-like [Nicotiana 
tomentosiformis]
Length=420

 Score = 98.6 bits (244),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 54/140 (39%), Positives = 80/140 (57%), Gaps = 5/140 (4%)
 Frame = +2

Query  266  IRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfngn  445
            I+ FK  IT DP  VT+SW G  +C     Y GF+C  P   +K  +     +   F  +
Sbjct  70   IQKFKNIITSDPLGVTKSWVGPNIC----NYTGFYCETPPD-NKSAIAVASIDFNGFQLS  124

Query  446  glslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEAT  625
              +L+ F++   D+ + H NSNNF+G     +   P L+ELD+SNN+ +G FP A+L   
Sbjct  125  APNLDGFLDQLPDIALFHANSNNFSGTLSANIANLPYLYELDISNNQFSGPFPPAILGMN  184

Query  626  NLTYLDLRFNMLTGPVHPQV  685
            +L++LD+RFN  TG V PQ+
Sbjct  185  SLSFLDIRFNSFTGSVPPQL  204



>dbj|BAJ91151.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ96549.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=541

 Score = 99.8 bits (247),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 58/144 (40%), Positives = 82/144 (57%), Gaps = 6/144 (4%)
 Frame = +2

Query  266  IRTFKKSITYDPQNVTQSWEGNELCINKK---KYQGFFCYVPRGGDKKRVggiyfngynf  436
            I+ FK++IT DP NVT +W G ++C + K    Y+GF+C  P     K +     +   F
Sbjct  164  IQAFKRTITSDPLNVTATWVGTKICDSAKGGGAYKGFYCDTPPDDANKTLTVASIDFNGF  223

Query  437  ngnglslnsFVESFNDLVVIHVNSNNFTGA-PGIPVQKFPTLFELDLSNNKLAGAFPTAV  613
            +    +L  F+++F DL + H NSNNF+G  P +   ++   +ELDLSNN  +GAFP AV
Sbjct  224  HLCAPTLAGFIDAFPDLALFHANSNNFSGDLPDLTSLRY--FYELDLSNNGFSGAFPAAV  281

Query  614  LEATNLTYLDLRFNMLTGPVHPQV  685
                 L +LDLRFN   G V P V
Sbjct  282  PPLGRLAFLDLRFNGFAGEVPPSV  305



>ref|XP_010263447.1| PREDICTED: uncharacterized protein At4g06744-like [Nelumbo nucifera]
Length=467

 Score = 99.0 bits (245),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 55/140 (39%), Positives = 73/140 (52%), Gaps = 5/140 (4%)
 Frame = +2

Query  266  IRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfngn  445
            I  FKKSIT DP  +T +W G  +C     Y GF+C  P   +  R            G 
Sbjct  101  IHRFKKSITSDPHGITNTWVGPRIC----NYTGFYCDHPPDDNSLRALAGIDFNGYQLGA  156

Query  446  glslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEAT  625
                + FV+   D+ + H N+NNF GA    + +   L+ELDLSNNK +G FP AVL   
Sbjct  157  PTLDD-FVDQLPDIAIFHANTNNFAGAISPKIAQLRYLYELDLSNNKFSGQFPMAVLGMD  215

Query  626  NLTYLDLRFNMLTGPVHPQV  685
             L++LD+RFN  TG V  Q+
Sbjct  216  GLSFLDIRFNSFTGTVPAQI  235



>ref|XP_009141276.1| PREDICTED: uncharacterized protein At4g06744 isoform X2 [Brassica 
rapa]
Length=343

 Score = 97.4 bits (241),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 57/141 (40%), Positives = 77/141 (55%), Gaps = 5/141 (4%)
 Frame = +2

Query  263  AIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfng  442
             I+ FK  IT DP  VTQ+W G+E+C     Y+GF C  P   +K  V     +   F  
Sbjct  41   VIQGFKSLITLDPFKVTQTWIGSEIC----SYRGFHCDNPPD-NKTAVTVASIDFNGFQL  95

Query  443  nglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEA  622
               S+  F++   DL + H NSNNF G     +     L+ELD+SNNK  G FPTAV+  
Sbjct  96   FAPSIEGFIDQLPDLALFHANSNNFGGTVPSKIVNLKYLYELDISNNKFTGQFPTAVVGM  155

Query  623  TNLTYLDLRFNMLTGPVHPQV  685
              LT+LD+RFN  +G + PQ+
Sbjct  156  PGLTFLDIRFNSFSGSIPPQI  176



>gb|EMT08852.1| hypothetical protein F775_11606 [Aegilops tauschii]
Length=518

 Score = 99.4 bits (246),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 57/144 (40%), Positives = 82/144 (57%), Gaps = 6/144 (4%)
 Frame = +2

Query  266  IRTFKKSITYDPQNVTQSWEGNELCINKK---KYQGFFCYVPRGGDKKRVggiyfngynf  436
            I+ FK++IT DP NVT +W G ++C + K    Y+GF+C  P     K +     +   F
Sbjct  147  IQAFKRTITSDPLNVTATWVGTKICDSSKGGSAYKGFYCDTPPDDANKTLTVASIDFNGF  206

Query  437  ngnglslnsFVESFNDLVVIHVNSNNFTGA-PGIPVQKFPTLFELDLSNNKLAGAFPTAV  613
            +    +L  F+++F DL + H NSNNF+G  P +   ++   +ELDLSNN  +G+FP AV
Sbjct  207  HLCAPTLAGFIDAFPDLALFHANSNNFSGVLPELTSLRY--FYELDLSNNAFSGSFPAAV  264

Query  614  LEATNLTYLDLRFNMLTGPVHPQV  685
                 L +LDLRFN   G V P V
Sbjct  265  PPLGRLAFLDLRFNGFAGEVPPSV  288



>ref|XP_008342943.1| PREDICTED: uncharacterized protein At4g06744-like [Malus domestica]
Length=424

 Score = 98.2 bits (243),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 53/140 (38%), Positives = 80/140 (57%), Gaps = 5/140 (4%)
 Frame = +2

Query  266  IRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfngn  445
            I TF+  I  DP  +TQ+W G+++C     Y+GF+C  P   +K        +   F  +
Sbjct  79   IMTFRNMIISDPLGITQTWVGSDIC----NYKGFYCDNPPD-NKSATTLASIDFNGFQLS  133

Query  446  glslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEAT  625
              +L+ F++   DL + H NSNNF+G     +     L+ELD+SNN  +G FPTAVL   
Sbjct  134  APTLDGFIDQLPDLALFHANSNNFSGIVSPKIANLQYLYELDISNNNFSGPFPTAVLTMN  193

Query  626  NLTYLDLRFNMLTGPVHPQV  685
            +L++LD+R+N  TG V PQ+
Sbjct  194  SLSFLDIRYNSFTGSVPPQI  213



>ref|XP_011467740.1| PREDICTED: uncharacterized protein At4g06744 [Fragaria vesca 
subsp. vesca]
Length=504

 Score = 99.0 bits (245),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 64/150 (43%), Positives = 82/150 (55%), Gaps = 10/150 (7%)
 Frame = +2

Query  254  SIKAIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngyn  433
            +++ I+ F+K I  DP N+T +W G+  C    K+ GF C V    ++  V G+ FNG  
Sbjct  135  ALRVIKRFQKLIGVDPDNITGTWNGDNPC----KFTGFICGVVPVYNQNAVAGVNFNGRK  190

Query  434  fngnglslns------FVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAG  595
              G      +      F++   DLV  H NSNNFTG   I   + P  +ELDLSNNKL G
Sbjct  191  LAGKWGGKETKLPLDGFLDQLPDLVFFHANSNNFTGQVPIGTSRLPYFYELDLSNNKLDG  250

Query  596  AFPTAVLEATNLTYLDLRFNMLTGPVHPQV  685
             FP  VL A NLT+LDLRFN   G V  QV
Sbjct  251  GFPYEVLSAPNLTFLDLRFNNYQGSVPSQV  280



>ref|XP_009141268.1| PREDICTED: uncharacterized protein At4g06744 isoform X1 [Brassica 
rapa]
Length=391

 Score = 97.4 bits (241),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 57/141 (40%), Positives = 77/141 (55%), Gaps = 5/141 (4%)
 Frame = +2

Query  263  AIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfng  442
             I+ FK  IT DP  VTQ+W G+E+C     Y+GF C  P   +K  V     +   F  
Sbjct  41   VIQGFKSLITLDPFKVTQTWIGSEIC----SYRGFHCDNPPD-NKTAVTVASIDFNGFQL  95

Query  443  nglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEA  622
               S+  F++   DL + H NSNNF G     +     L+ELD+SNNK  G FPTAV+  
Sbjct  96   FAPSIEGFIDQLPDLALFHANSNNFGGTVPSKIVNLKYLYELDISNNKFTGQFPTAVVGM  155

Query  623  TNLTYLDLRFNMLTGPVHPQV  685
              LT+LD+RFN  +G + PQ+
Sbjct  156  PGLTFLDIRFNSFSGSIPPQI  176



>ref|XP_008236576.1| PREDICTED: uncharacterized protein At4g06744-like [Prunus mume]
Length=481

 Score = 98.2 bits (243),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 63/149 (42%), Positives = 82/149 (55%), Gaps = 6/149 (4%)
 Frame = +2

Query  245  IRKSIKAIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfn  424
            I+ +    + F+  I  DP+N  +SW G ++C    KY+G  C +     ++ V G+  N
Sbjct  115  IKLAYYVFKNFRPLIKDDPKNYKKSWRGRDVC----KYKGVVCAIHPDYKQRAVAGLDIN  170

Query  425  gynfngnglsl--nsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGA  598
            G  F G    L  + F++   DL   H NSNNFTG     V K    +ELDLSNNKL G 
Sbjct  171  GALFGGYNAKLPLDGFLDKLEDLAFFHANSNNFTGFVPKDVYKLKFFYELDLSNNKLIGG  230

Query  599  FPTAVLEATNLTYLDLRFNMLTGPVHPQV  685
            FP  VL ATNLT+LDLRFN   G V P+V
Sbjct  231  FPNEVLAATNLTFLDLRFNSFAGSVTPEV  259



>ref|XP_011004883.1| PREDICTED: uncharacterized protein At4g06744-like, partial [Populus 
euphratica]
Length=394

 Score = 97.1 bits (240),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 63/149 (42%), Positives = 83/149 (56%), Gaps = 6/149 (4%)
 Frame = +2

Query  245  IRKSIKAIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfn  424
            I +    I+ FKK IT DP  + + W+G ++C     Y GF C          +    FN
Sbjct  24   IERDFHTIQRFKKLITIDPLGIKKKWKGTDVC----NYPGFKCATVPDQKVTALAAADFN  79

Query  425  gynfngnglslnsFVESFNDLVVIHVNSNNFTGA--PGIPVQKFPTLFELDLSNNKLAGA  598
            GY F G  L L  F++   DL + H NSNNFTG     I   +   LFE+DLSNNK +G 
Sbjct  80   GYFFGGRDLQLTGFLDQLPDLSIFHANSNNFTGPVPKSIGTSRVRYLFEVDLSNNKYSGG  139

Query  599  FPTAVLEATNLTYLDLRFNMLTGPVHPQV  685
            FP +VL+ATNLT+LD+RFN  +G V  +V
Sbjct  140  FPMSVLQATNLTFLDIRFNSFSGSVPAEV  168



>ref|XP_010523006.1| PREDICTED: uncharacterized protein At4g06744-like [Tarenaya hassleriana]
Length=423

 Score = 97.4 bits (241),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 55/141 (39%), Positives = 81/141 (57%), Gaps = 5/141 (4%)
 Frame = +2

Query  263  AIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfng  442
            AI+ FK  I+ DP NVT +W G+++C     Y+GFFC  P   +   +     +   F  
Sbjct  70   AIQKFKSLISSDPFNVTGTWVGSDIC----SYRGFFCDNPPD-NGSAIAVASIDFNGFQL  124

Query  443  nglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEA  622
            +  S++ F++   DL + H N+NNF G     + +   L+E D+SNN+ +G FPTAVL  
Sbjct  125  SAPSIDGFLDQLPDLAIFHANTNNFGGVVPPKIAELKYLYEFDISNNRFSGPFPTAVLGM  184

Query  623  TNLTYLDLRFNMLTGPVHPQV  685
              LT+LD+RFN  TG V PQ+
Sbjct  185  PGLTFLDIRFNRFTGSVPPQI  205



>ref|XP_011069732.1| PREDICTED: uncharacterized protein At4g06744-like [Sesamum indicum]
Length=424

 Score = 97.1 bits (240),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 56/140 (40%), Positives = 81/140 (58%), Gaps = 5/140 (4%)
 Frame = +2

Query  266  IRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfngn  445
            I+ FK  IT DP N+T SW G ++C     Y+GF+C  P   +K  +     +   F  +
Sbjct  79   IQKFKNLITSDPLNITGSWVGADIC----NYRGFYCESPPD-NKSAIALASIDFNGFQLS  133

Query  446  glslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEAT  625
              SLN F++   D+ + H NSNNF GA    + K   L+ELD+SNN  +G FPTA+L   
Sbjct  134  APSLNGFLDQLPDIALFHANSNNFAGAISPNIAKLQYLYELDISNNNFSGPFPTALLGMD  193

Query  626  NLTYLDLRFNMLTGPVHPQV  685
            +L++LD+RFN  +G V  Q+
Sbjct  194  SLSFLDVRFNSFSGAVPQQL  213



>emb|CDY29128.1| BnaA09g53810D [Brassica napus]
Length=329

 Score = 96.3 bits (238),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 55/141 (39%), Positives = 77/141 (55%), Gaps = 5/141 (4%)
 Frame = +2

Query  263  AIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfng  442
             I+ FK  IT DP  VTQ+W G+E+C     Y+GF C  P   +K  +     +   F  
Sbjct  41   VIQGFKSLITLDPFKVTQTWIGSEIC----SYRGFHCDNP-PDNKTAITVASIDFNGFQL  95

Query  443  nglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEA  622
               S+  F++   DL + H NSNNF G     +     L+ELD+SNNK  G FPTAV+  
Sbjct  96   FAPSIEGFIDQLPDLALFHANSNNFGGTVPSKIVNLKYLYELDISNNKFTGQFPTAVVGM  155

Query  623  TNLTYLDLRFNMLTGPVHPQV  685
              L++LD+RFN  +G + PQ+
Sbjct  156  PGLSFLDIRFNSFSGSIPPQI  176



>emb|CDX75185.1| BnaC09g24970D [Brassica napus]
Length=329

 Score = 96.3 bits (238),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 56/141 (40%), Positives = 77/141 (55%), Gaps = 5/141 (4%)
 Frame = +2

Query  263  AIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfng  442
             I+ FK  IT DP  VTQ+W G+++C     Y+GF C  P   +K  V     +   F  
Sbjct  41   VIQGFKSLITLDPFKVTQTWIGSDIC----SYRGFHCDNP-PDNKTAVTVASIDFNGFQL  95

Query  443  nglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEA  622
               S+  F++   DL + H NSNNF G     +     L+ELD+SNNK  G FPTAV+  
Sbjct  96   FAPSIEGFIDQLPDLALFHANSNNFGGTVPSNIVNLKYLYELDISNNKFTGQFPTAVVGM  155

Query  623  TNLTYLDLRFNMLTGPVHPQV  685
              LT+LD+RFN  +G + PQ+
Sbjct  156  PGLTFLDIRFNSFSGSIPPQI  176



>ref|XP_009605357.1| PREDICTED: uncharacterized protein At4g06744-like [Nicotiana 
tomentosiformis]
Length=382

 Score = 96.7 bits (239),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 54/140 (39%), Positives = 77/140 (55%), Gaps = 5/140 (4%)
 Frame = +2

Query  266  IRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfngn  445
            I+ FK  IT DP  VT+SW G  +C     Y GF+C  P   +K  +     +   F   
Sbjct  39   IQKFKNIITSDPLGVTKSWVGPNIC----NYTGFYCESPPD-NKSAIALASIDFNGFQLT  93

Query  446  glslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEAT  625
              +L  F++   D+ + H NSNNF+G     +   P L+ELD+SNN+  G FP+A+L   
Sbjct  94   APTLVGFLDQLPDIAIFHANSNNFSGTLSPKIANLPYLYELDISNNQFFGPFPSAILGMN  153

Query  626  NLTYLDLRFNMLTGPVHPQV  685
            +L+ LD+RFN  TG V PQ+
Sbjct  154  SLSILDIRFNSFTGSVPPQL  173



>gb|KDP47121.1| hypothetical protein JCGZ_22117 [Jatropha curcas]
Length=497

 Score = 97.4 bits (241),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 65/151 (43%), Positives = 86/151 (57%), Gaps = 7/151 (5%)
 Frame = +2

Query  233  LDPVIRKSIKAIRTFKKSITYDPQNVTQSWE--GNELCINKKKYQGFFCYVPRGGDKKRV  406
            L P + +   AI+ F K IT DPQ + +SW+     +C   K Y+GFFC          V
Sbjct  118  LTPNLIRDYNAIQQFSKLITDDPQGIKKSWDPKNKNVC---KGYKGFFCDTRPDTSVFSV  174

Query  407  ggiyfngynfngnglslnsFVESFNDLVVIHVNSNNFTGA--PGIPVQKFPTLFELDLSN  580
                FNGYNFNG  L +  F+    DL + H NSNNFTG    G+ +     L+E D+SN
Sbjct  175  AAADFNGYNFNGPKLKIEDFLGELKDLAIFHANSNNFTGKVPKGVSIDNINFLYEFDISN  234

Query  581  NKLAGAFPTAVLEATNLTYLDLRFNMLTGPV  673
            NK +  FP+ +L+ATNLT+LD+RFN   GPV
Sbjct  235  NKYSDEFPSQILKATNLTFLDIRFNNFFGPV  265



>ref|NP_001053250.1| Os04g0505200 [Oryza sativa Japonica Group]
 dbj|BAF15164.1| Os04g0505200 [Oryza sativa Japonica Group]
Length=306

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 58/145 (40%), Positives = 85/145 (59%), Gaps = 9/145 (6%)
 Frame = +2

Query  245  IRKSIKAIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfn  424
            + K+ K I+ F++++T DPQN+  SW G +LC     Y+GFFC  P     + +     +
Sbjct  84   LYKAYKVIQKFRRTVTCDPQNIISSWSGADLC---STYKGFFCERPPNITDRTI--ASVD  138

Query  425  gynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIP-VQKFPTLFELDLSNNKLAGA-  598
               +N    SL  FV++  DL + H NSNNF GA  +P + +    +ELDLSNNKL+ A 
Sbjct  139  FNGYNLQASSLKEFVDALPDLALFHANSNNFGGA--VPDLSRLQYFYELDLSNNKLSPAT  196

Query  599  FPTAVLEATNLTYLDLRFNMLTGPV  673
            FPT VL+  N T++D+RFN   G +
Sbjct  197  FPTDVLKLKNATFVDIRFNSFYGEL  221



>ref|XP_002514194.1| serine-threonine protein kinase, plant-type, putative [Ricinus 
communis]
 gb|EEF48148.1| serine-threonine protein kinase, plant-type, putative [Ricinus 
communis]
Length=414

 Score = 95.9 bits (237),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 51/146 (35%), Positives = 75/146 (51%), Gaps = 7/146 (5%)
 Frame = +2

Query  245  IRKSIKAIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfn  424
            +  +  A++ +K +IT DP  +  +W G  +C     Y+G FC VPRG D+         
Sbjct  61   LNNAYTALQAWKSAITDDPSKILDTWVGTNVC----SYKGIFCAVPRGDDRYAASTGPVV  116

Query  425  gynfngnglslnsFVESFN---DLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAG  595
                  +     + V+  +   D+ + H+NSN F+G      +   +L ELDLSNN  +G
Sbjct  117  SGIDLNHANLQGNLVKELSLLTDMSLFHLNSNRFSGTIPDTFKDLISLQELDLSNNHFSG  176

Query  596  AFPTAVLEATNLTYLDLRFNMLTGPV  673
            +FPT  L   NL YLDLRFN  +GPV
Sbjct  177  SFPTVTLYIPNLVYLDLRFNSFSGPV  202



>ref|XP_010928365.1| PREDICTED: uncharacterized protein At4g06744-like [Elaeis guineensis]
Length=457

 Score = 96.3 bits (238),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 57/141 (40%), Positives = 72/141 (51%), Gaps = 8/141 (6%)
 Frame = +2

Query  266  IRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfngn  445
            I+ FKK+IT DP NVTQ+W G   C     YQGF+C  P                     
Sbjct  94   IQLFKKTITCDPNNVTQTWVGYRPC----TYQGFYCEAPPDSPDTPTIASIDFNGFHLCA  149

Query  446  glslnsFVESFNDLVVIHVNSNNFTGAPGIP-VQKFPTLFELDLSNNKLAGAFPTAVLEA  622
                  F++   DL + H NSNNFTG   IP +      +ELD+SNN ++G FP  VL  
Sbjct  150  PTIAG-FIDKLPDLALFHANSNNFTGT--IPDLTGLQYFYELDVSNNNMSGPFPNDVLPL  206

Query  623  TNLTYLDLRFNMLTGPVHPQV  685
             NLT+LDLRFN+  G V P +
Sbjct  207  ANLTFLDLRFNLFAGAVPPSI  227



>ref|XP_010927582.1| PREDICTED: uncharacterized protein At4g06744-like [Elaeis guineensis]
Length=469

 Score = 96.3 bits (238),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 58/147 (39%), Positives = 85/147 (58%), Gaps = 8/147 (5%)
 Frame = +2

Query  248  RKSIKAIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfng  427
            R++ K I+ FKK+IT DP  ++++W G ++C    KY+GF+C  P    K        + 
Sbjct  95   RQAYKVIQRFKKTITCDPMRISRTWNGAKVC----KYKGFYCETP-PNRKNTPTIASVDF  149

Query  428  ynfngnglslnsFVESFNDLVVIHVNSNNFTGA-PGIPVQKFPTLFELDLSNNKLAGAFP  604
              F+    ++++F+    D+ + H NSNNF+G  P +   +F  L+ELD+SNN   G FP
Sbjct  150  NIFHLCAPTVDNFINKLPDVALFHANSNNFSGTVPDLTGLQF--LYELDVSNNNQTGFFP  207

Query  605  TAVLEATNLTYLDLRFNMLTGPVHPQV  685
            T VL   NLT+LDLRFN   G V P V
Sbjct  208  TNVLPLLNLTFLDLRFNHFLGTVPPDV  234



>ref|XP_007017157.1| Leucine-rich repeat family protein [Theobroma cacao]
 gb|EOY14382.1| Leucine-rich repeat family protein [Theobroma cacao]
Length=441

 Score = 95.9 bits (237),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 52/140 (37%), Positives = 80/140 (57%), Gaps = 5/140 (4%)
 Frame = +2

Query  266  IRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfngn  445
            I+ FK  IT DP  +T++W G+++C     Y+GF+C  P   +K  +     +   F   
Sbjct  100  IQKFKSIITSDPLGITETWLGSDVC----SYKGFYCDNPPD-NKSAIAVASIDFNGFQLA  154

Query  446  glslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEAT  625
              +L+ F++   D  + H NSNNF G     + K   L+ELD+SNN+ +G FP AV++ +
Sbjct  155  APTLDGFLDKLPDTALFHANSNNFGGTLSPNIAKLRYLYELDISNNQFSGPFPAAVVDMS  214

Query  626  NLTYLDLRFNMLTGPVHPQV  685
             LT+LD+RFN  TG V  Q+
Sbjct  215  GLTFLDIRFNFFTGSVPAQI  234



>ref|XP_010488556.1| PREDICTED: leucine-rich repeat extensin-like protein 4, partial 
[Camelina sativa]
Length=444

 Score = 95.9 bits (237),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 55/146 (38%), Positives = 77/146 (53%), Gaps = 6/146 (4%)
 Frame = +2

Query  236  DPVIRKSIKAIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggi  415
            +P +R +  A++ +K++I  DP N+T  W G+ +C     Y G FC   R  D +R+  +
Sbjct  73   NPRLRSAYIALQAWKQAILSDPNNITLDWIGSNVC----SYTGVFC--SRALDNRRIRTV  126

Query  416  yfngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAG  595
                 N       L   +    DL + HVNSN F G      ++   LFELDLSNN+ AG
Sbjct  127  AGIDLNHADIAGYLPEELGLLTDLALFHVNSNRFCGTVPRKFKQLKLLFELDLSNNRFAG  186

Query  596  AFPTAVLEATNLTYLDLRFNMLTGPV  673
             FPT VL+  +L +LDLRFN   G V
Sbjct  187  KFPTVVLQLPSLKFLDLRFNEFEGTV  212



>ref|XP_008796513.1| PREDICTED: uncharacterized protein At4g06744-like, partial [Phoenix 
dactylifera]
Length=402

 Score = 95.1 bits (235),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 57/152 (38%), Positives = 87/152 (57%), Gaps = 7/152 (5%)
 Frame = +2

Query  242  VIRKSIKAIRTFKKSITYDPQNVTQSWEGNELC--INKKKYQGFFCYVPRGGDKKRVggi  415
            ++ ++   I+ F+K+IT DP+ +++SW G ++C    +  Y+GFFC +P      R    
Sbjct  19   LLYRAYFVIQRFRKTITDDPKGISKSWRGYDICHKYTQDTYKGFFCGIPPTRKTMR-NVA  77

Query  416  yfngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIP-VQKFPTLFELDLSNNKLA  592
              +   +N    +L  F++   DL + H NSNNF+G   +P + K   L+ELD SNNKL 
Sbjct  78   SIDFNGYNLGAETLQGFIDRMPDLAIFHANSNNFSGT--VPDLSKLRFLYELDFSNNKLT  135

Query  593  GAFPTAVLE-ATNLTYLDLRFNMLTGPVHPQV  685
            G+FP  VL    N+++LDLRFN   G V P V
Sbjct  136  GSFPINVLPLLANISFLDLRFNQFFGTVPPSV  167



>ref|XP_006653579.1| PREDICTED: uncharacterized protein At4g06744-like [Oryza brachyantha]
Length=456

 Score = 95.9 bits (237),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 57/145 (39%), Positives = 84/145 (58%), Gaps = 9/145 (6%)
 Frame = +2

Query  245  IRKSIKAIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfn  424
            + ++ K I+ F++++T DPQN+ QSW G +LC     Y+GFFC  P     + +     +
Sbjct  88   LYRAYKVIQKFRRTVTCDPQNIIQSWSGTDLC---GSYKGFFCERPPNVSDRTI--ASVD  142

Query  425  gynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIP-VQKFPTLFELDLSNNKLA-GA  598
               +N    S+  FV++  DL + H NSNNF GA  +P +      +ELDLSNNKLA   
Sbjct  143  FNGYNLQSSSIKDFVDALPDLALFHANSNNFGGA--VPDLSGLQYFYELDLSNNKLAPNP  200

Query  599  FPTAVLEATNLTYLDLRFNMLTGPV  673
            FPT VL+  N T++D+RFN   G +
Sbjct  201  FPTDVLKLRNATFVDIRFNSFYGEL  225



>gb|KCW63737.1| hypothetical protein EUGRSUZ_G01385 [Eucalyptus grandis]
Length=324

 Score = 94.4 bits (233),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 55/151 (36%), Positives = 79/151 (52%), Gaps = 6/151 (4%)
 Frame = +2

Query  233  LDPVIRKSIKAIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVgg  412
            LD  +      I+ FK ++T DP  +T SW G  +C     Y GF+C  P   +      
Sbjct  50   LDQRLAAVYPVIQQFKNTVTADPSGITNSWVGPGIC----NYTGFYCDNPPD-NLTATAL  104

Query  413  iyfngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLA  592
               +   ++    +L  F++   DL + H NSNNF+G     + + P  +ELD+SNN  +
Sbjct  105  AGIDFNGYHLGAPTLEGFLDQLPDLAIFHANSNNFSGVIPQKIAQLPYFYELDVSNNNFS  164

Query  593  GAFPTAVLEATNLTYLDLRFNMLTGPVHPQV  685
            GAFP AV    NL++LD+RFN  TG V PQV
Sbjct  165  GAFPAAVF-GVNLSFLDIRFNSFTGSVPPQV  194



>ref|XP_010066095.1| PREDICTED: uncharacterized protein At4g06744-like [Eucalyptus 
grandis]
 gb|KCW63891.1| hypothetical protein EUGRSUZ_G01566 [Eucalyptus grandis]
Length=382

 Score = 94.7 bits (234),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 56/151 (37%), Positives = 79/151 (52%), Gaps = 6/151 (4%)
 Frame = +2

Query  233  LDPVIRKSIKAIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVgg  412
            LD  +      I+ FK +IT DP  +T SW G  +C     Y GF+C  P   +      
Sbjct  14   LDQRLAAVYPVIQQFKNTITADPSGITNSWVGPGIC----NYTGFYCDNPPD-NLTATAL  68

Query  413  iyfngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLA  592
               +   ++    +L  F++   DL + H NSNNF+G     + + P  +ELD+SNN  +
Sbjct  69   AGIDFNGYHLGAPTLEGFLDQLPDLAIFHANSNNFSGVIPQKIAQLPYFYELDVSNNNFS  128

Query  593  GAFPTAVLEATNLTYLDLRFNMLTGPVHPQV  685
            GAFP AV    NL++LD+RFN  TG V PQV
Sbjct  129  GAFPAAVF-GVNLSFLDIRFNSFTGSVPPQV  158



>ref|XP_003580786.1| PREDICTED: uncharacterized protein At4g06744 [Brachypodium distachyon]
Length=443

 Score = 95.5 bits (236),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 55/140 (39%), Positives = 79/140 (56%), Gaps = 6/140 (4%)
 Frame = +2

Query  266  IRTFKKSITYDPQNVTQSWEGNELCI---NKKKYQGFFCYVPRGGDKKRVggiyfngynf  436
            I+TFK++IT DP  VT +W G ++C    N   Y+GFFC  P             +   F
Sbjct  78   IQTFKRTITSDPLGVTSTWVGTKICDSADNGTAYKGFFCDHPPDSPPGTRTVASIDFNGF  137

Query  437  ngnglslnsFVESFNDLVVIHVNSNNFTGAPGIP-VQKFPTLFELDLSNNKLAGAFPTAV  613
            +    +L  F+++F DL + H NSN+F+G   +P +   P  +ELDLSNN  +G+FP  V
Sbjct  138  HLRAPTLAGFIDAFPDLALFHANSNSFSG--NVPDLTGLPYFYELDLSNNAFSGSFPDTV  195

Query  614  LEATNLTYLDLRFNMLTGPV  673
            +   NL +LDLRFN  +G V
Sbjct  196  VPLGNLLFLDLRFNGFSGSV  215



>ref|XP_002885307.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61566.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=494

 Score = 95.9 bits (237),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 63/150 (42%), Positives = 90/150 (60%), Gaps = 8/150 (5%)
 Frame = +2

Query  245  IRKSIKAIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfn  424
            I+     I+ F+  I  DP+ + ++W G ++C  + KY G  C    G +   +  I FN
Sbjct  125  IKNVYSVIKNFQTLIENDPKKILRTWVGTDICA-QDKYIGLECAKFPGTNDLALASIQFN  183

Query  425  gynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTL---FELDLSNNKLAG  595
             +N  G  L L++F+    ++ + H NSN+F G+    V KF  L   FELDLSNNKL+G
Sbjct  184  NFNLGGKKLRLDNFLNKLEEVTIFHANSNSFVGS----VPKFSNLKYLFELDLSNNKLSG  239

Query  596  AFPTAVLEATNLTYLDLRFNMLTGPVHPQV  685
             FP++VL+ATNLT+LDLRFN  +G V PQV
Sbjct  240  EFPSSVLKATNLTFLDLRFNSFSGSVPPQV  269



>gb|EEE61292.1| hypothetical protein OsJ_15379 [Oryza sativa Japonica Group]
Length=432

 Score = 95.1 bits (235),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 58/145 (40%), Positives = 85/145 (59%), Gaps = 9/145 (6%)
 Frame = +2

Query  245  IRKSIKAIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfn  424
            + K+ K I+ F++++T DPQN+  SW G +LC     Y+GFFC  P     + +     +
Sbjct  84   LYKAYKVIQKFRRTVTCDPQNIISSWSGADLC---STYKGFFCERPPNITDRTI--ASVD  138

Query  425  gynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIP-VQKFPTLFELDLSNNKLAGA-  598
               +N    SL  FV++  DL + H NSNNF GA  +P + +    +ELDLSNNKL+ A 
Sbjct  139  FNGYNLQASSLKEFVDALPDLALFHANSNNFGGA--VPDLSRLQYFYELDLSNNKLSPAT  196

Query  599  FPTAVLEATNLTYLDLRFNMLTGPV  673
            FPT VL+  N T++D+RFN   G +
Sbjct  197  FPTDVLKLKNATFVDIRFNSFYGEL  221



>ref|XP_009413340.1| PREDICTED: uncharacterized protein At4g06744-like [Musa acuminata 
subsp. malaccensis]
Length=464

 Score = 95.5 bits (236),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 56/142 (39%), Positives = 73/142 (51%), Gaps = 5/142 (4%)
 Frame = +2

Query  266  IRTFKKSITYDPQNVTQSWEGNELCINKKK-YQGFFCYVPRGGDKKRVggiyfngynfng  442
            I+ FK++IT DP N T +W G +LC N    YQGF+C  P      R            G
Sbjct  90   IQRFKRTITCDPLNKTDTWSGFKLCNNDGDGYQGFYCETPPNRKNMRTIASVDFNGFKLG  149

Query  443  nglslnsFVESFNDLVVIHVNSNNFTGAPGIP-VQKFPTLFELDLSNNKLAGAFPTAVLE  619
                   FV+   DL + H NSNN  G   +P ++  P  +ELDLSNN  +G FP  VL 
Sbjct  150  APTVSR-FVDQLPDLALFHANSNNLGGT--VPYIRTLPFFYELDLSNNDFSGGFPVNVLP  206

Query  620  ATNLTYLDLRFNMLTGPVHPQV  685
              NL++LDLR+N    P+ P V
Sbjct  207  LVNLSFLDLRYNGFASPLPPSV  228



>ref|XP_009762067.1| PREDICTED: uncharacterized protein At4g06744-like [Nicotiana 
sylvestris]
Length=462

 Score = 95.5 bits (236),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 61/147 (41%), Positives = 82/147 (56%), Gaps = 3/147 (2%)
 Frame = +2

Query  245  IRKSIKAIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfn  424
            I  +   I+ FK  I YDP  +  +W G ++C    KY+GF C +      + +  + FN
Sbjct  90   IEIAYNVIQKFKAKIKYDPLGIKNTWVGYDVC---NKYKGFHCAIVPDYKVQALAAVDFN  146

Query  425  gynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFP  604
             +NF G  L+LN F++   D+ + H NSN FTG     +     L+ELDLSNN   G FP
Sbjct  147  QFNFAGPDLTLNGFLDELPDITIFHANSNKFTGTIPKKIANLRYLYELDLSNNNYNGEFP  206

Query  605  TAVLEATNLTYLDLRFNMLTGPVHPQV  685
              VL A NLT+LDLRFN  +G V PQV
Sbjct  207  NDVLGAKNLTFLDLRFNTFSGLVPPQV  233



>emb|CAE02949.1| OSJNBa0014K14.21 [Oryza sativa Japonica Group]
 emb|CAE05560.1| OSJNBb0116K07.13 [Oryza sativa Japonica Group]
 gb|EAY94774.1| hypothetical protein OsI_16554 [Oryza sativa Indica Group]
 dbj|BAG90092.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97019.1| unnamed protein product [Oryza sativa Japonica Group]
Length=454

 Score = 95.1 bits (235),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 58/145 (40%), Positives = 85/145 (59%), Gaps = 9/145 (6%)
 Frame = +2

Query  245  IRKSIKAIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfn  424
            + K+ K I+ F++++T DPQN+  SW G +LC     Y+GFFC  P     + +     +
Sbjct  84   LYKAYKVIQKFRRTVTCDPQNIISSWSGADLC---STYKGFFCERPPNITDRTI--ASVD  138

Query  425  gynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIP-VQKFPTLFELDLSNNKLAGA-  598
               +N    SL  FV++  DL + H NSNNF GA  +P + +    +ELDLSNNKL+ A 
Sbjct  139  FNGYNLQASSLKEFVDALPDLALFHANSNNFGGA--VPDLSRLQYFYELDLSNNKLSPAT  196

Query  599  FPTAVLEATNLTYLDLRFNMLTGPV  673
            FPT VL+  N T++D+RFN   G +
Sbjct  197  FPTDVLKLKNATFVDIRFNSFYGEL  221



>ref|XP_011004900.1| PREDICTED: uncharacterized protein At4g06744-like [Populus euphratica]
Length=406

 Score = 94.7 bits (234),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 59/151 (39%), Positives = 84/151 (56%), Gaps = 11/151 (7%)
 Frame = +2

Query  245  IRKSIKAIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfn  424
            I +    I+ FK++I  DP  +T+ W GN++C     Y GF C    G D+K +     +
Sbjct  37   IERDYYTIQRFKETIK-DPLGITKKWVGNDVC----NYPGFKCAT--GPDQKVIALAAAD  89

Query  425  gynfngn--glslnsFVESFNDLVVIHVNSNNFTGA--PGIPVQKFPTLFELDLSNNKLA  592
               ++       L  F++   DL + H NSNNFTG     I   +   LFE+DLSNNK +
Sbjct  90   FNGYSFGGPDSQLTGFLDQLLDLSIFHANSNNFTGPVPKNIGTSRVRYLFEVDLSNNKYS  149

Query  593  GAFPTAVLEATNLTYLDLRFNMLTGPVHPQV  685
            G FP +VL+ATNLT+LD+RFN  +G V  +V
Sbjct  150  GGFPMSVLQATNLTFLDIRFNSFSGSVPAEV  180



>ref|XP_006300268.1| hypothetical protein CARUB_v100163570mg, partial [Capsella rubella]
 gb|EOA33166.1| hypothetical protein CARUB_v100163570mg, partial [Capsella rubella]
Length=457

 Score = 95.1 bits (235),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 55/146 (38%), Positives = 77/146 (53%), Gaps = 6/146 (4%)
 Frame = +2

Query  236  DPVIRKSIKAIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggi  415
            +P +R +  A++ +K++I  DP N+T +W G+ +C     Y G FC   R  D +R+  +
Sbjct  73   NPRLRSAYIALQAWKQAILSDPNNITLNWIGSNVC----SYTGVFC--SRALDNRRIRTV  126

Query  416  yfngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAG  595
                 N       L   +    DL + HVNSN F G       +   LFELDLSNN+ AG
Sbjct  127  AGIDLNHGDIAGYLPLELGLLTDLALFHVNSNRFCGTVPRTFNQLKLLFELDLSNNRFAG  186

Query  596  AFPTAVLEATNLTYLDLRFNMLTGPV  673
             FPT VL+  +L +LDLRFN   G V
Sbjct  187  KFPTVVLQLPSLKFLDLRFNEFEGTV  212



>ref|XP_008799889.1| PREDICTED: uncharacterized protein At4g06744-like [Phoenix dactylifera]
Length=447

 Score = 95.1 bits (235),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 58/138 (42%), Positives = 74/138 (54%), Gaps = 10/138 (7%)
 Frame = +2

Query  266  IRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfngn  445
            I+ FKK+IT DP NVT +W GN  C     YQGF+C  P                     
Sbjct  85   IQRFKKTITCDPNNVTGTWVGNLPC----TYQGFYCEAPPDSPNTPTIASVDFNGFHLCA  140

Query  446  glslnsFVESFNDLVVIHVNSNNFTGA-PGI-PVQKFPTLFELDLSNNKLAGAFPTAVLE  619
                  F++   DL + H NSNNFTG  P + P+Q F   +ELD+SNN ++G+FP  VL 
Sbjct  141  PTIAG-FIDQLPDLALFHANSNNFTGTIPDLTPLQYF---YELDVSNNNMSGSFPGNVLP  196

Query  620  ATNLTYLDLRFNMLTGPV  673
              NLT+LDLRFN+  G V
Sbjct  197  LANLTFLDLRFNLFAGTV  214



>ref|XP_009345138.1| PREDICTED: uncharacterized protein At4g06744-like [Pyrus x bretschneideri]
Length=426

 Score = 94.7 bits (234),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 51/140 (36%), Positives = 79/140 (56%), Gaps = 5/140 (4%)
 Frame = +2

Query  266  IRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfngn  445
            I +F+ +I  DP  +T +W G+++C     Y+GF+C  P   +K        +   F  +
Sbjct  79   IMSFRNTIISDPLGITNTWVGSDIC----NYKGFYCDNPPD-NKSATTLASIDFNGFQLS  133

Query  446  glslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEAT  625
              +L+ F++   DL + H NSNNF+G     +     L+ELD+SNN  +G FPTAVL   
Sbjct  134  APTLDGFIDQLPDLALFHANSNNFSGIVSPKIANLQYLYELDISNNNFSGPFPTAVLTMN  193

Query  626  NLTYLDLRFNMLTGPVHPQV  685
            +L +LD+R+N  TG V PQ+
Sbjct  194  SLLFLDIRYNSFTGSVPPQI  213



>ref|XP_010664552.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein At4g06744-like 
[Vitis vinifera]
Length=459

 Score = 95.1 bits (235),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 54/141 (38%), Positives = 80/141 (57%), Gaps = 5/141 (4%)
 Frame = +2

Query  263  AIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfng  442
             I+ FK  IT  P  + +SW+G ++C  K    GF+C  P   +K  +     +   F  
Sbjct  107  VIQKFKAIITSVPLGIAKSWQGLDICSCK----GFYCDNPPD-NKTAIALASIDFNGFQL  161

Query  443  nglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEA  622
               +L+ F+    D+ + H NSNNF G     + K P L+ELD+SNNKL+G+FP A+L  
Sbjct  162  GAPTLDGFINQLTDIALFHANSNNFAGTNPPDIAKLPCLYELDISNNKLSGSFPRAILGI  221

Query  623  TNLTYLDLRFNMLTGPVHPQV  685
             +LT+LD+RFN+ TG V  Q+
Sbjct  222  KSLTFLDIRFNLFTGSVPSQL  242



>ref|XP_006848210.1| hypothetical protein AMTR_s00029p00242610 [Amborella trichopoda]
 gb|ERN09791.1| hypothetical protein AMTR_s00029p00242610 [Amborella trichopoda]
Length=258

 Score = 92.8 bits (229),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 54/146 (37%), Positives = 76/146 (52%), Gaps = 6/146 (4%)
 Frame = +2

Query  236  DPVIRKSIKAIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggi  415
            +P +R++  A+ T+K++I  DP NVT +WEG ++C     Y+G FC      D   +  +
Sbjct  63   NPRLRRAYIALHTWKEAIFSDPYNVTSNWEGADVC----SYKGVFC--APALDDPSIDVV  116

Query  416  yfngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAG  595
                 N       L   +    DL ++H+NSN F G       K   LFELDLSNN+  G
Sbjct  117  AGIDLNHADIAGYLPPEIGLLTDLALLHINSNRFCGIVPKSFNKLELLFELDLSNNRFVG  176

Query  596  AFPTAVLEATNLTYLDLRFNMLTGPV  673
             FPT V+    L YLDLR+N   GP+
Sbjct  177  PFPTVVISIPALKYLDLRYNDFEGPL  202



>ref|XP_006653860.1| PREDICTED: uncharacterized protein At4g06744-like [Oryza brachyantha]
Length=448

 Score = 94.7 bits (234),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 60/148 (41%), Positives = 79/148 (53%), Gaps = 10/148 (7%)
 Frame = +2

Query  266  IRTFKKSITYDPQNVTQSWEGNELC---INKKKYQGFFC-YVPRGG---DKKRVggiyfn  424
            I+ FKK+IT DP+ VT SW G  LC        Y+GF+C Y P  G   D   +     +
Sbjct  87   IQAFKKTITCDPRGVTASWVGPNLCDSHFGGMAYKGFYCDYPPVTGAPQDNTTLTVASID  146

Query  425  gynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIP-VQKFPTLFELDLSNNKLAGAF  601
               F     S+  FV++F DL + H NSNN +G   +P +   P  +ELDLSNN  +GAF
Sbjct  147  FNGFGLCAPSIAGFVDAFPDLALFHANSNNLSGE--VPDLTGLPYFYELDLSNNNFSGAF  204

Query  602  PTAVLEATNLTYLDLRFNMLTGPVHPQV  685
            P  V+    L +LDLRFN   G V P +
Sbjct  205  PANVVPLGGLLFLDLRFNRFVGTVPPPI  232



>emb|CAN61023.1| hypothetical protein VITISV_001143 [Vitis vinifera]
Length=479

 Score = 95.1 bits (235),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 54/141 (38%), Positives = 80/141 (57%), Gaps = 5/141 (4%)
 Frame = +2

Query  263  AIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfng  442
             I+ FK  IT  P  + +SW+G ++C  K    GF+C  P   +K  +     +   F  
Sbjct  170  VIQKFKAIITSVPLGIAKSWQGLDICSCK----GFYCDNPPD-NKTAIALASIDFNGFQL  224

Query  443  nglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEA  622
               +L+ F+    D+ + H NSNNF G     + K P L+ELD+SNNKL+G+FP A+L  
Sbjct  225  GAPTLDGFINQLTDIALFHANSNNFAGTNPPDIAKLPXLYELDISNNKLSGSFPXAILGI  284

Query  623  TNLTYLDLRFNMLTGPVHPQV  685
             +LT+LD+RFN+ TG V  Q+
Sbjct  285  KSLTFLDIRFNLFTGSVPSQL  305



>ref|XP_002282474.2| PREDICTED: uncharacterized protein At4g06744 [Vitis vinifera]
 emb|CBI32376.3| unnamed protein product [Vitis vinifera]
Length=445

 Score = 94.4 bits (233),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 54/141 (38%), Positives = 79/141 (56%), Gaps = 5/141 (4%)
 Frame = +2

Query  263  AIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfng  442
             I+ FK SIT DP  +T +W G ++C    KY+GF+C  P   +   +     +   F  
Sbjct  89   VIQKFKASITSDPLGITSTWVGGDIC----KYKGFYCDNPPD-NSTSLALAGIDFNGFQL  143

Query  443  nglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEA  622
               SL+ F+++  DL + H N+N F+G     + K P  +ELDLSNNK +G FP  VL  
Sbjct  144  AAPSLDGFIDALPDLAIFHANTNFFSGNITPKIAKLPYFYELDLSNNKFSGEFPPTVLAI  203

Query  623  TNLTYLDLRFNMLTGPVHPQV  685
              L++LD+R+N  +G V PQV
Sbjct  204  PGLSFLDIRYNSFSGSVPPQV  224



>ref|XP_004304027.1| PREDICTED: uncharacterized protein At4g06744-like [Fragaria vesca 
subsp. vesca]
Length=411

 Score = 94.0 bits (232),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 50/140 (36%), Positives = 80/140 (57%), Gaps = 5/140 (4%)
 Frame = +2

Query  266  IRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfngn  445
            I++FK  IT DP  +T++W G ++C     Y+GF+C +P   +         +   F  +
Sbjct  65   IQSFKNIITSDPLGITKTWVGADIC----NYKGFYCDIPPD-NATATAIASIDFNGFQLS  119

Query  446  glslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEAT  625
              +L+ F++   DL + H NSNNF+G     +     L+ELD+SNN   G FPTAVL   
Sbjct  120  APTLDGFIDQLPDLALFHANSNNFSGILTPKIANLQYLYELDISNNNFFGPFPTAVLTMN  179

Query  626  NLTYLDLRFNMLTGPVHPQV  685
            +L++LD+R+N  TG + P++
Sbjct  180  SLSFLDIRYNSFTGSIPPEI  199



>ref|XP_009622015.1| PREDICTED: uncharacterized protein At4g06744-like [Nicotiana 
tomentosiformis]
Length=466

 Score = 94.7 bits (234),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 60/147 (41%), Positives = 82/147 (56%), Gaps = 3/147 (2%)
 Frame = +2

Query  245  IRKSIKAIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfn  424
            I  +   I+ FK  I YDP  +  +W G ++C    KY+GF C +      + +  + FN
Sbjct  93   IEIAYNVIQKFKAKIKYDPLGIKNTWVGYDVC---NKYKGFHCAIVPNYKVQALAAVDFN  149

Query  425  gynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFP  604
             +NF G  L+LN F++   D+ + H NSN FTG     +     L+ELDLSNN   G FP
Sbjct  150  QFNFAGPDLTLNDFLDELPDITIFHANSNKFTGTIPKKIANLRYLYELDLSNNNYNGEFP  209

Query  605  TAVLEATNLTYLDLRFNMLTGPVHPQV  685
              +L A NLT+LDLRFN  +G V PQV
Sbjct  210  YNILGAKNLTFLDLRFNTFSGLVPPQV  236



>gb|EQB58412.1| RAM signaling pathway protein [Colletotrichum gloeosporioides 
Cg-14]
Length=317

 Score = 93.2 bits (230),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 59/143 (41%), Positives = 87/143 (61%), Gaps = 5/143 (3%)
 Frame = +2

Query  245  IRKSIKAIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfn  424
            + + +  + +FK+ IT DPQ +T++W GN++C    ++ GF C       +K + GI FN
Sbjct  28   LHRDLLLVESFKQKITSDPQGITKNWTGNDVC----EFNGFSCDNNPNTGQKALAGIDFN  83

Query  425  gynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFP  604
            G+ F G  L+L+ F++   DL   H NSN F G     +     L+ELDLS+NKL+G FP
Sbjct  84   GFGFEGQKLTLDGFLDKLTDLTFFHANSNGFVGQIPSDLSALKWLYELDLSSNKLSGPFP  143

Query  605  TAVLEATNLTYLDLRFNMLTGPV  673
             AVL A +LT+LDLRFN  +G +
Sbjct  144  NAVLNA-DLTFLDLRFNEFSGSI  165



>ref|XP_010065987.1| PREDICTED: uncharacterized protein At4g06744-like [Eucalyptus 
grandis]
Length=418

 Score = 94.0 bits (232),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 55/151 (36%), Positives = 79/151 (52%), Gaps = 6/151 (4%)
 Frame = +2

Query  233  LDPVIRKSIKAIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVgg  412
            LD  +      I+ FK ++T DP  +T SW G  +C     Y GF+C  P   +      
Sbjct  50   LDQRLAAVYPVIQQFKNTVTADPSGITNSWVGPGIC----NYTGFYCDNPPD-NLTATAL  104

Query  413  iyfngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLA  592
               +   ++    +L  F++   DL + H NSNNF+G     + + P  +ELD+SNN  +
Sbjct  105  AGIDFNGYHLGAPTLEGFLDQLPDLAIFHANSNNFSGVIPQKIAQLPYFYELDVSNNNFS  164

Query  593  GAFPTAVLEATNLTYLDLRFNMLTGPVHPQV  685
            GAFP AV    NL++LD+RFN  TG V PQV
Sbjct  165  GAFPAAVF-GVNLSFLDIRFNSFTGSVPPQV  194



>emb|CDO97205.1| unnamed protein product [Coffea canephora]
Length=446

 Score = 94.0 bits (232),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 65/140 (46%), Positives = 80/140 (57%), Gaps = 3/140 (2%)
 Frame = +2

Query  266  IRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfngn  445
            I+  K  IT DP  +T+SW G ++C    KYQGF C        K +  + FNGYNF+G 
Sbjct  90   IQRLKAKITCDPLGITKSWVGPDIC---NKYQGFRCATVPDYGVKALADVQFNGYNFSGP  146

Query  446  glslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEAT  625
             L+L  F++   DL + H NSN F G     +     LFELDLSNN   G FP  VL AT
Sbjct  147  DLTLEGFIDELPDLSIFHGNSNKFAGNIPKKLSTIRYLFELDLSNNNFNGQFPYEVLGAT  206

Query  626  NLTYLDLRFNMLTGPVHPQV  685
             LT+LDLRFN  +G V PQV
Sbjct  207  KLTFLDLRFNSFSGAVPPQV  226



>gb|KCW54905.1| hypothetical protein EUGRSUZ_I00883 [Eucalyptus grandis]
Length=469

 Score = 94.0 bits (232),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 68/147 (46%), Positives = 86/147 (59%), Gaps = 11/147 (7%)
 Frame = +2

Query  266  IRTFKKSITY---DPQNVTQSWEGN--ELCINKKKYQGFFCYVPRGGDKKRVggiyfngy  430
            I+ FKK I+    DP+ VT +W G   ++C     Y+GF C    G     + GI FNG+
Sbjct  146  IQDFKKLISKGNCDPKKVTATWNGTGEKIC----NYKGFTCATVPGYKMSGLAGIDFNGF  201

Query  431  n--fngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFP  604
                +   L +++F+E   DLV  H NSNN TG     + K    +ELDLSNNKL GAFP
Sbjct  202  GFCNDKGQLPIDNFIEKLPDLVFFHTNSNNITGRIPSNLSKLKYFYELDLSNNKLRGAFP  261

Query  605  TAVLEATNLTYLDLRFNMLTGPVHPQV  685
              VL ATNLT+LDLRFN LTGP+  QV
Sbjct  262  LTVLGATNLTFLDLRFNNLTGPIPAQV  288



>dbj|BAJ86489.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=452

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 58/144 (40%), Positives = 83/144 (58%), Gaps = 5/144 (3%)
 Frame = +2

Query  245  IRKSIKAIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfn  424
            + ++   I+ FKK+IT DPQ VT++W G ++C +K  Y GFFC  P   + K       +
Sbjct  86   LYRAYLVIQRFKKTITCDPQGVTKTWTGTDIC-SKTCYLGFFCEAPP--NIKERALASVD  142

Query  425  gynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLA-GAF  601
               F     ++  FV++  DL + H NSN+F G   I ++     +ELD+SNNKLA  AF
Sbjct  143  FNGFKLEAPTVEGFVDALPDLALYHANSNDFGGVVPI-LRSLQYFYELDVSNNKLAPCAF  201

Query  602  PTAVLEATNLTYLDLRFNMLTGPV  673
            PT VL  TN T++D+RFN   G V
Sbjct  202  PTDVLGITNATFVDIRFNRFFGEV  225



>gb|AEV40972.1| uncharacterized protein At4g06744 precursor [Oryza punctata]
Length=457

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 60/159 (38%), Positives = 82/159 (52%), Gaps = 10/159 (6%)
 Frame = +2

Query  233  LDPVIRKSIKAIRTFKKSITYDPQNVTQSWEGNELC---INKKKYQGFFCYVP--RGG--  391
            L+  +R     I+ FK +IT DP+ VT SW G  LC        Y+GF+C  P  +G   
Sbjct  78   LNEKLRTLYPVIQAFKTTITSDPRGVTASWVGPNLCDSYFGGNMYKGFYCDHPPVKGAPQ  137

Query  392  DKKRVggiyfngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIP-VQKFPTLFEL  568
            D   +     +   +     SL  F+++F DL + H NSNNF+G   +P +   P  +EL
Sbjct  138  DDTTLTIASIDFNGYGLGAPSLAGFIDAFPDLALFHANSNNFSGD--VPDLTGLPYFYEL  195

Query  569  DLSNNKLAGAFPTAVLEATNLTYLDLRFNMLTGPVHPQV  685
            DLSNN  +G FP  V+    L +LDLRFN   G V P V
Sbjct  196  DLSNNNFSGVFPANVVPLGGLLFLDLRFNRFVGTVPPPV  234



>ref|XP_002885650.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61909.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=492

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 54/146 (37%), Positives = 77/146 (53%), Gaps = 6/146 (4%)
 Frame = +2

Query  236  DPVIRKSIKAIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggi  415
            +P +R +  A++ +K++I  DP N+T +W G+ +C     Y G FC   R  D +++  +
Sbjct  71   NPRLRSAYIALQAWKQAILSDPNNITVNWIGSNVC----NYTGVFC--SRALDNRKIRTV  124

Query  416  yfngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAG  595
                 N       L   +    DL + HVNSN F G      ++   LFELDLSNN+ AG
Sbjct  125  AGIDLNHADIAGYLPEELGLLTDLALFHVNSNRFCGTVPHKFKQLKLLFELDLSNNRFAG  184

Query  596  AFPTAVLEATNLTYLDLRFNMLTGPV  673
             FPT VL   +L +LDLRFN   G V
Sbjct  185  KFPTVVLHLPSLKFLDLRFNEFEGTV  210



>ref|XP_007285579.1| aldo/keto reductase, putative [Colletotrichum gloeosporioides 
Nara gc5]
 gb|ELA25352.1| aldo/keto reductase, putative [Colletotrichum gloeosporioides 
Nara gc5]
Length=653

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 60/143 (42%), Positives = 87/143 (61%), Gaps = 5/143 (3%)
 Frame = +2

Query  245  IRKSIKAIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfn  424
            + + +  + +FK+ IT DPQ +T++W GN++C    K+ GF C       +K + GI FN
Sbjct  364  LHRDLLLVESFKQKITSDPQGITKNWTGNDIC----KFNGFSCDNNPNTGQKALAGIDFN  419

Query  425  gynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFP  604
            G+ F G  L+L+ F++   DL   H NSN F G     +     L+ELDLS+NKL+G FP
Sbjct  420  GFGFEGQKLTLDGFLDKLTDLTFFHANSNGFVGQIPSDLSALKWLYELDLSSNKLSGPFP  479

Query  605  TAVLEATNLTYLDLRFNMLTGPV  673
             AVL A +LT+LDLRFN  +G +
Sbjct  480  KAVLNA-DLTFLDLRFNEFSGSI  501



>ref|XP_010028214.1| PREDICTED: uncharacterized protein At4g06744-like [Eucalyptus 
grandis]
Length=513

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 68/147 (46%), Positives = 86/147 (59%), Gaps = 11/147 (7%)
 Frame = +2

Query  266  IRTFKKSITY---DPQNVTQSWEGN--ELCINKKKYQGFFCYVPRGGDKKRVggiyfngy  430
            I+ FKK I+    DP+ VT +W G   ++C     Y+GF C    G     + GI FNG+
Sbjct  146  IQDFKKLISKGNCDPKKVTATWNGTGEKIC----NYKGFTCATVPGYKMSGLAGIDFNGF  201

Query  431  n--fngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFP  604
                +   L +++F+E   DLV  H NSNN TG     + K    +ELDLSNNKL GAFP
Sbjct  202  GFCNDKGQLPIDNFIEKLPDLVFFHTNSNNITGRIPSNLSKLKYFYELDLSNNKLRGAFP  261

Query  605  TAVLEATNLTYLDLRFNMLTGPVHPQV  685
              VL ATNLT+LDLRFN LTGP+  QV
Sbjct  262  LTVLGATNLTFLDLRFNNLTGPIPAQV  288



>gb|KJB54313.1| hypothetical protein B456_009G028700 [Gossypium raimondii]
Length=357

 Score = 92.0 bits (227),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 52/146 (36%), Positives = 82/146 (56%), Gaps = 6/146 (4%)
 Frame = +2

Query  245  IRKSIKAIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfn  424
            +  +  A++ +K +I  DP  + ++W G+++C     Y+G FC  P+GG          +
Sbjct  64   LSSAYTALQAWKSAIADDPMRILETWVGSDVC----SYKGVFCADPQGGVASEPFVAGID  119

Query  425  gynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFP  604
              + N  G  ++  +    D+ ++H+NSN F+G      ++  +L ELDLSNN+L+G FP
Sbjct  120  LNHANLLGTLVSE-LSVLTDISILHLNSNRFSGTVPDSFRELSSLQELDLSNNRLSGPFP  178

Query  605  TAVLEATNLTYLDLRFNMLTGPVHPQ  682
            T  L   NL YLDLRFN  +GPV PQ
Sbjct  179  TVTLYMPNLVYLDLRFNSFSGPV-PQ  203



>ref|XP_010513507.1| PREDICTED: leucine-rich repeat extensin-like protein 4 [Camelina 
sativa]
Length=719

 Score = 94.4 bits (233),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 54/146 (37%), Positives = 77/146 (53%), Gaps = 6/146 (4%)
 Frame = +2

Query  236  DPVIRKSIKAIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggi  415
            +P +R +  A++ +K++I  DP N+T  W G+ +C     Y G FC   R  D +R+  +
Sbjct  68   NPRLRSAYIALQAWKQAILSDPNNITLDWIGSNVC----SYTGVFC--SRALDNRRIRTV  121

Query  416  yfngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAG  595
                 N       L   +    D+ + HVNSN F G      ++   LFELDLSNN+ AG
Sbjct  122  AGIDLNHADIAGYLPEELGLLTDVALFHVNSNRFCGTVPRKFKQLKLLFELDLSNNRFAG  181

Query  596  AFPTAVLEATNLTYLDLRFNMLTGPV  673
             FPT VL+  +L +LDLRFN   G V
Sbjct  182  KFPTVVLQLPSLKFLDLRFNEFEGTV  207



>gb|ENH81556.1| leucine-rich repeat family protein [Colletotrichum orbiculare 
MAFF 240422]
Length=317

 Score = 91.7 bits (226),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 59/146 (40%), Positives = 82/146 (56%), Gaps = 5/146 (3%)
 Frame = +2

Query  236  DPVIRKSIKAIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggi  415
            D  + + +  +++FKK IT DP   T++W GN++C    K+ GF C        K + GI
Sbjct  26   DSNLHRDLLLVQSFKKQITSDPHGYTRNWTGNDVC----KFGGFRCADNPNTGLKALSGI  81

Query  416  yfngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAG  595
              N +   GN L L  F++   DL   H N+N FTG     +     L+ELDLS+N+L+G
Sbjct  82   DLNNFELEGNPLKLEGFLDKLTDLTFFHANTNGFTGELPKDLSALKWLWELDLSSNQLSG  141

Query  596  AFPTAVLEATNLTYLDLRFNMLTGPV  673
             FP AVL A NL +LDLRFN   GP+
Sbjct  142  PFPEAVLNA-NLVFLDLRFNGFDGPL  166



>ref|XP_003528523.1| PREDICTED: uncharacterized protein At4g06744-like [Glycine max]
 gb|KHN43048.1| Hypothetical protein glysoja_007578 [Glycine soja]
Length=417

 Score = 92.8 bits (229),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 58/153 (38%), Positives = 85/153 (56%), Gaps = 9/153 (6%)
 Frame = +2

Query  233  LDPVIRKSIKAIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVgg  412
            +D  + +    I+TFK +IT DP+ VT +W G  +C     Y GF+C  P   +      
Sbjct  49   IDQRLAQVFPIIQTFKNTITSDPRGVTSTWVGPNIC----NYTGFYCDNPPD-NLTATTI  103

Query  413  iyfngynfngnglslnsFVESFNDLVVIHVNSNNFTG--APGIPVQKFPTLFELDLSNNK  586
               +   F     +L+ F++   DL + H NSN F+G  +P I   KF  L+ELDLSNN 
Sbjct  104  ASIDFNGFQLTAPTLDGFIDQLPDLALFHANSNKFSGIVSPKIAGLKF--LYELDLSNNL  161

Query  587  LAGAFPTAVLEATNLTYLDLRFNMLTGPVHPQV  685
             +GAFPT+VL    L++LD+RFN  +G + PQ+
Sbjct  162  FSGAFPTSVLNIPTLSFLDIRFNSFSGTLPPQI  194



>tpg|DAA58808.1| TPA: leucine-rich repeat (LRR) family protein, partial [Zea mays]
Length=555

 Score = 94.0 bits (232),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 57/147 (39%), Positives = 79/147 (54%), Gaps = 8/147 (5%)
 Frame = +2

Query  236  DPVIRKSIKAIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCY-VPRGGDKKRVgg  412
            +P +R +  A++ ++++I  DP NVT SW G ++C     Y G +C   P+  D   V  
Sbjct  72   NPRLRDAYVALQAWRRAILSDPHNVTGSWTGPDVC----AYAGVYCAPSPQDPDLTVVAS  127

Query  413  iyfngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLA  592
            +  N  +  G+       +    DL V+H+NSN F G     + K   L ELDLSNN+L 
Sbjct  128  VDLNHADLAGHLPEELGLLA---DLAVLHLNSNRFCGLVPRSLDKLHALHELDLSNNRLV  184

Query  593  GAFPTAVLEATNLTYLDLRFNMLTGPV  673
            GAFP  VL   +L YLDLRFN   GPV
Sbjct  185  GAFPDVVLRLPSLRYLDLRFNDFEGPV  211



>ref|XP_006285388.1| hypothetical protein CARUB_v10006785mg [Capsella rubella]
 gb|EOA18286.1| hypothetical protein CARUB_v10006785mg [Capsella rubella]
Length=747

 Score = 94.4 bits (233),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 54/146 (37%), Positives = 76/146 (52%), Gaps = 6/146 (4%)
 Frame = +2

Query  236  DPVIRKSIKAIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggi  415
            +P +R +  A++ +K++I  DP N T +W G+++C     Y G FC      D +R+  +
Sbjct  73   NPRLRNAYVALQAWKQAILSDPNNFTTNWIGSDVC----SYTGVFCAP--ALDNRRIRTV  126

Query  416  yfngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAG  595
                 N       L   +    DL + HVNSN F G       +   LFELDLSNN+ AG
Sbjct  127  AGIDLNHADIAGYLPQELGLLTDLALFHVNSNRFCGTVPHRFNRLKLLFELDLSNNRFAG  186

Query  596  AFPTAVLEATNLTYLDLRFNMLTGPV  673
             FPT +L   +L +LDLRFN   GPV
Sbjct  187  VFPTVILHLPSLKFLDLRFNEFEGPV  212



>ref|XP_010270768.1| PREDICTED: uncharacterized protein At4g06744-like [Nelumbo nucifera]
Length=475

 Score = 93.2 bits (230),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 50/140 (36%), Positives = 73/140 (52%), Gaps = 5/140 (4%)
 Frame = +2

Query  266  IRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfngn  445
            I++FK  IT DP  +T +W G+++C     Y+GF+C  P      R              
Sbjct  109  IQSFKNIITSDPLGITSTWVGSDIC----NYRGFYCDNPPDDPSVRALAGIDFNGYQLAA  164

Query  446  glslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEAT  625
                  F++   DL + H N+NNFTG     + +   L+ELD+SNN  +G FPTAVL   
Sbjct  165  PTLDG-FIDLLPDLAIFHANTNNFTGIISPKIAQLRYLYELDISNNLFSGQFPTAVLGMN  223

Query  626  NLTYLDLRFNMLTGPVHPQV  685
             L++LD+RFN  +G V  Q+
Sbjct  224  GLSFLDIRFNSFSGSVPAQI  243



>emb|CDX94809.1| BnaC03g43790D [Brassica napus]
Length=530

 Score = 93.2 bits (230),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 54/146 (37%), Positives = 76/146 (52%), Gaps = 6/146 (4%)
 Frame = +2

Query  236  DPVIRKSIKAIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggi  415
            +P +R +  A++ +K++I  DP N+T +W G+ +C     Y G FC   R  D +R+  +
Sbjct  68   NPRLRSAYIALQAWKQAILSDPNNITLNWIGSNVC----SYTGVFCS--RAPDNRRIRTV  121

Query  416  yfngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAG  595
                 N       L   +    DL + HVNSN F G      +    LFELDLSNN+ AG
Sbjct  122  AGIDLNHADIAGYLPEELGLLTDLALFHVNSNRFCGTVPHKFKHLKLLFELDLSNNRFAG  181

Query  596  AFPTAVLEATNLTYLDLRFNMLTGPV  673
             FP  VL+  +L +LDLRFN   G V
Sbjct  182  KFPAVVLDLPSLKFLDLRFNEFEGTV  207



>gb|EPS72402.1| hypothetical protein M569_02357, partial [Genlisea aurea]
Length=395

 Score = 92.0 bits (227),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 48/146 (33%), Positives = 78/146 (53%), Gaps = 6/146 (4%)
 Frame = +2

Query  236  DPVIRKSIKAIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggi  415
            +P ++ +  A++++K++I  DP N+T +W G ++C     Y G FC+       +R   +
Sbjct  11   NPRLQNAYIALQSWKEAILSDPNNITANWIGPDVC----DYNGIFCWTSPDNHCERTVAV  66

Query  416  yfngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAG  595
                       L     +    DL ++HVNSN F G   + +     L+ELDLSNN+ +G
Sbjct  67   IDVNNGNIAGHLPHELGL--LYDLAILHVNSNRFCGVVPLSLSNLRLLYELDLSNNRFSG  124

Query  596  AFPTAVLEATNLTYLDLRFNMLTGPV  673
             FP  VL+ ++L YLD+RFN   GP+
Sbjct  125  KFPDHVLDLSSLAYLDIRFNEFEGPI  150



>ref|XP_002867981.1| hypothetical protein ARALYDRAFT_492992 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44240.1| hypothetical protein ARALYDRAFT_492992 [Arabidopsis lyrata subsp. 
lyrata]
Length=738

 Score = 93.6 bits (231),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 54/146 (37%), Positives = 77/146 (53%), Gaps = 6/146 (4%)
 Frame = +2

Query  236  DPVIRKSIKAIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggi  415
            +P +R +  A++ +K++I  DP N T +W G+++C     Y G +C      D +R+  +
Sbjct  76   NPRLRNAYIALQAWKQAILSDPNNFTTNWIGSDVC----SYTGVYCAP--ALDNRRIRTV  129

Query  416  yfngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAG  595
                 N       L   +    DL + HVNSN F G       +   LFELDLSNN+ AG
Sbjct  130  AGIDLNHADIAGYLPQELGLLTDLALFHVNSNRFCGTVPHRFNRLKLLFELDLSNNRFAG  189

Query  596  AFPTAVLEATNLTYLDLRFNMLTGPV  673
             FPT VL+  +L +LDLRFN   GPV
Sbjct  190  IFPTVVLQLPSLKFLDLRFNEFEGPV  215



>gb|EYU37650.1| hypothetical protein MIMGU_mgv11b016249mg [Erythranthe guttata]
Length=440

 Score = 92.0 bits (227),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 64/141 (45%), Positives = 87/141 (62%), Gaps = 5/141 (4%)
 Frame = +2

Query  266  IRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGG-DKKRVggiyfngynfng  442
            I+ FK+ IT DP N+T +W G ++C N   Y+GFFC    G  +   + G+ FNG+NF+G
Sbjct  77   IQKFKQKITSDPYNITNTWVGPDICNN---YKGFFCDTLLGDYNSVALAGVTFNGFNFDG  133

Query  443  nglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEA  622
              LSL  F++   D++V H NSNNF G     + K   L+ELDLSNNK    FP  +L  
Sbjct  134  PDLSLAGFIDELPDIIVFHANSNNFKGPFPSNISKIKYLYELDLSNNKYTCEFPHEIL-G  192

Query  623  TNLTYLDLRFNMLTGPVHPQV  685
            + LT+LDLR+N  +G V PQV
Sbjct  193  SQLTFLDLRYNTFSGAVPPQV  213



>ref|XP_001767662.1| predicted protein [Physcomitrella patens]
 gb|EDQ67413.1| predicted protein, partial [Physcomitrella patens]
Length=359

 Score = 90.9 bits (224),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 50/135 (37%), Positives = 77/135 (57%), Gaps = 4/135 (3%)
 Frame = +2

Query  263  AIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfng  442
            A++ +KK+IT DP+ + ++W G ++C    KY+G FC  P   D + +  +     N   
Sbjct  4    ALKAWKKAITDDPKGILKTWVGKDVC----KYEGVFCSPPEDPDLQYLEVVAGIDLNDAD  59

Query  443  nglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEA  622
               +L   +    ++ + H+NSN F+G      +   TLFELDLSNN+L+G+FP  VL+ 
Sbjct  60   LKGTLVPELGLLREIGIFHLNSNRFSGEVPDSFRYMKTLFELDLSNNQLSGSFPLVVLDI  119

Query  623  TNLTYLDLRFNMLTG  667
             NL YLD+RFN   G
Sbjct  120  PNLVYLDIRFNEFFG  134



>emb|CAB37452.1| extensin-like protein [Arabidopsis thaliana]
 emb|CAB78869.1| extensin-like protein [Arabidopsis thaliana]
Length=839

 Score = 93.6 bits (231),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 53/146 (36%), Positives = 77/146 (53%), Gaps = 6/146 (4%)
 Frame = +2

Query  236  DPVIRKSIKAIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggi  415
            +P +R +  A++ +K++I  DP N T +W G+++C     Y G +C      D +R+  +
Sbjct  75   NPRLRNAYIALQAWKQAILSDPNNFTTNWIGSDVC----SYTGVYC--APALDNRRIRTV  128

Query  416  yfngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAG  595
                 N       L   +    DL + H+NSN F G       +   LFELDLSNN+ AG
Sbjct  129  AGIDLNHADIAGYLPQELGLLTDLALFHINSNRFCGTVPHRFNRLKLLFELDLSNNRFAG  188

Query  596  AFPTAVLEATNLTYLDLRFNMLTGPV  673
             FPT VL+  +L +LDLRFN   GPV
Sbjct  189  IFPTVVLQLPSLKFLDLRFNEFEGPV  214



>emb|CDX93014.1| BnaA03g37360D [Brassica napus]
Length=456

 Score = 92.0 bits (227),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 53/146 (36%), Positives = 76/146 (52%), Gaps = 6/146 (4%)
 Frame = +2

Query  236  DPVIRKSIKAIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggi  415
            +P +R +  A++ +K++I  DP N+T +W G+ +C     Y G FC   R  D +R+  +
Sbjct  70   NPRLRSAYIALQAWKQAILSDPNNITLNWIGSNVCT----YTGVFC--SRAPDNRRIRTV  123

Query  416  yfngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAG  595
                 N       L   +    DL + HVN+N F G      +    LFELDLSNN+ AG
Sbjct  124  AGIDLNHADIAGYLPEELGLLTDLALFHVNTNRFCGTVPHKFKHLKLLFELDLSNNRFAG  183

Query  596  AFPTAVLEATNLTYLDLRFNMLTGPV  673
             FP  VL+  +L +LDLRFN   G V
Sbjct  184  KFPAVVLDLPSLKFLDLRFNEFEGTV  209



>gb|KFK35980.1| hypothetical protein AALP_AA4G062700 [Arabis alpina]
Length=490

 Score = 92.4 bits (228),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 60/149 (40%), Positives = 93/149 (62%), Gaps = 7/149 (5%)
 Frame = +2

Query  242  VIRKSIKAIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyf  421
            ++ K+   ++ FK ++  +P+ V  SW+G ++C    KY+G  C +  G ++  V    F
Sbjct  122  LVAKAYPVLQRFK-NLVEEPKGVFDSWKGGDIC---NKYRGLECAILPGKNQTAVVSYQF  177

Query  422  ngynfngnglslnsFVESFNDLVVIHVNSNNFTGA-PGIPVQKFPTLFELDLSNNKLAGA  598
            NG N +G  L L++F++   ++ + H NSNNF G+ P +   K+  L+ELDLSNNKL G 
Sbjct  178  NGLNLSGKNLRLDNFIDKLPEISIFHANSNNFLGSVPKLSHLKY--LYELDLSNNKLTGK  235

Query  599  FPTAVLEATNLTYLDLRFNMLTGPVHPQV  685
            FPT V++A  LT+LDLRFN  +G V P+V
Sbjct  236  FPTTVIDAKQLTFLDLRFNSFSGFVPPRV  264



>ref|NP_193602.4| leucine-rich repeat extensin-like protein 5 [Arabidopsis thaliana]
 sp|Q9SN46.2|LRX5_ARATH RecName: Full=Leucine-rich repeat extensin-like protein 5; Short=AtLRX5; 
Short=LRR/EXTENSIN5; AltName: Full=Cell wall hydroxyproline-rich 
glycoprotein; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AEE84074.1| leucine-rich repeat extensin-like protein 5 [Arabidopsis thaliana]
Length=857

 Score = 93.2 bits (230),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 53/146 (36%), Positives = 77/146 (53%), Gaps = 6/146 (4%)
 Frame = +2

Query  236  DPVIRKSIKAIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggi  415
            +P +R +  A++ +K++I  DP N T +W G+++C     Y G +C      D +R+  +
Sbjct  75   NPRLRNAYIALQAWKQAILSDPNNFTTNWIGSDVC----SYTGVYC--APALDNRRIRTV  128

Query  416  yfngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAG  595
                 N       L   +    DL + H+NSN F G       +   LFELDLSNN+ AG
Sbjct  129  AGIDLNHADIAGYLPQELGLLTDLALFHINSNRFCGTVPHRFNRLKLLFELDLSNNRFAG  188

Query  596  AFPTAVLEATNLTYLDLRFNMLTGPV  673
             FPT VL+  +L +LDLRFN   GPV
Sbjct  189  IFPTVVLQLPSLKFLDLRFNEFEGPV  214



>ref|NP_189091.1| leucine-rich repeat extensin-like protein 4 [Arabidopsis thaliana]
 sp|Q9LHF1.1|LRX4_ARATH RecName: Full=Leucine-rich repeat extensin-like protein 4; Short=AtLRX4; 
Short=LRR/EXTENSIN4; AltName: Full=Cell wall hydroxyproline-rich 
glycoprotein; Flags: Precursor [Arabidopsis 
thaliana]
 dbj|BAB01951.1| extensin-like protein [Arabidopsis thaliana]
 gb|AEE76902.1| leucine-rich repeat extensin-like protein 4 [Arabidopsis thaliana]
Length=494

 Score = 92.0 bits (227),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 53/146 (36%), Positives = 77/146 (53%), Gaps = 6/146 (4%)
 Frame = +2

Query  236  DPVIRKSIKAIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggi  415
            +P +R +  A++ +K++I  DP N+T +W G+ +C     Y G FC   +  D +++  +
Sbjct  71   NPRLRSAYIALQAWKQAILSDPNNITVNWIGSNVC----NYTGVFC--SKALDNRKIRTV  124

Query  416  yfngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAG  595
                 N       L   +    DL + HVNSN F G      ++   LFELDLSNN+ AG
Sbjct  125  AGIDLNHADIAGYLPEELGLLTDLALFHVNSNRFCGTVPHKFKQLKLLFELDLSNNRFAG  184

Query  596  AFPTAVLEATNLTYLDLRFNMLTGPV  673
             FPT VL   +L +LDLRFN   G V
Sbjct  185  KFPTVVLHLPSLKFLDLRFNEFEGTV  210



>ref|XP_007601154.1| crisp-1 [Colletotrichum fioriniae PJ7]
 gb|EXF75160.1| crisp-1 [Colletotrichum fioriniae PJ7]
Length=316

 Score = 90.1 bits (222),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 55/143 (38%), Positives = 80/143 (56%), Gaps = 5/143 (3%)
 Frame = +2

Query  245  IRKSIKAIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfn  424
            + + +  +++ K  IT DP  VT++W GN +C     + GF C          + GI  N
Sbjct  28   LGRDLSLVQSLKHKITVDPSGVTKNWTGNNVC----NFDGFSCAKNPNTGNNALSGIDLN  83

Query  425  gynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFP  604
            G+   G  L L+ F++   DL   H NSN FTG+    +     L+E+D+SNNKL+G FP
Sbjct  84   GFGLEGKDLVLDGFLDKLTDLTFFHANSNGFTGSLPKDLSALKWLWEIDVSNNKLSGPFP  143

Query  605  TAVLEATNLTYLDLRFNMLTGPV  673
            T V +  NLT+LDLRFN  +GP+
Sbjct  144  TGVFD-LNLTFLDLRFNEFSGPI  165



>ref|XP_004142874.1| PREDICTED: uncharacterized protein At4g06744-like [Cucumis sativus]
 ref|XP_004156371.1| PREDICTED: uncharacterized protein At4g06744-like [Cucumis sativus]
 gb|KGN62484.1| hypothetical protein Csa_2G356090 [Cucumis sativus]
Length=438

 Score = 91.7 bits (226),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 54/132 (41%), Positives = 76/132 (58%), Gaps = 4/132 (3%)
 Frame = +2

Query  278  KKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfngnglsl  457
            K++ITYDP+  T++W GN  C+    ++GFFC V    +   +  I F+G  F G  L+ 
Sbjct  75   KRNITYDPKGYTKTWVGNNYCL----FKGFFCDVVPDLNITGLSSIDFSGARFGGPFLNF  130

Query  458  nsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEATNLTY  637
              F+ +  D+ + H NSNNFTG     + K   L+ELDLSNNK  G FP  +L A  L++
Sbjct  131  YRFIRNLPDIALFHANSNNFTGVINRNINKLRYLYELDLSNNKFLGGFPGYILGANKLSF  190

Query  638  LDLRFNMLTGPV  673
            +D RFN   G V
Sbjct  191  VDFRFNTYNGSV  202



>ref|XP_008663372.1| PREDICTED: uncharacterized protein At4g06744-like [Zea mays]
 gb|AFW58791.1| leucine-rich repeat (LRR) family protein [Zea mays]
Length=548

 Score = 92.4 bits (228),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 56/143 (39%), Positives = 82/143 (57%), Gaps = 10/143 (7%)
 Frame = +2

Query  251  KSIKAIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngy  430
            ++   I+ F+ +++ DP +VT+SW G +LC     Y+GF+C  P     + +     +  
Sbjct  185  RAYLVIQQFRSAVSCDPMDVTRSWSGTDLC----GYKGFYCERPPNETDRTI--ASVDFN  238

Query  431  nfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIP-VQKFPTLFELDLSNNKLAGA-FP  604
             +     SL  FV S  DL + H NSN+F GA  +P +   P L+ELDLSNN+LA A FP
Sbjct  239  GYMLRADSLQGFVNSLPDLALFHANSNDFGGA--VPALAALPFLYELDLSNNRLAPATFP  296

Query  605  TAVLEATNLTYLDLRFNMLTGPV  673
            T VL  TN T++D+RFN   G +
Sbjct  297  TDVLALTNATFIDIRFNSFYGEL  319



>gb|KEH30896.1| Serine/Threonine kinase, plant-type protein, putative [Medicago 
truncatula]
Length=413

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 53/151 (35%), Positives = 81/151 (54%), Gaps = 5/151 (3%)
 Frame = +2

Query  233  LDPVIRKSIKAIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVgg  412
            LD  +      I+ FK +IT DP  +T +W G  +C     Y+GF+C  P   +      
Sbjct  50   LDQRLAIVFPIIQAFKNTITSDPLGITLTWVGPNIC----NYKGFYCDNPPD-NLSATTV  104

Query  413  iyfngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLA  592
               +   F  +  SL+ F++   DL + H NSNNF+G     +     L+ELDLSNN L+
Sbjct  105  ASIDFNGFQLSAPSLDDFIDQLPDLALFHANSNNFSGTISPKIASLKYLYELDLSNNLLS  164

Query  593  GAFPTAVLEATNLTYLDLRFNMLTGPVHPQV  685
            G FP+++L    L++LD+R+N+ TG V  Q+
Sbjct  165  GTFPSSILNMPTLSFLDIRYNLFTGTVPQQI  195



>gb|ADN33724.1| LRR-family protein [Cucumis melo subsp. melo]
Length=439

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 54/132 (41%), Positives = 76/132 (58%), Gaps = 4/132 (3%)
 Frame = +2

Query  278  KKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfngnglsl  457
            K++ITYDP+  T++W GN  C+    ++GFFC V    +   +  I F+G  F G  L+ 
Sbjct  75   KRNITYDPKGYTKTWVGNNYCL----FKGFFCDVVPDLNITGLSSIDFSGARFGGPFLNF  130

Query  458  nsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEATNLTY  637
              F+ +  D+ + H NSNNFTG     + K   L+ELDLSNNK  G FP  +L A  L++
Sbjct  131  YRFIRNLPDIALFHANSNNFTGVINRNINKLRYLYELDLSNNKFLGGFPGYILGANKLSF  190

Query  638  LDLRFNMLTGPV  673
            +D RFN   G V
Sbjct  191  VDFRFNTYNGSV  202



>ref|XP_004505255.1| PREDICTED: uncharacterized protein At4g06744-like [Cicer arietinum]
Length=407

 Score = 90.9 bits (224),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 52/140 (37%), Positives = 78/140 (56%), Gaps = 5/140 (4%)
 Frame = +2

Query  266  IRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfngn  445
            I+TFK +IT DP  +T +W G  +C     Y+GF+C  P   +         +   F+  
Sbjct  56   IQTFKNTITSDPLGITTTWVGPNIC----NYKGFYCDNPPD-NLTATTVASIDFNGFHLA  110

Query  446  glslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEAT  625
              SL+ F++   DL + H NSNNF+G     +     L+ELDLSNN L+G FP ++L   
Sbjct  111  APSLDGFIDQLPDLALFHANSNNFSGTISSKLASLKYLYELDLSNNFLSGTFPISILNIP  170

Query  626  NLTYLDLRFNMLTGPVHPQV  685
             L++LD+R+N+ TG V  Q+
Sbjct  171  TLSFLDIRYNLFTGTVPQQI  190



>ref|XP_008444596.1| PREDICTED: uncharacterized protein At4g06744-like [Cucumis melo]
Length=507

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 54/132 (41%), Positives = 76/132 (58%), Gaps = 4/132 (3%)
 Frame = +2

Query  278  KKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfngnglsl  457
            K++ITYDP+  T++W GN  C+    ++GFFC V    +   +  I F+G  F G  L+ 
Sbjct  147  KRNITYDPKGYTKTWVGNNYCL----FKGFFCDVVPDLNITGLSSIDFSGARFGGPFLNF  202

Query  458  nsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEATNLTY  637
              F+ +  D+ + H NSNNFTG     + K   L+ELDLSNNK  G FP  +L A  L++
Sbjct  203  YRFIRNLPDIALFHANSNNFTGVINRNINKLRYLYELDLSNNKFLGGFPGYILGANKLSF  262

Query  638  LDLRFNMLTGPV  673
            +D RFN   G V
Sbjct  263  VDFRFNTYNGSV  274



>ref|XP_007042487.1| Leucine-rich repeat family protein, putative [Theobroma cacao]
 gb|EOX98318.1| Leucine-rich repeat family protein, putative [Theobroma cacao]
Length=415

 Score = 90.5 bits (223),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 55/141 (39%), Positives = 78/141 (55%), Gaps = 8/141 (6%)
 Frame = +2

Query  266  IRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfngn  445
            I+ FK +IT DP N T +W G ++C     Y GFFC  P   ++  +     +   F   
Sbjct  61   IQAFKGTITGDPLNKTGNWVGCDIC----NYTGFFCDNPPD-NESALALAGIDFNGFLLT  115

Query  446  glslnsFVESFNDLVVIHVNSNNFTGAPGIP-VQKFPTLFELDLSNNKLAGAFPTAVLEA  622
              +L  F++   DL + H NSN FTG+  +P V   P  +ELD+SNN  +G FPT VL  
Sbjct  116  APTLEGFIDMLPDLAIFHANSNKFTGS--VPDVSNLPYFYELDISNNIFSGTFPTTVLGI  173

Query  623  TNLTYLDLRFNMLTGPVHPQV  685
             +L++LD+RFN   G V PQ+
Sbjct  174  KDLSFLDIRFNSFAGTVPPQI  194



>ref|XP_010461823.1| PREDICTED: uncharacterized protein At4g06744-like [Camelina sativa]
Length=490

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 61/150 (41%), Positives = 85/150 (57%), Gaps = 10/150 (7%)
 Frame = +2

Query  239  PVIRKSIKAIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiy  418
            P ++K+   +  FKKS+  DP N   +W G ++C     Y G  C +    + + +    
Sbjct  122  PFLKKAYPILLEFKKSVK-DPLNKLYNWGGPDVC----NYNGLKCAI--FPNSRHLAVAS  174

Query  419  fngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIP-VQKFPTLFELDLSNNKLAG  595
                 F   G++L++F+   +   + H NSNNF G+  +P V K   LFELDLSNNKL G
Sbjct  175  VQFNGFQLGGITLDNFLGKLDTFSIFHANSNNFIGS--VPDVSKLNFLFELDLSNNKLTG  232

Query  596  AFPTAVLEATNLTYLDLRFNMLTGPVHPQV  685
             FPT VL+ TNLT+LDLRFN  +G V PQV
Sbjct  233  DFPTNVLKGTNLTFLDLRFNTFSGSVPPQV  262



>ref|XP_009135898.1| PREDICTED: leucine-rich repeat extensin-like protein 4 [Brassica 
rapa]
Length=909

 Score = 92.4 bits (228),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 53/146 (36%), Positives = 76/146 (52%), Gaps = 6/146 (4%)
 Frame = +2

Query  236  DPVIRKSIKAIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggi  415
            +P +R +  A++ +K++I  DP N+T +W G+ +C     Y G FC   R  D +R+  +
Sbjct  67   NPRLRSAYIALQAWKQAILSDPNNITLNWIGSNVC----TYTGVFC--SRAPDNRRIRTV  120

Query  416  yfngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAG  595
                 N       L   +    DL + HVN+N F G      +    LFELDLSNN+ AG
Sbjct  121  AGIDLNHADIAGYLPEELGLLTDLALFHVNTNRFCGTVPHKFKHLKLLFELDLSNNRFAG  180

Query  596  AFPTAVLEATNLTYLDLRFNMLTGPV  673
             FP  VL+  +L +LDLRFN   G V
Sbjct  181  KFPAVVLDLPSLKFLDLRFNEFEGTV  206



>ref|XP_010434500.1| PREDICTED: leucine-rich repeat extensin-like protein 5 isoform 
X1 [Camelina sativa]
Length=780

 Score = 92.0 bits (227),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 54/146 (37%), Positives = 75/146 (51%), Gaps = 6/146 (4%)
 Frame = +2

Query  236  DPVIRKSIKAIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggi  415
            +P +R +  A++ +K++I  DP N T +W G+ +C     Y G FC      D +R+  +
Sbjct  77   NPRLRNAYVALQAWKQAILSDPNNFTTNWIGSNVC----SYTGVFC--APALDNRRIRTV  130

Query  416  yfngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAG  595
                 N       L   +    DL + HVNSN F G       +   LFELDLSNN+ AG
Sbjct  131  AGIDLNHVDIAGYLPQELGLLTDLALFHVNSNRFCGTVPHRFNRLKLLFELDLSNNRFAG  190

Query  596  AFPTAVLEATNLTYLDLRFNMLTGPV  673
             FP  VL+  +L +LDLRFN   GPV
Sbjct  191  IFPAVVLQLPSLKFLDLRFNEFEGPV  216



>ref|XP_010434501.1| PREDICTED: leucine-rich repeat extensin-like protein 5 isoform 
X2 [Camelina sativa]
Length=768

 Score = 92.0 bits (227),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 54/146 (37%), Positives = 75/146 (51%), Gaps = 6/146 (4%)
 Frame = +2

Query  236  DPVIRKSIKAIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggi  415
            +P +R +  A++ +K++I  DP N T +W G+ +C     Y G FC      D +R+  +
Sbjct  77   NPRLRNAYVALQAWKQAILSDPNNFTTNWIGSNVC----SYTGVFC--APALDNRRIRTV  130

Query  416  yfngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAG  595
                 N       L   +    DL + HVNSN F G       +   LFELDLSNN+ AG
Sbjct  131  AGIDLNHVDIAGYLPQELGLLTDLALFHVNSNRFCGTVPHRFNRLKLLFELDLSNNRFAG  190

Query  596  AFPTAVLEATNLTYLDLRFNMLTGPV  673
             FP  VL+  +L +LDLRFN   GPV
Sbjct  191  IFPAVVLQLPSLKFLDLRFNEFEGPV  216



>ref|XP_006414071.1| hypothetical protein EUTSA_v10024510mg [Eutrema salsugineum]
 gb|ESQ55524.1| hypothetical protein EUTSA_v10024510mg [Eutrema salsugineum]
Length=739

 Score = 92.0 bits (227),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 52/146 (36%), Positives = 76/146 (52%), Gaps = 6/146 (4%)
 Frame = +2

Query  236  DPVIRKSIKAIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggi  415
            +P +R +  A++ +K++I  DP N T +W G+++C     Y G +C      D +R+  +
Sbjct  80   NPRLRNAYIALQAWKQAILSDPNNFTTNWIGSDVC----SYTGVYCAP--APDNRRIRTV  133

Query  416  yfngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAG  595
                 N       L   +    DL + HVNSN F G       +   LFELDLSNN+ AG
Sbjct  134  AGIDLNHADIAGYLPQELGLLTDLALFHVNSNRFCGTVPHRFNRLKLLFELDLSNNRFAG  193

Query  596  AFPTAVLEATNLTYLDLRFNMLTGPV  673
             FP  +L+  +L +LDLRFN   GPV
Sbjct  194  KFPAVILQLPSLKFLDLRFNEFEGPV  219



>ref|XP_010479447.1| PREDICTED: leucine-rich repeat extensin-like protein 3 [Camelina 
sativa]
Length=502

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 64/150 (43%), Positives = 85/150 (57%), Gaps = 11/150 (7%)
 Frame = +2

Query  239  PVIRKSIKAIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiy  418
            P ++K+   +  FKKS+  DP N   +W G ++C     Y G  C +  G    R   + 
Sbjct  135  PFLKKAYPILLEFKKSVK-DPLNKLYNWGGPDVC----SYNGLKCAMFPG---TRDLAVA  186

Query  419  fngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIP-VQKFPTLFELDLSNNKLAG  595
               +N    G  L+SF+   + + + H NSNNF G+  +P V K   LFELDLSNNKL G
Sbjct  187  SFQFNGFQLGGKLDSFLGKLDTVSIFHANSNNFIGS--VPDVSKLNFLFELDLSNNKLTG  244

Query  596  AFPTAVLEATNLTYLDLRFNMLTGPVHPQV  685
             FPT VL+ TNLT+LDLRFN  +G V PQV
Sbjct  245  DFPTNVLKGTNLTFLDLRFNTFSGSVPPQV  274



>ref|XP_010439825.1| PREDICTED: leucine-rich repeat extensin-like protein 4 [Camelina 
sativa]
Length=862

 Score = 92.0 bits (227),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 54/146 (37%), Positives = 75/146 (51%), Gaps = 6/146 (4%)
 Frame = +2

Query  236  DPVIRKSIKAIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggi  415
            +P +R +  A++ +K++I  DP N T +W G+ +C     Y G FC      D +R+  +
Sbjct  78   NPRLRNAYVALQAWKQAILSDPNNFTTNWIGSNVC----SYTGVFCA--PALDNRRIRTV  131

Query  416  yfngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAG  595
                 N       L   +    DL + HVNSN F G       +   LFELDLSNN+ AG
Sbjct  132  AGIDLNHADIAGYLPQELGLLTDLALFHVNSNRFCGTVPHRFNRLKLLFELDLSNNRFAG  191

Query  596  AFPTAVLEATNLTYLDLRFNMLTGPV  673
             FP  VL+  +L +LDLRFN   GPV
Sbjct  192  IFPAVVLQLPSLKFLDLRFNEFEGPV  217



>gb|EMT04546.1| hypothetical protein F775_44003 [Aegilops tauschii]
Length=384

 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 54/137 (39%), Positives = 80/137 (58%), Gaps = 5/137 (4%)
 Frame = +2

Query  266  IRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfngn  445
            I+ FK++IT DPQ +T++W G  +C +   Y GFFC  P   +++ +     +   F   
Sbjct  22   IQRFKQTITCDPQGITKTWTGTAIC-SDTSYLGFFCEKPPNVNERAL--ASVDFNGFKLE  78

Query  446  glslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAG-AFPTAVLEA  622
              ++  FV++  DL + H NSN+F G   I ++     +ELD+SNNKLA  AFPT VL  
Sbjct  79   APTVEGFVDALPDLALFHANSNDFGGVVPI-LRSLQYFYELDVSNNKLARCAFPTDVLGI  137

Query  623  TNLTYLDLRFNMLTGPV  673
            TN T++D+RFN   G V
Sbjct  138  TNATFVDIRFNQFYGEV  154



>gb|EAZ32358.1| hypothetical protein OsJ_16568 [Oryza sativa Japonica Group]
Length=480

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 58/151 (38%), Positives = 77/151 (51%), Gaps = 13/151 (9%)
 Frame = +2

Query  266  IRTFKKSITYDPQNVTQSWEGNELC---INKKKYQGFFC-------YVPRGGDKKRVggi  415
            I+ FK +IT DP+ VT SW G  LC        Y+GF+C             D   +   
Sbjct  110  IQAFKATITSDPRGVTASWVGPNLCDSYFGGDMYKGFYCEHPPAPPGATTPKDNTTLTIA  169

Query  416  yfngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIP-VQKFPTLFELDLSNNKLA  592
              +   +     SL+ FV++F DL + H NSNNF+G   +P +   P  +ELDLSNN  +
Sbjct  170  SIDFNGYGLGAPSLSGFVDAFPDLALFHANSNNFSGE--VPDLTGLPYFYELDLSNNNFS  227

Query  593  GAFPTAVLEATNLTYLDLRFNMLTGPVHPQV  685
            GAFP  V+    L +LDLRFN   G V P V
Sbjct  228  GAFPATVVPLGRLLFLDLRFNRFVGTVPPPV  258



>emb|CAJ86091.1| H0818H01.13 [Oryza sativa Indica Group]
Length=480

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 58/151 (38%), Positives = 77/151 (51%), Gaps = 13/151 (9%)
 Frame = +2

Query  266  IRTFKKSITYDPQNVTQSWEGNELC---INKKKYQGFFC-------YVPRGGDKKRVggi  415
            I+ FK +IT DP+ VT SW G  LC        Y+GF+C             D   +   
Sbjct  110  IQAFKATITSDPRGVTASWVGPNLCDSYFGGDMYKGFYCEHPPAPPGATTPKDNTTLTIA  169

Query  416  yfngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIP-VQKFPTLFELDLSNNKLA  592
              +   +     SL+ FV++F DL + H NSNNF+G   +P +   P  +ELDLSNN  +
Sbjct  170  SIDFNGYGLGAPSLSGFVDAFPDLALFHANSNNFSGE--VPDLTGLPYFYELDLSNNNFS  227

Query  593  GAFPTAVLEATNLTYLDLRFNMLTGPVHPQV  685
            GAFP  V+    L +LDLRFN   G V P V
Sbjct  228  GAFPATVVPLGRLLFLDLRFNRFVGTVPPPV  258



>gb|AEV41070.1| uncharacterized protein At4g06744 precursor [Oryza minuta]
Length=455

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 71/195 (36%), Positives = 96/195 (49%), Gaps = 18/195 (9%)
 Frame = +2

Query  128  GEEESKETSPPASLVYNVD-CGCYVpppppppcpppLDPVIRKSIKAIRTFKKSITYDPQ  304
            GE +    SPP+     +D CGC   P P P     L+  +R     I+ FK+ IT D +
Sbjct  51   GEGKGSAPSPPS-----LDTCGC--GPAPAPAPSEFLNEKLRSLYPVIQAFKQRITSDLR  103

Query  305  NVTQSWEGNELC---INKKKYQGFFCYVPRGGDKKR----Vggiyfngynfngnglslns  463
             VT SW G  LC        Y+GF+C  P   D  +    +     +   +     SL  
Sbjct  104  GVTASWVGPNLCDSYFGGNMYKGFYCDHPPVNDAPQDDTTLTIASIDFNGYGLAAPSLAG  163

Query  464  FVESFNDLVVIHVNSNNFTGAPGIP-VQKFPTLFELDLSNNKLAGAFPTAVLEATNLTYL  640
            FV++F +L + H NSNNF+G   +P +   P  +ELDLSNN  +GAFP  V+    L +L
Sbjct  164  FVDAFPELALFHANSNNFSGE--VPDLTALPYFYELDLSNNNFSGAFPANVVPLGRLLFL  221

Query  641  DLRFNMLTGPVHPQV  685
            DLRFN   G V P V
Sbjct  222  DLRFNHFVGTVPPPV  236



>ref|XP_010449482.1| PREDICTED: leucine-rich repeat extensin-like protein 5 [Camelina 
sativa]
Length=825

 Score = 92.0 bits (227),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 54/146 (37%), Positives = 75/146 (51%), Gaps = 6/146 (4%)
 Frame = +2

Query  236  DPVIRKSIKAIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggi  415
            +P +R +  A++ +K++I  DP N T +W G+ +C     Y G FC      D +R+  +
Sbjct  82   NPRLRNAYVALQAWKQAILSDPNNFTTNWIGSNVC----GYTGVFCA--PALDNRRIRTV  135

Query  416  yfngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAG  595
                 N       L   +    DL + HVNSN F G       +   LFELDLSNN+ AG
Sbjct  136  AGIDLNHADIAGYLPQELGLLTDLALFHVNSNRFCGTVPHRFNRLKLLFELDLSNNRFAG  195

Query  596  AFPTAVLEATNLTYLDLRFNMLTGPV  673
             FP  VL+  +L +LDLRFN   GPV
Sbjct  196  IFPAVVLQLPSLKFLDLRFNEFEGPV  221



>gb|KDP24107.1| hypothetical protein JCGZ_25764 [Jatropha curcas]
Length=417

 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 54/150 (36%), Positives = 78/150 (52%), Gaps = 6/150 (4%)
 Frame = +2

Query  236  DPVIRKSIKAIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggi  415
            +P ++++  A++ +KK I  DP N T +W G  +C    KY G +C      D   +  +
Sbjct  53   NPRLKRAYIALQAWKKVIFSDPHNFTSNWVGPNVC----KYNGVYCAA--AVDDPTIKVV  106

Query  416  yfngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAG  595
                 NF      L   +    DL +IH+NSN F G     +     L+ELDLSNN+  G
Sbjct  107  AGIDLNFVDIAGFLPVEIGLLCDLALIHLNSNRFCGLIPESIANLTLLYELDLSNNRFVG  166

Query  596  AFPTAVLEATNLTYLDLRFNMLTGPVHPQV  685
             FP+AVL    LTYLDLR+N   GP+ P++
Sbjct  167  LFPSAVLSLPMLTYLDLRYNEFEGPLPPEL  196



>gb|AEV41116.1| uncharacterized protein At4g06744 precursor [Oryza officinalis]
Length=462

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 71/195 (36%), Positives = 96/195 (49%), Gaps = 18/195 (9%)
 Frame = +2

Query  128  GEEESKETSPPASLVYNVD-CGCYVpppppppcpppLDPVIRKSIKAIRTFKKSITYDPQ  304
            GE +    SPP+     +D CGC   P P P     L+  +R     I+ FK+ IT D +
Sbjct  51   GEGKGSAPSPPS-----LDTCGC--GPAPAPAPSEFLNEKLRSLYPVIQAFKQRITSDLR  103

Query  305  NVTQSWEGNELC---INKKKYQGFFCYVPRGGDKKR----Vggiyfngynfngnglslns  463
             VT SW G  LC        Y+GF+C  P   D  +    +     +   +     SL  
Sbjct  104  GVTASWVGPNLCDSYFGGNMYKGFYCDHPPVNDAPQDNTTLTIASIDFNGYGLAAPSLAG  163

Query  464  FVESFNDLVVIHVNSNNFTGAPGIP-VQKFPTLFELDLSNNKLAGAFPTAVLEATNLTYL  640
            FV++F +L + H NSNNF+G   +P +   P  +ELDLSNN  +GAFP  V+    L +L
Sbjct  164  FVDAFPELALFHANSNNFSGE--VPDLTALPYFYELDLSNNNFSGAFPANVVPLGRLLFL  221

Query  641  DLRFNMLTGPVHPQV  685
            DLRFN   G V P V
Sbjct  222  DLRFNHFVGTVPPPV  236



>gb|AEV41023.1| uncharacterized protein At4g06744 precursor [Oryza minuta]
Length=472

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 57/148 (39%), Positives = 76/148 (51%), Gaps = 10/148 (7%)
 Frame = +2

Query  266  IRTFKKSITYDPQNVTQSWEGNELC---INKKKYQGFFCYVP----RGGDKKRVggiyfn  424
            I+ FK +IT DP+ VT SW G  LC        Y+GF+C  P       D   +     +
Sbjct  104  IQAFKTTITSDPRGVTASWVGPNLCDSYFGGNMYKGFYCDHPPVKDAPQDDTTLTIASID  163

Query  425  gynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIP-VQKFPTLFELDLSNNKLAGAF  601
               +     SL  F+++F DL + H NSNNF+G   +P +   P  +ELDLSNN  +G F
Sbjct  164  FNGYGLGAPSLAGFIDAFPDLALFHANSNNFSGD--VPDLTGLPYFYELDLSNNNFSGVF  221

Query  602  PTAVLEATNLTYLDLRFNMLTGPVHPQV  685
            P  V+    L +LDLRFN   G V P V
Sbjct  222  PANVVPLGGLLFLDLRFNRFVGTVPPPV  249



>ref|XP_010094651.1| Uncharacterized protein L484_008883 [Morus notabilis]
 gb|EXB56502.1| Uncharacterized protein L484_008883 [Morus notabilis]
Length=437

 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 56/137 (41%), Positives = 79/137 (58%), Gaps = 4/137 (3%)
 Frame = +2

Query  275  FKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfngngls  454
             K++ITYDP N T +W GN  C+    ++G++C      +   +  I FNG  F G  L+
Sbjct  80   LKRNITYDPFNYTGTWVGNNYCL----FKGYYCDTVPDLNITGLASIDFNGARFGGRFLN  135

Query  455  lnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEATNLT  634
               +  +  D+ + H NSNNF+G     + +   L+ELDLSNN+  GAFP  VL ATNLT
Sbjct  136  FYRYSRNLPDIALFHANSNNFSGVINRNINQLRYLYELDLSNNRFLGAFPFYVLGATNLT  195

Query  635  YLDLRFNMLTGPVHPQV  685
            ++DLRFN   G V  Q+
Sbjct  196  FVDLRFNRYAGGVPTQL  212



>ref|XP_010227187.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Brachypodium distachyon]
Length=1492

 Score = 92.0 bits (227),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 55/145 (38%), Positives = 80/145 (55%), Gaps = 7/145 (5%)
 Frame = +2

Query  245  IRKSIKAIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfn  424
            + ++   I+ FKK++  DPQN+  SW G ++C     Y+GF+C  P     + V     +
Sbjct  79   LYRAYLVIQKFKKTVICDPQNIAGSWSGTDIC-GTSSYKGFYCDRPYKVTDRTV--ASVD  135

Query  425  gynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIP-VQKFPTLFELDLSNNKLA-GA  598
               +     S+  FV+   DL + H NSNNF GA  +P ++     +ELDLSNNKLA  A
Sbjct  136  FNGYGLQADSVQGFVDGLPDLALFHANSNNFGGA--VPNLKSLQYFYELDLSNNKLAPAA  193

Query  599  FPTAVLEATNLTYLDLRFNMLTGPV  673
            FP  VL  TN T++D+RFN   G +
Sbjct  194  FPLEVLAITNATFIDIRFNSFYGEL  218



>gb|ACG34018.1| protein binding protein [Zea mays]
 tpg|DAA37048.1| TPA: leucine-rich repeat (LRR) family protein [Zea mays]
Length=442

 Score = 90.1 bits (222),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 56/145 (39%), Positives = 81/145 (56%), Gaps = 10/145 (7%)
 Frame = +2

Query  245  IRKSIKAIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfn  424
            + ++   I+ F+ ++T DP  VTQSW G ++C     Y+GFFC  P     + +     +
Sbjct  82   LYRAYLVIQQFRSTVTCDPMGVTQSWSGTDVC----SYKGFFCERPPNVTDRAI--ASVD  135

Query  425  gynfngnglslnsFVESFNDLVVIHVNSNNFTGA-PGIPVQKFPTLFELDLSNNKLA-GA  598
               +     SL  FV+S  DL + H NSN+F GA P +   ++   +ELDLSNNKLA  A
Sbjct  136  FNGYMLQAGSLRGFVDSLPDLALFHANSNDFGGAVPALGGLQY--FYELDLSNNKLAPAA  193

Query  599  FPTAVLEATNLTYLDLRFNMLTGPV  673
            FP  VL  TN T++D+RFN   G +
Sbjct  194  FPADVLGLTNATFVDIRFNSFYGEL  218



>ref|NP_001054210.2| Os04g0670100 [Oryza sativa Japonica Group]
 emb|CAE02822.1| OSJNBa0043A12.27 [Oryza sativa Japonica Group]
 dbj|BAF16124.2| Os04g0670100 [Oryza sativa Japonica Group]
Length=446

 Score = 90.1 bits (222),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 58/151 (38%), Positives = 77/151 (51%), Gaps = 13/151 (9%)
 Frame = +2

Query  266  IRTFKKSITYDPQNVTQSWEGNELC---INKKKYQGFFC-------YVPRGGDKKRVggi  415
            I+ FK +IT DP+ VT SW G  LC        Y+GF+C             D   +   
Sbjct  76   IQAFKATITSDPRGVTASWVGPNLCDSYFGGDMYKGFYCEHPPAPPGATTPKDNTTLTIA  135

Query  416  yfngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIP-VQKFPTLFELDLSNNKLA  592
              +   +     SL+ FV++F DL + H NSNNF+G   +P +   P  +ELDLSNN  +
Sbjct  136  SIDFNGYGLGAPSLSGFVDAFPDLALFHANSNNFSGE--VPDLTGLPYFYELDLSNNNFS  193

Query  593  GAFPTAVLEATNLTYLDLRFNMLTGPVHPQV  685
            GAFP  V+    L +LDLRFN   G V P V
Sbjct  194  GAFPATVVPLGRLLFLDLRFNRFVGTVPPPV  224



>gb|AIE88270.1| hypothetical protein OG_BBa0063K01.1 [Oryza glaberrima]
Length=484

 Score = 90.5 bits (223),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 58/151 (38%), Positives = 76/151 (50%), Gaps = 13/151 (9%)
 Frame = +2

Query  266  IRTFKKSITYDPQNVTQSWEGNELC---INKKKYQGFFC-------YVPRGGDKKRVggi  415
            I+ FK +IT DP+ VT SW G  LC        Y+GF+C             D   +   
Sbjct  114  IQAFKATITSDPRGVTASWVGPNLCDSYFGGDMYKGFYCEHPPAPPGATPPKDNTTLTIA  173

Query  416  yfngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIP-VQKFPTLFELDLSNNKLA  592
              +   +     SL  FV++F DL + H NSNNF+G   +P +   P  +ELDLSNN  +
Sbjct  174  SIDFNGYGLGAPSLAGFVDAFPDLALFHANSNNFSGE--VPDLTGLPYFYELDLSNNNFS  231

Query  593  GAFPTAVLEATNLTYLDLRFNMLTGPVHPQV  685
            GAFP  V+    L +LDLRFN   G V P V
Sbjct  232  GAFPATVVPLGRLLFLDLRFNRFVGTVPPPV  262



>gb|EMS61305.1| hypothetical protein TRIUR3_11917 [Triticum urartu]
Length=414

 Score = 89.7 bits (221),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 55/144 (38%), Positives = 79/144 (55%), Gaps = 5/144 (3%)
 Frame = +2

Query  245  IRKSIKAIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfn  424
            + ++   I+ FK++IT DPQ +T +W G  +C N   Y GFFC  P   + K       +
Sbjct  45   LYRAYLVIQRFKQTITCDPQGITNTWTGTAICSN-TSYLGFFCEAPP--NVKERALASVD  101

Query  425  gynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAG-AF  601
               F     ++  FV++  DL + H NSN+F G   I ++     +ELD+SNNKLA  AF
Sbjct  102  FNGFKLEAPTVEGFVDALPDLALFHANSNDFGGVVPI-LRSLQYFYELDVSNNKLARCAF  160

Query  602  PTAVLEATNLTYLDLRFNMLTGPV  673
            P  VL  TN T++D+RFN   G V
Sbjct  161  PADVLGITNATFVDIRFNQFYGEV  184



>ref|XP_002518709.1| serine-threonine protein kinase, plant-type, putative [Ricinus 
communis]
 gb|EEF43634.1| serine-threonine protein kinase, plant-type, putative [Ricinus 
communis]
Length=510

 Score = 90.5 bits (223),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 62/149 (42%), Positives = 83/149 (56%), Gaps = 3/149 (2%)
 Frame = +2

Query  245  IRKSIKAIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfn  424
            I++    I+ FKK+IT+DP ++T SW+     +    Y+GF C +        V    FN
Sbjct  132  IKRDYFTIQKFKKTITHDPFHITDSWKEGVFNV-CATYKGFACDIRPDMGVLAVAAADFN  190

Query  425  gynfngnglslnsFVESFNDLVVIHVNSNNFTGA--PGIPVQKFPTLFELDLSNNKLAGA  598
            GYNFNG    +  F++   D+ + H NSNNFTG     I +     L+ELDLSNN   G 
Sbjct  191  GYNFNGPNFQIKGFLDKLEDVAIFHANSNNFTGIVPQNIDIMNINFLYELDLSNNNYTGG  250

Query  599  FPTAVLEATNLTYLDLRFNMLTGPVHPQV  685
            FP  VL ATNLT+LD+RFN   G V  +V
Sbjct  251  FPMNVLGATNLTFLDIRFNKFYGSVPKEV  279



>gb|KJB12465.1| hypothetical protein B456_002G019800 [Gossypium raimondii]
Length=402

 Score = 89.4 bits (220),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 54/150 (36%), Positives = 78/150 (52%), Gaps = 6/150 (4%)
 Frame = +2

Query  236  DPVIRKSIKAIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggi  415
            +P ++++  A++ FKK I  DP N+T +W G ++C    KY G +C  P   DK  +  +
Sbjct  42   NPKLQQAYTALQAFKKVIYSDPNNITTNWVGPDVC----KYTGLYC-APHPHDKT-IKVV  95

Query  416  yfngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAG  595
                 N       L   +    DL +IH+NSN F G     +     LFELDLSNN+  G
Sbjct  96   AGIDLNGYDIAGYLPDELGLLTDLALIHLNSNRFCGIVPQTLSNLSHLFELDLSNNRFVG  155

Query  596  AFPTAVLEATNLTYLDLRFNMLTGPVHPQV  685
             FPT VL   +L YLD+R+N   G +  Q+
Sbjct  156  PFPTVVLSLPSLKYLDIRYNEFEGSLPAQL  185



>ref|XP_004955608.1| PREDICTED: leucine-rich repeat extensin-like protein 3-like [Setaria 
italica]
Length=437

 Score = 89.7 bits (221),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 51/150 (34%), Positives = 80/150 (53%), Gaps = 6/150 (4%)
 Frame = +2

Query  236  DPVIRKSIKAIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggi  415
            +P ++++  A++  K++IT DP+N+T+ W G ++C     Y G FC      D      +
Sbjct  105  NPRLQRAYVALQALKRAITDDPKNLTRGWCGPDVCA----YFGVFCAA--APDDPHALTV  158

Query  416  yfngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAG  595
                 N      +    +   +DL ++H+NSN F G     + K   L ELD+SNN+L+G
Sbjct  159  AGLDLNHGDLAGTFPEELGMLSDLALLHLNSNRFAGGLPESLPKLHLLHELDVSNNRLSG  218

Query  596  AFPTAVLEATNLTYLDLRFNMLTGPVHPQV  685
             FP  +L   N+ Y+DLRFN L GPV P +
Sbjct  219  GFPQHILCLPNVKYVDLRFNNLCGPVPPAI  248



>gb|AGE09569.1| LRRK-like protein [Eucalyptus cladocalyx]
Length=421

 Score = 89.7 bits (221),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 52/143 (36%), Positives = 81/143 (57%), Gaps = 7/143 (5%)
 Frame = +2

Query  245  IRKSIKAIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfn  424
            +  +  A++ +K ++T DP  + ++W G+++C     Y+G FC   R G    V GI  N
Sbjct  72   LSNAYTALQAWKSAVTDDPNKIMETWVGSDVC----SYKGVFCSDSRDGMGPFVAGIDLN  127

Query  425  gynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFP  604
              N  G  +   S +    D+ ++H+NSN F+G+    ++   +L ELDLSNN+ +G FP
Sbjct  128  RANVQGTLVEELSLL---TDMTLLHLNSNRFSGSVPDTLRDLSSLQELDLSNNQFSGPFP  184

Query  605  TAVLEATNLTYLDLRFNMLTGPV  673
               LE  NL YLDLRFN  +GP+
Sbjct  185  AVALEIPNLIYLDLRFNSFSGPI  207



>dbj|BAJ86461.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=444

 Score = 89.7 bits (221),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 58/145 (40%), Positives = 82/145 (57%), Gaps = 9/145 (6%)
 Frame = +2

Query  245  IRKSIKAIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfn  424
            + ++   I+ F+K++  DP+ VT +W G +LC     Y+GFFC  P     + V     +
Sbjct  77   LYRAYLVIQKFRKTVICDPKGVTTTWAGTDLC---GSYKGFFCGRPINVSDRTV--ASVD  131

Query  425  gynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIP-VQKFPTLFELDLSNNKLAGA-  598
               +N    SL  FV+   DL + H NSNNF GA  +P ++     +ELDLSNNKLA A 
Sbjct  132  LNGYNLRSDSLQGFVDGLPDLALFHANSNNFGGA--VPNLRGLQYFYELDLSNNKLAPAP  189

Query  599  FPTAVLEATNLTYLDLRFNMLTGPV  673
            FPT VL  TN T++D+RFN   G +
Sbjct  190  FPTDVLGLTNCTFIDIRFNSFFGEL  214



>ref|XP_008794093.1| PREDICTED: LOW QUALITY PROTEIN: leucine-rich repeat extensin-like 
protein 3 [Phoenix dactylifera]
Length=423

 Score = 89.7 bits (221),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 54/153 (35%), Positives = 75/153 (49%), Gaps = 7/153 (5%)
 Frame = +2

Query  236  DPVIRKSIKAIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggi  415
            DP+  +   A++ +K +IT DP  +  SW G ++C     Y+G FC  P           
Sbjct  55   DPIPSREYAALQAWKSAITEDPSGILSSWVGPDVC----SYKGIFCSDPPEDMXASSATT  110

Query  416  yfngynfngnglslnsFVESFN---DLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNK  586
                           S V+  +    L +IH+NSN F+G      ++F  L ELDLSNN 
Sbjct  111  SVVAGIDLNRANLKGSLVKELSLLTHLSIIHLNSNRFSGTVPDSFREFQYLSELDLSNNL  170

Query  587  LAGAFPTAVLEATNLTYLDLRFNMLTGPVHPQV  685
            L+G FPT+ L   NL YLDLRFN  +G V  +V
Sbjct  171  LSGPFPTSTLVVPNLKYLDLRFNSFSGEVPDEV  203



>ref|XP_010228296.1| PREDICTED: leucine-rich repeat extensin-like protein 6 [Brachypodium 
distachyon]
Length=370

 Score = 89.0 bits (219),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 49/150 (33%), Positives = 76/150 (51%), Gaps = 6/150 (4%)
 Frame = +2

Query  236  DPVIRKSIKAIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggi  415
            +P ++++  A++  K +IT DP+N+T +W G ++C     Y G FC         R    
Sbjct  39   NPRLQRAYSALQALKHAITDDPRNLTSNWCGPDVC----AYYGVFCAAALDDPCSRAVAG  94

Query  416  yfngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAG  595
                +            +    D+ V+H+NSN F G     + K   L ELD+SNN+L+G
Sbjct  95   LDLNHGDIAGTFPDELGL--LTDIAVLHLNSNRFAGTLPETLPKLSLLHELDVSNNRLSG  152

Query  596  AFPTAVLEATNLTYLDLRFNMLTGPVHPQV  685
             FP  +L   N+ Y+D+RFN L GPV P +
Sbjct  153  GFPQHILCLPNVKYVDIRFNNLCGPVPPAI  182



>gb|KJB77660.1| hypothetical protein B456_012G149500 [Gossypium raimondii]
Length=449

 Score = 89.7 bits (221),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 60/151 (40%), Positives = 83/151 (55%), Gaps = 8/151 (5%)
 Frame = +2

Query  245  IRKSIKAIRTFKKSITYDP--QNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiy  418
            + K+   I+ FK+ I  D   +   ++W G ++C    KY+G +C +     +K V G+ 
Sbjct  77   LAKAYDVIQRFKEKIKVDANSEKYLKTWCGTDVC----KYRGIYCDIRPDVKEKAVAGVD  132

Query  419  fngynfngnglsl--nsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLA  592
            FNG  F G   +L  + F +  +DL + H NSNNFTG       K   L+ELDLSNNK+A
Sbjct  133  FNGAKFAGCDGTLPLDGFFDELDDLAIFHANSNNFTGTVPFKASKIKYLYELDLSNNKIA  192

Query  593  GAFPTAVLEATNLTYLDLRFNMLTGPVHPQV  685
            G FP   L   NLT+LDLR+N L G V  Q 
Sbjct  193  GGFPMKTLSTMNLTFLDLRYNSLKGTVPQQA  223



>gb|EMT03089.1| hypothetical protein F775_11041 [Aegilops tauschii]
Length=447

 Score = 89.7 bits (221),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 59/145 (41%), Positives = 82/145 (57%), Gaps = 9/145 (6%)
 Frame = +2

Query  245  IRKSIKAIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfn  424
            + ++   I+ F+K++  DP+ VT +W G +LC     Y+GFFC  P     + V     +
Sbjct  80   LYRAYLVIQKFRKTVICDPKGVTATWAGTDLC---GSYKGFFCGRPINVSDRTV--ASVD  134

Query  425  gynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIP-VQKFPTLFELDLSNNKLAGA-  598
               FN    SL  FV+   DL + H NSNNF GA  +P ++     +ELDLSNNKLA A 
Sbjct  135  LNGFNLRSDSLQGFVDGLPDLALFHANSNNFGGA--VPNLRGLQYFYELDLSNNKLAPAP  192

Query  599  FPTAVLEATNLTYLDLRFNMLTGPV  673
            FPT VL  TN T++D+RFN   G +
Sbjct  193  FPTDVLGLTNCTFIDIRFNSFFGEL  217



>ref|XP_007017156.1| LRR-family protein [Theobroma cacao]
 gb|EOY14381.1| LRR-family protein [Theobroma cacao]
Length=441

 Score = 89.7 bits (221),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 53/134 (40%), Positives = 74/134 (55%), Gaps = 9/134 (7%)
 Frame = +2

Query  278  KKSITYDPQNVTQSWEGNELCINKKKYQGFFC-YVPRGGDKKRVggiyfngynfngngls  454
            K++IT+DPQN T +W GN  C+    ++G+ C  VP   D+   G    +       G  
Sbjct  87   KRNITFDPQNYTGTWVGNNYCL----FKGYICDTVP---DRNITGLAGIDFNGARFGGNL  139

Query  455  l-nsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEATNL  631
                F+ +  D+ + H NSNNF+G     +      +E+DLSNNK  G FP+ VL ATNL
Sbjct  140  NFYRFITNLPDIAIFHANSNNFSGVINQGLNGLRYFYEIDLSNNKFMGGFPSNVLGATNL  199

Query  632  TYLDLRFNMLTGPV  673
            T++DLRFN   GPV
Sbjct  200  TFVDLRFNKYLGPV  213



>ref|XP_006389336.1| hypothetical protein POPTR_0028s00200g, partial [Populus trichocarpa]
 gb|ERP48250.1| hypothetical protein POPTR_0028s00200g, partial [Populus trichocarpa]
Length=500

 Score = 90.1 bits (222),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 53/146 (36%), Positives = 78/146 (53%), Gaps = 6/146 (4%)
 Frame = +2

Query  236  DPVIRKSIKAIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggi  415
            +P ++ +  A++ +K++I  DP N+T +W G+++C     Y+G FC   R  D K +  +
Sbjct  32   NPRLKNAYMALQAWKQAIFSDPLNLTANWVGSQVC----NYEGVFC--SRAPDNKTIRTV  85

Query  416  yfngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAG  595
                 N       L   +    DL + H+NSN F G      +K   LFELDLSNN+ AG
Sbjct  86   AGIDLNHGDIAGYLPEELGFLVDLALFHINSNRFCGTIPHKFKKLRLLFELDLSNNRFAG  145

Query  596  AFPTAVLEATNLTYLDLRFNMLTGPV  673
             FP  VL+  +L +LDLRFN   G V
Sbjct  146  KFPQVVLKLPSLKFLDLRFNEFEGTV  171



>ref|XP_010049599.1| PREDICTED: leucine-rich repeat extensin-like protein 4 [Eucalyptus 
grandis]
Length=446

 Score = 89.7 bits (221),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 52/148 (35%), Positives = 81/148 (55%), Gaps = 5/148 (3%)
 Frame = +2

Query  245  IRKSIKAIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGG-DKKRVggiyf  421
            +  +  A++ +K SIT DPQ V ++W G  +C     Y+G FC   + G  +     +  
Sbjct  83   LEAAYNALQAWKTSITEDPQGVLRNWVGPNVC----SYKGIFCADSQEGFLESNGPVLAG  138

Query  422  ngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAF  601
               N      +L   + S  DL + H+NSN F+G+         +L ELDLSNN+ +G F
Sbjct  139  IDLNRANLLGTLAPELSSLADLTLFHLNSNRFSGSVPSSFAGLASLQELDLSNNRFSGTF  198

Query  602  PTAVLEATNLTYLDLRFNMLTGPVHPQV  685
            P+AVL+  +L YLDLR+N  +GP+ P++
Sbjct  199  PSAVLDMPSLLYLDLRYNNFSGPIPPEL  226



>ref|XP_006389464.1| hypothetical protein POPTR_0024s00730g [Populus trichocarpa]
 gb|ERP48378.1| hypothetical protein POPTR_0024s00730g [Populus trichocarpa]
Length=569

 Score = 90.5 bits (223),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 53/146 (36%), Positives = 78/146 (53%), Gaps = 6/146 (4%)
 Frame = +2

Query  236  DPVIRKSIKAIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggi  415
            +P ++ +  A++ +K++I  DP N+T +W G+++C     Y+G FC   R  D K +  +
Sbjct  78   NPRLKNAYMALQAWKQAIFSDPLNLTANWVGSQVC----NYEGVFC--SRAPDNKTIRTV  131

Query  416  yfngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAG  595
                 N       L   +    DL + H+NSN F G      +K   LFELDLSNN+ AG
Sbjct  132  AGIDLNHGDIAGYLPEELGFLVDLALFHINSNRFCGTIPHKFKKLRLLFELDLSNNRFAG  191

Query  596  AFPTAVLEATNLTYLDLRFNMLTGPV  673
             FP  VL+  +L +LDLRFN   G V
Sbjct  192  KFPQVVLKLPSLKFLDLRFNEFEGTV  217



>ref|XP_006451102.1| hypothetical protein CICLE_v100107081mg, partial [Citrus clementina]
 gb|ESR64342.1| hypothetical protein CICLE_v100107081mg, partial [Citrus clementina]
Length=190

 Score = 86.7 bits (213),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 53/146 (36%), Positives = 73/146 (50%), Gaps = 6/146 (4%)
 Frame = +2

Query  236  DPVIRKSIKAIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggi  415
            +P IR +  A++ +K++I  DP N+T  W G+ +C     Y G FC  P   D KR+  +
Sbjct  47   NPRIRNAYIALQAWKQAILSDPYNLTADWVGSAVC----SYTGVFC-AP-APDNKRIRTV  100

Query  416  yfngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAG  595
                 N       L   +    DL + H+NSN F G      +    LFELDLSNN+ AG
Sbjct  101  AGIDLNHGDIAGYLPEELGLLTDLALFHINSNRFCGTVPHKFENLKLLFELDLSNNRFAG  160

Query  596  AFPTAVLEATNLTYLDLRFNMLTGPV  673
             FP  +L    L +LDLR+N   G V
Sbjct  161  KFPKVLLRLPQLKFLDLRYNEFEGTV  186



>ref|XP_011093658.1| PREDICTED: leucine-rich repeat extensin-like protein 4 [Sesamum 
indicum]
Length=399

 Score = 89.0 bits (219),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 53/148 (36%), Positives = 75/148 (51%), Gaps = 9/148 (6%)
 Frame = +2

Query  239  PVIRKSIKAIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPR---GGDKKRVg  409
            P   ++  A++ +K  IT DP  VT+SW G  +C     Y+G FC   R   G     V 
Sbjct  52   PTASRAYTALQAWKSVITDDPLGVTKSWVGPNVC----SYKGVFCSDSRDFMGNPAGEVV  107

Query  410  giyfngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKL  589
                  +      L     +    DL + H+NSN F+G+  +  ++  +L ELDLSNN  
Sbjct  108  AAIDLNHANLQGILVKE--LSLLTDLSIFHLNSNRFSGSVPLSFRELSSLTELDLSNNHF  165

Query  590  AGAFPTAVLEATNLTYLDLRFNMLTGPV  673
            +GAFP  V+   NL YLDLRFN  +GP+
Sbjct  166  SGAFPATVVYIPNLVYLDLRFNSFSGPI  193



>ref|XP_003566833.2| PREDICTED: leucine-rich repeat extensin-like protein 3, partial 
[Brachypodium distachyon]
Length=518

 Score = 90.1 bits (222),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 56/150 (37%), Positives = 77/150 (51%), Gaps = 6/150 (4%)
 Frame = +2

Query  236  DPVIRKSIKAIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggi  415
            +P +R +  A++++K++I  DP+NVT SW G ++C     Y G FC  P   D   +  +
Sbjct  25   NPRLRDAYVALQSWKRAILSDPRNVTGSWSGPDVC----AYYGVFC-APSESDHY-LTVV  78

Query  416  yfngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAG  595
                 N       L   +   +DL V HVNSN F G           L ELDLSNN+  G
Sbjct  79   AGVDLNHADLAGHLPEELGLLSDLSVFHVNSNRFCGVVPRSFHNLGLLHELDLSNNRFVG  138

Query  596  AFPTAVLEATNLTYLDLRFNMLTGPVHPQV  685
            AFP  VL   +L YLDLR+N   G V P++
Sbjct  139  AFPDVVLRMPSLKYLDLRYNEFEGAVPPEL  168



>ref|XP_002447298.1| hypothetical protein SORBIDRAFT_06g032310 [Sorghum bicolor]
 gb|EES11626.1| hypothetical protein SORBIDRAFT_06g032310 [Sorghum bicolor]
Length=449

 Score = 89.7 bits (221),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 60/153 (39%), Positives = 83/153 (54%), Gaps = 10/153 (7%)
 Frame = +2

Query  233  LDPVIRKSIKAIRTFKKSITYDPQNVTQSWEGNELCIN----KKKYQGFFCYVPRGGDKK  400
            L+  +R     I+ FK++IT DP  VT +W G ELC +       Y+GF+C  P   D  
Sbjct  73   LNEKLRSLYPVIQAFKQTITCDPLGVTATWTGTELCDSFFNGTTYYKGFYCDYPP--DAP  130

Query  401  RVggiyfngynfngngl-slnsFVESFNDLVVIHVNSNNFTGAPGIP-VQKFPTLFELDL  574
             V  +    +N  G    SL  F+++F DL + H NSNNF+G   +P +      +ELDL
Sbjct  131  GVLTVASIDFNGFGLCAPSLAGFIDAFPDLALFHANSNNFSGD--VPDLTHLQYFYELDL  188

Query  575  SNNKLAGAFPTAVLEATNLTYLDLRFNMLTGPV  673
            SNN  +GAFP +V+    L +LDLRFN   G V
Sbjct  189  SNNNFSGAFPDSVVPLGGLLFLDLRFNRYAGTV  221



>ref|XP_003555862.1| PREDICTED: uncharacterized protein At4g06744-like [Glycine max]
 gb|KHN32258.1| Hypothetical protein glysoja_039284 [Glycine soja]
Length=454

 Score = 89.7 bits (221),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 58/153 (38%), Positives = 82/153 (54%), Gaps = 11/153 (7%)
 Frame = +2

Query  245  IRKSIKAIRTFKKSITYDPQNVTQSW-EGNELCINKKKYQGFFCYVPRGGDKKRVggiyf  421
            + K+ + +  FK ++ YDP   TQSW E  + C     + G  C      ++K V G+  
Sbjct  83   LEKARRVLLKFK-TLIYDPDCYTQSWNENTDTC----DFNGVRCATYPNSEEKAVAGLDL  137

Query  422  ngynfngnglsl---nsFVESFNDLVVIHVNSNNFTGAPGIP--VQKFPTLFELDLSNNK  586
            NG   +            V+S  +L   HVNSNNF+   G P  +  FP  FELDLSNNK
Sbjct  138  NGAKLSTKDGCNLPLTGLVDSIPELTFFHVNSNNFSFTGGFPNNITTFPFFFELDLSNNK  197

Query  587  LAGAFPTAVLEATNLTYLDLRFNMLTGPVHPQV  685
            ++G FPT  ++   L +LDLRFN LTGP+ P++
Sbjct  198  VSGQFPTQAIQNNQLVFLDLRFNQLTGPIDPKL  230



>ref|XP_004157952.1| PREDICTED: leucine-rich repeat extensin-like protein 4-like [Cucumis 
sativus]
Length=409

 Score = 89.0 bits (219),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 51/147 (35%), Positives = 75/147 (51%), Gaps = 8/147 (5%)
 Frame = +2

Query  233  LDPVIRKSIKAIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVgg  412
            L+ V+ ++   ++T+K +I+ DP  +  +W G+++C     YQG FC     G     G 
Sbjct  68   LETVLNRAYTVLQTWKSAISDDPTGMLTTWVGSDVC----SYQGIFCTRLNSGQMSITGI  123

Query  413  iyfngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLA  592
             +                +   NDL +IH+NSN F G   +  ++   L ELDLSNN  +
Sbjct  124  DFNGKNLRGTLIKE----LALLNDLTLIHLNSNRFYGIVPVTFRQLVRLQELDLSNNNFS  179

Query  593  GAFPTAVLEATNLTYLDLRFNMLTGPV  673
            G FP+A L   NL YLDLRFN  TG +
Sbjct  180  GGFPSATLYIPNLRYLDLRFNSFTGGI  206



>ref|NP_001141186.1| leucine-rich repeat (LRR) family protein precursor [Zea mays]
 gb|ACF85658.1| unknown [Zea mays]
 gb|AFW59826.1| leucine-rich repeat (LRR) family protein [Zea mays]
Length=431

 Score = 89.4 bits (220),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 60/152 (39%), Positives = 82/152 (54%), Gaps = 13/152 (9%)
 Frame = +2

Query  245  IRKSIKAIRTFKKSITYDPQNVTQSWEGNELCIN-------KKKYQGFFCYVPRGGDKKR  403
            +R     I+ FK++IT DP  VT +W G ELC +          Y+GF+C  P   D   
Sbjct  69   LRALYPVIQAFKQTITCDPLGVTATWTGTELCDSFFNNGSTTTYYRGFYCDYPP--DAPG  126

Query  404  Vggiyfngynfngngl-slnsFVESFNDLVVIHVNSNNFTG-APGIPVQKFPTLFELDLS  577
            V  +    +N  G    SL  F+++F DL + H NSNNF+G  P +   ++   +ELDLS
Sbjct  127  VLTVASIDFNGFGLCAPSLAGFIDAFPDLALFHANSNNFSGDVPDLTQLRY--FYELDLS  184

Query  578  NNKLAGAFPTAVLEATNLTYLDLRFNMLTGPV  673
            NN  +GAFP AV+    L +LDLRFN   G V
Sbjct  185  NNNFSGAFPEAVVPLGGLLFLDLRFNRYAGEV  216



>gb|KCW82299.1| hypothetical protein EUGRSUZ_C03706, partial [Eucalyptus grandis]
Length=426

 Score = 89.0 bits (219),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 52/148 (35%), Positives = 81/148 (55%), Gaps = 5/148 (3%)
 Frame = +2

Query  245  IRKSIKAIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGG-DKKRVggiyf  421
            +  +  A++ +K SIT DPQ V ++W G  +C     Y+G FC   + G  +     +  
Sbjct  63   LEAAYNALQAWKTSITEDPQGVLRNWVGPNVC----SYKGIFCADSQEGFLESNGPVLAG  118

Query  422  ngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAF  601
               N      +L   + S  DL + H+NSN F+G+         +L ELDLSNN+ +G F
Sbjct  119  IDLNRANLLGTLAPELSSLADLTLFHLNSNRFSGSVPSSFAGLASLQELDLSNNRFSGTF  178

Query  602  PTAVLEATNLTYLDLRFNMLTGPVHPQV  685
            P+AVL+  +L YLDLR+N  +GP+ P++
Sbjct  179  PSAVLDMPSLLYLDLRYNNFSGPIPPEL  206



>ref|XP_004141032.1| PREDICTED: leucine-rich repeat extensin-like protein 4-like [Cucumis 
sativus]
 gb|KGN60563.1| hypothetical protein Csa_2G000710 [Cucumis sativus]
Length=409

 Score = 89.0 bits (219),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 51/147 (35%), Positives = 75/147 (51%), Gaps = 8/147 (5%)
 Frame = +2

Query  233  LDPVIRKSIKAIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVgg  412
            L+ V+ ++   ++T+K +I+ DP  +  +W G+++C     YQG FC     G     G 
Sbjct  68   LETVLNRAYTVLQTWKSAISDDPTGMLTTWVGSDVC----SYQGIFCTRLNSGQMSITGI  123

Query  413  iyfngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLA  592
             +                +   NDL +IH+NSN F G   +  ++   L ELDLSNN  +
Sbjct  124  DFNGKNLRGTLIKE----LALLNDLTLIHLNSNRFYGIVPVTFRQLVRLQELDLSNNNFS  179

Query  593  GAFPTAVLEATNLTYLDLRFNMLTGPV  673
            G FP+A L   NL YLDLRFN  TG +
Sbjct  180  GGFPSATLYIPNLRYLDLRFNSFTGGI  206



>ref|XP_001759047.1| predicted protein [Physcomitrella patens]
 gb|EDQ76116.1| predicted protein [Physcomitrella patens]
Length=465

 Score = 89.4 bits (220),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 50/135 (37%), Positives = 71/135 (53%), Gaps = 4/135 (3%)
 Frame = +2

Query  263  AIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfng  442
            A+R +KK+IT DP+NVT+SW+G  +C    +Y+G FC  P G     +  +     N   
Sbjct  84   ALRAWKKAITDDPKNVTRSWKGKYVC----RYEGVFCQHPPGQKYSSIKVVAAIDLNGAH  139

Query  443  nglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEA  622
               +L   +    ++ V H+NSN F G      +    L+ELDLSNN+ +G FP   L  
Sbjct  140  LKGTLVPELGLLREIAVFHLNSNRFCGGVPDSFRNMKLLYELDLSNNQFSGRFPMVTLAI  199

Query  623  TNLTYLDLRFNMLTG  667
              L +LDLRFN   G
Sbjct  200  PKLVFLDLRFNKFYG  214



>gb|ACG42798.1| leucine-rich repeat, plant specific [Zea mays]
Length=431

 Score = 89.0 bits (219),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 60/152 (39%), Positives = 82/152 (54%), Gaps = 13/152 (9%)
 Frame = +2

Query  245  IRKSIKAIRTFKKSITYDPQNVTQSWEGNELCIN-------KKKYQGFFCYVPRGGDKKR  403
            +R     I+ FK++IT DP  VT +W G ELC +          Y+GF+C  P   D   
Sbjct  69   LRALYPVIQAFKQTITCDPLGVTATWTGTELCDSFFNNGSTTTYYRGFYCDYPP--DAPG  126

Query  404  Vggiyfngynfngngl-slnsFVESFNDLVVIHVNSNNFTG-APGIPVQKFPTLFELDLS  577
            V  +    +N  G    SL  F+++F DL + H NSNNF+G  P +   ++   +ELDLS
Sbjct  127  VLTVASIDFNGFGLCAPSLAGFIDAFPDLALFHANSNNFSGDVPDLTQLRY--FYELDLS  184

Query  578  NNKLAGAFPTAVLEATNLTYLDLRFNMLTGPV  673
            NN  +GAFP AV+    L +LDLRFN   G V
Sbjct  185  NNNFSGAFPEAVVPLGGLLFLDLRFNRYAGEV  216



>ref|XP_007043626.1| Leucine-rich repeat family protein [Theobroma cacao]
 gb|EOX99457.1| Leucine-rich repeat family protein [Theobroma cacao]
Length=410

 Score = 89.0 bits (219),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 52/150 (35%), Positives = 76/150 (51%), Gaps = 6/150 (4%)
 Frame = +2

Query  236  DPVIRKSIKAIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggi  415
            +P ++++  A++ +K+ I  DP N T +W G+++C     Y G FC  P    K +V   
Sbjct  50   NPKLQQAYNALQAWKRVIYSDPHNFTSNWVGHDVC----NYTGVFCAPPPYDKKIKVVAG  105

Query  416  yfngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAG  595
                       L     + S  DL +IH+NSN F G     +     LFELDLSNN+  G
Sbjct  106  IDLNGADIAGFLPDEFALLS--DLALIHINSNRFCGILPQTLANLSLLFELDLSNNRFVG  163

Query  596  AFPTAVLEATNLTYLDLRFNMLTGPVHPQV  685
             FP  VL   +L YLD+R+N   GP+  Q+
Sbjct  164  PFPYVVLSLPSLQYLDIRYNEFEGPLPAQL  193



>ref|XP_008775577.1| PREDICTED: LOW QUALITY PROTEIN: pollen-specific leucine-rich 
repeat extensin-like protein 3 [Phoenix dactylifera]
Length=714

 Score = 90.5 bits (223),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 52/146 (36%), Positives = 74/146 (51%), Gaps = 6/146 (4%)
 Frame = +2

Query  236  DPVIRKSIKAIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggi  415
            +P +R++  A++ +KK+I  DP N T +W G E+C     Y G FC   +  D   V  +
Sbjct  65   NPRLRRAYIALQAWKKAIYSDPLNFTGNWVGPEVC----TYNGVFCS--KALDDPNVTVV  118

Query  416  yfngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAG  595
                 N       L   +   ND+ + H+NSN F G       +   L ELD+SNN+  G
Sbjct  119  AGVDLNGADIAGYLPVELGLLNDIAIFHINSNRFCGVIPKSFSRLALLHELDVSNNRFVG  178

Query  596  AFPTAVLEATNLTYLDLRFNMLTGPV  673
            +FP  V+   NL YLDLRFN   GP+
Sbjct  179  SFPMVVIGLPNLKYLDLRFNDFEGPI  204



>ref|NP_193070.1| leucine-rich repeat extensin-like protein 3 [Arabidopsis thaliana]
 sp|Q9T0K5.1|LRX3_ARATH RecName: Full=Leucine-rich repeat extensin-like protein 3; Short=AtLRX3; 
Short=LRR/EXTENSIN3; AltName: Full=Cell wall hydroxyproline-rich 
glycoprotein; Flags: Precursor [Arabidopsis 
thaliana]
 emb|CAB40769.1| extensin-like protein [Arabidopsis thaliana]
 emb|CAB78376.1| extensin-like protein [Arabidopsis thaliana]
 gb|AEE83265.1| leucine-rich repeat extensin-like protein 3 [Arabidopsis thaliana]
Length=760

 Score = 90.5 bits (223),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 53/146 (36%), Positives = 76/146 (52%), Gaps = 6/146 (4%)
 Frame = +2

Query  236  DPVIRKSIKAIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggi  415
            +P +R +  A++ +K++I  DP N T +W G+ +C     Y G FC      D +++  +
Sbjct  63   NPRLRNAYIALQAWKQAILSDPNNFTSNWIGSNVC----NYTGVFCS--PALDNRKIRTV  116

Query  416  yfngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAG  595
                 N       L   +   +DL + HVNSN F G       +   LFELDLSNN+ AG
Sbjct  117  AGIDLNHADIAGYLPEELGLLSDLALFHVNSNRFCGTVPHRFNRLKLLFELDLSNNRFAG  176

Query  596  AFPTAVLEATNLTYLDLRFNMLTGPV  673
             FPT VL+  +L +LDLRFN   G V
Sbjct  177  KFPTVVLQLPSLKFLDLRFNEFEGTV  202



>gb|KJB12258.1| hypothetical protein B456_002G008600 [Gossypium raimondii]
Length=497

 Score = 89.4 bits (220),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 64/151 (42%), Positives = 84/151 (56%), Gaps = 9/151 (6%)
 Frame = +2

Query  236  DPVIRKSIKAIRTFKKSITYDP--QNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVg  409
            + ++  S   I+ FKK I  D   +  T++W G  +C    KY+GF C V     KK V 
Sbjct  116  NELLATSYGVIQKFKKLIKPDENGKRYTKTWNGPNVC----KYKGFNCDVRPDVKKKAVA  171

Query  410  giyfngynfngnglsl--nsFVESFNDLVVIHVNSNNFTGA-PGIPVQKFPTLFELDLSN  580
             + FNG   +G   SL  + F++   DL + H NSNNFTG  P I   K   L+ELDLSN
Sbjct  172  AVDFNGAKLSGINGSLPLHDFIDGLTDLAIFHANSNNFTGTVPFIGTSKIKYLYELDLSN  231

Query  581  NKLAGAFPTAVLEATNLTYLDLRFNMLTGPV  673
            NK+   FP  VL AT LT+LD+RFN + G V
Sbjct  232  NKITDDFPMEVLRATQLTFLDIRFNRIKGVV  262



>ref|XP_006354850.1| PREDICTED: uncharacterized protein At4g06744-like [Solanum tuberosum]
Length=384

 Score = 88.2 bits (217),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 50/140 (36%), Positives = 76/140 (54%), Gaps = 5/140 (4%)
 Frame = +2

Query  266  IRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfngn  445
            I+ FK  I+ DP  +T++W G  +C     Y GF+C  P   +   +     +   F  +
Sbjct  41   IQKFKNIISADPLGITKTWVGPNIC----NYTGFYCESPPD-NNSAIALASIDFNGFQLS  95

Query  446  glslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEAT  625
             L+L+ F++   D+ + H NSNNF G     +   P L+ELD+SNN+  G FP+ +L   
Sbjct  96   ALTLDGFLDQLPDIAIFHANSNNFGGTLSPKIANLPYLYELDISNNQFFGPFPSPILGMN  155

Query  626  NLTYLDLRFNMLTGPVHPQV  685
            +L  LD+RFN  TG V PQ+
Sbjct  156  SLNILDIRFNSFTGSVPPQL  175



>ref|XP_007012977.1| Leucine-rich repeat family protein / extensin family protein 
[Theobroma cacao]
 gb|EOY30596.1| Leucine-rich repeat family protein / extensin family protein 
[Theobroma cacao]
Length=412

 Score = 88.6 bits (218),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 50/144 (35%), Positives = 76/144 (53%), Gaps = 5/144 (3%)
 Frame = +2

Query  245  IRKSIKAIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGG-DKKRVggiyf  421
            +  +  A++ +K +IT DP  + ++W G+++C     Y+G FC  P+G  D      +  
Sbjct  61   LSTAYTALQAWKSAITDDPLGILKTWVGSDVC----SYKGVFCADPQGAMDSASGQFVAG  116

Query  422  ngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAF  601
               N      +L   + +  D+ ++H+NSN F+G      +   +L ELDLSNN  +G F
Sbjct  117  IDLNHANLLGTLVRELSALTDVSILHLNSNRFSGTVPDTFKDLLSLQELDLSNNHFSGPF  176

Query  602  PTAVLEATNLTYLDLRFNMLTGPV  673
            PT  L   NL YLDLRFN   GPV
Sbjct  177  PTVTLYIPNLVYLDLRFNSFAGPV  200



>ref|XP_009132101.1| PREDICTED: leucine-rich repeat extensin-like protein 5 [Brassica 
rapa]
Length=749

 Score = 90.1 bits (222),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 52/146 (36%), Positives = 75/146 (51%), Gaps = 6/146 (4%)
 Frame = +2

Query  236  DPVIRKSIKAIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggi  415
            +P +R +  A++ +K++I  DP N T +W G+++C     Y G +C      D  R+  +
Sbjct  75   NPRLRSAYVALQAWKQAILSDPNNFTTNWIGSDVC----SYTGVYC--APAPDNPRIRTV  128

Query  416  yfngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAG  595
                 N       L   +    DL + HVNSN F G       +   LFELDLSNN+ AG
Sbjct  129  AGIDLNHADIAGYLPQELGLLTDLALFHVNSNRFCGTVPHRFNRLKLLFELDLSNNRFAG  188

Query  596  AFPTAVLEATNLTYLDLRFNMLTGPV  673
             FP  +L+  +L +LDLRFN   GPV
Sbjct  189  IFPAVILQLPSLKFLDLRFNEFEGPV  214



>ref|XP_010532845.1| PREDICTED: leucine-rich repeat extensin-like protein 4 [Tarenaya 
hassleriana]
Length=648

 Score = 89.7 bits (221),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 54/146 (37%), Positives = 74/146 (51%), Gaps = 6/146 (4%)
 Frame = +2

Query  236  DPVIRKSIKAIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggi  415
            +P +R +  A++ +K++I  DP N T SW G+ +C     Y G FC      D  R+  +
Sbjct  83   NPRLRSAYIALQAWKQAILSDPFNFTASWVGSNVC----NYTGVFCSP--APDNHRIRTV  136

Query  416  yfngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAG  595
                 N       L   +    DL + H+NSN F G      ++   LFELDLSNN+ AG
Sbjct  137  AGIDLNHADIAGYLPEELGLLTDLALFHINSNRFCGTVPHRFRQLKLLFELDLSNNRFAG  196

Query  596  AFPTAVLEATNLTYLDLRFNMLTGPV  673
             FPT VL   +L +LDLRFN   G V
Sbjct  197  KFPTVVLHLPSLKFLDLRFNEFEGSV  222



>ref|XP_009395500.1| PREDICTED: uncharacterized protein At4g06744-like [Musa acuminata 
subsp. malaccensis]
Length=448

 Score = 88.6 bits (218),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 53/140 (38%), Positives = 69/140 (49%), Gaps = 6/140 (4%)
 Frame = +2

Query  266  IRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfngynfngn  445
            I+ FK+SIT DP  V Q+W G   C     YQGF+C  P                     
Sbjct  93   IQRFKRSITCDPNGVIQTWVGYRPC----TYQGFYCAAPPDSPDTPTIASVDFNGFRLCA  148

Query  446  glslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFPTAVLEAT  625
                  FV+   D+ + H NSNNF+G P   +   P L+ELD+SNN  +G FP  VL  +
Sbjct  149  PTVAG-FVDQLPDVALFHANSNNFSG-PIPDLTGLPYLYELDVSNNLHSGPFPADVLALS  206

Query  626  NLTYLDLRFNMLTGPVHPQV  685
            NL +LDLR+N+  G V   V
Sbjct  207  NLIFLDLRYNLFAGSVPASV  226



>ref|XP_006838987.1| hypothetical protein AMTR_s00002p00271610 [Amborella trichopoda]
 gb|ERN01556.1| hypothetical protein AMTR_s00002p00271610 [Amborella trichopoda]
Length=487

 Score = 89.0 bits (219),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 51/146 (35%), Positives = 76/146 (52%), Gaps = 6/146 (4%)
 Frame = +2

Query  236  DPVIRKSIKAIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggi  415
            +P ++ +  A++ +K +I  DP+N+T++W G  +C     Y G +C   R  D   +  +
Sbjct  39   NPRLQNAYIALQAWKHAIVSDPKNITRNWVGPNVC----NYTGVYC--ARALDDPHITVV  92

Query  416  yfngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAG  595
                 N +     L   +    DL + H+NSN F G   +  +    LFELD+SNN+ AG
Sbjct  93   AGIDVNHDDIAGYLPEDLGLLTDLALFHINSNRFCGTIPMSFKDLKLLFELDVSNNRFAG  152

Query  596  AFPTAVLEATNLTYLDLRFNMLTGPV  673
            AFP  VL   +L YLDLRFN   G V
Sbjct  153  AFPYVVLSLKSLKYLDLRFNEFEGKV  178



>ref|XP_010435287.1| PREDICTED: leucine-rich repeat extensin-like protein 3 [Camelina 
sativa]
Length=738

 Score = 89.7 bits (221),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 53/146 (36%), Positives = 76/146 (52%), Gaps = 6/146 (4%)
 Frame = +2

Query  236  DPVIRKSIKAIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggi  415
            +P +R +  A++ +K++I  DP N T +W G+ +C     Y G FC      D +++  +
Sbjct  61   NPRLRNAYIALQAWKQAILSDPNNFTSNWIGSNVC----NYTGVFCSP--SLDNRKIRTV  114

Query  416  yfngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAG  595
                 N       L   +   +DL + HVNSN F G       +   LFELDLSNN+ AG
Sbjct  115  AGIDLNHADIAGYLPEELGLLSDLALFHVNSNRFCGTVPHRFNRLKLLFELDLSNNRFAG  174

Query  596  AFPTAVLEATNLTYLDLRFNMLTGPV  673
             FPT VL+  +L +LDLRFN   G V
Sbjct  175  KFPTVVLQLPSLKFLDLRFNEFEGTV  200



>ref|XP_002455880.1| hypothetical protein SORBIDRAFT_03g026730 [Sorghum bicolor]
 gb|EES01000.1| hypothetical protein SORBIDRAFT_03g026730 [Sorghum bicolor]
Length=613

 Score = 89.4 bits (220),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 54/146 (37%), Positives = 74/146 (51%), Gaps = 6/146 (4%)
 Frame = +2

Query  236  DPVIRKSIKAIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggi  415
            +P +R +  A++ +K++I  DP NVT SW G ++C     Y G +C  P   D   +  +
Sbjct  74   NPRLRDAYVALQAWKRAILSDPYNVTGSWSGPDVC----AYGGVYC-APSPQDPG-LTVV  127

Query  416  yfngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAG  595
                 N       L   +    DL V+H+NSN F G     + +   L ELDLSNN+  G
Sbjct  128  ASVDLNHADLAGHLPEALGRLADLAVLHLNSNRFCGLVPRSLHRLHALHELDLSNNRFVG  187

Query  596  AFPTAVLEATNLTYLDLRFNMLTGPV  673
             FP  VL   +L YLDLRFN   GPV
Sbjct  188  GFPDVVLRLPSLRYLDLRFNDFEGPV  213



>ref|XP_009144429.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 3 [Brassica rapa]
Length=410

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 51/147 (35%), Positives = 79/147 (54%), Gaps = 6/147 (4%)
 Frame = +2

Query  245  IRKSIKAIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfn  424
            ++K+ +A++ +KK I  DP+N+T  W G  +C     Y G FC  P   D+  +     +
Sbjct  59   LQKAYRALQAWKKVIYSDPKNLTGDWIGPSVC----SYTGIFC-APSPSDQNTLVVAGID  113

Query  425  gynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFP  604
              + +  G      +   +DL +IH+NSN F G     + +   L+ELDLSNN+  G FP
Sbjct  114  LNHGDIAGFLPEP-IGLLSDLALIHLNSNRFCGILPRSLSQLSLLYELDLSNNRFVGPFP  172

Query  605  TAVLEATNLTYLDLRFNMLTGPVHPQV  685
              VL   +L YLDLR+N   GP+ P++
Sbjct  173  DVVLSLPSLKYLDLRYNEFEGPLPPKL  199



>ref|XP_011078360.1| PREDICTED: leucine-rich repeat extensin-like protein 4 [Sesamum 
indicum]
Length=494

 Score = 89.0 bits (219),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 54/146 (37%), Positives = 72/146 (49%), Gaps = 6/146 (4%)
 Frame = +2

Query  236  DPVIRKSIKAIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggi  415
            +P +R +  A++ +KK+I  DP N+T  W G+++C     Y G FC      D   +  +
Sbjct  84   NPRLRSAYVALQAWKKAILSDPHNLTVDWVGSDVC----NYTGVFC--APALDNPSIRTV  137

Query  416  yfngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAG  595
                 N       L   +    DL + H+NSN F G      +    LFELDLSNN+ AG
Sbjct  138  AGIDLNHGDIAGYLPEELGLLTDLGLFHINSNRFCGTVPKKFKNLKILFELDLSNNRFAG  197

Query  596  AFPTAVLEATNLTYLDLRFNMLTGPV  673
             FP  VL    L YLDLRFN   GPV
Sbjct  198  KFPYVVLRLPKLKYLDLRFNEFEGPV  223



>ref|XP_010450227.1| PREDICTED: leucine-rich repeat extensin-like protein 3 isoform 
X1 [Camelina sativa]
Length=688

 Score = 89.4 bits (220),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 53/146 (36%), Positives = 76/146 (52%), Gaps = 6/146 (4%)
 Frame = +2

Query  236  DPVIRKSIKAIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggi  415
            +P +R +  A++ +K++I  DP N T +W G+ +C     Y G FC      D +++  +
Sbjct  60   NPRLRNAYIALQAWKQAILSDPNNFTSNWIGSNVC----NYTGVFCSP--SLDNRKIRTV  113

Query  416  yfngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAG  595
                 N       L   +   +DL + HVNSN F G       +   LFELDLSNN+ AG
Sbjct  114  AGIDLNHADIAGYLPEELGLLSDLALFHVNSNRFCGTVPHRFNRLKLLFELDLSNNRFAG  173

Query  596  AFPTAVLEATNLTYLDLRFNMLTGPV  673
             FPT VL+  +L +LDLRFN   G V
Sbjct  174  KFPTIVLQLPSLKFLDLRFNEFEGTV  199



>ref|XP_010450229.1| PREDICTED: leucine-rich repeat extensin-like protein 3 isoform 
X3 [Camelina sativa]
Length=733

 Score = 89.4 bits (220),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 53/146 (36%), Positives = 76/146 (52%), Gaps = 6/146 (4%)
 Frame = +2

Query  236  DPVIRKSIKAIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggi  415
            +P +R +  A++ +K++I  DP N T +W G+ +C     Y G FC      D +++  +
Sbjct  60   NPRLRNAYIALQAWKQAILSDPNNFTSNWIGSNVC----NYTGVFCSP--SLDNRKIRTV  113

Query  416  yfngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAG  595
                 N       L   +   +DL + HVNSN F G       +   LFELDLSNN+ AG
Sbjct  114  AGIDLNHADIAGYLPEELGLLSDLALFHVNSNRFCGTVPHRFNRLKLLFELDLSNNRFAG  173

Query  596  AFPTAVLEATNLTYLDLRFNMLTGPV  673
             FPT VL+  +L +LDLRFN   G V
Sbjct  174  KFPTIVLQLPSLKFLDLRFNEFEGTV  199



>ref|XP_010450228.1| PREDICTED: leucine-rich repeat extensin-like protein 3 isoform 
X2 [Camelina sativa]
Length=725

 Score = 89.4 bits (220),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 53/146 (36%), Positives = 76/146 (52%), Gaps = 6/146 (4%)
 Frame = +2

Query  236  DPVIRKSIKAIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggi  415
            +P +R +  A++ +K++I  DP N T +W G+ +C     Y G FC      D +++  +
Sbjct  60   NPRLRNAYIALQAWKQAILSDPNNFTSNWIGSNVC----NYTGVFCSP--SLDNRKIRTV  113

Query  416  yfngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAG  595
                 N       L   +   +DL + HVNSN F G       +   LFELDLSNN+ AG
Sbjct  114  AGIDLNHADIAGYLPEELGLLSDLALFHVNSNRFCGTVPHRFNRLKLLFELDLSNNRFAG  173

Query  596  AFPTAVLEATNLTYLDLRFNMLTGPV  673
             FPT VL+  +L +LDLRFN   G V
Sbjct  174  KFPTIVLQLPSLKFLDLRFNEFEGTV  199



>gb|KDP43798.1| hypothetical protein JCGZ_23006 [Jatropha curcas]
Length=834

 Score = 89.4 bits (220),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 53/146 (36%), Positives = 75/146 (51%), Gaps = 6/146 (4%)
 Frame = +2

Query  236  DPVIRKSIKAIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggi  415
            +P I  +  A++ +K+SI  DP+N+T +W G ++C     Y G FC+     D   +  +
Sbjct  70   NPRIDSAYIALQKWKRSIISDPKNLTANWVGFDVC----NYTGIFCWA--APDDSSIQTV  123

Query  416  yfngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAG  595
                 N      +L   +    D+ ++H+NSN F G      +K   L ELDLSNN+ AG
Sbjct  124  AGIDLNDGDIAGNLVHELGYLTDIALLHLNSNRFCGKIPRSFKKLKLLHELDLSNNRFAG  183

Query  596  AFPTAVLEATNLTYLDLRFNMLTGPV  673
             FP  VLE   L YLDLRFN   G V
Sbjct  184  RFPNVVLEMPELKYLDLRFNEFEGNV  209



>ref|XP_009795730.1| PREDICTED: leucine-rich repeat extensin-like protein 4 [Nicotiana 
sylvestris]
Length=408

 Score = 87.8 bits (216),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 58/146 (40%), Positives = 80/146 (55%), Gaps = 10/146 (7%)
 Frame = +2

Query  245  IRKSIKAIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPR---GGDKKRVggi  415
            I K+  A++T+K +IT DP  +  SW G  +C+    Y+G FC   +   G     V GI
Sbjct  58   INKAYTALQTWKSAITDDPLGILNSWVGTNVCV----YKGIFCSESQDYMGNPTSVVAGI  113

Query  416  yfngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAG  595
              N  N  G  +   SF+    ++ + H+NSN F+G      +   +L ELDLSNN  +G
Sbjct  114  DLNHANLQGILVKELSFLA---EMSIFHLNSNRFSGPIPQNFRDLTSLTELDLSNNHFSG  170

Query  596  AFPTAVLEATNLTYLDLRFNMLTGPV  673
             FPTAVL   NL YLDLRFN  +GP+
Sbjct  171  TFPTAVLLIPNLLYLDLRFNSFSGPI  196



>ref|XP_002446758.1| hypothetical protein SORBIDRAFT_06g021870 [Sorghum bicolor]
 gb|EES11086.1| hypothetical protein SORBIDRAFT_06g021870 [Sorghum bicolor]
Length=455

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 55/145 (38%), Positives = 82/145 (57%), Gaps = 9/145 (6%)
 Frame = +2

Query  245  IRKSIKAIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfn  424
            + ++   I+ F+ ++T DP +VT+SW G +LC     Y+GFFC  P     + +     +
Sbjct  88   LYRAYLVIQQFRSTVTCDPMDVTRSWSGTDLC---GGYKGFFCERPPNVTDRTI--ASVD  142

Query  425  gynfngnglslnsFVESFNDLVVIHVNSNNFTGA-PGIPVQKFPTLFELDLSNNKLAGA-  598
               +     SL  F+ +  DL + H NSN+F GA P +   ++   +ELDLSNNKLA A 
Sbjct  143  FNGYMLRADSLQGFINNLPDLALFHANSNDFGGAVPSLGSLQY--FYELDLSNNKLAPAP  200

Query  599  FPTAVLEATNLTYLDLRFNMLTGPV  673
            FPT VL  TN T++D+RFN   G +
Sbjct  201  FPTDVLGLTNATFIDIRFNSFYGEL  225



>gb|EYU25784.1| hypothetical protein MIMGU_mgv1a026389mg, partial [Erythranthe 
guttata]
Length=390

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 54/150 (36%), Positives = 74/150 (49%), Gaps = 6/150 (4%)
 Frame = +2

Query  236  DPVIRKSIKAIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggi  415
            +P +R++  A++ +K+SI  DP N T  W G+++C     Y G FC         +V   
Sbjct  45   NPNLRQAYIALQAWKQSIFSDPFNFTSDWTGSDVC----SYGGVFCAPATTNPSVKVVAG  100

Query  416  yfngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAG  595
                +      L     +    DL + H+NSN F G      +K   LFELDLSNN+  G
Sbjct  101  IDLNHADIAGFLPEELGL--LTDLALFHINSNRFCGIVPRSFKKLKLLFELDLSNNRFVG  158

Query  596  AFPTAVLEATNLTYLDLRFNMLTGPVHPQV  685
             FPT VL   +L +LDLRFN   G V  QV
Sbjct  159  GFPTVVLSLPSLKFLDLRFNEFEGGVPSQV  188



>ref|XP_010047660.1| PREDICTED: leucine-rich repeat extensin-like protein 4 [Eucalyptus 
grandis]
 gb|KCW79605.1| hypothetical protein EUGRSUZ_C00960 [Eucalyptus grandis]
Length=420

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 50/143 (35%), Positives = 81/143 (57%), Gaps = 7/143 (5%)
 Frame = +2

Query  245  IRKSIKAIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfn  424
            +  +  A++ +K ++T DP  + ++W G+++C     Y+G FC   + G  + V GI  N
Sbjct  72   LSDAYTALQAWKSAVTDDPNKIMETWVGSDVC----SYKGVFCSDSQDGMGRFVAGIDLN  127

Query  425  gynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFP  604
              N  G  +   S +    D+ ++H+NSN  +G+    ++   +L ELDLSNN+ +G FP
Sbjct  128  RANVQGTLVEELSLL---TDMTLLHLNSNRLSGSVPDTLRDLSSLQELDLSNNQFSGPFP  184

Query  605  TAVLEATNLTYLDLRFNMLTGPV  673
               LE  NL YLDLRFN  +GP+
Sbjct  185  AVALEIPNLIYLDLRFNSFSGPI  207



>ref|XP_004140710.1| PREDICTED: uncharacterized protein At4g06744-like [Cucumis sativus]
 gb|KGN57507.1| hypothetical protein Csa_3G200180 [Cucumis sativus]
Length=450

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 56/147 (38%), Positives = 83/147 (56%), Gaps = 4/147 (3%)
 Frame = +2

Query  245  IRKSIKAIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfn  424
            +RK+   IR  K  I     +V ++W+GN++C    +Y GF C       ++ +  + FN
Sbjct  83   LRKAFFVIRRLKSKIKSGRLDVVRTWQGNDVC----QYVGFRCDPLLVEKERSISAVMFN  138

Query  425  gynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFP  604
            G+ F G  L L  F++  +D+ V H NSN F G     + +    +E+DLSNNKL G FP
Sbjct  139  GFRFGGPELFLEGFMDELDDIAVFHANSNFFRGPIPKKIDRQRFFYEMDLSNNKLPGGFP  198

Query  605  TAVLEATNLTYLDLRFNMLTGPVHPQV  685
            T VL A+ LT+LDLR+N   GP+  Q+
Sbjct  199  TNVLGASELTFLDLRYNNYCGPIPEQI  225



>ref|XP_006414930.1| hypothetical protein EUTSA_v100275740mg, partial [Eutrema salsugineum]
 gb|ESQ56383.1| hypothetical protein EUTSA_v100275740mg, partial [Eutrema salsugineum]
Length=400

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 53/146 (36%), Positives = 74/146 (51%), Gaps = 6/146 (4%)
 Frame = +2

Query  236  DPVIRKSIKAIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggi  415
            +P +R +  A++ +K++I  DP N T +W G+ +C     Y G FC      D +R+  +
Sbjct  62   NPRLRNAYIALQAWKQAILSDPFNFTANWIGSNVC----NYTGVFCSP--ALDNRRIRTV  115

Query  416  yfngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAG  595
                 N       L   +   +DL + HVNSN F G       +   LFELDLSNN+ AG
Sbjct  116  AGIDLNHADIAGYLPEELGLLSDLALFHVNSNRFCGTVPHRFNRLKLLFELDLSNNRFAG  175

Query  596  AFPTAVLEATNLTYLDLRFNMLTGPV  673
             FP  VL   +L +LDLRFN   G V
Sbjct  176  KFPAVVLRLPSLKFLDLRFNEFEGTV  201



>ref|XP_004168435.1| PREDICTED: uncharacterized protein At4g06744-like [Cucumis sativus]
Length=453

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 56/147 (38%), Positives = 83/147 (56%), Gaps = 4/147 (3%)
 Frame = +2

Query  245  IRKSIKAIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfn  424
            +RK+   IR  K  I     +V ++W+GN++C    +Y GF C       ++ +  + FN
Sbjct  83   LRKAFFVIRRLKSKIKSGRLDVVRTWQGNDVC----QYVGFRCDPLLVEKERSISAVMFN  138

Query  425  gynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFP  604
            G+ F G  L L  F++  +D+ V H NSN F G     + +    +E+DLSNNKL G FP
Sbjct  139  GFRFGGPELFLEGFMDELDDIAVFHANSNFFRGPIPKKIDRQRFFYEMDLSNNKLPGGFP  198

Query  605  TAVLEATNLTYLDLRFNMLTGPVHPQV  685
            T VL A+ LT+LDLR+N   GP+  Q+
Sbjct  199  TNVLGASELTFLDLRYNNYCGPIPEQI  225



>ref|XP_010500525.1| PREDICTED: leucine-rich repeat extensin-like protein 3 [Camelina 
sativa]
Length=504

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 65/150 (43%), Positives = 83/150 (55%), Gaps = 11/150 (7%)
 Frame = +2

Query  239  PVIRKSIKAIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiy  418
            P ++K+   +  FKKS+  DP N   +W G ++C     Y G  C +        V  I 
Sbjct  137  PFLKKAYPILLEFKKSVK-DPLNKLYNWGGPDVC----NYNGLKCAIFPNSKNLAVANIQ  191

Query  419  fngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIP-VQKFPTLFELDLSNNKLAG  595
            FNG+   G   S   F+   + + + H NSNNF G+  +P V K   LFELDLSNNKL G
Sbjct  192  FNGFQLGGKLDS---FLGKLDTVSIFHANSNNFIGS--VPDVSKLNFLFELDLSNNKLTG  246

Query  596  AFPTAVLEATNLTYLDLRFNMLTGPVHPQV  685
             FPT VL  TNLT+LDLRFN  +G V PQV
Sbjct  247  DFPTNVLTGTNLTFLDLRFNTFSGSVPPQV  276



>ref|XP_006372265.1| hypothetical protein POPTR_0018s14790g [Populus trichocarpa]
 gb|ERP50062.1| hypothetical protein POPTR_0018s14790g [Populus trichocarpa]
Length=461

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 54/150 (36%), Positives = 77/150 (51%), Gaps = 6/150 (4%)
 Frame = +2

Query  236  DPVIRKSIKAIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggi  415
            +P IR++  A++++K++I  DP N T +W G+++C     Y G FC       K RV   
Sbjct  45   NPRIRRAYIALQSWKQAIFSDPFNFTANWNGSDVC----SYMGVFCAPSPKNKKIRVVAG  100

Query  416  yfngynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAG  595
                +      L     +    DL ++H+NSN F G      +K   L ELDLSNN+L G
Sbjct  101  IDLNHADIAGYLPTELGL--IIDLALLHINSNRFCGVVPSSFRKMKLLHELDLSNNRLMG  158

Query  596  AFPTAVLEATNLTYLDLRFNMLTGPVHPQV  685
             FP  V+   +L YLDLRFN   G V  Q+
Sbjct  159  KFPKVVVSLPSLKYLDLRFNEFEGSVPSQL  188



>ref|XP_010433232.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 3 [Camelina sativa]
Length=386

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 51/147 (35%), Positives = 78/147 (53%), Gaps = 6/147 (4%)
 Frame = +2

Query  245  IRKSIKAIRTFKKSITYDPQNVTQSWEGNELCINKKKYQGFFCYVPRGGDKKRVggiyfn  424
            ++++  A++T+KK I  DP+N+T  W G  +C     Y G FC  P   D   +     +
Sbjct  37   LQQAYHALQTWKKVIYSDPKNLTADWVGPSVC----SYTGIFC-APSPSDPNTLVVAGID  91

Query  425  gynfngnglslnsFVESFNDLVVIHVNSNNFTGAPGIPVQKFPTLFELDLSNNKLAGAFP  604
              + +  G    + +   +DL +IH+NSN F G     +     L+ELDLSNN+  G FP
Sbjct  92   LNHGDIAGFLPEA-IGLLSDLALIHLNSNRFCGILPSSLANLSLLYELDLSNNRFVGPFP  150

Query  605  TAVLEATNLTYLDLRFNMLTGPVHPQV  685
              VL   +L YLDLR+N   GP+ P++
Sbjct  151  DVVLSLPSLKYLDLRYNEFEGPLPPKL  177



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1360982043420