BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF044I15

Length=794
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AAS79608.1|  putative histone deacetylase                            391   2e-131   Ipomoea trifida
gb|KDO51348.1|  hypothetical protein CISIN_1g0130381mg                  370   3e-126   Citrus sinensis [apfelsine]
gb|KDO51350.1|  hypothetical protein CISIN_1g0130381mg                  370   3e-126   Citrus sinensis [apfelsine]
ref|XP_004172671.1|  PREDICTED: histone deacetylase 9-like              368   1e-125   
ref|XP_007015907.1|  Histone deacetylase 9 isoform 4                    370   7e-125   
ref|XP_007015914.1|  Histone deacetylase 9 isoform 11                   370   7e-125   
ref|XP_007015913.1|  Histone deacetylase 9 isoform 10                   370   8e-125   
ref|XP_009605994.1|  PREDICTED: histone deacetylase 9                   374   1e-124   Nicotiana tomentosiformis
ref|XP_010242657.1|  PREDICTED: histone deacetylase 9-like              368   1e-124   
ref|XP_003606237.1|  Histone deacetylase                                373   3e-124   Medicago truncatula
emb|CAN77816.1|  hypothetical protein VITISV_020659                     373   3e-124   Vitis vinifera
ref|XP_002266492.1|  PREDICTED: histone deacetylase 9 isoform X1        373   3e-124   Vitis vinifera
ref|XP_006471388.1|  PREDICTED: histone deacetylase 9-like              372   4e-124   Citrus sinensis [apfelsine]
ref|XP_006424306.1|  hypothetical protein CICLE_v10029823mg             372   4e-124   Citrus clementina [clementine]
ref|XP_007015912.1|  Histone deacetylase 9 isoform 9                    370   4e-124   
ref|XP_007015910.1|  Histone deacetylase 9 isoform 7                    371   5e-124   
gb|KCW50788.1|  hypothetical protein EUGRSUZ_J00456                     370   5e-124   Eucalyptus grandis [rose gum]
ref|XP_004251031.1|  PREDICTED: histone deacetylase 9                   372   6e-124   Solanum lycopersicum
ref|XP_007015908.1|  Histone deacetylase 9 isoform 5                    369   7e-124   
ref|XP_007015906.1|  Histone deacetylase 9 isoform 3                    372   8e-124   
gb|KCW50789.1|  hypothetical protein EUGRSUZ_J00456                     370   8e-124   Eucalyptus grandis [rose gum]
ref|XP_007015904.1|  Histone deacetylase 9 isoform 1                    371   1e-123   Theobroma cacao [chocolate]
ref|XP_007015905.1|  Histone deacetylase 9 isoform 2                    370   1e-123   
gb|KDP34706.1|  hypothetical protein JCGZ_10911                         371   1e-123   Jatropha curcas
gb|KCW50787.1|  hypothetical protein EUGRSUZ_J00456                     370   1e-123   Eucalyptus grandis [rose gum]
ref|XP_006349095.1|  PREDICTED: histone deacetylase 9-like              370   2e-123   Solanum tuberosum [potatoes]
ref|XP_010031477.1|  PREDICTED: histone deacetylase 9 isoform X1        370   2e-123   Eucalyptus grandis [rose gum]
gb|KCW50786.1|  hypothetical protein EUGRSUZ_J00456                     370   3e-123   Eucalyptus grandis [rose gum]
ref|XP_010651716.1|  PREDICTED: histone deacetylase 9                   370   4e-123   Vitis vinifera
ref|XP_007205234.1|  hypothetical protein PRUPE_ppa006053mg             370   4e-123   Prunus persica
ref|XP_008227393.1|  PREDICTED: histone deacetylase 9 isoform X1        370   5e-123   Prunus mume [ume]
ref|XP_008349785.1|  PREDICTED: histone deacetylase 9                   369   6e-123   Malus domestica [apple tree]
ref|XP_002529076.1|  histone deacetylase 1, 2 ,3, putative              369   6e-123   Ricinus communis
ref|XP_008458605.1|  PREDICTED: histone deacetylase 9 isoform X1        369   6e-123   Cucumis melo [Oriental melon]
ref|XP_008458608.1|  PREDICTED: histone deacetylase 9 isoform X2        369   8e-123   Cucumis melo [Oriental melon]
ref|NP_001105077.1|  histone deacetylase                                369   9e-123   Zea mays [maize]
ref|XP_004145792.1|  PREDICTED: histone deacetylase 9-like              369   9e-123   Cucumis sativus [cucumbers]
ref|XP_007132395.1|  hypothetical protein PHAVU_011G091100g             368   1e-122   Phaseolus vulgaris [French bean]
ref|XP_004975538.1|  PREDICTED: histone deacetylase 9-like isofor...    368   2e-122   Setaria italica
ref|XP_010239874.1|  PREDICTED: histone deacetylase 9 isoform X2        365   2e-122   Brachypodium distachyon [annual false brome]
ref|XP_002446401.1|  hypothetical protein SORBIDRAFT_06g015420          368   2e-122   Sorghum bicolor [broomcorn]
ref|XP_007142469.1|  hypothetical protein PHAVU_008G283200g             367   3e-122   Phaseolus vulgaris [French bean]
ref|XP_004300044.1|  PREDICTED: histone deacetylase 9                   367   4e-122   Fragaria vesca subsp. vesca
ref|XP_008788392.1|  PREDICTED: histone deacetylase 9 isoform X2        365   4e-122   Phoenix dactylifera
ref|XP_010692973.1|  PREDICTED: histone deacetylase 9 isoform X1        367   5e-122   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009364877.1|  PREDICTED: histone deacetylase 9-like              366   8e-122   Pyrus x bretschneideri [bai li]
ref|XP_003579685.1|  PREDICTED: histone deacetylase 9 isoform X1        366   8e-122   Brachypodium distachyon [annual false brome]
ref|XP_003539814.1|  PREDICTED: histone deacetylase 9 isoform X1        366   1e-121   Glycine max [soybeans]
gb|ACU20217.1|  unknown                                                 366   1e-121   Glycine max [soybeans]
ref|XP_010243527.1|  PREDICTED: histone deacetylase 9                   365   2e-121   Nelumbo nucifera [Indian lotus]
ref|XP_010093211.1|  Histone deacetylase 9                              365   2e-121   Morus notabilis
ref|XP_010940301.1|  PREDICTED: histone deacetylase 9                   365   3e-121   Elaeis guineensis
ref|XP_008788384.1|  PREDICTED: histone deacetylase 9 isoform X1        365   4e-121   Phoenix dactylifera
ref|XP_011090013.1|  PREDICTED: histone deacetylase 9 isoform X1        364   5e-121   Sesamum indicum [beniseed]
ref|XP_009364273.1|  PREDICTED: histone deacetylase 9                   364   7e-121   Pyrus x bretschneideri [bai li]
ref|XP_002300554.1|  histone deacetylase-related family protein         364   7e-121   Populus trichocarpa [western balsam poplar]
ref|XP_011005322.1|  PREDICTED: histone deacetylase 9 isoform X3        364   7e-121   Populus euphratica
ref|XP_004506146.1|  PREDICTED: histone deacetylase 9-like              364   8e-121   Cicer arietinum [garbanzo]
emb|CAH66503.1|  H0321H01.12                                            364   9e-121   Oryza sativa [red rice]
gb|ACD50313.1|  histone deacetylase RPD3/HDA1 class I isoform 1         363   9e-121   Hordeum vulgare [barley]
emb|CDP06960.1|  unnamed protein product                                363   1e-120   Coffea canephora [robusta coffee]
ref|XP_006652253.1|  PREDICTED: histone deacetylase 9-like              363   1e-120   Oryza brachyantha
gb|EYU36089.1|  hypothetical protein MIMGU_mgv1a006831mg                362   2e-120   Erythranthe guttata [common monkey flower]
ref|XP_006591090.1|  PREDICTED: histone deacetylase 9-like isofor...    362   3e-120   
dbj|BAH56771.1|  AT3G44680                                              355   3e-120   Arabidopsis thaliana [mouse-ear cress]
gb|EYU36088.1|  hypothetical protein MIMGU_mgv1a006831mg                362   3e-120   Erythranthe guttata [common monkey flower]
gb|EPS60971.1|  histone deacetylase                                     358   3e-120   Genlisea aurea
ref|XP_011005320.1|  PREDICTED: histone deacetylase 9 isoform X1        363   3e-120   Populus euphratica
ref|XP_003538135.1|  PREDICTED: histone deacetylase 9-like isofor...    362   4e-120   Glycine max [soybeans]
gb|KHN38656.1|  Histone deacetylase 9                                   362   4e-120   Glycine soja [wild soybean]
ref|XP_010425885.1|  PREDICTED: histone deacetylase 9 isoform X1        359   5e-119   Camelina sativa [gold-of-pleasure]
ref|XP_010503116.1|  PREDICTED: histone deacetylase 9-like              359   5e-119   Camelina sativa [gold-of-pleasure]
ref|XP_010514792.1|  PREDICTED: histone deacetylase 9                   359   5e-119   Camelina sativa [gold-of-pleasure]
ref|XP_006279377.1|  hypothetical protein CARUB_v10007995mg             359   5e-119   Capsella rubella
ref|XP_008360484.1|  PREDICTED: LOW QUALITY PROTEIN: histone deac...    356   5e-119   
ref|NP_190054.2|  histone deacetylase 9                                 358   1e-118   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006419115.1|  hypothetical protein EUTSA_v10002540mg             358   1e-118   Eutrema salsugineum [saltwater cress]
ref|XP_009404812.1|  PREDICTED: histone deacetylase 9 isoform X1        357   5e-118   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010541291.1|  PREDICTED: histone deacetylase 9 isoform X1        354   6e-117   Tarenaya hassleriana [spider flower]
ref|XP_009150313.1|  PREDICTED: histone deacetylase 9                   354   6e-117   
ref|XP_006851552.1|  hypothetical protein AMTR_s00040p00182290          353   2e-116   
tpg|DAA37954.1|  TPA: histone deacetylase                               349   5e-115   
tpg|DAA37953.1|  TPA: histone deacetylase, mRNA                         349   6e-115   
ref|XP_001774667.1|  class I RPD3 type histone deacetylase protein      345   1e-113   
gb|KHN21123.1|  Histone deacetylase 9                                   343   4e-112   Glycine soja [wild soybean]
emb|CAB72470.1|  putative protein                                       335   9e-110   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002966032.1|  hypothetical protein SELMODRAFT_84957              335   1e-109   
ref|XP_002971460.1|  hypothetical protein SELMODRAFT_172161             333   1e-108   
ref|XP_002877352.1|  hypothetical protein ARALYDRAFT_347545             343   6e-105   
gb|KEH29890.1|  histone deacetylase family protein                      321   2e-104   Medicago truncatula
gb|ACR37742.1|  unknown                                                 320   5e-104   Zea mays [maize]
gb|AAM70418.1|AF512725_1  histone deacetylase                           312   1e-103   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008458609.1|  PREDICTED: histone deacetylase 9 isoform X3        317   7e-103   Cucumis melo [Oriental melon]
emb|CAN75079.1|  hypothetical protein VITISV_007579                     316   1e-102   Vitis vinifera
ref|XP_011005321.1|  PREDICTED: histone deacetylase 9 isoform X2        313   5e-101   Populus euphratica
ref|XP_009404815.1|  PREDICTED: histone deacetylase 9 isoform X4        311   2e-100   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003060152.1|  histone deacetylase                                307   1e-98    Micromonas pusilla CCMP1545
emb|CDY08684.1|  BnaC03g54980D                                          304   1e-97    Brassica napus [oilseed rape]
ref|XP_002504208.1|  histone deacetylase                                293   5e-93    Micromonas commoda
ref|XP_005652289.1|  class I RPD3 type histone deacetylase protein      291   1e-92    Coccomyxa subellipsoidea C-169
ref|XP_002952849.1|  hypothetical protein VOLCADRAFT_62995              291   1e-92    Volvox carteri f. nagariensis
ref|XP_001695812.1|  histone deacetylase                                291   2e-92    Chlamydomonas reinhardtii
ref|XP_007509129.1|  histone deacetylase 3                              286   1e-90    Bathycoccus prasinos
ref|XP_001744309.1|  hypothetical protein                               283   7e-90    Monosiga brevicollis MX1
ref|XP_005079687.1|  PREDICTED: histone deacetylase 1                   279   2e-89    
emb|CEG00983.1|  Histone deacetylase superfamily                        283   2e-89    Ostreococcus tauri
ref|XP_001869513.1|  histone deacetylase                                276   1e-88    Culex quinquefasciatus
gb|ABO26690.1|  histone deacetylase 2                                   275   2e-88    Haliotis discus discus
dbj|BAG61671.1|  unnamed protein product                                274   3e-88    Homo sapiens [man]
ref|NP_001153253.1|  histone deacetylase 2                              272   7e-88    Pongo abelii [orang utan]
ref|XP_001416403.1|  histone deacetylase, probable                      279   1e-87    Ostreococcus lucimarinus CCE9901
ref|XP_010775614.1|  PREDICTED: probable histone deacetylase 1-B        276   1e-87    Notothenia coriiceps [yellowbelly rockcod]
emb|CDQ96434.1|  unnamed protein product                                272   2e-87    Oncorhynchus mykiss
ref|XP_007093839.1|  PREDICTED: histone deacetylase 1-like              276   2e-87    
ref|XP_001742912.1|  hypothetical protein                               279   3e-87    Monosiga brevicollis MX1
ref|XP_004368317.1|  histone deacetylase 1, putative                    274   4e-87    Acanthamoeba castellanii str. Neff
ref|XP_005318149.1|  PREDICTED: histone deacetylase 1                   276   6e-87    Ictidomys tridecemlineatus
gb|ABN81193.1|  histone deacetylase 1                                   280   7e-87    Schistosoma mansoni
ref|XP_005746257.1|  PREDICTED: probable histone deacetylase 1-B-...    277   8e-87    
gb|AAH85375.1|  Histone deacetylase 1                                   278   8e-87    Danio rerio [leopard danio]
ref|XP_005302255.1|  PREDICTED: histone deacetylase 1                   278   8e-87    Chrysemys picta bellii
gb|ACO11145.1|  Histone deacetylase 1                                   273   9e-87    Caligus rogercresseyi
ref|XP_003415511.1|  PREDICTED: histone deacetylase 1                   278   9e-87    Loxodonta africana [African bush elephant]
ref|XP_005477687.1|  PREDICTED: probable histone deacetylase 1-B-...    278   9e-87    Oreochromis niloticus
ref|XP_006274872.1|  PREDICTED: histone deacetylase 1 isoform X1        278   1e-86    
gb|AAB99850.1|  histone deacetylase 1                                   278   1e-86    Gallus gallus [bantam]
ref|XP_005529817.1|  PREDICTED: histone deacetylase 1                   278   1e-86    Pseudopodoces humilis [Tibetan ground-jay]
ref|NP_989487.1|  histone deacetylase 1                                 278   1e-86    Gallus gallus [bantam]
ref|XP_003446230.1|  PREDICTED: probable histone deacetylase 1-B-...    278   1e-86    Oreochromis niloticus
ref|XP_010877523.1|  PREDICTED: histone deacetylase 1 isoform X2        278   1e-86    Esox lucius
ref|XP_002194370.2|  PREDICTED: histone deacetylase 1                   277   1e-86    
ref|XP_003397521.1|  PREDICTED: hypothetical protein LOC100642763       292   1e-86    
ref|XP_008282430.1|  PREDICTED: histone deacetylase 1                   278   1e-86    Stegastes partitus
ref|XP_011488824.1|  PREDICTED: histone deacetylase 1 isoform X1        278   1e-86    Oryzias latipes [Japanese rice fish]
ref|XP_004083964.1|  PREDICTED: histone deacetylase 2                   278   1e-86    Oryzias latipes [Japanese rice fish]
ref|XP_004082433.1|  PREDICTED: histone deacetylase 1 isoform X2        278   1e-86    Oryzias latipes [Japanese rice fish]
ref|XP_002680769.1|  histone deacetylase                                276   1e-86    Naegleria gruberi strain NEG-M
ref|XP_009096801.1|  PREDICTED: histone deacetylase 1                   277   1e-86    
ref|XP_006019411.1|  PREDICTED: histone deacetylase 1 isoform X1        278   1e-86    
ref|XP_010877522.1|  PREDICTED: histone deacetylase 1 isoform X1        278   2e-86    Esox lucius
ref|XP_006631299.1|  PREDICTED: histone deacetylase 1-like              277   2e-86    Lepisosteus oculatus
gb|AAH64650.1|  Hdac1 protein                                           276   2e-86    Danio rerio [leopard danio]
emb|CAX72896.1|  histone deacetylase 1/2                                279   2e-86    Schistosoma japonicum
ref|XP_009174258.1|  hypothetical protein T265_09811                    278   2e-86    Opisthorchis viverrini [Southeast Asian liver fluke]
ref|NP_999711.1|  histone deacetylase 1                                 280   2e-86    Strongylocentrotus purpuratus [purple urchin]
ref|XP_004850908.1|  PREDICTED: histone deacetylase 1                   277   2e-86    Heterocephalus glaber [naked mole rat]
ref|XP_001848775.1|  histone deacetylase Rpd3                           277   2e-86    Culex quinquefasciatus
ref|XP_007574365.1|  PREDICTED: probable histone deacetylase 1-B        277   3e-86    Poecilia formosa
ref|XP_005799195.1|  PREDICTED: probable histone deacetylase 1-B-...    277   3e-86    Xiphophorus maculatus
emb|CAF93492.1|  unnamed protein product                                277   3e-86    Tetraodon nigroviridis
ref|XP_005739016.1|  PREDICTED: histone deacetylase 1-like              277   3e-86    Pundamilia nyererei
ref|NP_775343.1|  histone deacetylase 1                                 277   3e-86    Danio rerio [leopard danio]
ref|XP_005457977.1|  PREDICTED: histone deacetylase 2-like isofor...    277   3e-86    Oreochromis niloticus
ref|XP_004074465.1|  PREDICTED: probable histone deacetylase 1-B        277   3e-86    Oryzias latipes [Japanese rice fish]
ref|XP_003453058.2|  PREDICTED: histone deacetylase 2-like isofor...    277   3e-86    Oreochromis niloticus
ref|XP_004591679.1|  PREDICTED: histone deacetylase 1                   277   3e-86    Ochotona princeps [southern American pika]
dbj|BAC34755.1|  unnamed protein product                                271   3e-86    Mus musculus [mouse]
ref|XP_005100474.1|  PREDICTED: histone deacetylase 2-like isofor...    278   3e-86    Aplysia californica
ref|XP_004566615.1|  PREDICTED: probable histone deacetylase 1-B-...    277   3e-86    Maylandia zebra
ref|XP_008314048.1|  PREDICTED: histone deacetylase 1 isoform X1        277   3e-86    
ref|XP_007249467.1|  PREDICTED: probable histone deacetylase 1-B-...    277   4e-86    
ref|XP_005931104.1|  PREDICTED: histone deacetylase 2-like              276   4e-86    
ref|XP_005159649.1|  PREDICTED: histone deacetylase 1 isoform X1        276   4e-86    Danio rerio [leopard danio]
ref|NP_001020580.1|  histone deacetylase 1                              276   4e-86    Rattus norvegicus [brown rat]
ref|XP_001649445.1|  AAEL004586-PB                                      277   4e-86    
ref|XP_003977374.1|  PREDICTED: histone deacetylase 2-like              276   4e-86    
emb|CCI40020.1|  unnamed protein product                                276   4e-86    Albugo candida
ref|XP_008869931.1|  hypothetical protein, variant                      273   4e-86    Aphanomyces invadans
ref|XP_010729600.1|  PREDICTED: probable histone deacetylase 1-B        276   4e-86    Larimichthys crocea [croceine croaker]
ref|NP_032254.1|  histone deacetylase 1                                 276   4e-86    Mus musculus [mouse]
ref|XP_004678799.1|  PREDICTED: histone deacetylase 1                   276   4e-86    Condylura cristata
ref|NP_001273520.1|  histone deacetylase 1                              276   4e-86    Pantholops hodgsonii [Tibetan antelope]
ref|XP_004665328.1|  PREDICTED: histone deacetylase 1                   276   4e-86    Jaculus jaculus
ref|XP_004566614.1|  PREDICTED: probable histone deacetylase 1-B-...    277   4e-86    Maylandia zebra
ref|XP_003962463.1|  PREDICTED: histone deacetylase 1-like              276   4e-86    
ref|XP_010734201.1|  PREDICTED: histone deacetylase 2                   276   4e-86    
ref|XP_004566277.1|  PREDICTED: histone deacetylase 2-like              276   4e-86    Maylandia zebra
emb|CDQ74676.1|  unnamed protein product                                277   4e-86    Oncorhynchus mykiss
ref|XP_007249469.1|  PREDICTED: probable histone deacetylase 1-B-...    276   4e-86    
gb|KFM72198.1|  Histone deacetylase 2                                   276   4e-86    Stegodyphus mimosarum
ref|XP_006796302.1|  PREDICTED: histone deacetylase 2-like              276   4e-86    Neolamprologus brichardi [lyretail cichlid]
emb|CCI40019.1|  unnamed protein product                                275   5e-86    Albugo candida
ref|NP_001032521.1|  histone deacetylase 1                              276   5e-86    Bos taurus [bovine]
ref|XP_006054694.1|  PREDICTED: histone deacetylase 1 isoform X1        276   5e-86    Bubalus bubalis [domestic water buffalo]
ref|XP_003500683.1|  PREDICTED: histone deacetylase 1 isoform X1        276   5e-86    Cricetulus griseus [Chinese hamsters]
ref|XP_008314122.1|  PREDICTED: histone deacetylase 1 isoform X2        276   5e-86    
ref|XP_394976.4|  PREDICTED: histone deacetylase Rpd3 isoform 1         276   5e-86    Apis mellifera [bee]
ref|XP_010770908.1|  PREDICTED: histone deacetylase 1                   276   5e-86    Notothenia coriiceps [yellowbelly rockcod]
ref|XP_008283856.1|  PREDICTED: histone deacetylase 2 isoform X2        276   5e-86    Stegastes partitus
ref|XP_008283855.1|  PREDICTED: histone deacetylase 2 isoform X1        276   5e-86    Stegastes partitus
ref|XP_005812507.1|  PREDICTED: probable histone deacetylase 1-B-...    276   5e-86    Xiphophorus maculatus
ref|XP_007948636.1|  PREDICTED: histone deacetylase 1                   276   5e-86    Orycteropus afer afer
ref|NP_001265940.1|  Probable histone deacetylase 1-B                   276   6e-86    Salmo salar
ref|XP_007563814.1|  PREDICTED: probable histone deacetylase 1-B        276   6e-86    Poecilia formosa
ref|XP_005806080.1|  PREDICTED: histone deacetylase 2-like              276   6e-86    Xiphophorus maculatus
ref|XP_004519082.1|  PREDICTED: histone deacetylase Rpd3-like           276   6e-86    Ceratitis capitata [medfly]
ref|NP_001084011.1|  histone deacetylase 2                              276   6e-86    Xenopus laevis [clawed frog]
gb|ETN61439.1|  histone deacetylase                                     276   6e-86    Anopheles darlingi [American malaria mosquito]
ref|XP_003485786.1|  PREDICTED: histone deacetylase Rpd3-like           276   6e-86    
ref|XP_007570702.1|  PREDICTED: histone deacetylase 2                   276   6e-86    Poecilia formosa
ref|XP_005878413.1|  PREDICTED: histone deacetylase 1                   276   6e-86    Myotis brandtii
ref|XP_004372056.1|  PREDICTED: histone deacetylase 1                   276   7e-86    Trichechus manatus latirostris
gb|AAL89665.1|AF411956_6  histone deacetylase                           276   7e-86    Takifugu rubripes [tiger puffer]
gb|EHJ72565.1|  histone deacetylase Rpd3                                276   7e-86    
ref|XP_005100475.1|  PREDICTED: histone deacetylase 2-like isofor...    276   7e-86    Aplysia californica
gb|KFB51427.1|  histone deacetylase Rpd3                                276   7e-86    Anopheles sinensis
ref|XP_010619862.1|  PREDICTED: histone deacetylase 1                   276   7e-86    Fukomys damarensis [Damara mole rat]
dbj|BAA08909.1|  RPD3 protein                                           276   7e-86    Homo sapiens [man]
ref|XP_011181413.1|  PREDICTED: histone deacetylase Rpd3 isoform X1     276   8e-86    Zeugodacus cucurbitae [melon fruit fly]
ref|XP_011204627.1|  PREDICTED: histone deacetylase Rpd3                276   8e-86    Bactrocera dorsalis [papaya fruit fly]
ref|XP_007249466.1|  PREDICTED: probable histone deacetylase 1-B-...    276   8e-86    
ref|XP_010731445.1|  PREDICTED: probable histone deacetylase 1-B        276   8e-86    Larimichthys crocea [croceine croaker]
ref|XP_003471128.1|  PREDICTED: histone deacetylase 1                   276   8e-86    Cavia porcellus [guinea pig]
ref|XP_003801297.1|  PREDICTED: histone deacetylase 1                   276   8e-86    Otolemur garnettii
ref|XP_008846179.1|  PREDICTED: histone deacetylase 1                   276   9e-86    Nannospalax galili
ref|XP_005191575.1|  PREDICTED: histone deacetylase Rpd3                276   9e-86    Musca domestica
ref|XP_001649446.1|  AAEL004586-PA                                      275   9e-86    
ref|XP_006924353.1|  PREDICTED: histone deacetylase 1                   276   9e-86    Pteropus alecto
ref|XP_004563736.1|  PREDICTED: probable histone deacetylase 1-B-...    276   9e-86    Maylandia zebra
gb|AAP36140.1|  Homo sapiens histone deacetylase 1                      276   9e-86    synthetic construct
pdb|3MAX|A  Chain A, Crystal Structure Of Human Hdac2 Complexed W...    272   9e-86    Homo sapiens [man]
dbj|BAG70111.1|  histone deacetylase 1                                  276   9e-86    Homo sapiens [man]
gb|KDO17456.1|  hypothetical protein SPRG_17124                         266   1e-85    Saprolegnia parasitica CBS 223.65
ref|NP_001079396.1|  histone deacetylase 1                              275   1e-85    Xenopus laevis [clawed frog]
ref|XP_003443815.1|  PREDICTED: probable histone deacetylase 1-B-...    275   1e-85    Oreochromis niloticus
ref|XP_006094298.1|  PREDICTED: histone deacetylase 1                   275   1e-85    Myotis lucifugus
ref|XP_003828201.1|  PREDICTED: histone deacetylase 1                   275   1e-85    Pan paniscus [bonobo]
ref|XP_004025419.1|  PREDICTED: histone deacetylase 1 isoform 1         275   1e-85    Gorilla gorilla gorilla [lowland gorilla]
ref|NP_004955.2|  histone deacetylase 1                                 275   1e-85    Homo sapiens [man]
emb|CAG09908.1|  unnamed protein product                                276   1e-85    Tetraodon nigroviridis
ref|XP_007170674.1|  PREDICTED: histone deacetylase 1 isoform X1        275   1e-85    Balaenoptera acutorostrata scammoni
ref|XP_004425952.1|  PREDICTED: histone deacetylase 1                   275   1e-85    
ref|XP_007523321.1|  PREDICTED: histone deacetylase 1                   275   1e-85    Erinaceus europaeus [common hedgehog]
ref|XP_009451191.1|  PREDICTED: histone deacetylase 1 isoform X2        275   1e-85    
ref|XP_007468739.1|  PREDICTED: histone deacetylase 1 isoform X2        275   1e-85    Lipotes vexillifer [baiji]
ref|XP_008869930.1|  hypothetical protein H310_06587                    274   1e-85    Aphanomyces invadans
ref|XP_006196994.1|  PREDICTED: histone deacetylase 1                   275   1e-85    Vicugna pacos
ref|XP_004266568.1|  PREDICTED: histone deacetylase 1                   275   1e-85    Orcinus orca [Orca]
ref|XP_519834.2|  PREDICTED: histone deacetylase 1 isoform X1           275   1e-85    
ref|XP_002720761.1|  PREDICTED: histone deacetylase 1                   275   1e-85    Oryctolagus cuniculus [domestic rabbit]
ref|XP_009453837.1|  PREDICTED: histone deacetylase 1 isoform X2        275   1e-85    
gb|AAH54208.1|  Hdac2 protein                                           274   1e-85    Xenopus laevis [clawed frog]
gb|AEE62688.1|  unknown                                                 275   1e-85    Dendroctonus ponderosae
ref|XP_008300137.1|  PREDICTED: probable histone deacetylase 1-B        275   1e-85    Stegastes partitus
ref|XP_544435.2|  PREDICTED: histone deacetylase 1 isoform 1            275   1e-85    Canis lupus familiaris [dogs]
ref|XP_003276411.1|  PREDICTED: histone deacetylase 1 isoform 1         275   1e-85    Nomascus leucogenys [White-cheeked Gibbon]
ref|XP_007249468.1|  PREDICTED: probable histone deacetylase 1-B-...    275   1e-85    
ref|XP_006862222.1|  PREDICTED: histone deacetylase 1                   275   1e-85    Chrysochloris asiatica
ref|XP_006734227.1|  PREDICTED: histone deacetylase 1 isoform X1        275   1e-85    Leptonychotes weddellii
ref|XP_004740974.1|  PREDICTED: histone deacetylase 1 isoform X2        275   1e-85    Mustela putorius furo [black ferret]
ref|XP_004406478.1|  PREDICTED: histone deacetylase 1                   275   1e-85    Odobenus rosmarus divergens
gb|ACO10788.1|  Histone deacetylase 1                                   275   1e-85    Caligus rogercresseyi
gb|ENN73569.1|  hypothetical protein YQE_09818                          275   1e-85    Dendroctonus ponderosae
ref|XP_002921911.1|  PREDICTED: histone deacetylase 1                   275   1e-85    Ailuropoda melanoleuca
ref|XP_316539.2|  AGAP006511-PA                                         275   1e-85    Anopheles gambiae str. PEST
ref|XP_007259970.1|  PREDICTED: histone deacetylase 2 isoform X1        275   1e-85    Astyanax mexicanus [blind cave fish]
ref|XP_002750618.1|  PREDICTED: histone deacetylase 1                   275   2e-85    Callithrix jacchus [common marmoset]
ref|XP_966633.1|  PREDICTED: histone deacetylase Rpd3                   275   2e-85    Tribolium castaneum [rust-red flour beetle]
ref|XP_002060037.1|  GJ15512                                            276   2e-85    Drosophila virilis
emb|CAF99510.1|  unnamed protein product                                274   2e-85    Tetraodon nigroviridis
ref|XP_008610886.1|  histone deacetylase 1/2                            273   2e-85    Saprolegnia diclina VS20
emb|CCA14006.1|  histone deacetylase putative                           275   2e-85    Albugo laibachii Nc14
ref|XP_008070975.1|  PREDICTED: histone deacetylase 1                   275   2e-85    Carlito syrichta
gb|AAC61494.1|  putative histone deacetylase                            276   2e-85    Drosophila melanogaster
ref|NP_647918.2|  Rpd3                                                  276   2e-85    Drosophila melanogaster
ref|XP_004343197.1|  histone deacetylase-3                              274   2e-85    Capsaspora owczarzaki ATCC 30864
ref|XP_002083660.1|  GD13856                                            276   2e-85    
ref|XP_004603624.1|  PREDICTED: histone deacetylase 1                   275   2e-85    Sorex araneus [Eurasian shrew]
gb|EFX74892.1|  putative histone deacetylase Rpd3 protein               276   2e-85    Daphnia pulex
ref|XP_001971925.1|  GG15241                                            276   2e-85    Drosophila erecta
ref|XP_004705065.1|  PREDICTED: histone deacetylase 1                   275   2e-85    Echinops telfairi [lesser hedgehog tenrec]
ref|NP_001265942.1|  Histone deacetylase 2                              274   2e-85    Salmo salar
ref|XP_006895025.1|  PREDICTED: histone deacetylase 1                   275   2e-85    Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_003707550.1|  PREDICTED: histone deacetylase Rpd3-like           275   2e-85    Megachile rotundata
sp|O42227.1|HDA1B_XENLA  RecName: Full=Probable histone deacetyla...    275   2e-85    Xenopus laevis [clawed frog]
ref|XP_005717961.1|  histone deacetylase                                273   2e-85    Chondrus crispus [carageen]
ref|XP_001946324.2|  PREDICTED: histone deacetylase Rpd3-like           275   2e-85    Acyrthosiphon pisum
emb|CDQ67004.1|  unnamed protein product                                274   2e-85    Oncorhynchus mykiss
ref|XP_002093731.1|  GE21462                                            276   2e-85    Drosophila yakuba
ref|XP_001983253.1|  GH15691                                            277   2e-85    
ref|XP_011050777.1|  PREDICTED: histone deacetylase Rpd3-like           275   2e-85    
gb|EWM29801.1|  histone deacetylase 1                                   275   2e-85    
ref|XP_011260199.1|  PREDICTED: histone deacetylase Rpd3                274   2e-85    
ref|XP_008310868.1|  PREDICTED: histone deacetylase 2                   275   2e-85    
ref|XP_004580552.1|  PREDICTED: histone deacetylase 2-like              270   2e-85    
ref|XP_002062556.1|  GK16595                                            276   2e-85    
gb|AAB68398.1|  putative histone deacetylase                            275   3e-85    
ref|XP_007468738.1|  PREDICTED: histone deacetylase 1 isoform X1        276   3e-85    
ref|XP_001956187.1|  GF25085                                            275   3e-85    
pdb|4LXZ|A  Chain A, Structure Of Human Hdac2 In Complex With Sah...    271   3e-85    
sp|P56519.1|HDAC2_CHICK  RecName: Full=Histone deacetylase 2; Sho...    275   3e-85    
ref|XP_004322371.1|  PREDICTED: LOW QUALITY PROTEIN: histone deac...    275   3e-85    
ref|XP_007125154.1|  PREDICTED: histone deacetylase 1 isoform X1        276   3e-85    
ref|NP_001005432.1|  histone deacetylase 2                              275   3e-85    
gb|ADO79638.1|  histone deacetylase                                     275   3e-85    
ref|XP_011154868.1|  PREDICTED: histone deacetylase Rpd3                275   3e-85    
gb|ADO79635.1|  histone deacetylase                                     275   3e-85    
gb|ADO79632.1|  histone deacetylase                                     275   3e-85    
ref|XP_009523856.1|  hypothetical protein PHYSODRAFT_542338             273   3e-85    
emb|CAJ81536.1|  histone deacetylase 2                                  274   3e-85    
ref|XP_008458610.1|  PREDICTED: histone deacetylase 9 isoform X4        271   3e-85    
ref|XP_010346435.1|  PREDICTED: histone deacetylase 1                   274   4e-85    
ref|XP_004740973.1|  PREDICTED: histone deacetylase 1 isoform X1        275   4e-85    
ref|XP_003215628.1|  PREDICTED: histone deacetylase 2 isoform X2        274   4e-85    
ref|XP_003969046.1|  PREDICTED: probable histone deacetylase 1-B-...    274   4e-85    
ref|NP_001081491.1|  probable histone deacetylase 1-A                   274   4e-85    
ref|XP_008120699.1|  PREDICTED: histone deacetylase 1                   274   4e-85    
ref|XP_011260173.1|  PREDICTED: histone deacetylase Rpd3-like           274   4e-85    
ref|XP_011311168.1|  PREDICTED: histone deacetylase Rpd3                274   4e-85    
ref|XP_004645947.1|  PREDICTED: histone deacetylase 2-like              274   5e-85    
ref|XP_006839979.1|  PREDICTED: histone deacetylase 2                   274   5e-85    
ref|XP_005073321.1|  PREDICTED: histone deacetylase 2                   274   5e-85    
ref|XP_006626228.1|  PREDICTED: histone deacetylase 2-like              273   5e-85    
ref|XP_002922834.1|  PREDICTED: histone deacetylase 2                   274   5e-85    
ref|XP_003404327.1|  PREDICTED: LOW QUALITY PROTEIN: histone deac...    274   5e-85    
ref|XP_007423534.1|  PREDICTED: histone deacetylase 2                   274   5e-85    
gb|EFN65822.1|  Histone deacetylase Rpd3                                274   5e-85    
ref|XP_005154752.1|  PREDICTED: histone deacetylase 2                   274   5e-85    
gb|AAX29896.1|  histone deacetylase 2                                   274   5e-85    
ref|XP_006158173.1|  PREDICTED: histone deacetylase 1                   273   5e-85    
ref|XP_002192530.1|  PREDICTED: histone deacetylase 2                   274   5e-85    
ref|XP_001352649.2|  GA20378                                            275   5e-85    
ref|NP_001518.3|  histone deacetylase 2                                 274   6e-85    
ref|XP_005043547.1|  PREDICTED: histone deacetylase 2                   274   6e-85    
ref|XP_004011238.1|  PREDICTED: histone deacetylase 2                   274   6e-85    
ref|NP_990162.2|  histone deacetylase 2                                 274   6e-85    
ref|XP_001368989.1|  PREDICTED: histone deacetylase 2                   274   6e-85    
ref|XP_004869140.1|  PREDICTED: histone deacetylase 2                   274   6e-85    
ref|XP_004264753.1|  PREDICTED: histone deacetylase 2                   274   6e-85    
ref|XP_003898337.1|  PREDICTED: histone deacetylase 2                   274   6e-85    
ref|NP_001068614.1|  histone deacetylase 2                              274   6e-85    
ref|XP_007902498.1|  PREDICTED: histone deacetylase 1                   274   6e-85    
ref|NP_001161325.1|  Rpd3 histone deacetylase                           274   6e-85    
ref|XP_010692974.1|  PREDICTED: histone deacetylase 9 isoform X2        271   6e-85    
gb|ELK00659.1|  Histone deacetylase 2                                   273   6e-85    
ref|XP_003466519.2|  PREDICTED: histone deacetylase 2                   274   6e-85    
ref|NP_001025564.1|  histone deacetylase 1                              273   6e-85    
ref|XP_011363162.1|  PREDICTED: histone deacetylase 2                   271   6e-85    
ref|XP_011494484.1|  PREDICTED: histone deacetylase Rpd3                274   6e-85    
ref|XP_004648093.1|  PREDICTED: histone deacetylase 2-like              274   6e-85    
ref|XP_007406841.1|  hypothetical protein MELLADRAFT_74327              270   6e-85    
gb|KDO22540.1|  hypothetical protein SPRG_11722                         272   6e-85    
ref|XP_007452653.1|  PREDICTED: histone deacetylase 2                   273   6e-85    
tpg|DAA26292.1|  TPA: histone deacetylase 2                             273   7e-85    
ref|XP_006825578.1|  PREDICTED: histone deacetylase 2-like              275   7e-85    
ref|XP_004449541.1|  PREDICTED: histone deacetylase 2                   273   7e-85    
ref|XP_011061204.1|  PREDICTED: histone deacetylase Rpd3 isoform X3     272   7e-85    
gb|KFM79320.1|  Histone deacetylase 3                                   271   7e-85    
ref|XP_011061203.1|  PREDICTED: histone deacetylase Rpd3 isoform X2     272   8e-85    
ref|XP_005887760.1|  PREDICTED: histone deacetylase 2                   273   8e-85    
ref|XP_004605841.1|  PREDICTED: histone deacetylase 2-like              272   8e-85    
sp|P70288.1|HDAC2_MOUSE  RecName: Full=Histone deacetylase 2; Sho...    273   8e-85    
ref|NP_032255.2|  histone deacetylase 2                                 273   8e-85    
ref|XP_007190789.1|  PREDICTED: histone deacetylase 2 isoform X1        273   8e-85    
ref|XP_011334448.1|  PREDICTED: histone deacetylase Rpd3-like           273   9e-85    
ref|XP_010902261.1|  PREDICTED: probable histone deacetylase 1-B        273   9e-85    
ref|XP_007125155.1|  PREDICTED: histone deacetylase 1 isoform X2        275   9e-85    
ref|XP_011061205.1|  PREDICTED: histone deacetylase Rpd3 isoform X4     272   9e-85    
ref|XP_011061202.1|  PREDICTED: histone deacetylase Rpd3 isoform X1     273   1e-84    
ref|XP_011158304.1|  PREDICTED: histone deacetylase Rpd3-like           273   1e-84    
ref|XP_002983212.1|  hypothetical protein SELMODRAFT_234196             271   1e-84    
ref|XP_794761.1|  PREDICTED: histone deacetylase 3-like                 271   1e-84    
ref|XP_009056751.1|  hypothetical protein LOTGIDRAFT_178649             272   1e-84    
ref|NP_445899.1|  histone deacetylase 2                                 273   1e-84    
ref|XP_002007081.1|  GI12742                                            274   1e-84    
ref|XP_002908492.1|  histone deacetylase, putative                      272   1e-84    
ref|XP_010380656.1|  PREDICTED: histone deacetylase 1-like isofor...    273   1e-84    
ref|XP_006091905.1|  PREDICTED: histone deacetylase 2-like              273   1e-84    
ref|XP_003742933.1|  PREDICTED: histone deacetylase 1-like              273   1e-84    
ref|XP_004887243.1|  PREDICTED: histone deacetylase 1                   273   1e-84    
ref|XP_010881163.1|  PREDICTED: histone deacetylase 2                   273   1e-84    
ref|XP_011334447.1|  PREDICTED: histone deacetylase Rpd3-like           273   2e-84    
ref|XP_010990324.1|  PREDICTED: histone deacetylase 2                   273   2e-84    
gb|KGB40155.1|  Histone deacetylase Rpd3                                268   2e-84    
ref|XP_009827426.1|  hypothetical protein H257_04553                    271   2e-84    
gb|EDL38458.1|  mCG128529                                               272   2e-84    
gb|ELT91729.1|  hypothetical protein CAPTEDRAFT_175897                  274   2e-84    
ref|XP_009030811.1|  hypothetical protein HELRODRAFT_194553             276   2e-84    
ref|XP_004471453.1|  PREDICTED: histone deacetylase 1                   276   2e-84    
gb|AAC23917.1|  putative histone deacetylase HDAC1                      273   3e-84    
ref|XP_008554767.1|  PREDICTED: histone deacetylase Rpd3                272   3e-84    
gb|EMT12816.1|  Histone deacetylase 9                                   269   3e-84    
gb|ETL49347.1|  hypothetical protein L916_01156                         271   3e-84    
ref|XP_003356353.2|  PREDICTED: histone deacetylase 1-like              271   4e-84    
gb|ADO79639.1|  histone deacetylase                                     272   4e-84    
gb|ETI56169.1|  hypothetical protein F443_01243                         271   4e-84    
ref|XP_001540677.1|  hypothetical protein HCAG_04517                    262   5e-84    
ref|XP_002961351.1|  hypothetical protein SELMODRAFT_74186              271   5e-84    
ref|XP_002594632.1|  hypothetical protein BRAFLDRAFT_217516             270   6e-84    
gb|AGY34711.1|  histone deacetylase 1                                   270   7e-84    
gb|EPZ33497.1|  Histone deacetylase 3                                   269   8e-84    
gb|AJH76982.1|  histone deacetylase 3                                   269   8e-84    
gb|EJK57351.1|  hypothetical protein THAOC_22614                        269   9e-84    
ref|XP_001641983.1|  predicted protein                                  269   9e-84    
ref|XP_011166216.1|  PREDICTED: histone deacetylase Rpd3                266   9e-84    
gb|AAI61939.1|  Hdac2 protein                                           272   1e-83    
ref|XP_002028716.1|  GL22935                                            271   1e-83    
ref|XP_002742058.1|  PREDICTED: histone deacetylase 3-like              269   1e-83    
ref|XP_008890897.1|  hypothetical protein PPTG_01052                    270   1e-83    
emb|CAA86368.1|  RPD3 gene                                              261   1e-83    
gb|AAH31055.2|  HDAC2 protein                                           273   1e-83    
ref|XP_003769422.1|  PREDICTED: histone deacetylase 2                   270   1e-83    
gb|ETI56144.1|  hypothetical protein, variant 4                         266   1e-83    
emb|CDO94185.1|  unnamed protein product                                268   1e-83    
gb|EGV91765.1|  Histone deacetylase 1                                   262   1e-83    
gb|ETK95956.1|  hypothetical protein, variant 4                         266   2e-83    
ref|XP_005782462.1|  DNA-lyase                                          261   2e-83    
ref|XP_518700.2|  PREDICTED: histone deacetylase 2                      272   2e-83    
dbj|BAG59420.1|  unnamed protein product                                272   2e-83    
gb|AAI46377.1|  Histone deacetylase 2                                   272   2e-83    
ref|XP_003255642.1|  PREDICTED: histone deacetylase 2 isoform 1         272   2e-83    
gb|KDO22541.1|  hypothetical protein SPRG_11723                         268   2e-83    
ref|XP_003671394.2|  hypothetical protein NDAI_0G03740                  268   3e-83    
emb|CCI40018.1|  unnamed protein product                                268   3e-83    
ref|XP_454037.1|  hypothetical protein                                  268   3e-83    
ref|XP_003683549.1|  hypothetical protein TPHA_0A00300                  268   3e-83    
gb|AAK58884.1|  reduced potassium dependency 3 Rpd3p                    268   3e-83    
gb|EUB61434.1|  Histone deacetylase                                     270   3e-83    
gb|KFP10889.1|  Histone deacetylase 1                                   268   4e-83    
ref|XP_008215158.1|  PREDICTED: histone deacetylase 3 isoform X2        266   4e-83    
ref|XP_002426578.1|  histone deacetylase, putative                      267   4e-83    
ref|XP_003763804.1|  PREDICTED: histone deacetylase 1-like              266   4e-83    
ref|XP_001631125.1|  predicted protein                                  267   4e-83    
gb|ERE77200.1|  histone deacetylase 1-like protein                      269   4e-83    
ref|XP_010406403.1|  PREDICTED: histone deacetylase 1                   268   4e-83    
ref|XP_008610887.1|  histone deacetylase 1/2                            263   4e-83    
ref|XP_667698.1|  histone deacetylase                                   268   5e-83    
ref|XP_002140153.1|  RPD3/HD1 histone deacetylase                       267   5e-83    
gb|AAW32178.1|  histone deacetylase                                     267   5e-83    
gb|EFB15636.1|  hypothetical protein PANDA_011849                       270   5e-83    
ref|XP_625348.1|  RPD3/HD1 histone deacetylase                          268   5e-83    
ref|XP_504286.1|  YALI0E22935p                                          268   5e-83    
ref|XP_003834653.1|  hypothetical protein LEMA_P067960.1                272   5e-83    
ref|XP_002495808.1|  ZYRO0C03498p                                       267   5e-83    
gb|EJT52427.1|  hypothetical protein A1Q1_04639                         272   5e-83    
ref|XP_445032.1|  hypothetical protein                                  267   6e-83    
gb|ETI56140.1|  hypothetical protein F443_01262                         267   6e-83    
ref|XP_006096086.1|  PREDICTED: histone deacetylase 2-like              268   6e-83    
ref|XP_005287640.2|  PREDICTED: histone deacetylase 2                   272   6e-83    
emb|CDS23263.1|  histone deacetylase 1                                  269   7e-83    
emb|CAD98610.1|  histone deacetylase                                    267   7e-83    
gb|AAG21919.1|AF139991_1  histone deacetylase                           267   7e-83    
ref|XP_001643163.1|  hypothetical protein Kpol_1038p11                  266   7e-83    
gb|AHW42410.1|  hdac1                                                   268   8e-83    
ref|XP_002287594.1|  histone deactylase 1 HDAC Hda1p HDA1               266   8e-83    
gb|KFV55204.1|  Histone deacetylase 1                                   266   8e-83    
gb|KFP00125.1|  Histone deacetylase 1                                   266   8e-83    
ref|XP_003675786.1|  hypothetical protein NCAS_0C04320                  266   8e-83    
gb|KFP28914.1|  Histone deacetylase 1                                   266   8e-83    
gb|KFM11275.1|  Histone deacetylase 1                                   266   8e-83    
ref|XP_008974016.1|  PREDICTED: LOW QUALITY PROTEIN: histone deac...    271   9e-83    
gb|KFV75060.1|  Histone deacetylase 1                                   266   9e-83    
gb|KFQ67796.1|  Histone deacetylase 1                                   267   9e-83    
ref|XP_008890915.1|  hypothetical protein, variant 4                    264   9e-83    
ref|XP_003403085.1|  PREDICTED: histone deacetylase 3-like              267   9e-83    
gb|KFZ54710.1|  Histone deacetylase 2                                   261   9e-83    
gb|EMS23506.1|  histone deacetylase 1/2                                 271   9e-83    
gb|ETK95952.1|  hypothetical protein L915_01183                         266   1e-82    
ref|XP_007624850.1|  PREDICTED: LOW QUALITY PROTEIN: histone deac...    268   1e-82    
gb|KFU91820.1|  Histone deacetylase 1                                   266   1e-82    
gb|EMC82692.1|  Histone deacetylase 1                                   267   1e-82    
ref|XP_003321297.2|  histone deacetylase 1/2                            271   1e-82    
ref|XP_005715783.1|  histone deacetylase                                265   1e-82    
gb|KFO60221.1|  Histone deacetylase 1                                   266   1e-82    
ref|XP_003955432.1|  hypothetical protein KAFR_0A08630                  266   1e-82    
ref|NP_987061.1|  AGR395Wp                                              266   1e-82    
gb|AGO10754.1|  AaceriAGR395Wp                                          266   1e-82    
gb|KFW72873.1|  Histone deacetylase 1                                   267   1e-82    
gb|EDL10114.1|  histone deacetylase 3, isoform CRA_e                    259   1e-82    
dbj|BAO39086.1|  histone deacetylase RPD3                               266   1e-82    
gb|KIR64155.1|  histone deacetylase RPD3                                267   1e-82    
gb|KFV84480.1|  Histone deacetylase 1                                   266   1e-82    
emb|CEP64745.1|  LALA0S13e02058g1_1                                     266   1e-82    
gb|KJE00336.1|  histone deacetylase RPD3                                267   1e-82    
ref|XP_002602634.1|  hypothetical protein BRAFLDRAFT_281552             266   1e-82    
emb|CDR45985.1|  CYFA0S21e00254g1_1                                     266   1e-82    
gb|KIR44330.1|  histone deacetylase RPD3                                267   1e-82    
gb|EME46763.1|  histone deacetylase rpd3-like protein                   272   1e-82    
gb|KIR40496.1|  histone deacetylase RPD3                                267   1e-82    
ref|XP_001783065.1|  class I RPD3 type histone deacetylase protein      265   1e-82    
ref|XP_007007223.1|  hypothetical protein TREMEDRAFT_72293              270   1e-82    
ref|NP_445898.1|  histone deacetylase 1-like                            267   2e-82    
ref|XP_009924856.1|  PREDICTED: histone deacetylase 2                   263   2e-82    
gb|KIR86482.1|  histone deacetylase RPD3                                267   2e-82    
ref|XP_003194703.1|  hypothetical protein CGB_F2490W                    267   2e-82    
ref|XP_005597025.1|  PREDICTED: histone deacetylase 2                   272   2e-82    
gb|KGB76009.1|  histone deacetylase complex                             267   2e-82    
gb|KIR26703.1|  histone deacetylase RPD3                                267   2e-82    
ref|XP_008005472.1|  PREDICTED: LOW QUALITY PROTEIN: histone deac...    273   2e-82    
ref|XP_001602930.1|  PREDICTED: histone deacetylase 3 isoform X1        266   2e-82    
gb|EHB08180.1|  Histone deacetylase 2                                   263   2e-82    
ref|XP_571598.1|  hypothetical protein                                  266   2e-82    
gb|KFH69894.1|  histone deacetylase 1/2                                 270   2e-82    
ref|XP_003644587.1|  hypothetical protein Ecym_2010                     265   2e-82    
emb|CCU98110.1|  unnamed protein product                                267   2e-82    
ref|XP_005178084.1|  PREDICTED: histone deacetylase 3                   266   2e-82    
emb|CDS28565.1|  histone deacetylase 1                                  267   2e-82    
ref|XP_005551686.1|  PREDICTED: LOW QUALITY PROTEIN: histone deac...    273   2e-82    
gb|AFR96008.1|  histone deacetylase RPD3                                266   3e-82    
ref|XP_007926893.1|  hypothetical protein MYCFIDRAFT_154253             269   3e-82    



>gb|AAS79608.1| putative histone deacetylase [Ipomoea trifida]
Length=438

 Score =   391 bits (1005),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 186/188 (99%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = +1

Query  73   MRSKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMEL  252
            MRSKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMEL
Sbjct  1    MRSKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMEL  60

Query  253  AQFHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRL  432
            AQFH+ADYVEFLHRITPDTQHLFG DLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRL
Sbjct  61   AQFHTADYVEFLHRITPDTQHLFGSDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRL  120

Query  433  NNQLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVE  612
            NNQLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVE
Sbjct  121  NNQLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVE  180

Query  613  EAFYFTDR  636
            EAFYFTDR
Sbjct  181  EAFYFTDR  188



>gb|KDO51348.1| hypothetical protein CISIN_1g0130381mg, partial [Citrus sinensis]
 gb|KDO51349.1| hypothetical protein CISIN_1g0130381mg, partial [Citrus sinensis]
Length=209

 Score =   370 bits (949),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 174/188 (93%), Positives = 182/188 (97%), Gaps = 0/188 (0%)
 Frame = +1

Query  73   MRSKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMEL  252
            MRSKD+ISYFYDGDVG+VYFGPNHPMKPHRLCMTHHLVL+Y LH KMEIYRPHKAYP+EL
Sbjct  1    MRSKDKISYFYDGDVGSVYFGPNHPMKPHRLCMTHHLVLSYDLHKKMEIYRPHKAYPVEL  60

Query  253  AQFHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRL  432
            AQFHSADYVEFLHRITPDTQHLF  +L +YNLGEDCPVF+NLFEFCQIYAGGTIDAARRL
Sbjct  61   AQFHSADYVEFLHRITPDTQHLFRQELTKYNLGEDCPVFENLFEFCQIYAGGTIDAARRL  120

Query  433  NNQLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVE  612
            NNQLCD+AINWAGGLHHAKKCEASGFCYINDLVLGILELLKYH RVLYIDIDVHHGDGVE
Sbjct  121  NNQLCDIAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHARVLYIDIDVHHGDGVE  180

Query  613  EAFYFTDR  636
            EAFYFTDR
Sbjct  181  EAFYFTDR  188



>gb|KDO51350.1| hypothetical protein CISIN_1g0130381mg, partial [Citrus sinensis]
Length=231

 Score =   370 bits (950),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 174/188 (93%), Positives = 182/188 (97%), Gaps = 0/188 (0%)
 Frame = +1

Query  73   MRSKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMEL  252
            MRSKD+ISYFYDGDVG+VYFGPNHPMKPHRLCMTHHLVL+Y LH KMEIYRPHKAYP+EL
Sbjct  1    MRSKDKISYFYDGDVGSVYFGPNHPMKPHRLCMTHHLVLSYDLHKKMEIYRPHKAYPVEL  60

Query  253  AQFHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRL  432
            AQFHSADYVEFLHRITPDTQHLF  +L +YNLGEDCPVF+NLFEFCQIYAGGTIDAARRL
Sbjct  61   AQFHSADYVEFLHRITPDTQHLFRQELTKYNLGEDCPVFENLFEFCQIYAGGTIDAARRL  120

Query  433  NNQLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVE  612
            NNQLCD+AINWAGGLHHAKKCEASGFCYINDLVLGILELLKYH RVLYIDIDVHHGDGVE
Sbjct  121  NNQLCDIAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHARVLYIDIDVHHGDGVE  180

Query  613  EAFYFTDR  636
            EAFYFTDR
Sbjct  181  EAFYFTDR  188



>ref|XP_004172671.1| PREDICTED: histone deacetylase 9-like, partial [Cucumis sativus]
Length=219

 Score =   368 bits (945),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 173/188 (92%), Positives = 181/188 (96%), Gaps = 0/188 (0%)
 Frame = +1

Query  73   MRSKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMEL  252
            MRSKDRISYFYDGDVG+VYFGPNHPMKPHRLCMTHHLVL+Y LH KMEIYRPHKAYP+EL
Sbjct  1    MRSKDRISYFYDGDVGSVYFGPNHPMKPHRLCMTHHLVLSYELHKKMEIYRPHKAYPVEL  60

Query  253  AQFHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRL  432
            AQFHSADYVEFLHRI PDTQHLF  +L +YNLGEDCPVF+NLFEFCQIYAGGTIDAARRL
Sbjct  61   AQFHSADYVEFLHRINPDTQHLFANELSKYNLGEDCPVFENLFEFCQIYAGGTIDAARRL  120

Query  433  NNQLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVE  612
            N+QLCD+AINWAGGLHHAKKCEASGFCYINDLVLGILELLKYH RVLYIDIDVHHGDGVE
Sbjct  121  NHQLCDIAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHSRVLYIDIDVHHGDGVE  180

Query  613  EAFYFTDR  636
            EAFYFTDR
Sbjct  181  EAFYFTDR  188



>ref|XP_007015907.1| Histone deacetylase 9 isoform 4 [Theobroma cacao]
 gb|EOY33526.1| Histone deacetylase 9 isoform 4 [Theobroma cacao]
Length=327

 Score =   370 bits (951),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 174/188 (93%), Positives = 181/188 (96%), Gaps = 0/188 (0%)
 Frame = +1

Query  73   MRSKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMEL  252
            MR KD+I+YFYDGDVG+VYFGPNHPMKPHRLCMTHHLVLAY LH KMEIYRPHKAYP+EL
Sbjct  1    MRPKDKIAYFYDGDVGSVYFGPNHPMKPHRLCMTHHLVLAYDLHKKMEIYRPHKAYPVEL  60

Query  253  AQFHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRL  432
            AQFHSADYVEFLHRITPDTQHLF  +L RYNLGEDCPVF+NLFEFCQIYAGGTIDAARRL
Sbjct  61   AQFHSADYVEFLHRITPDTQHLFSNELARYNLGEDCPVFENLFEFCQIYAGGTIDAARRL  120

Query  433  NNQLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVE  612
            NNQLCD+AINWAGGLHHAKKCEASGFCYINDLVLGILELLKYH RVLYIDIDVHHGDGVE
Sbjct  121  NNQLCDIAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHARVLYIDIDVHHGDGVE  180

Query  613  EAFYFTDR  636
            EAFYFTDR
Sbjct  181  EAFYFTDR  188



>ref|XP_007015914.1| Histone deacetylase 9 isoform 11 [Theobroma cacao]
 gb|EOY33533.1| Histone deacetylase 9 isoform 11 [Theobroma cacao]
Length=303

 Score =   370 bits (949),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 174/188 (93%), Positives = 181/188 (96%), Gaps = 0/188 (0%)
 Frame = +1

Query  73   MRSKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMEL  252
            MR KD+I+YFYDGDVG+VYFGPNHPMKPHRLCMTHHLVLAY LH KMEIYRPHKAYP+EL
Sbjct  1    MRPKDKIAYFYDGDVGSVYFGPNHPMKPHRLCMTHHLVLAYDLHKKMEIYRPHKAYPVEL  60

Query  253  AQFHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRL  432
            AQFHSADYVEFLHRITPDTQHLF  +L RYNLGEDCPVF+NLFEFCQIYAGGTIDAARRL
Sbjct  61   AQFHSADYVEFLHRITPDTQHLFSNELARYNLGEDCPVFENLFEFCQIYAGGTIDAARRL  120

Query  433  NNQLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVE  612
            NNQLCD+AINWAGGLHHAKKCEASGFCYINDLVLGILELLKYH RVLYIDIDVHHGDGVE
Sbjct  121  NNQLCDIAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHARVLYIDIDVHHGDGVE  180

Query  613  EAFYFTDR  636
            EAFYFTDR
Sbjct  181  EAFYFTDR  188



>ref|XP_007015913.1| Histone deacetylase 9 isoform 10 [Theobroma cacao]
 gb|EOY33532.1| Histone deacetylase 9 isoform 10 [Theobroma cacao]
Length=327

 Score =   370 bits (950),  Expect = 8e-125, Method: Compositional matrix adjust.
 Identities = 174/188 (93%), Positives = 181/188 (96%), Gaps = 0/188 (0%)
 Frame = +1

Query  73   MRSKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMEL  252
            MR KD+I+YFYDGDVG+VYFGPNHPMKPHRLCMTHHLVLAY LH KMEIYRPHKAYP+EL
Sbjct  1    MRPKDKIAYFYDGDVGSVYFGPNHPMKPHRLCMTHHLVLAYDLHKKMEIYRPHKAYPVEL  60

Query  253  AQFHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRL  432
            AQFHSADYVEFLHRITPDTQHLF  +L RYNLGEDCPVF+NLFEFCQIYAGGTIDAARRL
Sbjct  61   AQFHSADYVEFLHRITPDTQHLFSNELARYNLGEDCPVFENLFEFCQIYAGGTIDAARRL  120

Query  433  NNQLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVE  612
            NNQLCD+AINWAGGLHHAKKCEASGFCYINDLVLGILELLKYH RVLYIDIDVHHGDGVE
Sbjct  121  NNQLCDIAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHARVLYIDIDVHHGDGVE  180

Query  613  EAFYFTDR  636
            EAFYFTDR
Sbjct  181  EAFYFTDR  188



>ref|XP_009605994.1| PREDICTED: histone deacetylase 9 [Nicotiana tomentosiformis]
 ref|XP_009788798.1| PREDICTED: histone deacetylase 9 isoform X1 [Nicotiana sylvestris]
 ref|XP_009788799.1| PREDICTED: histone deacetylase 9 isoform X2 [Nicotiana sylvestris]
Length=430

 Score =   374 bits (959),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 175/188 (93%), Positives = 183/188 (97%), Gaps = 0/188 (0%)
 Frame = +1

Query  73   MRSKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMEL  252
            MRSKD+ISYFYDGDVG+VYFGPNHPMKPHRLCMTHHLVLAYGLHNKME+YRPHKAYP+EL
Sbjct  1    MRSKDKISYFYDGDVGSVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEVYRPHKAYPVEL  60

Query  253  AQFHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRL  432
            AQFHSADYVEFL+RITPDTQHLF  ++ RYNLGEDCPVFDNLFEFCQIYAGGTIDAARRL
Sbjct  61   AQFHSADYVEFLNRITPDTQHLFPSEMARYNLGEDCPVFDNLFEFCQIYAGGTIDAARRL  120

Query  433  NNQLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVE  612
            NNQLCD+AINWAGGLHHAKKC ASGFCYINDLVLGILELLKYH RVLYIDIDVHHGDGVE
Sbjct  121  NNQLCDIAINWAGGLHHAKKCAASGFCYINDLVLGILELLKYHARVLYIDIDVHHGDGVE  180

Query  613  EAFYFTDR  636
            EAFYFTDR
Sbjct  181  EAFYFTDR  188



>ref|XP_010242657.1| PREDICTED: histone deacetylase 9-like [Nelumbo nucifera]
Length=279

 Score =   368 bits (945),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 174/190 (92%), Positives = 180/190 (95%), Gaps = 0/190 (0%)
 Frame = +1

Query  67   AKMRSKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPM  246
            AKM S+DRI+YFYDGDVGNVYFGPNHPMKPHRLCM HHLVL+Y LH KMEIYRPHKAYP+
Sbjct  56   AKMPSRDRIAYFYDGDVGNVYFGPNHPMKPHRLCMAHHLVLSYELHKKMEIYRPHKAYPV  115

Query  247  ELAQFHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAAR  426
            ELAQFHS DYVEFLHRITPDTQHLF  DL +YNLGEDCPVFDNLFEFCQIYAGGTIDAAR
Sbjct  116  ELAQFHSEDYVEFLHRITPDTQHLFSNDLAKYNLGEDCPVFDNLFEFCQIYAGGTIDAAR  175

Query  427  RLNNQLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDG  606
            RLNNQLCD+AINWAGGLHHAKK EASGFCYINDLVLGILELLKYH RVLYIDIDVHHGDG
Sbjct  176  RLNNQLCDIAINWAGGLHHAKKSEASGFCYINDLVLGILELLKYHARVLYIDIDVHHGDG  235

Query  607  VEEAFYFTDR  636
            VEEAFYFTDR
Sbjct  236  VEEAFYFTDR  245



>ref|XP_003606237.1| Histone deacetylase [Medicago truncatula]
 gb|AES88434.1| histone deacetylase family protein [Medicago truncatula]
Length=430

 Score =   373 bits (957),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 173/188 (92%), Positives = 183/188 (97%), Gaps = 0/188 (0%)
 Frame = +1

Query  73   MRSKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMEL  252
            MRSKDRISYFYDGDVG+VYFGPNHPMKPHRLCMTHHLVL+Y LH KME+YRPHKAYP+EL
Sbjct  1    MRSKDRISYFYDGDVGSVYFGPNHPMKPHRLCMTHHLVLSYDLHKKMEVYRPHKAYPVEL  60

Query  253  AQFHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRL  432
            AQFHSADYVEFLHRITPDTQHLF  +L +YNLGEDCPVFDNLFEFCQ+YAGGTIDAARRL
Sbjct  61   AQFHSADYVEFLHRITPDTQHLFSDELAKYNLGEDCPVFDNLFEFCQMYAGGTIDAARRL  120

Query  433  NNQLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVE  612
            NN+LCD+AINWAGGLHHAKKCEASGFCYINDLVLGILELLK+HPRVLYIDIDVHHGDGVE
Sbjct  121  NNKLCDIAINWAGGLHHAKKCEASGFCYINDLVLGILELLKHHPRVLYIDIDVHHGDGVE  180

Query  613  EAFYFTDR  636
            EAFYFTDR
Sbjct  181  EAFYFTDR  188



>emb|CAN77816.1| hypothetical protein VITISV_020659 [Vitis vinifera]
Length=430

 Score =   373 bits (957),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 175/188 (93%), Positives = 182/188 (97%), Gaps = 0/188 (0%)
 Frame = +1

Query  73   MRSKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMEL  252
            MRSKDRISYFYDGDVG+VYFGPNHPMKPHRLCMTHHLVL+Y LH KMEIYRPHKAYP+EL
Sbjct  1    MRSKDRISYFYDGDVGSVYFGPNHPMKPHRLCMTHHLVLSYELHKKMEIYRPHKAYPVEL  60

Query  253  AQFHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRL  432
            AQFHSADYVEFLHRITPDTQHLF  +L RYNLGEDCPVF+NLFEFCQIYAGGTIDAARRL
Sbjct  61   AQFHSADYVEFLHRITPDTQHLFSNELARYNLGEDCPVFENLFEFCQIYAGGTIDAARRL  120

Query  433  NNQLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVE  612
            NNQLCD+AINWAGGLHHAKKCEASGFCYINDLVLGILELLK+H RVLYIDIDVHHGDGVE
Sbjct  121  NNQLCDIAINWAGGLHHAKKCEASGFCYINDLVLGILELLKHHARVLYIDIDVHHGDGVE  180

Query  613  EAFYFTDR  636
            EAFYFTDR
Sbjct  181  EAFYFTDR  188



>ref|XP_002266492.1| PREDICTED: histone deacetylase 9 isoform X1 [Vitis vinifera]
 emb|CBI16725.3| unnamed protein product [Vitis vinifera]
Length=430

 Score =   373 bits (957),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 175/188 (93%), Positives = 182/188 (97%), Gaps = 0/188 (0%)
 Frame = +1

Query  73   MRSKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMEL  252
            MRSKDRISYFYDGDVG+VYFGPNHPMKPHRLCMTHHLVL+Y LH KMEIYRPHKAYP+EL
Sbjct  1    MRSKDRISYFYDGDVGSVYFGPNHPMKPHRLCMTHHLVLSYELHKKMEIYRPHKAYPVEL  60

Query  253  AQFHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRL  432
            AQFHSADYVEFLHRITPDTQHLF  +L RYNLGEDCPVF+NLFEFCQIYAGGTIDAARRL
Sbjct  61   AQFHSADYVEFLHRITPDTQHLFSNELARYNLGEDCPVFENLFEFCQIYAGGTIDAARRL  120

Query  433  NNQLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVE  612
            NNQLCD+AINWAGGLHHAKKCEASGFCYINDLVLGILELLK+H RVLYIDIDVHHGDGVE
Sbjct  121  NNQLCDIAINWAGGLHHAKKCEASGFCYINDLVLGILELLKHHARVLYIDIDVHHGDGVE  180

Query  613  EAFYFTDR  636
            EAFYFTDR
Sbjct  181  EAFYFTDR  188



>ref|XP_006471388.1| PREDICTED: histone deacetylase 9-like [Citrus sinensis]
Length=429

 Score =   372 bits (956),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 174/188 (93%), Positives = 182/188 (97%), Gaps = 0/188 (0%)
 Frame = +1

Query  73   MRSKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMEL  252
            MRSKD+ISYFYDGDVG+VYFGPNHPMKPHRLCMTHHLVL+Y LH KMEIYRPHKAYP+EL
Sbjct  1    MRSKDKISYFYDGDVGSVYFGPNHPMKPHRLCMTHHLVLSYDLHKKMEIYRPHKAYPVEL  60

Query  253  AQFHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRL  432
            AQFHSADYVEFLHRITPDTQHLF  +L +YNLGEDCPVF+NLFEFCQIYAGGTIDAARRL
Sbjct  61   AQFHSADYVEFLHRITPDTQHLFRQELTKYNLGEDCPVFENLFEFCQIYAGGTIDAARRL  120

Query  433  NNQLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVE  612
            NNQLCD+AINWAGGLHHAKKCEASGFCYINDLVLGILELLKYH RVLYIDIDVHHGDGVE
Sbjct  121  NNQLCDIAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHARVLYIDIDVHHGDGVE  180

Query  613  EAFYFTDR  636
            EAFYFTDR
Sbjct  181  EAFYFTDR  188



>ref|XP_006424306.1| hypothetical protein CICLE_v10029823mg [Citrus clementina]
 gb|ESR37546.1| hypothetical protein CICLE_v10029823mg [Citrus clementina]
Length=429

 Score =   372 bits (956),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 174/188 (93%), Positives = 182/188 (97%), Gaps = 0/188 (0%)
 Frame = +1

Query  73   MRSKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMEL  252
            MRSKD+ISYFYDGDVG+VYFGPNHPMKPHRLCMTHHLVL+Y LH KMEIYRPHKAYP+EL
Sbjct  1    MRSKDKISYFYDGDVGSVYFGPNHPMKPHRLCMTHHLVLSYDLHKKMEIYRPHKAYPVEL  60

Query  253  AQFHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRL  432
            AQFHSADYVEFLHRITPDTQHLF  +L +YNLGEDCPVF+NLFEFCQIYAGGTIDAARRL
Sbjct  61   AQFHSADYVEFLHRITPDTQHLFRQELTKYNLGEDCPVFENLFEFCQIYAGGTIDAARRL  120

Query  433  NNQLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVE  612
            NNQLCD+AINWAGGLHHAKKCEASGFCYINDLVLGILELLKYH RVLYIDIDVHHGDGVE
Sbjct  121  NNQLCDIAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHARVLYIDIDVHHGDGVE  180

Query  613  EAFYFTDR  636
            EAFYFTDR
Sbjct  181  EAFYFTDR  188



>ref|XP_007015912.1| Histone deacetylase 9 isoform 9 [Theobroma cacao]
 gb|EOY33531.1| Histone deacetylase 9 isoform 9 [Theobroma cacao]
Length=374

 Score =   370 bits (950),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 174/188 (93%), Positives = 181/188 (96%), Gaps = 0/188 (0%)
 Frame = +1

Query  73   MRSKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMEL  252
            MR KD+I+YFYDGDVG+VYFGPNHPMKPHRLCMTHHLVLAY LH KMEIYRPHKAYP+EL
Sbjct  1    MRPKDKIAYFYDGDVGSVYFGPNHPMKPHRLCMTHHLVLAYDLHKKMEIYRPHKAYPVEL  60

Query  253  AQFHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRL  432
            AQFHSADYVEFLHRITPDTQHLF  +L RYNLGEDCPVF+NLFEFCQIYAGGTIDAARRL
Sbjct  61   AQFHSADYVEFLHRITPDTQHLFSNELARYNLGEDCPVFENLFEFCQIYAGGTIDAARRL  120

Query  433  NNQLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVE  612
            NNQLCD+AINWAGGLHHAKKCEASGFCYINDLVLGILELLKYH RVLYIDIDVHHGDGVE
Sbjct  121  NNQLCDIAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHARVLYIDIDVHHGDGVE  180

Query  613  EAFYFTDR  636
            EAFYFTDR
Sbjct  181  EAFYFTDR  188



>ref|XP_007015910.1| Histone deacetylase 9 isoform 7, partial [Theobroma cacao]
 gb|EOY33529.1| Histone deacetylase 9 isoform 7, partial [Theobroma cacao]
Length=406

 Score =   371 bits (953),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 174/188 (93%), Positives = 181/188 (96%), Gaps = 0/188 (0%)
 Frame = +1

Query  73   MRSKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMEL  252
            MR KD+I+YFYDGDVG+VYFGPNHPMKPHRLCMTHHLVLAY LH KMEIYRPHKAYP+EL
Sbjct  1    MRPKDKIAYFYDGDVGSVYFGPNHPMKPHRLCMTHHLVLAYDLHKKMEIYRPHKAYPVEL  60

Query  253  AQFHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRL  432
            AQFHSADYVEFLHRITPDTQHLF  +L RYNLGEDCPVF+NLFEFCQIYAGGTIDAARRL
Sbjct  61   AQFHSADYVEFLHRITPDTQHLFSNELARYNLGEDCPVFENLFEFCQIYAGGTIDAARRL  120

Query  433  NNQLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVE  612
            NNQLCD+AINWAGGLHHAKKCEASGFCYINDLVLGILELLKYH RVLYIDIDVHHGDGVE
Sbjct  121  NNQLCDIAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHARVLYIDIDVHHGDGVE  180

Query  613  EAFYFTDR  636
            EAFYFTDR
Sbjct  181  EAFYFTDR  188



>gb|KCW50788.1| hypothetical protein EUGRSUZ_J00456 [Eucalyptus grandis]
Length=393

 Score =   370 bits (951),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 174/188 (93%), Positives = 179/188 (95%), Gaps = 0/188 (0%)
 Frame = +1

Query  73   MRSKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMEL  252
            MR KDRISYFYDGDVG+VYFGPNHPMKPHRLCMTHHLVL+Y LH KMEIYRPHKAYP EL
Sbjct  1    MRPKDRISYFYDGDVGSVYFGPNHPMKPHRLCMTHHLVLSYELHTKMEIYRPHKAYPAEL  60

Query  253  AQFHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRL  432
            AQFHS DYVEFLHRITPDTQHLF  DL +YNLGEDCPVF+NLFEFCQIYAGGTIDAARRL
Sbjct  61   AQFHSPDYVEFLHRITPDTQHLFPNDLAKYNLGEDCPVFENLFEFCQIYAGGTIDAARRL  120

Query  433  NNQLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVE  612
            NNQLCD+AINWAGGLHHAKKCEASGFCYINDLVLGILELLKYH RVLYIDIDVHHGDGVE
Sbjct  121  NNQLCDIAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHARVLYIDIDVHHGDGVE  180

Query  613  EAFYFTDR  636
            EAFYFTDR
Sbjct  181  EAFYFTDR  188



>ref|XP_004251031.1| PREDICTED: histone deacetylase 9 [Solanum lycopersicum]
Length=430

 Score =   372 bits (955),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 173/188 (92%), Positives = 184/188 (98%), Gaps = 0/188 (0%)
 Frame = +1

Query  73   MRSKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMEL  252
            MRSKD+ISYFYDGDVG+VYFGPNHPMKPHRLCMTHHLVLAYGLH+KME+YRPHKAYP+EL
Sbjct  1    MRSKDKISYFYDGDVGSVYFGPNHPMKPHRLCMTHHLVLAYGLHSKMEVYRPHKAYPVEL  60

Query  253  AQFHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRL  432
            AQFHSADYVEFL+RITPDTQ+LF  ++ RYNLGEDCPVFDNLFEFCQIYAGGTIDAARRL
Sbjct  61   AQFHSADYVEFLNRITPDTQNLFPSEMARYNLGEDCPVFDNLFEFCQIYAGGTIDAARRL  120

Query  433  NNQLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVE  612
            NN+LCD+AINWAGGLHHAKKC ASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVE
Sbjct  121  NNKLCDIAINWAGGLHHAKKCAASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVE  180

Query  613  EAFYFTDR  636
            EAFYFTDR
Sbjct  181  EAFYFTDR  188



>ref|XP_007015908.1| Histone deacetylase 9 isoform 5 [Theobroma cacao]
 gb|EOY33527.1| Histone deacetylase 9 isoform 5 [Theobroma cacao]
Length=349

 Score =   369 bits (947),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 174/188 (93%), Positives = 181/188 (96%), Gaps = 0/188 (0%)
 Frame = +1

Query  73   MRSKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMEL  252
            MR KD+I+YFYDGDVG+VYFGPNHPMKPHRLCMTHHLVLAY LH KMEIYRPHKAYP+EL
Sbjct  1    MRPKDKIAYFYDGDVGSVYFGPNHPMKPHRLCMTHHLVLAYDLHKKMEIYRPHKAYPVEL  60

Query  253  AQFHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRL  432
            AQFHSADYVEFLHRITPDTQHLF  +L RYNLGEDCPVF+NLFEFCQIYAGGTIDAARRL
Sbjct  61   AQFHSADYVEFLHRITPDTQHLFSNELARYNLGEDCPVFENLFEFCQIYAGGTIDAARRL  120

Query  433  NNQLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVE  612
            NNQLCD+AINWAGGLHHAKKCEASGFCYINDLVLGILELLKYH RVLYIDIDVHHGDGVE
Sbjct  121  NNQLCDIAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHARVLYIDIDVHHGDGVE  180

Query  613  EAFYFTDR  636
            EAFYFTDR
Sbjct  181  EAFYFTDR  188



>ref|XP_007015906.1| Histone deacetylase 9 isoform 3 [Theobroma cacao]
 ref|XP_007015909.1| Histone deacetylase 9 isoform 3 [Theobroma cacao]
 gb|EOY33525.1| Histone deacetylase 9 isoform 3 [Theobroma cacao]
 gb|EOY33528.1| Histone deacetylase 9 isoform 3 [Theobroma cacao]
Length=456

 Score =   372 bits (956),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 174/188 (93%), Positives = 181/188 (96%), Gaps = 0/188 (0%)
 Frame = +1

Query  73   MRSKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMEL  252
            MR KD+I+YFYDGDVG+VYFGPNHPMKPHRLCMTHHLVLAY LH KMEIYRPHKAYP+EL
Sbjct  1    MRPKDKIAYFYDGDVGSVYFGPNHPMKPHRLCMTHHLVLAYDLHKKMEIYRPHKAYPVEL  60

Query  253  AQFHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRL  432
            AQFHSADYVEFLHRITPDTQHLF  +L RYNLGEDCPVF+NLFEFCQIYAGGTIDAARRL
Sbjct  61   AQFHSADYVEFLHRITPDTQHLFSNELARYNLGEDCPVFENLFEFCQIYAGGTIDAARRL  120

Query  433  NNQLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVE  612
            NNQLCD+AINWAGGLHHAKKCEASGFCYINDLVLGILELLKYH RVLYIDIDVHHGDGVE
Sbjct  121  NNQLCDIAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHARVLYIDIDVHHGDGVE  180

Query  613  EAFYFTDR  636
            EAFYFTDR
Sbjct  181  EAFYFTDR  188



>gb|KCW50789.1| hypothetical protein EUGRSUZ_J00456 [Eucalyptus grandis]
Length=405

 Score =   370 bits (951),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 174/188 (93%), Positives = 179/188 (95%), Gaps = 0/188 (0%)
 Frame = +1

Query  73   MRSKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMEL  252
            MR KDRISYFYDGDVG+VYFGPNHPMKPHRLCMTHHLVL+Y LH KMEIYRPHKAYP EL
Sbjct  1    MRPKDRISYFYDGDVGSVYFGPNHPMKPHRLCMTHHLVLSYELHTKMEIYRPHKAYPAEL  60

Query  253  AQFHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRL  432
            AQFHS DYVEFLHRITPDTQHLF  DL +YNLGEDCPVF+NLFEFCQIYAGGTIDAARRL
Sbjct  61   AQFHSPDYVEFLHRITPDTQHLFPNDLAKYNLGEDCPVFENLFEFCQIYAGGTIDAARRL  120

Query  433  NNQLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVE  612
            NNQLCD+AINWAGGLHHAKKCEASGFCYINDLVLGILELLKYH RVLYIDIDVHHGDGVE
Sbjct  121  NNQLCDIAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHARVLYIDIDVHHGDGVE  180

Query  613  EAFYFTDR  636
            EAFYFTDR
Sbjct  181  EAFYFTDR  188



>ref|XP_007015904.1| Histone deacetylase 9 isoform 1 [Theobroma cacao]
 gb|EOY33523.1| Histone deacetylase 9 isoform 1 [Theobroma cacao]
Length=429

 Score =   371 bits (953),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 174/188 (93%), Positives = 181/188 (96%), Gaps = 0/188 (0%)
 Frame = +1

Query  73   MRSKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMEL  252
            MR KD+I+YFYDGDVG+VYFGPNHPMKPHRLCMTHHLVLAY LH KMEIYRPHKAYP+EL
Sbjct  1    MRPKDKIAYFYDGDVGSVYFGPNHPMKPHRLCMTHHLVLAYDLHKKMEIYRPHKAYPVEL  60

Query  253  AQFHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRL  432
            AQFHSADYVEFLHRITPDTQHLF  +L RYNLGEDCPVF+NLFEFCQIYAGGTIDAARRL
Sbjct  61   AQFHSADYVEFLHRITPDTQHLFSNELARYNLGEDCPVFENLFEFCQIYAGGTIDAARRL  120

Query  433  NNQLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVE  612
            NNQLCD+AINWAGGLHHAKKCEASGFCYINDLVLGILELLKYH RVLYIDIDVHHGDGVE
Sbjct  121  NNQLCDIAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHARVLYIDIDVHHGDGVE  180

Query  613  EAFYFTDR  636
            EAFYFTDR
Sbjct  181  EAFYFTDR  188



>ref|XP_007015905.1| Histone deacetylase 9 isoform 2 [Theobroma cacao]
 gb|EOY33524.1| Histone deacetylase 9 isoform 2 [Theobroma cacao]
Length=404

 Score =   370 bits (951),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 174/188 (93%), Positives = 181/188 (96%), Gaps = 0/188 (0%)
 Frame = +1

Query  73   MRSKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMEL  252
            MR KD+I+YFYDGDVG+VYFGPNHPMKPHRLCMTHHLVLAY LH KMEIYRPHKAYP+EL
Sbjct  1    MRPKDKIAYFYDGDVGSVYFGPNHPMKPHRLCMTHHLVLAYDLHKKMEIYRPHKAYPVEL  60

Query  253  AQFHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRL  432
            AQFHSADYVEFLHRITPDTQHLF  +L RYNLGEDCPVF+NLFEFCQIYAGGTIDAARRL
Sbjct  61   AQFHSADYVEFLHRITPDTQHLFSNELARYNLGEDCPVFENLFEFCQIYAGGTIDAARRL  120

Query  433  NNQLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVE  612
            NNQLCD+AINWAGGLHHAKKCEASGFCYINDLVLGILELLKYH RVLYIDIDVHHGDGVE
Sbjct  121  NNQLCDIAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHARVLYIDIDVHHGDGVE  180

Query  613  EAFYFTDR  636
            EAFYFTDR
Sbjct  181  EAFYFTDR  188



>gb|KDP34706.1| hypothetical protein JCGZ_10911 [Jatropha curcas]
Length=430

 Score =   371 bits (953),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 174/188 (93%), Positives = 181/188 (96%), Gaps = 0/188 (0%)
 Frame = +1

Query  73   MRSKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMEL  252
            MRSKDRI+YFYDGDVG VYFGPNHPMKPHRLCMTHHLVL+Y LH KMEIYRPHKAYP+EL
Sbjct  1    MRSKDRIAYFYDGDVGGVYFGPNHPMKPHRLCMTHHLVLSYELHKKMEIYRPHKAYPVEL  60

Query  253  AQFHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRL  432
            AQFHSADYVEFLHRITPDTQHLF  +L RYNLGEDCPVF+NLFEFCQIYAGGTIDAARRL
Sbjct  61   AQFHSADYVEFLHRITPDTQHLFANELVRYNLGEDCPVFENLFEFCQIYAGGTIDAARRL  120

Query  433  NNQLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVE  612
            NNQLCD+AINWAGGLHHAKKCEASGFCYINDLVLGILELLKYH RVLYIDIDVHHGDGVE
Sbjct  121  NNQLCDIAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHARVLYIDIDVHHGDGVE  180

Query  613  EAFYFTDR  636
            EAF+FTDR
Sbjct  181  EAFFFTDR  188



>gb|KCW50787.1| hypothetical protein EUGRSUZ_J00456 [Eucalyptus grandis]
Length=406

 Score =   370 bits (950),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 174/188 (93%), Positives = 179/188 (95%), Gaps = 0/188 (0%)
 Frame = +1

Query  73   MRSKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMEL  252
            MR KDRISYFYDGDVG+VYFGPNHPMKPHRLCMTHHLVL+Y LH KMEIYRPHKAYP EL
Sbjct  1    MRPKDRISYFYDGDVGSVYFGPNHPMKPHRLCMTHHLVLSYELHTKMEIYRPHKAYPAEL  60

Query  253  AQFHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRL  432
            AQFHS DYVEFLHRITPDTQHLF  DL +YNLGEDCPVF+NLFEFCQIYAGGTIDAARRL
Sbjct  61   AQFHSPDYVEFLHRITPDTQHLFPNDLAKYNLGEDCPVFENLFEFCQIYAGGTIDAARRL  120

Query  433  NNQLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVE  612
            NNQLCD+AINWAGGLHHAKKCEASGFCYINDLVLGILELLKYH RVLYIDIDVHHGDGVE
Sbjct  121  NNQLCDIAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHARVLYIDIDVHHGDGVE  180

Query  613  EAFYFTDR  636
            EAFYFTDR
Sbjct  181  EAFYFTDR  188



>ref|XP_006349095.1| PREDICTED: histone deacetylase 9-like [Solanum tuberosum]
Length=430

 Score =   370 bits (951),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 172/188 (91%), Positives = 184/188 (98%), Gaps = 0/188 (0%)
 Frame = +1

Query  73   MRSKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMEL  252
            MRSKD+ISYFYDGDVG+VYFGPNHPMKPHRLCMTHHLVLAYGLH+KME+YRPHKAYP+EL
Sbjct  1    MRSKDKISYFYDGDVGSVYFGPNHPMKPHRLCMTHHLVLAYGLHSKMEVYRPHKAYPVEL  60

Query  253  AQFHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRL  432
            AQFHSADYVEFL+RITP+TQ+LF  ++ RYNLGEDCPVFDNLFEFCQIYAGGTIDAARRL
Sbjct  61   AQFHSADYVEFLNRITPETQNLFPSEMARYNLGEDCPVFDNLFEFCQIYAGGTIDAARRL  120

Query  433  NNQLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVE  612
            NN+LCD+AINWAGGLHHAKKC ASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVE
Sbjct  121  NNKLCDIAINWAGGLHHAKKCAASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVE  180

Query  613  EAFYFTDR  636
            EAFYFTDR
Sbjct  181  EAFYFTDR  188



>ref|XP_010031477.1| PREDICTED: histone deacetylase 9 isoform X1 [Eucalyptus grandis]
 gb|KCW50785.1| hypothetical protein EUGRSUZ_J00456 [Eucalyptus grandis]
Length=432

 Score =   370 bits (951),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 174/188 (93%), Positives = 179/188 (95%), Gaps = 0/188 (0%)
 Frame = +1

Query  73   MRSKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMEL  252
            MR KDRISYFYDGDVG+VYFGPNHPMKPHRLCMTHHLVL+Y LH KMEIYRPHKAYP EL
Sbjct  1    MRPKDRISYFYDGDVGSVYFGPNHPMKPHRLCMTHHLVLSYELHTKMEIYRPHKAYPAEL  60

Query  253  AQFHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRL  432
            AQFHS DYVEFLHRITPDTQHLF  DL +YNLGEDCPVF+NLFEFCQIYAGGTIDAARRL
Sbjct  61   AQFHSPDYVEFLHRITPDTQHLFPNDLAKYNLGEDCPVFENLFEFCQIYAGGTIDAARRL  120

Query  433  NNQLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVE  612
            NNQLCD+AINWAGGLHHAKKCEASGFCYINDLVLGILELLKYH RVLYIDIDVHHGDGVE
Sbjct  121  NNQLCDIAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHARVLYIDIDVHHGDGVE  180

Query  613  EAFYFTDR  636
            EAFYFTDR
Sbjct  181  EAFYFTDR  188



>gb|KCW50786.1| hypothetical protein EUGRSUZ_J00456 [Eucalyptus grandis]
Length=430

 Score =   370 bits (950),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 174/188 (93%), Positives = 179/188 (95%), Gaps = 0/188 (0%)
 Frame = +1

Query  73   MRSKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMEL  252
            MR KDRISYFYDGDVG+VYFGPNHPMKPHRLCMTHHLVL+Y LH KMEIYRPHKAYP EL
Sbjct  1    MRPKDRISYFYDGDVGSVYFGPNHPMKPHRLCMTHHLVLSYELHTKMEIYRPHKAYPAEL  60

Query  253  AQFHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRL  432
            AQFHS DYVEFLHRITPDTQHLF  DL +YNLGEDCPVF+NLFEFCQIYAGGTIDAARRL
Sbjct  61   AQFHSPDYVEFLHRITPDTQHLFPNDLAKYNLGEDCPVFENLFEFCQIYAGGTIDAARRL  120

Query  433  NNQLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVE  612
            NNQLCD+AINWAGGLHHAKKCEASGFCYINDLVLGILELLKYH RVLYIDIDVHHGDGVE
Sbjct  121  NNQLCDIAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHARVLYIDIDVHHGDGVE  180

Query  613  EAFYFTDR  636
            EAFYFTDR
Sbjct  181  EAFYFTDR  188



>ref|XP_010651716.1| PREDICTED: histone deacetylase 9 [Vitis vinifera]
 emb|CBI17064.3| unnamed protein product [Vitis vinifera]
Length=430

 Score =   370 bits (949),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 174/188 (93%), Positives = 182/188 (97%), Gaps = 0/188 (0%)
 Frame = +1

Query  73   MRSKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMEL  252
            MRSKDRISYFYDGDVG+VYFGPNHPMKPHRLCMTHHLVL+Y LH KMEIYRPHKAYP+EL
Sbjct  1    MRSKDRISYFYDGDVGSVYFGPNHPMKPHRLCMTHHLVLSYELHKKMEIYRPHKAYPVEL  60

Query  253  AQFHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRL  432
            AQFHSADYVEFLHRITPDTQHLF  +L +YNLGEDCPVF+NLFEFCQIYAGGTIDAARRL
Sbjct  61   AQFHSADYVEFLHRITPDTQHLFLNELAKYNLGEDCPVFENLFEFCQIYAGGTIDAARRL  120

Query  433  NNQLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVE  612
            NNQLCD+AINWAGGLHHAKKCEASGFCYINDLVLGILELLK+H RVLYIDIDVHHGDGVE
Sbjct  121  NNQLCDIAINWAGGLHHAKKCEASGFCYINDLVLGILELLKHHARVLYIDIDVHHGDGVE  180

Query  613  EAFYFTDR  636
            EAFYFTDR
Sbjct  181  EAFYFTDR  188



>ref|XP_007205234.1| hypothetical protein PRUPE_ppa006053mg [Prunus persica]
 gb|EMJ06433.1| hypothetical protein PRUPE_ppa006053mg [Prunus persica]
Length=430

 Score =   370 bits (949),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 173/188 (92%), Positives = 182/188 (97%), Gaps = 0/188 (0%)
 Frame = +1

Query  73   MRSKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMEL  252
            MRSKD+I+YFYDGDVG+VYFGPNHPMKPHRLCMTHHLVL+Y LH KMEIYRPHKAYP+EL
Sbjct  1    MRSKDKIAYFYDGDVGSVYFGPNHPMKPHRLCMTHHLVLSYDLHKKMEIYRPHKAYPVEL  60

Query  253  AQFHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRL  432
            AQFHSADYVEFLHRITPDTQHLF  +L RYNLGEDCPVFDNLFEFCQIYAGGTIDAARRL
Sbjct  61   AQFHSADYVEFLHRITPDTQHLFSNELARYNLGEDCPVFDNLFEFCQIYAGGTIDAARRL  120

Query  433  NNQLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVE  612
            NN+LCD+AINWAGGLHHAKKCEASGFCYINDLVLGILELLK+H RVLYIDIDVHHGDGVE
Sbjct  121  NNKLCDIAINWAGGLHHAKKCEASGFCYINDLVLGILELLKHHARVLYIDIDVHHGDGVE  180

Query  613  EAFYFTDR  636
            EAFYFTDR
Sbjct  181  EAFYFTDR  188



>ref|XP_008227393.1| PREDICTED: histone deacetylase 9 isoform X1 [Prunus mume]
Length=430

 Score =   370 bits (949),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 173/188 (92%), Positives = 182/188 (97%), Gaps = 0/188 (0%)
 Frame = +1

Query  73   MRSKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMEL  252
            MRSKD+I+YFYDGDVG+VYFGPNHPMKPHRLCMTHHLVL+Y LH KMEIYRPHKAYP+EL
Sbjct  1    MRSKDKIAYFYDGDVGSVYFGPNHPMKPHRLCMTHHLVLSYDLHKKMEIYRPHKAYPVEL  60

Query  253  AQFHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRL  432
            AQFHSADYVEFLHRITPDTQHLF  +L RYNLGEDCPVFDNLFEFCQIYAGGTIDAARRL
Sbjct  61   AQFHSADYVEFLHRITPDTQHLFSNELARYNLGEDCPVFDNLFEFCQIYAGGTIDAARRL  120

Query  433  NNQLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVE  612
            NN+LCD+AINWAGGLHHAKKCEASGFCYINDLVLGILELLK+H RVLYIDIDVHHGDGVE
Sbjct  121  NNKLCDIAINWAGGLHHAKKCEASGFCYINDLVLGILELLKHHARVLYIDIDVHHGDGVE  180

Query  613  EAFYFTDR  636
            EAFYFTDR
Sbjct  181  EAFYFTDR  188



>ref|XP_008349785.1| PREDICTED: histone deacetylase 9 [Malus domestica]
Length=430

 Score =   369 bits (948),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 172/188 (91%), Positives = 182/188 (97%), Gaps = 0/188 (0%)
 Frame = +1

Query  73   MRSKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMEL  252
            MRSKD+I+YFYDGDVG+VYFGPNHPMKPHRLCMTHHLVL+Y LH KMEIYRPHKAYP+EL
Sbjct  1    MRSKDKIAYFYDGDVGSVYFGPNHPMKPHRLCMTHHLVLSYDLHKKMEIYRPHKAYPVEL  60

Query  253  AQFHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRL  432
            AQFHSADYVEFLHRITPDTQHLF  ++ RYNLGEDCPVFDNLFEFCQIYAGGTIDAARRL
Sbjct  61   AQFHSADYVEFLHRITPDTQHLFSNEMARYNLGEDCPVFDNLFEFCQIYAGGTIDAARRL  120

Query  433  NNQLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVE  612
            NN+LCD+AINWAGGLHHAKKCEASGFCYINDLVLGILELLK+H RVLYIDIDVHHGDGVE
Sbjct  121  NNKLCDIAINWAGGLHHAKKCEASGFCYINDLVLGILELLKHHARVLYIDIDVHHGDGVE  180

Query  613  EAFYFTDR  636
            EAFYFTDR
Sbjct  181  EAFYFTDR  188



>ref|XP_002529076.1| histone deacetylase 1, 2 ,3, putative [Ricinus communis]
 gb|EEF33320.1| histone deacetylase 1, 2, 3, putative [Ricinus communis]
Length=429

 Score =   369 bits (948),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 174/188 (93%), Positives = 178/188 (95%), Gaps = 0/188 (0%)
 Frame = +1

Query  73   MRSKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMEL  252
            MRSKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVL+Y LH KMEIYRPHKAYP+EL
Sbjct  1    MRSKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLSYDLHKKMEIYRPHKAYPVEL  60

Query  253  AQFHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRL  432
            AQFHS DYVEFLHRI PDTQHLF  +L RYNLGEDCPVF NLFEFCQIYAGGTIDAARRL
Sbjct  61   AQFHSTDYVEFLHRIVPDTQHLFANELARYNLGEDCPVFQNLFEFCQIYAGGTIDAARRL  120

Query  433  NNQLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVE  612
            NNQLCD+AINWAGGLHHAKKC ASGFCYINDLVLGILELLKYH RVLYIDIDVHHGDGVE
Sbjct  121  NNQLCDIAINWAGGLHHAKKCGASGFCYINDLVLGILELLKYHARVLYIDIDVHHGDGVE  180

Query  613  EAFYFTDR  636
            EAFYFTDR
Sbjct  181  EAFYFTDR  188



>ref|XP_008458605.1| PREDICTED: histone deacetylase 9 isoform X1 [Cucumis melo]
 ref|XP_008458606.1| PREDICTED: histone deacetylase 9 isoform X1 [Cucumis melo]
Length=430

 Score =   369 bits (948),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 173/188 (92%), Positives = 181/188 (96%), Gaps = 0/188 (0%)
 Frame = +1

Query  73   MRSKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMEL  252
            MRSKDRISYFYDGDVG+VYFGPNHPMKPHRLCMTHHLVL+Y LH KMEIYRPHKAYP+EL
Sbjct  1    MRSKDRISYFYDGDVGSVYFGPNHPMKPHRLCMTHHLVLSYELHKKMEIYRPHKAYPVEL  60

Query  253  AQFHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRL  432
            AQFHSADYVEFLHRI PDTQHLF  +L +YNLGEDCPVF+NLFEFCQIYAGGTIDAARRL
Sbjct  61   AQFHSADYVEFLHRINPDTQHLFANELSKYNLGEDCPVFENLFEFCQIYAGGTIDAARRL  120

Query  433  NNQLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVE  612
            N+QLCD+AINWAGGLHHAKKCEASGFCYINDLVLGILELLKYH RVLYIDIDVHHGDGVE
Sbjct  121  NHQLCDIAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHSRVLYIDIDVHHGDGVE  180

Query  613  EAFYFTDR  636
            EAFYFTDR
Sbjct  181  EAFYFTDR  188



>ref|XP_008458608.1| PREDICTED: histone deacetylase 9 isoform X2 [Cucumis melo]
Length=413

 Score =   369 bits (946),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 173/188 (92%), Positives = 181/188 (96%), Gaps = 0/188 (0%)
 Frame = +1

Query  73   MRSKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMEL  252
            MRSKDRISYFYDGDVG+VYFGPNHPMKPHRLCMTHHLVL+Y LH KMEIYRPHKAYP+EL
Sbjct  1    MRSKDRISYFYDGDVGSVYFGPNHPMKPHRLCMTHHLVLSYELHKKMEIYRPHKAYPVEL  60

Query  253  AQFHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRL  432
            AQFHSADYVEFLHRI PDTQHLF  +L +YNLGEDCPVF+NLFEFCQIYAGGTIDAARRL
Sbjct  61   AQFHSADYVEFLHRINPDTQHLFANELSKYNLGEDCPVFENLFEFCQIYAGGTIDAARRL  120

Query  433  NNQLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVE  612
            N+QLCD+AINWAGGLHHAKKCEASGFCYINDLVLGILELLKYH RVLYIDIDVHHGDGVE
Sbjct  121  NHQLCDIAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHSRVLYIDIDVHHGDGVE  180

Query  613  EAFYFTDR  636
            EAFYFTDR
Sbjct  181  EAFYFTDR  188



>ref|NP_001105077.1| histone deacetylase [Zea mays]
 gb|AAL33655.1|AF440228_1 histone deacetylase [Zea mays]
 gb|ACF83162.1| unknown [Zea mays]
 gb|ACG38577.1| histone deacetylase [Zea mays]
Length=430

 Score =   369 bits (947),  Expect = 9e-123, Method: Compositional matrix adjust.
 Identities = 171/188 (91%), Positives = 181/188 (96%), Gaps = 0/188 (0%)
 Frame = +1

Query  73   MRSKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMEL  252
            M  KDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVL+YGLH KMEIYRPHKAYP+EL
Sbjct  1    MLEKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLSYGLHQKMEIYRPHKAYPIEL  60

Query  253  AQFHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRL  432
            AQFHSADYVEFLHRITPD+QHL+  +L RYNLGEDCPVFDNLFEFCQIYAGGT+DAARRL
Sbjct  61   AQFHSADYVEFLHRITPDSQHLYASELTRYNLGEDCPVFDNLFEFCQIYAGGTLDAARRL  120

Query  433  NNQLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVE  612
            N+++CD+AINWAGGLHHAKKCEASGFCYINDLVLGILELLKYH RVLYIDIDVHHGDGVE
Sbjct  121  NHKICDIAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHARVLYIDIDVHHGDGVE  180

Query  613  EAFYFTDR  636
            EAFYFTDR
Sbjct  181  EAFYFTDR  188



>ref|XP_004145792.1| PREDICTED: histone deacetylase 9-like [Cucumis sativus]
 gb|KGN46931.1| hypothetical protein Csa_6G151680 [Cucumis sativus]
Length=430

 Score =   369 bits (947),  Expect = 9e-123, Method: Compositional matrix adjust.
 Identities = 173/188 (92%), Positives = 181/188 (96%), Gaps = 0/188 (0%)
 Frame = +1

Query  73   MRSKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMEL  252
            MRSKDRISYFYDGDVG+VYFGPNHPMKPHRLCMTHHLVL+Y LH KMEIYRPHKAYP+EL
Sbjct  1    MRSKDRISYFYDGDVGSVYFGPNHPMKPHRLCMTHHLVLSYELHKKMEIYRPHKAYPVEL  60

Query  253  AQFHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRL  432
            AQFHSADYVEFLHRI PDTQHLF  +L +YNLGEDCPVF+NLFEFCQIYAGGTIDAARRL
Sbjct  61   AQFHSADYVEFLHRINPDTQHLFANELSKYNLGEDCPVFENLFEFCQIYAGGTIDAARRL  120

Query  433  NNQLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVE  612
            N+QLCD+AINWAGGLHHAKKCEASGFCYINDLVLGILELLKYH RVLYIDIDVHHGDGVE
Sbjct  121  NHQLCDIAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHSRVLYIDIDVHHGDGVE  180

Query  613  EAFYFTDR  636
            EAFYFTDR
Sbjct  181  EAFYFTDR  188



>ref|XP_007132395.1| hypothetical protein PHAVU_011G091100g [Phaseolus vulgaris]
 gb|ESW04389.1| hypothetical protein PHAVU_011G091100g [Phaseolus vulgaris]
Length=429

 Score =   368 bits (945),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 173/188 (92%), Positives = 180/188 (96%), Gaps = 0/188 (0%)
 Frame = +1

Query  73   MRSKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMEL  252
            MRSKDRI+YFYDGDVG+VYFG  HPMKPHRLCMTHHLVL+Y LH KMEIYRPHKAYP+EL
Sbjct  1    MRSKDRIAYFYDGDVGSVYFGAKHPMKPHRLCMTHHLVLSYDLHKKMEIYRPHKAYPVEL  60

Query  253  AQFHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRL  432
            AQFHSADYVEFLHRITPDTQHLF  +L +YNLGEDCPVFDNLFEFCQIYAGGTIDAARRL
Sbjct  61   AQFHSADYVEFLHRITPDTQHLFLNELTKYNLGEDCPVFDNLFEFCQIYAGGTIDAARRL  120

Query  433  NNQLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVE  612
            NNQLCD+AINWAGGLHHAKKCEASGFCYINDLVLGILELLKYH RVLYIDIDVHHGDGVE
Sbjct  121  NNQLCDIAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHARVLYIDIDVHHGDGVE  180

Query  613  EAFYFTDR  636
            EAFYFTDR
Sbjct  181  EAFYFTDR  188



>ref|XP_004975538.1| PREDICTED: histone deacetylase 9-like isoform X1 [Setaria italica]
Length=430

 Score =   368 bits (944),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 172/188 (91%), Positives = 180/188 (96%), Gaps = 0/188 (0%)
 Frame = +1

Query  73   MRSKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMEL  252
            M  KDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVL+YGLH KMEIYRPHKAYP+EL
Sbjct  1    MLEKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLSYGLHKKMEIYRPHKAYPVEL  60

Query  253  AQFHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRL  432
            AQFHSADYVEFLHRITPDTQ L+G +L RYNLGEDCPVFDNLFEFCQIYAGGT+DAARRL
Sbjct  61   AQFHSADYVEFLHRITPDTQDLYGSELTRYNLGEDCPVFDNLFEFCQIYAGGTLDAARRL  120

Query  433  NNQLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVE  612
            N++ CD+AINWAGGLHHAKKCEASGFCYINDLVLGILELLKYH RVLYIDIDVHHGDGVE
Sbjct  121  NHKTCDIAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHARVLYIDIDVHHGDGVE  180

Query  613  EAFYFTDR  636
            EAFYFTDR
Sbjct  181  EAFYFTDR  188



>ref|XP_010239874.1| PREDICTED: histone deacetylase 9 isoform X2 [Brachypodium distachyon]
Length=352

 Score =   365 bits (937),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 171/188 (91%), Positives = 179/188 (95%), Gaps = 0/188 (0%)
 Frame = +1

Query  73   MRSKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMEL  252
            M  KDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVL+YGLH KMEIYRPHKAYP EL
Sbjct  1    MLEKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLSYGLHKKMEIYRPHKAYPTEL  60

Query  253  AQFHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRL  432
            AQFHSADYVEFLHRITPDTQHL+  +L RYNLGEDCPVFD+LFEFCQIYAGGT+DAARRL
Sbjct  61   AQFHSADYVEFLHRITPDTQHLYASELTRYNLGEDCPVFDDLFEFCQIYAGGTLDAARRL  120

Query  433  NNQLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVE  612
            N++ CD+AINWAGGLHHAKKCEASGFCYINDLVLGILELLKYH RVLYIDIDVHHGDGVE
Sbjct  121  NHKTCDIAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHSRVLYIDIDVHHGDGVE  180

Query  613  EAFYFTDR  636
            EAFYFTDR
Sbjct  181  EAFYFTDR  188



>ref|XP_002446401.1| hypothetical protein SORBIDRAFT_06g015420 [Sorghum bicolor]
 gb|EES10729.1| hypothetical protein SORBIDRAFT_06g015420 [Sorghum bicolor]
Length=430

 Score =   368 bits (944),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 171/188 (91%), Positives = 179/188 (95%), Gaps = 0/188 (0%)
 Frame = +1

Query  73   MRSKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMEL  252
            M  KDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVL+YGLH KMEIYRPHKAYP+EL
Sbjct  1    MLEKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLSYGLHKKMEIYRPHKAYPIEL  60

Query  253  AQFHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRL  432
            AQFHSADYVEFLHRITPDTQHL+  +L RYNLGEDCPVFDNLFEFCQIY GGT+DAARRL
Sbjct  61   AQFHSADYVEFLHRITPDTQHLYASELTRYNLGEDCPVFDNLFEFCQIYTGGTLDAARRL  120

Query  433  NNQLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVE  612
            N++ CD+AINWAGGLHHAKKCEASGFCYINDLVLGILELLKYH RVLYIDIDVHHGDGVE
Sbjct  121  NHKTCDIAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHARVLYIDIDVHHGDGVE  180

Query  613  EAFYFTDR  636
            EAFYFTDR
Sbjct  181  EAFYFTDR  188



>ref|XP_007142469.1| hypothetical protein PHAVU_008G283200g [Phaseolus vulgaris]
 gb|ESW14463.1| hypothetical protein PHAVU_008G283200g [Phaseolus vulgaris]
Length=429

 Score =   367 bits (943),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 171/188 (91%), Positives = 181/188 (96%), Gaps = 0/188 (0%)
 Frame = +1

Query  73   MRSKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMEL  252
            MRSKD+I+YFYDGDVG+VYFG  HPMKPHRLCMTHHLVL+Y LH KMEIYRPHKAYP+EL
Sbjct  1    MRSKDKIAYFYDGDVGSVYFGAKHPMKPHRLCMTHHLVLSYELHKKMEIYRPHKAYPVEL  60

Query  253  AQFHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRL  432
            AQFHSADYVEFLHRITPDTQHLF  +L +YNLGEDCPVFDN+FEFCQIYAGGTIDAARRL
Sbjct  61   AQFHSADYVEFLHRITPDTQHLFLDELTKYNLGEDCPVFDNIFEFCQIYAGGTIDAARRL  120

Query  433  NNQLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVE  612
            NNQLCD+AINWAGGLHHAKKCEASGFCYINDLVLGILELLK+HPRVLYIDIDVHHGDGVE
Sbjct  121  NNQLCDIAINWAGGLHHAKKCEASGFCYINDLVLGILELLKHHPRVLYIDIDVHHGDGVE  180

Query  613  EAFYFTDR  636
            EAFYFTDR
Sbjct  181  EAFYFTDR  188



>ref|XP_004300044.1| PREDICTED: histone deacetylase 9 [Fragaria vesca subsp. vesca]
Length=430

 Score =   367 bits (942),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 173/188 (92%), Positives = 180/188 (96%), Gaps = 0/188 (0%)
 Frame = +1

Query  73   MRSKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMEL  252
            MRSKDRISYFYDGDVG+VYFGPNHPMKPHRLCMTHHLVL+Y LH KMEIYRPHKAYP+EL
Sbjct  1    MRSKDRISYFYDGDVGSVYFGPNHPMKPHRLCMTHHLVLSYDLHKKMEIYRPHKAYPVEL  60

Query  253  AQFHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRL  432
            AQFHSADYVEFLHRITPD QHLF  +L RYNLGEDCPVFDNLFEFCQIYAGGTIDAARRL
Sbjct  61   AQFHSADYVEFLHRITPDKQHLFSNELARYNLGEDCPVFDNLFEFCQIYAGGTIDAARRL  120

Query  433  NNQLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVE  612
            NN+LCD+AINWAGGLHHAKKC ASGFCYINDLVLGILELLK+H RVLYIDIDVHHGDGVE
Sbjct  121  NNKLCDIAINWAGGLHHAKKCGASGFCYINDLVLGILELLKHHARVLYIDIDVHHGDGVE  180

Query  613  EAFYFTDR  636
            EAFYFTDR
Sbjct  181  EAFYFTDR  188



>ref|XP_008788392.1| PREDICTED: histone deacetylase 9 isoform X2 [Phoenix dactylifera]
Length=382

 Score =   365 bits (938),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 170/188 (90%), Positives = 180/188 (96%), Gaps = 0/188 (0%)
 Frame = +1

Query  73   MRSKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMEL  252
            M SKD+I+YFYDGDVGNVYFGPNHPMKPHRLCMTHHLVL+Y LH KMEIYRPHKAYP+EL
Sbjct  1    MPSKDKIAYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLSYELHKKMEIYRPHKAYPVEL  60

Query  253  AQFHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRL  432
            AQFHSADYVEFLHRITPDTQHLF  +L RYNLGEDCPVF+NLFEFCQIYAGGTIDAARRL
Sbjct  61   AQFHSADYVEFLHRITPDTQHLFADELARYNLGEDCPVFENLFEFCQIYAGGTIDAARRL  120

Query  433  NNQLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVE  612
            N+QLCD+AINWAGGLHHAKKC ASGFCYINDLVLGILELLK+H RVLYIDID+HHGDGVE
Sbjct  121  NHQLCDIAINWAGGLHHAKKCGASGFCYINDLVLGILELLKFHARVLYIDIDIHHGDGVE  180

Query  613  EAFYFTDR  636
            EAFYFTDR
Sbjct  181  EAFYFTDR  188



>ref|XP_010692973.1| PREDICTED: histone deacetylase 9 isoform X1 [Beta vulgaris subsp. 
vulgaris]
Length=429

 Score =   367 bits (942),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 171/188 (91%), Positives = 180/188 (96%), Gaps = 0/188 (0%)
 Frame = +1

Query  73   MRSKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMEL  252
            MRSKD+ISYFYDGDVG+VYFGPNHPMKPHRLCMTHHLVL+Y LH KMEIYRPHKAYP+EL
Sbjct  1    MRSKDKISYFYDGDVGSVYFGPNHPMKPHRLCMTHHLVLSYDLHKKMEIYRPHKAYPVEL  60

Query  253  AQFHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRL  432
            AQFHSADYVEFLHRITP+ QH F  ++ +YNLGEDCPVFDNLFEFCQIYAGGTIDAARRL
Sbjct  61   AQFHSADYVEFLHRITPEKQHQFMTEMAKYNLGEDCPVFDNLFEFCQIYAGGTIDAARRL  120

Query  433  NNQLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVE  612
            NNQLCD+AINWAGGLHHAKKCEASGFCYINDLVLGILELLKYH RVLYIDIDVHHGDGVE
Sbjct  121  NNQLCDIAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHARVLYIDIDVHHGDGVE  180

Query  613  EAFYFTDR  636
            EAFYFTDR
Sbjct  181  EAFYFTDR  188



>ref|XP_009364877.1| PREDICTED: histone deacetylase 9-like [Pyrus x bretschneideri]
 ref|XP_009339956.1| PREDICTED: histone deacetylase 9-like [Pyrus x bretschneideri]
Length=429

 Score =   366 bits (940),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 171/188 (91%), Positives = 181/188 (96%), Gaps = 0/188 (0%)
 Frame = +1

Query  73   MRSKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMEL  252
            M SKD+I+YFYDGDVG+VYFGPNHPMKPHRLCMTHHLVL+Y LH KMEIYRPHKAYP+EL
Sbjct  1    MPSKDKIAYFYDGDVGSVYFGPNHPMKPHRLCMTHHLVLSYDLHKKMEIYRPHKAYPVEL  60

Query  253  AQFHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRL  432
            AQFHSADYVEFLHRITPDTQHLF  ++ RYNLGEDCPVFDNLFEFCQIYAGGTIDAARRL
Sbjct  61   AQFHSADYVEFLHRITPDTQHLFSNEMARYNLGEDCPVFDNLFEFCQIYAGGTIDAARRL  120

Query  433  NNQLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVE  612
            NN+LCD+AINWAGGLHHAKKCEASGFCYINDLVLGILELLK+H RVLYIDIDVHHGDGVE
Sbjct  121  NNKLCDIAINWAGGLHHAKKCEASGFCYINDLVLGILELLKHHARVLYIDIDVHHGDGVE  180

Query  613  EAFYFTDR  636
            EAFYFTDR
Sbjct  181  EAFYFTDR  188



>ref|XP_003579685.1| PREDICTED: histone deacetylase 9 isoform X1 [Brachypodium distachyon]
Length=430

 Score =   366 bits (940),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 171/188 (91%), Positives = 179/188 (95%), Gaps = 0/188 (0%)
 Frame = +1

Query  73   MRSKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMEL  252
            M  KDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVL+YGLH KMEIYRPHKAYP EL
Sbjct  1    MLEKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLSYGLHKKMEIYRPHKAYPTEL  60

Query  253  AQFHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRL  432
            AQFHSADYVEFLHRITPDTQHL+  +L RYNLGEDCPVFD+LFEFCQIYAGGT+DAARRL
Sbjct  61   AQFHSADYVEFLHRITPDTQHLYASELTRYNLGEDCPVFDDLFEFCQIYAGGTLDAARRL  120

Query  433  NNQLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVE  612
            N++ CD+AINWAGGLHHAKKCEASGFCYINDLVLGILELLKYH RVLYIDIDVHHGDGVE
Sbjct  121  NHKTCDIAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHSRVLYIDIDVHHGDGVE  180

Query  613  EAFYFTDR  636
            EAFYFTDR
Sbjct  181  EAFYFTDR  188



>ref|XP_003539814.1| PREDICTED: histone deacetylase 9 isoform X1 [Glycine max]
Length=429

 Score =   366 bits (939),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 172/188 (91%), Positives = 180/188 (96%), Gaps = 0/188 (0%)
 Frame = +1

Query  73   MRSKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMEL  252
            MRSKDRI+YFYDGDVG+VYFG  HPMKPHRLCMTHHLVL+Y LH KMEIYRPHKAYP+EL
Sbjct  1    MRSKDRIAYFYDGDVGSVYFGAKHPMKPHRLCMTHHLVLSYDLHKKMEIYRPHKAYPVEL  60

Query  253  AQFHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRL  432
            AQFHSADYVEFL+RITPDTQHLF  +L +YNLGEDCPVFDNLFEFCQIYAGGTIDAARRL
Sbjct  61   AQFHSADYVEFLNRITPDTQHLFLNELTKYNLGEDCPVFDNLFEFCQIYAGGTIDAARRL  120

Query  433  NNQLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVE  612
            NNQLCD+AINWAGGLHHAKKCEASGFCYINDLVLGILELLKYH RVLYIDIDVHHGDGVE
Sbjct  121  NNQLCDIAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHARVLYIDIDVHHGDGVE  180

Query  613  EAFYFTDR  636
            EAFYFTDR
Sbjct  181  EAFYFTDR  188



>gb|ACU20217.1| unknown [Glycine max]
Length=429

 Score =   366 bits (939),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 172/188 (91%), Positives = 180/188 (96%), Gaps = 0/188 (0%)
 Frame = +1

Query  73   MRSKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMEL  252
            MRSKDRI+YFYDGDVG+VYFG  HPMKPHRLCMTHHLVL+Y LH KMEIYRPHKAYP+EL
Sbjct  1    MRSKDRIAYFYDGDVGSVYFGAKHPMKPHRLCMTHHLVLSYDLHKKMEIYRPHKAYPVEL  60

Query  253  AQFHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRL  432
            AQFHSADYVEFL+RITPDTQHLF  +L +YNLGEDCPVFDNLFEFCQIYAGGTIDAARRL
Sbjct  61   AQFHSADYVEFLNRITPDTQHLFLNELTKYNLGEDCPVFDNLFEFCQIYAGGTIDAARRL  120

Query  433  NNQLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVE  612
            NNQLCD+AINWAGGLHHAKKCEASGFCYINDLVLGILELLKYH RVLYIDIDVHHGDGVE
Sbjct  121  NNQLCDIAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHARVLYIDIDVHHGDGVE  180

Query  613  EAFYFTDR  636
            EAFYFTDR
Sbjct  181  EAFYFTDR  188



>ref|XP_010243527.1| PREDICTED: histone deacetylase 9 [Nelumbo nucifera]
Length=430

 Score =   365 bits (938),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 170/188 (90%), Positives = 181/188 (96%), Gaps = 0/188 (0%)
 Frame = +1

Query  73   MRSKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMEL  252
            MRSKDRISYFYDGDVG+VYFGPNHPMKPHRLCMTHHLVL+Y LH KMEIYRPHKAYP+EL
Sbjct  1    MRSKDRISYFYDGDVGSVYFGPNHPMKPHRLCMTHHLVLSYELHKKMEIYRPHKAYPVEL  60

Query  253  AQFHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRL  432
            AQFHS DY+EFLHRITP+TQHLF  +L++YNLG+DCPVFDNLFEFCQIYAGGTIDAARRL
Sbjct  61   AQFHSEDYIEFLHRITPETQHLFTNELEKYNLGDDCPVFDNLFEFCQIYAGGTIDAARRL  120

Query  433  NNQLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVE  612
            NNQLCD+AINWAGGLHHAKKC ASGFCY+NDLVLGILELLKYH RVLYIDIDVHHGDGVE
Sbjct  121  NNQLCDIAINWAGGLHHAKKCGASGFCYMNDLVLGILELLKYHARVLYIDIDVHHGDGVE  180

Query  613  EAFYFTDR  636
            EAFYFTDR
Sbjct  181  EAFYFTDR  188



>ref|XP_010093211.1| Histone deacetylase 9 [Morus notabilis]
 gb|EXB53709.1| Histone deacetylase 9 [Morus notabilis]
Length=429

 Score =   365 bits (938),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 172/188 (91%), Positives = 178/188 (95%), Gaps = 0/188 (0%)
 Frame = +1

Query  73   MRSKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMEL  252
            MRSKDRISYFYDGDVG+VYFGPNHPMKPHRLCMTHHLVL+Y LH KMEIYRPHKAYP+EL
Sbjct  1    MRSKDRISYFYDGDVGSVYFGPNHPMKPHRLCMTHHLVLSYDLHKKMEIYRPHKAYPVEL  60

Query  253  AQFHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRL  432
            AQFHS DYV FL RITPDT HLF  DL RYNLGEDCPVF+NLFEFCQIYAGGTIDAARRL
Sbjct  61   AQFHSEDYVAFLQRITPDTLHLFSSDLARYNLGEDCPVFENLFEFCQIYAGGTIDAARRL  120

Query  433  NNQLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVE  612
            NNQLCD+AINWAGGLHHAKKCEASGFCYINDLVLGILELLK+H RVLYIDIDVHHGDGVE
Sbjct  121  NNQLCDIAINWAGGLHHAKKCEASGFCYINDLVLGILELLKHHARVLYIDIDVHHGDGVE  180

Query  613  EAFYFTDR  636
            EAFYFTDR
Sbjct  181  EAFYFTDR  188



>ref|XP_010940301.1| PREDICTED: histone deacetylase 9 [Elaeis guineensis]
Length=431

 Score =   365 bits (937),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 171/188 (91%), Positives = 180/188 (96%), Gaps = 0/188 (0%)
 Frame = +1

Query  73   MRSKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMEL  252
            M SKDRI+YFYDGDVGNVYFGPNHPMKPHRLCMTHHLVL+Y LH KMEIYRPHKAYP+EL
Sbjct  1    MPSKDRIAYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLSYELHKKMEIYRPHKAYPVEL  60

Query  253  AQFHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRL  432
            AQFHSADYVEFLHRITPDTQHLF  +L RYNLGEDCPVF+NLFEFCQIYAGGTIDAARRL
Sbjct  61   AQFHSADYVEFLHRITPDTQHLFADELARYNLGEDCPVFENLFEFCQIYAGGTIDAARRL  120

Query  433  NNQLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVE  612
            N+QLCD+AINWAGGLHHAKKC ASGFCYINDLVLGILELLK+H RVLYIDID+HHGDGVE
Sbjct  121  NHQLCDIAINWAGGLHHAKKCGASGFCYINDLVLGILELLKFHARVLYIDIDIHHGDGVE  180

Query  613  EAFYFTDR  636
            EAFYFTDR
Sbjct  181  EAFYFTDR  188



>ref|XP_008788384.1| PREDICTED: histone deacetylase 9 isoform X1 [Phoenix dactylifera]
Length=431

 Score =   365 bits (936),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 170/188 (90%), Positives = 180/188 (96%), Gaps = 0/188 (0%)
 Frame = +1

Query  73   MRSKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMEL  252
            M SKD+I+YFYDGDVGNVYFGPNHPMKPHRLCMTHHLVL+Y LH KMEIYRPHKAYP+EL
Sbjct  1    MPSKDKIAYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLSYELHKKMEIYRPHKAYPVEL  60

Query  253  AQFHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRL  432
            AQFHSADYVEFLHRITPDTQHLF  +L RYNLGEDCPVF+NLFEFCQIYAGGTIDAARRL
Sbjct  61   AQFHSADYVEFLHRITPDTQHLFADELARYNLGEDCPVFENLFEFCQIYAGGTIDAARRL  120

Query  433  NNQLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVE  612
            N+QLCD+AINWAGGLHHAKKC ASGFCYINDLVLGILELLK+H RVLYIDID+HHGDGVE
Sbjct  121  NHQLCDIAINWAGGLHHAKKCGASGFCYINDLVLGILELLKFHARVLYIDIDIHHGDGVE  180

Query  613  EAFYFTDR  636
            EAFYFTDR
Sbjct  181  EAFYFTDR  188



>ref|XP_011090013.1| PREDICTED: histone deacetylase 9 isoform X1 [Sesamum indicum]
Length=430

 Score =   364 bits (935),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 170/188 (90%), Positives = 179/188 (95%), Gaps = 0/188 (0%)
 Frame = +1

Query  73   MRSKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMEL  252
            MRSKD+ISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVL+Y LH KME+YRPHKAYP+EL
Sbjct  1    MRSKDKISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLSYELHKKMEVYRPHKAYPVEL  60

Query  253  AQFHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRL  432
            AQFHS DYVEFL RITP+TQ LF  ++ +YNLGEDCPVFDNLFEFCQIYAGGTIDAARRL
Sbjct  61   AQFHSPDYVEFLQRITPNTQELFSNEMVKYNLGEDCPVFDNLFEFCQIYAGGTIDAARRL  120

Query  433  NNQLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVE  612
            NNQLCD+AINWAGGLHHAKKCEASGFCYINDLVLGILELLKYH RVLYIDIDVHHGDGVE
Sbjct  121  NNQLCDIAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHARVLYIDIDVHHGDGVE  180

Query  613  EAFYFTDR  636
            EAFYFTDR
Sbjct  181  EAFYFTDR  188



>ref|XP_009364273.1| PREDICTED: histone deacetylase 9 [Pyrus x bretschneideri]
Length=430

 Score =   364 bits (934),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 170/188 (90%), Positives = 180/188 (96%), Gaps = 0/188 (0%)
 Frame = +1

Query  73   MRSKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMEL  252
            M SKD+I+YFYDGDVG+VYFGPNHPMKPHRLCMTHHLVL+Y LH KMEIYRPHKAYP+EL
Sbjct  1    MPSKDKIAYFYDGDVGSVYFGPNHPMKPHRLCMTHHLVLSYDLHKKMEIYRPHKAYPVEL  60

Query  253  AQFHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRL  432
            AQFHSADYVEFLHRI PDTQHLF  ++ RYNLGEDCPVFDNLFEFCQIYAGGTIDAARRL
Sbjct  61   AQFHSADYVEFLHRIMPDTQHLFSNEMARYNLGEDCPVFDNLFEFCQIYAGGTIDAARRL  120

Query  433  NNQLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVE  612
            NN+LCD+AINWAGGLHHAKKCEASGFCYINDLVLGILELLK+H RVLYIDIDVHHGDGVE
Sbjct  121  NNKLCDIAINWAGGLHHAKKCEASGFCYINDLVLGILELLKHHARVLYIDIDVHHGDGVE  180

Query  613  EAFYFTDR  636
            EAFYFTDR
Sbjct  181  EAFYFTDR  188



>ref|XP_002300554.1| histone deacetylase-related family protein [Populus trichocarpa]
 gb|EEE85359.1| histone deacetylase-related family protein [Populus trichocarpa]
Length=429

 Score =   364 bits (934),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 171/188 (91%), Positives = 179/188 (95%), Gaps = 0/188 (0%)
 Frame = +1

Query  73   MRSKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMEL  252
            MRSKDRI+YFYDGDVG+VYFGPNHPMKPHRLCMTHHLVL+Y LH KMEIYRPHKAYP+EL
Sbjct  1    MRSKDRIAYFYDGDVGSVYFGPNHPMKPHRLCMTHHLVLSYELHKKMEIYRPHKAYPVEL  60

Query  253  AQFHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRL  432
            AQFHS DYVEFLHRITPDTQHLF  +L RYNLGEDCPVF+NLFEFCQIYAGGTIDAA RL
Sbjct  61   AQFHSEDYVEFLHRITPDTQHLFAGELARYNLGEDCPVFENLFEFCQIYAGGTIDAAHRL  120

Query  433  NNQLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVE  612
            NNQLCD+AINWAGGLHHAKKC ASGFCYINDLVLGILELLK+H RVLYIDIDVHHGDGVE
Sbjct  121  NNQLCDIAINWAGGLHHAKKCGASGFCYINDLVLGILELLKHHARVLYIDIDVHHGDGVE  180

Query  613  EAFYFTDR  636
            EAFYFTDR
Sbjct  181  EAFYFTDR  188



>ref|XP_011005322.1| PREDICTED: histone deacetylase 9 isoform X3 [Populus euphratica]
Length=429

 Score =   364 bits (934),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 171/188 (91%), Positives = 179/188 (95%), Gaps = 0/188 (0%)
 Frame = +1

Query  73   MRSKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMEL  252
            MRSKDRI+YFYDGDVG+VYFGPNHPMKPHRLCMTHHLVL+Y LH KMEIYRPHKAYP+EL
Sbjct  1    MRSKDRIAYFYDGDVGSVYFGPNHPMKPHRLCMTHHLVLSYELHKKMEIYRPHKAYPVEL  60

Query  253  AQFHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRL  432
            AQFHS DYVEFLHRITPDTQHLF  +L RYNLGEDCPVF+NLFEFCQIYAGGTIDAA RL
Sbjct  61   AQFHSEDYVEFLHRITPDTQHLFAGELARYNLGEDCPVFENLFEFCQIYAGGTIDAAHRL  120

Query  433  NNQLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVE  612
            NNQLCD+AINWAGGLHHAKKC ASGFCYINDLVLGILELLK+H RVLYIDIDVHHGDGVE
Sbjct  121  NNQLCDIAINWAGGLHHAKKCGASGFCYINDLVLGILELLKHHARVLYIDIDVHHGDGVE  180

Query  613  EAFYFTDR  636
            EAFYFTDR
Sbjct  181  EAFYFTDR  188



>ref|XP_004506146.1| PREDICTED: histone deacetylase 9-like [Cicer arietinum]
Length=430

 Score =   364 bits (934),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 170/188 (90%), Positives = 181/188 (96%), Gaps = 0/188 (0%)
 Frame = +1

Query  73   MRSKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMEL  252
            MRSK+RISYFYDGDVG+VYFGPNHPMKPHRLCMTHHLVL+Y LH +ME+YRPHKAYP+EL
Sbjct  1    MRSKNRISYFYDGDVGSVYFGPNHPMKPHRLCMTHHLVLSYDLHKQMEVYRPHKAYPVEL  60

Query  253  AQFHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRL  432
            AQFHSADYVEFLHRITPDTQHLF  +L +YNLGEDCPVFDNLFEFCQIYAGGTIDAA RL
Sbjct  61   AQFHSADYVEFLHRITPDTQHLFSNELAKYNLGEDCPVFDNLFEFCQIYAGGTIDAACRL  120

Query  433  NNQLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVE  612
            NN+LCD+AINWAGGLHHAKKCEASGFCYINDLVLGILELLK+H RVLYIDIDVHHGDGVE
Sbjct  121  NNKLCDIAINWAGGLHHAKKCEASGFCYINDLVLGILELLKHHARVLYIDIDVHHGDGVE  180

Query  613  EAFYFTDR  636
            EAFYFTDR
Sbjct  181  EAFYFTDR  188



>emb|CAH66503.1| H0321H01.12 [Oryza sativa Indica Group]
 gb|EEC77239.1| hypothetical protein OsI_15792 [Oryza sativa Indica Group]
 gb|EEE60951.1| hypothetical protein OsJ_14708 [Oryza sativa Japonica Group]
Length=430

 Score =   364 bits (934),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 170/188 (90%), Positives = 179/188 (95%), Gaps = 0/188 (0%)
 Frame = +1

Query  73   MRSKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMEL  252
            M  KDRI+YFYDGDVGNVYFGPNHPMKPHRLCMTHHLVL+Y LH KMEIYRPHKAYP EL
Sbjct  1    MLEKDRIAYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLSYDLHKKMEIYRPHKAYPTEL  60

Query  253  AQFHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRL  432
            AQFHSADYVEFLHRITPDTQHL+  +L+RYNLGEDCPVFDNLFEFCQIYAGGT+DAARRL
Sbjct  61   AQFHSADYVEFLHRITPDTQHLYENELRRYNLGEDCPVFDNLFEFCQIYAGGTLDAARRL  120

Query  433  NNQLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVE  612
            N++ CD+AINWAGGLHHAKKCEASGFCYINDLVLGILELLKYH RVLYIDIDVHHGDGVE
Sbjct  121  NHKTCDIAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHARVLYIDIDVHHGDGVE  180

Query  613  EAFYFTDR  636
            EAFYFTDR
Sbjct  181  EAFYFTDR  188



>gb|ACD50313.1| histone deacetylase RPD3/HDA1 class I isoform 1 [Hordeum vulgare]
Length=430

 Score =   363 bits (933),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 170/188 (90%), Positives = 178/188 (95%), Gaps = 0/188 (0%)
 Frame = +1

Query  73   MRSKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMEL  252
            M  KDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVL+Y LH KMEIYRPHKAYP EL
Sbjct  1    MLEKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLSYELHKKMEIYRPHKAYPTEL  60

Query  253  AQFHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRL  432
            AQFHSADYVEFLHRITPDTQHL+  +L RYNLGEDCPVFD+LFEFCQIYAGGT+DAARRL
Sbjct  61   AQFHSADYVEFLHRITPDTQHLYASELTRYNLGEDCPVFDDLFEFCQIYAGGTLDAARRL  120

Query  433  NNQLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVE  612
            N++ CD+AINWAGGLHHAKKCEASGFCYINDLVLGILELLKYH RVLYIDIDVHHGDGVE
Sbjct  121  NHKTCDIAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHARVLYIDIDVHHGDGVE  180

Query  613  EAFYFTDR  636
            EAFYFTDR
Sbjct  181  EAFYFTDR  188



>emb|CDP06960.1| unnamed protein product [Coffea canephora]
Length=430

 Score =   363 bits (933),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 171/188 (91%), Positives = 180/188 (96%), Gaps = 0/188 (0%)
 Frame = +1

Query  73   MRSKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMEL  252
            MRSKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAY LH KMEIYRPHKAYP+EL
Sbjct  1    MRSKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYQLHKKMEIYRPHKAYPVEL  60

Query  253  AQFHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRL  432
            AQFHSADYVEFLHRITP T+HLF  +L +YNLGEDCPVF+NLFEFCQIYAGGTIDAA RL
Sbjct  61   AQFHSADYVEFLHRITPSTEHLFPNELAKYNLGEDCPVFENLFEFCQIYAGGTIDAAHRL  120

Query  433  NNQLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVE  612
            NN+LCD+AINWAGGLHHAKKCEASGFCYINDLVLGILELLK+H RVLYIDIDVHHGDGVE
Sbjct  121  NNELCDIAINWAGGLHHAKKCEASGFCYINDLVLGILELLKHHARVLYIDIDVHHGDGVE  180

Query  613  EAFYFTDR  636
            EAFYFT+R
Sbjct  181  EAFYFTNR  188



>ref|XP_006652253.1| PREDICTED: histone deacetylase 9-like [Oryza brachyantha]
Length=430

 Score =   363 bits (932),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 170/188 (90%), Positives = 179/188 (95%), Gaps = 0/188 (0%)
 Frame = +1

Query  73   MRSKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMEL  252
            M  KDRI+YFYDGDVGNVYFGPNHPMKPHRLCMTHHLVL+Y LH KMEIYRPHKAYP EL
Sbjct  1    MLEKDRIAYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLSYELHKKMEIYRPHKAYPTEL  60

Query  253  AQFHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRL  432
            AQFHSADYVEFLHRITPDTQHL+  +L+RYNLGEDCPVFDNLFEFCQIYAGGT+DAARRL
Sbjct  61   AQFHSADYVEFLHRITPDTQHLYENELRRYNLGEDCPVFDNLFEFCQIYAGGTLDAARRL  120

Query  433  NNQLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVE  612
            N++ CD+AINWAGGLHHAKKCEASGFCYINDLVLGILELLKYH RVLYIDIDVHHGDGVE
Sbjct  121  NHKTCDIAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHARVLYIDIDVHHGDGVE  180

Query  613  EAFYFTDR  636
            EAFYFTDR
Sbjct  181  EAFYFTDR  188



>gb|EYU36089.1| hypothetical protein MIMGU_mgv1a006831mg [Erythranthe guttata]
Length=404

 Score =   362 bits (929),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 169/188 (90%), Positives = 180/188 (96%), Gaps = 0/188 (0%)
 Frame = +1

Query  73   MRSKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMEL  252
            MRSKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVL+Y LH+KMEIYRPHKAYP+EL
Sbjct  1    MRSKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLSYDLHHKMEIYRPHKAYPVEL  60

Query  253  AQFHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRL  432
            AQFHS DYVEFL RITPDTQ LF  ++ ++NLGEDCP+F+NLFEFCQIYAGGTIDAARRL
Sbjct  61   AQFHSPDYVEFLQRITPDTQELFSNEMVKHNLGEDCPIFENLFEFCQIYAGGTIDAARRL  120

Query  433  NNQLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVE  612
            NN+LCD+AINWAGGLHHAKKCEASGFCYINDLVLGILELLKYH RVLYIDIDVHHGDGVE
Sbjct  121  NNKLCDIAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHARVLYIDIDVHHGDGVE  180

Query  613  EAFYFTDR  636
            EAFYFTDR
Sbjct  181  EAFYFTDR  188



>ref|XP_006591090.1| PREDICTED: histone deacetylase 9-like isoform X2 [Glycine max]
Length=421

 Score =   362 bits (930),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 170/188 (90%), Positives = 179/188 (95%), Gaps = 0/188 (0%)
 Frame = +1

Query  73   MRSKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMEL  252
            M SKD+I+YFYDGDVG+VYFG  HPMKPHRLCMTHHLVL+Y LH KMEIYRPHKAYP+EL
Sbjct  1    MPSKDKIAYFYDGDVGSVYFGAKHPMKPHRLCMTHHLVLSYDLHKKMEIYRPHKAYPVEL  60

Query  253  AQFHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRL  432
            AQFHSADYVEFL+RITPDTQHLF  +L +YNLGEDCPVFDNLFEFCQIYAGGTIDAARRL
Sbjct  61   AQFHSADYVEFLNRITPDTQHLFLKELTKYNLGEDCPVFDNLFEFCQIYAGGTIDAARRL  120

Query  433  NNQLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVE  612
            NNQLCD+AINWAGGLHHAKKCEASGFCYINDLVLGILELLKYH RVLYIDIDVHHGDGVE
Sbjct  121  NNQLCDIAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHARVLYIDIDVHHGDGVE  180

Query  613  EAFYFTDR  636
            EAFYFTDR
Sbjct  181  EAFYFTDR  188



>dbj|BAH56771.1| AT3G44680 [Arabidopsis thaliana]
Length=222

 Score =   355 bits (910),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 163/188 (87%), Positives = 181/188 (96%), Gaps = 0/188 (0%)
 Frame = +1

Query  73   MRSKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMEL  252
            MRSKD+ISYFYDGDVG+VYFGPNHPMKPHRLCMTHHL+LAYGLH+KME+YRPHKAYP+E+
Sbjct  1    MRSKDKISYFYDGDVGSVYFGPNHPMKPHRLCMTHHLILAYGLHSKMEVYRPHKAYPIEM  60

Query  253  AQFHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRL  432
            AQFHS DYVEFL RI P+ Q+LF  ++ RYNLGEDCPVF++LFEFCQ+YAGGTIDAARRL
Sbjct  61   AQFHSPDYVEFLQRINPENQNLFPNEMARYNLGEDCPVFEDLFEFCQLYAGGTIDAARRL  120

Query  433  NNQLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVE  612
            NN+LCD+AINWAGGLHHAKKC+ASGFCYINDLVLGILELLK+HPRVLYIDIDVHHGDGVE
Sbjct  121  NNKLCDIAINWAGGLHHAKKCDASGFCYINDLVLGILELLKHHPRVLYIDIDVHHGDGVE  180

Query  613  EAFYFTDR  636
            EAFYFTDR
Sbjct  181  EAFYFTDR  188



>gb|EYU36088.1| hypothetical protein MIMGU_mgv1a006831mg [Erythranthe guttata]
Length=430

 Score =   362 bits (930),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 169/188 (90%), Positives = 180/188 (96%), Gaps = 0/188 (0%)
 Frame = +1

Query  73   MRSKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMEL  252
            MRSKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVL+Y LH+KMEIYRPHKAYP+EL
Sbjct  1    MRSKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLSYDLHHKMEIYRPHKAYPVEL  60

Query  253  AQFHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRL  432
            AQFHS DYVEFL RITPDTQ LF  ++ ++NLGEDCP+F+NLFEFCQIYAGGTIDAARRL
Sbjct  61   AQFHSPDYVEFLQRITPDTQELFSNEMVKHNLGEDCPIFENLFEFCQIYAGGTIDAARRL  120

Query  433  NNQLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVE  612
            NN+LCD+AINWAGGLHHAKKCEASGFCYINDLVLGILELLKYH RVLYIDIDVHHGDGVE
Sbjct  121  NNKLCDIAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHARVLYIDIDVHHGDGVE  180

Query  613  EAFYFTDR  636
            EAFYFTDR
Sbjct  181  EAFYFTDR  188



>gb|EPS60971.1| histone deacetylase, partial [Genlisea aurea]
Length=323

 Score =   358 bits (920),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 167/188 (89%), Positives = 177/188 (94%), Gaps = 0/188 (0%)
 Frame = +1

Query  73   MRSKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMEL  252
            M+SKDRISYFYDGDVG+VYFGPNHPMKPHRLCMTHHLVL+Y LH KME+YRPHKAYP+EL
Sbjct  1    MKSKDRISYFYDGDVGSVYFGPNHPMKPHRLCMTHHLVLSYELHKKMEVYRPHKAYPVEL  60

Query  253  AQFHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRL  432
            AQFHS DYVEFL RITPDT  LF  +  +YNLGEDCPVF+NLFEFCQIYAGGTIDAARRL
Sbjct  61   AQFHSPDYVEFLQRITPDTLELFSNETSKYNLGEDCPVFENLFEFCQIYAGGTIDAARRL  120

Query  433  NNQLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVE  612
            NN+LCD+AINWAGGLHHAKKCEASGFCYINDLVLGILELLKYH RVLYIDIDVHHGDGVE
Sbjct  121  NNKLCDIAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHARVLYIDIDVHHGDGVE  180

Query  613  EAFYFTDR  636
            EAFYFTDR
Sbjct  181  EAFYFTDR  188



>ref|XP_011005320.1| PREDICTED: histone deacetylase 9 isoform X1 [Populus euphratica]
Length=458

 Score =   363 bits (933),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 171/188 (91%), Positives = 179/188 (95%), Gaps = 0/188 (0%)
 Frame = +1

Query  73   MRSKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMEL  252
            MRSKDRI+YFYDGDVG+VYFGPNHPMKPHRLCMTHHLVL+Y LH KMEIYRPHKAYP+EL
Sbjct  1    MRSKDRIAYFYDGDVGSVYFGPNHPMKPHRLCMTHHLVLSYELHKKMEIYRPHKAYPVEL  60

Query  253  AQFHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRL  432
            AQFHS DYVEFLHRITPDTQHLF  +L RYNLGEDCPVF+NLFEFCQIYAGGTIDAA RL
Sbjct  61   AQFHSEDYVEFLHRITPDTQHLFAGELARYNLGEDCPVFENLFEFCQIYAGGTIDAAHRL  120

Query  433  NNQLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVE  612
            NNQLCD+AINWAGGLHHAKKC ASGFCYINDLVLGILELLK+H RVLYIDIDVHHGDGVE
Sbjct  121  NNQLCDIAINWAGGLHHAKKCGASGFCYINDLVLGILELLKHHARVLYIDIDVHHGDGVE  180

Query  613  EAFYFTDR  636
            EAFYFTDR
Sbjct  181  EAFYFTDR  188



>ref|XP_003538135.1| PREDICTED: histone deacetylase 9-like isoform X1 [Glycine max]
Length=429

 Score =   362 bits (929),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 170/188 (90%), Positives = 179/188 (95%), Gaps = 0/188 (0%)
 Frame = +1

Query  73   MRSKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMEL  252
            M SKD+I+YFYDGDVG+VYFG  HPMKPHRLCMTHHLVL+Y LH KMEIYRPHKAYP+EL
Sbjct  1    MPSKDKIAYFYDGDVGSVYFGAKHPMKPHRLCMTHHLVLSYDLHKKMEIYRPHKAYPVEL  60

Query  253  AQFHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRL  432
            AQFHSADYVEFL+RITPDTQHLF  +L +YNLGEDCPVFDNLFEFCQIYAGGTIDAARRL
Sbjct  61   AQFHSADYVEFLNRITPDTQHLFLKELTKYNLGEDCPVFDNLFEFCQIYAGGTIDAARRL  120

Query  433  NNQLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVE  612
            NNQLCD+AINWAGGLHHAKKCEASGFCYINDLVLGILELLKYH RVLYIDIDVHHGDGVE
Sbjct  121  NNQLCDIAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHARVLYIDIDVHHGDGVE  180

Query  613  EAFYFTDR  636
            EAFYFTDR
Sbjct  181  EAFYFTDR  188



>gb|KHN38656.1| Histone deacetylase 9 [Glycine soja]
Length=429

 Score =   362 bits (929),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 170/188 (90%), Positives = 179/188 (95%), Gaps = 0/188 (0%)
 Frame = +1

Query  73   MRSKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMEL  252
            M SKD+I+YFYDGDVG+VYFG  HPMKPHRLCMTHHLVL+Y LH KMEIYRPHKAYP+EL
Sbjct  1    MPSKDKIAYFYDGDVGSVYFGAKHPMKPHRLCMTHHLVLSYDLHKKMEIYRPHKAYPVEL  60

Query  253  AQFHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRL  432
            AQFHSADYVEFL+RITPDTQHLF  +L +YNLGEDCPVFDNLFEFCQIYAGGTIDAARRL
Sbjct  61   AQFHSADYVEFLNRITPDTQHLFLNELTKYNLGEDCPVFDNLFEFCQIYAGGTIDAARRL  120

Query  433  NNQLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVE  612
            NNQLCD+AINWAGGLHHAKKCEASGFCYINDLVLGILELLKYH RVLYIDIDVHHGDGVE
Sbjct  121  NNQLCDIAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHARVLYIDIDVHHGDGVE  180

Query  613  EAFYFTDR  636
            EAFYFTDR
Sbjct  181  EAFYFTDR  188



>ref|XP_010425885.1| PREDICTED: histone deacetylase 9 isoform X1 [Camelina sativa]
Length=426

 Score =   359 bits (922),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 164/188 (87%), Positives = 181/188 (96%), Gaps = 0/188 (0%)
 Frame = +1

Query  73   MRSKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMEL  252
            MRSKD+ISYFYDGDVG+VYFGPNHPMKPHRLCMTHHL+LAYGLH+KME+YRPHKAYP+E+
Sbjct  1    MRSKDKISYFYDGDVGSVYFGPNHPMKPHRLCMTHHLILAYGLHSKMEVYRPHKAYPIEM  60

Query  253  AQFHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRL  432
            AQFHS DYVEFL RI P+ Q+LF  ++ RYNLGEDCPVF++LFEFCQIYAGGTIDAARRL
Sbjct  61   AQFHSPDYVEFLQRINPENQNLFPNEMARYNLGEDCPVFEDLFEFCQIYAGGTIDAARRL  120

Query  433  NNQLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVE  612
            NN+LCD+AINWAGGLHHAKKC+ASGFCYINDLVLGILELLK+HPRVLYIDIDVHHGDGVE
Sbjct  121  NNKLCDIAINWAGGLHHAKKCDASGFCYINDLVLGILELLKHHPRVLYIDIDVHHGDGVE  180

Query  613  EAFYFTDR  636
            EAFYFTDR
Sbjct  181  EAFYFTDR  188



>ref|XP_010503116.1| PREDICTED: histone deacetylase 9-like [Camelina sativa]
Length=426

 Score =   359 bits (922),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 164/188 (87%), Positives = 181/188 (96%), Gaps = 0/188 (0%)
 Frame = +1

Query  73   MRSKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMEL  252
            MRSKD+ISYFYDGDVG+VYFGPNHPMKPHRLCMTHHL+LAYGLH+KME+YRPHKAYP+E+
Sbjct  1    MRSKDKISYFYDGDVGSVYFGPNHPMKPHRLCMTHHLILAYGLHSKMEVYRPHKAYPIEM  60

Query  253  AQFHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRL  432
            AQFHS DYVEFL RI P+ Q+LF  ++ RYNLGEDCPVF++LFEFCQIYAGGTIDAARRL
Sbjct  61   AQFHSPDYVEFLQRINPENQNLFPNEMARYNLGEDCPVFEDLFEFCQIYAGGTIDAARRL  120

Query  433  NNQLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVE  612
            NN+LCD+AINWAGGLHHAKKC+ASGFCYINDLVLGILELLK+HPRVLYIDIDVHHGDGVE
Sbjct  121  NNKLCDIAINWAGGLHHAKKCDASGFCYINDLVLGILELLKHHPRVLYIDIDVHHGDGVE  180

Query  613  EAFYFTDR  636
            EAFYFTDR
Sbjct  181  EAFYFTDR  188



>ref|XP_010514792.1| PREDICTED: histone deacetylase 9 [Camelina sativa]
Length=426

 Score =   359 bits (922),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 164/188 (87%), Positives = 181/188 (96%), Gaps = 0/188 (0%)
 Frame = +1

Query  73   MRSKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMEL  252
            MRSKD+ISYFYDGDVG+VYFGPNHPMKPHRLCMTHHL+LAYGLH+KME+YRPHKAYP+E+
Sbjct  1    MRSKDKISYFYDGDVGSVYFGPNHPMKPHRLCMTHHLILAYGLHSKMEVYRPHKAYPIEM  60

Query  253  AQFHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRL  432
            AQFHS DYVEFL RI P+ Q+LF  ++ RYNLGEDCPVF++LFEFCQIYAGGTIDAARRL
Sbjct  61   AQFHSPDYVEFLQRINPENQNLFPNEMARYNLGEDCPVFEDLFEFCQIYAGGTIDAARRL  120

Query  433  NNQLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVE  612
            NN+LCD+AINWAGGLHHAKKC+ASGFCYINDLVLGILELLK+HPRVLYIDIDVHHGDGVE
Sbjct  121  NNKLCDIAINWAGGLHHAKKCDASGFCYINDLVLGILELLKHHPRVLYIDIDVHHGDGVE  180

Query  613  EAFYFTDR  636
            EAFYFTDR
Sbjct  181  EAFYFTDR  188



>ref|XP_006279377.1| hypothetical protein CARUB_v10007995mg [Capsella rubella]
 gb|EOA12275.1| hypothetical protein CARUB_v10007995mg [Capsella rubella]
Length=426

 Score =   359 bits (921),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 164/188 (87%), Positives = 181/188 (96%), Gaps = 0/188 (0%)
 Frame = +1

Query  73   MRSKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMEL  252
            MRSKD+ISYFYDGDVG+VYFGPNHPMKPHRLCMTHHL+LAYGLH+KME+YRPHKAYP+E+
Sbjct  1    MRSKDKISYFYDGDVGSVYFGPNHPMKPHRLCMTHHLILAYGLHSKMEVYRPHKAYPIEM  60

Query  253  AQFHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRL  432
            AQFHS DYVEFL RI P+ Q+LF  ++ RYNLGEDCPVF++LFEFCQIYAGGTIDAARRL
Sbjct  61   AQFHSPDYVEFLQRINPENQNLFPNEMARYNLGEDCPVFEDLFEFCQIYAGGTIDAARRL  120

Query  433  NNQLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVE  612
            NN+LCD+AINWAGGLHHAKKC+ASGFCYINDLVLGILELLK+HPRVLYIDIDVHHGDGVE
Sbjct  121  NNKLCDIAINWAGGLHHAKKCDASGFCYINDLVLGILELLKHHPRVLYIDIDVHHGDGVE  180

Query  613  EAFYFTDR  636
            EAFYFTDR
Sbjct  181  EAFYFTDR  188



>ref|XP_008360484.1| PREDICTED: LOW QUALITY PROTEIN: histone deacetylase 9 [Malus 
domestica]
Length=334

 Score =   356 bits (913),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 167/188 (89%), Positives = 177/188 (94%), Gaps = 0/188 (0%)
 Frame = +1

Query  73   MRSKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMEL  252
            MR KD+I+YFYDGDVG+VYFGPNHPMKPHRLCMTHHLVL+Y LH KMEIYRPHKAYP+EL
Sbjct  1    MRLKDKIAYFYDGDVGSVYFGPNHPMKPHRLCMTHHLVLSYDLHKKMEIYRPHKAYPVEL  60

Query  253  AQFHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRL  432
            AQFHSAD+VEFLHRITPDTQHLF  ++ RYNLGEDCPVFDNLFEFCQIYA GTIDAARRL
Sbjct  61   AQFHSADHVEFLHRITPDTQHLFSNEMARYNLGEDCPVFDNLFEFCQIYAXGTIDAARRL  120

Query  433  NNQLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVE  612
            NN+LCD+AINWAGGLHHAKKCE SGFCY NDLVLGILELLK H RVLYIDIDVHHGDGVE
Sbjct  121  NNKLCDIAINWAGGLHHAKKCEXSGFCYXNDLVLGILELLKXHARVLYIDIDVHHGDGVE  180

Query  613  EAFYFTDR  636
            EAFYFTDR
Sbjct  181  EAFYFTDR  188



>ref|NP_190054.2| histone deacetylase 9 [Arabidopsis thaliana]
 sp|Q8H0W2.1|HDA9_ARATH RecName: Full=Histone deacetylase 9 [Arabidopsis thaliana]
 gb|AAN72014.1| putative protein [Arabidopsis thaliana]
 gb|AAP31920.1| At3g44680 [Arabidopsis thaliana]
 gb|AEE77930.1| histone deacetylase 9 [Arabidopsis thaliana]
Length=426

 Score =   358 bits (919),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 163/188 (87%), Positives = 181/188 (96%), Gaps = 0/188 (0%)
 Frame = +1

Query  73   MRSKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMEL  252
            MRSKD+ISYFYDGDVG+VYFGPNHPMKPHRLCMTHHL+LAYGLH+KME+YRPHKAYP+E+
Sbjct  1    MRSKDKISYFYDGDVGSVYFGPNHPMKPHRLCMTHHLILAYGLHSKMEVYRPHKAYPIEM  60

Query  253  AQFHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRL  432
            AQFHS DYVEFL RI P+ Q+LF  ++ RYNLGEDCPVF++LFEFCQ+YAGGTIDAARRL
Sbjct  61   AQFHSPDYVEFLQRINPENQNLFPNEMARYNLGEDCPVFEDLFEFCQLYAGGTIDAARRL  120

Query  433  NNQLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVE  612
            NN+LCD+AINWAGGLHHAKKC+ASGFCYINDLVLGILELLK+HPRVLYIDIDVHHGDGVE
Sbjct  121  NNKLCDIAINWAGGLHHAKKCDASGFCYINDLVLGILELLKHHPRVLYIDIDVHHGDGVE  180

Query  613  EAFYFTDR  636
            EAFYFTDR
Sbjct  181  EAFYFTDR  188



>ref|XP_006419115.1| hypothetical protein EUTSA_v10002540mg [Eutrema salsugineum]
 gb|ESQ37551.1| hypothetical protein EUTSA_v10002540mg [Eutrema salsugineum]
Length=426

 Score =   358 bits (919),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 162/188 (86%), Positives = 181/188 (96%), Gaps = 0/188 (0%)
 Frame = +1

Query  73   MRSKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMEL  252
            MRSKD+ISYFYDGDVG+VYFGPNHPMKPHRLCMTHHL+LAYGLH+KME+YRPHKAYP+E+
Sbjct  1    MRSKDKISYFYDGDVGSVYFGPNHPMKPHRLCMTHHLILAYGLHSKMEVYRPHKAYPIEM  60

Query  253  AQFHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRL  432
            AQFHS DYVEFL RI P+ Q+LF  ++ RYNLGEDCPVF+++FEFCQIYAGGTIDAARRL
Sbjct  61   AQFHSPDYVEFLQRINPENQNLFPNEMARYNLGEDCPVFEDMFEFCQIYAGGTIDAARRL  120

Query  433  NNQLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVE  612
            NN+LCD++INWAGGLHHAKKC+ASGFCYINDLVLGILELLK+HPRVLYIDIDVHHGDGVE
Sbjct  121  NNKLCDISINWAGGLHHAKKCDASGFCYINDLVLGILELLKHHPRVLYIDIDVHHGDGVE  180

Query  613  EAFYFTDR  636
            EAFYFTDR
Sbjct  181  EAFYFTDR  188



>ref|XP_009404812.1| PREDICTED: histone deacetylase 9 isoform X1 [Musa acuminata subsp. 
malaccensis]
Length=431

 Score =   357 bits (915),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 166/188 (88%), Positives = 179/188 (95%), Gaps = 0/188 (0%)
 Frame = +1

Query  73   MRSKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMEL  252
            M  K+RI+YFYDGDVGNVYFGPNHPMKPHRLCMTHHLVL+YGL+ KMEIYRPHKAYP+EL
Sbjct  1    MPPKERIAYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLSYGLYKKMEIYRPHKAYPVEL  60

Query  253  AQFHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRL  432
            AQFHSADYVEFLHRI+P+TQHLF  +L RYNLGEDCPVF+NLFEFCQ+YAGGTIDAARRL
Sbjct  61   AQFHSADYVEFLHRISPNTQHLFADELARYNLGEDCPVFENLFEFCQMYAGGTIDAARRL  120

Query  433  NNQLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVE  612
            N+QLCD+AINW+GGLHHAKK  ASGFCYINDLVLGILELLKYH RVLYIDIDVHHGDGVE
Sbjct  121  NHQLCDIAINWSGGLHHAKKSAASGFCYINDLVLGILELLKYHARVLYIDIDVHHGDGVE  180

Query  613  EAFYFTDR  636
            EAFYFTDR
Sbjct  181  EAFYFTDR  188



>ref|XP_010541291.1| PREDICTED: histone deacetylase 9 isoform X1 [Tarenaya hassleriana]
Length=426

 Score =   354 bits (908),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 161/188 (86%), Positives = 179/188 (95%), Gaps = 0/188 (0%)
 Frame = +1

Query  73   MRSKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMEL  252
            MRSKD+ISYFYDGDVG+VYFGPNHPMKPHRLCMTHHL+L+YGLH+KMEIYRPHKAYP+E+
Sbjct  1    MRSKDKISYFYDGDVGSVYFGPNHPMKPHRLCMTHHLILSYGLHDKMEIYRPHKAYPVEM  60

Query  253  AQFHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRL  432
            AQFHS DYVEFL RI P  +++F  ++ RYNLGEDCPVF+++FEFCQIYAGGTIDAARRL
Sbjct  61   AQFHSPDYVEFLQRINPGNENIFANEMARYNLGEDCPVFEDMFEFCQIYAGGTIDAARRL  120

Query  433  NNQLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVE  612
            NN+LCD+AINWAGGLHHAKKCEASGFCYINDLVLGILELLK+H RVLYIDIDVHHGDGVE
Sbjct  121  NNKLCDIAINWAGGLHHAKKCEASGFCYINDLVLGILELLKHHARVLYIDIDVHHGDGVE  180

Query  613  EAFYFTDR  636
            EAFYFTDR
Sbjct  181  EAFYFTDR  188



>ref|XP_009150313.1| PREDICTED: histone deacetylase 9 [Brassica rapa]
 emb|CDX99186.1| BnaA06g18770D [Brassica napus]
Length=426

 Score =   354 bits (908),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 161/188 (86%), Positives = 179/188 (95%), Gaps = 0/188 (0%)
 Frame = +1

Query  73   MRSKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMEL  252
            MRSKD+ISYFYDGDVG+VYFGPNHPMKPHRLCMTHHL+LAYGLH+KME+YRPHKAYP+E+
Sbjct  1    MRSKDKISYFYDGDVGSVYFGPNHPMKPHRLCMTHHLILAYGLHSKMEVYRPHKAYPIEM  60

Query  253  AQFHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRL  432
            AQFHS DYVEFL RI P+ + LF  ++ RYNLGEDCPVF+++FEFCQIYAG TIDAARRL
Sbjct  61   AQFHSPDYVEFLQRINPENKDLFPNEMARYNLGEDCPVFEDMFEFCQIYAGATIDAARRL  120

Query  433  NNQLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVE  612
            NN+LCD+AINWAGGLHHAKKC+ASGFCYINDLVLGILELLK+HPRVLYIDIDVHHGDGVE
Sbjct  121  NNKLCDIAINWAGGLHHAKKCDASGFCYINDLVLGILELLKHHPRVLYIDIDVHHGDGVE  180

Query  613  EAFYFTDR  636
            EAFYFTDR
Sbjct  181  EAFYFTDR  188



>ref|XP_006851552.1| hypothetical protein AMTR_s00040p00182290 [Amborella trichopoda]
 gb|ERN13133.1| hypothetical protein AMTR_s00040p00182290 [Amborella trichopoda]
Length=432

 Score =   353 bits (905),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 162/188 (86%), Positives = 177/188 (94%), Gaps = 0/188 (0%)
 Frame = +1

Query  73   MRSKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMEL  252
            M SKD++++FYDGDVGNVYFGPNHPMKPHRLCMT+ LVL+Y L  KMEIYRPHKAYP EL
Sbjct  1    MPSKDKVAFFYDGDVGNVYFGPNHPMKPHRLCMTYQLVLSYELQKKMEIYRPHKAYPQEL  60

Query  253  AQFHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRL  432
            AQFHSADYVEFLHRITPDTQHL+  +L RYNLGEDCPVF+NLFEFCQIYAGGT+DAAR+L
Sbjct  61   AQFHSADYVEFLHRITPDTQHLYAKELVRYNLGEDCPVFENLFEFCQIYAGGTLDAARKL  120

Query  433  NNQLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVE  612
            N++ CD+AINWAGGLHHAKKCEASGFCYINDLVLGILELLK+H RVLYIDIDVHHGDGVE
Sbjct  121  NSKQCDIAINWAGGLHHAKKCEASGFCYINDLVLGILELLKHHTRVLYIDIDVHHGDGVE  180

Query  613  EAFYFTDR  636
            EAFYFTDR
Sbjct  181  EAFYFTDR  188



>tpg|DAA37954.1| TPA: histone deacetylase [Zea mays]
Length=427

 Score =   349 bits (895),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 161/176 (91%), Positives = 171/176 (97%), Gaps = 0/176 (0%)
 Frame = +1

Query  109  GDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMELAQFHSADYVEFL  288
            GDVGNVYFGPNHPMKPHRLCMTHHLVL+YGLH KMEIYRPHKAYP+ELAQFHSADYVEFL
Sbjct  10   GDVGNVYFGPNHPMKPHRLCMTHHLVLSYGLHQKMEIYRPHKAYPIELAQFHSADYVEFL  69

Query  289  HRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRLNNQLCDVAINWA  468
            HRITPD+QHL+  +L RYNLGEDCPVFDNLFEFCQIYAGGT+DAARRLN+++CD+AINWA
Sbjct  70   HRITPDSQHLYASELTRYNLGEDCPVFDNLFEFCQIYAGGTLDAARRLNHKICDIAINWA  129

Query  469  GGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVEEAFYFTDR  636
            GGLHHAKKCEASGFCYINDLVLGILELLKYH RVLYIDIDVHHGDGVEEAFYFTDR
Sbjct  130  GGLHHAKKCEASGFCYINDLVLGILELLKYHARVLYIDIDVHHGDGVEEAFYFTDR  185



>tpg|DAA37953.1| TPA: histone deacetylase, mRNA [Zea mays]
Length=432

 Score =   349 bits (895),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 161/176 (91%), Positives = 171/176 (97%), Gaps = 0/176 (0%)
 Frame = +1

Query  109  GDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMELAQFHSADYVEFL  288
            GDVGNVYFGPNHPMKPHRLCMTHHLVL+YGLH KMEIYRPHKAYP+ELAQFHSADYVEFL
Sbjct  15   GDVGNVYFGPNHPMKPHRLCMTHHLVLSYGLHQKMEIYRPHKAYPIELAQFHSADYVEFL  74

Query  289  HRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRLNNQLCDVAINWA  468
            HRITPD+QHL+  +L RYNLGEDCPVFDNLFEFCQIYAGGT+DAARRLN+++CD+AINWA
Sbjct  75   HRITPDSQHLYASELTRYNLGEDCPVFDNLFEFCQIYAGGTLDAARRLNHKICDIAINWA  134

Query  469  GGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVEEAFYFTDR  636
            GGLHHAKKCEASGFCYINDLVLGILELLKYH RVLYIDIDVHHGDGVEEAFYFTDR
Sbjct  135  GGLHHAKKCEASGFCYINDLVLGILELLKYHARVLYIDIDVHHGDGVEEAFYFTDR  190



>ref|XP_001774667.1| class I RPD3 type histone deacetylase protein [Physcomitrella 
patens]
 gb|EDQ60482.1| class I RPD3 type histone deacetylase protein [Physcomitrella 
patens]
Length=431

 Score =   345 bits (886),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 160/188 (85%), Positives = 174/188 (93%), Gaps = 0/188 (0%)
 Frame = +1

Query  73   MRSKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMEL  252
            M  KDR+SYFYDGDVG+VY+GPNHPMKPHRLCMT+ LVLAYGLHNKMEIYRPHKAYP+EL
Sbjct  1    MPVKDRVSYFYDGDVGSVYYGPNHPMKPHRLCMTNSLVLAYGLHNKMEIYRPHKAYPVEL  60

Query  253  AQFHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRL  432
            AQFHS DYVEFL RITP++Q  +  +L RYN+GEDCPVFDNLFEFCQIYAGGTIDAA RL
Sbjct  61   AQFHSVDYVEFLGRITPESQEKYAAELIRYNMGEDCPVFDNLFEFCQIYAGGTIDAAHRL  120

Query  433  NNQLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVE  612
            N+ LCD+AINWAGGLHHAKKCEASGFCY+NDLVLGILELLKYH RVLYIDID+HHGDGVE
Sbjct  121  NHGLCDIAINWAGGLHHAKKCEASGFCYVNDLVLGILELLKYHARVLYIDIDIHHGDGVE  180

Query  613  EAFYFTDR  636
            EAFY TDR
Sbjct  181  EAFYLTDR  188



>gb|KHN21123.1| Histone deacetylase 9 [Glycine soja]
Length=477

 Score =   343 bits (880),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 161/176 (91%), Positives = 168/176 (95%), Gaps = 0/176 (0%)
 Frame = +1

Query  109  GDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMELAQFHSADYVEFL  288
            GDVG+VYFG  HPMKPHRLCMTHHLVL+Y LH KMEIYRPHKAYP+ELAQFHSADYVEFL
Sbjct  44   GDVGSVYFGAKHPMKPHRLCMTHHLVLSYDLHKKMEIYRPHKAYPVELAQFHSADYVEFL  103

Query  289  HRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRLNNQLCDVAINWA  468
            +RITPDTQHLF  +L +YNLGEDCPVFDNLFEFCQIYAGGTIDAARRLNNQLCD+AINWA
Sbjct  104  NRITPDTQHLFLNELTKYNLGEDCPVFDNLFEFCQIYAGGTIDAARRLNNQLCDIAINWA  163

Query  469  GGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVEEAFYFTDR  636
            GGLHHAKKCEASGFCYINDLVLGILELLKYH RVLYIDIDVHHGDGVEEAFYFTDR
Sbjct  164  GGLHHAKKCEASGFCYINDLVLGILELLKYHARVLYIDIDVHHGDGVEEAFYFTDR  219



>emb|CAB72470.1| putative protein [Arabidopsis thaliana]
Length=419

 Score =   335 bits (859),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 152/182 (84%), Positives = 172/182 (95%), Gaps = 0/182 (0%)
 Frame = +1

Query  91   ISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMELAQFHSA  270
            + ++  GDVG+VYFGPNHPMKPHRLCMTHHL+LAYGLH+KME+YRPHKAYP+E+AQFHS 
Sbjct  4    VFFWVAGDVGSVYFGPNHPMKPHRLCMTHHLILAYGLHSKMEVYRPHKAYPIEMAQFHSP  63

Query  271  DYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRLNNQLCD  450
            DYVEFL RI P+ Q+LF  ++ RYNLGEDCPVF++LFEFCQ+YAGGTIDAARRLNN+LCD
Sbjct  64   DYVEFLQRINPENQNLFPNEMARYNLGEDCPVFEDLFEFCQLYAGGTIDAARRLNNKLCD  123

Query  451  VAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVEEAFYFT  630
            +AINWAGGLHHAKKC+ASGFCYINDLVLGILELLK+HPRVLYIDIDVHHGDGVEEAFYFT
Sbjct  124  IAINWAGGLHHAKKCDASGFCYINDLVLGILELLKHHPRVLYIDIDVHHGDGVEEAFYFT  183

Query  631  DR  636
            DR
Sbjct  184  DR  185



>ref|XP_002966032.1| hypothetical protein SELMODRAFT_84957 [Selaginella moellendorffii]
 gb|EFJ33452.1| hypothetical protein SELMODRAFT_84957 [Selaginella moellendorffii]
Length=432

 Score =   335 bits (859),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 157/187 (84%), Positives = 171/187 (91%), Gaps = 1/187 (1%)
 Frame = +1

Query  79   SKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMELAQ  258
            +KDR+SYFYDGDVG+VY+GPNHPMKPHRLCMTH LVLAYGLHNKMEIYRP KAYP ELAQ
Sbjct  4    AKDRVSYFYDGDVGSVYYGPNHPMKPHRLCMTHSLVLAYGLHNKMEIYRPRKAYPAELAQ  63

Query  259  FHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTI-DAARRLN  435
            FHS DY++FLHRITP+ Q  +  +L  YN+GEDCPVFDNLFEFCQIYAGGTI DAA RLN
Sbjct  64   FHSTDYIDFLHRITPEMQDQYAKELLMYNMGEDCPVFDNLFEFCQIYAGGTIADAAHRLN  123

Query  436  NQLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVEE  615
            + LCD+AINWAGGLHHAKKCEASGFCY+NDLVLGILELLKY PRVLYIDID+HHGDGVEE
Sbjct  124  HGLCDIAINWAGGLHHAKKCEASGFCYVNDLVLGILELLKYFPRVLYIDIDIHHGDGVEE  183

Query  616  AFYFTDR  636
            AFY TDR
Sbjct  184  AFYLTDR  190



>ref|XP_002971460.1| hypothetical protein SELMODRAFT_172161 [Selaginella moellendorffii]
 gb|EFJ27209.1| hypothetical protein SELMODRAFT_172161 [Selaginella moellendorffii]
Length=432

 Score =   333 bits (853),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 156/187 (83%), Positives = 171/187 (91%), Gaps = 1/187 (1%)
 Frame = +1

Query  79   SKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMELAQ  258
            +KDR+SYFYDGDVG+VY+GPNHPMKPHRLCMTH LVLAYGLH+KMEIYRP KAYP ELAQ
Sbjct  4    AKDRVSYFYDGDVGSVYYGPNHPMKPHRLCMTHSLVLAYGLHHKMEIYRPRKAYPAELAQ  63

Query  259  FHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTI-DAARRLN  435
            FHS DY++FLHRITP+ Q  +  +L  YN+GEDCPVFDNLFEFCQIYAGGTI DAA RLN
Sbjct  64   FHSTDYIDFLHRITPEMQDQYAKELLMYNMGEDCPVFDNLFEFCQIYAGGTIADAAHRLN  123

Query  436  NQLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVEE  615
            + LCD+AINWAGGLHHAKKCEASGFCY+NDLVLGILELLKY PRVLYIDID+HHGDGVEE
Sbjct  124  HGLCDIAINWAGGLHHAKKCEASGFCYVNDLVLGILELLKYFPRVLYIDIDIHHGDGVEE  183

Query  616  AFYFTDR  636
            AFY TDR
Sbjct  184  AFYLTDR  190



>ref|XP_002877352.1| hypothetical protein ARALYDRAFT_347545 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53611.1| hypothetical protein ARALYDRAFT_347545 [Arabidopsis lyrata subsp. 
lyrata]
Length=1443

 Score =   343 bits (881),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 153/176 (87%), Positives = 169/176 (96%), Gaps = 0/176 (0%)
 Frame = +1

Query  109   GDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMELAQFHSADYVEFL  288
             GDVG+VYFGPNHPMKPHRLCMTHHL+LAYGLH+KME+YRPHKAYP+E+AQFHS DYVEFL
Sbjct  1014  GDVGSVYFGPNHPMKPHRLCMTHHLILAYGLHSKMEVYRPHKAYPIEMAQFHSPDYVEFL  1073

Query  289   HRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRLNNQLCDVAINWA  468
              RI P+ Q+LF  ++ RYNLGEDCPVF++LFEFCQIYAGGTIDAARRLNN+LCD+AINWA
Sbjct  1074  QRINPENQNLFPNEMARYNLGEDCPVFEDLFEFCQIYAGGTIDAARRLNNKLCDIAINWA  1133

Query  469   GGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVEEAFYFTDR  636
             GGLHHAKKC+ASGFCYINDLVLGILELLK+HPRVLYIDIDVHHGDGVEEAFYFTDR
Sbjct  1134  GGLHHAKKCDASGFCYINDLVLGILELLKHHPRVLYIDIDVHHGDGVEEAFYFTDR  1189



>gb|KEH29890.1| histone deacetylase family protein [Medicago truncatula]
Length=405

 Score =   321 bits (823),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 149/163 (91%), Positives = 158/163 (97%), Gaps = 0/163 (0%)
 Frame = +1

Query  148  MKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMELAQFHSADYVEFLHRITPDTQHLFGI  327
            MKPHRLCMTHHLVL+Y LH KME+YRPHKAYP+ELAQFHSADYVEFLHRITPDTQHLF  
Sbjct  1    MKPHRLCMTHHLVLSYDLHKKMEVYRPHKAYPVELAQFHSADYVEFLHRITPDTQHLFSD  60

Query  328  DLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRLNNQLCDVAINWAGGLHHAKKCEASG  507
            +L +YNLGEDCPVFDNLFEFCQ+YAGGTIDAARRLNN+LCD+AINWAGGLHHAKKCEASG
Sbjct  61   ELAKYNLGEDCPVFDNLFEFCQMYAGGTIDAARRLNNKLCDIAINWAGGLHHAKKCEASG  120

Query  508  FCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVEEAFYFTDR  636
            FCYINDLVLGILELLK+HPRVLYIDIDVHHGDGVEEAFYFTDR
Sbjct  121  FCYINDLVLGILELLKHHPRVLYIDIDVHHGDGVEEAFYFTDR  163



>gb|ACR37742.1| unknown [Zea mays]
Length=405

 Score =   320 bits (820),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 148/163 (91%), Positives = 158/163 (97%), Gaps = 0/163 (0%)
 Frame = +1

Query  148  MKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMELAQFHSADYVEFLHRITPDTQHLFGI  327
            MKPHRLCMTHHLVL+YGLH KMEIYRPHKAYP+ELAQFHSADYVEFLHRITPD+QHL+  
Sbjct  1    MKPHRLCMTHHLVLSYGLHQKMEIYRPHKAYPIELAQFHSADYVEFLHRITPDSQHLYAS  60

Query  328  DLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRLNNQLCDVAINWAGGLHHAKKCEASG  507
            +L RYNLGEDCPVFDNLFEFCQIYAGGT+DAARRLN+++CD+AINWAGGLHHAKKCEASG
Sbjct  61   ELTRYNLGEDCPVFDNLFEFCQIYAGGTLDAARRLNHKICDIAINWAGGLHHAKKCEASG  120

Query  508  FCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVEEAFYFTDR  636
            FCYINDLVLGILELLKYH RVLYIDIDVHHGDGVEEAFYFTDR
Sbjct  121  FCYINDLVLGILELLKYHARVLYIDIDVHHGDGVEEAFYFTDR  163



>gb|AAM70418.1|AF512725_1 histone deacetylase [Arabidopsis thaliana]
Length=206

 Score =   312 bits (799),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 143/166 (86%), Positives = 159/166 (96%), Gaps = 0/166 (0%)
 Frame = +1

Query  139  NHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMELAQFHSADYVEFLHRITPDTQHL  318
            NHPMKPHRLCMTHHL+LAYGLH+KME+YRPHKAYP+E+AQFHS DYVEFL RI P+ Q+L
Sbjct  1    NHPMKPHRLCMTHHLILAYGLHSKMEVYRPHKAYPIEMAQFHSPDYVEFLQRINPENQNL  60

Query  319  FGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRLNNQLCDVAINWAGGLHHAKKCE  498
            F  ++ RYNLGEDCPVF++LFEFCQ+YAGGTIDAARRLNN+LCD+AINWAGGLHHAKKC+
Sbjct  61   FPNEMARYNLGEDCPVFEDLFEFCQLYAGGTIDAARRLNNKLCDIAINWAGGLHHAKKCD  120

Query  499  ASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVEEAFYFTDR  636
            ASGFCYINDLVLGILELLK+HPRVLYIDIDVHHGDGVEEAFYFTDR
Sbjct  121  ASGFCYINDLVLGILELLKHHPRVLYIDIDVHHGDGVEEAFYFTDR  166



>ref|XP_008458609.1| PREDICTED: histone deacetylase 9 isoform X3 [Cucumis melo]
Length=405

 Score =   317 bits (813),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 149/163 (91%), Positives = 156/163 (96%), Gaps = 0/163 (0%)
 Frame = +1

Query  148  MKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMELAQFHSADYVEFLHRITPDTQHLFGI  327
            MKPHRLCMTHHLVL+Y LH KMEIYRPHKAYP+ELAQFHSADYVEFLHRI PDTQHLF  
Sbjct  1    MKPHRLCMTHHLVLSYELHKKMEIYRPHKAYPVELAQFHSADYVEFLHRINPDTQHLFAN  60

Query  328  DLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRLNNQLCDVAINWAGGLHHAKKCEASG  507
            +L +YNLGEDCPVF+NLFEFCQIYAGGTIDAARRLN+QLCD+AINWAGGLHHAKKCEASG
Sbjct  61   ELSKYNLGEDCPVFENLFEFCQIYAGGTIDAARRLNHQLCDIAINWAGGLHHAKKCEASG  120

Query  508  FCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVEEAFYFTDR  636
            FCYINDLVLGILELLKYH RVLYIDIDVHHGDGVEEAFYFTDR
Sbjct  121  FCYINDLVLGILELLKYHSRVLYIDIDVHHGDGVEEAFYFTDR  163



>emb|CAN75079.1| hypothetical protein VITISV_007579 [Vitis vinifera]
Length=393

 Score =   316 bits (810),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 149/163 (91%), Positives = 156/163 (96%), Gaps = 0/163 (0%)
 Frame = +1

Query  148  MKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMELAQFHSADYVEFLHRITPDTQHLFGI  327
            MKPHRLCMTHHLVL+Y LH KMEIYRPHKAYP+ELAQFHSADYVEFLHRITPDTQHLF  
Sbjct  1    MKPHRLCMTHHLVLSYELHKKMEIYRPHKAYPVELAQFHSADYVEFLHRITPDTQHLFLN  60

Query  328  DLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRLNNQLCDVAINWAGGLHHAKKCEASG  507
            +L +YNLGE CPVF+NLFEFCQIYAGGTIDAARRLNNQLCD+AINWAGGLHHAKKCEASG
Sbjct  61   ELAKYNLGEXCPVFENLFEFCQIYAGGTIDAARRLNNQLCDIAINWAGGLHHAKKCEASG  120

Query  508  FCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVEEAFYFTDR  636
            FCYINDLVLGILELLK+H RVLYIDIDVHHGDGVEEAFYFTDR
Sbjct  121  FCYINDLVLGILELLKHHARVLYIDIDVHHGDGVEEAFYFTDR  163



>ref|XP_011005321.1| PREDICTED: histone deacetylase 9 isoform X2 [Populus euphratica]
Length=433

 Score =   313 bits (803),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 148/163 (91%), Positives = 154/163 (94%), Gaps = 0/163 (0%)
 Frame = +1

Query  148  MKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMELAQFHSADYVEFLHRITPDTQHLFGI  327
            MKPHRLCMTHHLVL+Y LH KMEIYRPHKAYP+ELAQFHS DYVEFLHRITPDTQHLF  
Sbjct  1    MKPHRLCMTHHLVLSYELHKKMEIYRPHKAYPVELAQFHSEDYVEFLHRITPDTQHLFAG  60

Query  328  DLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRLNNQLCDVAINWAGGLHHAKKCEASG  507
            +L RYNLGEDCPVF+NLFEFCQIYAGGTIDAA RLNNQLCD+AINWAGGLHHAKKC ASG
Sbjct  61   ELARYNLGEDCPVFENLFEFCQIYAGGTIDAAHRLNNQLCDIAINWAGGLHHAKKCGASG  120

Query  508  FCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVEEAFYFTDR  636
            FCYINDLVLGILELLK+H RVLYIDIDVHHGDGVEEAFYFTDR
Sbjct  121  FCYINDLVLGILELLKHHARVLYIDIDVHHGDGVEEAFYFTDR  163



>ref|XP_009404815.1| PREDICTED: histone deacetylase 9 isoform X4 [Musa acuminata subsp. 
malaccensis]
Length=406

 Score =   311 bits (797),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 145/163 (89%), Positives = 156/163 (96%), Gaps = 0/163 (0%)
 Frame = +1

Query  148  MKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMELAQFHSADYVEFLHRITPDTQHLFGI  327
            MKPHRLCMTHHLVL+YGL+ KMEIYRPHKAYP+ELAQFHSADYVEFLHRI+P+TQHLF  
Sbjct  1    MKPHRLCMTHHLVLSYGLYKKMEIYRPHKAYPVELAQFHSADYVEFLHRISPNTQHLFAD  60

Query  328  DLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRLNNQLCDVAINWAGGLHHAKKCEASG  507
            +L RYNLGEDCPVF+NLFEFCQ+YAGGTIDAARRLN+QLCD+AINW+GGLHHAKK  ASG
Sbjct  61   ELARYNLGEDCPVFENLFEFCQMYAGGTIDAARRLNHQLCDIAINWSGGLHHAKKSAASG  120

Query  508  FCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVEEAFYFTDR  636
            FCYINDLVLGILELLKYH RVLYIDIDVHHGDGVEEAFYFTDR
Sbjct  121  FCYINDLVLGILELLKYHARVLYIDIDVHHGDGVEEAFYFTDR  163



>ref|XP_003060152.1| histone deacetylase [Micromonas pusilla CCMP1545]
 gb|EEH56104.1| histone deacetylase [Micromonas pusilla CCMP1545]
Length=430

 Score =   307 bits (787),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 139/186 (75%), Positives = 161/186 (87%), Gaps = 0/186 (0%)
 Frame = +1

Query  79   SKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMELAQ  258
            SKDRISYFYD DVG  Y+G NHPMKPHRL MTHHLVL+Y LH KME+YRP ++YP+E++Q
Sbjct  4    SKDRISYFYDADVGTSYYGNNHPMKPHRLAMTHHLVLSYDLHKKMEVYRPRRSYPVEMSQ  63

Query  259  FHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRLNN  438
            FH+ DYV+FL RITPDTQ      ++RYNLGEDCP+FD LF+FC++Y GG+ID A RLN+
Sbjct  64   FHAEDYVDFLSRITPDTQQDHTEQMQRYNLGEDCPIFDGLFDFCKLYTGGSIDGAVRLNH  123

Query  439  QLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVEEA  618
             L D+AINW+GGLHHAKK EASGFCYINDLVL ILELLK+HPRVLYIDID+HHGDGVEEA
Sbjct  124  GLSDIAINWSGGLHHAKKSEASGFCYINDLVLAILELLKHHPRVLYIDIDIHHGDGVEEA  183

Query  619  FYFTDR  636
            FY TDR
Sbjct  184  FYLTDR  189



>emb|CDY08684.1| BnaC03g54980D [Brassica napus]
Length=401

 Score =   304 bits (778),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 138/163 (85%), Positives = 154/163 (94%), Gaps = 0/163 (0%)
 Frame = +1

Query  148  MKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMELAQFHSADYVEFLHRITPDTQHLFGI  327
            MKPHRLCMTHHL+LAYGLH+KME+YRPHKAYP+E+AQFHS DYVEFL RI P+ + LF  
Sbjct  1    MKPHRLCMTHHLILAYGLHSKMEVYRPHKAYPIEMAQFHSPDYVEFLQRINPENKDLFPN  60

Query  328  DLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRLNNQLCDVAINWAGGLHHAKKCEASG  507
            ++ RYNLGEDCPVF+++FEFCQIYAG TIDAARRLNN+LCD+AINWAGGLHHAKKC+ASG
Sbjct  61   EMARYNLGEDCPVFEDMFEFCQIYAGATIDAARRLNNKLCDIAINWAGGLHHAKKCDASG  120

Query  508  FCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVEEAFYFTDR  636
            FCYINDLVLGILELLK+HPRVLYIDIDVHHGDGVEEAFYFTDR
Sbjct  121  FCYINDLVLGILELLKHHPRVLYIDIDVHHGDGVEEAFYFTDR  163



>ref|XP_002504208.1| histone deacetylase [Micromonas sp. RCC299]
 gb|ACO65466.1| histone deacetylase [Micromonas sp. RCC299]
Length=430

 Score =   293 bits (749),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 132/186 (71%), Positives = 157/186 (84%), Gaps = 0/186 (0%)
 Frame = +1

Query  79   SKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMELAQ  258
            SKDRI YFYD DVG  Y+G NHPMKPHRL MTHHLVL+Y LH +ME+YRP ++YP+E+ Q
Sbjct  4    SKDRICYFYDSDVGTSYYGNNHPMKPHRLAMTHHLVLSYDLHRRMEVYRPRRSYPVEMTQ  63

Query  259  FHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRLNN  438
            +H+ DYVEFL RITPDT       ++R+NLGEDCP+FD LF+FC++Y GG+ID A RLN+
Sbjct  64   YHAEDYVEFLSRITPDTASEHMQSMQRFNLGEDCPIFDGLFDFCKLYTGGSIDGAVRLNH  123

Query  439  QLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVEEA  618
             + D+AINW+GGLHHAKK EASGFCYINDLVL ILELLK+H RV+YIDID+HHGDGVEEA
Sbjct  124  GMSDIAINWSGGLHHAKKAEASGFCYINDLVLAILELLKHHARVVYIDIDIHHGDGVEEA  183

Query  619  FYFTDR  636
            FY TDR
Sbjct  184  FYMTDR  189



>ref|XP_005652289.1| class I RPD3 type histone deacetylase protein [Coccomyxa subellipsoidea 
C-169]
 gb|EIE27745.1| class I RPD3 type histone deacetylase protein [Coccomyxa subellipsoidea 
C-169]
Length=428

 Score =   291 bits (746),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 130/188 (69%), Positives = 155/188 (82%), Gaps = 0/188 (0%)
 Frame = +1

Query  73   MRSKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMEL  252
            M  K +++YFYD + G +Y+G NHPMKPHRLCMTHHLVLAY LH ++E+YRP  AYPMEL
Sbjct  1    MERKKKVAYFYDSEFGEMYYGANHPMKPHRLCMTHHLVLAYDLHKRLEVYRPRMAYPMEL  60

Query  253  AQFHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRL  432
             QFHS DYV FL R+TPD Q      L ++NLGEDCPVFD L++FC+ YAG +++ A +L
Sbjct  61   MQFHSEDYVNFLARVTPDNQEEMHQQLVQFNLGEDCPVFDGLYDFCRRYAGASVEGAVKL  120

Query  433  NNQLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVE  612
            N +L D+AINW+GGLHHAKK EASGFCY+NDLVLGILELLKYH RVLY+DID+HHGDGVE
Sbjct  121  NQELADIAINWSGGLHHAKKAEASGFCYVNDLVLGILELLKYHARVLYVDIDIHHGDGVE  180

Query  613  EAFYFTDR  636
            EAFY TDR
Sbjct  181  EAFYLTDR  188



>ref|XP_002952849.1| hypothetical protein VOLCADRAFT_62995 [Volvox carteri f. nagariensis]
 gb|EFJ46099.1| hypothetical protein VOLCADRAFT_62995 [Volvox carteri f. nagariensis]
Length=419

 Score =   291 bits (745),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 131/188 (70%), Positives = 157/188 (84%), Gaps = 0/188 (0%)
 Frame = +1

Query  73   MRSKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMEL  252
            M  K++++YFYD +    YFG NHPMKPHRL MTHHLVL YGLH KM+++RP KA+P EL
Sbjct  1    MARKNKVAYFYDSEFQEFYFGQNHPMKPHRLAMTHHLVLGYGLHKKMDVFRPRKAHPAEL  60

Query  253  AQFHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRL  432
            AQFHS DYVEFL ++TPD+   +   L++YN  +DCPVFDN+F+FCQ+YAG +I+ A +L
Sbjct  61   AQFHSEDYVEFLSKVTPDSAAKYANQLRQYNFNDDCPVFDNMFKFCQLYAGASIEGAVKL  120

Query  433  NNQLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVE  612
            N+ LCD+AINW+GGLHHAKK EASGFCY+NDLVL ILELLKYH RVLYIDIDVHHGDGVE
Sbjct  121  NHGLCDIAINWSGGLHHAKKGEASGFCYVNDLVLAILELLKYHARVLYIDIDVHHGDGVE  180

Query  613  EAFYFTDR  636
            EAFY TDR
Sbjct  181  EAFYLTDR  188



>ref|XP_001695812.1| histone deacetylase [Chlamydomonas reinhardtii]
 gb|EDP01149.1| histone deacetylase, partial [Chlamydomonas reinhardtii]
Length=418

 Score =   291 bits (744),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 128/185 (69%), Positives = 158/185 (85%), Gaps = 0/185 (0%)
 Frame = +1

Query  82   KDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMELAQF  261
            K++++YFYD +    YFG NHPMKPHRL MTHHLVL YGLH KM+++RP +A+P ELAQF
Sbjct  6    KNKVAYFYDREFQEFYFGQNHPMKPHRLAMTHHLVLGYGLHKKMDVFRPRRAHPAELAQF  65

Query  262  HSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRLNNQ  441
            H+ DY+EFL ++TPD+   FG  L++YN+ +DCP+FDN+F+FCQ+YAG +I+ A +LN+ 
Sbjct  66   HTEDYIEFLSKVTPDSAAKFGNQLRQYNINDDCPIFDNMFKFCQLYAGASIEGAVKLNHN  125

Query  442  LCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVEEAF  621
            LCD+AINW+GGLHHAKK EASGFCYINDLVL ILELLKYH RVLYIDIDVHHGDGVEEAF
Sbjct  126  LCDIAINWSGGLHHAKKGEASGFCYINDLVLAILELLKYHARVLYIDIDVHHGDGVEEAF  185

Query  622  YFTDR  636
            Y +DR
Sbjct  186  YLSDR  190



>ref|XP_007509129.1| histone deacetylase 3 [Bathycoccus prasinos]
 emb|CCO19586.1| histone deacetylase 3 [Bathycoccus prasinos]
Length=423

 Score =   286 bits (732),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 126/185 (68%), Positives = 155/185 (84%), Gaps = 0/185 (0%)
 Frame = +1

Query  82   KDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMELAQF  261
            K++ISY+YD +VG  Y+ PNHPMKPHRL MTH LVLAY LH  ++++RP KA   ELAQF
Sbjct  5    KNKISYYYDSEVGTSYYAPNHPMKPHRLSMTHSLVLAYRLHENLDVFRPRKATTSELAQF  64

Query  262  HSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRLNNQ  441
            H+ DYV+FL +ITP+TQH +   ++R+NLGEDCP+FD LF+FC+IY+GG+I+ A R+N+ 
Sbjct  65   HAEDYVDFLSKITPNTQHEYLTQMQRFNLGEDCPIFDGLFDFCKIYSGGSIEGAVRINHG  124

Query  442  LCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVEEAF  621
              D+AINW+GGLHHAKK EASGFCYIND+VL  LELLKYH RVLYIDID+HHGDGVEEAF
Sbjct  125  TSDIAINWSGGLHHAKKSEASGFCYINDIVLATLELLKYHARVLYIDIDIHHGDGVEEAF  184

Query  622  YFTDR  636
            Y TDR
Sbjct  185  YLTDR  189



>ref|XP_001744309.1| hypothetical protein [Monosiga brevicollis MX1]
 gb|EDQ91012.1| predicted protein [Monosiga brevicollis MX1]
Length=399

 Score =   283 bits (725),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 125/186 (67%), Positives = 156/186 (84%), Gaps = 0/186 (0%)
 Frame = +1

Query  79   SKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMELAQ  258
            S+ R++YF+D DVGN ++GP HPMKPHRL +TH LVL YGL +KMEI+RP++A P ++ +
Sbjct  2    SRPRVAYFFDADVGNFHYGPGHPMKPHRLALTHSLVLEYGLWSKMEIFRPYRASPEDMGR  61

Query  259  FHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRLNN  438
            FH+ DY+ FL R+TPD    FG  L+R+N+G+DCPVFD +F+FC IYAG +I+ A +LNN
Sbjct  62   FHATDYINFLQRVTPDNYRTFGSYLQRFNVGDDCPVFDGIFDFCSIYAGASIEGAVKLNN  121

Query  439  QLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVEEA  618
            + CDVAINW+GGLHHAKK EASGFCY+ND+VL ILELLK HPRVLYIDID+HHGDGVEEA
Sbjct  122  KQCDVAINWSGGLHHAKKFEASGFCYVNDIVLAILELLKQHPRVLYIDIDIHHGDGVEEA  181

Query  619  FYFTDR  636
            FY TDR
Sbjct  182  FYTTDR  187



>ref|XP_005079687.1| PREDICTED: histone deacetylase 1 [Mesocricetus auratus]
Length=301

 Score =   279 bits (714),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 122/186 (66%), Positives = 151/186 (81%), Gaps = 0/186 (0%)
 Frame = +1

Query  79   SKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMELAQ  258
            +K ++ Y+YDGDVGN Y+G  HPMKPHR+ MTH+L+L YGL+ KMEIYRPHKA   E+ +
Sbjct  7    TKRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTK  66

Query  259  FHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRLNN  438
            +HS DY++FL  I PD    +   ++R+N+GEDCPVFD LFEFCQ+  GG++ +A +LN 
Sbjct  67   YHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVASAVKLNK  126

Query  439  QLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVEEA  618
            Q  D+A+NWAGGLHHAKK EASGFCY+ND+VL ILELLKYH RVLYIDID+HHGDGVEEA
Sbjct  127  QQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEA  186

Query  619  FYFTDR  636
            FY TDR
Sbjct  187  FYTTDR  192



>emb|CEG00983.1| Histone deacetylase superfamily [Ostreococcus tauri]
Length=430

 Score =   283 bits (725),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 126/189 (67%), Positives = 155/189 (82%), Gaps = 0/189 (0%)
 Frame = +1

Query  70   KMRSKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPME  249
             M +KDRI Y+YD +VG  Y+GPNHPMKPHRLCMTH+L+LAY LH  +++YRP ++   E
Sbjct  8    SMVAKDRICYYYDEEVGRNYYGPNHPMKPHRLCMTHNLILAYDLHKHLQVYRPRESTNEE  67

Query  250  LAQFHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARR  429
              QFHS DY+ FL +ITPD Q    ++++R+NLGEDCP+FD++ +FC+ Y GG++D ARR
Sbjct  68   FTQFHSEDYIAFLSKITPDKQQQHVLEMQRFNLGEDCPIFDHMLDFCRRYTGGSVDGARR  127

Query  430  LNNQLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGV  609
            LN  L DVAINW+GGLHHAKK EASGFCY+NDLVL ILELLK+H RVLYIDID+HHGDGV
Sbjct  128  LNQGLSDVAINWSGGLHHAKKSEASGFCYVNDLVLAILELLKHHARVLYIDIDIHHGDGV  187

Query  610  EEAFYFTDR  636
            EEAFY TDR
Sbjct  188  EEAFYVTDR  196



>ref|XP_001869513.1| histone deacetylase [Culex quinquefasciatus]
 gb|EDS29525.1| histone deacetylase [Culex quinquefasciatus]
Length=275

 Score =   276 bits (707),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 124/186 (67%), Positives = 149/186 (80%), Gaps = 0/186 (0%)
 Frame = +1

Query  79   SKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMELAQ  258
            SK R+ Y+YD D+GN Y+G  HPMKPHR+ MTH+L+L YGL+ KMEIYRPHKA   E+ +
Sbjct  5    SKKRVCYYYDSDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATADEMTK  64

Query  259  FHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRLNN  438
            FHS DY+ FL  I PD    +   ++R+N+GEDCPVFD L+EFCQ+ AGG++ AA +LN 
Sbjct  65   FHSDDYIRFLRSIRPDNMSEYNKQMQRFNVGEDCPVFDGLYEFCQLSAGGSVAAAVKLNK  124

Query  439  QLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVEEA  618
            Q  ++ INW GGLHHAKK EASGFCY+ND+VLGILELLKYH RVLYIDIDVHHGDGVEEA
Sbjct  125  QASEICINWGGGLHHAKKSEASGFCYVNDIVLGILELLKYHQRVLYIDIDVHHGDGVEEA  184

Query  619  FYFTDR  636
            FY TDR
Sbjct  185  FYTTDR  190



>gb|ABO26690.1| histone deacetylase 2 [Haliotis discus discus]
Length=258

 Score =   275 bits (703),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 120/190 (63%), Positives = 150/190 (79%), Gaps = 0/190 (0%)
 Frame = +1

Query  67   AKMRSKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPM  246
            A    K ++ Y+YDGD+GN Y+G  HPMKPHR+ MTH+L+L YGL+ KMEIYRPHKA   
Sbjct  2    ASQTHKKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLILNYGLYRKMEIYRPHKATAE  61

Query  247  ELAQFHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAAR  426
            E+ +FHS DY++FL  I PD    +   ++R+N+GEDCPVFD ++EFCQ+  GG++  A 
Sbjct  62   EMTKFHSDDYIKFLRSIRPDNMSEYNKQMQRFNVGEDCPVFDGMYEFCQLSTGGSVAGAV  121

Query  427  RLNNQLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDG  606
            +LN Q  D+A+NWAGGLHHAKK EASGFCY+ND+VL ILELLKYH RVLY+DID+HHGDG
Sbjct  122  KLNKQAADIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYVDIDIHHGDG  181

Query  607  VEEAFYFTDR  636
            VEEAFY TDR
Sbjct  182  VEEAFYTTDR  191



>dbj|BAG61671.1| unnamed protein product [Homo sapiens]
Length=237

 Score =   274 bits (700),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 121/186 (65%), Positives = 151/186 (81%), Gaps = 0/186 (0%)
 Frame = +1

Query  79   SKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMELAQ  258
            ++ ++ Y+YDGDVGN Y+G  HPMKPHR+ MTH+L+L YGL+ KMEIYRPHKA   E+ +
Sbjct  7    TRRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTK  66

Query  259  FHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRLNN  438
            +HS DY++FL  I PD    +   ++R+N+GEDCPVFD LFEFCQ+  GG++ +A +LN 
Sbjct  67   YHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVASAVKLNK  126

Query  439  QLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVEEA  618
            Q  D+A+NWAGGLHHAKK EASGFCY+ND+VL ILELLKYH RVLYIDID+HHGDGVEEA
Sbjct  127  QQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEA  186

Query  619  FYFTDR  636
            FY TDR
Sbjct  187  FYTTDR  192



>ref|NP_001153253.1| histone deacetylase 2 [Pongo abelii]
 emb|CAH92541.1| hypothetical protein [Pongo abelii]
Length=219

 Score =   272 bits (696),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 120/186 (65%), Positives = 149/186 (80%), Gaps = 0/186 (0%)
 Frame = +1

Query  79   SKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMELAQ  258
             K ++ Y+YDGD+GN Y+G  HPMKPHR+ MTH+L+L YGL+ KMEIYRPHKA   E+ +
Sbjct  8    GKKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATAEEMTK  67

Query  259  FHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRLNN  438
            +HS +Y++FL  I PD    +   ++R+N+GEDCPVFD LFEFCQ+  GG++  A +LN 
Sbjct  68   YHSDEYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAGAVKLNR  127

Query  439  QLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVEEA  618
            Q  D+A+NWAGGLHHAKK EASGFCY+ND+VL ILELLKYH RVLYIDID+HHGDGVEEA
Sbjct  128  QQTDMAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEA  187

Query  619  FYFTDR  636
            FY TDR
Sbjct  188  FYTTDR  193



>ref|XP_001416403.1| histone deacetylase, probable [Ostreococcus lucimarinus CCE9901]
 gb|ABO94696.1| histone deacetylase, probable [Ostreococcus lucimarinus CCE9901]
Length=424

 Score =   279 bits (713),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 122/188 (65%), Positives = 153/188 (81%), Gaps = 0/188 (0%)
 Frame = +1

Query  73   MRSKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMEL  252
            M +K+R+ Y+YD +VG  Y+GPNHPMKPHRLCMTH+L+LAY LH  ++++RP      E 
Sbjct  1    MVAKERVCYYYDEEVGRNYYGPNHPMKPHRLCMTHNLILAYDLHKHLQVFRPRACTNTEF  60

Query  253  AQFHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRL  432
             QFHS DYV+FL +ITPD Q  + ++++R+NLGEDCP+FD++ +FC+ Y GG+ID  RRL
Sbjct  61   TQFHSEDYVDFLSKITPDKQQQYVLEMQRFNLGEDCPIFDHMLDFCRRYTGGSIDGVRRL  120

Query  433  NNQLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVE  612
            N  + D+AINW+GGLHHAKK EASGFCYINDLVL ILELLK H RV+YIDID+HHGDGVE
Sbjct  121  NQGVSDIAINWSGGLHHAKKAEASGFCYINDLVLAILELLKQHARVVYIDIDIHHGDGVE  180

Query  613  EAFYFTDR  636
            EAFY TDR
Sbjct  181  EAFYMTDR  188



>ref|XP_010775614.1| PREDICTED: probable histone deacetylase 1-B [Notothenia coriiceps]
Length=362

 Score =   276 bits (707),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 123/186 (66%), Positives = 150/186 (81%), Gaps = 0/186 (0%)
 Frame = +1

Query  79   SKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMELAQ  258
            +K ++ Y+YDGDVGN Y+G  HPMKPHR+ MTH+L+L YGL+ KMEIYRPHKA   E+ +
Sbjct  7    TKKKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKASGEEMTK  66

Query  259  FHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRLNN  438
            +HS DY++FL  I PD    +   ++R+N+GEDCPVFD LFEFCQ+  GG++  A +LN 
Sbjct  67   YHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAGALKLNK  126

Query  439  QLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVEEA  618
            Q  D+AINWAGGLHHAKK EASGFCY+ND+VL ILELLKYH RVLYIDID+HHGDGVEEA
Sbjct  127  QQTDIAINWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEA  186

Query  619  FYFTDR  636
            FY TDR
Sbjct  187  FYTTDR  192



>emb|CDQ96434.1| unnamed protein product [Oncorhynchus mykiss]
Length=232

 Score =   272 bits (695),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 122/186 (66%), Positives = 149/186 (80%), Gaps = 0/186 (0%)
 Frame = +1

Query  79   SKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMELAQ  258
            +K ++ Y+YDGDVGN Y+G  HPMKPHR+ MTH+L+L YGL+ KMEIYRPHKA   E+ +
Sbjct  9    TKKKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKASGEEMTK  68

Query  259  FHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRLNN  438
            +HS DY++FL  I PD        ++R+N+GEDCPVFD LFEFCQ+  GG++  A +LN 
Sbjct  69   YHSDDYIKFLRTIRPDNMSEHSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAGAVKLNK  128

Query  439  QLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVEEA  618
            Q  D+AINWAGGLHHAKK EASGFCY+ND+VL ILELLKYH RVLYIDID+HHGDGVEEA
Sbjct  129  QQTDIAINWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEA  188

Query  619  FYFTDR  636
            F+ TDR
Sbjct  189  FFTTDR  194



>ref|XP_007093839.1| PREDICTED: histone deacetylase 1-like [Panthera tigris altaica]
Length=379

 Score =   276 bits (707),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 121/186 (65%), Positives = 152/186 (82%), Gaps = 0/186 (0%)
 Frame = +1

Query  79   SKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMELAQ  258
            ++ ++ Y+YDGDVGN Y+G  HPMKPHR+ MTH+L+L YGL+ KMEIYRPHKA   E+ +
Sbjct  7    TRRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTK  66

Query  259  FHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRLNN  438
            +HS DY++FL  I PD+   +   ++R+N+GEDCPVFD LFEFCQ+  GG++ +A +LN 
Sbjct  67   YHSDDYIKFLRSIRPDSMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVASAVKLNK  126

Query  439  QLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVEEA  618
            Q  D+A+NWAGGLHHAKK EASGFCY+ND+VL ILELLKYH RVLYIDID+HHGDGVEEA
Sbjct  127  QQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEA  186

Query  619  FYFTDR  636
            FY TDR
Sbjct  187  FYTTDR  192



>ref|XP_001742912.1| hypothetical protein [Monosiga brevicollis MX1]
 gb|EDQ93150.1| predicted protein [Monosiga brevicollis MX1]
Length=462

 Score =   279 bits (713),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 127/188 (68%), Positives = 153/188 (81%), Gaps = 0/188 (0%)
 Frame = +1

Query  73   MRSKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMEL  252
            M SK  +SY+YDGDVGN Y+GP HPMKPHR+ MTH+L+L YGL+ KMEIYRPHKA   ++
Sbjct  1    MASKKHVSYYYDGDVGNYYYGPGHPMKPHRIRMTHNLLLNYGLYKKMEIYRPHKASMEDM  60

Query  253  AQFHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRL  432
             +FHS DY+ FL  I+PD  +    ++ R+N+GEDCPVFD LFEFCQI AGG++  A +L
Sbjct  61   TRFHSDDYINFLRTISPDATNEETKNMSRFNVGEDCPVFDGLFEFCQISAGGSLAGAAKL  120

Query  433  NNQLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVE  612
            N+Q  D+ INWAGGLHHAK+ EASGFCY+ND+VLGILELLK H RVLYIDID+HHGDGVE
Sbjct  121  NSQQSDICINWAGGLHHAKRSEASGFCYVNDIVLGILELLKRHERVLYIDIDIHHGDGVE  180

Query  613  EAFYFTDR  636
            EAFY TDR
Sbjct  181  EAFYCTDR  188



>ref|XP_004368317.1| histone deacetylase 1, putative [Acanthamoeba castellanii str. 
Neff]
 gb|ELR25562.1| histone deacetylase 1, putative [Acanthamoeba castellanii str. 
Neff]
Length=328

 Score =   274 bits (701),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 127/186 (68%), Positives = 152/186 (82%), Gaps = 0/186 (0%)
 Frame = +1

Query  79   SKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMELAQ  258
            SK RI YFYDGDVGN Y+G  HPMKPHR+ MTH+L+L YGL+ +M+IYRP  A   E+AQ
Sbjct  2    SKQRICYFYDGDVGNYYYGNGHPMKPHRIRMTHNLLLNYGLYKQMKIYRPRHATKQEMAQ  61

Query  259  FHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRLNN  438
            FH+ DYV+FL  ITPD  + +   L+R+N+GEDCPVFD +++FCQI +GG+I  A +LN+
Sbjct  62   FHAEDYVKFLRLITPDNMNEYTKQLQRFNVGEDCPVFDGMYQFCQISSGGSIGGAVKLNH  121

Query  439  QLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVEEA  618
               D+AINWAGGLHHAKK EASGFCYIND+VL ILELLKYH RVLYIDID+HHGDGVEEA
Sbjct  122  GESDIAINWAGGLHHAKKSEASGFCYINDIVLAILELLKYHARVLYIDIDIHHGDGVEEA  181

Query  619  FYFTDR  636
            FY TDR
Sbjct  182  FYTTDR  187



>ref|XP_005318149.1| PREDICTED: histone deacetylase 1 [Ictidomys tridecemlineatus]
Length=399

 Score =   276 bits (706),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 121/186 (65%), Positives = 151/186 (81%), Gaps = 0/186 (0%)
 Frame = +1

Query  79   SKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMELAQ  258
            ++ ++ Y+YDGDVGN Y+G  HPMKPHR+ MTH+L+L YGL+ KMEIYRPHKA   E+ +
Sbjct  7    TRRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTK  66

Query  259  FHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRLNN  438
            +HS DY++FL  I PD    +   ++R+N+GEDCPVFD LFEFCQ+  GG++ +A +LN 
Sbjct  67   YHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVASAVKLNK  126

Query  439  QLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVEEA  618
            Q  D+A+NWAGGLHHAKK EASGFCY+ND+VL ILELLKYH RVLYIDID+HHGDGVEEA
Sbjct  127  QQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEA  186

Query  619  FYFTDR  636
            FY TDR
Sbjct  187  FYTTDR  192



>gb|ABN81193.1| histone deacetylase 1 [Schistosoma mansoni]
Length=517

 Score =   280 bits (715),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 123/186 (66%), Positives = 152/186 (82%), Gaps = 0/186 (0%)
 Frame = +1

Query  79   SKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMELAQ  258
            +  ++ Y+YDGD+GN Y+G  HPMKPHR+ MTH+L+L YGL+ KME+YRP KAY  ++ +
Sbjct  5    TNKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEVYRPSKAYSEDMTR  64

Query  259  FHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRLNN  438
            FHS +YV+FL  + PD  H F   ++R+N+GEDCPVFD LFEFCQ+ AGG+I AA +LN 
Sbjct  65   FHSDEYVKFLKNVRPDNMHEFNKQMQRFNVGEDCPVFDGLFEFCQLSAGGSIAAAVKLNK  124

Query  439  QLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVEEA  618
            Q  D+AINW GGLHHAKK EASGFCYIND+V+GILELLKYH RVLY+DID+HHGDGVEEA
Sbjct  125  QQTDIAINWGGGLHHAKKSEASGFCYINDIVIGILELLKYHQRVLYVDIDIHHGDGVEEA  184

Query  619  FYFTDR  636
            FY TDR
Sbjct  185  FYTTDR  190



>ref|XP_005746257.1| PREDICTED: probable histone deacetylase 1-B-like [Pundamilia 
nyererei]
Length=432

 Score =   277 bits (708),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 121/186 (65%), Positives = 150/186 (81%), Gaps = 0/186 (0%)
 Frame = +1

Query  79   SKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMELAQ  258
            +K ++ Y+YDGD+GN Y+G  HPMKPHR+ MTH+L+L YGL+ KME+YRPHKA   E+ +
Sbjct  9    TKKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEVYRPHKATADEMTK  68

Query  259  FHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRLNN  438
            +HS DY++FL  I PD    F   ++R+N+GEDCPVFD LFEFCQ+ AGG+   + +LN 
Sbjct  69   YHSDDYIKFLRSIRPDNMSEFSKQMQRFNVGEDCPVFDGLFEFCQLSAGGSAAGSVKLNR  128

Query  439  QLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVEEA  618
            Q  D+A+NWAGGLHHAKK EASGFCY+ND+VL ILELLKYH RVLYIDID+HHGDGVEEA
Sbjct  129  QQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEA  188

Query  619  FYFTDR  636
            FY TDR
Sbjct  189  FYTTDR  194



>gb|AAH85375.1| Histone deacetylase 1 [Danio rerio]
 gb|AAI65208.1| Hdac1 protein [Danio rerio]
Length=480

 Score =   278 bits (712),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 124/186 (67%), Positives = 151/186 (81%), Gaps = 0/186 (0%)
 Frame = +1

Query  79   SKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMELAQ  258
            +K ++ Y+YDGDVGN Y+G  HPMKPHR+ MTH+L+L YGL+ KMEIYRPHKA   E+ +
Sbjct  8    TKKKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTK  67

Query  259  FHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRLNN  438
            +HS DY++FL  I PD    +   ++R+N+GEDCPVFD LFEFCQ+ AGG++  A +LN 
Sbjct  68   YHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSAGGSVAGAVKLNK  127

Query  439  QLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVEEA  618
            Q  D+AINWAGGLHHAKK EASGFCY+ND+VL ILELLKYH RVLYIDID+HHGDGVEEA
Sbjct  128  QQTDIAINWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEA  187

Query  619  FYFTDR  636
            FY TDR
Sbjct  188  FYTTDR  193



>ref|XP_005302255.1| PREDICTED: histone deacetylase 1 [Chrysemys picta bellii]
 ref|XP_007067627.1| PREDICTED: histone deacetylase 1 [Chelonia mydas]
Length=480

 Score =   278 bits (711),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 123/186 (66%), Positives = 152/186 (82%), Gaps = 0/186 (0%)
 Frame = +1

Query  79   SKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMELAQ  258
            +K ++ Y+YDGDVGN Y+G  HPMKPHR+ MTH+L+L YGL+ KMEIYRPHKA   E+ +
Sbjct  7    TKRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTK  66

Query  259  FHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRLNN  438
            +HS DY++FL  I PD    +   ++R+N+GEDCPVFD LFEFCQ+ AGG++ +A +LN 
Sbjct  67   YHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSAGGSVASAVKLNK  126

Query  439  QLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVEEA  618
            Q  D+A+NWAGGLHHAKK EASGFCY+ND+VL ILELLKYH RVLYIDID+HHGDGVEEA
Sbjct  127  QQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEA  186

Query  619  FYFTDR  636
            FY TDR
Sbjct  187  FYTTDR  192



>gb|ACO11145.1| Histone deacetylase 1 [Caligus rogercresseyi]
Length=322

 Score =   273 bits (698),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 122/186 (66%), Positives = 149/186 (80%), Gaps = 0/186 (0%)
 Frame = +1

Query  79   SKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMELAQ  258
            S+ +I Y+YD D+GN Y+G  HPMKPHR+ MTH+L+L YGL+ KMEIYRPHKA   E+ +
Sbjct  8    SRKKICYYYDSDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATQEEMTK  67

Query  259  FHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRLNN  438
            FHS DY+ FL  I PD    +   ++R+N+GEDCPVFD L+EFCQ+  GG++ +A +LN 
Sbjct  68   FHSDDYIRFLRSIRPDNMSEYNKQMQRFNVGEDCPVFDGLYEFCQLSGGGSVASAVKLNK  127

Query  439  QLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVEEA  618
            Q  D+AINWAGGLHHAKK EASGFCY+ND+VL ILELLKYH RVLYIDID+HHGDGVEEA
Sbjct  128  QAADIAINWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEA  187

Query  619  FYFTDR  636
            FY TDR
Sbjct  188  FYTTDR  193



>ref|XP_003415511.1| PREDICTED: histone deacetylase 1 [Loxodonta africana]
Length=482

 Score =   278 bits (711),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 123/186 (66%), Positives = 152/186 (82%), Gaps = 0/186 (0%)
 Frame = +1

Query  79   SKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMELAQ  258
            +K ++ Y+YDGDVGN Y+G  HPMKPHR+ MTH+L+L YGL+ KMEIYRPHKA   E+ +
Sbjct  7    TKRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTK  66

Query  259  FHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRLNN  438
            +HS DY++FL  I PD    +   ++R+N+GEDCPVFD LFEFCQ+ AGG++ +A +LN 
Sbjct  67   YHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSAGGSVASAVKLNK  126

Query  439  QLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVEEA  618
            Q  D+A+NWAGGLHHAKK EASGFCY+ND+VL ILELLKYH RVLYIDID+HHGDGVEEA
Sbjct  127  QQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEA  186

Query  619  FYFTDR  636
            FY TDR
Sbjct  187  FYTTDR  192



>ref|XP_005477687.1| PREDICTED: probable histone deacetylase 1-B-like isoform X2 [Oreochromis 
niloticus]
Length=484

 Score =   278 bits (711),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 124/186 (67%), Positives = 151/186 (81%), Gaps = 0/186 (0%)
 Frame = +1

Query  79   SKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMELAQ  258
            +K ++ Y+YDGDVGN Y+G  HPMKPHR+ MTH+L+L YGL+ KMEIYRPHKA   E+ +
Sbjct  8    TKKKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKASGEEMTK  67

Query  259  FHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRLNN  438
            +HS DY++FL  I PD    +   ++R+N+GEDCPVFD LFEFCQ+ AGG++  A +LN 
Sbjct  68   YHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSAGGSVAGAVKLNK  127

Query  439  QLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVEEA  618
            Q  D+AINWAGGLHHAKK EASGFCY+ND+VL ILELLKYH RVLYIDID+HHGDGVEEA
Sbjct  128  QQTDIAINWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEA  187

Query  619  FYFTDR  636
            FY TDR
Sbjct  188  FYTTDR  193



>ref|XP_006274872.1| PREDICTED: histone deacetylase 1 isoform X1 [Alligator mississippiensis]
Length=480

 Score =   278 bits (711),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 123/186 (66%), Positives = 152/186 (82%), Gaps = 0/186 (0%)
 Frame = +1

Query  79   SKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMELAQ  258
            +K ++ Y+YDGDVGN Y+G  HPMKPHR+ MTH+L+L YGL+ KMEIYRPHKA   E+ +
Sbjct  7    TKRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTK  66

Query  259  FHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRLNN  438
            +HS DY++FL  I PD    +   ++R+N+GEDCPVFD LFEFCQ+ AGG++ +A +LN 
Sbjct  67   YHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSAGGSVASAVKLNK  126

Query  439  QLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVEEA  618
            Q  D+A+NWAGGLHHAKK EASGFCY+ND+VL ILELLKYH RVLYIDID+HHGDGVEEA
Sbjct  127  QQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEA  186

Query  619  FYFTDR  636
            FY TDR
Sbjct  187  FYTTDR  192



>gb|AAB99850.1| histone deacetylase 1 [Gallus gallus]
Length=480

 Score =   278 bits (711),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 123/186 (66%), Positives = 152/186 (82%), Gaps = 0/186 (0%)
 Frame = +1

Query  79   SKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMELAQ  258
            +K ++ Y+YDGDVGN Y+G  HPMKPHR+ MTH+L+L YGL+ KMEIYRPHKA   E+ +
Sbjct  7    TKRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTK  66

Query  259  FHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRLNN  438
            +HS DY++FL  I PD    +   ++R+N+GEDCPVFD LFEFCQ+ AGG++ +A +LN 
Sbjct  67   YHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSAGGSVASAVKLNK  126

Query  439  QLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVEEA  618
            Q  D+A+NWAGGLHHAKK EASGFCY+ND+VL ILELLKYH RVLYIDID+HHGDGVEEA
Sbjct  127  QQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEA  186

Query  619  FYFTDR  636
            FY TDR
Sbjct  187  FYTTDR  192



>ref|XP_005529817.1| PREDICTED: histone deacetylase 1 [Pseudopodoces humilis]
Length=482

 Score =   278 bits (711),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 123/186 (66%), Positives = 152/186 (82%), Gaps = 0/186 (0%)
 Frame = +1

Query  79   SKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMELAQ  258
            +K ++ Y+YDGDVGN Y+G  HPMKPHR+ MTH+L+L YGL+ KMEIYRPHKA   E+ +
Sbjct  7    TKRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTK  66

Query  259  FHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRLNN  438
            +HS DY++FL  I PD    +   ++R+N+GEDCPVFD LFEFCQ+ AGG++ +A +LN 
Sbjct  67   YHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSAGGSVASAVKLNK  126

Query  439  QLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVEEA  618
            Q  D+A+NWAGGLHHAKK EASGFCY+ND+VL ILELLKYH RVLYIDID+HHGDGVEEA
Sbjct  127  QQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEA  186

Query  619  FYFTDR  636
            FY TDR
Sbjct  187  FYTTDR  192



>ref|NP_989487.1| histone deacetylase 1 [Gallus gallus]
 sp|P56517.1|HDAC1_CHICK RecName: Full=Histone deacetylase 1; Short=HD1 [Gallus gallus]
 gb|AAB96923.1| histone deacetylase-1 [Gallus gallus]
 gb|AAC00504.1| erythrocyte histone deacetylase [Gallus gallus]
Length=480

 Score =   278 bits (711),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 123/186 (66%), Positives = 152/186 (82%), Gaps = 0/186 (0%)
 Frame = +1

Query  79   SKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMELAQ  258
            +K ++ Y+YDGDVGN Y+G  HPMKPHR+ MTH+L+L YGL+ KMEIYRPHKA   E+ +
Sbjct  7    TKRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTK  66

Query  259  FHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRLNN  438
            +HS DY++FL  I PD    +   ++R+N+GEDCPVFD LFEFCQ+ AGG++ +A +LN 
Sbjct  67   YHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSAGGSVASAVKLNK  126

Query  439  QLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVEEA  618
            Q  D+A+NWAGGLHHAKK EASGFCY+ND+VL ILELLKYH RVLYIDID+HHGDGVEEA
Sbjct  127  QQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEA  186

Query  619  FYFTDR  636
            FY TDR
Sbjct  187  FYTTDR  192



>ref|XP_003446230.1| PREDICTED: probable histone deacetylase 1-B-like isoform X1 [Oreochromis 
niloticus]
Length=490

 Score =   278 bits (711),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 124/186 (67%), Positives = 151/186 (81%), Gaps = 0/186 (0%)
 Frame = +1

Query  79   SKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMELAQ  258
            +K ++ Y+YDGDVGN Y+G  HPMKPHR+ MTH+L+L YGL+ KMEIYRPHKA   E+ +
Sbjct  8    TKKKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKASGEEMTK  67

Query  259  FHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRLNN  438
            +HS DY++FL  I PD    +   ++R+N+GEDCPVFD LFEFCQ+ AGG++  A +LN 
Sbjct  68   YHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSAGGSVAGAVKLNK  127

Query  439  QLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVEEA  618
            Q  D+AINWAGGLHHAKK EASGFCY+ND+VL ILELLKYH RVLYIDID+HHGDGVEEA
Sbjct  128  QQTDIAINWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEA  187

Query  619  FYFTDR  636
            FY TDR
Sbjct  188  FYTTDR  193



>ref|XP_010877523.1| PREDICTED: histone deacetylase 1 isoform X2 [Esox lucius]
Length=486

 Score =   278 bits (711),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 124/186 (67%), Positives = 151/186 (81%), Gaps = 0/186 (0%)
 Frame = +1

Query  79   SKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMELAQ  258
            +K ++ Y+YDGDVGN Y+G  HPMKPHR+ MTH+L+L YGL+ KMEIYRPHKA   E+ +
Sbjct  8    TKKKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANGEEMTK  67

Query  259  FHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRLNN  438
            +HS DY++FL  I PD    +   ++R+N+GEDCPVFD LFEFCQ+ AGG++  A +LN 
Sbjct  68   YHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSAGGSVAGAVKLNK  127

Query  439  QLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVEEA  618
            Q  D+AINWAGGLHHAKK EASGFCY+ND+VL ILELLKYH RVLYIDID+HHGDGVEEA
Sbjct  128  QQTDIAINWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEA  187

Query  619  FYFTDR  636
            FY TDR
Sbjct  188  FYTTDR  193



>ref|XP_002194370.2| PREDICTED: histone deacetylase 1, partial [Taeniopygia guttata]
Length=466

 Score =   277 bits (709),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 123/186 (66%), Positives = 152/186 (82%), Gaps = 0/186 (0%)
 Frame = +1

Query  79   SKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMELAQ  258
            +K ++ Y+YDGDVGN Y+G  HPMKPHR+ MTH+L+L YGL+ KMEIYRPHKA   E+ +
Sbjct  7    TKRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTK  66

Query  259  FHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRLNN  438
            +HS DY++FL  I PD    +   ++R+N+GEDCPVFD LFEFCQ+ AGG++ +A +LN 
Sbjct  67   YHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSAGGSVASAVKLNK  126

Query  439  QLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVEEA  618
            Q  D+A+NWAGGLHHAKK EASGFCY+ND+VL ILELLKYH RVLYIDID+HHGDGVEEA
Sbjct  127  QQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEA  186

Query  619  FYFTDR  636
            FY TDR
Sbjct  187  FYTTDR  192



>ref|XP_003397521.1| PREDICTED: hypothetical protein LOC100642763 [Bombus terrestris]
Length=1431

 Score =   292 bits (747),  Expect = 1e-86, Method: Composition-based stats.
 Identities = 124/186 (67%), Positives = 149/186 (80%), Gaps = 0/186 (0%)
 Frame = +1

Query  79   SKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMELAQ  258
            SK R+ Y+YD D+GN Y+G  HPMKPHR+ MTH+L+L YGL+ KMEIYRPHKA   E+ +
Sbjct  7    SKKRVCYYYDSDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATADEMTK  66

Query  259  FHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRLNN  438
            FHS DY+ FL  I PD    +   ++R+N+GEDCPVFD L+EFCQ+ AGG++ AA +LN 
Sbjct  67   FHSDDYIRFLRSIRPDNMSEYNKQMQRFNVGEDCPVFDGLYEFCQLSAGGSVAAAVKLNK  126

Query  439  QLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVEEA  618
            Q  ++ INW GGLHHAKK EASGFCY+ND+VLGILELLKYH RVLYIDIDVHHGDGVEEA
Sbjct  127  QASEICINWGGGLHHAKKSEASGFCYVNDIVLGILELLKYHQRVLYIDIDVHHGDGVEEA  186

Query  619  FYFTDR  636
            FY TDR
Sbjct  187  FYTTDR  192



>ref|XP_008282430.1| PREDICTED: histone deacetylase 1 [Stegastes partitus]
Length=490

 Score =   278 bits (711),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 124/186 (67%), Positives = 151/186 (81%), Gaps = 0/186 (0%)
 Frame = +1

Query  79   SKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMELAQ  258
            +K ++ Y+YDGDVGN Y+G  HPMKPHR+ MTH+L+L YGL+ KMEIYRPHKA   E+ +
Sbjct  8    TKKKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKASGEEMTK  67

Query  259  FHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRLNN  438
            +HS DY++FL  I PD    +   ++R+N+GEDCPVFD LFEFCQ+ AGG++  A +LN 
Sbjct  68   YHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSAGGSVAGAVKLNK  127

Query  439  QLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVEEA  618
            Q  D+AINWAGGLHHAKK EASGFCY+ND+VL ILELLKYH RVLYIDID+HHGDGVEEA
Sbjct  128  QQTDIAINWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEA  187

Query  619  FYFTDR  636
            FY TDR
Sbjct  188  FYTTDR  193



>ref|XP_011488824.1| PREDICTED: histone deacetylase 1 isoform X1 [Oryzias latipes]
Length=482

 Score =   278 bits (710),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 124/186 (67%), Positives = 151/186 (81%), Gaps = 0/186 (0%)
 Frame = +1

Query  79   SKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMELAQ  258
            +K ++ Y+YDGDVGN Y+G  HPMKPHR+ MTH+L+L YGL+ KMEIYRPHKA   E+ +
Sbjct  8    TKKKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKASGEEMTK  67

Query  259  FHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRLNN  438
            +HS DY++FL  I PD    +   ++R+N+GEDCPVFD LFEFCQ+ AGG++  A +LN 
Sbjct  68   YHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSAGGSVAGAVKLNK  127

Query  439  QLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVEEA  618
            Q  D+AINWAGGLHHAKK EASGFCY+ND+VL ILELLKYH RVLYIDID+HHGDGVEEA
Sbjct  128  QQTDIAINWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEA  187

Query  619  FYFTDR  636
            FY TDR
Sbjct  188  FYTTDR  193



>ref|XP_004083964.1| PREDICTED: histone deacetylase 2 [Oryzias latipes]
Length=489

 Score =   278 bits (711),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 124/186 (67%), Positives = 150/186 (81%), Gaps = 0/186 (0%)
 Frame = +1

Query  79   SKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMELAQ  258
            +K ++ Y+YDGDVGN Y+G  HPMKPHR+ MTH+L+L YGL+ KMEIYRPHKA   E+ +
Sbjct  9    TKKKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATADEMTK  68

Query  259  FHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRLNN  438
            +HS DY++FL  I PD    F   ++R+N+GEDCPVFD LFEFCQ+ AGG+   A +LN 
Sbjct  69   YHSDDYIKFLRSIRPDNMSEFSKQMQRFNVGEDCPVFDGLFEFCQLSAGGSAAGAVKLNR  128

Query  439  QLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVEEA  618
            Q  D+A+NWAGGLHHAKK EASGFCY+ND+VL ILELLKYH RVLYIDID+HHGDGVEEA
Sbjct  129  QQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEA  188

Query  619  FYFTDR  636
            FY TDR
Sbjct  189  FYTTDR  194



>ref|XP_004082433.1| PREDICTED: histone deacetylase 1 isoform X2 [Oryzias latipes]
Length=476

 Score =   278 bits (710),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 124/186 (67%), Positives = 151/186 (81%), Gaps = 0/186 (0%)
 Frame = +1

Query  79   SKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMELAQ  258
            +K ++ Y+YDGDVGN Y+G  HPMKPHR+ MTH+L+L YGL+ KMEIYRPHKA   E+ +
Sbjct  8    TKKKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKASGEEMTK  67

Query  259  FHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRLNN  438
            +HS DY++FL  I PD    +   ++R+N+GEDCPVFD LFEFCQ+ AGG++  A +LN 
Sbjct  68   YHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSAGGSVAGAVKLNK  127

Query  439  QLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVEEA  618
            Q  D+AINWAGGLHHAKK EASGFCY+ND+VL ILELLKYH RVLYIDID+HHGDGVEEA
Sbjct  128  QQTDIAINWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEA  187

Query  619  FYFTDR  636
            FY TDR
Sbjct  188  FYTTDR  193



>ref|XP_002680769.1| histone deacetylase [Naegleria gruberi]
 gb|EFC48025.1| histone deacetylase [Naegleria gruberi]
Length=421

 Score =   276 bits (705),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 128/188 (68%), Positives = 153/188 (81%), Gaps = 0/188 (0%)
 Frame = +1

Query  73   MRSKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMEL  252
            M     ISYFYDGDVGN Y+G  HPMKPHR+ MTH+L+L YGL+  +E+YRPH A  +E+
Sbjct  1    MPKHQNISYFYDGDVGNYYYGQGHPMKPHRIKMTHNLLLNYGLYKHLEVYRPHPASEVEM  60

Query  253  AQFHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRL  432
             +FH+ +YVEFL R+TPD  H F   L+ +N+GEDCPVFD LFEFC++ AGG+I AA +L
Sbjct  61   CKFHADEYVEFLKRVTPDNMHDFQKQLQAFNVGEDCPVFDGLFEFCKLSAGGSIGAAVKL  120

Query  433  NNQLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVE  612
            N++  D+AINWAGGLHHAKK EASGFCYIND+VL ILELLKYH RVLYIDID+HHGDGVE
Sbjct  121  NHEQSDIAINWAGGLHHAKKNEASGFCYINDIVLAILELLKYHARVLYIDIDIHHGDGVE  180

Query  613  EAFYFTDR  636
            EAFY TDR
Sbjct  181  EAFYTTDR  188



>ref|XP_009096801.1| PREDICTED: histone deacetylase 1 [Serinus canaria]
Length=475

 Score =   277 bits (709),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 123/186 (66%), Positives = 152/186 (82%), Gaps = 0/186 (0%)
 Frame = +1

Query  79   SKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMELAQ  258
            +K ++ Y+YDGDVGN Y+G  HPMKPHR+ MTH+L+L YGL+ KMEIYRPHKA   E+ +
Sbjct  7    TKRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTK  66

Query  259  FHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRLNN  438
            +HS DY++FL  I PD    +   ++R+N+GEDCPVFD LFEFCQ+ AGG++ +A +LN 
Sbjct  67   YHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSAGGSVASAVKLNK  126

Query  439  QLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVEEA  618
            Q  D+A+NWAGGLHHAKK EASGFCY+ND+VL ILELLKYH RVLYIDID+HHGDGVEEA
Sbjct  127  QQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEA  186

Query  619  FYFTDR  636
            FY TDR
Sbjct  187  FYTTDR  192



>ref|XP_006019411.1| PREDICTED: histone deacetylase 1 isoform X1 [Alligator sinensis]
 ref|XP_006019412.1| PREDICTED: histone deacetylase 1 isoform X2 [Alligator sinensis]
 ref|XP_006019413.1| PREDICTED: histone deacetylase 1 isoform X3 [Alligator sinensis]
 ref|XP_006019414.1| PREDICTED: histone deacetylase 1 isoform X4 [Alligator sinensis]
 ref|XP_006019415.1| PREDICTED: histone deacetylase 1 isoform X5 [Alligator sinensis]
 ref|XP_006019416.1| PREDICTED: histone deacetylase 1 isoform X6 [Alligator sinensis]
Length=480

 Score =   278 bits (710),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 123/186 (66%), Positives = 152/186 (82%), Gaps = 0/186 (0%)
 Frame = +1

Query  79   SKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMELAQ  258
            +K ++ Y+YDGDVGN Y+G  HPMKPHR+ MTH+L+L YGL+ KMEIYRPHKA   E+ +
Sbjct  7    TKRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLYYGLYRKMEIYRPHKANAEEMTK  66

Query  259  FHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRLNN  438
            +HS DY++FL  I PD    +   ++R+N+GEDCPVFD LFEFCQ+ AGG++ +A +LN 
Sbjct  67   YHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSAGGSVASAVKLNK  126

Query  439  QLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVEEA  618
            Q  D+A+NWAGGLHHAKK EASGFCY+ND+VL ILELLKYH RVLYIDID+HHGDGVEEA
Sbjct  127  QQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEA  186

Query  619  FYFTDR  636
            FY TDR
Sbjct  187  FYTTDR  192



>ref|XP_010877522.1| PREDICTED: histone deacetylase 1 isoform X1 [Esox lucius]
Length=502

 Score =   278 bits (711),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 124/186 (67%), Positives = 151/186 (81%), Gaps = 0/186 (0%)
 Frame = +1

Query  79   SKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMELAQ  258
            +K ++ Y+YDGDVGN Y+G  HPMKPHR+ MTH+L+L YGL+ KMEIYRPHKA   E+ +
Sbjct  8    TKKKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANGEEMTK  67

Query  259  FHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRLNN  438
            +HS DY++FL  I PD    +   ++R+N+GEDCPVFD LFEFCQ+ AGG++  A +LN 
Sbjct  68   YHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSAGGSVAGAVKLNK  127

Query  439  QLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVEEA  618
            Q  D+AINWAGGLHHAKK EASGFCY+ND+VL ILELLKYH RVLYIDID+HHGDGVEEA
Sbjct  128  QQTDIAINWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEA  187

Query  619  FYFTDR  636
            FY TDR
Sbjct  188  FYTTDR  193



>ref|XP_006631299.1| PREDICTED: histone deacetylase 1-like [Lepisosteus oculatus]
Length=480

 Score =   277 bits (709),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 123/186 (66%), Positives = 150/186 (81%), Gaps = 0/186 (0%)
 Frame = +1

Query  79   SKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMELAQ  258
            +K ++ Y+YDGDVGN Y+G  HPMKPHR+ MTH+L+L YGL+ KMEIYRPHKA   E+ +
Sbjct  7    TKKKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTK  66

Query  259  FHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRLNN  438
            +HS DY++FL  I PD    +   ++R+N+GEDCPVFD LFEFCQ+  GG++  A +LN 
Sbjct  67   YHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAGAVKLNK  126

Query  439  QLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVEEA  618
            Q  D+AINWAGGLHHAKK EASGFCY+ND+VL ILELLKYH RVLYIDID+HHGDGVEEA
Sbjct  127  QQTDIAINWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEA  186

Query  619  FYFTDR  636
            FY TDR
Sbjct  187  FYTTDR  192



>gb|AAH64650.1| Hdac1 protein [Danio rerio]
Length=457

 Score =   276 bits (707),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 123/186 (66%), Positives = 150/186 (81%), Gaps = 0/186 (0%)
 Frame = +1

Query  79   SKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMELAQ  258
            +K ++ Y+YDGDVGN Y+G  HPMKPHR+ MTH+L+L YGL+ KMEIYRPHKA   E+ +
Sbjct  8    TKKKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTK  67

Query  259  FHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRLNN  438
            +HS DY++FL  I PD    +   ++R+N+GEDCPVFD LFEFCQ+  GG++  A +LN 
Sbjct  68   YHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAGAVKLNK  127

Query  439  QLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVEEA  618
            Q  D+AINWAGGLHHAKK EASGFCY+ND+VL ILELLKYH RVLYIDID+HHGDGVEEA
Sbjct  128  QQTDIAINWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEA  187

Query  619  FYFTDR  636
            FY TDR
Sbjct  188  FYTTDR  193



>emb|CAX72896.1| histone deacetylase 1/2 [Schistosoma japonicum]
Length=537

 Score =   279 bits (713),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 124/183 (68%), Positives = 151/183 (83%), Gaps = 0/183 (0%)
 Frame = +1

Query  88   RISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMELAQFHS  267
            ++ Y+YDGD+GN Y+G  HPMKPHR+ MTH+L+L YGL+ KME+YRP KAY  ++ +FHS
Sbjct  8    KVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEVYRPSKAYSEDMTRFHS  67

Query  268  ADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRLNNQLC  447
             +YV+FL  I PD  H F   ++R+N+GEDCPVFD LFEFCQ+ AGGTI AA +LN Q  
Sbjct  68   DEYVKFLKNIRPDNMHEFNKQMQRFNVGEDCPVFDGLFEFCQLSAGGTIAAAVKLNKQQT  127

Query  448  DVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVEEAFYF  627
            D+A+NW GGLHHAKK EASGFCYIND+V+GILELLKYH RVLY+DID+HHGDGVEEAFY 
Sbjct  128  DIAVNWGGGLHHAKKSEASGFCYINDIVIGILELLKYHQRVLYVDIDIHHGDGVEEAFYT  187

Query  628  TDR  636
            TDR
Sbjct  188  TDR  190



>ref|XP_009174258.1| hypothetical protein T265_09811 [Opisthorchis viverrini]
 gb|KER21980.1| hypothetical protein T265_09811 [Opisthorchis viverrini]
Length=505

 Score =   278 bits (711),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 123/183 (67%), Positives = 150/183 (82%), Gaps = 0/183 (0%)
 Frame = +1

Query  88   RISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMELAQFHS  267
            ++ Y+YDGD+GN Y+G  HPMKPHR+ MTH+L+L YGL+ KME+YRP KAY  ++ +FHS
Sbjct  8    KVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEVYRPSKAYSEDMTKFHS  67

Query  268  ADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRLNNQLC  447
             +YV+FL  I PD  H F   ++R+N+GEDCPVFD LFEFCQ+ AGG+I  A +LN Q  
Sbjct  68   DEYVKFLKSIRPDNMHEFNKQMQRFNVGEDCPVFDGLFEFCQLSAGGSIAGAVKLNKQQT  127

Query  448  DVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVEEAFYF  627
            D+AINW GGLHHAKK EASGFCYIND+V+GILELLKYH RVLY+DID+HHGDGVEEAFY 
Sbjct  128  DIAINWGGGLHHAKKSEASGFCYINDIVMGILELLKYHQRVLYVDIDIHHGDGVEEAFYT  187

Query  628  TDR  636
            TDR
Sbjct  188  TDR  190



>ref|NP_999711.1| histone deacetylase 1 [Strongylocentrotus purpuratus]
 sp|P56518.1|HDAC1_STRPU RecName: Full=Histone deacetylase 1; Short=HD1 [Strongylocentrotus 
purpuratus]
 gb|AAB87685.1| histone deacetylase [Strongylocentrotus purpuratus]
Length=576

 Score =   280 bits (716),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 125/190 (66%), Positives = 152/190 (80%), Gaps = 0/190 (0%)
 Frame = +1

Query  67   AKMRSKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPM  246
            A   +K R+ Y+YDGDVGN Y+G  HPMKPHR+ MTH+L+L YGL+ KMEIYRPHKA   
Sbjct  2    ASTGTKKRVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLILNYGLYRKMEIYRPHKAVME  61

Query  247  ELAQFHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAAR  426
            E+ ++HS DYV+FL  I PD    +   ++R+N+GEDCPVFD L+EFCQ+ +GG++  A 
Sbjct  62   EMTKYHSDDYVKFLRTIRPDNMSEYTKQMQRFNVGEDCPVFDGLYEFCQLSSGGSVAGAV  121

Query  427  RLNNQLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDG  606
            +LN Q  D+AINWAGGLHHAKK EASGFCY+ND+VL ILELLKYH RVLYIDID+HHGDG
Sbjct  122  KLNKQQTDIAINWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDG  181

Query  607  VEEAFYFTDR  636
            VEEAFY TDR
Sbjct  182  VEEAFYTTDR  191



>ref|XP_004850908.1| PREDICTED: histone deacetylase 1 [Heterocephalus glaber]
Length=482

 Score =   277 bits (709),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 122/186 (66%), Positives = 152/186 (82%), Gaps = 0/186 (0%)
 Frame = +1

Query  79   SKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMELAQ  258
            ++ ++ Y+YDGDVGN Y+G  HPMKPHR+ MTH+L+L YGL+ KMEIYRPHKA   E+ +
Sbjct  7    TRRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTK  66

Query  259  FHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRLNN  438
            +HS DY++FL  I PD    +   ++R+N+GEDCPVFD LFEFCQ+ AGG++ +A +LN 
Sbjct  67   YHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSAGGSVASAVKLNK  126

Query  439  QLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVEEA  618
            Q  D+A+NWAGGLHHAKK EASGFCY+ND+VL ILELLKYH RVLYIDID+HHGDGVEEA
Sbjct  127  QQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEA  186

Query  619  FYFTDR  636
            FY TDR
Sbjct  187  FYTTDR  192



>ref|XP_001848775.1| histone deacetylase Rpd3 [Culex quinquefasciatus]
 gb|EDS29016.1| histone deacetylase Rpd3 [Culex quinquefasciatus]
Length=489

 Score =   277 bits (709),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 124/186 (67%), Positives = 149/186 (80%), Gaps = 0/186 (0%)
 Frame = +1

Query  79   SKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMELAQ  258
            SK R+ Y+YD D+GN Y+G  HPMKPHR+ MTH+L+L YGL+ KMEIYRPHKA   E+ +
Sbjct  5    SKKRVCYYYDSDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATADEMTK  64

Query  259  FHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRLNN  438
            FHS DY+ FL  I PD    +   ++R+N+GEDCPVFD L+EFCQ+ AGG++ AA +LN 
Sbjct  65   FHSDDYIRFLRSIRPDNMSEYNKQMQRFNVGEDCPVFDGLYEFCQLSAGGSVAAAVKLNK  124

Query  439  QLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVEEA  618
            Q  ++ INW GGLHHAKK EASGFCY+ND+VLGILELLKYH RVLYIDIDVHHGDGVEEA
Sbjct  125  QASEICINWGGGLHHAKKSEASGFCYVNDIVLGILELLKYHQRVLYIDIDVHHGDGVEEA  184

Query  619  FYFTDR  636
            FY TDR
Sbjct  185  FYTTDR  190



>ref|XP_007574365.1| PREDICTED: probable histone deacetylase 1-B [Poecilia formosa]
 ref|XP_008397809.1| PREDICTED: probable histone deacetylase 1-B [Poecilia reticulata]
Length=488

 Score =   277 bits (709),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 124/186 (67%), Positives = 150/186 (81%), Gaps = 0/186 (0%)
 Frame = +1

Query  79   SKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMELAQ  258
            +K ++ Y+YDGDVGN Y+G  HPMKPHR+ MTH+L+L YGL+ KMEIYRPHKA   E+ +
Sbjct  8    TKKKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKASGEEMTK  67

Query  259  FHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRLNN  438
            +HS DY+ FL  I PD    +   ++R+N+GEDCPVFD LFEFCQ+ AGG++  A +LN 
Sbjct  68   YHSDDYIRFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSAGGSVAGAVKLNK  127

Query  439  QLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVEEA  618
            Q  D+AINWAGGLHHAKK EASGFCY+ND+VL ILELLKYH RVLYIDID+HHGDGVEEA
Sbjct  128  QQTDIAINWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEA  187

Query  619  FYFTDR  636
            FY TDR
Sbjct  188  FYTTDR  193



>ref|XP_005799195.1| PREDICTED: probable histone deacetylase 1-B-like [Xiphophorus 
maculatus]
Length=488

 Score =   277 bits (709),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 124/186 (67%), Positives = 150/186 (81%), Gaps = 0/186 (0%)
 Frame = +1

Query  79   SKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMELAQ  258
            +K ++ Y+YDGDVGN Y+G  HPMKPHR+ MTH+L+L YGL+ KMEIYRPHKA   E+ +
Sbjct  8    TKKKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKASGEEMTK  67

Query  259  FHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRLNN  438
            +HS DY+ FL  I PD    +   ++R+N+GEDCPVFD LFEFCQ+ AGG++  A +LN 
Sbjct  68   YHSDDYIRFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSAGGSVAGAVKLNK  127

Query  439  QLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVEEA  618
            Q  D+AINWAGGLHHAKK EASGFCY+ND+VL ILELLKYH RVLYIDID+HHGDGVEEA
Sbjct  128  QQTDIAINWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEA  187

Query  619  FYFTDR  636
            FY TDR
Sbjct  188  FYTTDR  193



>emb|CAF93492.1| unnamed protein product [Tetraodon nigroviridis]
Length=490

 Score =   277 bits (709),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 122/186 (66%), Positives = 150/186 (81%), Gaps = 0/186 (0%)
 Frame = +1

Query  79   SKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMELAQ  258
            +K ++ Y+YDGD+GN Y+G  HPMKPHR+ MTH+L+L YGL+ KMEIYRPHKA   E+ +
Sbjct  9    TKKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATAEEMTK  68

Query  259  FHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRLNN  438
            +HS DY++FL  I PD    F   ++R+N+GEDCPVFD LFEFCQ+ AGG+   + +LN 
Sbjct  69   YHSDDYIKFLRSIRPDNMSEFSKQMQRFNVGEDCPVFDGLFEFCQLSAGGSAAGSVKLNR  128

Query  439  QLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVEEA  618
            Q  D+A+NWAGGLHHAKK EASGFCY+ND+VL ILELLKYH RVLYIDID+HHGDGVEEA
Sbjct  129  QQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEA  188

Query  619  FYFTDR  636
            FY TDR
Sbjct  189  FYTTDR  194



>ref|XP_005739016.1| PREDICTED: histone deacetylase 1-like [Pundamilia nyererei]
Length=484

 Score =   277 bits (708),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 123/186 (66%), Positives = 150/186 (81%), Gaps = 0/186 (0%)
 Frame = +1

Query  79   SKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMELAQ  258
            +K ++ Y+YDGDVGN Y+G  HPMKPHR+ MTH+L+L YGL+ KMEIYRPHKA   E+ +
Sbjct  8    TKKKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKASGEEMTK  67

Query  259  FHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRLNN  438
            +HS DY++FL  I PD    +   ++R+N+GEDCPVFD LFEFCQ+  GG++  A +LN 
Sbjct  68   YHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSGGGSVAGAVKLNK  127

Query  439  QLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVEEA  618
            Q  D+AINWAGGLHHAKK EASGFCY+ND+VL ILELLKYH RVLYIDID+HHGDGVEEA
Sbjct  128  QQTDIAINWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEA  187

Query  619  FYFTDR  636
            FY TDR
Sbjct  188  FYTTDR  193



>ref|NP_775343.1| histone deacetylase 1 [Danio rerio]
 gb|AAM34645.1|AF506201_1 histone deaceytlase 1 [Danio rerio]
Length=480

 Score =   277 bits (708),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 123/186 (66%), Positives = 150/186 (81%), Gaps = 0/186 (0%)
 Frame = +1

Query  79   SKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMELAQ  258
            +K ++ Y+YDGDVGN Y+G  HPMKPHR+ MTH+L+L YGL+ KMEIYRPHKA   E+ +
Sbjct  8    TKKKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTK  67

Query  259  FHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRLNN  438
            +HS DY++FL  I PD    +   ++R+N+GEDCPVFD LFEFCQ+  GG++  A +LN 
Sbjct  68   YHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAGAVKLNK  127

Query  439  QLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVEEA  618
            Q  D+AINWAGGLHHAKK EASGFCY+ND+VL ILELLKYH RVLYIDID+HHGDGVEEA
Sbjct  128  QQTDIAINWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEA  187

Query  619  FYFTDR  636
            FY TDR
Sbjct  188  FYTTDR  193



>ref|XP_005457977.1| PREDICTED: histone deacetylase 2-like isoform X2 [Oreochromis 
niloticus]
Length=489

 Score =   277 bits (708),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 121/186 (65%), Positives = 150/186 (81%), Gaps = 0/186 (0%)
 Frame = +1

Query  79   SKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMELAQ  258
            +K ++ Y+YDGD+GN Y+G  HPMKPHR+ MTH+L+L YGL+ KME+YRPHKA   E+ +
Sbjct  9    TKKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEVYRPHKATADEMTK  68

Query  259  FHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRLNN  438
            +HS DY++FL  I PD    F   ++R+N+GEDCPVFD LFEFCQ+ AGG+   + +LN 
Sbjct  69   YHSDDYIKFLRSIRPDNMSEFSKQMQRFNVGEDCPVFDGLFEFCQLSAGGSAAGSVKLNR  128

Query  439  QLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVEEA  618
            Q  D+A+NWAGGLHHAKK EASGFCY+ND+VL ILELLKYH RVLYIDID+HHGDGVEEA
Sbjct  129  QQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEA  188

Query  619  FYFTDR  636
            FY TDR
Sbjct  189  FYTTDR  194



>ref|XP_004074465.1| PREDICTED: probable histone deacetylase 1-B [Oryzias latipes]
Length=482

 Score =   277 bits (708),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 123/186 (66%), Positives = 150/186 (81%), Gaps = 0/186 (0%)
 Frame = +1

Query  79   SKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMELAQ  258
            +K ++ Y+YDGDVGN Y+G  HPMKPHR+ MTH+L+L YGL+ KMEIYRPHKA   E+ +
Sbjct  7    TKKKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKASAEEMTK  66

Query  259  FHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRLNN  438
            +HS DY++FL  I PD    +   ++R+N+GEDCPVFD LFEFCQ+  GG++  A +LN 
Sbjct  67   YHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAGAVKLNK  126

Query  439  QLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVEEA  618
            Q  D+AINWAGGLHHAKK EASGFCY+ND+VL ILELLKYH RVLYIDID+HHGDGVEEA
Sbjct  127  QQTDIAINWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEA  186

Query  619  FYFTDR  636
            FY TDR
Sbjct  187  FYTTDR  192



>ref|XP_003453058.2| PREDICTED: histone deacetylase 2-like isoform X1 [Oreochromis 
niloticus]
Length=490

 Score =   277 bits (708),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 121/186 (65%), Positives = 150/186 (81%), Gaps = 0/186 (0%)
 Frame = +1

Query  79   SKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMELAQ  258
            +K ++ Y+YDGD+GN Y+G  HPMKPHR+ MTH+L+L YGL+ KME+YRPHKA   E+ +
Sbjct  9    TKKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEVYRPHKATADEMTK  68

Query  259  FHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRLNN  438
            +HS DY++FL  I PD    F   ++R+N+GEDCPVFD LFEFCQ+ AGG+   + +LN 
Sbjct  69   YHSDDYIKFLRSIRPDNMSEFSKQMQRFNVGEDCPVFDGLFEFCQLSAGGSAAGSVKLNR  128

Query  439  QLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVEEA  618
            Q  D+A+NWAGGLHHAKK EASGFCY+ND+VL ILELLKYH RVLYIDID+HHGDGVEEA
Sbjct  129  QQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEA  188

Query  619  FYFTDR  636
            FY TDR
Sbjct  189  FYTTDR  194



>ref|XP_004591679.1| PREDICTED: histone deacetylase 1 [Ochotona princeps]
Length=482

 Score =   277 bits (708),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 122/186 (66%), Positives = 151/186 (81%), Gaps = 0/186 (0%)
 Frame = +1

Query  79   SKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMELAQ  258
            +K ++ Y+YDGDVGN Y+G  HPMKPHR+ MTH+L+L YGL+ KMEIYRPHKA   E+ +
Sbjct  7    TKRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTK  66

Query  259  FHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRLNN  438
            +HS DY++FL  I PD    +   ++R+N+GEDCPVFD LFEFCQ+  GG++ +A +LN 
Sbjct  67   YHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVASAVKLNK  126

Query  439  QLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVEEA  618
            Q  D+A+NWAGGLHHAKK EASGFCY+ND+VL ILELLKYH RVLYIDID+HHGDGVEEA
Sbjct  127  QQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEA  186

Query  619  FYFTDR  636
            FY TDR
Sbjct  187  FYTTDR  192



>dbj|BAC34755.1| unnamed protein product [Mus musculus]
Length=304

 Score =   271 bits (693),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 120/185 (65%), Positives = 149/185 (81%), Gaps = 0/185 (0%)
 Frame = +1

Query  82   KDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMELAQF  261
            K ++ Y+YDGD+GN Y+G  HPMKPHR+ MTH+L+L YGL+ KMEIYRPHKA   E+ ++
Sbjct  9    KKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATAEEMTKY  68

Query  262  HSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRLNNQ  441
            HS +Y++FL  I PD    +   ++R+N+GEDCPVFD LFEFCQ+  GG++  A +LN Q
Sbjct  69   HSDEYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAGAVKLNRQ  128

Query  442  LCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVEEAF  621
              D+A+NWAGGLHHAKK EASGFCY+ND+VL ILELLKYH RVLYIDID+HHGDGVEEAF
Sbjct  129  QTDMAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAF  188

Query  622  YFTDR  636
            Y TDR
Sbjct  189  YTTDR  193



>ref|XP_005100474.1| PREDICTED: histone deacetylase 2-like isoform X1 [Aplysia californica]
Length=532

 Score =   278 bits (711),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 122/185 (66%), Positives = 150/185 (81%), Gaps = 0/185 (0%)
 Frame = +1

Query  82   KDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMELAQF  261
            K +I Y+YDGD+GN Y+G  HPMKPHR+ MTH+L+L YGL+ KMEIYRPHKA   E+ +F
Sbjct  7    KRKICYYYDGDIGNYYYGQGHPMKPHRIRMTHNLILNYGLYRKMEIYRPHKATAEEMTKF  66

Query  262  HSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRLNNQ  441
            HS DY++FL  I PD    +   ++R+N+GEDCPVFD ++EFCQ+  GG++  A +LN Q
Sbjct  67   HSDDYIKFLRSIRPDNMAEYNKQMQRFNVGEDCPVFDGMYEFCQLSTGGSVAGAVKLNKQ  126

Query  442  LCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVEEAF  621
              D+AINWAGGLHHAKK EASGFCY+ND+VLGILELLKYH RVLY+DID+HHGDGVEEAF
Sbjct  127  AADIAINWAGGLHHAKKSEASGFCYVNDIVLGILELLKYHQRVLYVDIDIHHGDGVEEAF  186

Query  622  YFTDR  636
            Y TDR
Sbjct  187  YTTDR  191



>ref|XP_004566615.1| PREDICTED: probable histone deacetylase 1-B-like isoform X2 [Maylandia 
zebra]
 ref|XP_005922380.1| PREDICTED: probable histone deacetylase 1-B-like isoform X2 [Haplochromis 
burtoni]
Length=484

 Score =   277 bits (708),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 123/186 (66%), Positives = 150/186 (81%), Gaps = 0/186 (0%)
 Frame = +1

Query  79   SKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMELAQ  258
            +K ++ Y+YDGDVGN Y+G  HPMKPHR+ MTH+L+L YGL+ KMEIYRPHKA   E+ +
Sbjct  8    TKKKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKASGEEMTK  67

Query  259  FHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRLNN  438
            +HS DY++FL  I PD    +   ++R+N+GEDCPVFD LFEFCQ+  GG++  A +LN 
Sbjct  68   YHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSGGGSVAGAVKLNK  127

Query  439  QLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVEEA  618
            Q  D+AINWAGGLHHAKK EASGFCY+ND+VL ILELLKYH RVLYIDID+HHGDGVEEA
Sbjct  128  QQTDIAINWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEA  187

Query  619  FYFTDR  636
            FY TDR
Sbjct  188  FYTTDR  193



>ref|XP_008314048.1| PREDICTED: histone deacetylase 1 isoform X1 [Cynoglossus semilaevis]
Length=490

 Score =   277 bits (708),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 123/186 (66%), Positives = 150/186 (81%), Gaps = 0/186 (0%)
 Frame = +1

Query  79   SKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMELAQ  258
            +K ++ Y+YDGDVGN Y+G  HPMKPHR+ MTH+L+L YGL+ KMEIYRPHKA   E+ +
Sbjct  8    TKKKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKASGEEMTK  67

Query  259  FHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRLNN  438
            +HS DY++FL  I PD    +   ++R+N+GEDCPVFD LFEFCQ+  GG++  A +LN 
Sbjct  68   YHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSGGGSVAGAVKLNK  127

Query  439  QLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVEEA  618
            Q  D+AINWAGGLHHAKK EASGFCY+ND+VL ILELLKYH RVLYIDID+HHGDGVEEA
Sbjct  128  QQTDIAINWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEA  187

Query  619  FYFTDR  636
            FY TDR
Sbjct  188  FYTTDR  193



>ref|XP_007249467.1| PREDICTED: probable histone deacetylase 1-B-like isoform X2 [Astyanax 
mexicanus]
Length=484

 Score =   277 bits (708),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 123/186 (66%), Positives = 150/186 (81%), Gaps = 0/186 (0%)
 Frame = +1

Query  79   SKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMELAQ  258
            +K ++ Y+YDGDVGN Y+G  HPMKPHR+ MTH+L+L YGL+ KMEIYRPHKA   E+ +
Sbjct  8    TKKKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANGEEMTK  67

Query  259  FHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRLNN  438
            +HS DY++FL  I PD    +   ++R+N+GEDCPVFD LFEFCQ+  GG++  A +LN 
Sbjct  68   YHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAGAVKLNK  127

Query  439  QLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVEEA  618
            Q  D+AINWAGGLHHAKK EASGFCY+ND+VL ILELLKYH RVLYIDID+HHGDGVEEA
Sbjct  128  QQTDIAINWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEA  187

Query  619  FYFTDR  636
            FY TDR
Sbjct  188  FYTTDR  193



>ref|XP_005931104.1| PREDICTED: histone deacetylase 2-like [Haplochromis burtoni]
Length=481

 Score =   276 bits (707),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 121/186 (65%), Positives = 150/186 (81%), Gaps = 0/186 (0%)
 Frame = +1

Query  79   SKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMELAQ  258
            +K ++ Y+YDGD+GN Y+G  HPMKPHR+ MTH+L+L YGL+ KME+YRPHKA   E+ +
Sbjct  9    TKKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEVYRPHKATADEMTK  68

Query  259  FHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRLNN  438
            +HS DY++FL  I PD    F   ++R+N+GEDCPVFD LFEFCQ+ AGG+   + +LN 
Sbjct  69   YHSDDYIKFLRSIRPDNMSEFSKQMQRFNVGEDCPVFDGLFEFCQLSAGGSAAGSVKLNR  128

Query  439  QLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVEEA  618
            Q  D+A+NWAGGLHHAKK EASGFCY+ND+VL ILELLKYH RVLYIDID+HHGDGVEEA
Sbjct  129  QQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEA  188

Query  619  FYFTDR  636
            FY TDR
Sbjct  189  FYTTDR  194



>ref|XP_005159649.1| PREDICTED: histone deacetylase 1 isoform X1 [Danio rerio]
Length=484

 Score =   276 bits (707),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 123/186 (66%), Positives = 150/186 (81%), Gaps = 0/186 (0%)
 Frame = +1

Query  79   SKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMELAQ  258
            +K ++ Y+YDGDVGN Y+G  HPMKPHR+ MTH+L+L YGL+ KMEIYRPHKA   E+ +
Sbjct  8    TKKKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTK  67

Query  259  FHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRLNN  438
            +HS DY++FL  I PD    +   ++R+N+GEDCPVFD LFEFCQ+  GG++  A +LN 
Sbjct  68   YHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAGAVKLNK  127

Query  439  QLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVEEA  618
            Q  D+AINWAGGLHHAKK EASGFCY+ND+VL ILELLKYH RVLYIDID+HHGDGVEEA
Sbjct  128  QQTDIAINWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEA  187

Query  619  FYFTDR  636
            FY TDR
Sbjct  188  FYTTDR  193



>ref|NP_001020580.1| histone deacetylase 1 [Rattus norvegicus]
 sp|Q4QQW4.1|HDAC1_RAT RecName: Full=Histone deacetylase 1; Short=HD1 [Rattus norvegicus]
 gb|AAH97943.1| Histone deacetylase 1 [Rattus norvegicus]
 gb|AAI07477.1| Histone deacetylase 1 [Rattus norvegicus]
 gb|EDL80545.1| rCG31110 [Rattus norvegicus]
Length=482

 Score =   276 bits (707),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 122/186 (66%), Positives = 151/186 (81%), Gaps = 0/186 (0%)
 Frame = +1

Query  79   SKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMELAQ  258
            +K ++ Y+YDGDVGN Y+G  HPMKPHR+ MTH+L+L YGL+ KMEIYRPHKA   E+ +
Sbjct  7    TKRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTK  66

Query  259  FHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRLNN  438
            +HS DY++FL  I PD    +   ++R+N+GEDCPVFD LFEFCQ+  GG++ +A +LN 
Sbjct  67   YHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVASAVKLNK  126

Query  439  QLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVEEA  618
            Q  D+A+NWAGGLHHAKK EASGFCY+ND+VL ILELLKYH RVLYIDID+HHGDGVEEA
Sbjct  127  QQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEA  186

Query  619  FYFTDR  636
            FY TDR
Sbjct  187  FYTTDR  192



>ref|XP_001649445.1| AAEL004586-PB [Aedes aegypti]
 gb|EAT44001.1| AAEL004586-PB [Aedes aegypti]
Length=487

 Score =   277 bits (708),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 124/186 (67%), Positives = 149/186 (80%), Gaps = 0/186 (0%)
 Frame = +1

Query  79   SKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMELAQ  258
            SK R+ Y+YD D+GN Y+G  HPMKPHR+ MTH+L+L YGL+ KMEIYRPHKA   E+ +
Sbjct  5    SKKRVCYYYDSDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATADEMTK  64

Query  259  FHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRLNN  438
            FHS DY+ FL  I PD    +   ++R+N+GEDCPVFD L+EFCQ+ AGG++ AA +LN 
Sbjct  65   FHSDDYIRFLRSIRPDNMSEYNKQMQRFNVGEDCPVFDGLYEFCQLSAGGSVAAAVKLNK  124

Query  439  QLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVEEA  618
            Q  ++ INW GGLHHAKK EASGFCY+ND+VLGILELLKYH RVLYIDIDVHHGDGVEEA
Sbjct  125  QASEICINWGGGLHHAKKSEASGFCYVNDIVLGILELLKYHQRVLYIDIDVHHGDGVEEA  184

Query  619  FYFTDR  636
            FY TDR
Sbjct  185  FYTTDR  190



>ref|XP_003977374.1| PREDICTED: histone deacetylase 2-like [Takifugu rubripes]
Length=479

 Score =   276 bits (707),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 122/186 (66%), Positives = 150/186 (81%), Gaps = 0/186 (0%)
 Frame = +1

Query  79   SKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMELAQ  258
            +K ++ Y+YDGD+GN Y+G  HPMKPHR+ MTH+L+L YGL+ KMEIYRPHKA   E+ +
Sbjct  9    TKKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATAEEMTK  68

Query  259  FHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRLNN  438
            +HS DY++FL  I PD    F   ++R+N+GEDCPVFD LFEFCQ+ AGG+   + +LN 
Sbjct  69   YHSDDYIKFLRSIRPDNMSEFSKQMQRFNVGEDCPVFDGLFEFCQLSAGGSAAGSVKLNR  128

Query  439  QLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVEEA  618
            Q  D+A+NWAGGLHHAKK EASGFCY+ND+VL ILELLKYH RVLYIDID+HHGDGVEEA
Sbjct  129  QQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEA  188

Query  619  FYFTDR  636
            FY TDR
Sbjct  189  FYTTDR  194



>emb|CCI40020.1| unnamed protein product [Albugo candida]
Length=451

 Score =   276 bits (705),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 123/190 (65%), Positives = 155/190 (82%), Gaps = 2/190 (1%)
 Frame = +1

Query  73   MRSKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMEL  252
            M  K R++YFY  D G+ Y+GP HPMKPHR+ +THHLV+ Y L+ KM+++ PH A P E+
Sbjct  1    MGGKTRVAYFYHPDEGHFYYGPGHPMKPHRMKLTHHLVVNYDLYRKMDVFEPHWASPEEI  60

Query  253  AQFHSADYVEFLHRITPDTQHLFGIDLKRYNLGE--DCPVFDNLFEFCQIYAGGTIDAAR  426
              FHS +Y++FL R+TP  Q  +  +L+++N GE  DCP+FD +F+FC+IY+GGT+DAA 
Sbjct  61   KAFHSPEYIDFLQRVTPTNQKEYAQELQKFNCGEFTDCPIFDGVFDFCRIYSGGTLDAAH  120

Query  427  RLNNQLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDG  606
            RLN+ LCD+AINWAGGLHHAKK E SGFCY+ND+VLGILELL+YHPRVLYIDIDVHHGDG
Sbjct  121  RLNHGLCDIAINWAGGLHHAKKSEGSGFCYVNDIVLGILELLRYHPRVLYIDIDVHHGDG  180

Query  607  VEEAFYFTDR  636
            VEEAFY TDR
Sbjct  181  VEEAFYVTDR  190



>ref|XP_008869931.1| hypothetical protein, variant [Aphanomyces invadans]
 gb|ETW00933.1| hypothetical protein, variant [Aphanomyces invadans]
Length=377

 Score =   273 bits (699),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 129/187 (69%), Positives = 151/187 (81%), Gaps = 2/187 (1%)
 Frame = +1

Query  82   KDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMELAQF  261
            K R+SYFY  + GN Y+GP HPMKPHRL + HHLVL Y L  KME++ PH A   E+  F
Sbjct  3    KSRVSYFYHPEEGNFYYGPGHPMKPHRLKLAHHLVLNYDLFRKMEVFEPHWASSEEVKAF  62

Query  262  HSADYVEFLHRITPDTQHLFGIDLKRYNLGE--DCPVFDNLFEFCQIYAGGTIDAARRLN  435
            H+ADYVEFL +I+P  +  +  D+ ++N+GE  DCPVFD +F FCQIY+GG++DAA RLN
Sbjct  63   HTADYVEFLKKISPSNEKQYQSDVNKFNVGEFTDCPVFDGIFNFCQIYSGGSLDAAYRLN  122

Query  436  NQLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVEE  615
            + L DVAINWAGGLHHAKK EASGFCYIND+VLGILELLKYHPRVLYIDIDVHHGDGVEE
Sbjct  123  HGLTDVAINWAGGLHHAKKSEASGFCYINDIVLGILELLKYHPRVLYIDIDVHHGDGVEE  182

Query  616  AFYFTDR  636
            AFY TDR
Sbjct  183  AFYVTDR  189



>ref|XP_010729600.1| PREDICTED: probable histone deacetylase 1-B [Larimichthys crocea]
Length=484

 Score =   276 bits (707),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 123/186 (66%), Positives = 150/186 (81%), Gaps = 0/186 (0%)
 Frame = +1

Query  79   SKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMELAQ  258
            +K ++ Y+YDGDVGN Y+G  HPMKPHR+ MTH+L+L YGL+ KMEIYRPHKA   E+ +
Sbjct  8    TKKKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKASGEEMTK  67

Query  259  FHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRLNN  438
            +HS DY++FL  I PD    +   ++R+N+GEDCPVFD LFEFCQ+  GG++  A +LN 
Sbjct  68   YHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSGGGSVAGAVKLNK  127

Query  439  QLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVEEA  618
            Q  D+AINWAGGLHHAKK EASGFCY+ND+VL ILELLKYH RVLYIDID+HHGDGVEEA
Sbjct  128  QQTDIAINWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEA  187

Query  619  FYFTDR  636
            FY TDR
Sbjct  188  FYTTDR  193



>ref|NP_032254.1| histone deacetylase 1 [Mus musculus]
 ref|XP_005353247.1| PREDICTED: histone deacetylase 1 [Microtus ochrogaster]
 ref|XP_006994438.1| PREDICTED: histone deacetylase 1 [Peromyscus maniculatus bairdii]
 sp|O09106.1|HDAC1_MOUSE RecName: Full=Histone deacetylase 1; Short=HD1 [Mus musculus]
 emb|CAA66870.1| histone deacetylase [Mus musculus]
 gb|AAH92070.1| Hdac1 protein [Mus musculus]
 gb|AAI08372.1| Hdac1 protein [Mus musculus]
Length=482

 Score =   276 bits (707),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 122/186 (66%), Positives = 151/186 (81%), Gaps = 0/186 (0%)
 Frame = +1

Query  79   SKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMELAQ  258
            +K ++ Y+YDGDVGN Y+G  HPMKPHR+ MTH+L+L YGL+ KMEIYRPHKA   E+ +
Sbjct  7    TKRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTK  66

Query  259  FHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRLNN  438
            +HS DY++FL  I PD    +   ++R+N+GEDCPVFD LFEFCQ+  GG++ +A +LN 
Sbjct  67   YHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVASAVKLNK  126

Query  439  QLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVEEA  618
            Q  D+A+NWAGGLHHAKK EASGFCY+ND+VL ILELLKYH RVLYIDID+HHGDGVEEA
Sbjct  127  QQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEA  186

Query  619  FYFTDR  636
            FY TDR
Sbjct  187  FYTTDR  192



>ref|XP_004678799.1| PREDICTED: histone deacetylase 1 [Condylura cristata]
Length=481

 Score =   276 bits (707),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 122/186 (66%), Positives = 151/186 (81%), Gaps = 0/186 (0%)
 Frame = +1

Query  79   SKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMELAQ  258
            +K ++ Y+YDGDVGN Y+G  HPMKPHR+ MTH+L+L YGL+ KMEIYRPHKA   E+ +
Sbjct  7    TKRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTK  66

Query  259  FHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRLNN  438
            +HS DY++FL  I PD    +   ++R+N+GEDCPVFD LFEFCQ+  GG++ +A +LN 
Sbjct  67   YHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVASAVKLNK  126

Query  439  QLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVEEA  618
            Q  D+A+NWAGGLHHAKK EASGFCY+ND+VL ILELLKYH RVLYIDID+HHGDGVEEA
Sbjct  127  QQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEA  186

Query  619  FYFTDR  636
            FY TDR
Sbjct  187  FYTTDR  192



>ref|NP_001273520.1| histone deacetylase 1 [Pantholops hodgsonii]
 gb|AEL79596.1| Histone deacetylase 1 [Pantholops hodgsonii]
Length=482

 Score =   276 bits (707),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 122/186 (66%), Positives = 151/186 (81%), Gaps = 0/186 (0%)
 Frame = +1

Query  79   SKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMELAQ  258
            +K ++ Y+YDGDVGN Y+G  HPMKPHR+ MTH+L+L YGL+ KMEIYRPHKA   E+ +
Sbjct  7    TKRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTK  66

Query  259  FHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRLNN  438
            +HS DY++FL  I PD    +   ++R+N+GEDCPVFD LFEFCQ+  GG++ +A +LN 
Sbjct  67   YHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVASAVKLNK  126

Query  439  QLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVEEA  618
            Q  D+A+NWAGGLHHAKK EASGFCY+ND+VL ILELLKYH RVLYIDID+HHGDGVEEA
Sbjct  127  QQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEA  186

Query  619  FYFTDR  636
            FY TDR
Sbjct  187  FYTTDR  192



>ref|XP_004665328.1| PREDICTED: histone deacetylase 1 [Jaculus jaculus]
Length=482

 Score =   276 bits (707),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 122/186 (66%), Positives = 151/186 (81%), Gaps = 0/186 (0%)
 Frame = +1

Query  79   SKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMELAQ  258
            +K ++ Y+YDGDVGN Y+G  HPMKPHR+ MTH+L+L YGL+ KMEIYRPHKA   E+ +
Sbjct  7    TKRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTK  66

Query  259  FHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRLNN  438
            +HS DY++FL  I PD    +   ++R+N+GEDCPVFD LFEFCQ+  GG++ +A +LN 
Sbjct  67   YHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVASAVKLNK  126

Query  439  QLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVEEA  618
            Q  D+A+NWAGGLHHAKK EASGFCY+ND+VL ILELLKYH RVLYIDID+HHGDGVEEA
Sbjct  127  QQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEA  186

Query  619  FYFTDR  636
            FY TDR
Sbjct  187  FYTTDR  192



>ref|XP_004566614.1| PREDICTED: probable histone deacetylase 1-B-like isoform X1 [Maylandia 
zebra]
 ref|XP_005922379.1| PREDICTED: probable histone deacetylase 1-B-like isoform X1 [Haplochromis 
burtoni]
 ref|XP_006800703.1| PREDICTED: probable histone deacetylase 1-B-like [Neolamprologus 
brichardi]
Length=490

 Score =   277 bits (708),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 123/186 (66%), Positives = 150/186 (81%), Gaps = 0/186 (0%)
 Frame = +1

Query  79   SKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMELAQ  258
            +K ++ Y+YDGDVGN Y+G  HPMKPHR+ MTH+L+L YGL+ KMEIYRPHKA   E+ +
Sbjct  8    TKKKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKASGEEMTK  67

Query  259  FHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRLNN  438
            +HS DY++FL  I PD    +   ++R+N+GEDCPVFD LFEFCQ+  GG++  A +LN 
Sbjct  68   YHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSGGGSVAGAVKLNK  127

Query  439  QLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVEEA  618
            Q  D+AINWAGGLHHAKK EASGFCY+ND+VL ILELLKYH RVLYIDID+HHGDGVEEA
Sbjct  128  QQTDIAINWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEA  187

Query  619  FYFTDR  636
            FY TDR
Sbjct  188  FYTTDR  193



>ref|XP_003962463.1| PREDICTED: histone deacetylase 1-like [Takifugu rubripes]
Length=484

 Score =   276 bits (707),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 123/186 (66%), Positives = 150/186 (81%), Gaps = 0/186 (0%)
 Frame = +1

Query  79   SKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMELAQ  258
            +K ++ Y+YDGDVGN Y+G  HPMKPHR+ MTH+L+L YGL+ KMEIYRPHKA   E+ +
Sbjct  8    TKKKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANGEEMTK  67

Query  259  FHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRLNN  438
            +HS DY++FL  I PD    +   ++R+N+GEDCPVFD LFEFCQ+  GG++  A +LN 
Sbjct  68   YHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSVGGSVAGAVKLNK  127

Query  439  QLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVEEA  618
            Q  D+AINWAGGLHHAKK EASGFCY+ND+VL ILELLKYH RVLYIDID+HHGDGVEEA
Sbjct  128  QQTDIAINWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEA  187

Query  619  FYFTDR  636
            FY TDR
Sbjct  188  FYTTDR  193



>ref|XP_010734201.1| PREDICTED: histone deacetylase 2 [Larimichthys crocea]
Length=489

 Score =   276 bits (707),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 122/186 (66%), Positives = 150/186 (81%), Gaps = 0/186 (0%)
 Frame = +1

Query  79   SKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMELAQ  258
            +K ++ Y+YDGD+GN Y+G  HPMKPHR+ MTH+L+L YGL+ KMEIYRPHKA   E+ +
Sbjct  9    TKKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATAEEMTK  68

Query  259  FHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRLNN  438
            +HS DY++FL  I PD    F   ++R+N+GEDCPVFD LFEFCQ+ AGG+   + +LN 
Sbjct  69   YHSDDYIKFLRSIRPDNMSEFSKQMQRFNVGEDCPVFDGLFEFCQLSAGGSAAGSVKLNR  128

Query  439  QLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVEEA  618
            Q  D+A+NWAGGLHHAKK EASGFCY+ND+VL ILELLKYH RVLYIDID+HHGDGVEEA
Sbjct  129  QQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEA  188

Query  619  FYFTDR  636
            FY TDR
Sbjct  189  FYTTDR  194



>ref|XP_004566277.1| PREDICTED: histone deacetylase 2-like [Maylandia zebra]
Length=489

 Score =   276 bits (707),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 121/186 (65%), Positives = 150/186 (81%), Gaps = 0/186 (0%)
 Frame = +1

Query  79   SKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMELAQ  258
            +K ++ Y+YDGD+GN Y+G  HPMKPHR+ MTH+L+L YGL+ KME+YRPHKA   E+ +
Sbjct  9    TKKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEVYRPHKATADEMTK  68

Query  259  FHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRLNN  438
            +HS DY++FL  I PD    F   ++R+N+GEDCPVFD LFEFCQ+ AGG+   + +LN 
Sbjct  69   YHSDDYIKFLRSIRPDNMSEFSKQMQRFNVGEDCPVFDGLFEFCQLSAGGSAAGSVKLNR  128

Query  439  QLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVEEA  618
            Q  D+A+NWAGGLHHAKK EASGFCY+ND+VL ILELLKYH RVLYIDID+HHGDGVEEA
Sbjct  129  QQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEA  188

Query  619  FYFTDR  636
            FY TDR
Sbjct  189  FYTTDR  194



>emb|CDQ74676.1| unnamed protein product [Oncorhynchus mykiss]
Length=498

 Score =   277 bits (708),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 123/186 (66%), Positives = 150/186 (81%), Gaps = 0/186 (0%)
 Frame = +1

Query  79   SKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMELAQ  258
            +K ++ Y+YDGDVGN Y+G  HPMKPHR+ MTH+L+L YGL+ KMEIYRPHKA   E+ +
Sbjct  8    TKKKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKASGEEMTK  67

Query  259  FHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRLNN  438
            +HS DY++FL  I PD    +   ++R+N+GEDCPVFD LFEFCQ+  GG++  A +LN 
Sbjct  68   YHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAGAVKLNK  127

Query  439  QLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVEEA  618
            Q  D+AINWAGGLHHAKK EASGFCY+ND+VL ILELLKYH RVLYIDID+HHGDGVEEA
Sbjct  128  QQTDIAINWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEA  187

Query  619  FYFTDR  636
            FY TDR
Sbjct  188  FYTTDR  193



>ref|XP_007249469.1| PREDICTED: probable histone deacetylase 1-B-like isoform X4 [Astyanax 
mexicanus]
Length=480

 Score =   276 bits (707),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 123/186 (66%), Positives = 150/186 (81%), Gaps = 0/186 (0%)
 Frame = +1

Query  79   SKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMELAQ  258
            +K ++ Y+YDGDVGN Y+G  HPMKPHR+ MTH+L+L YGL+ KMEIYRPHKA   E+ +
Sbjct  8    TKKKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANGEEMTK  67

Query  259  FHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRLNN  438
            +HS DY++FL  I PD    +   ++R+N+GEDCPVFD LFEFCQ+  GG++  A +LN 
Sbjct  68   YHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAGAVKLNK  127

Query  439  QLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVEEA  618
            Q  D+AINWAGGLHHAKK EASGFCY+ND+VL ILELLKYH RVLYIDID+HHGDGVEEA
Sbjct  128  QQTDIAINWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEA  187

Query  619  FYFTDR  636
            FY TDR
Sbjct  188  FYTTDR  193



>gb|KFM72198.1| Histone deacetylase 2, partial [Stegodyphus mimosarum]
Length=476

 Score =   276 bits (706),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 122/186 (66%), Positives = 149/186 (80%), Gaps = 0/186 (0%)
 Frame = +1

Query  79   SKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMELAQ  258
            SK R+ Y+YDGD+GN Y+G  HPMKPHR+ MTH+L+L YGL+ KMEIYRPHKA   E+ +
Sbjct  6    SKKRVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLILNYGLYRKMEIYRPHKATQEEMTK  65

Query  259  FHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRLNN  438
            +HS DYV FL  I PD    +   ++R+N+GEDCPVFD L+EFCQ+  GG++  A +LN 
Sbjct  66   YHSDDYVRFLRSIRPDNMSEYNKQMQRFNVGEDCPVFDGLYEFCQLSTGGSVAGAVKLNK  125

Query  439  QLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVEEA  618
            Q  ++A+NWAGGLHHAKK EASGFCY+ND+VL ILELLKYH RVLYIDID+HHGDGVEEA
Sbjct  126  QAAEIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEA  185

Query  619  FYFTDR  636
            FY TDR
Sbjct  186  FYTTDR  191



>ref|XP_006796302.1| PREDICTED: histone deacetylase 2-like [Neolamprologus brichardi]
Length=489

 Score =   276 bits (707),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 121/186 (65%), Positives = 150/186 (81%), Gaps = 0/186 (0%)
 Frame = +1

Query  79   SKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMELAQ  258
            +K ++ Y+YDGD+GN Y+G  HPMKPHR+ MTH+L+L YGL+ KME+YRPHKA   E+ +
Sbjct  9    TKKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEVYRPHKATADEMTK  68

Query  259  FHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRLNN  438
            +HS DY++FL  I PD    F   ++R+N+GEDCPVFD LFEFCQ+ AGG+   + +LN 
Sbjct  69   YHSDDYIKFLRSIRPDNMSEFSKQMQRFNVGEDCPVFDGLFEFCQLSAGGSAAGSVKLNR  128

Query  439  QLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVEEA  618
            Q  D+A+NWAGGLHHAKK EASGFCY+ND+VL ILELLKYH RVLYIDID+HHGDGVEEA
Sbjct  129  QQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEA  188

Query  619  FYFTDR  636
            FY TDR
Sbjct  189  FYTTDR  194



>emb|CCI40019.1| unnamed protein product [Albugo candida]
Length=449

 Score =   275 bits (704),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 123/190 (65%), Positives = 155/190 (82%), Gaps = 2/190 (1%)
 Frame = +1

Query  73   MRSKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMEL  252
            M  K R++YFY  D G+ Y+GP HPMKPHR+ +THHLV+ Y L+ KM+++ PH A P E+
Sbjct  1    MGGKTRVAYFYHPDEGHFYYGPGHPMKPHRMKLTHHLVVNYDLYRKMDVFEPHWASPEEI  60

Query  253  AQFHSADYVEFLHRITPDTQHLFGIDLKRYNLGE--DCPVFDNLFEFCQIYAGGTIDAAR  426
              FHS +Y++FL R+TP  Q  +  +L+++N GE  DCP+FD +F+FC+IY+GGT+DAA 
Sbjct  61   KAFHSPEYIDFLQRVTPTNQKEYAQELQKFNCGEFTDCPIFDGVFDFCRIYSGGTLDAAH  120

Query  427  RLNNQLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDG  606
            RLN+ LCD+AINWAGGLHHAKK E SGFCY+ND+VLGILELL+YHPRVLYIDIDVHHGDG
Sbjct  121  RLNHGLCDIAINWAGGLHHAKKSEGSGFCYVNDIVLGILELLRYHPRVLYIDIDVHHGDG  180

Query  607  VEEAFYFTDR  636
            VEEAFY TDR
Sbjct  181  VEEAFYVTDR  190



>ref|NP_001032521.1| histone deacetylase 1 [Bos taurus]
 ref|XP_004005072.1| PREDICTED: histone deacetylase 1 [Ovis aries]
 ref|XP_005906267.1| PREDICTED: histone deacetylase 1 [Bos mutus]
 ref|XP_010835214.1| PREDICTED: histone deacetylase 1 [Bison bison bison]
 sp|Q32PJ8.1|HDAC1_BOVIN RecName: Full=Histone deacetylase 1; Short=HD1 [Bos taurus]
 gb|AAI08089.1| Histone deacetylase 1 [Bos taurus]
 gb|ABS45034.1| histone deacetylase 1 [Bos taurus]
 tpg|DAA32275.1| TPA: histone deacetylase 1 [Bos taurus]
Length=482

 Score =   276 bits (707),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 122/186 (66%), Positives = 151/186 (81%), Gaps = 0/186 (0%)
 Frame = +1

Query  79   SKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMELAQ  258
            +K ++ Y+YDGDVGN Y+G  HPMKPHR+ MTH+L+L YGL+ KMEIYRPHKA   E+ +
Sbjct  7    TKRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTK  66

Query  259  FHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRLNN  438
            +HS DY++FL  I PD    +   ++R+N+GEDCPVFD LFEFCQ+  GG++ +A +LN 
Sbjct  67   YHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVASAVKLNK  126

Query  439  QLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVEEA  618
            Q  D+A+NWAGGLHHAKK EASGFCY+ND+VL ILELLKYH RVLYIDID+HHGDGVEEA
Sbjct  127  QQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEA  186

Query  619  FYFTDR  636
            FY TDR
Sbjct  187  FYTTDR  192



>ref|XP_006054694.1| PREDICTED: histone deacetylase 1 isoform X1 [Bubalus bubalis]
Length=482

 Score =   276 bits (707),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 122/186 (66%), Positives = 151/186 (81%), Gaps = 0/186 (0%)
 Frame = +1

Query  79   SKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMELAQ  258
            +K ++ Y+YDGDVGN Y+G  HPMKPHR+ MTH+L+L YGL+ KMEIYRPHKA   E+ +
Sbjct  7    TKRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTK  66

Query  259  FHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRLNN  438
            +HS DY++FL  I PD    +   ++R+N+GEDCPVFD LFEFCQ+  GG++ +A +LN 
Sbjct  67   YHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVASAVKLNK  126

Query  439  QLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVEEA  618
            Q  D+A+NWAGGLHHAKK EASGFCY+ND+VL ILELLKYH RVLYIDID+HHGDGVEEA
Sbjct  127  QQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEA  186

Query  619  FYFTDR  636
            FY TDR
Sbjct  187  FYTTDR  192



>ref|XP_003500683.1| PREDICTED: histone deacetylase 1 isoform X1 [Cricetulus griseus]
 gb|EGW00109.1| Histone deacetylase 1 [Cricetulus griseus]
 gb|ERE85421.1| histone deacetylase 1-like protein [Cricetulus griseus]
Length=482

 Score =   276 bits (707),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 122/186 (66%), Positives = 151/186 (81%), Gaps = 0/186 (0%)
 Frame = +1

Query  79   SKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMELAQ  258
            +K ++ Y+YDGDVGN Y+G  HPMKPHR+ MTH+L+L YGL+ KMEIYRPHKA   E+ +
Sbjct  7    TKRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTK  66

Query  259  FHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRLNN  438
            +HS DY++FL  I PD    +   ++R+N+GEDCPVFD LFEFCQ+  GG++ +A +LN 
Sbjct  67   YHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVASAVKLNK  126

Query  439  QLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVEEA  618
            Q  D+A+NWAGGLHHAKK EASGFCY+ND+VL ILELLKYH RVLYIDID+HHGDGVEEA
Sbjct  127  QQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEA  186

Query  619  FYFTDR  636
            FY TDR
Sbjct  187  FYTTDR  192



>ref|XP_008314122.1| PREDICTED: histone deacetylase 1 isoform X2 [Cynoglossus semilaevis]
Length=484

 Score =   276 bits (707),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 123/186 (66%), Positives = 150/186 (81%), Gaps = 0/186 (0%)
 Frame = +1

Query  79   SKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMELAQ  258
            +K ++ Y+YDGDVGN Y+G  HPMKPHR+ MTH+L+L YGL+ KMEIYRPHKA   E+ +
Sbjct  8    TKKKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKASGEEMTK  67

Query  259  FHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRLNN  438
            +HS DY++FL  I PD    +   ++R+N+GEDCPVFD LFEFCQ+  GG++  A +LN 
Sbjct  68   YHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSGGGSVAGAVKLNK  127

Query  439  QLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVEEA  618
            Q  D+AINWAGGLHHAKK EASGFCY+ND+VL ILELLKYH RVLYIDID+HHGDGVEEA
Sbjct  128  QQTDIAINWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEA  187

Query  619  FYFTDR  636
            FY TDR
Sbjct  188  FYTTDR  193



>ref|XP_394976.4| PREDICTED: histone deacetylase Rpd3 isoform 1 [Apis mellifera]
 ref|XP_006617807.1| PREDICTED: histone deacetylase Rpd3-like [Apis dorsata]
Length=492

 Score =   276 bits (707),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 124/186 (67%), Positives = 149/186 (80%), Gaps = 0/186 (0%)
 Frame = +1

Query  79   SKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMELAQ  258
            SK R+ Y+YD D+GN Y+G  HPMKPHR+ MTH+L+L YGL+ KMEIYRPHKA   E+ +
Sbjct  7    SKKRVCYYYDSDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATADEMTK  66

Query  259  FHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRLNN  438
            FHS DY+ FL  I PD    +   ++R+N+GEDCPVFD L+EFCQ+ AGG++ AA +LN 
Sbjct  67   FHSDDYIRFLRSIRPDNMSEYNKQMQRFNVGEDCPVFDGLYEFCQLSAGGSVAAAVKLNK  126

Query  439  QLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVEEA  618
            Q  ++ INW GGLHHAKK EASGFCY+ND+VLGILELLKYH RVLYIDIDVHHGDGVEEA
Sbjct  127  QASEICINWGGGLHHAKKSEASGFCYVNDIVLGILELLKYHQRVLYIDIDVHHGDGVEEA  186

Query  619  FYFTDR  636
            FY TDR
Sbjct  187  FYTTDR  192



>ref|XP_010770908.1| PREDICTED: histone deacetylase 1 [Notothenia coriiceps]
Length=490

 Score =   276 bits (707),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 123/186 (66%), Positives = 150/186 (81%), Gaps = 0/186 (0%)
 Frame = +1

Query  79   SKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMELAQ  258
            +K ++ Y+YDGDVGN Y+G  HPMKPHR+ MTH+L+L YGL+ KMEIYRPHKA   E+ +
Sbjct  8    TKKKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKASGEEMTK  67

Query  259  FHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRLNN  438
            +HS DY++FL  I PD    +   ++R+N+GEDCPVFD LFEFCQ+  GG++  A +LN 
Sbjct  68   YHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSGGGSVAGAVKLNK  127

Query  439  QLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVEEA  618
            Q  D+AINWAGGLHHAKK EASGFCY+ND+VL ILELLKYH RVLYIDID+HHGDGVEEA
Sbjct  128  QQTDIAINWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEA  187

Query  619  FYFTDR  636
            FY TDR
Sbjct  188  FYTTDR  193



>ref|XP_008283856.1| PREDICTED: histone deacetylase 2 isoform X2 [Stegastes partitus]
Length=489

 Score =   276 bits (707),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 122/186 (66%), Positives = 150/186 (81%), Gaps = 0/186 (0%)
 Frame = +1

Query  79   SKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMELAQ  258
            +K ++ Y+YDGD+GN Y+G  HPMKPHR+ MTH+L+L YGL+ KMEIYRPHKA   E+ +
Sbjct  9    TKKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATADEMTK  68

Query  259  FHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRLNN  438
            +HS DY++FL  I PD    F   ++R+N+GEDCPVFD LFEFCQ+ AGG+   + +LN 
Sbjct  69   YHSDDYIKFLRSIRPDNMSEFSKQMQRFNVGEDCPVFDGLFEFCQLSAGGSAAGSVKLNR  128

Query  439  QLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVEEA  618
            Q  D+A+NWAGGLHHAKK EASGFCY+ND+VL ILELLKYH RVLYIDID+HHGDGVEEA
Sbjct  129  QQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEA  188

Query  619  FYFTDR  636
            FY TDR
Sbjct  189  FYTTDR  194



>ref|XP_008283855.1| PREDICTED: histone deacetylase 2 isoform X1 [Stegastes partitus]
Length=490

 Score =   276 bits (707),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 122/186 (66%), Positives = 150/186 (81%), Gaps = 0/186 (0%)
 Frame = +1

Query  79   SKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMELAQ  258
            +K ++ Y+YDGD+GN Y+G  HPMKPHR+ MTH+L+L YGL+ KMEIYRPHKA   E+ +
Sbjct  9    TKKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATADEMTK  68

Query  259  FHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRLNN  438
            +HS DY++FL  I PD    F   ++R+N+GEDCPVFD LFEFCQ+ AGG+   + +LN 
Sbjct  69   YHSDDYIKFLRSIRPDNMSEFSKQMQRFNVGEDCPVFDGLFEFCQLSAGGSAAGSVKLNR  128

Query  439  QLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVEEA  618
            Q  D+A+NWAGGLHHAKK EASGFCY+ND+VL ILELLKYH RVLYIDID+HHGDGVEEA
Sbjct  129  QQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEA  188

Query  619  FYFTDR  636
            FY TDR
Sbjct  189  FYTTDR  194



>ref|XP_005812507.1| PREDICTED: probable histone deacetylase 1-B-like [Xiphophorus 
maculatus]
 ref|XP_008419626.1| PREDICTED: probable histone deacetylase 1-B [Poecilia reticulata]
Length=482

 Score =   276 bits (706),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 123/186 (66%), Positives = 150/186 (81%), Gaps = 0/186 (0%)
 Frame = +1

Query  79   SKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMELAQ  258
            +K ++ Y+YDGDVGN Y+G  HPMKPHR+ MTH+L+L YGL+ KMEIYRPHKA   E+ +
Sbjct  7    TKKKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKASAEEMTK  66

Query  259  FHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRLNN  438
            +HS DY++FL  I PD    +   ++R+N+GEDCPVFD LFEFCQ+  GG++  A +LN 
Sbjct  67   YHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAGAVKLNK  126

Query  439  QLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVEEA  618
            Q  D+AINWAGGLHHAKK EASGFCY+ND+VL ILELLKYH RVLYIDID+HHGDGVEEA
Sbjct  127  QQTDIAINWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEA  186

Query  619  FYFTDR  636
            FY TDR
Sbjct  187  FYTTDR  192



>ref|XP_007948636.1| PREDICTED: histone deacetylase 1 [Orycteropus afer afer]
Length=482

 Score =   276 bits (706),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 122/186 (66%), Positives = 151/186 (81%), Gaps = 0/186 (0%)
 Frame = +1

Query  79   SKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMELAQ  258
            +K ++ Y+YDGDVGN Y+G  HPMKPHR+ MTH+L+L YGL+ KMEIYRPHKA   E+ +
Sbjct  7    TKRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTK  66

Query  259  FHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRLNN  438
            +HS DY++FL  I PD    +   ++R+N+GEDCPVFD LFEFCQ+  GG++ +A +LN 
Sbjct  67   YHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVASAVKLNK  126

Query  439  QLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVEEA  618
            Q  D+A+NWAGGLHHAKK EASGFCY+ND+VL ILELLKYH RVLYIDID+HHGDGVEEA
Sbjct  127  QQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEA  186

Query  619  FYFTDR  636
            FY TDR
Sbjct  187  FYTTDR  192



>ref|NP_001265940.1| Probable histone deacetylase 1-B [Salmo salar]
 gb|ACI33471.1| Probable histone deacetylase 1-B [Salmo salar]
Length=498

 Score =   276 bits (707),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 123/186 (66%), Positives = 150/186 (81%), Gaps = 0/186 (0%)
 Frame = +1

Query  79   SKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMELAQ  258
            +K ++ Y+YDGDVGN Y+G  HPMKPHR+ MTH+L+L YGL+ KMEIYRPHKA   E+ +
Sbjct  8    TKKKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANGEEMTK  67

Query  259  FHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRLNN  438
            +HS DY++FL  I PD    +   ++R+N+GEDCPVFD LFEFCQ+  GG++  A +LN 
Sbjct  68   YHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAGAVKLNK  127

Query  439  QLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVEEA  618
            Q  D+AINWAGGLHHAKK EASGFCY+ND+VL ILELLKYH RVLYIDID+HHGDGVEEA
Sbjct  128  QQTDIAINWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEA  187

Query  619  FYFTDR  636
            FY TDR
Sbjct  188  FYTTDR  193



>ref|XP_007563814.1| PREDICTED: probable histone deacetylase 1-B [Poecilia formosa]
Length=482

 Score =   276 bits (706),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 123/186 (66%), Positives = 150/186 (81%), Gaps = 0/186 (0%)
 Frame = +1

Query  79   SKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMELAQ  258
            +K ++ Y+YDGDVGN Y+G  HPMKPHR+ MTH+L+L YGL+ KMEIYRPHKA   E+ +
Sbjct  7    TKKKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKASAEEMTK  66

Query  259  FHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRLNN  438
            +HS DY++FL  I PD    +   ++R+N+GEDCPVFD LFEFCQ+  GG++  A +LN 
Sbjct  67   YHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAGAVKLNK  126

Query  439  QLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVEEA  618
            Q  D+AINWAGGLHHAKK EASGFCY+ND+VL ILELLKYH RVLYIDID+HHGDGVEEA
Sbjct  127  QQTDIAINWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEA  186

Query  619  FYFTDR  636
            FY TDR
Sbjct  187  FYTTDR  192



>ref|XP_005806080.1| PREDICTED: histone deacetylase 2-like [Xiphophorus maculatus]
Length=490

 Score =   276 bits (706),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 121/186 (65%), Positives = 150/186 (81%), Gaps = 0/186 (0%)
 Frame = +1

Query  79   SKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMELAQ  258
            +K ++ Y+YDGD+GN Y+G  HPMKPHR+ MTH+L+L YGL+ KME+YRPHKA   E+ +
Sbjct  9    TKKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEVYRPHKATADEMTK  68

Query  259  FHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRLNN  438
            +HS DY++FL  I PD    F   ++R+N+GEDCPVFD LFEFCQ+ AGG+   + +LN 
Sbjct  69   YHSDDYIKFLKSIRPDNMSEFSKQMQRFNVGEDCPVFDGLFEFCQLSAGGSAAGSVKLNR  128

Query  439  QLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVEEA  618
            Q  D+A+NWAGGLHHAKK EASGFCY+ND+VL ILELLKYH RVLYIDID+HHGDGVEEA
Sbjct  129  QQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEA  188

Query  619  FYFTDR  636
            FY TDR
Sbjct  189  FYTTDR  194



>ref|XP_004519082.1| PREDICTED: histone deacetylase Rpd3-like [Ceratitis capitata]
Length=484

 Score =   276 bits (706),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 124/186 (67%), Positives = 149/186 (80%), Gaps = 0/186 (0%)
 Frame = +1

Query  79   SKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMELAQ  258
            SK R+ Y+YD D+GN Y+G  HPMKPHR+ MTH+L+L YGL+ KMEIYRPHKA   E+ +
Sbjct  5    SKKRVCYYYDSDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATADEMTK  64

Query  259  FHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRLNN  438
            FHS +YV FL  I PD    +   ++R+N+GEDCPVFD L+EFCQ+ AGG++ AA +LN 
Sbjct  65   FHSDEYVRFLRSIRPDNMSEYNKQMQRFNVGEDCPVFDGLYEFCQLSAGGSVAAAVKLNK  124

Query  439  QLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVEEA  618
            Q  ++ INW GGLHHAKK EASGFCY+ND+VLGILELLKYH RVLYIDIDVHHGDGVEEA
Sbjct  125  QASEICINWGGGLHHAKKSEASGFCYVNDIVLGILELLKYHQRVLYIDIDVHHGDGVEEA  184

Query  619  FYFTDR  636
            FY TDR
Sbjct  185  FYTTDR  190



>ref|NP_001084011.1| histone deacetylase 2 [Xenopus laevis]
 gb|AAH81054.1| Hdac2 protein [Xenopus laevis]
Length=488

 Score =   276 bits (706),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 121/186 (65%), Positives = 151/186 (81%), Gaps = 0/186 (0%)
 Frame = +1

Query  79   SKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMELAQ  258
            +K ++ Y+YDGD+GN Y+G  HPMKPHR+ MTH+L+L YGL+ KMEIYRPHKA   E+ +
Sbjct  8    AKKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATAEEMTK  67

Query  259  FHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRLNN  438
            +HS +Y++FL  I PD    +   ++R+N+GEDCPVFD LFEFCQ+  GG++  A +LN 
Sbjct  68   YHSDEYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAGAVKLNR  127

Query  439  QLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVEEA  618
            Q  D+A+NWAGGLHHAKK EASGFCY+ND+VLGILELLKYH RVLYIDID+HHGDGVEEA
Sbjct  128  QQTDMAVNWAGGLHHAKKSEASGFCYVNDIVLGILELLKYHQRVLYIDIDIHHGDGVEEA  187

Query  619  FYFTDR  636
            FY TDR
Sbjct  188  FYTTDR  193



>gb|ETN61439.1| histone deacetylase [Anopheles darlingi]
Length=491

 Score =   276 bits (706),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 124/186 (67%), Positives = 149/186 (80%), Gaps = 0/186 (0%)
 Frame = +1

Query  79   SKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMELAQ  258
            SK R+ Y+YD D+GN Y+G  HPMKPHR+ MTH+L+L YGL+ KMEIYRPHKA   E+ +
Sbjct  5    SKKRVCYYYDSDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATADEMTK  64

Query  259  FHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRLNN  438
            FHS DY+ FL  I PD    +   ++R+N+GEDCPVFD L+EFCQ+ AGG++ AA +LN 
Sbjct  65   FHSDDYIRFLRSIRPDNMSEYNKHMQRFNVGEDCPVFDGLYEFCQLSAGGSVAAAVKLNK  124

Query  439  QLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVEEA  618
            Q  ++ INW GGLHHAKK EASGFCY+ND+VLGILELLKYH RVLYIDIDVHHGDGVEEA
Sbjct  125  QASEICINWGGGLHHAKKSEASGFCYVNDIVLGILELLKYHQRVLYIDIDVHHGDGVEEA  184

Query  619  FYFTDR  636
            FY TDR
Sbjct  185  FYTTDR  190



>ref|XP_003485786.1| PREDICTED: histone deacetylase Rpd3-like [Bombus impatiens]
Length=492

 Score =   276 bits (706),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 124/186 (67%), Positives = 149/186 (80%), Gaps = 0/186 (0%)
 Frame = +1

Query  79   SKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMELAQ  258
            SK R+ Y+YD D+GN Y+G  HPMKPHR+ MTH+L+L YGL+ KMEIYRPHKA   E+ +
Sbjct  7    SKKRVCYYYDSDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATADEMTK  66

Query  259  FHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRLNN  438
            FHS DY+ FL  I PD    +   ++R+N+GEDCPVFD L+EFCQ+ AGG++ AA +LN 
Sbjct  67   FHSDDYIRFLRSIRPDNMSEYNKQMQRFNVGEDCPVFDGLYEFCQLSAGGSVAAAVKLNK  126

Query  439  QLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVEEA  618
            Q  ++ INW GGLHHAKK EASGFCY+ND+VLGILELLKYH RVLYIDIDVHHGDGVEEA
Sbjct  127  QASEICINWGGGLHHAKKSEASGFCYVNDIVLGILELLKYHQRVLYIDIDVHHGDGVEEA  186

Query  619  FYFTDR  636
            FY TDR
Sbjct  187  FYTTDR  192



>ref|XP_007570702.1| PREDICTED: histone deacetylase 2 [Poecilia formosa]
Length=491

 Score =   276 bits (706),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 121/186 (65%), Positives = 150/186 (81%), Gaps = 0/186 (0%)
 Frame = +1

Query  79   SKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMELAQ  258
            +K ++ Y+YDGD+GN Y+G  HPMKPHR+ MTH+L+L YGL+ KME+YRPHKA   E+ +
Sbjct  9    TKKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEVYRPHKATADEMTK  68

Query  259  FHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRLNN  438
            +HS DY++FL  I PD    F   ++R+N+GEDCPVFD LFEFCQ+ AGG+   + +LN 
Sbjct  69   YHSDDYIKFLRSIRPDNMSEFSKQMQRFNVGEDCPVFDGLFEFCQLSAGGSAAGSVKLNR  128

Query  439  QLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVEEA  618
            Q  D+A+NWAGGLHHAKK EASGFCY+ND+VL ILELLKYH RVLYIDID+HHGDGVEEA
Sbjct  129  QQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEA  188

Query  619  FYFTDR  636
            FY TDR
Sbjct  189  FYTTDR  194



>ref|XP_005878413.1| PREDICTED: histone deacetylase 1 [Myotis brandtii]
Length=482

 Score =   276 bits (706),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 121/186 (65%), Positives = 151/186 (81%), Gaps = 0/186 (0%)
 Frame = +1

Query  79   SKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMELAQ  258
            ++ ++ Y+YDGDVGN Y+G  HPMKPHR+ MTH+L+L YGL+ KMEIYRPHKA   E+ +
Sbjct  7    TRRKVCYYYDGDVGNYYYGQGHPMKPHRIGMTHNLLLNYGLYRKMEIYRPHKANAEEMTK  66

Query  259  FHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRLNN  438
            +HS DY++FL  I PD    +   ++R+N+GEDCPVFD LFEFCQ+  GG++ +A +LN 
Sbjct  67   YHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVASAVKLNK  126

Query  439  QLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVEEA  618
            Q  D+A+NWAGGLHHAKK EASGFCY+ND+VL ILELLKYH RVLYIDID+HHGDGVEEA
Sbjct  127  QQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEA  186

Query  619  FYFTDR  636
            FY TDR
Sbjct  187  FYTTDR  192



>ref|XP_004372056.1| PREDICTED: histone deacetylase 1 [Trichechus manatus latirostris]
Length=482

 Score =   276 bits (706),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 122/186 (66%), Positives = 151/186 (81%), Gaps = 0/186 (0%)
 Frame = +1

Query  79   SKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMELAQ  258
            +K ++ Y+YDGDVGN Y+G  HPMKPHR+ MTH+L+L YGL+ KMEIYRPHKA   E+ +
Sbjct  7    TKRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTK  66

Query  259  FHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRLNN  438
            +HS DY++FL  I PD    +   ++R+N+GEDCPVFD LFEFCQ+  GG++ +A +LN 
Sbjct  67   YHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVASAVKLNK  126

Query  439  QLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVEEA  618
            Q  D+A+NWAGGLHHAKK EASGFCY+ND+VL ILELLKYH RVLYIDID+HHGDGVEEA
Sbjct  127  QQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEA  186

Query  619  FYFTDR  636
            FY TDR
Sbjct  187  FYTTDR  192



>gb|AAL89665.1|AF411956_6 histone deacetylase [Takifugu rubripes]
Length=477

 Score =   276 bits (705),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 123/186 (66%), Positives = 150/186 (81%), Gaps = 0/186 (0%)
 Frame = +1

Query  79   SKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMELAQ  258
            +K ++ Y+YDGDVGN Y+G  HPMKPHR+ MTH+L+L YGL+ KMEIYRPHKA   E+ +
Sbjct  8    TKKKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANGEEMTK  67

Query  259  FHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRLNN  438
            +HS DY++FL  I PD    +   ++R+N+GEDCPVFD LFEFCQ+  GG++  A +LN 
Sbjct  68   YHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSVGGSVAGAVKLNK  127

Query  439  QLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVEEA  618
            Q  D+AINWAGGLHHAKK EASGFCY+ND+VL ILELLKYH RVLYIDID+HHGDGVEEA
Sbjct  128  QQTDIAINWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEA  187

Query  619  FYFTDR  636
            FY TDR
Sbjct  188  FYTTDR  193



>gb|EHJ72565.1| histone deacetylase Rpd3 [Danaus plexippus]
Length=481

 Score =   276 bits (705),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 124/186 (67%), Positives = 149/186 (80%), Gaps = 0/186 (0%)
 Frame = +1

Query  79   SKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMELAQ  258
            SK R+ Y+YD D+GN Y+G  HPMKPHR+ MTH+L+L YGL+ KMEIYRPHKA   E+ +
Sbjct  5    SKKRVCYYYDSDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATADEMTK  64

Query  259  FHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRLNN  438
            FHS DY+ FL  I PD    +   ++R+N+GEDCPVFD L+EFCQ+ AGG++ AA +LN 
Sbjct  65   FHSDDYIRFLRSIRPDNMSEYNKQMQRFNVGEDCPVFDGLYEFCQLSAGGSVAAAVKLNK  124

Query  439  QLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVEEA  618
            Q  ++ INW GGLHHAKK EASGFCY+ND+VLGILELLKYH RVLYIDIDVHHGDGVEEA
Sbjct  125  QASEICINWGGGLHHAKKSEASGFCYVNDIVLGILELLKYHQRVLYIDIDVHHGDGVEEA  184

Query  619  FYFTDR  636
            FY TDR
Sbjct  185  FYTTDR  190



>ref|XP_005100475.1| PREDICTED: histone deacetylase 2-like isoform X2 [Aplysia californica]
Length=486

 Score =   276 bits (706),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 122/185 (66%), Positives = 150/185 (81%), Gaps = 0/185 (0%)
 Frame = +1

Query  82   KDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMELAQF  261
            K +I Y+YDGD+GN Y+G  HPMKPHR+ MTH+L+L YGL+ KMEIYRPHKA   E+ +F
Sbjct  7    KRKICYYYDGDIGNYYYGQGHPMKPHRIRMTHNLILNYGLYRKMEIYRPHKATAEEMTKF  66

Query  262  HSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRLNNQ  441
            HS DY++FL  I PD    +   ++R+N+GEDCPVFD ++EFCQ+  GG++  A +LN Q
Sbjct  67   HSDDYIKFLRSIRPDNMAEYNKQMQRFNVGEDCPVFDGMYEFCQLSTGGSVAGAVKLNKQ  126

Query  442  LCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVEEAF  621
              D+AINWAGGLHHAKK EASGFCY+ND+VLGILELLKYH RVLY+DID+HHGDGVEEAF
Sbjct  127  AADIAINWAGGLHHAKKSEASGFCYVNDIVLGILELLKYHQRVLYVDIDIHHGDGVEEAF  186

Query  622  YFTDR  636
            Y TDR
Sbjct  187  YTTDR  191



>gb|KFB51427.1| histone deacetylase Rpd3 [Anopheles sinensis]
Length=488

 Score =   276 bits (706),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 124/186 (67%), Positives = 149/186 (80%), Gaps = 0/186 (0%)
 Frame = +1

Query  79   SKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMELAQ  258
            SK R+ Y+YD D+GN Y+G  HPMKPHR+ MTH+L+L YGL+ KMEIYRPHKA   E+ +
Sbjct  5    SKKRVCYYYDSDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATADEMTK  64

Query  259  FHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRLNN  438
            FHS DY+ FL  I PD    +   ++R+N+GEDCPVFD L+EFCQ+ AGG++ AA +LN 
Sbjct  65   FHSDDYIRFLRSIRPDNMSEYNKHMQRFNVGEDCPVFDGLYEFCQLSAGGSVAAAVKLNK  124

Query  439  QLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVEEA  618
            Q  ++ INW GGLHHAKK EASGFCY+ND+VLGILELLKYH RVLYIDIDVHHGDGVEEA
Sbjct  125  QASEICINWGGGLHHAKKSEASGFCYVNDIVLGILELLKYHQRVLYIDIDVHHGDGVEEA  184

Query  619  FYFTDR  636
            FY TDR
Sbjct  185  FYTTDR  190



>ref|XP_010619862.1| PREDICTED: histone deacetylase 1 [Fukomys damarensis]
 gb|KFO34419.1| Histone deacetylase 1 [Fukomys damarensis]
Length=482

 Score =   276 bits (705),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 121/186 (65%), Positives = 151/186 (81%), Gaps = 0/186 (0%)
 Frame = +1

Query  79   SKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMELAQ  258
            ++ ++ Y+YDGDVGN Y+G  HPMKPHR+ MTH+L+L YGL+ KMEIYRPHKA   E+ +
Sbjct  7    TRRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTK  66

Query  259  FHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRLNN  438
            +HS DY++FL  I PD    +   ++R+N+GEDCPVFD LFEFCQ+  GG++ +A +LN 
Sbjct  67   YHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVASAVKLNK  126

Query  439  QLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVEEA  618
            Q  D+A+NWAGGLHHAKK EASGFCY+ND+VL ILELLKYH RVLYIDID+HHGDGVEEA
Sbjct  127  QQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEA  186

Query  619  FYFTDR  636
            FY TDR
Sbjct  187  FYTTDR  192



>dbj|BAA08909.1| RPD3 protein [Homo sapiens]
 gb|AAX36503.1| histone deacetylase 1 [synthetic construct]
Length=482

 Score =   276 bits (705),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 121/186 (65%), Positives = 151/186 (81%), Gaps = 0/186 (0%)
 Frame = +1

Query  79   SKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMELAQ  258
            ++ ++ Y+YDGDVGN Y+G  HPMKPHR+ MTH+L+L YGL+ KMEIYRPHKA   E+ +
Sbjct  7    TRRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTK  66

Query  259  FHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRLNN  438
            +HS DY++FL  I PD    +   ++R+N+GEDCPVFD LFEFCQ+  GG++ +A +LN 
Sbjct  67   YHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVASAVKLNK  126

Query  439  QLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVEEA  618
            Q  D+A+NWAGGLHHAKK EASGFCY+ND+VL ILELLKYH RVLYIDID+HHGDGVEEA
Sbjct  127  QQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEA  186

Query  619  FYFTDR  636
            FY TDR
Sbjct  187  FYTTDR  192



>ref|XP_011181413.1| PREDICTED: histone deacetylase Rpd3 isoform X1 [Bactrocera cucurbitae]
Length=484

 Score =   276 bits (705),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 124/186 (67%), Positives = 149/186 (80%), Gaps = 0/186 (0%)
 Frame = +1

Query  79   SKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMELAQ  258
            SK R+ Y+YD D+GN Y+G  HPMKPHR+ MTH+L+L YGL+ KMEIYRPHKA   E+ +
Sbjct  5    SKKRVCYYYDSDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATADEMTK  64

Query  259  FHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRLNN  438
            FHS +YV FL  I PD    +   ++R+N+GEDCPVFD L+EFCQ+ AGG++ AA +LN 
Sbjct  65   FHSDEYVRFLRSIRPDNMSEYNKQMQRFNVGEDCPVFDGLYEFCQLSAGGSVAAAVKLNK  124

Query  439  QLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVEEA  618
            Q  ++ INW GGLHHAKK EASGFCY+ND+VLGILELLKYH RVLYIDIDVHHGDGVEEA
Sbjct  125  QASEICINWGGGLHHAKKSEASGFCYVNDIVLGILELLKYHQRVLYIDIDVHHGDGVEEA  184

Query  619  FYFTDR  636
            FY TDR
Sbjct  185  FYTTDR  190



>ref|XP_011204627.1| PREDICTED: histone deacetylase Rpd3 [Bactrocera dorsalis]
Length=484

 Score =   276 bits (705),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 124/186 (67%), Positives = 149/186 (80%), Gaps = 0/186 (0%)
 Frame = +1

Query  79   SKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMELAQ  258
            SK R+ Y+YD D+GN Y+G  HPMKPHR+ MTH+L+L YGL+ KMEIYRPHKA   E+ +
Sbjct  5    SKKRVCYYYDSDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATADEMTK  64

Query  259  FHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRLNN  438
            FHS +YV FL  I PD    +   ++R+N+GEDCPVFD L+EFCQ+ AGG++ AA +LN 
Sbjct  65   FHSDEYVRFLRSIRPDNMSEYNKQMQRFNVGEDCPVFDGLYEFCQLSAGGSVAAAVKLNK  124

Query  439  QLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVEEA  618
            Q  ++ INW GGLHHAKK EASGFCY+ND+VLGILELLKYH RVLYIDIDVHHGDGVEEA
Sbjct  125  QASEICINWGGGLHHAKKSEASGFCYVNDIVLGILELLKYHQRVLYIDIDVHHGDGVEEA  184

Query  619  FYFTDR  636
            FY TDR
Sbjct  185  FYTTDR  190



>ref|XP_007249466.1| PREDICTED: probable histone deacetylase 1-B-like isoform X1 [Astyanax 
mexicanus]
Length=488

 Score =   276 bits (705),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 123/186 (66%), Positives = 150/186 (81%), Gaps = 0/186 (0%)
 Frame = +1

Query  79   SKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMELAQ  258
            +K ++ Y+YDGDVGN Y+G  HPMKPHR+ MTH+L+L YGL+ KMEIYRPHKA   E+ +
Sbjct  8    TKKKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANGEEMTK  67

Query  259  FHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRLNN  438
            +HS DY++FL  I PD    +   ++R+N+GEDCPVFD LFEFCQ+  GG++  A +LN 
Sbjct  68   YHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAGAVKLNK  127

Query  439  QLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVEEA  618
            Q  D+AINWAGGLHHAKK EASGFCY+ND+VL ILELLKYH RVLYIDID+HHGDGVEEA
Sbjct  128  QQTDIAINWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEA  187

Query  619  FYFTDR  636
            FY TDR
Sbjct  188  FYTTDR  193



>ref|XP_010731445.1| PREDICTED: probable histone deacetylase 1-B [Larimichthys crocea]
Length=482

 Score =   276 bits (705),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 123/186 (66%), Positives = 150/186 (81%), Gaps = 0/186 (0%)
 Frame = +1

Query  79   SKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMELAQ  258
            +K ++ Y+YDGDVGN Y+G  HPMKPHR+ MTH+L+L YGL+ KMEIYRPHKA   E+ +
Sbjct  7    TKKKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKASGEEMTK  66

Query  259  FHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRLNN  438
            +HS DY++FL  I PD    +   ++R+N+GEDCPVFD LFEFCQ+  GG++  A +LN 
Sbjct  67   YHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAGALKLNK  126

Query  439  QLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVEEA  618
            Q  D+AINWAGGLHHAKK EASGFCY+ND+VL ILELLKYH RVLYIDID+HHGDGVEEA
Sbjct  127  QQTDIAINWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEA  186

Query  619  FYFTDR  636
            FY TDR
Sbjct  187  FYTTDR  192



>ref|XP_003471128.1| PREDICTED: histone deacetylase 1 [Cavia porcellus]
Length=482

 Score =   276 bits (705),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 121/186 (65%), Positives = 151/186 (81%), Gaps = 0/186 (0%)
 Frame = +1

Query  79   SKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMELAQ  258
            ++ ++ Y+YDGDVGN Y+G  HPMKPHR+ MTH+L+L YGL+ KMEIYRPHKA   E+ +
Sbjct  7    TRRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTK  66

Query  259  FHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRLNN  438
            +HS DY++FL  I PD    +   ++R+N+GEDCPVFD LFEFCQ+  GG++ +A +LN 
Sbjct  67   YHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVASAVKLNK  126

Query  439  QLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVEEA  618
            Q  D+A+NWAGGLHHAKK EASGFCY+ND+VL ILELLKYH RVLYIDID+HHGDGVEEA
Sbjct  127  QQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEA  186

Query  619  FYFTDR  636
            FY TDR
Sbjct  187  FYTTDR  192



>ref|XP_003801297.1| PREDICTED: histone deacetylase 1 [Otolemur garnettii]
 ref|XP_005395117.1| PREDICTED: histone deacetylase 1 [Chinchilla lanigera]
 ref|XP_008576439.1| PREDICTED: histone deacetylase 1 [Galeopterus variegatus]
Length=482

 Score =   276 bits (705),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 121/186 (65%), Positives = 151/186 (81%), Gaps = 0/186 (0%)
 Frame = +1

Query  79   SKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMELAQ  258
            ++ ++ Y+YDGDVGN Y+G  HPMKPHR+ MTH+L+L YGL+ KMEIYRPHKA   E+ +
Sbjct  7    TRRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTK  66

Query  259  FHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRLNN  438
            +HS DY++FL  I PD    +   ++R+N+GEDCPVFD LFEFCQ+  GG++ +A +LN 
Sbjct  67   YHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVASAVKLNK  126

Query  439  QLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVEEA  618
            Q  D+A+NWAGGLHHAKK EASGFCY+ND+VL ILELLKYH RVLYIDID+HHGDGVEEA
Sbjct  127  QQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEA  186

Query  619  FYFTDR  636
            FY TDR
Sbjct  187  FYTTDR  192



>ref|XP_008846179.1| PREDICTED: histone deacetylase 1 [Nannospalax galili]
Length=482

 Score =   276 bits (705),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 121/186 (65%), Positives = 151/186 (81%), Gaps = 0/186 (0%)
 Frame = +1

Query  79   SKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMELAQ  258
            ++ ++ Y+YDGDVGN Y+G  HPMKPHR+ MTH+L+L YGL+ KMEIYRPHKA   E+ +
Sbjct  7    TRRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTK  66

Query  259  FHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRLNN  438
            +HS DY++FL  I PD    +   ++R+N+GEDCPVFD LFEFCQ+  GG++ +A +LN 
Sbjct  67   YHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVASAVKLNK  126

Query  439  QLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVEEA  618
            Q  D+A+NWAGGLHHAKK EASGFCY+ND+VL ILELLKYH RVLYIDID+HHGDGVEEA
Sbjct  127  QQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEA  186

Query  619  FYFTDR  636
            FY TDR
Sbjct  187  FYTTDR  192



>ref|XP_005191575.1| PREDICTED: histone deacetylase Rpd3 [Musca domestica]
Length=485

 Score =   276 bits (705),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 124/186 (67%), Positives = 149/186 (80%), Gaps = 0/186 (0%)
 Frame = +1

Query  79   SKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMELAQ  258
            SK R+ Y+YD D+GN Y+G  HPMKPHR+ MTH+L+L YGL+ KMEIYRPHKA   E+ +
Sbjct  6    SKKRVCYYYDSDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATADEMTK  65

Query  259  FHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRLNN  438
            FHS +YV FL  I PD    +   ++R+N+GEDCPVFD L+EFCQ+ AGG++ AA +LN 
Sbjct  66   FHSDEYVRFLRSIRPDNMTEYNKQMQRFNVGEDCPVFDGLYEFCQLSAGGSVAAAVKLNK  125

Query  439  QLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVEEA  618
            Q  ++ INW GGLHHAKK EASGFCY+ND+VLGILELLKYH RVLYIDIDVHHGDGVEEA
Sbjct  126  QASEICINWGGGLHHAKKSEASGFCYVNDIVLGILELLKYHQRVLYIDIDVHHGDGVEEA  185

Query  619  FYFTDR  636
            FY TDR
Sbjct  186  FYTTDR  191



>ref|XP_001649446.1| AAEL004586-PA [Aedes aegypti]
 gb|EAT44002.1| AAEL004586-PA [Aedes aegypti]
Length=468

 Score =   275 bits (704),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 124/186 (67%), Positives = 149/186 (80%), Gaps = 0/186 (0%)
 Frame = +1

Query  79   SKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMELAQ  258
            SK R+ Y+YD D+GN Y+G  HPMKPHR+ MTH+L+L YGL+ KMEIYRPHKA   E+ +
Sbjct  5    SKKRVCYYYDSDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATADEMTK  64

Query  259  FHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRLNN  438
            FHS DY+ FL  I PD    +   ++R+N+GEDCPVFD L+EFCQ+ AGG++ AA +LN 
Sbjct  65   FHSDDYIRFLRSIRPDNMSEYNKQMQRFNVGEDCPVFDGLYEFCQLSAGGSVAAAVKLNK  124

Query  439  QLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVEEA  618
            Q  ++ INW GGLHHAKK EASGFCY+ND+VLGILELLKYH RVLYIDIDVHHGDGVEEA
Sbjct  125  QASEICINWGGGLHHAKKSEASGFCYVNDIVLGILELLKYHQRVLYIDIDVHHGDGVEEA  184

Query  619  FYFTDR  636
            FY TDR
Sbjct  185  FYTTDR  190



>ref|XP_006924353.1| PREDICTED: histone deacetylase 1 [Pteropus alecto]
 ref|XP_011356151.1| PREDICTED: histone deacetylase 1 [Pteropus vampyrus]
 gb|ELK02014.1| Histone deacetylase 1 [Pteropus alecto]
Length=482

 Score =   276 bits (705),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 121/186 (65%), Positives = 151/186 (81%), Gaps = 0/186 (0%)
 Frame = +1

Query  79   SKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMELAQ  258
            ++ ++ Y+YDGDVGN Y+G  HPMKPHR+ MTH+L+L YGL+ KMEIYRPHKA   E+ +
Sbjct  7    TRRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTK  66

Query  259  FHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRLNN  438
            +HS DY++FL  I PD    +   ++R+N+GEDCPVFD LFEFCQ+  GG++ +A +LN 
Sbjct  67   YHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVASAVKLNK  126

Query  439  QLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVEEA  618
            Q  D+A+NWAGGLHHAKK EASGFCY+ND+VL ILELLKYH RVLYIDID+HHGDGVEEA
Sbjct  127  QQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEA  186

Query  619  FYFTDR  636
            FY TDR
Sbjct  187  FYTTDR  192



>ref|XP_004563736.1| PREDICTED: probable histone deacetylase 1-B-like [Maylandia zebra]
 ref|XP_005745285.1| PREDICTED: probable histone deacetylase 1-B-like [Pundamilia 
nyererei]
 ref|XP_005950653.1| PREDICTED: probable histone deacetylase 1-B-like [Haplochromis 
burtoni]
 ref|XP_006806094.1| PREDICTED: probable histone deacetylase 1-B-like [Neolamprologus 
brichardi]
Length=482

 Score =   276 bits (705),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 123/186 (66%), Positives = 150/186 (81%), Gaps = 0/186 (0%)
 Frame = +1

Query  79   SKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMELAQ  258
            +K ++ Y+YDGDVGN Y+G  HPMKPHR+ MTH+L+L YGL+ KMEIYRPHKA   E+ +
Sbjct  7    TKKKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKASGEEMTK  66

Query  259  FHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRLNN  438
            +HS DY++FL  I PD    +   ++R+N+GEDCPVFD LFEFCQ+  GG++  A +LN 
Sbjct  67   YHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAGAVKLNK  126

Query  439  QLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVEEA  618
            Q  D+AINWAGGLHHAKK EASGFCY+ND+VL ILELLKYH RVLYIDID+HHGDGVEEA
Sbjct  127  QQTDIAINWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEA  186

Query  619  FYFTDR  636
            FY TDR
Sbjct  187  FYTTDR  192



>gb|AAP36140.1| Homo sapiens histone deacetylase 1 [synthetic construct]
 gb|AAX43347.1| histone deacetylase 1, partial [synthetic construct]
Length=483

 Score =   276 bits (705),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 121/186 (65%), Positives = 151/186 (81%), Gaps = 0/186 (0%)
 Frame = +1

Query  79   SKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMELAQ  258
            ++ ++ Y+YDGDVGN Y+G  HPMKPHR+ MTH+L+L YGL+ KMEIYRPHKA   E+ +
Sbjct  7    TRRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTK  66

Query  259  FHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRLNN  438
            +HS DY++FL  I PD    +   ++R+N+GEDCPVFD LFEFCQ+  GG++ +A +LN 
Sbjct  67   YHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVASAVKLNK  126

Query  439  QLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVEEA  618
            Q  D+A+NWAGGLHHAKK EASGFCY+ND+VL ILELLKYH RVLYIDID+HHGDGVEEA
Sbjct  127  QQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEA  186

Query  619  FYFTDR  636
            FY TDR
Sbjct  187  FYTTDR  192



>pdb|3MAX|A Chain A, Crystal Structure Of Human Hdac2 Complexed With An N-(2-Amin 
Benzamide
 pdb|3MAX|B Chain B, Crystal Structure Of Human Hdac2 Complexed With An N-(2-Amin 
Benzamide
 pdb|3MAX|C Chain C, Crystal Structure Of Human Hdac2 Complexed With An N-(2-Amin 
Benzamide
Length=367

 Score =   272 bits (695),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 120/186 (65%), Positives = 150/186 (81%), Gaps = 0/186 (0%)
 Frame = +1

Query  79   SKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMELAQ  258
            +K ++ Y+YDGD+GN Y+G  HPMKPHR+ MTH+L+L YGL+ KMEIYRPHKA   E+ +
Sbjct  1    AKKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATAEEMTK  60

Query  259  FHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRLNN  438
            +HS +Y++FL  I PD    +   ++R+N+GEDCPVFD LFEFCQ+  GG++  A +LN 
Sbjct  61   YHSDEYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAGAVKLNR  120

Query  439  QLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVEEA  618
            Q  D+A+NWAGGLHHAKK EASGFCY+ND+VL ILELLKYH RVLYIDID+HHGDGVEEA
Sbjct  121  QQTDMAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEA  180

Query  619  FYFTDR  636
            FY TDR
Sbjct  181  FYTTDR  186



>dbj|BAG70111.1| histone deacetylase 1 [Homo sapiens]
Length=482

 Score =   276 bits (705),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 121/186 (65%), Positives = 151/186 (81%), Gaps = 0/186 (0%)
 Frame = +1

Query  79   SKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMELAQ  258
            ++ ++ Y+YDGDVGN Y+G  HPMKPHR+ MTH+L+L YGL+ KMEIYRPHKA   E+ +
Sbjct  7    TRRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTK  66

Query  259  FHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRLNN  438
            +HS DY++FL  I PD    +   ++R+N+GEDCPVFD LFEFCQ+  GG++ +A +LN 
Sbjct  67   YHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVASAVKLNK  126

Query  439  QLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVEEA  618
            Q  D+A+NWAGGLHHAKK EASGFCY+ND+VL ILELLKYH RVLYIDID+HHGDGVEEA
Sbjct  127  QQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEA  186

Query  619  FYFTDR  636
            FY TDR
Sbjct  187  FYTTDR  192



>gb|KDO17456.1| hypothetical protein SPRG_17124 [Saprolegnia parasitica CBS 223.65]
Length=211

 Score =   266 bits (681),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 125/187 (67%), Positives = 147/187 (79%), Gaps = 2/187 (1%)
 Frame = +1

Query  82   KDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMELAQF  261
            K R+SYFY  + GN Y+GP HPMKPHRL + HHLVL Y L  KME+++PH A P E+  F
Sbjct  3    KPRVSYFYHPEEGNFYYGPGHPMKPHRLKLAHHLVLNYDLFRKMEVFQPHWASPEEIKAF  62

Query  262  HSADYVEFLHRITPDTQHLFGIDLKRYNLGE--DCPVFDNLFEFCQIYAGGTIDAARRLN  435
            H+ADYV+FL +++P T+      + +YN+GE  DCPVFD +F F QI AGG++DAA RLN
Sbjct  63   HAADYVDFLQKVSPSTEKSMQTQVDKYNMGEFSDCPVFDGVFNFSQISAGGSLDAAYRLN  122

Query  436  NQLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVEE  615
              L D+ INWAGGLHHAKK EASGFCYIND+VLGILELLKYH RVLYIDIDVHHGDGVEE
Sbjct  123  QGLSDICINWAGGLHHAKKAEASGFCYINDIVLGILELLKYHARVLYIDIDVHHGDGVEE  182

Query  616  AFYFTDR  636
            AFY TDR
Sbjct  183  AFYVTDR  189



>ref|NP_001079396.1| histone deacetylase 1 [Xenopus laevis]
 gb|AAH41296.1| MGC53583 protein [Xenopus laevis]
Length=480

 Score =   275 bits (704),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 119/186 (64%), Positives = 151/186 (81%), Gaps = 0/186 (0%)
 Frame = +1

Query  79   SKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMELAQ  258
            +K ++ Y+YDGDVGN Y+G  HPMKPHR+ MTH+L+L YGL+ KMEIYRPHKA   E+ +
Sbjct  7    TKKKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKASAEEMTK  66

Query  259  FHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRLNN  438
            +HS DY++FL  I PD    +   ++R+N+GEDCPVFD LFEFCQ+  GG++ +A +LN 
Sbjct  67   YHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVASAVKLNK  126

Query  439  QLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVEEA  618
            Q  D+++NW+GGLHHAKK EASGFCY+ND+VL ILELLKYH RV+YIDID+HHGDGVEEA
Sbjct  127  QQTDISVNWSGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVVYIDIDIHHGDGVEEA  186

Query  619  FYFTDR  636
            FY TDR
Sbjct  187  FYTTDR  192



>ref|XP_003443815.1| PREDICTED: probable histone deacetylase 1-B-like [Oreochromis 
niloticus]
Length=482

 Score =   275 bits (704),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 123/186 (66%), Positives = 150/186 (81%), Gaps = 0/186 (0%)
 Frame = +1

Query  79   SKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMELAQ  258
            +K ++ Y+YDGDVGN Y+G  HPMKPHR+ MTH+L+L YGL+ KMEIYRPHKA   E+ +
Sbjct  7    TKKKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKASGEEMTK  66

Query  259  FHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRLNN  438
            +HS DY++FL  I PD    +   ++R+N+GEDCPVFD LFEFCQ+  GG++  A +LN 
Sbjct  67   YHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAGAVKLNK  126

Query  439  QLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVEEA  618
            Q  D+AINWAGGLHHAKK EASGFCY+ND+VL ILELLKYH RVLYIDID+HHGDGVEEA
Sbjct  127  QQTDIAINWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEA  186

Query  619  FYFTDR  636
            FY TDR
Sbjct  187  FYTTDR  192



>ref|XP_006094298.1| PREDICTED: histone deacetylase 1 [Myotis lucifugus]
 ref|XP_008155228.1| PREDICTED: histone deacetylase 1 [Eptesicus fuscus]
Length=482

 Score =   275 bits (704),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 121/186 (65%), Positives = 151/186 (81%), Gaps = 0/186 (0%)
 Frame = +1

Query  79   SKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMELAQ  258
            ++ ++ Y+YDGDVGN Y+G  HPMKPHR+ MTH+L+L YGL+ KMEIYRPHKA   E+ +
Sbjct  7    TRRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTK  66

Query  259  FHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRLNN  438
            +HS DY++FL  I PD    +   ++R+N+GEDCPVFD LFEFCQ+  GG++ +A +LN 
Sbjct  67   YHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVASAVKLNK  126

Query  439  QLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVEEA  618
            Q  D+A+NWAGGLHHAKK EASGFCY+ND+VL ILELLKYH RVLYIDID+HHGDGVEEA
Sbjct  127  QQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEA  186

Query  619  FYFTDR  636
            FY TDR
Sbjct  187  FYTTDR  192



>ref|XP_003828201.1| PREDICTED: histone deacetylase 1 [Pan paniscus]
 ref|XP_005544162.1| PREDICTED: histone deacetylase 1 isoform X1 [Macaca fascicularis]
 ref|XP_007977777.1| PREDICTED: histone deacetylase 1 isoform X1 [Chlorocebus sabaeus]
 ref|XP_009453836.1| PREDICTED: histone deacetylase 1 isoform X1 [Pan troglodytes]
 ref|XP_010352359.1| PREDICTED: histone deacetylase 1 [Rhinopithecus roxellana]
Length=482

 Score =   275 bits (704),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 121/186 (65%), Positives = 151/186 (81%), Gaps = 0/186 (0%)
 Frame = +1

Query  79   SKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMELAQ  258
            ++ ++ Y+YDGDVGN Y+G  HPMKPHR+ MTH+L+L YGL+ KMEIYRPHKA   E+ +
Sbjct  7    TRRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTK  66

Query  259  FHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRLNN  438
            +HS DY++FL  I PD    +   ++R+N+GEDCPVFD LFEFCQ+  GG++ +A +LN 
Sbjct  67   YHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVASAVKLNK  126

Query  439  QLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVEEA  618
            Q  D+A+NWAGGLHHAKK EASGFCY+ND+VL ILELLKYH RVLYIDID+HHGDGVEEA
Sbjct  127  QQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEA  186

Query  619  FYFTDR  636
            FY TDR
Sbjct  187  FYTTDR  192



>ref|XP_004025419.1| PREDICTED: histone deacetylase 1 isoform 1 [Gorilla gorilla gorilla]
Length=482

 Score =   275 bits (704),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 121/186 (65%), Positives = 151/186 (81%), Gaps = 0/186 (0%)
 Frame = +1

Query  79   SKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMELAQ  258
            ++ ++ Y+YDGDVGN Y+G  HPMKPHR+ MTH+L+L YGL+ KMEIYRPHKA   E+ +
Sbjct  7    TRRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTK  66

Query  259  FHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRLNN  438
            +HS DY++FL  I PD    +   ++R+N+GEDCPVFD LFEFCQ+  GG++ +A +LN 
Sbjct  67   YHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVASAVKLNK  126

Query  439  QLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVEEA  618
            Q  D+A+NWAGGLHHAKK EASGFCY+ND+VL ILELLKYH RVLYIDID+HHGDGVEEA
Sbjct  127  QQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEA  186

Query  619  FYFTDR  636
            FY TDR
Sbjct  187  FYTTDR  192



>ref|NP_004955.2| histone deacetylase 1 [Homo sapiens]
 ref|NP_001125738.1| histone deacetylase 1 [Pongo abelii]
 sp|Q13547.1|HDAC1_HUMAN RecName: Full=Histone deacetylase 1; Short=HD1 [Homo sapiens]
 sp|Q5RAG0.1|HDAC1_PONAB RecName: Full=Histone deacetylase 1; Short=HD1 [Pongo abelii]
 pdb|4BKX|B Chain B, The Structure Of Hdac1 In Complex With The Dimeric Elm2-sant 
Domain Of Mta1 From The Nurd Complex
 gb|AAC50475.1| histone deacetylase HD1 [Homo sapiens]
 gb|AAH00301.1| Histone deacetylase 1 [Homo sapiens]
 gb|AAT44863.1| histone deacetylase 1 [Homo sapiens]
 emb|CAG46518.1| HDAC1 [Homo sapiens]
 emb|CAH91250.1| hypothetical protein [Pongo abelii]
 gb|AAX36302.1| histone deacetylase 1 [synthetic construct]
 gb|AAX42342.1| histone deacetylase 1 [synthetic construct]
 gb|EAX07540.1| histone deacetylase 1, isoform CRA_a [Homo sapiens]
 gb|EAX07541.1| histone deacetylase 1, isoform CRA_a [Homo sapiens]
 gb|ABM82324.1| histone deacetylase 1 [synthetic construct]
 gb|ABM85503.1| histone deacetylase 1 [synthetic construct]
 dbj|BAG70244.1| histone deacetylase 1 [Homo sapiens]
 dbj|BAG73249.1| histone deacetylase 1 [synthetic construct]
 gb|AIC48927.1| HDAC1, partial [synthetic construct]
Length=482

 Score =   275 bits (704),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 121/186 (65%), Positives = 151/186 (81%), Gaps = 0/186 (0%)
 Frame = +1

Query  79   SKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMELAQ  258
            ++ ++ Y+YDGDVGN Y+G  HPMKPHR+ MTH+L+L YGL+ KMEIYRPHKA   E+ +
Sbjct  7    TRRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTK  66

Query  259  FHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRLNN  438
            +HS DY++FL  I PD    +   ++R+N+GEDCPVFD LFEFCQ+  GG++ +A +LN 
Sbjct  67   YHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVASAVKLNK  126

Query  439  QLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVEEA  618
            Q  D+A+NWAGGLHHAKK EASGFCY+ND+VL ILELLKYH RVLYIDID+HHGDGVEEA
Sbjct  127  QQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEA  186

Query  619  FYFTDR  636
            FY TDR
Sbjct  187  FYTTDR  192



>emb|CAG09908.1| unnamed protein product, partial [Tetraodon nigroviridis]
Length=486

 Score =   276 bits (705),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 123/186 (66%), Positives = 150/186 (81%), Gaps = 0/186 (0%)
 Frame = +1

Query  79   SKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMELAQ  258
            +K ++ Y+YDGDVGN Y+G  HPMKPHR+ MTH+L+L YGL+ KMEIYRPHKA   E+ +
Sbjct  8    TKKKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANGEEMTK  67

Query  259  FHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRLNN  438
            +HS DY++FL  I PD    +   ++R+N+GEDCPVFD LFEFCQ+  GG++  A +LN 
Sbjct  68   YHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSVGGSVAGAVKLNK  127

Query  439  QLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVEEA  618
            Q  D+AINWAGGLHHAKK EASGFCY+ND+VL ILELLKYH RVLYIDID+HHGDGVEEA
Sbjct  128  QQTDIAINWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEA  187

Query  619  FYFTDR  636
            FY TDR
Sbjct  188  FYTTDR  193



>ref|XP_007170674.1| PREDICTED: histone deacetylase 1 isoform X1 [Balaenoptera acutorostrata 
scammoni]
Length=482

 Score =   275 bits (704),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 121/186 (65%), Positives = 151/186 (81%), Gaps = 0/186 (0%)
 Frame = +1

Query  79   SKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMELAQ  258
            ++ ++ Y+YDGDVGN Y+G  HPMKPHR+ MTH+L+L YGL+ KMEIYRPHKA   E+ +
Sbjct  7    TRRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTK  66

Query  259  FHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRLNN  438
            +HS DY++FL  I PD    +   ++R+N+GEDCPVFD LFEFCQ+  GG++ +A +LN 
Sbjct  67   YHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVASAVKLNK  126

Query  439  QLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVEEA  618
            Q  D+A+NWAGGLHHAKK EASGFCY+ND+VL ILELLKYH RVLYIDID+HHGDGVEEA
Sbjct  127  QQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEA  186

Query  619  FYFTDR  636
            FY TDR
Sbjct  187  FYTTDR  192



>ref|XP_004425952.1| PREDICTED: histone deacetylase 1 [Ceratotherium simum simum]
Length=482

 Score =   275 bits (704),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 121/186 (65%), Positives = 151/186 (81%), Gaps = 0/186 (0%)
 Frame = +1

Query  79   SKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMELAQ  258
            ++ ++ Y+YDGDVGN Y+G  HPMKPHR+ MTH+L+L YGL+ KMEIYRPHKA   E+ +
Sbjct  7    TRRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTK  66

Query  259  FHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRLNN  438
            +HS DY++FL  I PD    +   ++R+N+GEDCPVFD LFEFCQ+  GG++ +A +LN 
Sbjct  67   YHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVASAVKLNK  126

Query  439  QLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVEEA  618
            Q  D+A+NWAGGLHHAKK EASGFCY+ND+VL ILELLKYH RVLYIDID+HHGDGVEEA
Sbjct  127  QQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEA  186

Query  619  FYFTDR  636
            FY TDR
Sbjct  187  FYTTDR  192



>ref|XP_007523321.1| PREDICTED: histone deacetylase 1 [Erinaceus europaeus]
Length=481

 Score =   275 bits (704),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 121/186 (65%), Positives = 151/186 (81%), Gaps = 0/186 (0%)
 Frame = +1

Query  79   SKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMELAQ  258
            ++ ++ Y+YDGDVGN Y+G  HPMKPHR+ MTH+L+L YGL+ KMEIYRPHKA   E+ +
Sbjct  7    TRRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTK  66

Query  259  FHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRLNN  438
            +HS DY++FL  I PD    +   ++R+N+GEDCPVFD LFEFCQ+  GG++ +A +LN 
Sbjct  67   YHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVASAVKLNK  126

Query  439  QLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVEEA  618
            Q  D+A+NWAGGLHHAKK EASGFCY+ND+VL ILELLKYH RVLYIDID+HHGDGVEEA
Sbjct  127  QQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEA  186

Query  619  FYFTDR  636
            FY TDR
Sbjct  187  FYTTDR  192



>ref|XP_009451191.1| PREDICTED: histone deacetylase 1 isoform X2 [Pan troglodytes]
Length=476

 Score =   275 bits (704),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 121/186 (65%), Positives = 151/186 (81%), Gaps = 0/186 (0%)
 Frame = +1

Query  79   SKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMELAQ  258
            ++ ++ Y+YDGDVGN Y+G  HPMKPHR+ MTH+L+L YGL+ KMEIYRPHKA   E+ +
Sbjct  7    TRRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTK  66

Query  259  FHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRLNN  438
            +HS DY++FL  I PD    +   ++R+N+GEDCPVFD LFEFCQ+  GG++ +A +LN 
Sbjct  67   YHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVASAVKLNK  126

Query  439  QLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVEEA  618
            Q  D+A+NWAGGLHHAKK EASGFCY+ND+VL ILELLKYH RVLYIDID+HHGDGVEEA
Sbjct  127  QQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEA  186

Query  619  FYFTDR  636
            FY TDR
Sbjct  187  FYTTDR  192



>ref|XP_007468739.1| PREDICTED: histone deacetylase 1 isoform X2 [Lipotes vexillifer]
Length=482

 Score =   275 bits (704),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 121/186 (65%), Positives = 151/186 (81%), Gaps = 0/186 (0%)
 Frame = +1

Query  79   SKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMELAQ  258
            ++ ++ Y+YDGDVGN Y+G  HPMKPHR+ MTH+L+L YGL+ KMEIYRPHKA   E+ +
Sbjct  7    TRRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTK  66

Query  259  FHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRLNN  438
            +HS DY++FL  I PD    +   ++R+N+GEDCPVFD LFEFCQ+  GG++ +A +LN 
Sbjct  67   YHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVASAVKLNK  126

Query  439  QLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVEEA  618
            Q  D+A+NWAGGLHHAKK EASGFCY+ND+VL ILELLKYH RVLYIDID+HHGDGVEEA
Sbjct  127  QQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEA  186

Query  619  FYFTDR  636
            FY TDR
Sbjct  187  FYTTDR  192



>ref|XP_008869930.1| hypothetical protein H310_06587 [Aphanomyces invadans]
 gb|ETW00932.1| hypothetical protein H310_06587 [Aphanomyces invadans]
Length=438

 Score =   274 bits (701),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 129/187 (69%), Positives = 151/187 (81%), Gaps = 2/187 (1%)
 Frame = +1

Query  82   KDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMELAQF  261
            K R+SYFY  + GN Y+GP HPMKPHRL + HHLVL Y L  KME++ PH A   E+  F
Sbjct  3    KSRVSYFYHPEEGNFYYGPGHPMKPHRLKLAHHLVLNYDLFRKMEVFEPHWASSEEVKAF  62

Query  262  HSADYVEFLHRITPDTQHLFGIDLKRYNLGE--DCPVFDNLFEFCQIYAGGTIDAARRLN  435
            H+ADYVEFL +I+P  +  +  D+ ++N+GE  DCPVFD +F FCQIY+GG++DAA RLN
Sbjct  63   HTADYVEFLKKISPSNEKQYQSDVNKFNVGEFTDCPVFDGIFNFCQIYSGGSLDAAYRLN  122

Query  436  NQLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVEE  615
            + L DVAINWAGGLHHAKK EASGFCYIND+VLGILELLKYHPRVLYIDIDVHHGDGVEE
Sbjct  123  HGLTDVAINWAGGLHHAKKSEASGFCYINDIVLGILELLKYHPRVLYIDIDVHHGDGVEE  182

Query  616  AFYFTDR  636
            AFY TDR
Sbjct  183  AFYVTDR  189



>ref|XP_006196994.1| PREDICTED: histone deacetylase 1 [Vicugna pacos]
 ref|XP_010950464.1| PREDICTED: histone deacetylase 1 [Camelus bactrianus]
 ref|XP_010974376.1| PREDICTED: histone deacetylase 1 [Camelus dromedarius]
Length=482

 Score =   275 bits (704),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 121/186 (65%), Positives = 151/186 (81%), Gaps = 0/186 (0%)
 Frame = +1

Query  79   SKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMELAQ  258
            ++ ++ Y+YDGDVGN Y+G  HPMKPHR+ MTH+L+L YGL+ KMEIYRPHKA   E+ +
Sbjct  7    TRRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTK  66

Query  259  FHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRLNN  438
            +HS DY++FL  I PD    +   ++R+N+GEDCPVFD LFEFCQ+  GG++ +A +LN 
Sbjct  67   YHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVASAVKLNK  126

Query  439  QLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVEEA  618
            Q  D+A+NWAGGLHHAKK EASGFCY+ND+VL ILELLKYH RVLYIDID+HHGDGVEEA
Sbjct  127  QQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEA  186

Query  619  FYFTDR  636
            FY TDR
Sbjct  187  FYTTDR  192



>ref|XP_004266568.1| PREDICTED: histone deacetylase 1 [Orcinus orca]
 ref|XP_007125156.1| PREDICTED: histone deacetylase 1 isoform X3 [Physeter catodon]
Length=482

 Score =   275 bits (704),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 121/186 (65%), Positives = 151/186 (81%), Gaps = 0/186 (0%)
 Frame = +1

Query  79   SKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMELAQ  258
            ++ ++ Y+YDGDVGN Y+G  HPMKPHR+ MTH+L+L YGL+ KMEIYRPHKA   E+ +
Sbjct  7    TRRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTK  66

Query  259  FHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRLNN  438
            +HS DY++FL  I PD    +   ++R+N+GEDCPVFD LFEFCQ+  GG++ +A +LN 
Sbjct  67   YHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVASAVKLNK  126

Query  439  QLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVEEA  618
            Q  D+A+NWAGGLHHAKK EASGFCY+ND+VL ILELLKYH RVLYIDID+HHGDGVEEA
Sbjct  127  QQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEA  186

Query  619  FYFTDR  636
            FY TDR
Sbjct  187  FYTTDR  192



>ref|XP_519834.2| PREDICTED: histone deacetylase 1 isoform X1 [Pan troglodytes]
Length=482

 Score =   275 bits (704),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 121/186 (65%), Positives = 151/186 (81%), Gaps = 0/186 (0%)
 Frame = +1

Query  79   SKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMELAQ  258
            ++ ++ Y+YDGDVGN Y+G  HPMKPHR+ MTH+L+L YGL+ KMEIYRPHKA   E+ +
Sbjct  7    TRRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTK  66

Query  259  FHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRLNN  438
            +HS DY++FL  I PD    +   ++R+N+GEDCPVFD LFEFCQ+  GG++ +A +LN 
Sbjct  67   YHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVASAVKLNK  126

Query  439  QLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVEEA  618
            Q  D+A+NWAGGLHHAKK EASGFCY+ND+VL ILELLKYH RVLYIDID+HHGDGVEEA
Sbjct  127  QQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEA  186

Query  619  FYFTDR  636
            FY TDR
Sbjct  187  FYTTDR  192



>ref|XP_002720761.1| PREDICTED: histone deacetylase 1 [Oryctolagus cuniculus]
Length=482

 Score =   275 bits (704),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 121/186 (65%), Positives = 151/186 (81%), Gaps = 0/186 (0%)
 Frame = +1

Query  79   SKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMELAQ  258
            ++ ++ Y+YDGDVGN Y+G  HPMKPHR+ MTH+L+L YGL+ KMEIYRPHKA   E+ +
Sbjct  7    TRRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTK  66

Query  259  FHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRLNN  438
            +HS DY++FL  I PD    +   ++R+N+GEDCPVFD LFEFCQ+  GG++ +A +LN 
Sbjct  67   YHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVASAVKLNK  126

Query  439  QLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVEEA  618
            Q  D+A+NWAGGLHHAKK EASGFCY+ND+VL ILELLKYH RVLYIDID+HHGDGVEEA
Sbjct  127  QQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEA  186

Query  619  FYFTDR  636
            FY TDR
Sbjct  187  FYTTDR  192



>ref|XP_009453837.1| PREDICTED: histone deacetylase 1 isoform X2 [Pan troglodytes]
Length=476

 Score =   275 bits (703),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 121/186 (65%), Positives = 151/186 (81%), Gaps = 0/186 (0%)
 Frame = +1

Query  79   SKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMELAQ  258
            ++ ++ Y+YDGDVGN Y+G  HPMKPHR+ MTH+L+L YGL+ KMEIYRPHKA   E+ +
Sbjct  7    TRRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTK  66

Query  259  FHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRLNN  438
            +HS DY++FL  I PD    +   ++R+N+GEDCPVFD LFEFCQ+  GG++ +A +LN 
Sbjct  67   YHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVASAVKLNK  126

Query  439  QLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVEEA  618
            Q  D+A+NWAGGLHHAKK EASGFCY+ND+VL ILELLKYH RVLYIDID+HHGDGVEEA
Sbjct  127  QQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEA  186

Query  619  FYFTDR  636
            FY TDR
Sbjct  187  FYTTDR  192



>gb|AAH54208.1| Hdac2 protein, partial [Xenopus laevis]
Length=447

 Score =   274 bits (701),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 121/186 (65%), Positives = 151/186 (81%), Gaps = 0/186 (0%)
 Frame = +1

Query  79   SKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMELAQ  258
            +K ++ Y+YDGD+GN Y+G  HPMKPHR+ MTH+L+L YGL+ KMEIYRPHKA   E+ +
Sbjct  8    AKKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATAEEMTK  67

Query  259  FHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRLNN  438
            +HS +Y++FL  I PD    +   ++R+N+GEDCPVFD LFEFCQ+  GG++  A +LN 
Sbjct  68   YHSDEYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAGAVKLNR  127

Query  439  QLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVEEA  618
            Q  D+A+NWAGGLHHAKK EASGFCY+ND+VLGILELLKYH RVLYIDID+HHGDGVEEA
Sbjct  128  QQTDMAVNWAGGLHHAKKSEASGFCYVNDIVLGILELLKYHQRVLYIDIDIHHGDGVEEA  187

Query  619  FYFTDR  636
            FY TDR
Sbjct  188  FYTTDR  193



>gb|AEE62688.1| unknown [Dendroctonus ponderosae]
 gb|ENN73570.1| hypothetical protein YQE_09818, partial [Dendroctonus ponderosae]
 gb|ERL89485.1| hypothetical protein D910_06851 [Dendroctonus ponderosae]
Length=473

 Score =   275 bits (703),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 123/186 (66%), Positives = 149/186 (80%), Gaps = 0/186 (0%)
 Frame = +1

Query  79   SKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMELAQ  258
            S+ R+ Y+YD D+GN Y+G  HPMKPHR+ MTH+L+L YGL+ KMEIYRPHKA   E+ +
Sbjct  7    SRKRVCYYYDSDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATAEEMTK  66

Query  259  FHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRLNN  438
            FHS DY+ FL  I PD    +   ++R+N+GEDCPVFD L+EFCQ+ AGG++ AA +LN 
Sbjct  67   FHSDDYIRFLRSIRPDNMAEYNKQMQRFNVGEDCPVFDGLYEFCQLSAGGSVAAAVKLNK  126

Query  439  QLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVEEA  618
            Q  ++ INW GGLHHAKK EASGFCY+ND+VLGILELLKYH RVLYIDIDVHHGDGVEEA
Sbjct  127  QASEICINWGGGLHHAKKSEASGFCYVNDIVLGILELLKYHQRVLYIDIDVHHGDGVEEA  186

Query  619  FYFTDR  636
            FY TDR
Sbjct  187  FYTTDR  192



>ref|XP_008300137.1| PREDICTED: probable histone deacetylase 1-B [Stegastes partitus]
Length=482

 Score =   275 bits (704),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 123/186 (66%), Positives = 150/186 (81%), Gaps = 0/186 (0%)
 Frame = +1

Query  79   SKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMELAQ  258
            +K ++ Y+YDGDVGN Y+G  HPMKPHR+ MTH+L+L YGL+ KMEIYRPHKA   E+ +
Sbjct  7    TKKKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKASGEEMTK  66

Query  259  FHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRLNN  438
            +HS DY++FL  I PD    +   ++R+N+GEDCPVFD LFEFCQ+  GG++  A +LN 
Sbjct  67   YHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAGAVKLNK  126

Query  439  QLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVEEA  618
            Q  D+AINWAGGLHHAKK EASGFCY+ND+VL ILELLKYH RVLYIDID+HHGDGVEEA
Sbjct  127  QQTDIAINWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEA  186

Query  619  FYFTDR  636
            FY TDR
Sbjct  187  FYTTDR  192



>ref|XP_544435.2| PREDICTED: histone deacetylase 1 isoform 1 [Canis lupus familiaris]
 ref|XP_003989864.1| PREDICTED: histone deacetylase 1 [Felis catus]
Length=482

 Score =   275 bits (704),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 121/186 (65%), Positives = 151/186 (81%), Gaps = 0/186 (0%)
 Frame = +1

Query  79   SKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMELAQ  258
            ++ ++ Y+YDGDVGN Y+G  HPMKPHR+ MTH+L+L YGL+ KMEIYRPHKA   E+ +
Sbjct  7    TRRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTK  66

Query  259  FHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRLNN  438
            +HS DY++FL  I PD    +   ++R+N+GEDCPVFD LFEFCQ+  GG++ +A +LN 
Sbjct  67   YHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVASAVKLNK  126

Query  439  QLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVEEA  618
            Q  D+A+NWAGGLHHAKK EASGFCY+ND+VL ILELLKYH RVLYIDID+HHGDGVEEA
Sbjct  127  QQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEA  186

Query  619  FYFTDR  636
            FY TDR
Sbjct  187  FYTTDR  192



>ref|XP_003276411.1| PREDICTED: histone deacetylase 1 isoform 1 [Nomascus leucogenys]
Length=482

 Score =   275 bits (704),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 121/186 (65%), Positives = 151/186 (81%), Gaps = 0/186 (0%)
 Frame = +1

Query  79   SKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMELAQ  258
            ++ ++ Y+YDGDVGN Y+G  HPMKPHR+ MTH+L+L YGL+ KMEIYRPHKA   E+ +
Sbjct  7    TRRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTK  66

Query  259  FHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRLNN  438
            +HS DY++FL  I PD    +   ++R+N+GEDCPVFD LFEFCQ+  GG++ +A +LN 
Sbjct  67   YHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVASAVKLNK  126

Query  439  QLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVEEA  618
            Q  D+A+NWAGGLHHAKK EASGFCY+ND+VL ILELLKYH RVLYIDID+HHGDGVEEA
Sbjct  127  QQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEA  186

Query  619  FYFTDR  636
            FY TDR
Sbjct  187  FYTTDR  192



>ref|XP_007249468.1| PREDICTED: probable histone deacetylase 1-B-like isoform X3 [Astyanax 
mexicanus]
Length=484

 Score =   275 bits (704),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 123/186 (66%), Positives = 150/186 (81%), Gaps = 0/186 (0%)
 Frame = +1

Query  79   SKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMELAQ  258
            +K ++ Y+YDGDVGN Y+G  HPMKPHR+ MTH+L+L YGL+ KMEIYRPHKA   E+ +
Sbjct  8    TKKKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANGEEMTK  67

Query  259  FHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRLNN  438
            +HS DY++FL  I PD    +   ++R+N+GEDCPVFD LFEFCQ+  GG++  A +LN 
Sbjct  68   YHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAGAVKLNK  127

Query  439  QLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVEEA  618
            Q  D+AINWAGGLHHAKK EASGFCY+ND+VL ILELLKYH RVLYIDID+HHGDGVEEA
Sbjct  128  QQTDIAINWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEA  187

Query  619  FYFTDR  636
            FY TDR
Sbjct  188  FYTTDR  193



>ref|XP_006862222.1| PREDICTED: histone deacetylase 1 [Chrysochloris asiatica]
Length=482

 Score =   275 bits (704),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 121/186 (65%), Positives = 151/186 (81%), Gaps = 0/186 (0%)
 Frame = +1

Query  79   SKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMELAQ  258
            ++ ++ Y+YDGDVGN Y+G  HPMKPHR+ MTH+L+L YGL+ KMEIYRPHKA   E+ +
Sbjct  7    TRRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTK  66

Query  259  FHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRLNN  438
            +HS DY++FL  I PD    +   ++R+N+GEDCPVFD LFEFCQ+  GG++ +A +LN 
Sbjct  67   YHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVASAVKLNK  126

Query  439  QLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVEEA  618
            Q  D+A+NWAGGLHHAKK EASGFCY+ND+VL ILELLKYH RVLYIDID+HHGDGVEEA
Sbjct  127  QQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEA  186

Query  619  FYFTDR  636
            FY TDR
Sbjct  187  FYTTDR  192



>ref|XP_006734227.1| PREDICTED: histone deacetylase 1 isoform X1 [Leptonychotes weddellii]
Length=482

 Score =   275 bits (703),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 121/186 (65%), Positives = 151/186 (81%), Gaps = 0/186 (0%)
 Frame = +1

Query  79   SKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMELAQ  258
            ++ ++ Y+YDGDVGN Y+G  HPMKPHR+ MTH+L+L YGL+ KMEIYRPHKA   E+ +
Sbjct  7    TRRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTK  66

Query  259  FHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRLNN  438
            +HS DY++FL  I PD    +   ++R+N+GEDCPVFD LFEFCQ+  GG++ +A +LN 
Sbjct  67   YHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVASAVKLNK  126

Query  439  QLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVEEA  618
            Q  D+A+NWAGGLHHAKK EASGFCY+ND+VL ILELLKYH RVLYIDID+HHGDGVEEA
Sbjct  127  QQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEA  186

Query  619  FYFTDR  636
            FY TDR
Sbjct  187  FYTTDR  192



>ref|XP_004740974.1| PREDICTED: histone deacetylase 1 isoform X2 [Mustela putorius 
furo]
 ref|XP_004783241.1| PREDICTED: histone deacetylase 1 isoform X2 [Mustela putorius 
furo]
Length=482

 Score =   275 bits (703),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 121/186 (65%), Positives = 151/186 (81%), Gaps = 0/186 (0%)
 Frame = +1

Query  79   SKDRISYFYDGDVGNVYFGPNHPMKPHRLCMTHHLVLAYGLHNKMEIYRPHKAYPMELAQ  258
            ++ ++ Y+YDGDVGN Y+G  HPMKPHR+ MTH+L+L YGL+ KMEIYRPHKA   E+ +
Sbjct  7    TRRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTK  66

Query  259  FHSADYVEFLHRITPDTQHLFGIDLKRYNLGEDCPVFDNLFEFCQIYAGGTIDAARRLNN  438
            +HS DY++FL  I PD    +   ++R+N+GEDCPVFD LFEFCQ+  GG++ +A +LN 
Sbjct  67   YHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVASAVKLNK  126

Query  439  QLCDVAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHPRVLYIDIDVHHGDGVEEA  618
            Q  D+A+NWAGGLHHAKK EASGFCY+ND+VL ILELLKYH RVLYIDID+HHGDGVEEA
Sbjct  127  QQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEA  186

Query  619  FYFTDR  636
            FY TDR
Sbjct  187  FYTTDR  192



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1553719916385