BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF044I13

Length=798
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|ACF17656.1|  putative glutamine synthase 2                           382   7e-128   Capsicum annuum
ref|XP_009629915.1|  PREDICTED: glutamine synthetase, chloroplastic     380   5e-127   Nicotiana tomentosiformis
ref|XP_009773609.1|  PREDICTED: glutamine synthetase, chloroplastic     379   1e-126   Nicotiana sylvestris
ref|NP_001275177.1|  glutamine synthetase, chloroplastic-like           374   1e-124   Solanum tuberosum [potatoes]
ref|XP_004229461.1|  PREDICTED: glutamine synthetase, chloroplastic     369   1e-122   
ref|XP_011090823.1|  PREDICTED: glutamine synthetase leaf isozyme...    365   2e-121   Sesamum indicum [beniseed]
emb|CDO98975.1|  unnamed protein product                                364   8e-121   Coffea canephora [robusta coffee]
gb|EYU45601.1|  hypothetical protein MIMGU_mgv1a007136mg                363   1e-120   Erythranthe guttata [common monkey flower]
ref|XP_011071523.1|  PREDICTED: glutamine synthetase leaf isozyme...    361   1e-119   Sesamum indicum [beniseed]
emb|CAA47373.2|  glutamate--ammonia ligase                              360   3e-119   Nicotiana sylvestris
ref|XP_010105702.1|  Glutamine synthetase leaf isozyme                  359   6e-119   Morus notabilis
ref|XP_007034566.1|  Glutamine synthetase 2                             361   4e-118   
ref|XP_011006593.1|  PREDICTED: glutamine synthetase leaf isozyme...    357   4e-118   Populus euphratica
ref|XP_002314425.1|  glutamine synthetase family protein                357   5e-118   Populus trichocarpa [western balsam poplar]
ref|XP_006380048.1|  hypothetical protein POPTR_0008s20460g             352   6e-118   
ref|XP_010255852.1|  PREDICTED: glutamine synthetase leaf isozyme...    356   1e-117   Nelumbo nucifera [Indian lotus]
ref|XP_002312733.1|  glutamine synthetase family protein                355   3e-117   
gb|KDO74876.1|  hypothetical protein CISIN_1g013478mg                   352   5e-117   Citrus sinensis [apfelsine]
ref|XP_006419778.1|  hypothetical protein CICLE_v10005007mg             354   7e-117   Citrus clementina [clementine]
gb|KDO74872.1|  hypothetical protein CISIN_1g013478mg                   354   8e-117   Citrus sinensis [apfelsine]
dbj|BAF62340.1|  glutamine synthetase                                   353   9e-117   Avicennia marina
gb|KHG04493.1|  Glutamine synthetase leaf isozyme, chloroplastic        352   4e-116   Gossypium arboreum [tree cotton]
ref|XP_011009035.1|  PREDICTED: glutamine synthetase leaf isozyme...    352   4e-116   Populus euphratica
sp|O22506.1|GLNA2_DAUCA  RecName: Full=Glutamine synthetase, chlo...    350   2e-115   Daucus carota [carrots]
pir||S22527  glutamate-ammonia ligase (EC 6.3.1.2) - tobacco            350   2e-115
gb|AAD49734.1|AF169795_1  glutamine synthetase precursor                350   2e-115   Juglans nigra
ref|XP_002516801.1|  glutamine synthetase plant, putative               350   3e-115   Ricinus communis
gb|ADK27329.1|  plastid glutamine synthetase                            349   5e-115   Vigna radiata [mung bean]
gb|KJB37729.1|  hypothetical protein B456_006G218100                    349   6e-115   Gossypium raimondii
gb|KJB28233.1|  hypothetical protein B456_005G035800                    348   1e-114   Gossypium raimondii
gb|KDP40083.1|  hypothetical protein JCGZ_02081                         348   2e-114   Jatropha curcas
gb|ACU24520.1|  unknown                                                 345   1e-113   Glycine max [soybeans]
ref|XP_006593484.1|  PREDICTED: glutamine synthetase precursor is...    345   2e-113   Glycine max [soybeans]
ref|XP_003546121.1|  PREDICTED: glutamine synthetase leaf isozyme...    345   2e-113   Glycine max [soybeans]
ref|NP_001237784.1|  glutamine synthetase precursor                     345   2e-113   
sp|P08281.2|GLNA2_PEA  RecName: Full=Glutamine synthetase leaf is...    345   2e-113   Pisum sativum [garden pea]
gb|ACU18743.1|  unknown                                                 344   3e-113   Glycine max [soybeans]
ref|XP_011462784.1|  PREDICTED: glutamine synthetase leaf isozyme...    344   4e-113   Fragaria vesca subsp. vesca
ref|XP_008223033.1|  PREDICTED: glutamine synthetase leaf isozyme...    343   7e-113   Prunus mume [ume]
gb|KCW84320.1|  hypothetical protein EUGRSUZ_B01163                     340   8e-113   Eucalyptus grandis [rose gum]
ref|XP_007147796.1|  hypothetical protein PHAVU_006G155800g             342   2e-112   Phaseolus vulgaris [French bean]
ref|XP_010035905.1|  PREDICTED: glutamine synthetase leaf isozyme...    342   2e-112   Eucalyptus grandis [rose gum]
ref|XP_010035896.1|  PREDICTED: glutamine synthetase leaf isozyme...    342   3e-112   Eucalyptus grandis [rose gum]
prf||1601519A  Gln synthetase                                           342   3e-112
ref|XP_004486102.1|  PREDICTED: glutamine synthetase leaf isozyme...    342   3e-112   Cicer arietinum [garbanzo]
gb|KDO74871.1|  hypothetical protein CISIN_1g013478mg                   342   3e-112   Citrus sinensis [apfelsine]
gb|AAF17703.1|AF031082_1  glutamine synthetase                          342   4e-112   Canavalia lineata
gb|AJD14836.1|  plastid glutamine synthetase                            342   5e-112   Boehmeria nivea [Chinese silk-plant]
gb|KDO74875.1|  hypothetical protein CISIN_1g013478mg                   342   5e-112   Citrus sinensis [apfelsine]
ref|XP_007222384.1|  hypothetical protein PRUPE_ppa006025mg             341   6e-112   Prunus persica
gb|AJI44225.1|  plastid glutamine synthetase                            341   7e-112   Boehmeria nivea [Chinese silk-plant]
ref|XP_010041422.1|  PREDICTED: glutamine synthetase leaf isozyme...    341   9e-112   Eucalyptus grandis [rose gum]
ref|NP_001284439.1|  glutamine synthetase leaf isozyme, chloropla...    340   2e-111   Cucumis melo [Oriental melon]
ref|XP_008438737.1|  PREDICTED: glutamine synthetase leaf isozyme...    340   2e-111   Cucumis melo [Oriental melon]
ref|XP_002279497.1|  PREDICTED: glutamine synthetase leaf isozyme...    340   2e-111   Vitis vinifera
ref|XP_004134161.1|  PREDICTED: glutamine synthetase leaf isozyme...    340   3e-111   Cucumis sativus [cucumbers]
gb|AAN84538.1|  putative plastidic glutamine synthetase                 338   1e-110   Spiraea nipponica
ref|XP_009339932.1|  PREDICTED: glutamine synthetase leaf isozyme...    336   7e-110   Pyrus x bretschneideri [bai li]
ref|XP_009352136.1|  PREDICTED: glutamine synthetase leaf isozyme...    335   1e-109   Pyrus x bretschneideri [bai li]
gb|ACJ84875.1|  unknown                                                 331   2e-109   Medicago truncatula
ref|XP_008361978.1|  PREDICTED: glutamine synthetase leaf isozyme...    333   2e-109   
gb|KEH36742.1|  glutamine synthetase domain protein                     333   3e-109   Medicago truncatula
sp|Q9XQ94.1|GLNA2_MEDSA  RecName: Full=Glutamine synthetase leaf ...    334   3e-109   Medicago sativa [alfalfa]
ref|XP_008390805.1|  PREDICTED: glutamine synthetase leaf isozyme...    334   3e-109   Malus domestica [apple tree]
ref|XP_008353244.1|  PREDICTED: glutamine synthetase leaf isozyme...    334   5e-109   
gb|AAO37651.1|  glutamine synthetase                                    333   6e-109   Medicago truncatula
gb|AAO85218.1|  glutamine synthetase PR2 mutant                         333   6e-109   Lotus japonicus
gb|AAN84563.1|  glutamine synthetase                                    333   6e-109   Lotus japonicus
gb|AAL67439.1|  glutamine synthetase precursor                          333   7e-109   Lotus japonicus
gb|AAN84537.1|  putative plastidic glutamine synthetase                 333   1e-108   Crataegus crus-galli
gb|AAO85217.1|  glutamine synthetase PR1 mutant                         330   1e-107   Lotus japonicus
gb|AGV54414.1|  glutamine synthetase                                    330   1e-107   Phaseolus vulgaris [French bean]
gb|KHN37551.1|  Glutamine synthetase leaf isozyme, chloroplastic        330   2e-107   Glycine soja [wild soybean]
ref|XP_002274139.1|  PREDICTED: glutamine synthetase leaf isozyme...    327   2e-106   Vitis vinifera
gb|ADM45299.1|  chloroplast GS2b-alpha precursor                        324   2e-105   Medicago truncatula
gb|AAD31898.1|AF145480_1  glutamine synthetase leaf isozyme precu...    324   3e-105   Mesembryanthemum crystallinum
ref|XP_010557680.1|  PREDICTED: glutamine synthetase, chloroplast...    323   5e-105   Tarenaya hassleriana [spider flower]
gb|AFH88076.1|  chloroplast glutamine synthetase protein                323   6e-105   Sesuvium portulacastrum [sea-purslane]
gb|ABL89188.2|  plastid glutamine synthetase 2                          323   7e-105   Spinacia oleracea
ref|XP_010542001.1|  PREDICTED: glutamine synthetase, chloroplast...    323   1e-104   Tarenaya hassleriana [spider flower]
ref|XP_010666333.1|  PREDICTED: glutamine synthetase leaf isozyme...    319   3e-103   Beta vulgaris subsp. vulgaris [field beet]
emb|CAN61808.1|  hypothetical protein VITISV_014295                     318   8e-103   Vitis vinifera
ref|XP_003594092.1|  Glutamine synthetase                               335   2e-101   
ref|XP_004174085.1|  PREDICTED: glutamine synthetase, chloroplast...    306   2e-101   
ref|XP_010435449.1|  PREDICTED: glutamine synthetase, chloroplast...    312   2e-100   Camelina sativa [gold-of-pleasure]
ref|XP_010435447.1|  PREDICTED: glutamine synthetase, chloroplast...    312   2e-100   
ref|XP_010450396.1|  PREDICTED: glutamine synthetase, chloroplast...    310   1e-99    Camelina sativa [gold-of-pleasure]
ref|XP_002868428.1|  hypothetical protein ARALYDRAFT_493621             308   4e-99    
ref|XP_008779349.1|  PREDICTED: glutamine synthetase leaf isozyme...    301   9e-99    
ref|NP_198413.1|  glutamine synthetase 2                                307   1e-98    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009124267.1|  PREDICTED: glutamine synthetase, chloroplastic     305   5e-98    Brassica rapa
ref|XP_009391592.1|  PREDICTED: glutamine synthetase leaf isozyme...    305   1e-97    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010938796.1|  PREDICTED: glutamine synthetase leaf isozyme...    305   1e-97    Elaeis guineensis
gb|ABY87178.1|  chloroplast glutamine synthetase                        304   2e-97    Brassica rapa subsp. chinensis [bok-choy]
emb|CDY33684.1|  BnaC04g29670D                                          306   2e-97    Brassica napus [oilseed rape]
ref|XP_006850815.1|  hypothetical protein AMTR_s00025p00120730          304   3e-97    Amborella trichopoda
ref|XP_006282617.1|  hypothetical protein CARUB_v10004865mg             303   4e-97    Capsella rubella
dbj|BAH56878.1|  AT5G35630                                              298   4e-97    Arabidopsis thaliana [mouse-ear cress]
emb|CAB72423.1|  glutamine synthetase                                   302   8e-97    Brassica napus [oilseed rape]
emb|CDY49365.1|  BnaA08g29950D                                          300   2e-96    Brassica napus [oilseed rape]
emb|CAA73062.1|  plastidic glutamine synthetase precursor               301   3e-96    Brassica napus [oilseed rape]
ref|XP_006395952.1|  hypothetical protein EUTSA_v10004280mg             301   4e-96    Eutrema salsugineum [saltwater cress]
ref|XP_009108017.1|  PREDICTED: glutamine synthetase, chloroplast...    301   4e-96    Brassica rapa
ref|XP_009417914.1|  PREDICTED: glutamine synthetase leaf isozyme...    300   6e-96    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010435452.1|  PREDICTED: glutamine synthetase, chloroplast...    299   1e-95    
ref|XP_003580719.1|  PREDICTED: glutamine synthetase, chloroplastic     295   5e-94    Brachypodium distachyon [annual false brome]
emb|CDX84116.1|  BnaC08g07930D                                          288   2e-93    
ref|XP_004960149.1|  PREDICTED: glutamine synthetase, chloroplast...    285   3e-90    Setaria italica
gb|EPS57543.1|  glutamine synthetase                                    276   2e-89    Genlisea aurea
dbj|BAD12057.1|  plastidic glutamine synthetase                         282   5e-89    Phragmites australis
dbj|BAD12059.1|  plastidic glutamine synthetase                         282   6e-89    Phragmites australis
ref|NP_001241708.1|  uncharacterized protein LOC100856886               280   6e-89    
dbj|BAG88835.1|  unnamed protein product                                278   7e-89    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006593065.1|  PREDICTED: glutamine synthetase leaf isozyme...    273   2e-88    Glycine max [soybeans]
gb|AFB69878.1|  chloroplast glutamine synthetase isoform 2-1            281   2e-88    Secale cereale
ref|NP_001054133.1|  Os04g0659100                                       281   2e-88    
gb|AAZ30062.1|  plastid glutamine synthetase isoform GS2c               281   2e-88    Triticum aestivum [Canadian hard winter wheat]
dbj|BAJ91545.1|  predicted protein                                      281   2e-88    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AAL87183.1|AF480497_11  putative precursor chloroplastic gluta...    281   3e-88    Oryza sativa Japonica Group [Japonica rice]
ref|XP_008662331.1|  PREDICTED: glutamine synthetase, chloroplast...    280   3e-88    
gb|ACT22496.1|  plastid glutamine synthetase 2                          280   5e-88    Triticum aestivum [Canadian hard winter wheat]
ref|NP_001105725.1|  glutamine synthetase, chloroplastic precursor      279   8e-88    
prf||1804333B  Gln synthetase                                           279   1e-87 
gb|ACT22500.1|  plastid glutamine synthetase 2                          279   1e-87    Triticum aestivum [Canadian hard winter wheat]
dbj|BAJ95492.1|  predicted protein                                      279   1e-87    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008662330.1|  PREDICTED: glutamine synthetase, chloroplast...    281   2e-87    Zea mays [maize]
gb|AAZ30061.1|  plastid glutamine synthetase isoform GS2b               278   3e-87    Triticum aestivum [Canadian hard winter wheat]
emb|CAA29057.1|  gluthamine synthetase                                  276   3e-87    Pisum sativum [garden pea]
emb|CAA34131.1|  unnamed protein product                                278   3e-87    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AAZ30060.1|  plastid glutamine synthetase isoform GS2a               277   7e-87    Triticum aestivum [Canadian hard winter wheat]
ref|XP_006653841.1|  PREDICTED: LOW QUALITY PROTEIN: glutamine sy...    275   3e-86    
sp|P13564.2|GLNA2_HORVU  RecName: Full=Glutamine synthetase leaf ...    275   6e-86    Hordeum vulgare [barley]
prf||1804333C  Gln synthetase                                           272   5e-85 
gb|ACG35376.1|  glutamine synthetase                                    272   5e-85    Zea mays [maize]
gb|EMS53309.1|  Glutamine synthetase leaf isozyme, chloroplastic        275   8e-85    Triticum urartu
gb|ACG31728.1|  hypothetical protein                                    267   1e-83    Zea mays [maize]
prf||1804333D  Gln synthetase                                           266   1e-82 
gb|AHJ10962.1|  chloroplast glutamine synthetase 2 isoform 2            252   3e-77    Lemna minor
gb|AHJ10961.1|  chloroplast glutamine synthetase 2 isoform 1            252   3e-77    Lemna minor
gb|AAT46062.1|  glutamine synthetase GS2                                241   2e-76    Apium graveolens Dulce Group [celery]
ref|XP_010492570.1|  PREDICTED: glutamine synthetase cytosolic is...    241   4e-75    Camelina sativa [gold-of-pleasure]
ref|XP_010419001.1|  PREDICTED: glutamine synthetase cytosolic is...    237   6e-75    
ref|XP_010420355.1|  PREDICTED: glutamine synthetase cytosolic is...    243   9e-75    Camelina sativa [gold-of-pleasure]
ref|XP_010492569.1|  PREDICTED: glutamine synthetase cytosolic is...    243   1e-74    Camelina sativa [gold-of-pleasure]
ref|XP_010420354.1|  PREDICTED: glutamine synthetase cytosolic is...    243   1e-74    Camelina sativa [gold-of-pleasure]
dbj|BAA04995.1|  glutamine synthetase                                   243   2e-74    Raphanus sativus
gb|ACF42116.1|  cytosolic glutamine synthetase                          243   2e-74    Brassica oleracea var. italica [asparagus broccoli]
gb|EYU24513.1|  hypothetical protein MIMGU_mgv1a008973mg                243   2e-74    Erythranthe guttata [common monkey flower]
emb|CAA73063.1|  cytosolic glutamine synthetase                         242   2e-74    Brassica napus [oilseed rape]
ref|NP_001267644.1|  glutamine synthetase cytosolic isozyme-like        242   4e-74    Cucumis sativus [cucumbers]
ref|XP_010453820.1|  PREDICTED: glutamine synthetase cytosolic is...    241   5e-74    Camelina sativa [gold-of-pleasure]
ref|XP_010435596.1|  PREDICTED: glutamine synthetase cytosolic is...    239   5e-74    Camelina sativa [gold-of-pleasure]
ref|XP_006391364.1|  hypothetical protein EUTSA_v10018774mg             241   6e-74    Eutrema salsugineum [saltwater cress]
gb|AHJ10960.1|  cytosolic glutamine synthetase 1 isoform 2              241   6e-74    Lemna minor
ref|XP_010470494.1|  PREDICTED: glutamine synthetase cytosolic is...    238   7e-74    Camelina sativa [gold-of-pleasure]
gb|KDP25795.1|  hypothetical protein JCGZ_22517                         241   7e-74    Jatropha curcas
gb|KFK25875.1|  hypothetical protein AALP_AA8G173600                    241   9e-74    Arabis alpina [alpine rockcress]
ref|XP_010440874.1|  PREDICTED: glutamine synthetase cytosolic is...    241   1e-73    Camelina sativa [gold-of-pleasure]
ref|XP_011001555.1|  PREDICTED: glutamine synthetase cytosolic is...    241   1e-73    Populus euphratica
emb|CAA54151.1|  glutamine                                              240   1e-73    Brassica napus [oilseed rape]
gb|ACD13217.1|  glutamine synthetase                                    240   1e-73    Brassica rapa subsp. chinensis [bok-choy]
gb|AFK46766.1|  unknown                                                 235   2e-73    Medicago truncatula
ref|XP_006288043.1|  hypothetical protein CARUB_v10001277mg             240   2e-73    
ref|XP_010415164.1|  PREDICTED: glutamine synthetase cytosolic is...    238   2e-73    Camelina sativa [gold-of-pleasure]
ref|XP_010435595.1|  PREDICTED: glutamine synthetase cytosolic is...    240   2e-73    Camelina sativa [gold-of-pleasure]
emb|CAA73064.1|  cytosolic glutamine synthetase                         240   2e-73    Brassica napus [oilseed rape]
ref|XP_010103463.1|  Glutamine synthetase nodule isozyme                240   2e-73    Morus notabilis
ref|XP_010470493.1|  PREDICTED: glutamine synthetase cytosolic is...    240   2e-73    Camelina sativa [gold-of-pleasure]
ref|XP_010450519.1|  PREDICTED: glutamine synthetase cytosolic is...    237   2e-73    Camelina sativa [gold-of-pleasure]
emb|CDY49656.1|  BnaC09g41340D                                          239   3e-73    Brassica napus [oilseed rape]
ref|XP_009127475.1|  PREDICTED: glutamine synthetase cytosolic is...    237   3e-73    
gb|AAB61597.1|  glutamine synthetase                                    239   4e-73    Hevea brasiliensis [jebe]
gb|AGC24244.1|  glutamine synthetase 1                                  231   4e-73    Brassica napus [oilseed rape]
ref|XP_009785976.1|  PREDICTED: glutamine synthetase isoform X1         239   4e-73    Nicotiana sylvestris
ref|XP_009370554.1|  PREDICTED: glutamine synthetase cytosolic is...    239   4e-73    Pyrus x bretschneideri [bai li]
ref|XP_006590378.1|  PREDICTED: glutamine synthetase cytosolic is...    236   5e-73    Glycine max [soybeans]
ref|XP_009785977.1|  PREDICTED: glutamine synthetase isoform X2         239   5e-73    Nicotiana sylvestris
gb|ACU15915.1|  unknown                                                 234   6e-73    Glycine max [soybeans]
emb|CDY01727.1|  BnaC04g30250D                                          238   6e-73    
gb|AFW90613.1|  glutamine synthetase GS1                                235   6e-73    Solanum tuberosum [potatoes]
ref|XP_006300523.1|  hypothetical protein CARUB_v10020543mg             239   6e-73    Capsella rubella
ref|XP_010415162.1|  PREDICTED: glutamine synthetase cytosolic is...    239   7e-73    Camelina sativa [gold-of-pleasure]
ref|XP_010511548.1|  PREDICTED: glutamine synthetase cytosolic is...    238   7e-73    Camelina sativa [gold-of-pleasure]
ref|XP_006284008.1|  hypothetical protein CARUB_v10005130mg             238   7e-73    Capsella rubella
gb|AAG24873.1|AF301590_1  cytosolic glutamine synthetase GSbeta1        238   8e-73    Glycine max [soybeans]
gb|AHJ10959.1|  cytosolic glutamine synthetase 1 isoform 1              238   8e-73    Lemna minor
ref|XP_009127474.1|  PREDICTED: glutamine synthetase cytosolic is...    238   9e-73    Brassica rapa
ref|XP_010450518.1|  PREDICTED: glutamine synthetase cytosolic is...    238   9e-73    Camelina sativa [gold-of-pleasure]
sp|P04078.1|GLNA1_MEDSA  RecName: Full=Glutamine synthetase cytos...    238   1e-72    Medicago sativa [alfalfa]
emb|CAA58118.1|  glutamate--ammonia ligase                              238   1e-72    Brassica napus [oilseed rape]
ref|XP_009139734.1|  PREDICTED: glutamine synthetase cytosolic is...    238   1e-72    Brassica rapa
ref|XP_006372556.1|  glutamate-ammonia ligase family protein            238   2e-72    Populus trichocarpa [western balsam poplar]
ref|XP_003600702.1|  Glutamine synthetase                               238   2e-72    Medicago truncatula
ref|XP_009631593.1|  PREDICTED: glutamine synthetase isoform X2         234   2e-72    Nicotiana tomentosiformis
dbj|BAH56851.1|  AT1G66200                                              234   2e-72    Arabidopsis thaliana [mouse-ear cress]
gb|ACF74298.1|  glutamine synthetase GS56                               230   2e-72    Arachis hypogaea [goober]
ref|XP_002873784.1|  GLN1_4                                             237   2e-72    
ref|XP_002888488.1|  ATGSR2                                             237   2e-72    
gb|AAR86718.1|  glutamine synthetase GS56                               237   2e-72    Nicotiana attenuata
ref|NP_001031240.1|  glutamine synthetase                               234   3e-72    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008353857.1|  PREDICTED: glutamine synthetase cytosolic is...    237   3e-72    
ref|NP_198576.1|  glutamine synthetase 1;1                              237   3e-72    Arabidopsis thaliana [mouse-ear cress]
dbj|BAA04996.1|  glutamine synthetase                                   237   3e-72    Raphanus sativus
sp|P12424.1|GLNA_NICPL  RecName: Full=Glutamine synthetase; AltNa...    237   3e-72    Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|XP_009629012.1|  PREDICTED: glutamine synthetase-like               237   3e-72    Nicotiana tomentosiformis
ref|XP_007215605.1|  hypothetical protein PRUPE_ppa007772mg             237   3e-72    Prunus persica
gb|ABK93921.1|  unknown                                                 232   3e-72    Populus trichocarpa [western balsam poplar]
ref|XP_009385541.1|  PREDICTED: glutamine synthetase nodule isozy...    236   4e-72    Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001284433.1|  glutamine synthetase cytosolic isozyme             236   4e-72    Cucumis melo [Oriental melon]
ref|XP_002870545.1|  ATGSR1                                             236   5e-72    Arabidopsis lyrata subsp. lyrata
ref|XP_009393673.1|  PREDICTED: glutamine synthetase nodule isozyme     236   5e-72    Musa acuminata subsp. malaccensis [pisang utan]
gb|AAP33167.1|  cytosolic glutamine synthetase                          236   5e-72    Securigera parviflora
ref|XP_009800983.1|  PREDICTED: glutamine synthetase-like               236   5e-72    Nicotiana sylvestris
ref|XP_009631592.1|  PREDICTED: glutamine synthetase isoform X1         236   5e-72    Nicotiana tomentosiformis
ref|NP_001048045.1|  Os02g0735200                                       236   5e-72    
emb|CAA71317.1|  glutamine synthetase                                   236   5e-72    Medicago truncatula
gb|EYU30859.1|  hypothetical protein MIMGU_mgv1a008986mg                236   6e-72    Erythranthe guttata [common monkey flower]
emb|CDX69442.1|  BnaA10g17910D                                          236   6e-72    
gb|ACN36710.1|  unknown                                                 231   6e-72    Zea mays [maize]
gb|KFK41041.1|  hypothetical protein AALP_AA2G077900                    236   8e-72    Arabis alpina [alpine rockcress]
ref|XP_004288594.1|  PREDICTED: glutamine synthetase nodule isozyme     236   8e-72    Fragaria vesca subsp. vesca
ref|XP_009338856.1|  PREDICTED: glutamine synthetase cytosolic is...    236   8e-72    
ref|XP_009772493.1|  PREDICTED: glutamine synthetase cytosolic is...    236   9e-72    Nicotiana sylvestris
ref|NP_176794.1|  glutamine synthetase                                  236   9e-72    Arabidopsis thaliana [mouse-ear cress]
gb|AAM63710.1|  glutamine synthetase, putative                          236   1e-71    Arabidopsis thaliana [mouse-ear cress]
dbj|BAE98486.1|  glutamine synthetase like protein                      235   1e-71    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008460506.1|  PREDICTED: glutamine synthetase nodule isozy...    235   1e-71    Cucumis melo [Oriental melon]
ref|XP_006374208.1|  glutamine synthetase family protein                235   1e-71    
ref|XP_011035558.1|  PREDICTED: glutamine synthetase cytosolic is...    235   2e-71    Populus euphratica
ref|XP_004162638.1|  PREDICTED: glutamine synthetase nodule isozy...    235   2e-71    
sp|P04770.1|GLNA1_PHAVU  RecName: Full=Glutamine synthetase PR-1;...    235   2e-71    Phaseolus vulgaris [French bean]
ref|XP_006346760.1|  PREDICTED: glutamine synthetase cytosolic is...    235   2e-71    Solanum tuberosum [potatoes]
gb|KJB10478.1|  hypothetical protein B456_001G203300                    231   2e-71    Gossypium raimondii
ref|XP_009121474.1|  PREDICTED: glutamine synthetase cytosolic is...    235   2e-71    Brassica rapa
gb|KGN51032.1|  Glutamine synthetase                                    234   2e-71    Cucumis sativus [cucumbers]
gb|AIK03054.1|  glutamine synthetase                                    234   2e-71    Eichhornia crassipes
sp|P32289.1|GLNA_VIGAC  RecName: Full=Glutamine synthetase nodule...    234   3e-71    Vigna aconitifolia [moth-bean]
ref|XP_004236686.1|  PREDICTED: glutamine synthetase cytosolic is...    234   3e-71    
gb|KJB10479.1|  hypothetical protein B456_001G203300                    233   3e-71    Gossypium raimondii
ref|XP_006405853.1|  hypothetical protein EUTSA_v10027817mg             234   3e-71    Eutrema salsugineum [saltwater cress]
sp|Q42899.2|GLNA1_LOTJA  RecName: Full=Glutamine synthetase cytos...    234   3e-71    Lotus japonicus
gb|ABK94916.1|  unknown                                                 234   3e-71    Populus trichocarpa [western balsam poplar]
ref|XP_006400196.1|  hypothetical protein EUTSA_v10013948mg             234   3e-71    Eutrema salsugineum [saltwater cress]
ref|XP_009614064.1|  PREDICTED: glutamine synthetase cytosolic is...    234   3e-71    Nicotiana tomentosiformis
emb|CCO25538.1|  glutamine synthetase                                   234   3e-71    Pinus pinaster [cluster pine]
ref|XP_006406687.1|  hypothetical protein EUTSA_v10021026mg             234   3e-71    Eutrema salsugineum [saltwater cress]
gb|AFN42876.1|  glutamine synthetase                                    234   3e-71    Camellia sinensis [black tea]
ref|XP_009370058.1|  PREDICTED: glutamine synthetase cytosolic is...    234   3e-71    Pyrus x bretschneideri [bai li]
ref|XP_004953842.1|  PREDICTED: glutamine synthetase cytosolic is...    234   3e-71    Setaria italica
emb|CAA63963.1|  glutamate synthetase                                   234   3e-71    Lotus japonicus
dbj|BAM84282.1|  glutamine synthetase                                   234   4e-71    Tulipa humilis var. pulchella
ref|XP_002318305.1|  glutamine synthetase family protein                234   4e-71    
gb|AAW21273.1|  glutamine synthetase                                    234   4e-71    Saccharum officinarum [noble cane]
ref|XP_007141923.1|  hypothetical protein PHAVU_008G237400g             234   4e-71    Phaseolus vulgaris [French bean]
ref|NP_001268054.1|  glutamine synthetase cytosolic isozyme 2           234   4e-71    Vitis vinifera
ref|XP_002465624.1|  hypothetical protein SORBIDRAFT_01g042450          234   5e-71    Sorghum bicolor [broomcorn]
gb|AJD14835.1|  glutamine synthetase                                    234   5e-71    Boehmeria nivea [Chinese silk-plant]
emb|CAA65174.1|  glutamine synthetase                                   234   5e-71    Nicotiana tabacum [American tobacco]
ref|XP_010551131.1|  PREDICTED: glutamine synthetase nodule isozy...    234   5e-71    Tarenaya hassleriana [spider flower]
ref|XP_004140309.1|  PREDICTED: glutamine synthetase nodule isozy...    234   5e-71    
emb|CAA65173.1|  glutamine synthetase                                   234   5e-71    Nicotiana tabacum [American tobacco]
ref|XP_008803403.1|  PREDICTED: glutamine synthetase nodule isozy...    234   5e-71    Phoenix dactylifera
ref|XP_009126124.1|  PREDICTED: glutamine synthetase cytosolic is...    234   6e-71    Brassica rapa
gb|AAW21274.1|  glutamine synthetase                                    233   6e-71    Saccharum officinarum [noble cane]
ref|XP_009391413.1|  PREDICTED: glutamine synthetase nodule isozy...    233   6e-71    Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY38104.1|  BnaC02g06690D                                          233   6e-71    Brassica napus [oilseed rape]
gb|AGC24239.1|  glutamine synthetase 1                                  233   6e-71    Brassica napus [oilseed rape]
ref|XP_006360384.1|  PREDICTED: glutamine synthetase nodule isozy...    233   7e-71    Solanum tuberosum [potatoes]
ref|XP_006647853.1|  PREDICTED: glutamine synthetase cytosolic is...    233   7e-71    
gb|ABW89460.1|  glutamine synthetase                                    233   7e-71    Gossypium herbaceum [Arabian cotton]
ref|NP_568335.1|  glutamine synthetase 1;4                              233   7e-71    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010271347.1|  PREDICTED: glutamine synthetase cytosolic is...    233   7e-71    Nelumbo nucifera [Indian lotus]
gb|KHG00636.1|  Glutamine synthetase cytosolic isozyme 1                233   8e-71    Gossypium arboreum [tree cotton]
emb|CAA73366.1|  glutamine synthetase                                   233   8e-71    Lotus japonicus
gb|ABW89463.1|  glutamine synthetase                                    233   8e-71    Gossypium raimondii
gb|ABW89461.1|  glutamine synthetase                                    233   8e-71    Gossypium hirsutum [American cotton]
gb|ABW89462.1|  glutamine synthetase                                    233   9e-71    Gossypium hirsutum [American cotton]
sp|P38563.2|GLNA5_MAIZE  RecName: Full=Glutamine synthetase root ...    233   9e-71    Zea mays [maize]
emb|CAN68162.1|  hypothetical protein VITISV_015673                     233   9e-71    Vitis vinifera
ref|XP_011085871.1|  PREDICTED: glutamine synthetase cytosolic is...    233   1e-70    
gb|ABW89464.1|  glutamine synthetase                                    233   1e-70    
gb|KFK39112.1|  hypothetical protein AALP_AA3G202500                    233   1e-70    
tpg|DAA44141.1|  TPA: glutamine synthetase6                             233   1e-70    
ref|XP_010909363.1|  PREDICTED: glutamine synthetase nodule isozyme     233   1e-70    
ref|XP_004299511.1|  PREDICTED: glutamine synthetase cytosolic is...    233   1e-70    
gb|KFK33302.1|  hypothetical protein AALP_AA6G357500                    233   1e-70    
sp|P52782.1|GLNA_LUPLU  RecName: Full=Glutamine synthetase nodule...    233   1e-70    
ref|XP_007036934.1|  Glutamine synthase clone R1, 1,ATGLN1,1 isof...    229   2e-70    
ref|XP_011002191.1|  PREDICTED: glutamine synthetase cytosolic is...    233   2e-70    
sp|O04867.1|GLNA1_ALNGL  RecName: Full=Glutamine synthetase; AltN...    232   2e-70    
ref|XP_010940335.1|  PREDICTED: glutamine synthetase nodule isozy...    232   2e-70    
ref|NP_001268175.1|  glutamine synthetase cytosolic isozyme 1           232   2e-70    
dbj|BAD99525.1|  glutamine synthetase                                   232   2e-70    
ref|NP_001105297.1|  glutamine synthetase root isozyme 5                232   2e-70    
ref|XP_007032111.1|  Glutamine synthase clone R1, 1,ATGLN1,1 isof...    232   2e-70    
emb|CDO98315.1|  unnamed protein product                                232   3e-70    
emb|CDP01645.1|  unnamed protein product                                232   3e-70    
ref|NP_001105538.1|  glutamine synthetase root isozyme 1                232   3e-70    
emb|CBI33470.3|  unnamed protein product                                232   3e-70    
ref|XP_010505938.1|  PREDICTED: glutamine synthetase cytosolic is...    232   3e-70    
ref|XP_007163376.1|  hypothetical protein PHAVU_001G229500g             232   3e-70    
gb|AGV54248.1|  glutamine synthetase                                    232   3e-70    
ref|XP_004240034.1|  PREDICTED: glutamine synthetase-like               232   3e-70    
ref|NP_001242332.1|  cytosolic glutamine synthetase beta2               231   3e-70    
gb|AAN05339.1|  Putative GLN1_ORYSA GLUTAMINE SYNTHETASE ROOT ISO...    231   4e-70    
gb|AAR29057.1|  glutamine synthetase 1                                  231   4e-70    
ref|XP_008358170.1|  PREDICTED: glutamine synthetase cytosolic is...    231   4e-70    
sp|P38561.1|GLNA3_MAIZE  RecName: Full=Glutamine synthetase root ...    231   4e-70    
ref|XP_008365754.1|  PREDICTED: glutamine synthetase cytosolic is...    231   4e-70    
sp|P23712.2|GLNA_LACSA  RecName: Full=Glutamine synthetase; AltNa...    231   4e-70    
ref|XP_002305885.1|  glutamate-ammonia ligase family protein            231   4e-70    
ref|NP_001105296.1|  glutamine synthetase root isozyme 3                231   5e-70    
gb|ACA50923.1|  glutamine synthetase                                    231   5e-70    
ref|XP_004503122.1|  PREDICTED: glutamine synthetase nodule isozy...    231   5e-70    
ref|XP_006298020.1|  hypothetical protein CARUB_v10014064mg             231   6e-70    
gb|KCW69393.1|  hypothetical protein EUGRSUZ_F02872                     228   6e-70    
gb|AGC24238.1|  glutamine synthetase 1                                  231   6e-70    
ref|NP_001049424.1|  Os03g0223400                                       231   7e-70    
gb|ABF06665.1|  glutamine synthetase                                    231   7e-70    
ref|XP_004512771.1|  PREDICTED: glutamine synthetase nodule isozy...    231   7e-70    
sp|P14636.1|GLNA3_LUPAN  RecName: Full=Glutamine synthetase nodul...    229   8e-70    
ref|XP_007036933.1|  Glutamine synthase clone R1, 1,ATGLN1,1 isof...    230   9e-70    
ref|XP_002883089.1|  ATGSKB6                                            230   1e-69    
gb|KHN07539.1|  Glutamine synthetase nodule isozyme                     230   1e-69    
ref|XP_004250194.1|  PREDICTED: glutamine synthetase                    230   1e-69    
gb|AAK08103.1|AF338444_1  glutamine synthetase                          230   1e-69    
ref|XP_006590377.1|  PREDICTED: glutamine synthetase cytosolic is...    230   1e-69    
ref|XP_010553887.1|  PREDICTED: glutamine synthetase nodule isozyme     230   1e-69    
gb|AAK49029.1|  cytosolic glutamine synthetase                          230   1e-69    
ref|XP_011022058.1|  PREDICTED: glutamine synthetase cytosolic is...    230   2e-69    
gb|KCW48620.1|  hypothetical protein EUGRSUZ_K02283                     226   2e-69    
gb|AAD52008.1|  cytosolic glutamine synthetase                          229   2e-69    
ref|XP_009414782.1|  PREDICTED: glutamine synthetase cytosolic is...    229   2e-69    
gb|KCW48621.1|  hypothetical protein EUGRSUZ_K02283                     226   2e-69    
gb|KDO50821.1|  hypothetical protein CISIN_1g018434mg                   226   2e-69    
sp|P38559.1|GLNA1_MAIZE  RecName: Full=Glutamine synthetase root ...    229   2e-69    
ref|XP_011003750.1|  PREDICTED: glutamine synthetase nodule isozyme     229   2e-69    
ref|XP_007152660.1|  hypothetical protein PHAVU_004G148300g             229   2e-69    
ref|XP_010935533.1|  PREDICTED: glutamine synthetase nodule isozy...    229   3e-69    
ref|NP_001105444.1|  glutamine synthetase root isozyme 4                229   3e-69    
ref|XP_003519325.1|  PREDICTED: glutamine synthetase cytosolic is...    229   3e-69    
emb|CAJ87510.1|  putative glutamine synthetase                          229   3e-69    
gb|ABK95973.1|  unknown                                                 229   3e-69    
gb|ABU45501.1|  cytosolic glutamine synthetase                          229   3e-69    
gb|AGZ15411.1|  glutamine synthetase PR-2                               229   3e-69    
pdb|2D3A|A  Chain A, Crystal Structure Of The Maize Glutamine Syn...    229   3e-69    
ref|XP_010465841.1|  PREDICTED: glutamine synthetase cytosolic is...    229   3e-69    
ref|NP_188409.1|  glutamine synthetase cytosolic isozyme 1-3            229   3e-69    
ref|XP_010041423.1|  PREDICTED: glutamine synthetase leaf isozyme...    229   3e-69    
gb|ACU19484.1|  unknown                                                 229   3e-69    
gb|ACB06727.1|  glutamine synthetase                                    229   3e-69    
ref|XP_010528561.1|  PREDICTED: glutamine synthetase nodule isozy...    229   3e-69    
ref|XP_003544980.1|  PREDICTED: glutamine synthetase cytosolic is...    229   4e-69    
gb|AID48673.1|  theanine synthetase                                     229   4e-69    
ref|XP_006352444.1|  PREDICTED: glutamine synthetase-like               229   4e-69    
sp|P08282.2|GLNA1_PEA  RecName: Full=Glutamine synthetase nodule ...    229   4e-69    
ref|XP_009360053.1|  PREDICTED: glutamine synthetase nodule isozy...    229   4e-69    
gb|EYU45782.1|  hypothetical protein MIMGU_mgv1a009017mg                229   4e-69    
gb|AGC24234.1|  glutamine synthetase 1                                  229   4e-69    
ref|XP_009145973.1|  PREDICTED: LOW QUALITY PROTEIN: glutamine sy...    228   5e-69    
ref|XP_010525077.1|  PREDICTED: glutamine synthetase nodule isozyme     229   5e-69    
gb|AGI78873.1|  glutamine synthetase                                    229   5e-69    
ref|XP_010062276.1|  PREDICTED: glutamine synthetase nodule isozy...    228   5e-69    
gb|ACG47508.1|  glutamine synthetase root isozyme 5                     228   6e-69    
ref|XP_006387591.1|  hypothetical protein POPTR_0799s00200g             228   6e-69    
gb|KJB43163.1|  hypothetical protein B456_007G187300                    228   6e-69    
gb|KDO50820.1|  hypothetical protein CISIN_1g018434mg                   227   6e-69    
gb|KDO50819.1|  hypothetical protein CISIN_1g018434mg                   228   6e-69    
ref|XP_002306385.1|  glutamine synthetase family protein                228   7e-69    
dbj|BAD11327.1|  glutamine synthetase                                   228   8e-69    
ref|XP_008812466.1|  PREDICTED: glutamine synthetase nodule isozyme     228   8e-69    
gb|AFP20991.1|  glutamine synthetase isozyme                            228   9e-69    
gb|AGI78872.1|  glutamine synthetase                                    228   9e-69    
gb|KCW48619.1|  hypothetical protein EUGRSUZ_K02283                     228   9e-69    
ref|XP_004985157.1|  PREDICTED: glutamine synthetase root isozyme...    228   9e-69    
ref|XP_004135959.1|  PREDICTED: glutamine synthetase nodule isozy...    228   1e-68    
sp|Q43785.1|GLNA3_MEDSA  RecName: Full=Glutamine synthetase nodul...    228   1e-68    
ref|NP_001268104.1|  glutamine synthetase                               228   1e-68    
dbj|BAD99526.1|  glutamine synthetase                                   228   1e-68    
dbj|BAM84285.1|  glutamine synthetase                                   228   1e-68    
emb|CAL07995.1|  cytosolic glutamine synthetase                         224   1e-68    
ref|XP_008789283.1|  PREDICTED: glutamine synthetase nodule isozy...    228   1e-68    
ref|XP_010036983.1|  PREDICTED: glutamine synthetase cytosolic is...    228   1e-68    
ref|XP_003558466.1|  PREDICTED: glutamine synthetase cytosolic is...    228   1e-68    
gb|ABX79672.1|  glutamine synthetase                                    228   1e-68    
gb|AAG40237.2|  glutamine synthetase GS1                                227   1e-68    
ref|XP_010236151.1|  PREDICTED: glutamine synthetase cytosolic is...    228   1e-68    
sp|Q43066.1|GLNA4_PEA  RecName: Full=Glutamine synthetase root is...    228   1e-68    
ref|XP_010652433.1|  PREDICTED: glutamine synthetase isoform X1         227   1e-68    
ref|NP_001185327.1|  glutamine synthetase                               228   1e-68    
sp|P07694.1|GLNA3_PEA  RecName: Full=Glutamine synthetase root is...    227   2e-68    
gb|AGG19203.1|  glutamine synthetase                                    227   2e-68    
pdb|4IS4|A  Chain A, The Glutamine Synthetase From The Dicotyledo...    228   2e-68    
gb|ABK51388.1|  cytosolic glutamine synthetase                          227   2e-68    
ref|XP_006649656.1|  PREDICTED: glutamine synthetase cytosolic is...    227   2e-68    
ref|XP_007141924.1|  hypothetical protein PHAVU_008G237500g             227   2e-68    
dbj|BAL14865.1|  putative cytosolic glutamine synthetase                227   2e-68    
ref|XP_006482120.1|  PREDICTED: glutamine synthetase nodule isozy...    227   2e-68    
ref|XP_011007210.1|  PREDICTED: glutamine synthetase cytosolic is...    227   2e-68    
gb|KHG00904.1|  Glutamine synthetase nodule isozyme                     227   2e-68    
gb|AFW63835.1|  glutamine synthetase5                                   225   3e-68    
ref|XP_002310666.1|  glutamine synthetase family protein                226   3e-68    
gb|EEC73954.1|  hypothetical protein OsI_08842                          227   3e-68    
gb|AFB69879.1|  glutamine synthetase isoform 1-1                        226   3e-68    
ref|XP_010932552.1|  PREDICTED: glutamine synthetase nodule isozyme     226   3e-68    
ref|XP_003619869.1|  Glutamine synthetase                               226   4e-68    
gb|KDP24824.1|  hypothetical protein JCGZ_25308                         226   4e-68    
ref|XP_006430603.1|  hypothetical protein CICLE_v10011785mg             228   4e-68    
gb|AAO42253.1|  putative glutamine synthetase                           226   4e-68    
gb|EYU43846.1|  hypothetical protein MIMGU_mgv1a010285mg                224   6e-68    
tpg|DAA44139.1|  TPA: glutamine synthetase6                             226   6e-68    
gb|ACR38147.1|  unknown                                                 226   7e-68    
ref|XP_007043312.1|  Glutamine synthetase 1,4                           226   7e-68    
gb|ABK23723.1|  unknown                                                 225   8e-68    
gb|KCW52168.1|  hypothetical protein EUGRSUZ_J01606                     225   8e-68    
ref|XP_008351243.1|  PREDICTED: glutamine synthetase, chloroplast...    219   1e-67    
ref|XP_003528974.1|  PREDICTED: glutamine synthetase PR-2               225   1e-67    
ref|NP_001239821.1|  cytosolic glutamine synthetase alpha               225   1e-67    
ref|XP_010271383.1|  PREDICTED: glutamine synthetase cytosolic is...    225   2e-67    
gb|AGC24245.1|  glutamine synthetase 1                                  217   2e-67    
gb|KCW52167.1|  hypothetical protein EUGRSUZ_J01606                     224   2e-67    
pir||S18603  glutamate-ammonia ligase (EC 6.3.1.2), cytosolic (cl...    225   2e-67 
ref|NP_001241743.1|  glutamine synthetase root isozyme 3                224   2e-67    
ref|XP_010032725.1|  PREDICTED: glutamine synthetase nodule isozyme     224   2e-67    
ref|XP_009113719.1|  PREDICTED: glutamine synthetase cytosolic is...    224   2e-67    
emb|CDY68590.1|  BnaAnng27730D                                          224   2e-67    
ref|XP_002972155.1|  hypothetical protein SELMODRAFT_270944             225   2e-67    
ref|XP_011083120.1|  PREDICTED: glutamine synthetase cytosolic is...    224   2e-67    
gb|AGV07415.1|  glutamine synthetase                                    224   3e-67    
ref|XP_007222176.1|  hypothetical protein PRUPE_ppa007771mg             224   3e-67    
ref|XP_008461372.1|  PREDICTED: glutamine synthetase nodule isozy...    224   3e-67    
gb|AJD14834.1|  glutamine synthetase                                    224   3e-67    
ref|XP_009408415.1|  PREDICTED: glutamine synthetase nodule isozy...    224   3e-67    
emb|CDX82343.1|  BnaA03g34780D                                          224   3e-67    
gb|AEH16645.1|  glutamine synthetase                                    224   3e-67    
ref|XP_011073176.1|  PREDICTED: glutamine synthetase nodule isozy...    225   3e-67    
dbj|BAA04994.1|  glutamine synthetase                                   224   4e-67    
gb|AAQ16554.1|  glufosinate-resistant glutamine synthetase              220   4e-67    
gb|AFK48742.1|  unknown                                                 224   4e-67    
ref|XP_009135551.1|  PREDICTED: glutamine synthetase cytosolic is...    224   4e-67    
ref|XP_006828438.1|  hypothetical protein AMTR_s00060p00109730          223   5e-67    
gb|AAR84347.1|  glutamine synthetase isoform GSr1                       223   5e-67    
ref|XP_002977477.1|  hypothetical protein SELMODRAFT_151817             224   5e-67    
ref|XP_010089044.1|  Glutamine synthetase nodule isozyme                222   6e-67    
ref|XP_008221045.1|  PREDICTED: glutamine synthetase nodule isozy...    223   6e-67    
gb|AAG40238.2|AF302115_1  glutamine synthetase GS1                      223   6e-67    
gb|ACR45959.1|  glutamine synthetase 1a                                 223   7e-67    
ref|XP_003616263.1|  Glutamine synthetase                               223   7e-67    
ref|XP_001782920.1|  predicted protein                                  223   7e-67    
dbj|BAK01909.1|  predicted protein                                      223   7e-67    
emb|CDX75942.1|  BnaC03g40250D                                          223   8e-67    
ref|XP_007209293.1|  hypothetical protein PRUPE_ppa007728mg             223   8e-67    
ref|XP_009351711.1|  PREDICTED: glutamine synthetase nodule isozy...    223   1e-66    
gb|ACN40288.1|  unknown                                                 223   1e-66    
gb|AFB69880.1|  glutamine synthetase isoform 1r                         222   1e-66    
ref|XP_010066985.1|  PREDICTED: glutamine synthetase cytosolic is...    222   1e-66    
ref|XP_006844043.1|  hypothetical protein AMTR_s00006p00241880          222   1e-66    
ref|XP_010066984.1|  PREDICTED: glutamine synthetase cytosolic is...    222   2e-66    
ref|XP_004297747.1|  PREDICTED: glutamine synthetase nodule isozy...    222   2e-66    
gb|KJB77351.1|  hypothetical protein B456_012G133400                    219   2e-66    
gb|AAD31899.1|AF145481_1  cytosolic glutamine synthetase                221   2e-66    
ref|XP_010926111.1|  PREDICTED: glutamine synthetase cytosolic is...    222   2e-66    
ref|XP_010250142.1|  PREDICTED: glutamine synthetase nodule isozyme     221   3e-66    
gb|AAR84348.1|  glutamine synthetase isoform GSr2                       221   3e-66    
ref|XP_002527139.1|  glutamine synthetase plant, putative               221   5e-66    
gb|ACR45960.1|  glutamine synthetase 1b                                 221   5e-66    
ref|XP_008775534.1|  PREDICTED: glutamine synthetase nodule isozy...    221   6e-66    
gb|AEM42902.1|  cytosolic glutamine synthetase isoform                  220   7e-66    
gb|AAZ30058.1|  glutamine synthetase isoform GS1b                       220   7e-66    
gb|AAZ30057.1|  glutamine synthetase isoform GS1a                       220   8e-66    
ref|XP_008350820.1|  PREDICTED: glutamine synthetase nodule isozy...    220   8e-66    
gb|KHG29839.1|  Glutamine synthetase cytosolic isozyme 1-1              220   8e-66    
ref|XP_001782914.1|  predicted protein                                  220   9e-66    
gb|ACJ11724.1|  glutamine synthase                                      220   9e-66    
ref|NP_001238531.1|  glutamine synthetase cytosolic isozyme 1           220   1e-65    
gb|KHG29838.1|  Glutamine synthetase cytosolic isozyme 1-1              220   1e-65    
gb|ACL54769.1|  unknown                                                 220   1e-65    
gb|KDP43303.1|  hypothetical protein JCGZ_24224                         220   1e-65    
ref|NP_001105443.1|  glutamine synthetase root isozyme 2                220   1e-65    
ref|XP_008340445.1|  PREDICTED: glutamine synthetase PR-2               219   2e-65    
gb|AFX60876.1|  glutamine synthetase isoform GS1_2                      219   2e-65    
ref|XP_010916212.1|  PREDICTED: glutamine synthetase nodule isozy...    219   2e-65    
gb|AAD28469.1|AF130882_1  glutamine synthetase                          213   2e-65    
ref|XP_008240120.1|  PREDICTED: glutamine synthetase nodule isozyme     219   3e-65    
gb|AAK14401.1|AF343667_1  cytosolic glutamine synthetase                219   4e-65    
ref|XP_010688706.1|  PREDICTED: glutamine synthetase nodule isozyme     218   4e-65    
gb|AAZ30059.1|  glutamine synthetase isoform GS1c                       218   4e-65    
gb|AAP33169.1|  cytosolic glutamine synthetase                          218   5e-65    
ref|XP_004490827.1|  PREDICTED: glutamine synthetase nodule isozy...    218   6e-65    
sp|Q06378.1|GLNA3_HORVU  RecName: Full=Glutamine synthetase; AltN...    217   1e-64    
gb|ACR38893.1|  glutamine synthetase                                    217   1e-64    
ref|XP_004981993.1|  PREDICTED: glutamine synthetase cytosolic is...    218   1e-64    
gb|AET22435.1|  glutamine synthetase                                    211   1e-64    
ref|XP_006651743.1|  PREDICTED: glutamine synthetase cytosolic is...    217   2e-64    
gb|AAW21275.1|  glutamine synthetase                                    217   2e-64    
pir||S30569  glutamate-ammonia ligase (EC 6.3.1.2), cytosolic - b...    217   2e-64 
ref|XP_010314231.1|  PREDICTED: glutamine synthetase cytosolic is...    216   3e-64    
gb|ACO59263.1|  chloroplast glutamine synthetase                        215   3e-64    
ref|NP_001051067.1|  Os03g0712800                                       216   3e-64    
emb|CAA06383.1|  glutamine synthetase                                   216   3e-64    



>gb|ACF17656.1| putative glutamine synthase 2 [Capsicum annuum]
Length=432

 Score =   382 bits (981),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 181/203 (89%), Positives = 194/203 (96%), Gaps = 0/203 (0%)
 Frame = +3

Query  132  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  311
            MAQILAPSAQWQMRMTK+ T+A+P+ SKMW SVV+K NK++AVKS+AKFRVFALQS N+T
Sbjct  1    MAQILAPSAQWQMRMTKSSTDASPLTSKMWSSVVLKQNKKLAVKSSAKFRVFALQSDNAT  60

Query  312  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  491
            VNR+EQLLNLDVTPYT+KIIAEYIWIGGSGID RSKSRTISKPVQH SELPKWNYDGSST
Sbjct  61   VNRMEQLLNLDVTPYTDKIIAEYIWIGGSGIDMRSKSRTISKPVQHASELPKWNYDGSST  120

Query  492  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVV  671
            GQAPGEDSEVILYPQAIFKDPFRGGNNILVICD YTPAGEPIPTNKRH+AAQIFSDPKVV
Sbjct  121  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDAYTPAGEPIPTNKRHKAAQIFSDPKVV  180

Query  672  SEVPWYGIEQEYTLLQQNVKWPL  740
            SEVPW+GIEQEYTLLQ NVKWPL
Sbjct  181  SEVPWFGIEQEYTLLQPNVKWPL  203



>ref|XP_009629915.1| PREDICTED: glutamine synthetase, chloroplastic [Nicotiana tomentosiformis]
 gb|AAR86719.1| glutamine synthetase GS58 [Nicotiana attenuata]
Length=432

 Score =   380 bits (975),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 180/203 (89%), Positives = 192/203 (95%), Gaps = 0/203 (0%)
 Frame = +3

Query  132  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  311
            MAQILAPSAQWQMRMTK+ T+A P+ SKMW SVV+K NKR+AVKS+AKFRVFALQS + T
Sbjct  1    MAQILAPSAQWQMRMTKSSTDANPLTSKMWSSVVLKQNKRLAVKSSAKFRVFALQSDSGT  60

Query  312  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  491
            VNR+EQLLNLDVTPYT+KIIAEYIWIGGSGID RSKSRTISKPV+H SELPKWNYDGSST
Sbjct  61   VNRVEQLLNLDVTPYTDKIIAEYIWIGGSGIDMRSKSRTISKPVKHASELPKWNYDGSST  120

Query  492  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVV  671
            GQAPGEDSEVILYPQAIFKDPFRGGNNILVICD YTPAGEPIPTNKRH+AAQIFSD KVV
Sbjct  121  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDAYTPAGEPIPTNKRHKAAQIFSDSKVV  180

Query  672  SEVPWYGIEQEYTLLQQNVKWPL  740
            SEVPW+GIEQEYTLLQQNVKWPL
Sbjct  181  SEVPWFGIEQEYTLLQQNVKWPL  203



>ref|XP_009773609.1| PREDICTED: glutamine synthetase, chloroplastic [Nicotiana sylvestris]
Length=432

 Score =   379 bits (973),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 179/203 (88%), Positives = 192/203 (95%), Gaps = 0/203 (0%)
 Frame = +3

Query  132  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  311
            MAQILAPSAQWQMRMTK+ T+A P+ SKMW SVV+K NKR+AVKS+AKFRVFALQS + T
Sbjct  1    MAQILAPSAQWQMRMTKSSTDANPLTSKMWSSVVLKQNKRLAVKSSAKFRVFALQSDSGT  60

Query  312  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  491
            VNR+EQLLNLDVTPYT+KIIAEYIWIGGSGID RSKSRTISKPV+H SELPKWNYDGSST
Sbjct  61   VNRVEQLLNLDVTPYTDKIIAEYIWIGGSGIDMRSKSRTISKPVKHASELPKWNYDGSST  120

Query  492  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVV  671
            GQAPGEDSEVILYPQAIFKDPFRGGNNILVICD YTPAGEPIP+NKRH+AAQIFSD KVV
Sbjct  121  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDAYTPAGEPIPSNKRHKAAQIFSDSKVV  180

Query  672  SEVPWYGIEQEYTLLQQNVKWPL  740
            SEVPW+GIEQEYTLLQQNVKWPL
Sbjct  181  SEVPWFGIEQEYTLLQQNVKWPL  203



>ref|NP_001275177.1| glutamine synthetase, chloroplastic-like [Solanum tuberosum]
 gb|AAG40236.2| plastid glutamine synthetase GS2 [Solanum tuberosum]
Length=432

 Score =   374 bits (959),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 177/203 (87%), Positives = 191/203 (94%), Gaps = 0/203 (0%)
 Frame = +3

Query  132  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  311
            MAQILAPSAQWQMRMTK+ T+A+P+ SKMW SVV+K NKR+AVKS+AKFRVFALQS N T
Sbjct  1    MAQILAPSAQWQMRMTKSSTDASPLTSKMWSSVVLKQNKRLAVKSSAKFRVFALQSDNGT  60

Query  312  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  491
            VNR+EQLLNLDVTPYT+KIIAEYIWIGG+GID RSKSRTISKPV+  SELPKWNYDGSST
Sbjct  61   VNRMEQLLNLDVTPYTDKIIAEYIWIGGTGIDVRSKSRTISKPVKDASELPKWNYDGSST  120

Query  492  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVV  671
            GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRH+AAQIFSDPKV 
Sbjct  121  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHKAAQIFSDPKVA  180

Query  672  SEVPWYGIEQEYTLLQQNVKWPL  740
            S+VPW+GIEQEYTLLQ NV WPL
Sbjct  181  SQVPWFGIEQEYTLLQPNVNWPL  203



>ref|XP_004229461.1| PREDICTED: glutamine synthetase, chloroplastic [Solanum lycopersicum]
 ref|XP_010322793.1| PREDICTED: glutamine synthetase, chloroplastic [Solanum lycopersicum]
Length=432

 Score =   369 bits (946),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 174/203 (86%), Positives = 189/203 (93%), Gaps = 0/203 (0%)
 Frame = +3

Query  132  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  311
            MAQILAPSAQWQMRMTK+ T+A+P+ SKMW SVV+K NKR A+KS+AKFRVFALQS N T
Sbjct  1    MAQILAPSAQWQMRMTKSSTDASPLTSKMWSSVVLKQNKRHALKSSAKFRVFALQSDNGT  60

Query  312  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  491
            VNR+EQLLNLDVTPYT+KIIAEYIWIGG+GID RSKSRTISKPV+  SELPKWNYDGSST
Sbjct  61   VNRVEQLLNLDVTPYTDKIIAEYIWIGGTGIDMRSKSRTISKPVKDASELPKWNYDGSST  120

Query  492  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVV  671
            GQAPGEDSEVILYPQAIFKDPFRGGNNILVICD YTPAGEPIPTNKRH+AAQIFSDPKV 
Sbjct  121  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDAYTPAGEPIPTNKRHKAAQIFSDPKVA  180

Query  672  SEVPWYGIEQEYTLLQQNVKWPL  740
            ++VPW+GIEQEYTLLQ NV WPL
Sbjct  181  AQVPWFGIEQEYTLLQPNVNWPL  203



>ref|XP_011090823.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic [Sesamum 
indicum]
 ref|XP_011090824.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic [Sesamum 
indicum]
 ref|XP_011090825.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic [Sesamum 
indicum]
 ref|XP_011090827.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic [Sesamum 
indicum]
Length=432

 Score =   365 bits (938),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 171/203 (84%), Positives = 189/203 (93%), Gaps = 0/203 (0%)
 Frame = +3

Query  132  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  311
            MA ILAPSAQWQMR+ KN T+A+P+ SKMW S+V+K NK+ AVK++AKFRV A+QS N T
Sbjct  1    MAHILAPSAQWQMRIAKNSTDASPLTSKMWSSLVLKQNKKGAVKTSAKFRVLAVQSENGT  60

Query  312  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  491
            +NR+EQ+LNLDV+P T+KIIAEYIWIGGSGID RSKSRTISKPV+HPSELPKWNYDGSST
Sbjct  61   INRMEQMLNLDVSPITDKIIAEYIWIGGSGIDLRSKSRTISKPVEHPSELPKWNYDGSST  120

Query  492  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVV  671
            GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTP GEPIPTNKR+RAAQIFSDPKVV
Sbjct  121  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPQGEPIPTNKRYRAAQIFSDPKVV  180

Query  672  SEVPWYGIEQEYTLLQQNVKWPL  740
            +EVPWYGIEQEYTLLQ NVKWPL
Sbjct  181  AEVPWYGIEQEYTLLQTNVKWPL  203



>emb|CDO98975.1| unnamed protein product [Coffea canephora]
Length=432

 Score =   364 bits (934),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 168/203 (83%), Positives = 191/203 (94%), Gaps = 0/203 (0%)
 Frame = +3

Query  132  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  311
            MAQILAPS QWQMR+TKNL + +P+ SKMW S+V+K +K+ A+K+++KF+V+ALQS N T
Sbjct  1    MAQILAPSPQWQMRVTKNLMDVSPLTSKMWSSLVLKQSKKGAIKTSSKFKVYALQSENGT  60

Query  312  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  491
            VNR+EQLLNLDVTPYT+KIIAEYIWIGGSG D RSKS+TISKPV+HPSELPKWNYDGSST
Sbjct  61   VNRVEQLLNLDVTPYTDKIIAEYIWIGGSGTDVRSKSKTISKPVEHPSELPKWNYDGSST  120

Query  492  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVV  671
            GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKR+RAAQIFS+PKV+
Sbjct  121  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYRAAQIFSNPKVI  180

Query  672  SEVPWYGIEQEYTLLQQNVKWPL  740
            +EVPW+GIEQEYTLLQ NVKWPL
Sbjct  181  AEVPWFGIEQEYTLLQTNVKWPL  203



>gb|EYU45601.1| hypothetical protein MIMGU_mgv1a007136mg [Erythranthe guttata]
Length=418

 Score =   363 bits (931),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 167/203 (82%), Positives = 191/203 (94%), Gaps = 0/203 (0%)
 Frame = +3

Query  132  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  311
            MAQILAPSAQWQMR+ KN T+A+ + SKMW S+VMK NK+ +V+++AKFRVFA++S + T
Sbjct  1    MAQILAPSAQWQMRIGKNSTDASALNSKMWSSLVMKQNKKGSVRTSAKFRVFAVKSEDGT  60

Query  312  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  491
            +NR+EQLLNLDVTPYT+KIIAEYIWIGG+GID RSKSRT+SKPV+HPSELPKWNYDGSST
Sbjct  61   INRMEQLLNLDVTPYTDKIIAEYIWIGGTGIDVRSKSRTLSKPVEHPSELPKWNYDGSST  120

Query  492  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVV  671
            GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKR++AAQ+FSDPKV 
Sbjct  121  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYKAAQVFSDPKVA  180

Query  672  SEVPWYGIEQEYTLLQQNVKWPL  740
            +E+PWYGIEQEYTLLQ NVKWPL
Sbjct  181  AEIPWYGIEQEYTLLQTNVKWPL  203



>ref|XP_011071523.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic-like 
[Sesamum indicum]
Length=429

 Score =   361 bits (926),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 170/203 (84%), Positives = 190/203 (94%), Gaps = 3/203 (1%)
 Frame = +3

Query  132  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  311
            MAQILAPSAQWQM ++K LT+ATP+ +KMWGS+ +K   + +VKS+AKF VFA++S NST
Sbjct  1    MAQILAPSAQWQMGISKGLTDATPLTTKMWGSLALK---QGSVKSSAKFGVFAVKSDNST  57

Query  312  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  491
            +NR+EQ+LNLDVTPYT+KIIAEYIWIGGSGID RSKSRTISKPV+HPSELPKWNYDGSST
Sbjct  58   INRLEQMLNLDVTPYTDKIIAEYIWIGGSGIDVRSKSRTISKPVEHPSELPKWNYDGSST  117

Query  492  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVV  671
            GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKR+RAAQIFSDPKV 
Sbjct  118  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYRAAQIFSDPKVS  177

Query  672  SEVPWYGIEQEYTLLQQNVKWPL  740
            +E+PWYGIEQEYTLLQ NVKWPL
Sbjct  178  AEIPWYGIEQEYTLLQTNVKWPL  200



>emb|CAA47373.2| glutamate--ammonia ligase [Nicotiana sylvestris]
Length=432

 Score =   360 bits (924),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 171/203 (84%), Positives = 186/203 (92%), Gaps = 0/203 (0%)
 Frame = +3

Query  132  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  311
            MAQILAPS +WQMRMTK+ T+A P+ SKMW SVV+K  K +AVKS+AKFR FAL+S + T
Sbjct  1    MAQILAPSGEWQMRMTKSSTDANPLTSKMWSSVVLKIIKELAVKSSAKFRFFALESDSGT  60

Query  312  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  491
            VN+ EQLLNLDVTPYT+KIIAEYIWIGGSGID RSKSRTISKPV+H SELPKWNYDGSST
Sbjct  61   VNQSEQLLNLDVTPYTDKIIAEYIWIGGSGIDMRSKSRTISKPVKHASELPKWNYDGSST  120

Query  492  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVV  671
            GQAPGEDSEVILYPQAIFKDPFRGGNNILVICD YTPAGEPIP+NKRH+AAQIFSD KVV
Sbjct  121  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDAYTPAGEPIPSNKRHKAAQIFSDSKVV  180

Query  672  SEVPWYGIEQEYTLLQQNVKWPL  740
            SEVPW+ IEQEYTLLQQNVKWPL
Sbjct  181  SEVPWFEIEQEYTLLQQNVKWPL  203



>ref|XP_010105702.1| Glutamine synthetase leaf isozyme [Morus notabilis]
 gb|EXC05733.1| Glutamine synthetase leaf isozyme [Morus notabilis]
Length=433

 Score =   359 bits (922),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 190/204 (93%), Gaps = 1/204 (0%)
 Frame = +3

Query  132  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPN-KRVAVKSTAKFRVFALQSGNS  308
            MAQILAPS QWQMR+TK  T+A+PM SKMWGS+VMK N K+ A+KS+ KFRVFAL+S N 
Sbjct  1    MAQILAPSTQWQMRITKASTDASPMTSKMWGSLVMKQNNKKGAMKSSTKFRVFALKSDNG  60

Query  309  TVNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSS  488
            T+NR+E LLNLDVTPYT+KIIAEYIWIGGSGID RSK+RTISKPV+HPSELPKWN+DGSS
Sbjct  61   TINRLEDLLNLDVTPYTDKIIAEYIWIGGSGIDVRSKARTISKPVEHPSELPKWNFDGSS  120

Query  489  TGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKV  668
            TGQAPGEDSEVI+YPQA+FKDPFRGGNNILVICD+YTPAGEPIPTNKRHRAA+IFS+ KV
Sbjct  121  TGQAPGEDSEVIIYPQAVFKDPFRGGNNILVICDSYTPAGEPIPTNKRHRAAEIFSNKKV  180

Query  669  VSEVPWYGIEQEYTLLQQNVKWPL  740
            V+EVPW+GIEQEYTLLQ NV+WPL
Sbjct  181  VNEVPWFGIEQEYTLLQPNVRWPL  204



>ref|XP_007034566.1| Glutamine synthetase 2 [Theobroma cacao]
 gb|EOY05492.1| Glutamine synthetase 2 [Theobroma cacao]
Length=549

 Score =   361 bits (927),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 168/204 (82%), Positives = 187/204 (92%), Gaps = 0/204 (0%)
 Frame = +3

Query  129  KMAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNS  308
            KMAQILAPS QWQMR+ K  T  +P+A+KMW S+V+K NK+ A KS  KFRVFALQS NS
Sbjct  117  KMAQILAPSTQWQMRLPKTSTYGSPIATKMWNSLVLKQNKQGAAKSCGKFRVFALQSENS  176

Query  309  TVNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSS  488
            TVNR+E+LLN+D+TPYT+KIIAEYIWIGGSGID RSKS+TI+KPV+HPSELPKWNYDGSS
Sbjct  177  TVNRLEKLLNMDITPYTDKIIAEYIWIGGSGIDLRSKSKTIAKPVEHPSELPKWNYDGSS  236

Query  489  TGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKV  668
            TGQAPGEDSEVILYPQAIFKDPFRGGNNILVICD YTPAGEPIPTNKRHRAA+IFS+ KV
Sbjct  237  TGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDAYTPAGEPIPTNKRHRAAEIFSNKKV  296

Query  669  VSEVPWYGIEQEYTLLQQNVKWPL  740
            V +VPW+GIEQEYTLLQQNVKWPL
Sbjct  297  VDKVPWFGIEQEYTLLQQNVKWPL  320



>ref|XP_011006593.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic [Populus 
euphratica]
Length=432

 Score =   357 bits (916),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 165/203 (81%), Positives = 184/203 (91%), Gaps = 0/203 (0%)
 Frame = +3

Query  132  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  311
            MAQILAPS+QWQMR+ KN   A PM +KMW S+V+K NK+   KS+AKFRVFAL+S NST
Sbjct  1    MAQILAPSSQWQMRIAKNSAPACPMTAKMWSSLVLKQNKKGIAKSSAKFRVFALKSENST  60

Query  312  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  491
            +NR+E LLNLD+TPYT+K IAEYIWIGGSGID RSKSRTISKP++HPSELPKWNYDGSST
Sbjct  61   INRMEDLLNLDLTPYTDKFIAEYIWIGGSGIDLRSKSRTISKPIEHPSELPKWNYDGSST  120

Query  492  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVV  671
            GQAPGEDSEVILYPQAIFKDPFRGGNNILV+CDTYTP GEPIPTNKRHRAA+IFS+ KV+
Sbjct  121  GQAPGEDSEVILYPQAIFKDPFRGGNNILVMCDTYTPQGEPIPTNKRHRAAEIFSNKKVI  180

Query  672  SEVPWYGIEQEYTLLQQNVKWPL  740
             EVPW+GIEQEYTLLQ NVKWPL
Sbjct  181  DEVPWFGIEQEYTLLQTNVKWPL  203



>ref|XP_002314425.1| glutamine synthetase family protein [Populus trichocarpa]
 gb|EEF00596.1| glutamine synthetase family protein [Populus trichocarpa]
Length=432

 Score =   357 bits (915),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 165/203 (81%), Positives = 184/203 (91%), Gaps = 0/203 (0%)
 Frame = +3

Query  132  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  311
            MAQILAPS+QWQMR+ KN   A PM +KMW S+V+K NK+   KS+AKFRVFAL+S NST
Sbjct  1    MAQILAPSSQWQMRIAKNSAPACPMTAKMWSSLVLKQNKKGIAKSSAKFRVFALKSENST  60

Query  312  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  491
            +NR+E LLNLD+TPYT+K IAEYIWIGGSGID RSKSRTISKP++HPSELPKWNYDGSST
Sbjct  61   INRMEDLLNLDLTPYTDKFIAEYIWIGGSGIDLRSKSRTISKPIEHPSELPKWNYDGSST  120

Query  492  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVV  671
            GQAPGEDSEVILYPQAIFKDPFRGGNNILV+CDTYTP GEPIPTNKRHRAA+IFS+ KV+
Sbjct  121  GQAPGEDSEVILYPQAIFKDPFRGGNNILVMCDTYTPQGEPIPTNKRHRAAEIFSNKKVI  180

Query  672  SEVPWYGIEQEYTLLQQNVKWPL  740
             EVPW+GIEQEYTLLQ NVKWPL
Sbjct  181  DEVPWFGIEQEYTLLQTNVKWPL  203



>ref|XP_006380048.1| hypothetical protein POPTR_0008s20460g [Populus trichocarpa]
 gb|ERP57845.1| hypothetical protein POPTR_0008s20460g [Populus trichocarpa]
Length=306

 Score =   352 bits (903),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 164/203 (81%), Positives = 183/203 (90%), Gaps = 0/203 (0%)
 Frame = +3

Query  132  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  311
            MAQILAPS+QWQMR+ KN   A+PM +KMW S+V+K NK+   KS+AKFRVFA++S N T
Sbjct  1    MAQILAPSSQWQMRIAKNSAPASPMTAKMWSSLVLKQNKKGTAKSSAKFRVFAVKSENGT  60

Query  312  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  491
            +NR+E LLNLD+TPYTN  IAEYIWIGGSGID RSKSRTISKP++HPSELPKWNYDGSST
Sbjct  61   INRMEDLLNLDLTPYTNNFIAEYIWIGGSGIDLRSKSRTISKPIEHPSELPKWNYDGSST  120

Query  492  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVV  671
            GQAPGEDSEVILYPQAIFKDPFRGGNNILV+CDTYTP GEPIPTNKRHRAA+IFS+ KVV
Sbjct  121  GQAPGEDSEVILYPQAIFKDPFRGGNNILVMCDTYTPQGEPIPTNKRHRAAEIFSNKKVV  180

Query  672  SEVPWYGIEQEYTLLQQNVKWPL  740
             EVPW+GIEQEYTLLQ NVKWPL
Sbjct  181  DEVPWFGIEQEYTLLQTNVKWPL  203



>ref|XP_010255852.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic [Nelumbo 
nucifera]
Length=432

 Score =   356 bits (914),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 167/203 (82%), Positives = 184/203 (91%), Gaps = 0/203 (0%)
 Frame = +3

Query  132  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  311
            MAQILAPS QWQ++MTKN + A P+ +KMW S+++   ++ A K +AKFRVFALQS +ST
Sbjct  1    MAQILAPSIQWQIKMTKNSSSARPITAKMWSSLLLNQKRKGAAKGSAKFRVFALQSESST  60

Query  312  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  491
            VNR+E LL LD TPYT+KIIAEYIWIGGSGID RSKSRTISKPV+HPSELPKWNYDGSST
Sbjct  61   VNRLEDLLKLDTTPYTDKIIAEYIWIGGSGIDLRSKSRTISKPVEHPSELPKWNYDGSST  120

Query  492  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVV  671
            GQAPGEDSEVILYPQAIFKDPFRGGNNILVICD+YTPAGEPIPTNKR+RAAQIFSDPKVV
Sbjct  121  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDSYTPAGEPIPTNKRYRAAQIFSDPKVV  180

Query  672  SEVPWYGIEQEYTLLQQNVKWPL  740
             EVPWYGIEQEYTLLQ NVKWPL
Sbjct  181  QEVPWYGIEQEYTLLQTNVKWPL  203



>ref|XP_002312733.1| glutamine synthetase family protein [Populus trichocarpa]
 ref|XP_006380049.1| hypothetical protein POPTR_0008s20460g [Populus trichocarpa]
 gb|ABK94955.1| unknown [Populus trichocarpa]
 gb|EEE90100.1| glutamine synthetase family protein [Populus trichocarpa]
 gb|ERP57846.1| hypothetical protein POPTR_0008s20460g [Populus trichocarpa]
Length=432

 Score =   355 bits (911),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 164/203 (81%), Positives = 183/203 (90%), Gaps = 0/203 (0%)
 Frame = +3

Query  132  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  311
            MAQILAPS+QWQMR+ KN   A+PM +KMW S+V+K NK+   KS+AKFRVFA++S N T
Sbjct  1    MAQILAPSSQWQMRIAKNSAPASPMTAKMWSSLVLKQNKKGTAKSSAKFRVFAVKSENGT  60

Query  312  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  491
            +NR+E LLNLD+TPYTN  IAEYIWIGGSGID RSKSRTISKP++HPSELPKWNYDGSST
Sbjct  61   INRMEDLLNLDLTPYTNNFIAEYIWIGGSGIDLRSKSRTISKPIEHPSELPKWNYDGSST  120

Query  492  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVV  671
            GQAPGEDSEVILYPQAIFKDPFRGGNNILV+CDTYTP GEPIPTNKRHRAA+IFS+ KVV
Sbjct  121  GQAPGEDSEVILYPQAIFKDPFRGGNNILVMCDTYTPQGEPIPTNKRHRAAEIFSNKKVV  180

Query  672  SEVPWYGIEQEYTLLQQNVKWPL  740
             EVPW+GIEQEYTLLQ NVKWPL
Sbjct  181  DEVPWFGIEQEYTLLQTNVKWPL  203



>gb|KDO74876.1| hypothetical protein CISIN_1g013478mg [Citrus sinensis]
Length=375

 Score =   352 bits (904),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 166/203 (82%), Positives = 185/203 (91%), Gaps = 0/203 (0%)
 Frame = +3

Query  132  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  311
            MAQILAPS QWQMRM K    A+PM +KMW S++MK NK+   +S+AKFRV AL+S +ST
Sbjct  1    MAQILAPSMQWQMRMPKYSNIASPMTTKMWSSLLMKQNKKGTNRSSAKFRVLALKSEDST  60

Query  312  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  491
            VNR+E LLNLD+TPYT+KIIAEYIWIGG+GID RSKS+TISKPV+HPSELPKWNYDGSST
Sbjct  61   VNRLEDLLNLDITPYTDKIIAEYIWIGGTGIDMRSKSKTISKPVEHPSELPKWNYDGSST  120

Query  492  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVV  671
            GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAA+IFS+ KV 
Sbjct  121  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAEIFSNSKVS  180

Query  672  SEVPWYGIEQEYTLLQQNVKWPL  740
            +EVPW+GIEQEYTLLQQNVKWPL
Sbjct  181  AEVPWFGIEQEYTLLQQNVKWPL  203



>ref|XP_006419778.1| hypothetical protein CICLE_v10005007mg [Citrus clementina]
 ref|XP_006489239.1| PREDICTED: glutamine synthetase, chloroplastic-like isoform X1 
[Citrus sinensis]
 ref|XP_006489240.1| PREDICTED: glutamine synthetase, chloroplastic-like isoform X2 
[Citrus sinensis]
 gb|ESR33018.1| hypothetical protein CICLE_v10005007mg [Citrus clementina]
Length=432

 Score =   354 bits (908),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 166/203 (82%), Positives = 185/203 (91%), Gaps = 0/203 (0%)
 Frame = +3

Query  132  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  311
            MAQILAPS QWQMRM K    A+PM +KMW S++MK NK+   +S+AKFRV AL+S +ST
Sbjct  1    MAQILAPSMQWQMRMPKYSNIASPMTTKMWSSLLMKQNKKGTNRSSAKFRVLALKSEDST  60

Query  312  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  491
            VNR+E LLNLD+TPYT+KIIAEYIWIGG+GID RSKS+TISKPV+HPSELPKWNYDGSST
Sbjct  61   VNRLEDLLNLDITPYTDKIIAEYIWIGGTGIDMRSKSKTISKPVEHPSELPKWNYDGSST  120

Query  492  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVV  671
            GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAA+IFS+ KV 
Sbjct  121  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAEIFSNSKVS  180

Query  672  SEVPWYGIEQEYTLLQQNVKWPL  740
            +EVPW+GIEQEYTLLQQNVKWPL
Sbjct  181  AEVPWFGIEQEYTLLQQNVKWPL  203



>gb|KDO74872.1| hypothetical protein CISIN_1g013478mg [Citrus sinensis]
 gb|KDO74873.1| hypothetical protein CISIN_1g013478mg [Citrus sinensis]
 gb|KDO74874.1| hypothetical protein CISIN_1g013478mg [Citrus sinensis]
Length=432

 Score =   354 bits (908),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 166/203 (82%), Positives = 185/203 (91%), Gaps = 0/203 (0%)
 Frame = +3

Query  132  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  311
            MAQILAPS QWQMRM K    A+PM +KMW S++MK NK+   +S+AKFRV AL+S +ST
Sbjct  1    MAQILAPSMQWQMRMPKYSNIASPMTTKMWSSLLMKQNKKGTNRSSAKFRVLALKSEDST  60

Query  312  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  491
            VNR+E LLNLD+TPYT+KIIAEYIWIGG+GID RSKS+TISKPV+HPSELPKWNYDGSST
Sbjct  61   VNRLEDLLNLDITPYTDKIIAEYIWIGGTGIDMRSKSKTISKPVEHPSELPKWNYDGSST  120

Query  492  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVV  671
            GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAA+IFS+ KV 
Sbjct  121  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAEIFSNSKVS  180

Query  672  SEVPWYGIEQEYTLLQQNVKWPL  740
            +EVPW+GIEQEYTLLQQNVKWPL
Sbjct  181  AEVPWFGIEQEYTLLQQNVKWPL  203



>dbj|BAF62340.1| glutamine synthetase [Avicennia marina]
Length=432

 Score =   353 bits (907),  Expect = 9e-117, Method: Compositional matrix adjust.
 Identities = 164/203 (81%), Positives = 186/203 (92%), Gaps = 0/203 (0%)
 Frame = +3

Query  132  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  311
            MAQILAPSAQWQMR+ KN  +A+P+++K W S+++K NK+ AVKS  KFRV A++S NST
Sbjct  1    MAQILAPSAQWQMRIAKNSIDASPLSTKTWSSLILKQNKKEAVKSPGKFRVLAVKSENST  60

Query  312  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  491
            VNR+EQ+LNLDVTPYT+KIIAEYIWIGGSGID RSKSRTI KPV+HPSELPKWNYDGSST
Sbjct  61   VNRLEQMLNLDVTPYTDKIIAEYIWIGGSGIDLRSKSRTIPKPVEHPSELPKWNYDGSST  120

Query  492  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVV  671
            GQAPGEDSEVILYPQAIFKDPFRGGNNILV CDTYTP GEPIPTNKR+RAAQIFSDPKV 
Sbjct  121  GQAPGEDSEVILYPQAIFKDPFRGGNNILVTCDTYTPQGEPIPTNKRYRAAQIFSDPKVA  180

Query  672  SEVPWYGIEQEYTLLQQNVKWPL  740
            +++PW+GIEQEYTLLQ NV+WPL
Sbjct  181  ADIPWFGIEQEYTLLQPNVQWPL  203



>gb|KHG04493.1| Glutamine synthetase leaf isozyme, chloroplastic [Gossypium arboreum]
Length=432

 Score =   352 bits (903),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 164/203 (81%), Positives = 183/203 (90%), Gaps = 0/203 (0%)
 Frame = +3

Query  132  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  311
            MAQILAPS QWQMR+ K+ T  +P+A+KMW S+++K N + A KS  KFRV AL S NST
Sbjct  1    MAQILAPSTQWQMRVPKSSTFGSPIATKMWSSLLLKQNMKGAAKSAGKFRVLALHSENST  60

Query  312  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  491
            VNR E+LLN+D+TPYT+KIIAEYIWIGG+GID RSKSRTISKPV+HPSELPKWNYDGSST
Sbjct  61   VNRTEKLLNMDITPYTDKIIAEYIWIGGTGIDMRSKSRTISKPVEHPSELPKWNYDGSST  120

Query  492  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVV  671
            GQAPGEDSEVILYPQAIFKDPFRGGNNILVICD YTPAGEPIPTNKRH+AA+IFS+ KVV
Sbjct  121  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDAYTPAGEPIPTNKRHKAAEIFSNKKVV  180

Query  672  SEVPWYGIEQEYTLLQQNVKWPL  740
             EVPW+GIEQEYTLLQQNVKWPL
Sbjct  181  DEVPWFGIEQEYTLLQQNVKWPL  203



>ref|XP_011009035.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic-like 
[Populus euphratica]
 ref|XP_011009036.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic-like 
[Populus euphratica]
Length=432

 Score =   352 bits (903),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 163/203 (80%), Positives = 182/203 (90%), Gaps = 0/203 (0%)
 Frame = +3

Query  132  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  311
            MAQILAPS+QWQMR+ KN   A+PM +KMW S+V+K NK+   KS+AKFRVFA++S N T
Sbjct  1    MAQILAPSSQWQMRIPKNSAPASPMTAKMWSSLVLKQNKKGIAKSSAKFRVFAVKSENGT  60

Query  312  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  491
            +NR+E LLNLD+TPYTN  IAEYIWIGGSGID RSKSRTISKP++HPSELPKWNYDGSST
Sbjct  61   INRVEDLLNLDLTPYTNSFIAEYIWIGGSGIDLRSKSRTISKPIEHPSELPKWNYDGSST  120

Query  492  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVV  671
            GQAPGEDSEVILYPQAIFKDPFRGGNNILV+CDTYTP GEPIP NKRHRAA+IFS+ KVV
Sbjct  121  GQAPGEDSEVILYPQAIFKDPFRGGNNILVMCDTYTPQGEPIPKNKRHRAAEIFSNKKVV  180

Query  672  SEVPWYGIEQEYTLLQQNVKWPL  740
             EVPW+GIEQEYTLLQ NVKWPL
Sbjct  181  DEVPWFGIEQEYTLLQTNVKWPL  203



>sp|O22506.1|GLNA2_DAUCA RecName: Full=Glutamine synthetase, chloroplastic; AltName: Full=GS2; 
AltName: Full=Glutamate--ammonia ligase; Flags: Precursor 
[Daucus carota]
 gb|AAB71693.1| glutamine synthetase [Daucus carota]
Length=432

 Score =   350 bits (899),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 160/203 (79%), Positives = 181/203 (89%), Gaps = 0/203 (0%)
 Frame = +3

Query  132  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  311
            MAQILAPS QWQMR TKN TE + M SKMWGS+ +K NK+   +S+ K+R  A++S + T
Sbjct  1    MAQILAPSVQWQMRFTKNSTEVSSMTSKMWGSLFLKQNKKAPARSSTKYRALAVKSEDGT  60

Query  312  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  491
            +NR+E LLNLDVTPYT+KIIAEYIWIGG+GID RSKSRTISKPV+HPSELPKWNYDGSST
Sbjct  61   INRMEDLLNLDVTPYTDKIIAEYIWIGGTGIDVRSKSRTISKPVEHPSELPKWNYDGSST  120

Query  492  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVV  671
            GQAPG+DSEVILYPQAIFKDPFRGGNNILVICDTYTP GEPIPTNKRH+AAQIFSD KV+
Sbjct  121  GQAPGDDSEVILYPQAIFKDPFRGGNNILVICDTYTPQGEPIPTNKRHKAAQIFSDAKVL  180

Query  672  SEVPWYGIEQEYTLLQQNVKWPL  740
             EVPW+GIEQEYTL+QQ+V WPL
Sbjct  181  GEVPWFGIEQEYTLMQQDVNWPL  203



>pir||S22527 glutamate-ammonia ligase (EC 6.3.1.2) - tobacco
Length=432

 Score =   350 bits (899),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 168/203 (83%), Positives = 183/203 (90%), Gaps = 0/203 (0%)
 Frame = +3

Query  132  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  311
            MAQILAPS +WQMRMTK+ T+A P+ SKMW SVV+K  K +AVKS+AKFRVFAL+S + T
Sbjct  1    MAQILAPSGEWQMRMTKSSTDANPLTSKMWSSVVIKIIKELAVKSSAKFRVFALESDSGT  60

Query  312  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  491
            VN+ EQLLNLDVTPYT+ IIAEYIWIGGSGID RSKSRTISKPV+H SELPKWNYDGSST
Sbjct  61   VNQSEQLLNLDVTPYTDLIIAEYIWIGGSGIDMRSKSRTISKPVKHASELPKWNYDGSST  120

Query  492  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVV  671
            GQAPGEDSEVILYPQAIFKDPFRGGNNILVICD Y PAGEPIP+N RH+AAQIFSD  VV
Sbjct  121  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDAYWPAGEPIPSNLRHKAAQIFSDSLVV  180

Query  672  SEVPWYGIEQEYTLLQQNVKWPL  740
            SEVPW+ IEQEYTLLQQNVKWPL
Sbjct  181  SEVPWFEIEQEYTLLQQNVKWPL  203



>gb|AAD49734.1|AF169795_1 glutamine synthetase precursor [Juglans nigra]
Length=432

 Score =   350 bits (898),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 168/203 (83%), Positives = 187/203 (92%), Gaps = 0/203 (0%)
 Frame = +3

Query  132  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  311
            MA IL P+ +WQMR+TKN   A+PM +KMWGS+++K NK+ + KS+AKFRVFA +S NST
Sbjct  1    MAHILTPTTRWQMRITKNSANASPMTAKMWGSLLLKQNKKGSSKSSAKFRVFATKSENST  60

Query  312  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  491
            VNRIE+LLNLD+TPYT+KIIAEYIWIGGSGID RSKSRTISKPV+HPSELPKWNYDGSST
Sbjct  61   VNRIEKLLNLDLTPYTDKIIAEYIWIGGSGIDLRSKSRTISKPVEHPSELPKWNYDGSST  120

Query  492  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVV  671
            GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAA+IF++ KV 
Sbjct  121  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAEIFTNKKVA  180

Query  672  SEVPWYGIEQEYTLLQQNVKWPL  740
             EVPWYGIEQEYTLLQQNVKWPL
Sbjct  181  DEVPWYGIEQEYTLLQQNVKWPL  203



>ref|XP_002516801.1| glutamine synthetase plant, putative [Ricinus communis]
 gb|EEF45415.1| glutamine synthetase plant, putative [Ricinus communis]
Length=432

 Score =   350 bits (898),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 162/203 (80%), Positives = 184/203 (91%), Gaps = 0/203 (0%)
 Frame = +3

Query  132  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  311
            MAQILAPS QWQMR+ KN   A+P+ +KMW S+++K NK+V  K++ + RVFAL+S NST
Sbjct  1    MAQILAPSPQWQMRLPKNSMPASPLTTKMWSSLLLKQNKKVTAKNSGRLRVFALKSENST  60

Query  312  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  491
            +NR+E LLNLD+TPYT++IIAEYIWIGGSGID RSKSRTISKPV+HPSELPKWNYDGSST
Sbjct  61   INRLEDLLNLDITPYTDRIIAEYIWIGGSGIDVRSKSRTISKPVEHPSELPKWNYDGSST  120

Query  492  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVV  671
            GQAPGEDSEVILYPQAIFKDPFRGGNNILVICD+YTPAGEPIPTNKR+RAA+IFS  KVV
Sbjct  121  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDSYTPAGEPIPTNKRNRAAEIFSSKKVV  180

Query  672  SEVPWYGIEQEYTLLQQNVKWPL  740
             EVPW+GIEQEYTLLQ NVKWPL
Sbjct  181  DEVPWFGIEQEYTLLQPNVKWPL  203



>gb|ADK27329.1| plastid glutamine synthetase [Vigna radiata]
Length=429

 Score =   349 bits (895),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 162/203 (80%), Positives = 185/203 (91%), Gaps = 3/203 (1%)
 Frame = +3

Query  132  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  311
            MAQILAPS QWQMR+TK+   A+P+ S  W S++MK NK+    S+AKFRV A++S NST
Sbjct  1    MAQILAPSTQWQMRVTKSSLHASPITSNTWSSLLMKQNKKT---SSAKFRVLAVKSDNST  57

Query  312  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  491
            +NR+E LLNLD+TP+T+KIIAEYIWIGG+GID RSKSRTISKPV+HPSELPKWNYDGSST
Sbjct  58   INRLEGLLNLDITPFTDKIIAEYIWIGGTGIDVRSKSRTISKPVEHPSELPKWNYDGSST  117

Query  492  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVV  671
            GQAPGEDSEVILYPQAIFKDPFRGGNNILVICD+YTPAGEPIPTNKRHRAA++FS+PKV+
Sbjct  118  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDSYTPAGEPIPTNKRHRAAEVFSNPKVI  177

Query  672  SEVPWYGIEQEYTLLQQNVKWPL  740
            +EVPWYGIEQEYTLLQ NVKWPL
Sbjct  178  AEVPWYGIEQEYTLLQTNVKWPL  200



>gb|KJB37729.1| hypothetical protein B456_006G218100 [Gossypium raimondii]
Length=432

 Score =   349 bits (895),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 163/203 (80%), Positives = 180/203 (89%), Gaps = 0/203 (0%)
 Frame = +3

Query  132  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  311
            MAQIL PS QWQMR+ K  T  +P+ +KMW S+++K N + A KS  KFRV AL S NST
Sbjct  1    MAQILVPSTQWQMRVPKCSTFGSPIVTKMWSSLLLKQNMKGAAKSAGKFRVLALHSENST  60

Query  312  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  491
            VNR E+LLN+D+TPYT+KIIAEYIWIGGSGID RSKSRTISKPV+HPSELPKWNYDGSST
Sbjct  61   VNRTEKLLNMDITPYTDKIIAEYIWIGGSGIDMRSKSRTISKPVEHPSELPKWNYDGSST  120

Query  492  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVV  671
            GQAPGEDSEVILYPQAIFKDPFRGGNNILVICD YTPAGEPIPTNKRH+AA+IFS+ KVV
Sbjct  121  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDAYTPAGEPIPTNKRHKAAEIFSNKKVV  180

Query  672  SEVPWYGIEQEYTLLQQNVKWPL  740
             EVPW+GIEQEYTLLQQNVKWPL
Sbjct  181  DEVPWFGIEQEYTLLQQNVKWPL  203



>gb|KJB28233.1| hypothetical protein B456_005G035800 [Gossypium raimondii]
Length=431

 Score =   348 bits (893),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 164/203 (81%), Positives = 183/203 (90%), Gaps = 1/203 (0%)
 Frame = +3

Query  132  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  311
            MAQ+LAPS QWQM + K  T  +P+A+KMW S+V+K NK+ A KS+ KF+V AL S NST
Sbjct  1    MAQLLAPSTQWQMTLPKTSTYGSPIATKMWSSLVLKQNKKGAAKSSGKFKVVAL-SENST  59

Query  312  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  491
            VNR+E LLN+DVTPYT+KIIAEY+WIGGSG+D RSKSRTISKPV+HPSELPKWNYDGSST
Sbjct  60   VNRLENLLNMDVTPYTDKIIAEYVWIGGSGLDMRSKSRTISKPVKHPSELPKWNYDGSST  119

Query  492  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVV  671
            GQAPGEDSEVILYPQAIFKDPFRGGNNILVICD YTPAGEPIPTNKRHRAA+IFS+ KVV
Sbjct  120  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDAYTPAGEPIPTNKRHRAAEIFSNKKVV  179

Query  672  SEVPWYGIEQEYTLLQQNVKWPL  740
             EVPW+GIEQEYTLLQQNVKWPL
Sbjct  180  DEVPWFGIEQEYTLLQQNVKWPL  202



>gb|KDP40083.1| hypothetical protein JCGZ_02081 [Jatropha curcas]
Length=432

 Score =   348 bits (892),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 162/203 (80%), Positives = 182/203 (90%), Gaps = 0/203 (0%)
 Frame = +3

Query  132  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  311
            MAQILAPS QWQMR+ KN T  +P+ +KM+ S+ +K NK+   ++TA+ RVFA++S NST
Sbjct  1    MAQILAPSTQWQMRIQKNSTPMSPLTAKMFNSLFLKQNKKGTARNTARLRVFAMKSDNST  60

Query  312  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  491
            +NR+E LLNLD+TPYT+KIIAEYIWIGGSGID RSKSRTISKPV HPSELPKWNYDGSST
Sbjct  61   INRLEDLLNLDITPYTDKIIAEYIWIGGSGIDVRSKSRTISKPVGHPSELPKWNYDGSST  120

Query  492  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVV  671
            GQAPGEDSEVILYPQAIFKDPFRGGNNILVICD+YTP+GEPIPTNKRHRAAQIFS  KVV
Sbjct  121  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDSYTPSGEPIPTNKRHRAAQIFSKQKVV  180

Query  672  SEVPWYGIEQEYTLLQQNVKWPL  740
             EVPW+GIEQEYTLLQ NVKWPL
Sbjct  181  DEVPWFGIEQEYTLLQPNVKWPL  203



>gb|ACU24520.1| unknown [Glycine max]
Length=432

 Score =   345 bits (886),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 160/203 (79%), Positives = 184/203 (91%), Gaps = 0/203 (0%)
 Frame = +3

Query  132  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  311
            MAQILAPS QWQMR++K+   A+P+ S MW S++ K NK+V+  S+AKFRV A++S NS 
Sbjct  1    MAQILAPSTQWQMRISKSSPNASPITSNMWSSLLWKQNKKVSPTSSAKFRVMAIKSDNSI  60

Query  312  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  491
            +NR+E LLNLD+TP+T+KIIAEYIWIGG+GID RSKSRTISKPV+HPSELPKWNYDGSST
Sbjct  61   INRLEGLLNLDITPFTDKIIAEYIWIGGTGIDVRSKSRTISKPVEHPSELPKWNYDGSST  120

Query  492  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVV  671
            GQAPG+DSEVILYPQAIFKDPFRGGNNILVICD+YTP GEPIPTNKRHRAA+IFS+PKV 
Sbjct  121  GQAPGDDSEVILYPQAIFKDPFRGGNNILVICDSYTPQGEPIPTNKRHRAAEIFSNPKVQ  180

Query  672  SEVPWYGIEQEYTLLQQNVKWPL  740
            +EVPWYGIEQEYTLLQ NVKWPL
Sbjct  181  AEVPWYGIEQEYTLLQTNVKWPL  203



>ref|XP_006593484.1| PREDICTED: glutamine synthetase precursor isoform X1 [Glycine 
max]
Length=432

 Score =   345 bits (886),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 161/203 (79%), Positives = 184/203 (91%), Gaps = 0/203 (0%)
 Frame = +3

Query  132  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  311
            MAQILAPS QWQMR++K+   ATP+ S MW S++ K NK+V+  S+AKFRV A++S NST
Sbjct  1    MAQILAPSTQWQMRISKSSPNATPITSNMWSSLLWKQNKKVSPTSSAKFRVLAIKSDNST  60

Query  312  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  491
            +NR+E LLNLD+TP+T+KIIAEYIWIGG+GID RSKSRTISKPV+ PSELPKWNYDGSST
Sbjct  61   INRLEGLLNLDITPFTDKIIAEYIWIGGTGIDVRSKSRTISKPVEDPSELPKWNYDGSST  120

Query  492  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVV  671
            GQAPG+DSEVILYPQAIFKDPFRGGNNILVICD+YTP GEPIPTNKRHRAA+IFS+PKV 
Sbjct  121  GQAPGDDSEVILYPQAIFKDPFRGGNNILVICDSYTPQGEPIPTNKRHRAAEIFSNPKVQ  180

Query  672  SEVPWYGIEQEYTLLQQNVKWPL  740
            +EVPWYGIEQEYTLLQ NVKWPL
Sbjct  181  AEVPWYGIEQEYTLLQTNVKWPL  203



>ref|XP_003546121.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic-like 
isoform X1 [Glycine max]
 ref|XP_006597566.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic-like 
isoform X2 [Glycine max]
 gb|KHN33081.1| Glutamine synthetase leaf isozyme, chloroplastic [Glycine soja]
Length=432

 Score =   345 bits (886),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 160/203 (79%), Positives = 184/203 (91%), Gaps = 0/203 (0%)
 Frame = +3

Query  132  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  311
            MAQILAPS QWQMR++K+   A+P+ S MW S++ K NK+V+  S+AKFRV A++S NS 
Sbjct  1    MAQILAPSTQWQMRISKSSPNASPITSNMWSSLLWKQNKKVSPTSSAKFRVMAIKSDNSI  60

Query  312  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  491
            +NR+E LLNLD+TP+T+KIIAEYIWIGG+GID RSKSRTISKPV+HPSELPKWNYDGSST
Sbjct  61   INRLEGLLNLDITPFTDKIIAEYIWIGGTGIDVRSKSRTISKPVEHPSELPKWNYDGSST  120

Query  492  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVV  671
            GQAPG+DSEVILYPQAIFKDPFRGGNNILVICD+YTP GEPIPTNKRHRAA+IFS+PKV 
Sbjct  121  GQAPGDDSEVILYPQAIFKDPFRGGNNILVICDSYTPQGEPIPTNKRHRAAEIFSNPKVQ  180

Query  672  SEVPWYGIEQEYTLLQQNVKWPL  740
            +EVPWYGIEQEYTLLQ NVKWPL
Sbjct  181  AEVPWYGIEQEYTLLQTNVKWPL  203



>ref|NP_001237784.1| glutamine synthetase precursor [Glycine max]
 gb|AAK43833.1|AF353620_1 glutamine synthetase precursor [Glycine max]
Length=432

 Score =   345 bits (886),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 160/203 (79%), Positives = 184/203 (91%), Gaps = 0/203 (0%)
 Frame = +3

Query  132  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  311
            MAQILAPS QWQMR++K+   A+P+ S MW S++ K NK+V+  S+AKFRV A++S NS 
Sbjct  1    MAQILAPSTQWQMRISKSSPNASPITSNMWSSLLWKQNKKVSPTSSAKFRVMAIKSDNSI  60

Query  312  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  491
            +NR+E LLNLD+TP+T+KIIAEYIWIGG+GID RSKSRTISKPV+HPSELPKWNYDGSST
Sbjct  61   INRLEGLLNLDITPFTDKIIAEYIWIGGTGIDVRSKSRTISKPVEHPSELPKWNYDGSST  120

Query  492  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVV  671
            GQAPG+DSEVILYPQAIFKDPFRGGNNILVICD+YTP GEPIPTNKRHRAA+IFS+PKV 
Sbjct  121  GQAPGDDSEVILYPQAIFKDPFRGGNNILVICDSYTPQGEPIPTNKRHRAAEIFSNPKVQ  180

Query  672  SEVPWYGIEQEYTLLQQNVKWPL  740
            +EVPWYGIEQEYTLLQ NVKWPL
Sbjct  181  AEVPWYGIEQEYTLLQTNVKWPL  203



>sp|P08281.2|GLNA2_PEA RecName: Full=Glutamine synthetase leaf isozyme, chloroplastic; 
AltName: Full=GS2; AltName: Full=Glutamate--ammonia ligase; 
Flags: Precursor [Pisum sativum]
 gb|AAA33653.1| glutamine synthetase (chloroplast GS2) (EC 6.3.1.2) [Pisum sativum]
Length=430

 Score =   345 bits (885),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 162/203 (80%), Positives = 180/203 (89%), Gaps = 2/203 (1%)
 Frame = +3

Query  132  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  311
            MAQILAPS QWQMR+TK    ATP+ SKMW S+VMK  K+VA   +AKFRV A+ S N T
Sbjct  1    MAQILAPSTQWQMRITKTSPCATPITSKMWSSLVMKQTKKVA--HSAKFRVMAVNSENGT  58

Query  312  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  491
            +NR+E LLNLD+TP+T+ IIAEYIWIGG+GID RSKSRTISKPV HPSE+PKWNYDGSST
Sbjct  59   INRVEDLLNLDITPFTDSIIAEYIWIGGTGIDVRSKSRTISKPVSHPSEVPKWNYDGSST  118

Query  492  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVV  671
            GQAPGEDSEVILYPQAIFKDPFRGGNNILV+CD YTPAGEPIPTNKRHRAA+IFS+PKV 
Sbjct  119  GQAPGEDSEVILYPQAIFKDPFRGGNNILVVCDAYTPAGEPIPTNKRHRAAEIFSNPKVE  178

Query  672  SEVPWYGIEQEYTLLQQNVKWPL  740
            +E+PWYGIEQEYTLLQ NVKWPL
Sbjct  179  AEIPWYGIEQEYTLLQTNVKWPL  201



>gb|ACU18743.1| unknown [Glycine max]
Length=420

 Score =   344 bits (883),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 161/203 (79%), Positives = 184/203 (91%), Gaps = 0/203 (0%)
 Frame = +3

Query  132  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  311
            MAQILAPS QWQMR++K+   ATP+ S MW S++ K NK+V+  S+AKFRV A++S NST
Sbjct  1    MAQILAPSTQWQMRISKSSPNATPITSNMWSSLLWKQNKKVSPTSSAKFRVLAIKSDNST  60

Query  312  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  491
            +NR+E LLNLD+TP+T+KIIAEYIWIGG+GID RSKSRTISKPV+ PSELPKWNYDGSST
Sbjct  61   INRLEGLLNLDITPFTDKIIAEYIWIGGTGIDVRSKSRTISKPVEDPSELPKWNYDGSST  120

Query  492  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVV  671
            GQAPG+DSEVILYPQAIFKDPFRGGNNILVICD+YTP GEPIPTNKRHRAA+IFS+PKV 
Sbjct  121  GQAPGDDSEVILYPQAIFKDPFRGGNNILVICDSYTPQGEPIPTNKRHRAAEIFSNPKVQ  180

Query  672  SEVPWYGIEQEYTLLQQNVKWPL  740
            +EVPWYGIEQEYTLLQ NVKWPL
Sbjct  181  AEVPWYGIEQEYTLLQTNVKWPL  203



>ref|XP_011462784.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic [Fragaria 
vesca subsp. vesca]
Length=431

 Score =   344 bits (883),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 160/203 (79%), Positives = 184/203 (91%), Gaps = 1/203 (0%)
 Frame = +3

Query  132  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  311
            MAQILAP++QWQMR+TK+   ++PM  KMW S+V+K NK+ A+KS+ KFRVFA +  + T
Sbjct  1    MAQILAPTSQWQMRITKSSIPSSPMTGKMWSSLVLKQNKKGAIKSS-KFRVFASKYEDYT  59

Query  312  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  491
            +NR+E LLNLD+TPYT+KIIAEYIWIGGSGID RSKSRTISKPV+HPSELPKWNYDGSST
Sbjct  60   INRVEDLLNLDITPYTDKIIAEYIWIGGSGIDVRSKSRTISKPVEHPSELPKWNYDGSST  119

Query  492  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVV  671
            GQAPG+DSEVILYPQAIFKDPFRGGNNILVICD+YTP GEPIPTNKRHRAAQ+FS+ KV+
Sbjct  120  GQAPGDDSEVILYPQAIFKDPFRGGNNILVICDSYTPQGEPIPTNKRHRAAQVFSNQKVI  179

Query  672  SEVPWYGIEQEYTLLQQNVKWPL  740
             EVPWYGIEQEYTLLQ +VKWPL
Sbjct  180  DEVPWYGIEQEYTLLQSSVKWPL  202



>ref|XP_008223033.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic [Prunus 
mume]
Length=432

 Score =   343 bits (881),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 158/203 (78%), Positives = 184/203 (91%), Gaps = 0/203 (0%)
 Frame = +3

Query  132  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  311
            MAQILAP++QWQMR+TK+ T A+PM +KMW S+++K NKR   KS+AKFRV A++S + T
Sbjct  1    MAQILAPTSQWQMRITKSSTTASPMTAKMWSSLLLKQNKRGPTKSSAKFRVLAVKSEDYT  60

Query  312  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  491
            +NR+E LLNLD+TP+T++IIAEYIWIGGSG+D RSKSRTISKPV+HPSELPKWNYDGSST
Sbjct  61   INRLEGLLNLDLTPFTDRIIAEYIWIGGSGVDVRSKSRTISKPVEHPSELPKWNYDGSST  120

Query  492  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVV  671
            GQAPGEDSEVILYPQAIFKDPFRGGNNILVICD YTP GEPIPTNKR RAA+IF++ KV+
Sbjct  121  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDAYTPQGEPIPTNKRARAAEIFANQKVI  180

Query  672  SEVPWYGIEQEYTLLQQNVKWPL  740
             EVPWYGIEQEYTLLQ +VKWPL
Sbjct  181  DEVPWYGIEQEYTLLQTDVKWPL  203



>gb|KCW84320.1| hypothetical protein EUGRSUZ_B01163 [Eucalyptus grandis]
Length=322

 Score =   340 bits (871),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 160/203 (79%), Positives = 182/203 (90%), Gaps = 0/203 (0%)
 Frame = +3

Query  132  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  311
            MAQI+AP+ Q QMR+TKN   A+PM +K W S+++K  K    KS +KFRV+AL+S NST
Sbjct  7    MAQIMAPTIQCQMRITKNSLTASPMTAKTWSSLLLKQKKSGNTKSLSKFRVYALKSENST  66

Query  312  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  491
            +NR+E LLNLDVTPYT+KIIAEYIWIGGSGID RSKSRTIS+PV+HPSELPKWNYDGSST
Sbjct  67   INRLENLLNLDVTPYTDKIIAEYIWIGGSGIDLRSKSRTISRPVEHPSELPKWNYDGSST  126

Query  492  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVV  671
            GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKR RAA+IFS+ KV+
Sbjct  127  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRARAAEIFSNQKVI  186

Query  672  SEVPWYGIEQEYTLLQQNVKWPL  740
            +EVPWYGIEQEYTL+Q NV+WPL
Sbjct  187  NEVPWYGIEQEYTLMQTNVRWPL  209



>ref|XP_007147796.1| hypothetical protein PHAVU_006G155800g [Phaseolus vulgaris]
 ref|XP_007147797.1| hypothetical protein PHAVU_006G155800g [Phaseolus vulgaris]
 sp|P15102.1|GLNA4_PHAVU RecName: Full=Glutamine synthetase leaf isozyme, chloroplastic; 
AltName: Full=Glutamate--ammonia ligase; AltName: Full=Isozyme 
delta; Flags: Precursor [Phaseolus vulgaris]
 emb|CAA31234.1| unnamed protein product [Phaseolus vulgaris]
 gb|ESW19790.1| hypothetical protein PHAVU_006G155800g [Phaseolus vulgaris]
 gb|ESW19791.1| hypothetical protein PHAVU_006G155800g [Phaseolus vulgaris]
Length=429

 Score =   342 bits (878),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 158/203 (78%), Positives = 181/203 (89%), Gaps = 3/203 (1%)
 Frame = +3

Query  132  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  311
            MAQILAPS QWQMR TK+   A+P+ S  W S++MK NK+    S+AKFRV A++S  ST
Sbjct  1    MAQILAPSTQWQMRFTKSSRHASPITSNTWSSLLMKQNKKT---SSAKFRVLAVKSDGST  57

Query  312  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  491
            +NR+E LLNLD+TP+T+KIIAEYIWIGG+GID RSKSRTISKPV+HPSELPKWNYDGSST
Sbjct  58   INRLEGLLNLDITPFTDKIIAEYIWIGGTGIDVRSKSRTISKPVEHPSELPKWNYDGSST  117

Query  492  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVV  671
            GQAPGEDSEVILYPQAIFKDPFRGGNNILVICD YTPAGEPIPTNKRHRAA++FS+P+V+
Sbjct  118  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDAYTPAGEPIPTNKRHRAAEVFSNPRVI  177

Query  672  SEVPWYGIEQEYTLLQQNVKWPL  740
            +EVPW+GIEQEYTLLQ NV WPL
Sbjct  178  AEVPWFGIEQEYTLLQTNVNWPL  200



>ref|XP_010035905.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic-like 
isoform X2 [Eucalyptus grandis]
 ref|XP_010035913.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic-like 
isoform X2 [Eucalyptus grandis]
 gb|KCW84321.1| hypothetical protein EUGRSUZ_B01163 [Eucalyptus grandis]
Length=432

 Score =   342 bits (878),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 160/203 (79%), Positives = 182/203 (90%), Gaps = 0/203 (0%)
 Frame = +3

Query  132  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  311
            MAQI+AP+ Q QMR+TKN   A+PM +K W S+++K  K    KS +KFRV+AL+S NST
Sbjct  1    MAQIMAPTIQCQMRITKNSLTASPMTAKTWSSLLLKQKKSGNTKSLSKFRVYALKSENST  60

Query  312  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  491
            +NR+E LLNLDVTPYT+KIIAEYIWIGGSGID RSKSRTIS+PV+HPSELPKWNYDGSST
Sbjct  61   INRLENLLNLDVTPYTDKIIAEYIWIGGSGIDLRSKSRTISRPVEHPSELPKWNYDGSST  120

Query  492  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVV  671
            GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKR RAA+IFS+ KV+
Sbjct  121  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRARAAEIFSNQKVI  180

Query  672  SEVPWYGIEQEYTLLQQNVKWPL  740
            +EVPWYGIEQEYTL+Q NV+WPL
Sbjct  181  NEVPWYGIEQEYTLMQTNVRWPL  203



>ref|XP_010035896.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic-like 
isoform X1 [Eucalyptus grandis]
 gb|KCW84319.1| hypothetical protein EUGRSUZ_B01163 [Eucalyptus grandis]
Length=438

 Score =   342 bits (878),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 160/203 (79%), Positives = 182/203 (90%), Gaps = 0/203 (0%)
 Frame = +3

Query  132  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  311
            MAQI+AP+ Q QMR+TKN   A+PM +K W S+++K  K    KS +KFRV+AL+S NST
Sbjct  7    MAQIMAPTIQCQMRITKNSLTASPMTAKTWSSLLLKQKKSGNTKSLSKFRVYALKSENST  66

Query  312  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  491
            +NR+E LLNLDVTPYT+KIIAEYIWIGGSGID RSKSRTIS+PV+HPSELPKWNYDGSST
Sbjct  67   INRLENLLNLDVTPYTDKIIAEYIWIGGSGIDLRSKSRTISRPVEHPSELPKWNYDGSST  126

Query  492  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVV  671
            GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKR RAA+IFS+ KV+
Sbjct  127  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRARAAEIFSNQKVI  186

Query  672  SEVPWYGIEQEYTLLQQNVKWPL  740
            +EVPWYGIEQEYTL+Q NV+WPL
Sbjct  187  NEVPWYGIEQEYTLMQTNVRWPL  209



>prf||1601519A Gln synthetase
Length=429

 Score =   342 bits (877),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 158/203 (78%), Positives = 181/203 (89%), Gaps = 3/203 (1%)
 Frame = +3

Query  132  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  311
            MAQILAPS QWQMR TK+   A+P+ S  W S++MK NK+    S+AKFRV A++S  ST
Sbjct  1    MAQILAPSTQWQMRFTKSSRHASPITSNTWSSLLMKQNKKT---SSAKFRVLAVKSDGST  57

Query  312  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  491
            +NR+E LLNLD+TP+T+KIIAEYIWIGG+GID RSKSRTISKPV+HPSELPKWNYDGSST
Sbjct  58   INRLEGLLNLDITPFTDKIIAEYIWIGGTGIDVRSKSRTISKPVEHPSELPKWNYDGSST  117

Query  492  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVV  671
            GQAPGEDSEVILYPQAIFKDPFRGGNNILVICD YTPAGEPIPTNKRHRAA++FS+P+V+
Sbjct  118  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDAYTPAGEPIPTNKRHRAAEVFSNPRVI  177

Query  672  SEVPWYGIEQEYTLLQQNVKWPL  740
            +EVPW+GIEQEYTLLQ NV WPL
Sbjct  178  AEVPWFGIEQEYTLLQTNVNWPL  200



>ref|XP_004486102.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic-like 
[Cicer arietinum]
Length=430

 Score =   342 bits (877),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 162/203 (80%), Positives = 182/203 (90%), Gaps = 2/203 (1%)
 Frame = +3

Query  132  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  311
            MAQILAPS QWQMR+TK     TP+ SKMW S+V+K NK+VA   +AKFRV A++  NST
Sbjct  1    MAQILAPSTQWQMRITKTSPCVTPITSKMWSSLVVKQNKKVA--RSAKFRVMAIKPDNST  58

Query  312  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  491
            +NR+E LLNLD+TP+T+KIIAEYIWIGG+GID RSKSRTISKPV+ PSELPKWNYDGSST
Sbjct  59   INRLEGLLNLDITPFTDKIIAEYIWIGGTGIDVRSKSRTISKPVEDPSELPKWNYDGSST  118

Query  492  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVV  671
            GQAPGEDSEVILYPQAIFKDPFRGGNNILVICD YTPAGEPIPTNKRHRAA+IFS+PKV 
Sbjct  119  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDAYTPAGEPIPTNKRHRAAEIFSNPKVQ  178

Query  672  SEVPWYGIEQEYTLLQQNVKWPL  740
            +E+PWYGIEQEYTLLQ +VKWPL
Sbjct  179  AEIPWYGIEQEYTLLQTDVKWPL  201



>gb|KDO74871.1| hypothetical protein CISIN_1g013478mg [Citrus sinensis]
Length=428

 Score =   342 bits (877),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 163/203 (80%), Positives = 181/203 (89%), Gaps = 4/203 (2%)
 Frame = +3

Query  132  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  311
            MAQILAPS QWQMRM K    A+PM +KMW S++MK NK+   +S+AKFRV AL+S +ST
Sbjct  1    MAQILAPSMQWQMRMPKYSNIASPMTTKMWSSLLMKQNKKGTNRSSAKFRVLALKSEDST  60

Query  312  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  491
            VNR+E LLNLD+TPYT+KIIAEYIWIGG+GID RSKS    KPV+HPSELPKWNYDGSST
Sbjct  61   VNRLEDLLNLDITPYTDKIIAEYIWIGGTGIDMRSKS----KPVEHPSELPKWNYDGSST  116

Query  492  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVV  671
            GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAA+IFS+ KV 
Sbjct  117  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAEIFSNSKVS  176

Query  672  SEVPWYGIEQEYTLLQQNVKWPL  740
            +EVPW+GIEQEYTLLQQNVKWPL
Sbjct  177  AEVPWFGIEQEYTLLQQNVKWPL  199



>gb|AAF17703.1|AF031082_1 glutamine synthetase [Canavalia lineata]
Length=430

 Score =   342 bits (877),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 158/203 (78%), Positives = 181/203 (89%), Gaps = 2/203 (1%)
 Frame = +3

Query  132  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  311
            MAQILAPS QWQMR+TK    A+P+ S MW S++MK NK+    S+AKFRV A++S N T
Sbjct  1    MAQILAPSTQWQMRITKTSPNASPVTSNMWSSLLMKQNKKAT--SSAKFRVLAIKSENGT  58

Query  312  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  491
            +NR+E LL+LD+TPYT+KIIAEYIW+GG+GID RSKSRTI++PV+HPSELPKWNYDGSST
Sbjct  59   INRLENLLDLDITPYTDKIIAEYIWVGGTGIDVRSKSRTIARPVEHPSELPKWNYDGSST  118

Query  492  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVV  671
            GQAPG+DSEVILYPQAIFKDPFRGGNNILVICD YTPAGEPIPTNKRHRAA+IFS+PKV 
Sbjct  119  GQAPGDDSEVILYPQAIFKDPFRGGNNILVICDAYTPAGEPIPTNKRHRAAEIFSNPKVQ  178

Query  672  SEVPWYGIEQEYTLLQQNVKWPL  740
            +EVPWYGIEQEYTLLQ NV WPL
Sbjct  179  AEVPWYGIEQEYTLLQTNVNWPL  201



>gb|AJD14836.1| plastid glutamine synthetase [Boehmeria nivea]
Length=430

 Score =   342 bits (876),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 158/203 (78%), Positives = 184/203 (91%), Gaps = 2/203 (1%)
 Frame = +3

Query  132  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  311
            MAQILAPS Q QMR+TK  +  +P+ SKMW S+V+K +KRV  K ++K++V  ++S + T
Sbjct  1    MAQILAPSTQMQMRITKASSSTSPLTSKMWSSIVLKQSKRV--KGSSKYKVLTVKSEHGT  58

Query  312  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  491
            +NR+E LLNLD+TP+T+KIIAEYIWIGG+GID RSKSRTISKPV+HPSELPKWNYDGSST
Sbjct  59   INRLEDLLNLDITPFTDKIIAEYIWIGGTGIDVRSKSRTISKPVEHPSELPKWNYDGSST  118

Query  492  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVV  671
            GQAPGEDSEVILYPQAIFKDPFRGGNNILV+CD+YTPAGEPIPTNKRHRAA+IFS+PKVV
Sbjct  119  GQAPGEDSEVILYPQAIFKDPFRGGNNILVMCDSYTPAGEPIPTNKRHRAAEIFSNPKVV  178

Query  672  SEVPWYGIEQEYTLLQQNVKWPL  740
            SEVPW+GIEQEYTLLQ NVKWPL
Sbjct  179  SEVPWFGIEQEYTLLQTNVKWPL  201



>gb|KDO74875.1| hypothetical protein CISIN_1g013478mg [Citrus sinensis]
Length=442

 Score =   342 bits (877),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 166/213 (78%), Positives = 185/213 (87%), Gaps = 10/213 (5%)
 Frame = +3

Query  132  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  311
            MAQILAPS QWQMRM K    A+PM +KMW S++MK NK+   +S+AKFRV AL+S +ST
Sbjct  1    MAQILAPSMQWQMRMPKYSNIASPMTTKMWSSLLMKQNKKGTNRSSAKFRVLALKSEDST  60

Query  312  VNRIEQLLNLDVTPYTNKIIAEYI--------W--IGGSGIDTRSKSRTISKPVQHPSEL  461
            VNR+E LLNLD+TPYT+KIIAEYI        W  IGG+GID RSKS+TISKPV+HPSEL
Sbjct  61   VNRLEDLLNLDITPYTDKIIAEYICQNNTISCWNRIGGTGIDMRSKSKTISKPVEHPSEL  120

Query  462  PKWNYDGSSTGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRA  641
            PKWNYDGSSTGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRA
Sbjct  121  PKWNYDGSSTGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRA  180

Query  642  AQIFSDPKVVSEVPWYGIEQEYTLLQQNVKWPL  740
            A+IFS+ KV +EVPW+GIEQEYTLLQQNVKWPL
Sbjct  181  AEIFSNSKVSAEVPWFGIEQEYTLLQQNVKWPL  213



>ref|XP_007222384.1| hypothetical protein PRUPE_ppa006025mg [Prunus persica]
 gb|EMJ23583.1| hypothetical protein PRUPE_ppa006025mg [Prunus persica]
Length=432

 Score =   341 bits (875),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 157/203 (77%), Positives = 183/203 (90%), Gaps = 0/203 (0%)
 Frame = +3

Query  132  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  311
            MAQILAP++QWQMR+TK+ T A+PM +K+W S+++K NKR   KS+AKFRV A++S   T
Sbjct  1    MAQILAPTSQWQMRITKSSTTASPMTAKVWSSLLLKQNKRGPTKSSAKFRVLAVKSEGYT  60

Query  312  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  491
            +NR+E LLNLD+TP+T++IIAEYIWIGGSG+D RSKSRTISKPV+HPSELPKWNYDGSST
Sbjct  61   INRLEGLLNLDLTPFTDRIIAEYIWIGGSGVDVRSKSRTISKPVEHPSELPKWNYDGSST  120

Query  492  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVV  671
            GQAPGEDSEVILYPQAIFKDPFRGGNNILVICD YTP GEPIPTNKR RAA+IF++ KV+
Sbjct  121  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDAYTPQGEPIPTNKRARAAEIFANQKVI  180

Query  672  SEVPWYGIEQEYTLLQQNVKWPL  740
             EVPWYGIEQEYTLLQ +VKWPL
Sbjct  181  DEVPWYGIEQEYTLLQTDVKWPL  203



>gb|AJI44225.1| plastid glutamine synthetase [Boehmeria nivea]
Length=430

 Score =   341 bits (874),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 158/203 (78%), Positives = 184/203 (91%), Gaps = 2/203 (1%)
 Frame = +3

Query  132  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  311
            MAQILAPS Q QMR+TK  +  +P+ SKMW S+V+K +KRV  K ++K++V  ++S + T
Sbjct  1    MAQILAPSTQMQMRITKASSSTSPLTSKMWSSIVLKQSKRV--KGSSKYKVLTVKSEHGT  58

Query  312  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  491
            +NR+E LLNLD+TP+T+KIIAEYIWIGG+GID RSKSRTISKPV+HPSELPKWNYDGSST
Sbjct  59   INRLEDLLNLDITPFTDKIIAEYIWIGGTGIDVRSKSRTISKPVEHPSELPKWNYDGSST  118

Query  492  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVV  671
            GQAPGEDSEVILYPQAIFKDPFRGGNNILV+CD+YTPAGEPIPTNKRHRAA+IFS+PKVV
Sbjct  119  GQAPGEDSEVILYPQAIFKDPFRGGNNILVMCDSYTPAGEPIPTNKRHRAAEIFSNPKVV  178

Query  672  SEVPWYGIEQEYTLLQQNVKWPL  740
            SEVPW+GIEQEYTLLQ NVKWPL
Sbjct  179  SEVPWFGIEQEYTLLQPNVKWPL  201



>ref|XP_010041422.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic isoform 
X1 [Eucalyptus grandis]
Length=432

 Score =   341 bits (874),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 159/203 (78%), Positives = 182/203 (90%), Gaps = 0/203 (0%)
 Frame = +3

Query  132  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  311
            MAQI+AP+ Q QMR+TK+   A+PM +K W S+++K  K    KS +KFRV+AL+S NST
Sbjct  1    MAQIMAPTTQCQMRITKHSLNASPMTAKTWSSLLLKQKKSGNTKSLSKFRVYALKSENST  60

Query  312  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  491
            +NR+E LLNLDVTPYT+KIIAEYIWIGGSGID RSKSRTIS+PV+HPSELPKWNYDGSST
Sbjct  61   INRLENLLNLDVTPYTDKIIAEYIWIGGSGIDLRSKSRTISRPVEHPSELPKWNYDGSST  120

Query  492  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVV  671
            GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKR RAA+IFS+ KV+
Sbjct  121  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRARAAEIFSNQKVI  180

Query  672  SEVPWYGIEQEYTLLQQNVKWPL  740
            +EVPWYGIEQEYTL+Q NV+WPL
Sbjct  181  NEVPWYGIEQEYTLMQTNVQWPL  203



>ref|NP_001284439.1| glutamine synthetase leaf isozyme, chloroplastic [Cucumis melo]
 gb|AAX35343.1| glutamine synthetase [Cucumis melo]
Length=432

 Score =   340 bits (873),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 158/203 (78%), Positives = 179/203 (88%), Gaps = 0/203 (0%)
 Frame = +3

Query  132  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  311
            MAQILAPS QWQ+R       ++P+  KMW S+++K NK+ AVKS++K+RV +++S   T
Sbjct  1    MAQILAPSTQWQLRTKLTSMSSSPITPKMWSSILLKQNKKGAVKSSSKYRVLSVKSVGGT  60

Query  312  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  491
            +NR+E LLNLDVTPYT+KIIAEYIWIGGSGID RSKSRTISKPV+HPSELPKWNYDGSST
Sbjct  61   INRMEDLLNLDVTPYTDKIIAEYIWIGGSGIDLRSKSRTISKPVEHPSELPKWNYDGSST  120

Query  492  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVV  671
            GQAPGEDSEVILYPQAIFKDPFRGGNNILVICD YTPAG PIPTNKRHRAA+IFS+ KVV
Sbjct  121  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDAYTPAGVPIPTNKRHRAAEIFSNKKVV  180

Query  672  SEVPWYGIEQEYTLLQQNVKWPL  740
             E+PWYGIEQEYTLLQ NVKWPL
Sbjct  181  DEIPWYGIEQEYTLLQTNVKWPL  203



>ref|XP_008438737.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic [Cucumis 
melo]
Length=432

 Score =   340 bits (872),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 158/203 (78%), Positives = 179/203 (88%), Gaps = 0/203 (0%)
 Frame = +3

Query  132  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  311
            MAQILAPS QWQ+R       ++P+  KMW S+++K NK+ AVKS++K+RV +++S   T
Sbjct  1    MAQILAPSTQWQLRTKLTSMSSSPITPKMWSSILLKQNKKGAVKSSSKYRVLSVKSVGGT  60

Query  312  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  491
            +NR+E LLNLDVTPYT+KIIAEYIWIGGSGID RSKSRTISKPV+HPSELPKWNYDGSST
Sbjct  61   INRMEDLLNLDVTPYTDKIIAEYIWIGGSGIDLRSKSRTISKPVEHPSELPKWNYDGSST  120

Query  492  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVV  671
            GQAPGEDSEVILYPQAIFKDPFRGGNNILVICD YTPAG PIPTNKRHRAA+IFS+ KVV
Sbjct  121  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDAYTPAGVPIPTNKRHRAAEIFSNKKVV  180

Query  672  SEVPWYGIEQEYTLLQQNVKWPL  740
             E+PWYGIEQEYTLLQ NVKWPL
Sbjct  181  DEIPWYGIEQEYTLLQTNVKWPL  203



>ref|XP_002279497.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic [Vitis 
vinifera]
 emb|CBI26165.3| unnamed protein product [Vitis vinifera]
Length=432

 Score =   340 bits (871),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 157/203 (77%), Positives = 178/203 (88%), Gaps = 0/203 (0%)
 Frame = +3

Query  132  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  311
            MAQILAPS QWQMRMTKN   A+P  +KMWGS+ +K   +   K + KFRV A +S +ST
Sbjct  1    MAQILAPSTQWQMRMTKNPANASPFTTKMWGSLFLKQKTKGTAKFSTKFRVCASKSESST  60

Query  312  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  491
            VNR++ LLN+D+ PYT+KIIAEY+WIGG+GID RSKSRTISKPV+HPSELPKWNYDGSST
Sbjct  61   VNRLDDLLNMDIRPYTDKIIAEYVWIGGTGIDLRSKSRTISKPVEHPSELPKWNYDGSST  120

Query  492  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVV  671
            GQAPGEDSEVILYPQAIFKDPFRGGNNILVICD+YTPAGEPIPTNKRHRAA+IF + KV+
Sbjct  121  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDSYTPAGEPIPTNKRHRAAEIFGNKKVI  180

Query  672  SEVPWYGIEQEYTLLQQNVKWPL  740
             EVPW+GIEQEYTLLQ NVKWPL
Sbjct  181  DEVPWFGIEQEYTLLQPNVKWPL  203



>ref|XP_004134161.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic-like 
[Cucumis sativus]
 gb|KGN57036.1| Glutamine synthetase [Cucumis sativus]
Length=432

 Score =   340 bits (871),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 158/203 (78%), Positives = 179/203 (88%), Gaps = 0/203 (0%)
 Frame = +3

Query  132  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  311
            MAQILAPS QWQ+R       ++P+  KMW S+++K NK+ AVKS++K+RV +++S   T
Sbjct  1    MAQILAPSTQWQLRTKLTPMSSSPITPKMWSSILLKQNKKGAVKSSSKYRVLSVRSEGGT  60

Query  312  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  491
            +NR+E LLNLDVTPYT+KIIAEYIWIGGSGID RSKSRTISKPV+HPSELPKWNYDGSST
Sbjct  61   INRMEDLLNLDVTPYTDKIIAEYIWIGGSGIDLRSKSRTISKPVEHPSELPKWNYDGSST  120

Query  492  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVV  671
            GQAPGEDSEVILYPQAIFKDPFRGGNNILVICD YTPAG PIPTNKRHRAA+IFS+ KVV
Sbjct  121  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDAYTPAGVPIPTNKRHRAAEIFSNKKVV  180

Query  672  SEVPWYGIEQEYTLLQQNVKWPL  740
             E+PWYGIEQEYTLLQ NVKWPL
Sbjct  181  DEIPWYGIEQEYTLLQTNVKWPL  203



>gb|AAN84538.1| putative plastidic glutamine synthetase [Spiraea nipponica]
Length=429

 Score =   338 bits (866),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 154/203 (76%), Positives = 179/203 (88%), Gaps = 0/203 (0%)
 Frame = +3

Query  132  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  311
            MA ILAP+ QWQ R+TKN T A+PM +KMWGS+++K NK+   K++ KFRV A++S   T
Sbjct  1    MAHILAPTTQWQTRITKNATSASPMTAKMWGSLLLKQNKKGPTKTSTKFRVLAVKSEGYT  60

Query  312  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  491
            +NR+E LLNLD+TP+T+KIIAEYIWIGG+G+D RSKSRTISKPV+HPSELPKWNYDGSST
Sbjct  61   INRLEGLLNLDLTPFTDKIIAEYIWIGGTGVDVRSKSRTISKPVEHPSELPKWNYDGSST  120

Query  492  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVV  671
            GQAPGEDSEVILYPQAIFKDPFRGGNNILVICD YTP GEPIPTNKR +AA+IF+  KV+
Sbjct  121  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDAYTPQGEPIPTNKRAKAAEIFAKQKVI  180

Query  672  SEVPWYGIEQEYTLLQQNVKWPL  740
             EVPWYGIEQEYTLLQ +VKWPL
Sbjct  181  DEVPWYGIEQEYTLLQTDVKWPL  203



>ref|XP_009339932.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic [Pyrus 
x bretschneideri]
Length=432

 Score =   336 bits (862),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 156/203 (77%), Positives = 179/203 (88%), Gaps = 0/203 (0%)
 Frame = +3

Query  132  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  311
            MAQILAP++QWQM++TK+   A+PM +KMWGS+V+K NK+   +S+ KFRV A +S   T
Sbjct  1    MAQILAPTSQWQMKVTKSSATASPMTAKMWGSLVLKQNKKGPTRSSTKFRVLATKSEGYT  60

Query  312  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  491
            +NR+E LLNLD+TP+T+KIIAEYIWIGGSGID RSKSRTISKPV+ PSELPKWNYDGSST
Sbjct  61   INRLEGLLNLDLTPFTDKIIAEYIWIGGSGIDVRSKSRTISKPVEDPSELPKWNYDGSST  120

Query  492  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVV  671
            GQAPGEDSEVILYPQAIFKDPFRGGNNILVICD YTP GEPIPTNKR RAA+IF + KV+
Sbjct  121  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDAYTPQGEPIPTNKRARAAEIFKNKKVI  180

Query  672  SEVPWYGIEQEYTLLQQNVKWPL  740
             EVPWYGIEQEYTLLQ +VKWPL
Sbjct  181  DEVPWYGIEQEYTLLQTDVKWPL  203



>ref|XP_009352136.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic-like 
[Pyrus x bretschneideri]
Length=432

 Score =   335 bits (860),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 154/203 (76%), Positives = 180/203 (89%), Gaps = 0/203 (0%)
 Frame = +3

Query  132  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  311
            MAQILAP++QWQM++TK+ T A+PM +KMWGS+V+K NK+   +S+ KFRV A ++   T
Sbjct  1    MAQILAPTSQWQMKITKSSTTASPMTAKMWGSLVLKQNKKGPARSSTKFRVLATKAEGYT  60

Query  312  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  491
            +NR+E LLNLD+TP+T++IIAEYIWIGGSG+D RSKSRTISKPV+ PSELPKWNYDGSST
Sbjct  61   INRLEGLLNLDLTPFTDRIIAEYIWIGGSGVDVRSKSRTISKPVEDPSELPKWNYDGSST  120

Query  492  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVV  671
            GQAPGEDSEVILYPQAIFKDPFRGGNNILVICD YTP GEPIPTNKR RAA+IF + KV+
Sbjct  121  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDAYTPQGEPIPTNKRARAAEIFKNKKVI  180

Query  672  SEVPWYGIEQEYTLLQQNVKWPL  740
             EVPWYGIEQEYTLLQ +VKWPL
Sbjct  181  DEVPWYGIEQEYTLLQTDVKWPL  203



>gb|ACJ84875.1| unknown [Medicago truncatula]
Length=321

 Score =   331 bits (849),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 160/203 (79%), Positives = 180/203 (89%), Gaps = 4/203 (2%)
 Frame = +3

Query  132  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  311
            MAQILAPS Q Q R+TK    ATP++SKMW S+VMK NK+VA   +AKFRV A+ SG  T
Sbjct  1    MAQILAPSTQCQARITKISPVATPISSKMWSSLVMKQNKKVA--RSAKFRVMAVNSG--T  56

Query  312  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  491
            +NR+E LLNLD+TP+T+ IIAEYIWIGG+GID RSKSRTISKPV+HPSELPKWNYDGSST
Sbjct  57   INRVEDLLNLDITPFTDSIIAEYIWIGGTGIDVRSKSRTISKPVEHPSELPKWNYDGSST  116

Query  492  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVV  671
            GQAPGEDSEVILYPQAIFKDPFRGGNNILVICD YTP GEPIPTNKRH+AA+IFS+PKV 
Sbjct  117  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDAYTPQGEPIPTNKRHKAAEIFSNPKVE  176

Query  672  SEVPWYGIEQEYTLLQQNVKWPL  740
            +E+PWYGIEQEYTLLQ +VKWPL
Sbjct  177  AEIPWYGIEQEYTLLQTDVKWPL  199



>ref|XP_008361978.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic [Malus 
domestica]
Length=396

 Score =   333 bits (855),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 155/203 (76%), Positives = 178/203 (88%), Gaps = 0/203 (0%)
 Frame = +3

Query  132  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  311
            MAQILAP++QWQM++TK+   A+PM +KMWGS+V+K NK+   +S+ KFRV A +S   T
Sbjct  1    MAQILAPTSQWQMKVTKSSATASPMTAKMWGSLVLKQNKKGPTRSSTKFRVLATKSEGYT  60

Query  312  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  491
            +NR+E LLNLD+TP+T+KIIAEYIWIGGSGID RSKSRT SKPV+ PSELPKWNYDGSST
Sbjct  61   INRLEGLLNLDLTPFTDKIIAEYIWIGGSGIDVRSKSRTXSKPVEDPSELPKWNYDGSST  120

Query  492  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVV  671
            GQAPGEDSEVILYPQAIFKDPFRGGNNILVICD YTP GEPIPTNKR RAA+IF + KV+
Sbjct  121  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDAYTPQGEPIPTNKRARAAEIFKNKKVI  180

Query  672  SEVPWYGIEQEYTLLQQNVKWPL  740
             EVPWYGIEQEYTLLQ +VKWPL
Sbjct  181  DEVPWYGIEQEYTLLQTDVKWPL  203



>gb|KEH36742.1| glutamine synthetase domain protein [Medicago truncatula]
Length=393

 Score =   333 bits (854),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 160/203 (79%), Positives = 180/203 (89%), Gaps = 4/203 (2%)
 Frame = +3

Query  132  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  311
            MAQILAPS Q Q R+TK    ATP++SKMW S+VMK NK+VA   +AKFRV A+ SG  T
Sbjct  1    MAQILAPSTQCQARITKISPVATPISSKMWSSLVMKQNKKVA--RSAKFRVMAVNSG--T  56

Query  312  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  491
            +NR+E LLNLD+TP+T+ IIAEYIWIGG+GID RSKSRTISKPV+HPSELPKWNYDGSST
Sbjct  57   INRVEDLLNLDITPFTDSIIAEYIWIGGTGIDVRSKSRTISKPVEHPSELPKWNYDGSST  116

Query  492  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVV  671
            GQAPGEDSEVILYPQAIFKDPFRGGNNILVICD YTP GEPIPTNKRH+AA+IFS+PKV 
Sbjct  117  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDAYTPQGEPIPTNKRHKAAEIFSNPKVE  176

Query  672  SEVPWYGIEQEYTLLQQNVKWPL  740
            +E+PWYGIEQEYTLLQ +VKWPL
Sbjct  177  AEIPWYGIEQEYTLLQTDVKWPL  199



>sp|Q9XQ94.1|GLNA2_MEDSA RecName: Full=Glutamine synthetase leaf isozyme, chloroplastic; 
AltName: Full=GS2; AltName: Full=Glutamate--ammonia ligase; 
Flags: Precursor [Medicago sativa]
 gb|AAD28443.1|AF124244_1 glutamine synthetase precursor [Medicago sativa]
Length=428

 Score =   334 bits (857),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 160/203 (79%), Positives = 180/203 (89%), Gaps = 4/203 (2%)
 Frame = +3

Query  132  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  311
            MAQILAPS Q Q R+TK    ATP++SKMW S+VMK NK+VA   +AKFRV A+ SG  T
Sbjct  1    MAQILAPSIQCQTRITKTSPLATPISSKMWSSLVMKQNKKVA--RSAKFRVMAINSG--T  56

Query  312  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  491
            +NR+E LLNLD+TP+T+ IIAEYIWIGG+GID RSKSRTISKPV+HPSELPKWNYDGSST
Sbjct  57   INRVEDLLNLDITPFTDSIIAEYIWIGGTGIDVRSKSRTISKPVEHPSELPKWNYDGSST  116

Query  492  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVV  671
            GQAPGEDSEVILYPQAIFKDPFRGGNNILVICD YTP GEPIPTNKRH+AA+IFS+PKV 
Sbjct  117  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDAYTPQGEPIPTNKRHKAAEIFSNPKVE  176

Query  672  SEVPWYGIEQEYTLLQQNVKWPL  740
            +E+PWYGIEQEYTLLQ +VKWPL
Sbjct  177  AEIPWYGIEQEYTLLQTDVKWPL  199



>ref|XP_008390805.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic [Malus 
domestica]
Length=432

 Score =   334 bits (857),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 153/203 (75%), Positives = 180/203 (89%), Gaps = 0/203 (0%)
 Frame = +3

Query  132  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  311
            MAQILAP++QWQM++T++ T A+PM +KMWGS+V+K NK+   +S+ KFRV A ++   T
Sbjct  1    MAQILAPNSQWQMKITRSSTTASPMTAKMWGSLVLKQNKKGPARSSTKFRVLATKAEGYT  60

Query  312  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  491
            +NR+E LLNLD+TP+T++IIAEYIWIGGSG+D RSKSRTISKPV+ PSELPKWNYDGSST
Sbjct  61   INRLEGLLNLDLTPFTDRIIAEYIWIGGSGVDVRSKSRTISKPVEDPSELPKWNYDGSST  120

Query  492  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVV  671
            GQAPGEDSEVILYPQAIFKDPFRGGNNILVICD YTP GEPIPTNKR RAA+IF + KV+
Sbjct  121  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDAYTPQGEPIPTNKRARAAEIFKNKKVI  180

Query  672  SEVPWYGIEQEYTLLQQNVKWPL  740
             EVPWYGIEQEYTLLQ +VKWPL
Sbjct  181  DEVPWYGIEQEYTLLQTDVKWPL  203



>ref|XP_008353244.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic [Malus 
domestica]
Length=432

 Score =   334 bits (856),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 155/203 (76%), Positives = 178/203 (88%), Gaps = 0/203 (0%)
 Frame = +3

Query  132  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  311
            MAQILAP++QWQM++TK+   A+PM +KMWGS+V+K NK+   +S+ KFRV A +S   T
Sbjct  1    MAQILAPTSQWQMKVTKSSATASPMTAKMWGSLVLKQNKKGPTRSSTKFRVLATKSEGYT  60

Query  312  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  491
            +NR+E LLNLD+TP+T+KIIAEYIWIGGSGID RSKSRT SKPV+ PSELPKWNYDGSST
Sbjct  61   INRLEGLLNLDLTPFTDKIIAEYIWIGGSGIDVRSKSRTXSKPVEDPSELPKWNYDGSST  120

Query  492  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVV  671
            GQAPGEDSEVILYPQAIFKDPFRGGNNILVICD YTP GEPIPTNKR RAA+IF + KV+
Sbjct  121  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDAYTPQGEPIPTNKRARAAEIFKNKKVI  180

Query  672  SEVPWYGIEQEYTLLQQNVKWPL  740
             EVPWYGIEQEYTLLQ +VKWPL
Sbjct  181  DEVPWYGIEQEYTLLQTDVKWPL  203



>gb|AAO37651.1| glutamine synthetase [Medicago truncatula]
 gb|KEH36741.1| glutamine synthetase domain protein [Medicago truncatula]
Length=428

 Score =   333 bits (855),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 160/203 (79%), Positives = 180/203 (89%), Gaps = 4/203 (2%)
 Frame = +3

Query  132  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  311
            MAQILAPS Q Q R+TK    ATP++SKMW S+VMK NK+VA   +AKFRV A+ SG  T
Sbjct  1    MAQILAPSTQCQARITKISPVATPISSKMWSSLVMKQNKKVA--RSAKFRVMAVNSG--T  56

Query  312  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  491
            +NR+E LLNLD+TP+T+ IIAEYIWIGG+GID RSKSRTISKPV+HPSELPKWNYDGSST
Sbjct  57   INRVEDLLNLDITPFTDSIIAEYIWIGGTGIDVRSKSRTISKPVEHPSELPKWNYDGSST  116

Query  492  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVV  671
            GQAPGEDSEVILYPQAIFKDPFRGGNNILVICD YTP GEPIPTNKRH+AA+IFS+PKV 
Sbjct  117  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDAYTPQGEPIPTNKRHKAAEIFSNPKVE  176

Query  672  SEVPWYGIEQEYTLLQQNVKWPL  740
            +E+PWYGIEQEYTLLQ +VKWPL
Sbjct  177  AEIPWYGIEQEYTLLQTDVKWPL  199



>gb|AAO85218.1| glutamine synthetase PR2 mutant [Lotus japonicus]
Length=430

 Score =   333 bits (855),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 157/203 (77%), Positives = 177/203 (87%), Gaps = 2/203 (1%)
 Frame = +3

Query  132  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  311
            MAQILAPS QWQ R+TK    A+P+ S MW S++ K NK+VA  S  KFRV A++S  ST
Sbjct  1    MAQILAPSTQWQTRITKTSPNASPITSNMWSSLLWKQNKKVARAS--KFRVLAIKSDGST  58

Query  312  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  491
            +NR+E LLNLDVTPYT+K IAEYIWIGG+G+D RSKSRTISKPV HPSELPKWNYDGSST
Sbjct  59   INRLEGLLNLDVTPYTDKFIAEYIWIGGTGVDVRSKSRTISKPVSHPSELPKWNYDGSST  118

Query  492  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVV  671
            GQAPG+DSEVILYPQAIF+DPFRGGNNILVICD YTP GEPIPTNKRHRAA+IFS+PKV 
Sbjct  119  GQAPGDDSEVILYPQAIFRDPFRGGNNILVICDAYTPQGEPIPTNKRHRAAEIFSNPKVQ  178

Query  672  SEVPWYGIEQEYTLLQQNVKWPL  740
            +E+PWYGIEQEYTLLQ +VKWPL
Sbjct  179  AEIPWYGIEQEYTLLQTDVKWPL  201



>gb|AAN84563.1| glutamine synthetase [Lotus japonicus]
Length=430

 Score =   333 bits (855),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 157/203 (77%), Positives = 177/203 (87%), Gaps = 2/203 (1%)
 Frame = +3

Query  132  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  311
            MAQILAPS QWQ R+TK    A+P+ S MW S++ K NK+VA  S  KFRV A++S  ST
Sbjct  1    MAQILAPSTQWQTRITKTSPNASPITSNMWSSLLWKQNKKVARAS--KFRVLAIKSDGST  58

Query  312  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  491
            +NR+E LLNLDVTPYT+K IAEYIWIGG+G+D RSKSRTISKPV HPSELPKWNYDGSST
Sbjct  59   INRLEGLLNLDVTPYTDKFIAEYIWIGGTGVDVRSKSRTISKPVSHPSELPKWNYDGSST  118

Query  492  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVV  671
            GQAPG+DSEVILYPQAIF+DPFRGGNNILVICD YTP GEPIPTNKRHRAA+IFS+PKV 
Sbjct  119  GQAPGDDSEVILYPQAIFRDPFRGGNNILVICDAYTPQGEPIPTNKRHRAAEIFSNPKVQ  178

Query  672  SEVPWYGIEQEYTLLQQNVKWPL  740
            +E+PWYGIEQEYTLLQ +VKWPL
Sbjct  179  AEIPWYGIEQEYTLLQTDVKWPL  201



>gb|AAL67439.1| glutamine synthetase precursor [Lotus japonicus]
Length=430

 Score =   333 bits (855),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 157/203 (77%), Positives = 177/203 (87%), Gaps = 2/203 (1%)
 Frame = +3

Query  132  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  311
            MAQILAPS QWQ R+TK    A+P+ S MW S++ K NK+VA  S  KFRV A++S  ST
Sbjct  1    MAQILAPSTQWQTRITKTSPNASPITSNMWSSLLWKQNKKVARAS--KFRVLAIKSDGST  58

Query  312  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  491
            +NR+E LLNLDVTPYT+K IAEYIWIGG+G+D RSKSRTISKPV HPSELPKWNYDGSST
Sbjct  59   INRLEGLLNLDVTPYTDKFIAEYIWIGGTGVDVRSKSRTISKPVSHPSELPKWNYDGSST  118

Query  492  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVV  671
            GQAPG+DSEVILYPQAIF+DPFRGGNNILVICD YTP GEPIPTNKRHRAA+IFS+PKV 
Sbjct  119  GQAPGDDSEVILYPQAIFRDPFRGGNNILVICDAYTPQGEPIPTNKRHRAAEIFSNPKVQ  178

Query  672  SEVPWYGIEQEYTLLQQNVKWPL  740
            +E+PWYGIEQEYTLLQ +VKWPL
Sbjct  179  AEIPWYGIEQEYTLLQTDVKWPL  201



>gb|AAN84537.1| putative plastidic glutamine synthetase [Crataegus crus-galli]
Length=432

 Score =   333 bits (854),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 153/203 (75%), Positives = 179/203 (88%), Gaps = 0/203 (0%)
 Frame = +3

Query  132  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  311
            MAQILAP++QW+M++T++   A+PM +KMWGS+V+K NK+   +S+ KFRV A +S   T
Sbjct  1    MAQILAPTSQWRMKVTRSSATASPMTAKMWGSLVLKQNKKGPARSSTKFRVLATKSEGYT  60

Query  312  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  491
            +NR+E LLNLD+TP+T+KIIAEYIWIGGSG+D RSKSRTISKPV+ PSELPKWNYDGSST
Sbjct  61   INRLEGLLNLDLTPFTDKIIAEYIWIGGSGVDVRSKSRTISKPVEDPSELPKWNYDGSST  120

Query  492  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVV  671
            GQAPGEDSEVILYPQAIFKDPFRGGNNILVICD YTP GEPIPTNKR RAA+IF + KV+
Sbjct  121  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDAYTPQGEPIPTNKRARAAEIFKNKKVI  180

Query  672  SEVPWYGIEQEYTLLQQNVKWPL  740
             EVPWYGIEQEYTLLQ +VKWPL
Sbjct  181  DEVPWYGIEQEYTLLQTDVKWPL  203



>gb|AAO85217.1| glutamine synthetase PR1 mutant [Lotus japonicus]
Length=430

 Score =   330 bits (847),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 156/203 (77%), Positives = 176/203 (87%), Gaps = 2/203 (1%)
 Frame = +3

Query  132  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  311
            MAQILAPS QWQ R+TK    A+P+ S MW S++ K NK+VA  S  KFRV A++S  ST
Sbjct  1    MAQILAPSTQWQTRITKTSPNASPITSNMWSSLLWKQNKKVARAS--KFRVLAIKSDGST  58

Query  312  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  491
            +NR+E LLNLDVTPYT+K IAEYIWI G+G+D RSKSRTISKPV HPSELPKWNYDGSST
Sbjct  59   INRLEGLLNLDVTPYTDKFIAEYIWIRGTGVDVRSKSRTISKPVSHPSELPKWNYDGSST  118

Query  492  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVV  671
            GQAPG+DSEVILYPQAIF+DPFRGGNNILVICD YTP GEPIPTNKRHRAA+IFS+PKV 
Sbjct  119  GQAPGDDSEVILYPQAIFRDPFRGGNNILVICDAYTPQGEPIPTNKRHRAAEIFSNPKVQ  178

Query  672  SEVPWYGIEQEYTLLQQNVKWPL  740
            +E+PWYGIEQEYTLLQ +VKWPL
Sbjct  179  AEIPWYGIEQEYTLLQTDVKWPL  201



>gb|AGV54414.1| glutamine synthetase [Phaseolus vulgaris]
Length=429

 Score =   330 bits (846),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 154/203 (76%), Positives = 177/203 (87%), Gaps = 3/203 (1%)
 Frame = +3

Query  132  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  311
            MAQILAPS QWQMR TK+   A+P+ S  W S++MK NK+    S+AKFRV A++S  ST
Sbjct  1    MAQILAPSTQWQMRFTKSSHHASPITSNTWSSLLMKQNKKT---SSAKFRVLAVKSDGST  57

Query  312  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  491
            +NR+E LLNLD+TP+T+KIIAEYIWIGG+GID RSKSRTISKPV+HPSELPKWNYDGSST
Sbjct  58   INRLEGLLNLDITPFTDKIIAEYIWIGGTGIDVRSKSRTISKPVEHPSELPKWNYDGSST  117

Query  492  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVV  671
            GQAPGEDSEVILYPQAIFKDPFRGGNNILVICD YTPAGEPIPTNKRHRAA++FS+P+V+
Sbjct  118  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDAYTPAGEPIPTNKRHRAAEVFSNPRVI  177

Query  672  SEVPWYGIEQEYTLLQQNVKWPL  740
            +E    GI+QEYTLLQ NV WPL
Sbjct  178  AEFHGLGIKQEYTLLQTNVNWPL  200



>gb|KHN37551.1| Glutamine synthetase leaf isozyme, chloroplastic [Glycine soja]
Length=434

 Score =   330 bits (845),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 156/205 (76%), Positives = 180/205 (88%), Gaps = 2/205 (1%)
 Frame = +3

Query  132  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  311
            MAQILAPS QWQMR++K+   ATP+ S MW S++ K NK+V++ S+AKFRV A++S NST
Sbjct  1    MAQILAPSTQWQMRISKSSPNATPITSNMWSSLLWKQNKKVSLTSSAKFRVLAIKSDNST  60

Query  312  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  491
            +NR+E LLNLD+TP+T+KIIAEYIWIGG+GID RSKSRTISKPV+ PSELPKWNYDGSST
Sbjct  61   INRLEGLLNLDITPFTDKIIAEYIWIGGTGIDVRSKSRTISKPVEDPSELPKWNYDGSST  120

Query  492  GQAPGEDSEVILYPQAIFKDPFRGGNNIL--VICDTYTPAGEPIPTNKRHRAAQIFSDPK  665
            GQAPG+DSEVILYPQAIFKDPFRG       VICD+YTP GEPIPTNKRHRAA+IFS+PK
Sbjct  121  GQAPGDDSEVILYPQAIFKDPFRGDIFCFAKVICDSYTPQGEPIPTNKRHRAAEIFSNPK  180

Query  666  VVSEVPWYGIEQEYTLLQQNVKWPL  740
            V +EVPWYGIEQEYTLLQ NVKWPL
Sbjct  181  VQAEVPWYGIEQEYTLLQTNVKWPL  205



>ref|XP_002274139.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic [Vitis 
vinifera]
 emb|CBI32325.3| unnamed protein product [Vitis vinifera]
Length=433

 Score =   327 bits (838),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 157/205 (77%), Positives = 179/205 (87%), Gaps = 3/205 (1%)
 Frame = +3

Query  132  MAQILAPSAQWQMRM--TKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGN  305
            MA I APS Q Q+R+  T + T A PM +K+W S+++   K+   +S+A+FRV ALQS +
Sbjct  1    MAHITAPSVQCQVRVVPTSSFT-ARPMTAKLWNSLLLNQRKKGTSRSSARFRVLALQSES  59

Query  306  STVNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGS  485
            STVNR++ LLNLD+TPYT+KIIAEYIWIGGSGID RSKSRTISKPV+HPSELPKWNYDGS
Sbjct  60   STVNRLKDLLNLDITPYTDKIIAEYIWIGGSGIDLRSKSRTISKPVKHPSELPKWNYDGS  119

Query  486  STGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPK  665
            STGQAPGEDSEVILYPQAIFKDPFRGGNNILVICD+YTPAGEPIPTNKRH AA+IFS  K
Sbjct  120  STGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDSYTPAGEPIPTNKRHGAAEIFSSQK  179

Query  666  VVSEVPWYGIEQEYTLLQQNVKWPL  740
            V++EVPWYGIEQEYTLLQ NVKWPL
Sbjct  180  VINEVPWYGIEQEYTLLQTNVKWPL  204



>gb|ADM45299.1| chloroplast GS2b-alpha precursor [Medicago truncatula]
 gb|ADM45300.1| chloroplast GS2b-beta precursor [Medicago truncatula]
 gb|KEH36738.1| glutamine synthetase domain protein [Medicago truncatula]
Length=428

 Score =   324 bits (831),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 155/203 (76%), Positives = 176/203 (87%), Gaps = 4/203 (2%)
 Frame = +3

Query  132  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  311
            MAQILAPS Q Q R+TK    ATP++SKMW S+VMK NK+VA   +A FR  A+ SG  T
Sbjct  1    MAQILAPSTQCQTRITKTSPFATPISSKMWSSLVMKQNKKVA--RSATFRAMAINSG--T  56

Query  312  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  491
            +NR+E LLNLD+TP+T+ IIAEYIWIGG+GID RSKSRTISKPV+HPSELPKWNYDGSST
Sbjct  57   INRVEDLLNLDITPFTDSIIAEYIWIGGTGIDVRSKSRTISKPVEHPSELPKWNYDGSST  116

Query  492  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVV  671
            GQAPGED+EVILYPQAIFKDPFRGGNNILVICD YT  GEPIPTNKR++AAQIF +PKV 
Sbjct  117  GQAPGEDTEVILYPQAIFKDPFRGGNNILVICDAYTTQGEPIPTNKRYKAAQIFRNPKVE  176

Query  672  SEVPWYGIEQEYTLLQQNVKWPL  740
            +E+PW+GIEQEYTLLQ NVKWPL
Sbjct  177  AEIPWFGIEQEYTLLQTNVKWPL  199



>gb|AAD31898.1|AF145480_1 glutamine synthetase leaf isozyme precursor [Mesembryanthemum 
crystallinum]
Length=433

 Score =   324 bits (830),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 155/204 (76%), Positives = 180/204 (88%), Gaps = 1/204 (0%)
 Frame = +3

Query  132  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFA-LQSGNS  308
            MAQILAPS Q +M +TK+ T A+ M    W SVV+K +++ ++K++ KF+V A ++   S
Sbjct  1    MAQILAPSLQVKMSITKSSTPASSMLPNTWTSVVLKQSRKGSIKNSTKFKVCASIKPDVS  60

Query  309  TVNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSS  488
              NR+EQLLNLDVTP+T+KIIAEYIWIGG+GID RSKSRT+SKPV+HPSELPKWNYDGSS
Sbjct  61   VQNRVEQLLNLDVTPFTDKIIAEYIWIGGAGIDLRSKSRTLSKPVEHPSELPKWNYDGSS  120

Query  489  TGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKV  668
            TGQAPGEDSEVILYPQAIFKDPFRGGNNILVICD YTPAGEPIPTNKRH+AA+IFS+PKV
Sbjct  121  TGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDAYTPAGEPIPTNKRHKAAEIFSNPKV  180

Query  669  VSEVPWYGIEQEYTLLQQNVKWPL  740
            VSEVPWYGIEQEYTL+Q NVKWPL
Sbjct  181  VSEVPWYGIEQEYTLMQPNVKWPL  204



>ref|XP_010557680.1| PREDICTED: glutamine synthetase, chloroplastic/mitochondrial-like 
[Tarenaya hassleriana]
Length=434

 Score =   323 bits (829),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 157/205 (77%), Positives = 177/205 (86%), Gaps = 2/205 (1%)
 Frame = +3

Query  132  MAQILAPSAQWQMRMTKNLTEATPMAS-KMWGSVVMKPNKRVA-VKSTAKFRVFALQSGN  305
            MAQILAPS + QM + K+   ++P AS K+W SVV++ NK+   +  + KFRV ALQS +
Sbjct  1    MAQILAPSPKCQMGVPKHSVISSPAASSKLWSSVVLRQNKQSGKLNCSNKFRVLALQSDD  60

Query  306  STVNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGS  485
            STVNR+E LLNLD  PYT+KIIAEYIWIGGSGID RSKSRTI KPV+HPSELPKWNYDGS
Sbjct  61   STVNRLEGLLNLDTKPYTDKIIAEYIWIGGSGIDLRSKSRTIEKPVEHPSELPKWNYDGS  120

Query  486  STGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPK  665
            STGQAPGEDSEVILYPQAIF+DPFRGGNNILVICD YTPAGEPIPTNKR RAA+IFSD K
Sbjct  121  STGQAPGEDSEVILYPQAIFRDPFRGGNNILVICDCYTPAGEPIPTNKRARAAEIFSDKK  180

Query  666  VVSEVPWYGIEQEYTLLQQNVKWPL  740
            VV ++PW+GIEQEYTLLQQNVKWPL
Sbjct  181  VVDDIPWFGIEQEYTLLQQNVKWPL  205



>gb|AFH88076.1| chloroplast glutamine synthetase protein, partial [Sesuvium portulacastrum]
Length=433

 Score =   323 bits (829),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 156/204 (76%), Positives = 178/204 (87%), Gaps = 1/204 (0%)
 Frame = +3

Query  132  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFA-LQSGNS  308
            MAQILAPS Q QM + K+   A  +    W SVV+K +++ ++K++ KF+V A  +S +S
Sbjct  1    MAQILAPSMQLQMGIPKSSVLANSVMPNKWTSVVLKQSRKGSIKNSTKFKVCATFKSEDS  60

Query  309  TVNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSS  488
            TVNR+EQLLNLDVTPYT+KIIAEYIWIGGSGID RSKSRTISKPV+HPSELPKWNYDGSS
Sbjct  61   TVNRVEQLLNLDVTPYTDKIIAEYIWIGGSGIDLRSKSRTISKPVEHPSELPKWNYDGSS  120

Query  489  TGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKV  668
            TGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTP GEPIPTNKRH+AA+IFS+PKV
Sbjct  121  TGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPQGEPIPTNKRHKAAEIFSNPKV  180

Query  669  VSEVPWYGIEQEYTLLQQNVKWPL  740
             +EVPW+GIEQEYTLLQ NV WPL
Sbjct  181  SAEVPWFGIEQEYTLLQPNVSWPL  204



>gb|ABL89188.2| plastid glutamine synthetase 2 [Spinacia oleracea]
Length=431

 Score =   323 bits (828),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 154/204 (75%), Positives = 178/204 (87%), Gaps = 3/204 (1%)
 Frame = +3

Query  132  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFA-LQSGNS  308
            MAQILAPS Q QM+++K LT +  M    W S+++K  ++ ++K + KFRV A LQS + 
Sbjct  1    MAQILAPSMQCQMKLSKGLTSS--MTPSPWTSILLKQGQKGSIKCSTKFRVCASLQSDHG  58

Query  309  TVNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSS  488
            TVNR+EQLLNLDVTPYT+KIIAEYIWIGG+GID RSKSRT+SKPV+HPSELPKWNYDGSS
Sbjct  59   TVNRVEQLLNLDVTPYTDKIIAEYIWIGGTGIDLRSKSRTLSKPVEHPSELPKWNYDGSS  118

Query  489  TGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKV  668
            TGQAPG+DSEVILYPQAIFKDPFRGGNNILVICD YTPAGEPIPTNKRH+AA+IF++ KV
Sbjct  119  TGQAPGQDSEVILYPQAIFKDPFRGGNNILVICDAYTPAGEPIPTNKRHKAAEIFNNQKV  178

Query  669  VSEVPWYGIEQEYTLLQQNVKWPL  740
             SEVPW+GIEQEYTLLQ NV WPL
Sbjct  179  ASEVPWFGIEQEYTLLQPNVSWPL  202



>ref|XP_010542001.1| PREDICTED: glutamine synthetase, chloroplastic/mitochondrial 
[Tarenaya hassleriana]
 ref|XP_010542002.1| PREDICTED: glutamine synthetase, chloroplastic/mitochondrial 
[Tarenaya hassleriana]
Length=434

 Score =   323 bits (827),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 157/205 (77%), Positives = 176/205 (86%), Gaps = 2/205 (1%)
 Frame = +3

Query  132  MAQILAPSAQWQMRMTKNLTEATPMAS-KMWGSVVMKPNKRVA-VKSTAKFRVFALQSGN  305
            MAQILAPS + QM   K+    +P AS ++W SVV+K NK+   +K ++KFRV A+QS +
Sbjct  1    MAQILAPSPKCQMGAPKHSFITSPAASSRLWSSVVLKQNKQSGKLKYSSKFRVLAVQSDD  60

Query  306  STVNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGS  485
            STVNR+E LLNLD  PYT+KIIAEYIWIGGSGID RSKSRTI KPV+HPSELPKWNYDGS
Sbjct  61   STVNRLEGLLNLDTKPYTDKIIAEYIWIGGSGIDLRSKSRTIEKPVEHPSELPKWNYDGS  120

Query  486  STGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPK  665
            STGQAPGEDSEVILYPQAIF+DPFRGGNNILVICD YTPAGEPIPTNKR RAA+IF D K
Sbjct  121  STGQAPGEDSEVILYPQAIFRDPFRGGNNILVICDCYTPAGEPIPTNKRARAAEIFGDKK  180

Query  666  VVSEVPWYGIEQEYTLLQQNVKWPL  740
            VV E+PW+GIEQEYTLLQQNVKWPL
Sbjct  181  VVGEIPWFGIEQEYTLLQQNVKWPL  205



>ref|XP_010666333.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010666334.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic [Beta 
vulgaris subsp. vulgaris]
 gb|AAK07678.1| glutamine synthetase GS2 [Beta vulgaris]
 gb|ACB45672.1| plastid glutamine synthetase [Beta vulgaris]
Length=431

 Score =   319 bits (818),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 151/204 (74%), Positives = 181/204 (89%), Gaps = 3/204 (1%)
 Frame = +3

Query  132  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFA-LQSGNS  308
            MAQILAP+ Q QM+++K+LT +  M    W S+++K +++ ++K + KF+V A L++ + 
Sbjct  1    MAQILAPNMQCQMKLSKSLTNS--MIPNSWTSILLKGSQKGSIKCSTKFKVCAALKTEHG  58

Query  309  TVNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSS  488
            TVNR+EQLLNLDVTP+T+KIIAEYIWIGGSGID RSKSRT+S+PV+ PSELPKWNYDGSS
Sbjct  59   TVNRMEQLLNLDVTPFTDKIIAEYIWIGGSGIDLRSKSRTLSRPVEDPSELPKWNYDGSS  118

Query  489  TGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKV  668
            TGQAPGEDSEVILYPQAIFKDPFRGGNNILVICD YTPAGEPIPTNKRH+AA+IFS+PKV
Sbjct  119  TGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDAYTPAGEPIPTNKRHKAAEIFSNPKV  178

Query  669  VSEVPWYGIEQEYTLLQQNVKWPL  740
             SEVPW+GIEQEYTLLQ NV+WPL
Sbjct  179  ASEVPWFGIEQEYTLLQPNVQWPL  202



>emb|CAN61808.1| hypothetical protein VITISV_014295 [Vitis vinifera]
Length=433

 Score =   318 bits (815),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 154/205 (75%), Positives = 175/205 (85%), Gaps = 3/205 (1%)
 Frame = +3

Query  132  MAQILAPSAQWQMRM--TKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGN  305
            MA I APS Q Q+R+  T + T A  M +K+W S++    K+   +S+A+ RV ALQS +
Sbjct  1    MAHIXAPSVQCQVRVVPTSSFT-ARXMTAKLWNSLLXNQRKKGTSRSSARXRVLALQSES  59

Query  306  STVNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGS  485
             TVNR++ LLNLD+TPYT+KIIAEYIWIGGSGID RSKSRTISKPV+HPSELPKWNYDGS
Sbjct  60   XTVNRLKDLLNLDITPYTDKIIAEYIWIGGSGIDLRSKSRTISKPVKHPSELPKWNYDGS  119

Query  486  STGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPK  665
            STGQAPGEDSEVILYPQAIFKDPFRGGNNILVICD+YTPAGEPIPTNKRH AA+IFS  K
Sbjct  120  STGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDSYTPAGEPIPTNKRHGAAEIFSSQK  179

Query  666  VVSEVPWYGIEQEYTLLQQNVKWPL  740
            V++EVPWYGIEQEYTLLQ NVKWPL
Sbjct  180  VINEVPWYGIEQEYTLLQTNVKWPL  204



>ref|XP_003594092.1| Glutamine synthetase [Medicago truncatula]
Length=1639

 Score =   335 bits (858),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 160/203 (79%), Positives = 180/203 (89%), Gaps = 4/203 (2%)
 Frame = +3

Query  132  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  311
            MAQILAPS Q Q R+TK    ATP++SKMW S+VMK NK+VA   +AKFRV A+ SG  T
Sbjct  1    MAQILAPSTQCQARITKISPVATPISSKMWSSLVMKQNKKVA--RSAKFRVMAVNSG--T  56

Query  312  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  491
            +NR+E LLNLD+TP+T+ IIAEYIWIGG+GID RSKSRTISKPV+HPSELPKWNYDGSST
Sbjct  57   INRVEDLLNLDITPFTDSIIAEYIWIGGTGIDVRSKSRTISKPVEHPSELPKWNYDGSST  116

Query  492  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVV  671
            GQAPGEDSEVILYPQAIFKDPFRGGNNILVICD YTP GEPIPTNKRH+AA+IFS+PKV 
Sbjct  117  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDAYTPQGEPIPTNKRHKAAEIFSNPKVE  176

Query  672  SEVPWYGIEQEYTLLQQNVKWPL  740
            +E+PWYGIEQEYTLLQ +VKWPL
Sbjct  177  AEIPWYGIEQEYTLLQTDVKWPL  199


 Score =   326 bits (835),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 155/203 (76%), Positives = 176/203 (87%), Gaps = 4/203 (2%)
 Frame = +3

Query  132   MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  311
             MAQILAPS Q Q R+TK    ATP++SKMW S+VMK NK+VA   +A FR  A+ SG  T
Sbjct  1212  MAQILAPSTQCQTRITKTSPFATPISSKMWSSLVMKQNKKVA--RSATFRAMAINSG--T  1267

Query  312   VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  491
             +NR+E LLNLD+TP+T+ IIAEYIWIGG+GID RSKSRTISKPV+HPSELPKWNYDGSST
Sbjct  1268  INRVEDLLNLDITPFTDSIIAEYIWIGGTGIDVRSKSRTISKPVEHPSELPKWNYDGSST  1327

Query  492   GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVV  671
             GQAPGED+EVILYPQAIFKDPFRGGNNILVICD YT  GEPIPTNKR++AAQIF +PKV 
Sbjct  1328  GQAPGEDTEVILYPQAIFKDPFRGGNNILVICDAYTTQGEPIPTNKRYKAAQIFRNPKVE  1387

Query  672   SEVPWYGIEQEYTLLQQNVKWPL  740
             +E+PW+GIEQEYTLLQ NVKWPL
Sbjct  1388  AEIPWFGIEQEYTLLQTNVKWPL  1410



>ref|XP_004174085.1| PREDICTED: glutamine synthetase, chloroplastic-like, partial 
[Cucumis sativus]
Length=196

 Score =   306 bits (783),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 142/185 (77%), Positives = 163/185 (88%), Gaps = 0/185 (0%)
 Frame = +3

Query  132  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  311
            MAQILAPS QWQ+R       ++P+  KMW S+++K NK+ AVKS++K+RV +++S   T
Sbjct  1    MAQILAPSTQWQLRTKLTPMSSSPITPKMWSSILLKQNKKGAVKSSSKYRVLSVRSEGGT  60

Query  312  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  491
            +NR+E LLNLDVTPYT+KIIAEYIWIGGSGID RSKSRTISKPV+HPSELPKWNYDGSST
Sbjct  61   INRMEDLLNLDVTPYTDKIIAEYIWIGGSGIDLRSKSRTISKPVEHPSELPKWNYDGSST  120

Query  492  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVV  671
            GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAG PIPTNKRHRAA+IFS+ KVV
Sbjct  121  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGVPIPTNKRHRAAEIFSNKKVV  180

Query  672  SEVPW  686
             E+PW
Sbjct  181  DEIPW  185



>ref|XP_010435449.1| PREDICTED: glutamine synthetase, chloroplastic/mitochondrial-like 
isoform X3 [Camelina sativa]
 ref|XP_010435451.1| PREDICTED: glutamine synthetase, chloroplastic/mitochondrial-like 
isoform X4 [Camelina sativa]
 ref|XP_010440748.1| PREDICTED: glutamine synthetase, chloroplastic/mitochondrial-like 
isoform X2 [Camelina sativa]
Length=430

 Score =   312 bits (799),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 153/203 (75%), Positives = 174/203 (86%), Gaps = 2/203 (1%)
 Frame = +3

Query  132  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  311
            MAQILA S   QMR+ K+ + ++ + +K+W SVV+K  K+ + K    FRVFALQS NST
Sbjct  1    MAQILAASPTCQMRVPKH-SSSSVITNKLWSSVVLKQKKQSSNKLRG-FRVFALQSDNST  58

Query  312  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  491
            VNR+E LLNLD  PY+++IIAEYIWIGGSGID RSKSRTI KPV+ PSELPKWNYDGSST
Sbjct  59   VNRVETLLNLDTKPYSDRIIAEYIWIGGSGIDLRSKSRTIEKPVEDPSELPKWNYDGSST  118

Query  492  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVV  671
            GQAPGEDSEVILYPQAIF+DPFRGGNNILVICDT+TPAGEPIPTNKR RAA+IFS+ KV 
Sbjct  119  GQAPGEDSEVILYPQAIFRDPFRGGNNILVICDTWTPAGEPIPTNKRARAAEIFSNKKVT  178

Query  672  SEVPWYGIEQEYTLLQQNVKWPL  740
             EVPW+GIEQEYTLLQQNVKWPL
Sbjct  179  GEVPWFGIEQEYTLLQQNVKWPL  201



>ref|XP_010435447.1| PREDICTED: glutamine synthetase, chloroplastic/mitochondrial-like 
isoform X1 [Camelina sativa]
 ref|XP_010435448.1| PREDICTED: glutamine synthetase, chloroplastic/mitochondrial-like 
isoform X2 [Camelina sativa]
 ref|XP_010435454.1| PREDICTED: glutamine synthetase, chloroplastic/mitochondrial-like 
isoform X7 [Camelina sativa]
 ref|XP_010440747.1| PREDICTED: glutamine synthetase, chloroplastic/mitochondrial-like 
isoform X1 [Camelina sativa]
Length=441

 Score =   312 bits (799),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 153/203 (75%), Positives = 174/203 (86%), Gaps = 2/203 (1%)
 Frame = +3

Query  132  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  311
            MAQILA S   QMR+ K+ + ++ + +K+W SVV+K  K+ + K    FRVFALQS NST
Sbjct  12   MAQILAASPTCQMRVPKH-SSSSVITNKLWSSVVLKQKKQSSNKLRG-FRVFALQSDNST  69

Query  312  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  491
            VNR+E LLNLD  PY+++IIAEYIWIGGSGID RSKSRTI KPV+ PSELPKWNYDGSST
Sbjct  70   VNRVETLLNLDTKPYSDRIIAEYIWIGGSGIDLRSKSRTIEKPVEDPSELPKWNYDGSST  129

Query  492  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVV  671
            GQAPGEDSEVILYPQAIF+DPFRGGNNILVICDT+TPAGEPIPTNKR RAA+IFS+ KV 
Sbjct  130  GQAPGEDSEVILYPQAIFRDPFRGGNNILVICDTWTPAGEPIPTNKRARAAEIFSNKKVT  189

Query  672  SEVPWYGIEQEYTLLQQNVKWPL  740
             EVPW+GIEQEYTLLQQNVKWPL
Sbjct  190  GEVPWFGIEQEYTLLQQNVKWPL  212



>ref|XP_010450396.1| PREDICTED: glutamine synthetase, chloroplastic/mitochondrial 
[Camelina sativa]
 ref|XP_010450397.1| PREDICTED: glutamine synthetase, chloroplastic/mitochondrial 
[Camelina sativa]
Length=430

 Score =   310 bits (793),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 152/203 (75%), Positives = 173/203 (85%), Gaps = 2/203 (1%)
 Frame = +3

Query  132  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  311
            MAQILA S   QMR+ K+ + ++ + +K+W SVV+K  K+ + K    FRV ALQS NST
Sbjct  1    MAQILAASPTCQMRVPKH-SSSSVITNKLWSSVVLKQKKQSSNKLRG-FRVLALQSDNST  58

Query  312  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  491
            VNR+E LLNLD  PY+++IIAEYIWIGGSGID RSKSRTI KPV+ PSELPKWNYDGSST
Sbjct  59   VNRVETLLNLDTKPYSDRIIAEYIWIGGSGIDLRSKSRTIEKPVEDPSELPKWNYDGSST  118

Query  492  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVV  671
            GQAPGEDSEVILYPQAIF+DPFRGGNNILVICDT+TPAGEPIPTNKR RAA+IFS+ KV 
Sbjct  119  GQAPGEDSEVILYPQAIFRDPFRGGNNILVICDTWTPAGEPIPTNKRARAAEIFSNKKVT  178

Query  672  SEVPWYGIEQEYTLLQQNVKWPL  740
             EVPW+GIEQEYTLLQQNVKWPL
Sbjct  179  GEVPWFGIEQEYTLLQQNVKWPL  201



>ref|XP_002868428.1| hypothetical protein ARALYDRAFT_493621 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44687.1| hypothetical protein ARALYDRAFT_493621 [Arabidopsis lyrata subsp. 
lyrata]
Length=429

 Score =   308 bits (790),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 153/203 (75%), Positives = 171/203 (84%), Gaps = 3/203 (1%)
 Frame = +3

Query  132  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  311
            MAQILA S   QMR+ K+   +   +SK+W SVV+K  K+   K    FRV ALQS NST
Sbjct  1    MAQILAASPTCQMRVPKH--SSVIASSKLWSSVVLKQKKQSNNKVRG-FRVLALQSDNST  57

Query  312  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  491
            VNR+E LLNLD  PYT++IIAEYIWIGGSGID RSKSRTI KPV+ PSELPKWNYDGSST
Sbjct  58   VNRVETLLNLDTKPYTDRIIAEYIWIGGSGIDLRSKSRTIEKPVEDPSELPKWNYDGSST  117

Query  492  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVV  671
            GQAPGEDSEVILYPQAIF+DPFRGGNNILVICDT+TPAGEPIPTNKR +AA+IFS+ KV 
Sbjct  118  GQAPGEDSEVILYPQAIFRDPFRGGNNILVICDTWTPAGEPIPTNKRAKAAEIFSNKKVT  177

Query  672  SEVPWYGIEQEYTLLQQNVKWPL  740
            +EVPW+GIEQEYTLLQQNVKWPL
Sbjct  178  NEVPWFGIEQEYTLLQQNVKWPL  200



>ref|XP_008779349.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic-like, 
partial [Phoenix dactylifera]
Length=259

 Score =   301 bits (772),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 143/205 (70%), Positives = 170/205 (83%), Gaps = 2/205 (1%)
 Frame = +3

Query  132  MAQILAPSAQWQMRMTKNLTEATP-MASKMWGSVVMKPNKRVAVKSTAKFRVFALQS-GN  305
            MA +L PS Q +M +T N  +A P M +K W S++    +    KST+ F+V AL+S  N
Sbjct  1    MAHMLVPSMQCRMGITSNSIQARPIMTAKTWNSLLSNARRPKTKKSTSTFKVLALKSDNN  60

Query  306  STVNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGS  485
              V+R+E LLNLD+TP+T+KIIAEYIWIGG+GID RSK+RT+ +PV+HPSELPKWNYDGS
Sbjct  61   GAVSRLENLLNLDITPFTDKIIAEYIWIGGTGIDIRSKARTVPRPVEHPSELPKWNYDGS  120

Query  486  STGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPK  665
            STGQAPGEDSEVILYPQA F+DPFRGGNNILVICD YTP+GEPIPTNKR+RAAQIFS+ K
Sbjct  121  STGQAPGEDSEVILYPQAFFRDPFRGGNNILVICDCYTPSGEPIPTNKRYRAAQIFSEKK  180

Query  666  VVSEVPWYGIEQEYTLLQQNVKWPL  740
            V++E PWYGIEQEYTLLQ NVKWPL
Sbjct  181  VINETPWYGIEQEYTLLQPNVKWPL  205



>ref|NP_198413.1| glutamine synthetase 2 [Arabidopsis thaliana]
 ref|NP_001031969.1| glutamine synthetase 2 [Arabidopsis thaliana]
 ref|NP_001078639.1| glutamine synthetase 2 [Arabidopsis thaliana]
 sp|Q43127.1|GLNA2_ARATH RecName: Full=Glutamine synthetase, chloroplastic/mitochondrial; 
AltName: Full=GS2; AltName: Full=Glutamate--ammonia ligase; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAL16230.1|AF428461_1 AT5g35630/MJE4_9 [Arabidopsis thaliana]
 gb|AAL16249.1|AF428319_1 AT5g35630/MJE4_9 [Arabidopsis thaliana]
 gb|AAB20558.1| light-regulated glutamine synthetase isoenzyme [Arabidopsis thaliana]
 dbj|BAA88761.1| Glutamine Synthetase [Arabidopsis thaliana]
 dbj|BAB09304.1| glutamate-ammonia ligase (EC 6.3.1.2) precursor, chloroplast 
(clone lambdaAtgsl1) [Arabidopsis thaliana]
 gb|AAL91141.1| glutamate-ammonia ligase, chloroplast [Arabidopsis thaliana]
 gb|AAM14064.1| putative glutamate-ammonia ligase precursor, chloroplast [Arabidopsis 
thaliana]
 gb|AAM65763.1| glutamate-ammonia ligase (EC 6.3.1.2) precursor, chloroplast 
[Arabidopsis thaliana]
 gb|AAM67510.1| putative glutamate-ammonia ligase precursor, chloroplast [Arabidopsis 
thaliana]
 dbj|BAH19798.1| AT5G35630 [Arabidopsis thaliana]
 gb|AED93993.1| glutamine synthetase [Arabidopsis thaliana]
 gb|AED93994.1| glutamine synthetase [Arabidopsis thaliana]
 gb|AED93995.1| glutamine synthetase [Arabidopsis thaliana]
 prf||1804333A Gln synthetase
Length=430

 Score =   307 bits (786),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 152/203 (75%), Positives = 170/203 (84%), Gaps = 2/203 (1%)
 Frame = +3

Query  132  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  311
            MAQILA S   QMR+ K+ +     +SK+W SVV+K  K+   K    FRV ALQS NST
Sbjct  1    MAQILAASPTCQMRVPKH-SSVIASSSKLWSSVVLKQKKQSNNKVRG-FRVLALQSDNST  58

Query  312  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  491
            VNR+E LLNLD  PY+++IIAEYIWIGGSGID RSKSRTI KPV+ PSELPKWNYDGSST
Sbjct  59   VNRVETLLNLDTKPYSDRIIAEYIWIGGSGIDLRSKSRTIEKPVEDPSELPKWNYDGSST  118

Query  492  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVV  671
            GQAPGEDSEVILYPQAIF+DPFRGGNNILVICDT+TPAGEPIPTNKR +AA+IFS+ KV 
Sbjct  119  GQAPGEDSEVILYPQAIFRDPFRGGNNILVICDTWTPAGEPIPTNKRAKAAEIFSNKKVS  178

Query  672  SEVPWYGIEQEYTLLQQNVKWPL  740
             EVPW+GIEQEYTLLQQNVKWPL
Sbjct  179  GEVPWFGIEQEYTLLQQNVKWPL  201



>ref|XP_009124267.1| PREDICTED: glutamine synthetase, chloroplastic [Brassica rapa]
 sp|Q42624.1|GLNAC_BRANA RecName: Full=Glutamine synthetase, chloroplastic; AltName: Full=GS2; 
AltName: Full=Glutamate--ammonia ligase; Flags: Precursor 
[Brassica napus]
 emb|CAA51280.1| glutamate--ammonia ligase precursor [Brassica napus]
 emb|CDX74644.1| BnaA04g07450D [Brassica napus]
Length=428

 Score =   305 bits (782),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 150/203 (74%), Positives = 170/203 (84%), Gaps = 4/203 (2%)
 Frame = +3

Query  132  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  311
            MAQILA S   QMR+TK  + A+   SK+W SVV+K  K+ + K    F+V ALQS NST
Sbjct  1    MAQILAASPTCQMRLTKPSSIAS---SKLWNSVVLKQKKQSSSK-VRSFKVMALQSDNST  56

Query  312  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  491
            +NR+E LLNLD  P+T++IIAEYIWIGGSGID RSKSRT+ KPV+ PSELPKWNYDGSST
Sbjct  57   INRVESLLNLDTKPFTDRIIAEYIWIGGSGIDLRSKSRTLEKPVEDPSELPKWNYDGSST  116

Query  492  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVV  671
            GQAPGEDSEVILYPQAIF+DPFRGGNNILVICDTYTPAGEPIPTNKR RAA+IFS+ KV 
Sbjct  117  GQAPGEDSEVILYPQAIFRDPFRGGNNILVICDTYTPAGEPIPTNKRARAAEIFSNKKVN  176

Query  672  SEVPWYGIEQEYTLLQQNVKWPL  740
             E+PW+GIEQEYTLLQ NV WPL
Sbjct  177  EEIPWFGIEQEYTLLQPNVNWPL  199



>ref|XP_009391592.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
 ref|XP_009391594.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=433

 Score =   305 bits (780),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 143/204 (70%), Positives = 167/204 (82%), Gaps = 1/204 (0%)
 Frame = +3

Query  132  MAQILAPSAQWQMRMTKNLTEATPM-ASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNS  308
            MA+++    Q QM    N  +  PM  SKMW S+++   +    +  + F+V A++S N 
Sbjct  1    MAKMMVSPMQCQMGFPSNSLQGRPMITSKMWNSLLLNAQRPKTRRGISAFKVLAVKSENG  60

Query  309  TVNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSS  488
             V+R+E LLNLD TP+T+KIIAEYIWIGG+GID RSKSRTISKPV+H SELPKWNYDGSS
Sbjct  61   VVSRLEDLLNLDTTPFTDKIIAEYIWIGGTGIDIRSKSRTISKPVEHASELPKWNYDGSS  120

Query  489  TGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKV  668
            TGQAPGEDSEVILYPQAIFKDPFRGGNNILVICD+YTP+GEPIPTNKRHRA+QIFSD KV
Sbjct  121  TGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDSYTPSGEPIPTNKRHRASQIFSDQKV  180

Query  669  VSEVPWYGIEQEYTLLQQNVKWPL  740
            + EVPWYGIEQEYTLLQ NV+WPL
Sbjct  181  IDEVPWYGIEQEYTLLQTNVQWPL  204



>ref|XP_010938796.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic [Elaeis 
guineensis]
Length=434

 Score =   305 bits (780),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 145/205 (71%), Positives = 171/205 (83%), Gaps = 2/205 (1%)
 Frame = +3

Query  132  MAQILAPSAQWQMRMTKNLTEATPM-ASKMWGSVVMKPNKRVAVKSTAKFRVFALQ-SGN  305
            MA++L PS Q QM MT N  +A P+  +K W S+++   +    KST+ F+V AL+   N
Sbjct  1    MARMLVPSMQCQMGMTSNSIQARPIITTKSWNSLLLNSQRPKTKKSTSTFKVLALKYDNN  60

Query  306  STVNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGS  485
             TV+R+E LLN+D+TP+T+KIIAEYIWIGG+GID RSK RTI +PV+HPSELPKWNYDGS
Sbjct  61   GTVSRLENLLNMDITPFTDKIIAEYIWIGGTGIDIRSKPRTIPRPVEHPSELPKWNYDGS  120

Query  486  STGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPK  665
            STGQAPGEDSEVILYPQAIF+DPFRGGNNILVICD YTP+G PIPTNKR+RAAQIFS+ K
Sbjct  121  STGQAPGEDSEVILYPQAIFRDPFRGGNNILVICDCYTPSGAPIPTNKRYRAAQIFSEKK  180

Query  666  VVSEVPWYGIEQEYTLLQQNVKWPL  740
            V+ EVPWYGIEQEYTLLQ NVKWPL
Sbjct  181  VIDEVPWYGIEQEYTLLQPNVKWPL  205



>gb|ABY87178.1| chloroplast glutamine synthetase [Brassica rapa subsp. chinensis]
Length=428

 Score =   304 bits (778),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 149/203 (73%), Positives = 170/203 (84%), Gaps = 4/203 (2%)
 Frame = +3

Query  132  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  311
            MAQILA S   QMR+TK  + A+   SK+W SVV+K  ++ + K    F+V ALQS NST
Sbjct  1    MAQILAASPTCQMRLTKPSSIAS---SKLWNSVVLKQKEQSSSK-VRSFKVMALQSDNST  56

Query  312  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  491
            +NR+E LLNLD  P+T++IIAEYIWIGGSGID RSKSRT+ KPV+ PSELPKWNYDGSST
Sbjct  57   INRVESLLNLDTKPFTDRIIAEYIWIGGSGIDLRSKSRTLEKPVEDPSELPKWNYDGSST  116

Query  492  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVV  671
            GQAPGEDSEVILYPQAIF+DPFRGGNNILVICDTYTPAGEPIPTNKR RAA+IFS+ KV 
Sbjct  117  GQAPGEDSEVILYPQAIFRDPFRGGNNILVICDTYTPAGEPIPTNKRARAAEIFSNKKVN  176

Query  672  SEVPWYGIEQEYTLLQQNVKWPL  740
             E+PW+GIEQEYTLLQ NV WPL
Sbjct  177  EEIPWFGIEQEYTLLQPNVNWPL  199



>emb|CDY33684.1| BnaC04g29670D [Brassica napus]
Length=489

 Score =   306 bits (783),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 150/205 (73%), Positives = 171/205 (83%), Gaps = 3/205 (1%)
 Frame = +3

Query  126  VKMAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGN  305
            +KMAQILA S   QMR+TK  + A+   SK+W SVV+K  K+ +      F+V ALQS N
Sbjct  59   IKMAQILAASPTCQMRLTKPSSIAS---SKLWNSVVLKQKKQSSSSKVRSFKVMALQSDN  115

Query  306  STVNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGS  485
            ST+NR+E LLNLD  P+T++IIAEYIWIGGSGID RSKSRT+ KPV+ PSELPKWNYDGS
Sbjct  116  STINRVESLLNLDTKPFTDRIIAEYIWIGGSGIDLRSKSRTLEKPVEDPSELPKWNYDGS  175

Query  486  STGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPK  665
            STGQAPGEDSEVILYPQAIF+DPFRGGNNILVICDTYTPAGEPIPTNKR RAA+IFS+ K
Sbjct  176  STGQAPGEDSEVILYPQAIFRDPFRGGNNILVICDTYTPAGEPIPTNKRARAAEIFSNKK  235

Query  666  VVSEVPWYGIEQEYTLLQQNVKWPL  740
            V  E+PW+GIEQEYTLLQ NV WPL
Sbjct  236  VNEEIPWFGIEQEYTLLQPNVNWPL  260



>ref|XP_006850815.1| hypothetical protein AMTR_s00025p00120730 [Amborella trichopoda]
 gb|ERN12396.1| hypothetical protein AMTR_s00025p00120730 [Amborella trichopoda]
Length=433

 Score =   304 bits (778),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 149/207 (72%), Positives = 170/207 (82%), Gaps = 4/207 (2%)
 Frame = +3

Query  132  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVM--KPNKRVAVKSTAKFRVFALQ--S  299
            MAQILAPS Q QM   K   +A P+ +KMW S+V+  + + R + KS +KFR F+++  S
Sbjct  1    MAQILAPSMQCQMGSAKISIKAGPVTAKMWNSLVLNHRLSGRNSFKSASKFRAFSVKAAS  60

Query  300  GNSTVNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYD  479
             N  VNR+E LL LD+TP T+KIIAEYIWIGGSG D RSKSRTIS+PV+    LPKWNYD
Sbjct  61   DNGVVNRLEDLLKLDLTPITDKIIAEYIWIGGSGTDLRSKSRTISRPVESALGLPKWNYD  120

Query  480  GSSTGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSD  659
            GSSTGQAPGEDSEVILYPQAIFKDPFRGGNNILVICD YTPAGEP+PTNKR+RAAQIFS+
Sbjct  121  GSSTGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDAYTPAGEPLPTNKRYRAAQIFSE  180

Query  660  PKVVSEVPWYGIEQEYTLLQQNVKWPL  740
             KV+ EVPWYGIEQEYTLLQ NVKWPL
Sbjct  181  KKVIDEVPWYGIEQEYTLLQPNVKWPL  207



>ref|XP_006282617.1| hypothetical protein CARUB_v10004865mg [Capsella rubella]
 gb|EOA15515.1| hypothetical protein CARUB_v10004865mg [Capsella rubella]
Length=429

 Score =   303 bits (777),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 150/204 (74%), Positives = 172/204 (84%), Gaps = 5/204 (2%)
 Frame = +3

Query  132  MAQILAPS-AQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNS  308
            MAQILA S    QMR+ K+   ++ + +K+W SVV+K  K+ + K    FRV ALQS NS
Sbjct  1    MAQILAASPTTCQMRVPKH---SSVITNKLWSSVVLKQKKQSSNKHRG-FRVLALQSDNS  56

Query  309  TVNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSS  488
            TVNR+E LLNLD  PY+++IIAEYIWIGGSGID RSKSRT+ KPV+ PSELPKWNYDGSS
Sbjct  57   TVNRVETLLNLDTKPYSDRIIAEYIWIGGSGIDLRSKSRTLEKPVEDPSELPKWNYDGSS  116

Query  489  TGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKV  668
            TGQAPGEDSEVILYPQAIF+DPFRGGNNILVICDT+TPAGEPIPTNKR RAA+IFS+ KV
Sbjct  117  TGQAPGEDSEVILYPQAIFRDPFRGGNNILVICDTWTPAGEPIPTNKRARAAEIFSNQKV  176

Query  669  VSEVPWYGIEQEYTLLQQNVKWPL  740
              E+PW+GIEQEYTLLQQNVKWPL
Sbjct  177  TDELPWFGIEQEYTLLQQNVKWPL  200



>dbj|BAH56878.1| AT5G35630 [Arabidopsis thaliana]
Length=278

 Score =   298 bits (763),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 151/203 (74%), Positives = 169/203 (83%), Gaps = 3/203 (1%)
 Frame = +3

Query  132  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  311
            MAQILA S   QMR+ K+ +     +SK+W SVV+K  K+   K    FRV ALQS NST
Sbjct  1    MAQILAASPTCQMRVPKH-SSVIASSSKLWSSVVLKQKKQSNNKVRG-FRVLALQSDNST  58

Query  312  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  491
            VNR+E LLNLD  PY+++IIAEYIWIGGSGID RSKSRTI KPV+ PSELPKWNYDGSST
Sbjct  59   VNRVETLLNLDTKPYSDRIIAEYIWIGGSGIDLRSKSRTIEKPVEDPSELPKWNYDGSST  118

Query  492  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVV  671
            GQAPGEDSEVILYPQAIF+DPFRGGNNILVICDT+TPAGEPIPTNKR + A+IFS+ KV 
Sbjct  119  GQAPGEDSEVILYPQAIFRDPFRGGNNILVICDTWTPAGEPIPTNKRAK-AEIFSNKKVS  177

Query  672  SEVPWYGIEQEYTLLQQNVKWPL  740
             EVPW+GIEQEYTLLQQNVKWPL
Sbjct  178  GEVPWFGIEQEYTLLQQNVKWPL  200



>emb|CAB72423.1| glutamine synthetase [Brassica napus]
Length=428

 Score =   302 bits (774),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 148/203 (73%), Positives = 169/203 (83%), Gaps = 4/203 (2%)
 Frame = +3

Query  132  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  311
            MAQILA S   QMR+TK  + A+   SK+W SVV+K  K+ + K    F+V A+QS NST
Sbjct  1    MAQILAASPTCQMRLTKPSSIAS---SKLWNSVVLKQKKQSSSK-VRSFKVMAIQSDNST  56

Query  312  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  491
            +NR+E LLNLD  P+T++IIAEYIW GGSGID RSKSRT+ KPV+ PSELPKWNYDGSST
Sbjct  57   INRVESLLNLDTKPFTDRIIAEYIWYGGSGIDLRSKSRTLEKPVEDPSELPKWNYDGSST  116

Query  492  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVV  671
            GQAPGEDSEVILYPQAIF+DPFRGGNNILVICDTYTPAGEPIPTNKR RAA+IFS+ KV 
Sbjct  117  GQAPGEDSEVILYPQAIFRDPFRGGNNILVICDTYTPAGEPIPTNKRARAAEIFSNKKVN  176

Query  672  SEVPWYGIEQEYTLLQQNVKWPL  740
             E+PW+GIEQEYTLLQ NV WPL
Sbjct  177  EEIPWFGIEQEYTLLQPNVNWPL  199



>emb|CDY49365.1| BnaA08g29950D [Brassica napus]
Length=394

 Score =   300 bits (768),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 148/204 (73%), Positives = 172/204 (84%), Gaps = 6/204 (3%)
 Frame = +3

Query  132  MAQILAPSAQWQMRMTKNLTEATPMAS-KMWGSVVMKPNKRVAVKSTAKFRVFALQSGNS  308
            MAQILA S   QM++TK     +P+AS K+W SV++K  K+ + K  + F+V ALQS NS
Sbjct  1    MAQILAASPTCQMKLTK----PSPIASSKLWSSVMLKQKKQNSSKLRS-FKVMALQSDNS  55

Query  309  TVNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSS  488
            T+NR+E LLNLD  P+T++IIAEYIWIGGSGID RSKSRT+ KPV+ PSELPKWNYDGSS
Sbjct  56   TINRVESLLNLDTKPFTDRIIAEYIWIGGSGIDLRSKSRTLEKPVEDPSELPKWNYDGSS  115

Query  489  TGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKV  668
            TGQAPGEDSEVILYPQAIF+DPFRGG+NILVICDTYTPAGEPIPTNKR RAA+IFS+ KV
Sbjct  116  TGQAPGEDSEVILYPQAIFRDPFRGGDNILVICDTYTPAGEPIPTNKRARAAEIFSNKKV  175

Query  669  VSEVPWYGIEQEYTLLQQNVKWPL  740
              E+PW+GIEQEYTLLQ NV WPL
Sbjct  176  NEEIPWFGIEQEYTLLQPNVNWPL  199



>emb|CAA73062.1| plastidic glutamine synthetase precursor [Brassica napus]
Length=428

 Score =   301 bits (770),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 148/204 (73%), Positives = 171/204 (84%), Gaps = 6/204 (3%)
 Frame = +3

Query  132  MAQILAPSAQWQMRMTKNLTEATPMAS-KMWGSVVMKPNKRVAVKSTAKFRVFALQSGNS  308
            MAQILA S   QM++TK     +P+AS K+W SV++K  K+ + K  + F+  ALQS NS
Sbjct  1    MAQILAASPTCQMKLTK----PSPIASSKLWSSVMLKQKKQNSSKLRS-FKAMALQSDNS  55

Query  309  TVNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSS  488
            T+NR+E LLNLD  P+T++IIAEYIWIGGSGID RSKSRT+ KPV+ PSELPKWNYDGSS
Sbjct  56   TINRVESLLNLDTKPFTDRIIAEYIWIGGSGIDLRSKSRTLEKPVEDPSELPKWNYDGSS  115

Query  489  TGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKV  668
            TGQAPGEDSEVILYPQAIF+DPFRGGNNILVICDTYTPAGEPIPTNKR RAA+IFS+ KV
Sbjct  116  TGQAPGEDSEVILYPQAIFRDPFRGGNNILVICDTYTPAGEPIPTNKRARAAEIFSNKKV  175

Query  669  VSEVPWYGIEQEYTLLQQNVKWPL  740
              E+PW+GIEQEYTLLQ NV WPL
Sbjct  176  NEEIPWFGIEQEYTLLQPNVNWPL  199



>ref|XP_006395952.1| hypothetical protein EUTSA_v10004280mg [Eutrema salsugineum]
 ref|XP_006395953.1| hypothetical protein EUTSA_v10004280mg [Eutrema salsugineum]
 ref|XP_006395954.1| hypothetical protein EUTSA_v10004280mg [Eutrema salsugineum]
 gb|ESQ33238.1| hypothetical protein EUTSA_v10004280mg [Eutrema salsugineum]
 gb|ESQ33239.1| hypothetical protein EUTSA_v10004280mg [Eutrema salsugineum]
 gb|ESQ33240.1| hypothetical protein EUTSA_v10004280mg [Eutrema salsugineum]
Length=426

 Score =   301 bits (770),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 148/203 (73%), Positives = 169/203 (83%), Gaps = 6/203 (3%)
 Frame = +3

Query  132  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  311
            MAQILA S   QMR+TK  + A+   SK+W SV++K  K+     +  FRV ALQS NST
Sbjct  1    MAQILAASPTCQMRVTKPSSIAS---SKLWSSVMLKQKKQ---SRSTSFRVMALQSDNST  54

Query  312  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  491
            +NR+E LLNLD  P+T++IIAEYIWIGGSGID RSKSRT+ KPV+ PSELPKWNYDGSST
Sbjct  55   INRVESLLNLDTKPFTDRIIAEYIWIGGSGIDLRSKSRTLEKPVEDPSELPKWNYDGSST  114

Query  492  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVV  671
            GQAPGEDSEVILYPQAIF+DPFRGGNNILVICDT+TPAGEPIPTNKR RAA+IFS+ KV 
Sbjct  115  GQAPGEDSEVILYPQAIFRDPFRGGNNILVICDTWTPAGEPIPTNKRARAAEIFSNKKVN  174

Query  672  SEVPWYGIEQEYTLLQQNVKWPL  740
             E+PW+GIEQEYTLLQ NV WPL
Sbjct  175  EELPWFGIEQEYTLLQPNVNWPL  197



>ref|XP_009108017.1| PREDICTED: glutamine synthetase, chloroplastic-like [Brassica 
rapa]
Length=428

 Score =   301 bits (770),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 148/204 (73%), Positives = 171/204 (84%), Gaps = 6/204 (3%)
 Frame = +3

Query  132  MAQILAPSAQWQMRMTKNLTEATPMAS-KMWGSVVMKPNKRVAVKSTAKFRVFALQSGNS  308
            MAQILA S   QM++TK     +P+AS K+W SV++K  K+ + K    F+V ALQS NS
Sbjct  1    MAQILAASPTCQMKLTK----PSPIASSKLWSSVMLKQKKQNSSKLRG-FKVMALQSDNS  55

Query  309  TVNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSS  488
            T+NR+E LLNLD  P+T++IIAEYIWIGGSGID RSKSRT+ KPV+ PSELPKWNYDGSS
Sbjct  56   TINRVESLLNLDTKPFTDRIIAEYIWIGGSGIDLRSKSRTLEKPVEDPSELPKWNYDGSS  115

Query  489  TGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKV  668
            TGQAPGEDSEVILYPQAIF+DPFRGG+NILVICDTYTPAGEPIPTNKR RAA+IFS+ KV
Sbjct  116  TGQAPGEDSEVILYPQAIFRDPFRGGDNILVICDTYTPAGEPIPTNKRARAAEIFSNKKV  175

Query  669  VSEVPWYGIEQEYTLLQQNVKWPL  740
              E+PW+GIEQEYTLLQ NV WPL
Sbjct  176  NEEIPWFGIEQEYTLLQPNVNWPL  199



>ref|XP_009417914.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
 ref|XP_009417915.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=428

 Score =   300 bits (768),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 139/204 (68%), Positives = 168/204 (82%), Gaps = 1/204 (0%)
 Frame = +3

Query  132  MAQILAPSAQWQMRMTKNLTEATPM-ASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNS  308
            MAQ++    Q Q+R      +  PM  SKMW S+++   +    +S + F+V A++S N 
Sbjct  1    MAQMMVSPMQCQIRFPSKSLQGKPMITSKMWNSLLLNAQRFKTKRSVSAFKVLAVKSDNG  60

Query  309  TVNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSS  488
             V+R+E LL LD+ P+T+KIIAEYIWIGG+GID RSKSRTI++PV++PSELPKWNYDGSS
Sbjct  61   VVSRLEDLLKLDMAPFTDKIIAEYIWIGGTGIDIRSKSRTITRPVEYPSELPKWNYDGSS  120

Query  489  TGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKV  668
            TGQAPGEDSEVILYPQA+FKDPFRGGNNILVICD+YTP+GEPIPTNKR+RAAQIFS+ KV
Sbjct  121  TGQAPGEDSEVILYPQAVFKDPFRGGNNILVICDSYTPSGEPIPTNKRYRAAQIFSEQKV  180

Query  669  VSEVPWYGIEQEYTLLQQNVKWPL  740
            + EVPWYGIEQEYTLLQ NVKWPL
Sbjct  181  IDEVPWYGIEQEYTLLQTNVKWPL  204



>ref|XP_010435452.1| PREDICTED: glutamine synthetase, chloroplastic/mitochondrial-like 
isoform X5 [Camelina sativa]
 ref|XP_010435453.1| PREDICTED: glutamine synthetase, chloroplastic/mitochondrial-like 
isoform X6 [Camelina sativa]
 ref|XP_010440749.1| PREDICTED: glutamine synthetase, chloroplastic/mitochondrial-like 
isoform X3 [Camelina sativa]
Length=418

 Score =   299 bits (766),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 145/191 (76%), Positives = 166/191 (87%), Gaps = 2/191 (1%)
 Frame = +3

Query  168  MRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNSTVNRIEQLLNLDV  347
            MR+ K+ + ++ + +K+W SVV+K  K+ + K    FRVFALQS NSTVNR+E LLNLD 
Sbjct  1    MRVPKH-SSSSVITNKLWSSVVLKQKKQSSNKLRG-FRVFALQSDNSTVNRVETLLNLDT  58

Query  348  TPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQAPGEDSEVIL  527
             PY+++IIAEYIWIGGSGID RSKSRTI KPV+ PSELPKWNYDGSSTGQAPGEDSEVIL
Sbjct  59   KPYSDRIIAEYIWIGGSGIDLRSKSRTIEKPVEDPSELPKWNYDGSSTGQAPGEDSEVIL  118

Query  528  YPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVVSEVPWYGIEQEY  707
            YPQAIF+DPFRGGNNILVICDT+TPAGEPIPTNKR RAA+IFS+ KV  EVPW+GIEQEY
Sbjct  119  YPQAIFRDPFRGGNNILVICDTWTPAGEPIPTNKRARAAEIFSNKKVTGEVPWFGIEQEY  178

Query  708  TLLQQNVKWPL  740
            TLLQQNVKWPL
Sbjct  179  TLLQQNVKWPL  189



>ref|XP_003580719.1| PREDICTED: glutamine synthetase, chloroplastic [Brachypodium 
distachyon]
Length=430

 Score =   295 bits (756),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 145/207 (70%), Positives = 167/207 (81%), Gaps = 10/207 (5%)
 Frame = +3

Query  132  MAQILAPSAQWQM-RMTKNLTEATPMAS--KMWGSVVMKPNKRVAVKSTAKFRVFALQSG  302
            MAQ + P+ Q QM  + K+   A P A+  ++WG       +R   + T+ F+V AL + 
Sbjct  1    MAQAVVPAMQCQMGALGKSAVRARPAAAGGRVWGV------RRSGARGTSGFKVLALGTE  54

Query  303  NS-TVNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYD  479
             +  V R+EQLLN+D  PY++KIIAEYIW+GGSGID RSKSRTISKPV  PSELPKWNYD
Sbjct  55   TTGVVPRLEQLLNMDTKPYSDKIIAEYIWVGGSGIDIRSKSRTISKPVADPSELPKWNYD  114

Query  480  GSSTGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSD  659
            GSSTGQAPGEDSEVILYPQAIFKDPFRGGNNILV+CDTYTPAGEPIPTNKRHRAAQIFSD
Sbjct  115  GSSTGQAPGEDSEVILYPQAIFKDPFRGGNNILVVCDTYTPAGEPIPTNKRHRAAQIFSD  174

Query  660  PKVVSEVPWYGIEQEYTLLQQNVKWPL  740
            PKV S+VPWYGIEQEYTLLQ++V WPL
Sbjct  175  PKVASQVPWYGIEQEYTLLQRDVNWPL  201



>emb|CDX84116.1| BnaC08g07930D [Brassica napus]
Length=247

 Score =   288 bits (736),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 139/186 (75%), Positives = 161/186 (87%), Gaps = 2/186 (1%)
 Frame = +3

Query  186  LTEATPMAS-KMWGSVVMKPNKRVAVKSTAKFRVFALQSGNSTVNRIEQLLNLDVTPYTN  362
            LT+ +P+AS K+W SV++K  K+ + K  + F+  ALQS NST+NR+E LLNLD  P+T+
Sbjct  3    LTKPSPIASSKLWSSVMLKQKKQNSSKLRS-FKAMALQSDNSTINRVESLLNLDTKPFTD  61

Query  363  KIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQAPGEDSEVILYPQAI  542
            +IIAEYIWIGGSGID RSKSRT+ KPV+ PSELPKWNYDGSSTGQAPGEDSEVILYPQAI
Sbjct  62   RIIAEYIWIGGSGIDLRSKSRTLEKPVEDPSELPKWNYDGSSTGQAPGEDSEVILYPQAI  121

Query  543  FKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVVSEVPWYGIEQEYTLLQQ  722
            F+DPFRGGNNILVICDTYTPAGEPIPTNKR RAA+IFS+ KV  E+PW+GIEQEYTLLQ 
Sbjct  122  FRDPFRGGNNILVICDTYTPAGEPIPTNKRARAAEIFSNKKVNEEIPWFGIEQEYTLLQP  181

Query  723  NVKWPL  740
            NV WPL
Sbjct  182  NVNWPL  187



>ref|XP_004960149.1| PREDICTED: glutamine synthetase, chloroplastic-like [Setaria 
italica]
Length=428

 Score =   285 bits (730),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 141/207 (68%), Positives = 164/207 (79%), Gaps = 12/207 (6%)
 Frame = +3

Query  132  MAQILAPSAQWQMRMTKNLTEATPMAS---KMWGSVVMKPNKRVAVKSTAKFRVFALQSG  302
            MAQ + P+ Q Q+   K    A P A    ++WG        R   + T+ F+V A+ + 
Sbjct  1    MAQAVVPAMQCQVG-AKAAVRARPAAGAGGRVWGV-------RRTGRGTSGFKVMAISTA  52

Query  303  NS-TVNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYD  479
            ++  V R+EQ+LNLD  PYT+KIIAEYIW+GGSGID RSKSRTI KPV+ PSELPKWNYD
Sbjct  53   STGVVPRLEQMLNLDTKPYTDKIIAEYIWVGGSGIDLRSKSRTIEKPVEDPSELPKWNYD  112

Query  480  GSSTGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSD  659
            GSSTGQAPGEDSEVILYPQAIFKDPFRGGNNILV+CDTYTPAGEPIPTNKRHRAAQIFSD
Sbjct  113  GSSTGQAPGEDSEVILYPQAIFKDPFRGGNNILVMCDTYTPAGEPIPTNKRHRAAQIFSD  172

Query  660  PKVVSEVPWYGIEQEYTLLQQNVKWPL  740
            P+VV +VPW+GIEQEYTLLQ++V WPL
Sbjct  173  PRVVEQVPWFGIEQEYTLLQRDVNWPL  199



>gb|EPS57543.1| glutamine synthetase, partial [Genlisea aurea]
Length=222

 Score =   276 bits (707),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 131/143 (92%), Positives = 138/143 (97%), Gaps = 0/143 (0%)
 Frame = +3

Query  312  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  491
            VNR+++LLN D+TPYT+ IIAEYIWIGGSGID RSKSRTISKPVQHPSELPKWNYDGSST
Sbjct  1    VNRLDKLLNSDLTPYTDNIIAEYIWIGGSGIDIRSKSRTISKPVQHPSELPKWNYDGSST  60

Query  492  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVV  671
            GQAPGEDSEVILYPQAIFKDPFR GNNILVICDTYTPAG+PIPTNKRHRAAQIFSDPKVV
Sbjct  61   GQAPGEDSEVILYPQAIFKDPFRVGNNILVICDTYTPAGDPIPTNKRHRAAQIFSDPKVV  120

Query  672  SEVPWYGIEQEYTLLQQNVKWPL  740
            SE+PWYGIEQEYTLLQ NVKWPL
Sbjct  121  SEIPWYGIEQEYTLLQNNVKWPL  143



>dbj|BAD12057.1| plastidic glutamine synthetase [Phragmites australis]
 dbj|BAD12058.1| plastidic glutamine synthetase [Phragmites australis]
Length=429

 Score =   282 bits (722),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 142/207 (69%), Positives = 163/207 (79%), Gaps = 11/207 (5%)
 Frame = +3

Query  132  MAQILAPSAQWQMRM-TKNLTEATPMAS--KMWGSVVMKPNKRVAVKSTAKFRVFALQS-  299
            MAQ + P+ Q Q+    K    A P  +  ++WG       KR   + T+ F+V A+ + 
Sbjct  1    MAQPVVPAMQCQVGARGKAAVRARPAGAGGRVWGV------KRSG-RGTSGFKVMAVSTE  53

Query  300  GNSTVNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYD  479
                V R+EQLLN+D  P+T+KIIAEYIW+GGSGID RSKSRT+SKPV+ PSELPKWNYD
Sbjct  54   STGVVPRLEQLLNMDTKPFTDKIIAEYIWVGGSGIDLRSKSRTLSKPVEDPSELPKWNYD  113

Query  480  GSSTGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSD  659
            GSSTGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSD
Sbjct  114  GSSTGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSD  173

Query  660  PKVVSEVPWYGIEQEYTLLQQNVKWPL  740
            PKVV +VPW+GIEQEYTLLQ +V WPL
Sbjct  174  PKVVDQVPWFGIEQEYTLLQTDVNWPL  200



>dbj|BAD12059.1| plastidic glutamine synthetase [Phragmites australis]
Length=429

 Score =   282 bits (722),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 142/207 (69%), Positives = 163/207 (79%), Gaps = 11/207 (5%)
 Frame = +3

Query  132  MAQILAPSAQWQMRM---TKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFAL-QS  299
            MAQ + P+ Q Q+ +    +    A     ++WG        R + + T+ F+V A+  S
Sbjct  1    MAQAVVPAMQCQVGVKAAVRARPAAAGAGGRVWGV-------RRSGRGTSGFKVMAMGMS  53

Query  300  GNSTVNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYD  479
             +  V R+EQLLN+D  PYT+ IIAEYIW+GGSGID RSKSRTISKPV+ PSELPKWNYD
Sbjct  54   TSGVVPRLEQLLNMDTKPYTDNIIAEYIWVGGSGIDVRSKSRTISKPVEDPSELPKWNYD  113

Query  480  GSSTGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSD  659
            GSSTGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSD
Sbjct  114  GSSTGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSD  173

Query  660  PKVVSEVPWYGIEQEYTLLQQNVKWPL  740
            PKVVS+VPW+GIEQEYTLLQ +V WPL
Sbjct  174  PKVVSQVPWFGIEQEYTLLQTDVNWPL  200



>ref|NP_001241708.1| uncharacterized protein LOC100856886 [Zea mays]
 gb|ACF85271.1| unknown [Zea mays]
 gb|AFW59722.1| glutamine synthetase1 [Zea mays]
Length=380

 Score =   280 bits (717),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 135/204 (66%), Positives = 163/204 (80%), Gaps = 11/204 (5%)
 Frame = +3

Query  132  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNS-  308
            MAQ + P+ Q ++ +          A ++W +   +  +  A   +  F+V A+ +G++ 
Sbjct  1    MAQAVVPAMQCRVGVKA-------AAGRVWSAGRTRTGRGGA---SPGFKVMAVSTGSTG  50

Query  309  TVNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSS  488
             V R+EQLLN+D TPYT+K+IAEYIW+GGSGID RSKSRTISKPV+ PSELPKWNYDGSS
Sbjct  51   VVPRLEQLLNMDTTPYTDKVIAEYIWVGGSGIDIRSKSRTISKPVEDPSELPKWNYDGSS  110

Query  489  TGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKV  668
            TGQAPGEDSEVILYPQAIFKDPFRGGNN+LVICDTYTP GEP+PTNKRHRAAQIFSDPKV
Sbjct  111  TGQAPGEDSEVILYPQAIFKDPFRGGNNVLVICDTYTPQGEPLPTNKRHRAAQIFSDPKV  170

Query  669  VSEVPWYGIEQEYTLLQQNVKWPL  740
              +VPW+GIEQEYTLLQ++V WPL
Sbjct  171  AEQVPWFGIEQEYTLLQKDVNWPL  194



>dbj|BAG88835.1| unnamed protein product [Oryza sativa Japonica Group]
Length=322

 Score =   278 bits (712),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 140/206 (68%), Positives = 164/206 (80%), Gaps = 10/206 (5%)
 Frame = +3

Query  132  MAQILAPSAQWQMRMTKNLTEATPMASKM--WGSVVMKPNKRVAVKSTAKFRVFALQSGN  305
            MAQ + P+ Q Q+   +    A   A+    WG        R   + T+ FRV A+ +  
Sbjct  1    MAQAVVPAMQCQVGAVRARPAAAAAAAGGRVWGV-------RRTGRGTSGFRVMAVSTET  53

Query  306  S-TVNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  482
            +  V R+EQLLN+D TP+T+KIIAEYIW+GG+GID RSKSRTISKPV+ PSELPKWNYDG
Sbjct  54   TGVVTRMEQLLNMDTTPFTDKIIAEYIWVGGTGIDLRSKSRTISKPVEDPSELPKWNYDG  113

Query  483  SSTGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDP  662
            SSTGQAPGEDSEVILYPQAIFKDPFRGGNNILV+CDTYTPAGEPIPTNKR+RAAQ+FSDP
Sbjct  114  SSTGQAPGEDSEVILYPQAIFKDPFRGGNNILVMCDTYTPAGEPIPTNKRNRAAQVFSDP  173

Query  663  KVVSEVPWYGIEQEYTLLQQNVKWPL  740
            KVVS+VPW+GIEQEYTLLQ++V WPL
Sbjct  174  KVVSQVPWFGIEQEYTLLQRDVNWPL  199



>ref|XP_006593065.1| PREDICTED: glutamine synthetase leaf isozyme, chloroplastic-like 
[Glycine max]
Length=198

 Score =   273 bits (698),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 131/197 (66%), Positives = 162/197 (82%), Gaps = 11/197 (6%)
 Frame = +3

Query  132  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  311
            MAQILAPS QWQMR++K+   ATP+ S MWGS++ K NK+V++ S+AKFRV A++S NST
Sbjct  1    MAQILAPSTQWQMRISKSSPNATPITSNMWGSLLWKQNKKVSLTSSAKFRVLAIKSDNST  60

Query  312  VNRIEQLLNLDVTPYTNKIIAEYIW-----------IGGSGIDTRSKSRTISKPVQHPSE  458
            +NR+E LLNLD+TP+T+KIIAEYIW           + G GID RSKSRTISKPV+ PS+
Sbjct  61   INRLEGLLNLDITPFTDKIIAEYIWYLKLIFFFETGLRGIGIDVRSKSRTISKPVEDPSK  120

Query  459  LPKWNYDGSSTGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHR  638
            LP+WNYDGSSTGQA G++SEVILYPQAIFKDP+RGGNNILVI D+YTP GEPIP++ + R
Sbjct  121  LPRWNYDGSSTGQAQGDNSEVILYPQAIFKDPYRGGNNILVIYDSYTPQGEPIPSSLQTR  180

Query  639  AAQIFSDPKVVSEVPWY  689
              +IFS+PKV +EVPWY
Sbjct  181  DTEIFSNPKVQAEVPWY  197



>gb|AFB69878.1| chloroplast glutamine synthetase isoform 2-1 [Secale cereale]
Length=427

 Score =   281 bits (719),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 136/205 (66%), Positives = 163/205 (80%), Gaps = 9/205 (4%)
 Frame = +3

Query  132  MAQILAPSAQWQMRM-TKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQ-SGN  305
            MAQ + P+ Q Q+ +  ++   A   A ++WG        R   ++T+ F+V AL     
Sbjct  1    MAQAVVPAMQCQVGVRGRSAVPARQPAGRLWGV-------RRTARATSGFKVLALGPETT  53

Query  306  STVNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGS  485
              + R++QLL++D TP+T+KIIAEYIW+GGSGID RSKSRTISKPV+ PSELPKWNYDGS
Sbjct  54   GVIQRMQQLLDMDTTPFTDKIIAEYIWVGGSGIDLRSKSRTISKPVEDPSELPKWNYDGS  113

Query  486  STGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPK  665
            STGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTP GEPIPTNKRH AAQIFSDPK
Sbjct  114  STGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPQGEPIPTNKRHMAAQIFSDPK  173

Query  666  VVSEVPWYGIEQEYTLLQQNVKWPL  740
            V ++VPW+GIEQEYTL+Q++V WPL
Sbjct  174  VTAQVPWFGIEQEYTLMQRDVNWPL  198



>ref|NP_001054133.1| Os04g0659100 [Oryza sativa Japonica Group]
 sp|P14655.1|GLNA2_ORYSJ RecName: Full=Glutamine synthetase, chloroplastic; AltName: Full=Glutamate--ammonia 
ligase; AltName: Full=OsGS2; Short=GS2; 
Flags: Precursor [Oryza sativa Japonica Group]
 emb|CAA32462.1| unnamed protein product [Oryza sativa]
 emb|CAE02885.2| OSJNBa0015K02.2 [Oryza sativa Japonica Group]
 emb|CAE54574.1| OSJNBa0011F23.15 [Oryza sativa Japonica Group]
 dbj|BAF16047.1| Os04g0659100 [Oryza sativa Japonica Group]
 emb|CAH67797.1| OSIGBa0132E09-OSIGBa0108L24.11 [Oryza sativa Indica Group]
 gb|EEC78171.1| hypothetical protein OsI_17756 [Oryza sativa Indica Group]
 gb|EEE61834.1| hypothetical protein OsJ_16481 [Oryza sativa Japonica Group]
Length=428

 Score =   281 bits (718),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 140/206 (68%), Positives = 164/206 (80%), Gaps = 10/206 (5%)
 Frame = +3

Query  132  MAQILAPSAQWQMRMTKNLTEATPMASKM--WGSVVMKPNKRVAVKSTAKFRVFALQSGN  305
            MAQ + P+ Q Q+   +    A   A+    WG        R   + T+ FRV A+ +  
Sbjct  1    MAQAVVPAMQCQVGAVRARPAAAAAAAGGRVWGV-------RRTGRGTSGFRVMAVSTET  53

Query  306  S-TVNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  482
            +  V R+EQLLN+D TP+T+KIIAEYIW+GG+GID RSKSRTISKPV+ PSELPKWNYDG
Sbjct  54   TGVVTRMEQLLNMDTTPFTDKIIAEYIWVGGTGIDLRSKSRTISKPVEDPSELPKWNYDG  113

Query  483  SSTGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDP  662
            SSTGQAPGEDSEVILYPQAIFKDPFRGGNNILV+CDTYTPAGEPIPTNKR+RAAQ+FSDP
Sbjct  114  SSTGQAPGEDSEVILYPQAIFKDPFRGGNNILVMCDTYTPAGEPIPTNKRNRAAQVFSDP  173

Query  663  KVVSEVPWYGIEQEYTLLQQNVKWPL  740
            KVVS+VPW+GIEQEYTLLQ++V WPL
Sbjct  174  KVVSQVPWFGIEQEYTLLQRDVNWPL  199



>gb|AAZ30062.1| plastid glutamine synthetase isoform GS2c [Triticum aestivum]
 gb|AAZ80474.1| GS2 [Triticum aestivum]
 gb|ACT22493.1| plastid glutamine synthetase 2 [Triticum aestivum]
 gb|ACT22495.1| plastid glutamine synthetase 2 [Triticum aestivum]
 gb|ACT22498.1| plastid glutamine synthetase 2 [Triticum aestivum]
 gb|AEH16638.1| glutamine synthetase [Triticum aestivum]
 gb|AEM42904.1| plastid glutamine synthetase isoform [Secale cereale x Triticum 
turgidum subsp. durum]
 gb|EMT11272.1| Glutamine synthetase leaf isozyme, chloroplastic [Aegilops tauschii]
Length=427

 Score =   281 bits (718),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 136/205 (66%), Positives = 163/205 (80%), Gaps = 9/205 (4%)
 Frame = +3

Query  132  MAQILAPSAQWQMRM-TKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQ-SGN  305
            MAQ + P+ Q Q+ +  ++   A   A ++WG        R   ++T+ F+V AL     
Sbjct  1    MAQAVVPAMQCQVGVRGRSAVPARQPAGRVWGV-------RRTARATSGFKVLALGPETT  53

Query  306  STVNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGS  485
              + R++QLL++D TP+T+KIIAEYIW+GGSGID RSKSRTISKPV+ PSELPKWNYDGS
Sbjct  54   GVIQRMQQLLDMDTTPFTDKIIAEYIWVGGSGIDLRSKSRTISKPVEDPSELPKWNYDGS  113

Query  486  STGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPK  665
            STGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTP GEPIPTNKRH AAQIFSDPK
Sbjct  114  STGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPQGEPIPTNKRHMAAQIFSDPK  173

Query  666  VVSEVPWYGIEQEYTLLQQNVKWPL  740
            V ++VPW+GIEQEYTL+Q++V WPL
Sbjct  174  VTAQVPWFGIEQEYTLMQRDVNWPL  198



>dbj|BAJ91545.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=435

 Score =   281 bits (718),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 137/208 (66%), Positives = 163/208 (78%), Gaps = 9/208 (4%)
 Frame = +3

Query  123  QVKMAQILAPSAQWQMRM-TKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQ-  296
            +  MAQ +  + Q Q+ +  +    A   A ++WG        R A ++T+ F+V AL  
Sbjct  6    ETTMAQAVVQAMQCQVGVRGRTAVPARQPAGRVWGV-------RRAARATSGFKVLALGP  58

Query  297  SGNSTVNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNY  476
                 + R++QLL++D TP+T+KIIAEYIW+GGSGID RSKSRTISKPV+ PSELPKWNY
Sbjct  59   ETTGVIQRMQQLLDMDTTPFTDKIIAEYIWVGGSGIDLRSKSRTISKPVEDPSELPKWNY  118

Query  477  DGSSTGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFS  656
            DGSSTGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTP GEPIPTNKRH AAQIFS
Sbjct  119  DGSSTGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPQGEPIPTNKRHMAAQIFS  178

Query  657  DPKVVSEVPWYGIEQEYTLLQQNVKWPL  740
            DPKV S+VPW+GIEQEYTL+Q++V WPL
Sbjct  179  DPKVTSQVPWFGIEQEYTLMQRDVNWPL  206



>gb|AAL87183.1|AF480497_11 putative precursor chloroplastic glutamine synthetase [Oryza 
sativa Japonica Group]
Length=451

 Score =   281 bits (719),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 140/206 (68%), Positives = 164/206 (80%), Gaps = 10/206 (5%)
 Frame = +3

Query  132  MAQILAPSAQWQMRMTKNLTEATPMASKM--WGSVVMKPNKRVAVKSTAKFRVFALQSGN  305
            MAQ + P+ Q Q+   +    A   A+    WG        R   + T+ FRV A+ +  
Sbjct  1    MAQAVVPAMQCQVGAVRARPAAAAAAAGGRVWGV-------RRTGRGTSGFRVMAVSTET  53

Query  306  S-TVNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDG  482
            +  V R+EQLLN+D TP+T+KIIAEYIW+GG+GID RSKSRTISKPV+ PSELPKWNYDG
Sbjct  54   TGVVTRMEQLLNMDTTPFTDKIIAEYIWVGGTGIDLRSKSRTISKPVEDPSELPKWNYDG  113

Query  483  SSTGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDP  662
            SSTGQAPGEDSEVILYPQAIFKDPFRGGNNILV+CDTYTPAGEPIPTNKR+RAAQ+FSDP
Sbjct  114  SSTGQAPGEDSEVILYPQAIFKDPFRGGNNILVMCDTYTPAGEPIPTNKRNRAAQVFSDP  173

Query  663  KVVSEVPWYGIEQEYTLLQQNVKWPL  740
            KVVS+VPW+GIEQEYTLLQ++V WPL
Sbjct  174  KVVSQVPWFGIEQEYTLLQRDVNWPL  199



>ref|XP_008662331.1| PREDICTED: glutamine synthetase, chloroplastic isoform X1 [Zea 
mays]
 gb|ACF83467.1| unknown [Zea mays]
 gb|ACN27769.1| unknown [Zea mays]
 gb|ACF86733.2| unknown [Zea mays]
 gb|AFW59720.1| glutamine synthetase1 isoform 1 [Zea mays]
 gb|AFW59721.1| glutamine synthetase1 isoform 2 [Zea mays]
Length=423

 Score =   280 bits (716),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 135/204 (66%), Positives = 163/204 (80%), Gaps = 11/204 (5%)
 Frame = +3

Query  132  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNS-  308
            MAQ + P+ Q ++ +          A ++W +   +  +  A   +  F+V A+ +G++ 
Sbjct  1    MAQAVVPAMQCRVGVKA-------AAGRVWSAGRTRTGRGGA---SPGFKVMAVSTGSTG  50

Query  309  TVNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSS  488
             V R+EQLLN+D TPYT+K+IAEYIW+GGSGID RSKSRTISKPV+ PSELPKWNYDGSS
Sbjct  51   VVPRLEQLLNMDTTPYTDKVIAEYIWVGGSGIDIRSKSRTISKPVEDPSELPKWNYDGSS  110

Query  489  TGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKV  668
            TGQAPGEDSEVILYPQAIFKDPFRGGNN+LVICDTYTP GEP+PTNKRHRAAQIFSDPKV
Sbjct  111  TGQAPGEDSEVILYPQAIFKDPFRGGNNVLVICDTYTPQGEPLPTNKRHRAAQIFSDPKV  170

Query  669  VSEVPWYGIEQEYTLLQQNVKWPL  740
              +VPW+GIEQEYTLLQ++V WPL
Sbjct  171  AEQVPWFGIEQEYTLLQKDVNWPL  194



>gb|ACT22496.1| plastid glutamine synthetase 2 [Triticum aestivum]
 gb|ACT22497.1| plastid glutamine synthetase 2 [Triticum aestivum]
Length=427

 Score =   280 bits (716),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 136/205 (66%), Positives = 162/205 (79%), Gaps = 9/205 (4%)
 Frame = +3

Query  132  MAQILAPSAQWQMRM-TKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQ-SGN  305
            MAQ + P+ Q Q+ +  ++   A   A ++WG        R   ++ + F+V AL     
Sbjct  1    MAQAVVPAMQCQVGVRGRSAVPARQPAGRVWGV-------RRTARAASGFKVLALGPETT  53

Query  306  STVNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGS  485
              + R++QLL++D TP+T+KIIAEYIW+GGSGID RSKSRTISKPV+ PSELPKWNYDGS
Sbjct  54   GVIQRMQQLLDMDTTPFTDKIIAEYIWVGGSGIDLRSKSRTISKPVEDPSELPKWNYDGS  113

Query  486  STGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPK  665
            STGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTP GEPIPTNKRH AAQIFSDPK
Sbjct  114  STGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPQGEPIPTNKRHMAAQIFSDPK  173

Query  666  VVSEVPWYGIEQEYTLLQQNVKWPL  740
            V S+VPW+GIEQEYTL+Q++V WPL
Sbjct  174  VTSQVPWFGIEQEYTLMQRDVNWPL  198



>ref|NP_001105725.1| glutamine synthetase, chloroplastic precursor [Zea mays]
 sp|P25462.1|GLNAC_MAIZE RecName: Full=Glutamine synthetase, chloroplastic; AltName: Full=GS2; 
AltName: Full=Glutamate--ammonia ligase; Flags: Precursor 
[Zea mays]
 emb|CAA46724.1| glutamine synthetase [Zea mays]
Length=423

 Score =   279 bits (714),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 135/204 (66%), Positives = 163/204 (80%), Gaps = 11/204 (5%)
 Frame = +3

Query  132  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNS-  308
            MAQ + P+ Q ++ +          A ++W +   +  +  A   +  F+V A+ +G++ 
Sbjct  1    MAQAVVPAMQCRVGVKA-------AAGRVWSAGRTRTGRGGA---SPGFKVMAVSTGSTG  50

Query  309  TVNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSS  488
             V R+EQLLN+D TPYT+K+IAEYIW+GGSGID RSKSRTISKPV+ PSELPKWNYDGSS
Sbjct  51   VVPRLEQLLNMDTTPYTDKVIAEYIWVGGSGIDIRSKSRTISKPVEDPSELPKWNYDGSS  110

Query  489  TGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKV  668
            TGQAPGEDSEVILYPQAIFKDPFRGGNN+LVICDTYTP GEP+PTNKRHRAAQIFSDPKV
Sbjct  111  TGQAPGEDSEVILYPQAIFKDPFRGGNNVLVICDTYTPQGEPLPTNKRHRAAQIFSDPKV  170

Query  669  VSEVPWYGIEQEYTLLQQNVKWPL  740
              +VPW+GIEQEYTLLQ++V WPL
Sbjct  171  GEQVPWFGIEQEYTLLQKDVNWPL  194



>prf||1804333B Gln synthetase
Length=430

 Score =   279 bits (714),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 137/203 (67%), Positives = 162/203 (80%), Gaps = 2/203 (1%)
 Frame = +3

Query  132  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  311
            MAQILA S   QMR+ K+ +     +SK+W SVV+K  K+   K    FRV ALQS N +
Sbjct  1    MAQILAASPTCQMRVPKH-SSVIASSSKLWSSVVLKQKKQSNNKVRG-FRVLALQSDNMS  58

Query  312  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  491
            +N  E LLNL  + Y ++IIAEYIW+GGSG+D RSK+RT+  PV  PS+LPKWNYDGSST
Sbjct  59   LNSDEILLNLSDSTYKDRIIAEYIWVGGSGMDMRSKARTLPGPVTDPSQLPKWNYDGSST  118

Query  492  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVV  671
            GQAPGEDSEVILYPQAIFKDPFR GNNILV+CD YTPAGEPIPTNKRH AA++FS+P V 
Sbjct  119  GQAPGEDSEVILYPQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRHAAAKVFSNPDVA  178

Query  672  SEVPWYGIEQEYTLLQQNVKWPL  740
            +EVPWYGIEQEYTLLQ++VKWP+
Sbjct  179  AEVPWYGIEQEYTLLQKDVKWPV  201



>gb|ACT22500.1| plastid glutamine synthetase 2 [Triticum aestivum]
Length=427

 Score =   279 bits (713),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 135/205 (66%), Positives = 162/205 (79%), Gaps = 9/205 (4%)
 Frame = +3

Query  132  MAQILAPSAQWQMRM-TKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQ-SGN  305
            MAQ + P+ Q Q+ +  ++   A   A ++WG        R   ++ + F+V AL     
Sbjct  1    MAQAVVPAMQCQVGVRGRSAVPARQPAGRVWGV-------RRTARAASGFKVLALGPETT  53

Query  306  STVNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGS  485
              + R++QLL++D TP+T+KIIAEYIW+GGSGID RSKSRTISKPV+ PSELPKWNYDGS
Sbjct  54   GVIQRMQQLLDMDTTPFTDKIIAEYIWVGGSGIDLRSKSRTISKPVEDPSELPKWNYDGS  113

Query  486  STGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPK  665
            STGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTP GEPIPTNKRH AAQIFSDPK
Sbjct  114  STGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPQGEPIPTNKRHMAAQIFSDPK  173

Query  666  VVSEVPWYGIEQEYTLLQQNVKWPL  740
            V ++VPW+GIEQEYTL+Q++V WPL
Sbjct  174  VTAQVPWFGIEQEYTLMQRDVNWPL  198



>dbj|BAJ95492.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=435

 Score =   279 bits (713),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 136/208 (65%), Positives = 162/208 (78%), Gaps = 9/208 (4%)
 Frame = +3

Query  123  QVKMAQILAPSAQWQMRM-TKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQ-  296
            +  MAQ +  + Q Q+ +  +    A   A ++WG        R A ++T+ F+V AL  
Sbjct  6    ETTMAQAVVQAMQCQVGVRGRTAVPARQPAGRVWGV-------RRAARATSGFKVLALGP  58

Query  297  SGNSTVNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNY  476
                 + R++QLL++D TP+T+KIIAEYIW+GGSGID RSKSRTISKPV+ PSELPKWNY
Sbjct  59   ETTGVIQRMQQLLDMDTTPFTDKIIAEYIWVGGSGIDLRSKSRTISKPVEDPSELPKWNY  118

Query  477  DGSSTGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFS  656
            DGSSTGQAPGEDSEVILYPQA FKDPFRGGNNILVICDTYTP GEPIPTNKRH AAQIFS
Sbjct  119  DGSSTGQAPGEDSEVILYPQATFKDPFRGGNNILVICDTYTPQGEPIPTNKRHMAAQIFS  178

Query  657  DPKVVSEVPWYGIEQEYTLLQQNVKWPL  740
            DPKV S+VPW+GIEQEYTL+Q++V WPL
Sbjct  179  DPKVTSQVPWFGIEQEYTLMQRDVNWPL  206



>ref|XP_008662330.1| PREDICTED: glutamine synthetase, chloroplastic isoform X2 [Zea 
mays]
Length=512

 Score =   281 bits (718),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 139/219 (63%), Positives = 168/219 (77%), Gaps = 15/219 (7%)
 Frame = +3

Query  87   PCHCYPISTDR*QVKMAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKS  266
            PC C P +       MAQ + P+ Q ++ +          A ++W +   +  +  A   
Sbjct  79   PCPC-PSTVGS---GMAQAVVPAMQCRVGVKA-------AAGRVWSAGRTRTGRGGA---  124

Query  267  TAKFRVFALQSGNS-TVNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPV  443
            +  F+V A+ +G++  V R+EQLLN+D TPYT+K+IAEYIW+GGSGID RSKSRTISKPV
Sbjct  125  SPGFKVMAVSTGSTGVVPRLEQLLNMDTTPYTDKVIAEYIWVGGSGIDIRSKSRTISKPV  184

Query  444  QHPSELPKWNYDGSSTGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPT  623
            + PSELPKWNYDGSSTGQAPGEDSEVILYPQAIFKDPFRGGNN+LVICDTYTP GEP+PT
Sbjct  185  EDPSELPKWNYDGSSTGQAPGEDSEVILYPQAIFKDPFRGGNNVLVICDTYTPQGEPLPT  244

Query  624  NKRHRAAQIFSDPKVVSEVPWYGIEQEYTLLQQNVKWPL  740
            NKRHRAAQIFSDPKV  +VPW+GIEQEYTLLQ++V WPL
Sbjct  245  NKRHRAAQIFSDPKVAEQVPWFGIEQEYTLLQKDVNWPL  283



>gb|AAZ30061.1| plastid glutamine synthetase isoform GS2b [Triticum aestivum]
Length=427

 Score =   278 bits (711),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 136/205 (66%), Positives = 162/205 (79%), Gaps = 9/205 (4%)
 Frame = +3

Query  132  MAQILAPSAQWQMRM-TKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQ-SGN  305
            MAQ + P+ Q Q+ +  ++   A   A ++WG        R   ++T+ F+V AL     
Sbjct  1    MAQAVVPAMQCQVGVRGRSAVPARQPAGRVWGV-------RRTARATSGFKVLALGPETT  53

Query  306  STVNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGS  485
              + R++QLL++D TP+T+KIIAEYIW+GGSGID RSKSRTISKPV+ PSELPKWNYDGS
Sbjct  54   GVIQRMQQLLDMDTTPFTDKIIAEYIWVGGSGIDLRSKSRTISKPVEDPSELPKWNYDGS  113

Query  486  STGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPK  665
            STGQAPGEDSEVILYPQAIFKDPFRGGNNILVIC TYTP GEPIPTNKRH AAQIFSDPK
Sbjct  114  STGQAPGEDSEVILYPQAIFKDPFRGGNNILVICVTYTPQGEPIPTNKRHMAAQIFSDPK  173

Query  666  VVSEVPWYGIEQEYTLLQQNVKWPL  740
            V S+VPW+GIEQEYTL+Q++V WPL
Sbjct  174  VTSQVPWFGIEQEYTLMQRDVNWPL  198



>emb|CAA29057.1| gluthamine synthetase [Pisum sativum]
Length=373

 Score =   276 bits (705),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 125/144 (87%), Positives = 137/144 (95%), Gaps = 0/144 (0%)
 Frame = +3

Query  309  TVNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSS  488
            T+NR+E LLNLD+TP+T+ IIAEYIWIGG+GID RSKSRTISKPV HPSE+PKWNYDGSS
Sbjct  1    TINRVEDLLNLDITPFTDSIIAEYIWIGGTGIDVRSKSRTISKPVSHPSEVPKWNYDGSS  60

Query  489  TGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKV  668
            TGQAPGEDSEVILYPQAIFKDPFRGGNNILV+CD YTPAGEPIPTNKRHRAA+IFS+PKV
Sbjct  61   TGQAPGEDSEVILYPQAIFKDPFRGGNNILVVCDAYTPAGEPIPTNKRHRAAEIFSNPKV  120

Query  669  VSEVPWYGIEQEYTLLQQNVKWPL  740
             +E+PWYGIEQEYTLLQ NVKWPL
Sbjct  121  EAEIPWYGIEQEYTLLQTNVKWPL  144



>emb|CAA34131.1| unnamed protein product [Hordeum vulgare subsp. vulgare]
Length=426

 Score =   278 bits (710),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 131/179 (73%), Positives = 151/179 (84%), Gaps = 8/179 (4%)
 Frame = +3

Query  207  ASKMWGSVVMKPNKRVAVKSTAKFRVFALQ-SGNSTVNRIEQLLNLDVTPYTNKIIAEYI  383
            A ++WG        R A ++T+ F+V AL       + R++QLL++D TP+T+KIIAEYI
Sbjct  26   AGRVWGV-------RRAARATSGFKVLALGPETTGVIQRMQQLLDMDTTPFTDKIIAEYI  78

Query  384  WIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQAPGEDSEVILYPQAIFKDPFRG  563
            W+GGSGID RSKSRTISKPV+ PSELPKWNYDGSSTGQAPGEDSEVILYPQAIFKDPFRG
Sbjct  79   WVGGSGIDLRSKSRTISKPVEDPSELPKWNYDGSSTGQAPGEDSEVILYPQAIFKDPFRG  138

Query  564  GNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVVSEVPWYGIEQEYTLLQQNVKWPL  740
            GNNILVICDTYTP GEPIPTNKRH AAQIFSDPKV S+VPW+GIEQEYTL+Q++V WPL
Sbjct  139  GNNILVICDTYTPQGEPIPTNKRHMAAQIFSDPKVTSQVPWFGIEQEYTLMQRDVNWPL  197



>gb|AAZ30060.1| plastid glutamine synthetase isoform GS2a [Triticum aestivum]
Length=427

 Score =   277 bits (708),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 134/205 (65%), Positives = 161/205 (79%), Gaps = 9/205 (4%)
 Frame = +3

Query  132  MAQILAPSAQWQMRM-TKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQ-SGN  305
            MAQ + P+ Q Q+ +  ++   A   A ++WG        R   ++T+ F V AL     
Sbjct  1    MAQAVVPAMQCQVGVRGRSAVPARQPAGRVWGV-------RRTARATSGFEVLALGPETT  53

Query  306  STVNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGS  485
              + R++QLL++D TP+T+KIIAEYIW+GGSGID RSKSRTISKPV+ PSELPKWNYDGS
Sbjct  54   GVIQRMQQLLDMDTTPFTDKIIAEYIWVGGSGIDLRSKSRTISKPVEDPSELPKWNYDGS  113

Query  486  STGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPK  665
            STGQ PGEDSEVILYPQAIFKDPFRGGNNILVICDTYTP GEP+PTNKRH AAQIFSDPK
Sbjct  114  STGQPPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPQGEPVPTNKRHMAAQIFSDPK  173

Query  666  VVSEVPWYGIEQEYTLLQQNVKWPL  740
            V ++VPW+GIEQEYTL+Q++V WPL
Sbjct  174  VTAQVPWFGIEQEYTLMQRDVNWPL  198



>ref|XP_006653841.1| PREDICTED: LOW QUALITY PROTEIN: glutamine synthetase, chloroplastic-like 
[Oryza brachyantha]
Length=410

 Score =   275 bits (703),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 127/145 (88%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = +3

Query  306  STVNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGS  485
              V R+EQLLN+D  PYT+KIIAEYIW+GGSGID RSKSRTISKPV+ PSELPKWNYDGS
Sbjct  37   GVVTRLEQLLNMDTKPYTDKIIAEYIWVGGSGIDLRSKSRTISKPVEDPSELPKWNYDGS  96

Query  486  STGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPK  665
            STGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPK
Sbjct  97   STGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPK  156

Query  666  VVSEVPWYGIEQEYTLLQQNVKWPL  740
            V S+VPW+GIEQEYTLLQ++V WPL
Sbjct  157  VASQVPWFGIEQEYTLLQRDVNWPL  181



>sp|P13564.2|GLNA2_HORVU RecName: Full=Glutamine synthetase leaf isozyme, chloroplastic; 
AltName: Full=GS2; AltName: Full=Glutamate--ammonia ligase; 
Flags: Precursor [Hordeum vulgare]
 emb|CAA37643.1| unnamed protein product [Hordeum vulgare]
Length=434

 Score =   275 bits (702),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 127/163 (78%), Positives = 145/163 (89%), Gaps = 1/163 (1%)
 Frame = +3

Query  255  AVKSTAKFRVFALQ-SGNSTVNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTI  431
            A ++T+ F+V AL       + R++QLL++D TP+T+KIIAEYIW+GGSGID RSKSRTI
Sbjct  43   AARATSGFKVLALGPETTGVIQRMQQLLDMDTTPFTDKIIAEYIWVGGSGIDLRSKSRTI  102

Query  432  SKPVQHPSELPKWNYDGSSTGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGE  611
            SKPV+ PSELPKWNYDGSSTGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTP GE
Sbjct  103  SKPVEDPSELPKWNYDGSSTGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPQGE  162

Query  612  PIPTNKRHRAAQIFSDPKVVSEVPWYGIEQEYTLLQQNVKWPL  740
            PIPTNKRH AAQIFSDPKV S+VPW+GIEQEYTL+Q++V WPL
Sbjct  163  PIPTNKRHMAAQIFSDPKVTSQVPWFGIEQEYTLMQRDVNWPL  205



>prf||1804333C Gln synthetase
Length=430

 Score =   272 bits (696),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 134/203 (66%), Positives = 160/203 (79%), Gaps = 2/203 (1%)
 Frame = +3

Query  132  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  311
            MAQILA S   QMR+ K+ +     +SK+W SVV+K  K+   K    FRV ALQS N +
Sbjct  1    MAQILAASPTCQMRVPKH-SSVIASSSKLWSSVVLKQKKQSNNKVRG-FRVLALQSDNMS  58

Query  312  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  491
            +   E LLN+   P  ++IIAEYIW+GGSG+D RSK+RT+  PV  PS+LPKWNYDGSST
Sbjct  59   LLADEVLLNISDNPEKDRIIAEYIWVGGSGMDMRSKARTLPGPVTDPSKLPKWNYDGSST  118

Query  492  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVV  671
            GQAPG+DSEVILYPQAIFKDPFR GNNILV+CD YTPAGEPIPTNKRH AA+IF++P V+
Sbjct  119  GQAPGQDSEVILYPQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRHAAAEIFANPDVI  178

Query  672  SEVPWYGIEQEYTLLQQNVKWPL  740
            +EVPWYGIEQEYTLLQ++V WPL
Sbjct  179  AEVPWYGIEQEYTLLQKDVNWPL  201



>gb|ACG35376.1| glutamine synthetase [Zea mays]
Length=427

 Score =   272 bits (695),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 126/161 (78%), Positives = 144/161 (89%), Gaps = 1/161 (1%)
 Frame = +3

Query  261  KSTAKFRVFALQSGNS-TVNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISK  437
            +  A  +   L +G++  V R+EQLLN+D TPYT+K+IAEYIW+GGSGID RSKSRTISK
Sbjct  38   RRLAGVQGHGLSTGSTGVVPRLEQLLNMDTTPYTDKVIAEYIWVGGSGIDIRSKSRTISK  97

Query  438  PVQHPSELPKWNYDGSSTGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPI  617
            PV+ PSELPKWNYDGSSTGQAPGEDSEVILYPQAIFKDPFRGGNN+LVICDTYTP GEP+
Sbjct  98   PVEDPSELPKWNYDGSSTGQAPGEDSEVILYPQAIFKDPFRGGNNVLVICDTYTPQGEPL  157

Query  618  PTNKRHRAAQIFSDPKVVSEVPWYGIEQEYTLLQQNVKWPL  740
            PTNKRHRAAQIFSDPKV ++VPW+GIEQEYTLLQ++V WPL
Sbjct  158  PTNKRHRAAQIFSDPKVAAQVPWFGIEQEYTLLQKDVNWPL  198



>gb|EMS53309.1| Glutamine synthetase leaf isozyme, chloroplastic [Triticum urartu]
Length=535

 Score =   275 bits (702),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 129/179 (72%), Positives = 150/179 (84%), Gaps = 8/179 (4%)
 Frame = +3

Query  207  ASKMWGSVVMKPNKRVAVKSTAKFRVFALQ-SGNSTVNRIEQLLNLDVTPYTNKIIAEYI  383
            A ++WG        R   ++T+ F+V AL       + R++QLL++D TP+T+KIIAEYI
Sbjct  19   AGRVWGV-------RRTARATSGFKVLALGPETTGVIQRMQQLLDMDTTPFTDKIIAEYI  71

Query  384  WIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQAPGEDSEVILYPQAIFKDPFRG  563
            W+GGSGID RSKSRTISKPV+ PSELPKWNYDGSSTGQAPGEDSEVILYPQAIFKDPFRG
Sbjct  72   WVGGSGIDLRSKSRTISKPVEDPSELPKWNYDGSSTGQAPGEDSEVILYPQAIFKDPFRG  131

Query  564  GNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVVSEVPWYGIEQEYTLLQQNVKWPL  740
            GNNILVICDTYTP GEPIPTNKRH AAQIFSDPKV ++VPW+GIEQEYTL+Q++V WPL
Sbjct  132  GNNILVICDTYTPQGEPIPTNKRHMAAQIFSDPKVTAQVPWFGIEQEYTLMQRDVNWPL  190



>gb|ACG31728.1| hypothetical protein [Zea mays]
Length=382

 Score =   267 bits (683),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 124/153 (81%), Positives = 141/153 (92%), Gaps = 1/153 (1%)
 Frame = +3

Query  285  FALQSGNS-TVNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSEL  461
             A+ +G++  V R+EQLLN+D TPYT+K+IAEYIW+GGSGID RSKSRTISKPV+ PSEL
Sbjct  1    MAVSTGSTGXVPRLEQLLNMDTTPYTDKVIAEYIWVGGSGIDIRSKSRTISKPVEDPSEL  60

Query  462  PKWNYDGSSTGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRA  641
            PKWNYDGSSTGQAP EDSEVILYPQAIFKDPFRGGNN+LVICDTYTP GEP+PTNKRHRA
Sbjct  61   PKWNYDGSSTGQAPVEDSEVILYPQAIFKDPFRGGNNVLVICDTYTPQGEPLPTNKRHRA  120

Query  642  AQIFSDPKVVSEVPWYGIEQEYTLLQQNVKWPL  740
            AQIFSDPKV ++VPW+GIEQEYTLLQ++V WPL
Sbjct  121  AQIFSDPKVAAQVPWFGIEQEYTLLQKDVNWPL  153



>prf||1804333D Gln synthetase
Length=430

 Score =   266 bits (680),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 134/203 (66%), Positives = 155/203 (76%), Gaps = 2/203 (1%)
 Frame = +3

Query  132  MAQILAPSAQWQMRMTKNLTEATPMASKMWGSVVMKPNKRVAVKSTAKFRVFALQSGNST  311
            MAQILA S   QMR+ K+ +     +SK+W SVV+K  K+   K    FRV ALQS NST
Sbjct  1    MAQILAASPTCQMRVPKH-SSVIASSSKLWSSVVLKQKKQSNNKVRG-FRVLALQSDNST  58

Query  312  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  491
            +   E LLNL      ++IIAEYIWIGGSG+D RSK+RT+  PV  PS+LPKWNYDGSST
Sbjct  59   LLSDEVLLNLTDATGKDRIIAEYIWIGGSGMDIRSKARTLPGPVTDPSKLPKWNYDGSST  118

Query  492  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVV  671
            GQA GEDSEVILYPQAIFKDPFR GNNILV+CD YTPAG+PIPTNKRH AA+IFS P V 
Sbjct  119  GQAAGEDSEVILYPQAIFKDPFRKGNNILVMCDAYTPAGDPIPTNKRHNAAKIFSHPDVA  178

Query  672  SEVPWYGIEQEYTLLQQNVKWPL  740
             E PWYGIEQEYTL+Q++V WP+
Sbjct  179  KEEPWYGIEQEYTLMQKDVNWPI  201



>gb|AHJ10962.1| chloroplast glutamine synthetase 2 isoform 2 [Lemna minor]
Length=424

 Score =   252 bits (643),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 139/204 (68%), Positives = 157/204 (77%), Gaps = 5/204 (2%)
 Frame = +3

Query  135  AQILAPSAQWQMRMTKNLTEA-TPMASKMWGSVVMKPNKRVAVKSTAKFRVFA-LQSGNS  308
            AQI APS + +  +    + A  P+     GS   +    V  +    F V A L + N+
Sbjct  3    AQIPAPSLRCERSIAIRPSLARNPLMLAQRGSPASRKGGPVRYRG---FSVRAVLGNRNN  59

Query  309  TVNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSS  488
             V+R+E LLNLD+ P+T KIIAEYIWIGGSGID RSKSRTIS+PV  PSELPKWNYDGSS
Sbjct  60   AVSRLEDLLNLDLNPHTEKIIAEYIWIGGSGIDVRSKSRTISRPVDDPSELPKWNYDGSS  119

Query  489  TGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKV  668
            TGQAPGEDSEVILYPQAIFKDPFRGGNNILV+CD Y P GEPIPTNKR+RAAQIFSDPKV
Sbjct  120  TGQAPGEDSEVILYPQAIFKDPFRGGNNILVMCDAYKPNGEPIPTNKRYRAAQIFSDPKV  179

Query  669  VSEVPWYGIEQEYTLLQQNVKWPL  740
            V+EVPW+GIEQEYTLLQ NV WPL
Sbjct  180  VAEVPWFGIEQEYTLLQPNVNWPL  203



>gb|AHJ10961.1| chloroplast glutamine synthetase 2 isoform 1 [Lemna minor]
Length=424

 Score =   252 bits (643),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 139/204 (68%), Positives = 157/204 (77%), Gaps = 5/204 (2%)
 Frame = +3

Query  135  AQILAPSAQWQMRMTKNLTEA-TPMASKMWGSVVMKPNKRVAVKSTAKFRVFA-LQSGNS  308
            AQI APS + +  +    + A  P+     GS   +    V  +    F V A L + N+
Sbjct  3    AQIPAPSLRCERSIAIRPSLARNPLMLAQRGSPASRKGGPVRYRG---FSVRAVLGNRNN  59

Query  309  TVNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSS  488
             V+R+E LLNLD+ P+T KIIAEYIWIGGSGID RSKSRTIS+PV  PSELPKWNYDGSS
Sbjct  60   AVSRLEDLLNLDLNPHTEKIIAEYIWIGGSGIDVRSKSRTISRPVDDPSELPKWNYDGSS  119

Query  489  TGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKV  668
            TGQAPGEDSEVILYPQAIFKDPFRGGNNILV+CD Y P GEPIPTNKR+RAAQIFSDPKV
Sbjct  120  TGQAPGEDSEVILYPQAIFKDPFRGGNNILVMCDAYKPNGEPIPTNKRYRAAQIFSDPKV  179

Query  669  VSEVPWYGIEQEYTLLQQNVKWPL  740
            V+EVPW+GIEQEYTLLQ NV WPL
Sbjct  180  VAEVPWFGIEQEYTLLQPNVNWPL  203



>gb|AAT46062.1| glutamine synthetase GS2 [Apium graveolens Dulce Group]
Length=150

 Score =   241 bits (614),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 111/125 (89%), Positives = 119/125 (95%), Gaps = 0/125 (0%)
 Frame = +3

Query  366  IIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQAPGEDSEVILYPQAIF  545
             IAEYIWIGG+G+D RSKSRTISKPV+HPSELPKWNYDGSSTGQAPG+DSEVILYPQAIF
Sbjct  5    FIAEYIWIGGTGVDVRSKSRTISKPVEHPSELPKWNYDGSSTGQAPGDDSEVILYPQAIF  64

Query  546  KDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVVSEVPWYGIEQEYTLLQQN  725
            KDPFRGGNNILVICDTYTP GEPIPTNKRH+AAQIFSD KV+ EVPW+GIEQEYTL+QQN
Sbjct  65   KDPFRGGNNILVICDTYTPQGEPIPTNKRHKAAQIFSDAKVLGEVPWFGIEQEYTLMQQN  124

Query  726  VKWPL  740
            V WPL
Sbjct  125  VNWPL  129



>ref|XP_010492570.1| PREDICTED: glutamine synthetase cytosolic isozyme 1-4-like isoform 
X2 [Camelina sativa]
Length=272

 Score =   241 bits (616),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 110/143 (77%), Positives = 130/143 (91%), Gaps = 0/143 (0%)
 Frame = +3

Query  312  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  491
            ++ +  L+NLD++  T++IIAEYIWIGGSG+D RSK+RT+S PV+ PSELPKWNYDGSST
Sbjct  1    MSALADLINLDLSDSTDQIIAEYIWIGGSGLDMRSKARTLSGPVKDPSELPKWNYDGSST  60

Query  492  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVV  671
            GQAPG+DSEVILYPQAIFKDPFR GNNILV+CD YTPAGEPIPTNKRH AA+IFSDP VV
Sbjct  61   GQAPGDDSEVILYPQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRHAAAKIFSDPNVV  120

Query  672  SEVPWYGIEQEYTLLQQNVKWPL  740
            +EV WYGIEQEYTLLQ+++KWP+
Sbjct  121  AEVTWYGIEQEYTLLQKDIKWPV  143



>ref|XP_010419001.1| PREDICTED: glutamine synthetase cytosolic isozyme 1-2-like, partial 
[Camelina sativa]
Length=163

 Score =   237 bits (605),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 109/143 (76%), Positives = 128/143 (90%), Gaps = 0/143 (0%)
 Frame = +3

Query  312  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  491
            ++ +  L+NLD++  T KIIAEYIW+GGSG+D RSK+RT+S PV  PS+LPKWNYDGSST
Sbjct  1    MSLLADLVNLDLSDNTEKIIAEYIWVGGSGMDMRSKARTLSGPVTDPSKLPKWNYDGSST  60

Query  492  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVV  671
            GQAPG+DSEVIL+PQAIFKDPFR GNNILV+CD YTPAGEPIPTNKRH AA+IFS+P VV
Sbjct  61   GQAPGQDSEVILFPQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRHAAAEIFSNPDVV  120

Query  672  SEVPWYGIEQEYTLLQQNVKWPL  740
            +EVPWYGIEQEYTLLQ++V WPL
Sbjct  121  AEVPWYGIEQEYTLLQKDVNWPL  143



>ref|XP_010420355.1| PREDICTED: glutamine synthetase cytosolic isozyme 1-4 isoform 
X2 [Camelina sativa]
Length=355

 Score =   243 bits (621),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 110/143 (77%), Positives = 130/143 (91%), Gaps = 0/143 (0%)
 Frame = +3

Query  312  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  491
            ++ +  L+NLD++  T++IIAEYIWIGGSG+D RSK+RT+S PV+ PSELPKWNYDGSST
Sbjct  1    MSALADLINLDLSDSTDQIIAEYIWIGGSGLDMRSKARTLSGPVKDPSELPKWNYDGSST  60

Query  492  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVV  671
            GQAPG+DSEVILYPQAIFKDPFR GNNILV+CD YTPAGEPIPTNKRH AA+IFSDP VV
Sbjct  61   GQAPGDDSEVILYPQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRHAAAKIFSDPNVV  120

Query  672  SEVPWYGIEQEYTLLQQNVKWPL  740
            +EV WYGIEQEYTLLQ+++KWP+
Sbjct  121  AEVTWYGIEQEYTLLQKDIKWPV  143



>ref|XP_010492569.1| PREDICTED: glutamine synthetase cytosolic isozyme 1-4-like isoform 
X1 [Camelina sativa]
Length=356

 Score =   243 bits (620),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 110/143 (77%), Positives = 130/143 (91%), Gaps = 0/143 (0%)
 Frame = +3

Query  312  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  491
            ++ +  L+NLD++  T++IIAEYIWIGGSG+D RSK+RT+S PV+ PSELPKWNYDGSST
Sbjct  1    MSALADLINLDLSDSTDQIIAEYIWIGGSGLDMRSKARTLSGPVKDPSELPKWNYDGSST  60

Query  492  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVV  671
            GQAPG+DSEVILYPQAIFKDPFR GNNILV+CD YTPAGEPIPTNKRH AA+IFSDP VV
Sbjct  61   GQAPGDDSEVILYPQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRHAAAKIFSDPNVV  120

Query  672  SEVPWYGIEQEYTLLQQNVKWPL  740
            +EV WYGIEQEYTLLQ+++KWP+
Sbjct  121  AEVTWYGIEQEYTLLQKDIKWPV  143



>ref|XP_010420354.1| PREDICTED: glutamine synthetase cytosolic isozyme 1-4 isoform 
X1 [Camelina sativa]
Length=356

 Score =   243 bits (620),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 110/143 (77%), Positives = 130/143 (91%), Gaps = 0/143 (0%)
 Frame = +3

Query  312  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  491
            ++ +  L+NLD++  T++IIAEYIWIGGSG+D RSK+RT+S PV+ PSELPKWNYDGSST
Sbjct  1    MSALADLINLDLSDSTDQIIAEYIWIGGSGLDMRSKARTLSGPVKDPSELPKWNYDGSST  60

Query  492  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVV  671
            GQAPG+DSEVILYPQAIFKDPFR GNNILV+CD YTPAGEPIPTNKRH AA+IFSDP VV
Sbjct  61   GQAPGDDSEVILYPQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRHAAAKIFSDPNVV  120

Query  672  SEVPWYGIEQEYTLLQQNVKWPL  740
            +EV WYGIEQEYTLLQ+++KWP+
Sbjct  121  AEVTWYGIEQEYTLLQKDIKWPV  143



>dbj|BAA04995.1| glutamine synthetase [Raphanus sativus]
Length=356

 Score =   243 bits (619),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 112/140 (80%), Positives = 127/140 (91%), Gaps = 0/140 (0%)
 Frame = +3

Query  321  IEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  500
            +  L+NLD++  T KIIAEYIW+GGSG+D RSK+RT+S PV  PS+LPKWNYDGSSTGQA
Sbjct  4    LTDLINLDLSDNTEKIIAEYIWVGGSGMDMRSKARTLSGPVTDPSQLPKWNYDGSSTGQA  63

Query  501  PGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVVSEV  680
            PGEDSEVILYPQAIFKDPFR GN+ILV+CDTYTPAGEPIPTNKRH AAQIFS P VV+EV
Sbjct  64   PGEDSEVILYPQAIFKDPFRRGNHILVMCDTYTPAGEPIPTNKRHAAAQIFSHPDVVAEV  123

Query  681  PWYGIEQEYTLLQQNVKWPL  740
            PWYGIEQEYTLLQ++VKWP+
Sbjct  124  PWYGIEQEYTLLQKDVKWPV  143



>gb|ACF42116.1| cytosolic glutamine synthetase [Brassica oleracea var. italica]
Length=356

 Score =   243 bits (619),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 112/140 (80%), Positives = 127/140 (91%), Gaps = 0/140 (0%)
 Frame = +3

Query  321  IEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  500
            +  L+NLD++  T KIIAEYIW+GGSG+D RSK+RT+  PV  PS+LPKWNYDGSSTGQA
Sbjct  4    LTDLVNLDLSDNTEKIIAEYIWVGGSGMDMRSKARTLPGPVTDPSKLPKWNYDGSSTGQA  63

Query  501  PGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVVSEV  680
            PGEDSEVILYPQAIFKDPFR GNNILV+CDTYTPAGEPIPTNKRH AAQIFS+P VV+EV
Sbjct  64   PGEDSEVILYPQAIFKDPFRRGNNILVMCDTYTPAGEPIPTNKRHAAAQIFSNPDVVAEV  123

Query  681  PWYGIEQEYTLLQQNVKWPL  740
            PWYGIEQEYTLLQ++VKWP+
Sbjct  124  PWYGIEQEYTLLQKDVKWPV  143



>gb|EYU24513.1| hypothetical protein MIMGU_mgv1a008973mg [Erythranthe guttata]
Length=356

 Score =   243 bits (619),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 111/140 (79%), Positives = 127/140 (91%), Gaps = 0/140 (0%)
 Frame = +3

Query  321  IEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  500
            +  L+NLD++  T K IAEYIWIGGSG+D RSK+RT S P++HPSELPKWNYDGSSTGQA
Sbjct  4    LSDLINLDLSDTTEKTIAEYIWIGGSGMDLRSKARTFSGPIKHPSELPKWNYDGSSTGQA  63

Query  501  PGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVVSEV  680
            PGEDSEVILYPQAIF DPFR GN+ILV+CDTYTPAGEPIPTNKR+ AAQIFS+P+V +EV
Sbjct  64   PGEDSEVILYPQAIFPDPFRRGNHILVMCDTYTPAGEPIPTNKRYGAAQIFSNPEVAAEV  123

Query  681  PWYGIEQEYTLLQQNVKWPL  740
            PWYGIEQEYTLLQ++VKWPL
Sbjct  124  PWYGIEQEYTLLQKDVKWPL  143



>emb|CAA73063.1| cytosolic glutamine synthetase [Brassica napus]
 gb|ACF42115.1| cytosolic glutamine synthetase [Brassica oleracea var. botrytis]
 emb|CDY52941.1| BnaCnng23850D [Brassica napus]
Length=356

 Score =   242 bits (618),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 112/140 (80%), Positives = 127/140 (91%), Gaps = 0/140 (0%)
 Frame = +3

Query  321  IEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  500
            +  L+NLD++  T KIIAEYIW+GGSG+D RSK+RT+  PV  PS+LPKWNYDGSSTGQA
Sbjct  4    LTDLVNLDLSDNTEKIIAEYIWVGGSGMDMRSKARTLPGPVTDPSKLPKWNYDGSSTGQA  63

Query  501  PGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVVSEV  680
            PGEDSEVILYPQAIFKDPFR GNNILV+CDTYTPAGEPIPTNKRH AAQIFS+P VV+EV
Sbjct  64   PGEDSEVILYPQAIFKDPFRRGNNILVMCDTYTPAGEPIPTNKRHAAAQIFSNPDVVAEV  123

Query  681  PWYGIEQEYTLLQQNVKWPL  740
            PWYGIEQEYTLLQ++VKWP+
Sbjct  124  PWYGIEQEYTLLQKDVKWPV  143



>ref|NP_001267644.1| glutamine synthetase cytosolic isozyme-like [Cucumis sativus]
 gb|AEZ56958.1| glutamine synthetase [Cucumis sativus]
 gb|KGN57792.1| hypothetical protein Csa_3G304140 [Cucumis sativus]
Length=356

 Score =   242 bits (617),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 111/140 (79%), Positives = 127/140 (91%), Gaps = 0/140 (0%)
 Frame = +3

Query  321  IEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  500
            +  L+NL+++  T KIIAEYIWIGGSG+D RSK+RT+S PV  PS+LPKWNYDGSSTGQA
Sbjct  4    LSDLVNLNLSDSTEKIIAEYIWIGGSGMDLRSKARTLSGPVSDPSKLPKWNYDGSSTGQA  63

Query  501  PGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVVSEV  680
            PGEDSEVILYPQAIF+DPFR GNNILV+CDTYTPAGEPIPTNKRH AA+IFS P VV+EV
Sbjct  64   PGEDSEVILYPQAIFRDPFRRGNNILVVCDTYTPAGEPIPTNKRHAAAKIFSHPDVVAEV  123

Query  681  PWYGIEQEYTLLQQNVKWPL  740
            PWYGIEQEYTLLQ++VKWP+
Sbjct  124  PWYGIEQEYTLLQKDVKWPI  143



>ref|XP_010453820.1| PREDICTED: glutamine synthetase cytosolic isozyme 1-4-like [Camelina 
sativa]
Length=356

 Score =   241 bits (616),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 109/143 (76%), Positives = 130/143 (91%), Gaps = 0/143 (0%)
 Frame = +3

Query  312  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  491
            ++ +  L+NLD++  T++IIAEYIWIGGSG+D RSK+RT+S PV+ PSELPKWNYDGSST
Sbjct  1    MSALADLINLDLSDSTDQIIAEYIWIGGSGLDMRSKARTLSGPVKDPSELPKWNYDGSST  60

Query  492  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVV  671
            GQAPG+DSEVILYPQAIF+DPFR GNNILV+CD YTPAGEPIPTNKRH AA+IFSDP VV
Sbjct  61   GQAPGDDSEVILYPQAIFQDPFRRGNNILVMCDAYTPAGEPIPTNKRHAAAKIFSDPNVV  120

Query  672  SEVPWYGIEQEYTLLQQNVKWPL  740
            +EV WYGIEQEYTLLQ+++KWP+
Sbjct  121  AEVTWYGIEQEYTLLQKDIKWPV  143



>ref|XP_010435596.1| PREDICTED: glutamine synthetase cytosolic isozyme 1-1-like isoform 
X2 [Camelina sativa]
Length=276

 Score =   239 bits (609),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 109/143 (76%), Positives = 130/143 (91%), Gaps = 0/143 (0%)
 Frame = +3

Query  312  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  491
            ++ +  L+NL+++  T+KIIAEYIW+GGSG+D RSK+RT+S PV+ PSELPKWNYDGSST
Sbjct  1    MSNLSDLVNLNLSDTTDKIIAEYIWVGGSGMDMRSKARTLSGPVKDPSELPKWNYDGSST  60

Query  492  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVV  671
            GQAPGEDSEVILYPQAIFKDPFR GNNILV+C+ YTPAGEPIPTNKRH AA++FS P VV
Sbjct  61   GQAPGEDSEVILYPQAIFKDPFRRGNNILVMCNAYTPAGEPIPTNKRHAAAKVFSHPDVV  120

Query  672  SEVPWYGIEQEYTLLQQNVKWPL  740
            +EVPWYGIEQEYTLLQ++VKWP+
Sbjct  121  AEVPWYGIEQEYTLLQKDVKWPV  143



>ref|XP_006391364.1| hypothetical protein EUTSA_v10018774mg [Eutrema salsugineum]
 gb|ESQ28650.1| hypothetical protein EUTSA_v10018774mg [Eutrema salsugineum]
Length=356

 Score =   241 bits (616),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 111/140 (79%), Positives = 126/140 (90%), Gaps = 0/140 (0%)
 Frame = +3

Query  321  IEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  500
            +  L+NLD++  T KIIAEYIW+GGSG+D RSK+RT+  PV  PS+LPKWNYDGSSTGQA
Sbjct  4    LTDLINLDLSDSTEKIIAEYIWVGGSGMDMRSKARTLPGPVTDPSKLPKWNYDGSSTGQA  63

Query  501  PGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVVSEV  680
            PGEDSEVILYPQAIFKDPFR GNNILV+CD YTPAGEPIPTNKRH AAQIFS+P VV+EV
Sbjct  64   PGEDSEVILYPQAIFKDPFRKGNNILVMCDAYTPAGEPIPTNKRHAAAQIFSNPAVVAEV  123

Query  681  PWYGIEQEYTLLQQNVKWPL  740
            PWYGIEQEYTLLQ++VKWP+
Sbjct  124  PWYGIEQEYTLLQKDVKWPV  143



>gb|AHJ10960.1| cytosolic glutamine synthetase 1 isoform 2 [Lemna minor]
Length=356

 Score =   241 bits (615),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 112/140 (80%), Positives = 125/140 (89%), Gaps = 0/140 (0%)
 Frame = +3

Query  321  IEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  500
            +  L NL++T  T KIIAEYIWIGGSG+D RSK+RTISKPV  P ELPKWNYDGSSTGQA
Sbjct  4    LTDLQNLNLTETTEKIIAEYIWIGGSGLDMRSKARTISKPVSDPKELPKWNYDGSSTGQA  63

Query  501  PGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVVSEV  680
            PGEDSEVILYPQAIF+DPFR GNNILV+CD YTPAGEPIPTNKR+RA+QIFSDP VV+E 
Sbjct  64   PGEDSEVILYPQAIFRDPFRKGNNILVMCDCYTPAGEPIPTNKRYRASQIFSDPAVVAEE  123

Query  681  PWYGIEQEYTLLQQNVKWPL  740
             WYG+EQEYTLLQ++VKWPL
Sbjct  124  TWYGLEQEYTLLQKDVKWPL  143



>ref|XP_010470494.1| PREDICTED: glutamine synthetase cytosolic isozyme 1-2-like isoform 
X2 [Camelina sativa]
Length=275

 Score =   238 bits (608),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 110/143 (77%), Positives = 128/143 (90%), Gaps = 0/143 (0%)
 Frame = +3

Query  312  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  491
            ++ +  L+NLD++  T KIIAEYIW+GGSG+D RSK+RT+S PV  PS+LPKWNYDGSST
Sbjct  1    MSLLADLVNLDLSDNTEKIIAEYIWVGGSGMDMRSKARTLSGPVTDPSKLPKWNYDGSST  60

Query  492  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVV  671
            GQAPG+DSEVILYPQAIFKDPFR GNNILV+CD YTPAGEPIPTNKRH AA+IFS+P VV
Sbjct  61   GQAPGQDSEVILYPQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRHAAAEIFSNPDVV  120

Query  672  SEVPWYGIEQEYTLLQQNVKWPL  740
            +EVPWYGIEQEYTLLQ++V WPL
Sbjct  121  AEVPWYGIEQEYTLLQKDVNWPL  143



>gb|KDP25795.1| hypothetical protein JCGZ_22517 [Jatropha curcas]
Length=356

 Score =   241 bits (615),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 110/140 (79%), Positives = 127/140 (91%), Gaps = 0/140 (0%)
 Frame = +3

Query  321  IEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  500
            +  L+NL+++  T+KIIAEYIWIGGSG+D RSK+RT+S PV  PS+LPKWNYDGSSTGQA
Sbjct  4    LSDLINLNLSETTDKIIAEYIWIGGSGMDLRSKARTLSGPVSDPSKLPKWNYDGSSTGQA  63

Query  501  PGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVVSEV  680
            PGEDSEVILYPQAIF+DPFR GNNILVICD YTPAGEPIPTNKRH AA+IFS P VV+EV
Sbjct  64   PGEDSEVILYPQAIFRDPFRRGNNILVICDAYTPAGEPIPTNKRHAAAKIFSHPDVVAEV  123

Query  681  PWYGIEQEYTLLQQNVKWPL  740
            PWYGIEQEYTLLQ+++KWP+
Sbjct  124  PWYGIEQEYTLLQKDIKWPI  143



>gb|KFK25875.1| hypothetical protein AALP_AA8G173600 [Arabis alpina]
Length=356

 Score =   241 bits (614),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 110/143 (77%), Positives = 128/143 (90%), Gaps = 0/143 (0%)
 Frame = +3

Query  312  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  491
            ++ +  L+NLD++  TN+IIAEYIWIGGSGID RSK+RT++ PV+ PSELPKWNYDGSST
Sbjct  1    MSALADLINLDLSDSTNQIIAEYIWIGGSGIDMRSKARTLAGPVKDPSELPKWNYDGSST  60

Query  492  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVV  671
            GQAPG DSEVILYPQAIFKDPFR GNNILV+CD YTPAGEPIPTNKRH AA+IFSDP VV
Sbjct  61   GQAPGNDSEVILYPQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRHAAAKIFSDPTVV  120

Query  672  SEVPWYGIEQEYTLLQQNVKWPL  740
            +E  WYGIEQEYTLLQ+++KWP+
Sbjct  121  AEETWYGIEQEYTLLQKDIKWPV  143



>ref|XP_010440874.1| PREDICTED: glutamine synthetase cytosolic isozyme 1-1 [Camelina 
sativa]
Length=356

 Score =   241 bits (614),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 109/143 (76%), Positives = 130/143 (91%), Gaps = 0/143 (0%)
 Frame = +3

Query  312  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  491
            ++ +  L+NL+++  T+KIIAEYIW+GGSG+D RSK+RT+S PV+ PSELPKWNYDGSST
Sbjct  1    MSNLSDLVNLNLSDTTDKIIAEYIWVGGSGMDMRSKARTLSGPVKDPSELPKWNYDGSST  60

Query  492  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVV  671
            GQAPGEDSEVILYPQAIFKDPFR G+NILV+CD YTPAGEPIPTNKRH AA++FS P VV
Sbjct  61   GQAPGEDSEVILYPQAIFKDPFRRGDNILVMCDAYTPAGEPIPTNKRHAAAKVFSHPDVV  120

Query  672  SEVPWYGIEQEYTLLQQNVKWPL  740
            +EVPWYGIEQEYTLLQ++VKWP+
Sbjct  121  AEVPWYGIEQEYTLLQKDVKWPV  143



>ref|XP_011001555.1| PREDICTED: glutamine synthetase cytosolic isozyme 1-like [Populus 
euphratica]
Length=356

 Score =   241 bits (614),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 111/140 (79%), Positives = 126/140 (90%), Gaps = 0/140 (0%)
 Frame = +3

Query  321  IEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  500
            +  L+NLD++  T KIIAEYIW+GGSG+D RSK RT+S PV  PS+LPKWNYDGSSTGQA
Sbjct  4    LSDLINLDLSDSTEKIIAEYIWVGGSGMDIRSKGRTLSGPVSDPSKLPKWNYDGSSTGQA  63

Query  501  PGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVVSEV  680
            PGEDSEVILYPQAIFKDPFR GNNILVICDTYTPAGEPIPTNKR +AA+IFS P VV+EV
Sbjct  64   PGEDSEVILYPQAIFKDPFRRGNNILVICDTYTPAGEPIPTNKRCKAAKIFSHPDVVAEV  123

Query  681  PWYGIEQEYTLLQQNVKWPL  740
            PW+G+EQEYTLLQ++VKWPL
Sbjct  124  PWFGLEQEYTLLQKDVKWPL  143



>emb|CAA54151.1| glutamine [Brassica napus]
 gb|AAX35342.1| glutamine synthetase [Brassica rapa subsp. pekinensis]
 emb|CDY16439.1| BnaA02g12430D [Brassica napus]
Length=356

 Score =   240 bits (613),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 111/140 (79%), Positives = 126/140 (90%), Gaps = 0/140 (0%)
 Frame = +3

Query  321  IEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  500
            +  L+NLD++  T KIIAEYIW+GGSG+D RSK+RT+  PV  PS+LPKWNYDGSSTGQA
Sbjct  4    LTDLVNLDLSDNTEKIIAEYIWVGGSGMDMRSKARTLPGPVTDPSKLPKWNYDGSSTGQA  63

Query  501  PGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVVSEV  680
            PGEDSEVILYPQAIFKDPFR GNNILV+CDTYTPAGEPIPTNKRH AAQIFS+P VV+EV
Sbjct  64   PGEDSEVILYPQAIFKDPFRRGNNILVMCDTYTPAGEPIPTNKRHAAAQIFSNPDVVAEV  123

Query  681  PWYGIEQEYTLLQQNVKWPL  740
            PWYGIEQEYTLLQ++V WP+
Sbjct  124  PWYGIEQEYTLLQKDVNWPV  143



>gb|ACD13217.1| glutamine synthetase [Brassica rapa subsp. chinensis]
Length=356

 Score =   240 bits (613),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 111/140 (79%), Positives = 126/140 (90%), Gaps = 0/140 (0%)
 Frame = +3

Query  321  IEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  500
            +  L+NLD++  T KIIAEYIW+GGSG+D RSK+RT+  PV  PS+LPKWNYDGSSTGQA
Sbjct  4    LTDLVNLDLSDNTEKIIAEYIWVGGSGMDMRSKARTLPGPVTDPSKLPKWNYDGSSTGQA  63

Query  501  PGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVVSEV  680
            PGEDSEVILYPQAIFKDPFR GNNILV+CDTYTPAGEPIPTNKRH AAQIFS+P VV+EV
Sbjct  64   PGEDSEVILYPQAIFKDPFRRGNNILVMCDTYTPAGEPIPTNKRHAAAQIFSNPDVVAEV  123

Query  681  PWYGIEQEYTLLQQNVKWPL  740
            PWYGIEQEYTLLQ++V WP+
Sbjct  124  PWYGIEQEYTLLQKDVNWPV  143



>gb|AFK46766.1| unknown [Medicago truncatula]
Length=211

 Score =   235 bits (600),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 108/143 (76%), Positives = 126/143 (88%), Gaps = 0/143 (0%)
 Frame = +3

Query  312  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  491
            ++ +  L+NLD++  T KIIAEYIWIGGSG+D RSK+RT+  PV  PS+LPKWNYDGSST
Sbjct  1    MSLLSDLINLDLSETTEKIIAEYIWIGGSGLDLRSKARTLPGPVTDPSQLPKWNYDGSST  60

Query  492  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVV  671
            GQAPGEDSEVI+YPQAIFKDPFR GNNILV+CD YTPAGEPIPTNKRH AA++FS P VV
Sbjct  61   GQAPGEDSEVIIYPQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRHAAAKVFSHPDVV  120

Query  672  SEVPWYGIEQEYTLLQQNVKWPL  740
            +EVPWYGIEQEYTLLQ+++ WPL
Sbjct  121  AEVPWYGIEQEYTLLQKDINWPL  143



>ref|XP_006288043.1| hypothetical protein CARUB_v10001277mg [Capsella rubella]
 gb|EOA20941.1| hypothetical protein CARUB_v10001277mg [Capsella rubella]
Length=356

 Score =   240 bits (613),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 109/140 (78%), Positives = 127/140 (91%), Gaps = 0/140 (0%)
 Frame = +3

Query  321  IEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  500
            +  L+NLD++  T++IIAEYIWIGGSG+D RSK+RT+S PV+ PSELPKWNYDGSSTGQA
Sbjct  4    LADLINLDLSDSTDQIIAEYIWIGGSGLDMRSKARTLSGPVKDPSELPKWNYDGSSTGQA  63

Query  501  PGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVVSEV  680
            PG+DSEVILYPQAIFKDPFR GNNILV+CD YTPAGEPIPTNKRH AA+IFSDP VV+E 
Sbjct  64   PGDDSEVILYPQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRHAAAKIFSDPNVVAEE  123

Query  681  PWYGIEQEYTLLQQNVKWPL  740
             WYGIEQEYTLLQ+++KWP+
Sbjct  124  TWYGIEQEYTLLQKDIKWPV  143



>ref|XP_010415164.1| PREDICTED: glutamine synthetase cytosolic isozyme 1-2-like isoform 
X3 [Camelina sativa]
Length=276

 Score =   238 bits (606),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 109/143 (76%), Positives = 128/143 (90%), Gaps = 0/143 (0%)
 Frame = +3

Query  312  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  491
            ++ +  L+NLD++  T KIIAEYIW+GGSG+D RSK+RT+S PV  PS+LPKWNYDGSST
Sbjct  1    MSLLADLVNLDLSDNTEKIIAEYIWVGGSGMDMRSKARTLSGPVTDPSKLPKWNYDGSST  60

Query  492  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVV  671
            GQAPG+DSEVIL+PQAIFKDPFR GNNILV+CD YTPAGEPIPTNKRH AA+IFS+P VV
Sbjct  61   GQAPGQDSEVILFPQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRHAAAEIFSNPDVV  120

Query  672  SEVPWYGIEQEYTLLQQNVKWPL  740
            +EVPWYGIEQEYTLLQ++V WPL
Sbjct  121  AEVPWYGIEQEYTLLQKDVNWPL  143



>ref|XP_010435595.1| PREDICTED: glutamine synthetase cytosolic isozyme 1-1-like isoform 
X1 [Camelina sativa]
Length=356

 Score =   240 bits (612),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 109/143 (76%), Positives = 130/143 (91%), Gaps = 0/143 (0%)
 Frame = +3

Query  312  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  491
            ++ +  L+NL+++  T+KIIAEYIW+GGSG+D RSK+RT+S PV+ PSELPKWNYDGSST
Sbjct  1    MSNLSDLVNLNLSDTTDKIIAEYIWVGGSGMDMRSKARTLSGPVKDPSELPKWNYDGSST  60

Query  492  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVV  671
            GQAPGEDSEVILYPQAIFKDPFR GNNILV+C+ YTPAGEPIPTNKRH AA++FS P VV
Sbjct  61   GQAPGEDSEVILYPQAIFKDPFRRGNNILVMCNAYTPAGEPIPTNKRHAAAKVFSHPDVV  120

Query  672  SEVPWYGIEQEYTLLQQNVKWPL  740
            +EVPWYGIEQEYTLLQ++VKWP+
Sbjct  121  AEVPWYGIEQEYTLLQKDVKWPV  143



>emb|CAA73064.1| cytosolic glutamine synthetase [Brassica napus]
Length=349

 Score =   240 bits (612),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 109/136 (80%), Positives = 125/136 (92%), Gaps = 0/136 (0%)
 Frame = +3

Query  333  LNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQAPGED  512
            +NL+++  T+KIIAEYIW+GGSG+D RSK+RT+  PV  PSELPKWNYDGSSTGQAPGED
Sbjct  1    VNLNLSETTDKIIAEYIWVGGSGMDMRSKARTLPGPVSDPSELPKWNYDGSSTGQAPGED  60

Query  513  SEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVVSEVPWYG  692
            SEVILYPQAIFKDPFRGGNNILV+CD YTPAGEPIPTNKRH AA++FS P VV+EVPWYG
Sbjct  61   SEVILYPQAIFKDPFRGGNNILVMCDAYTPAGEPIPTNKRHAAAKVFSHPDVVAEVPWYG  120

Query  693  IEQEYTLLQQNVKWPL  740
            IEQEYTLLQ++VKWP+
Sbjct  121  IEQEYTLLQKDVKWPV  136



>ref|XP_010103463.1| Glutamine synthetase nodule isozyme [Morus notabilis]
 gb|EXB95908.1| Glutamine synthetase nodule isozyme [Morus notabilis]
Length=356

 Score =   240 bits (612),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 111/140 (79%), Positives = 124/140 (89%), Gaps = 0/140 (0%)
 Frame = +3

Query  321  IEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  500
            +  L+NL+++  T KIIAEYIWIGGSG+D RSK+RT+  PV  PS+LPKWNYDGSSTGQA
Sbjct  4    LSDLVNLNLSDTTEKIIAEYIWIGGSGLDVRSKARTLPGPVSDPSKLPKWNYDGSSTGQA  63

Query  501  PGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVVSEV  680
            PGEDSEVILYPQAIFKDPFRGGNNILVICD YTPAGEPIPTNKRH AA+IFS P V +E 
Sbjct  64   PGEDSEVILYPQAIFKDPFRGGNNILVICDAYTPAGEPIPTNKRHAAAKIFSHPDVAAEE  123

Query  681  PWYGIEQEYTLLQQNVKWPL  740
            PWYGIEQEYTLLQ++VKWPL
Sbjct  124  PWYGIEQEYTLLQKDVKWPL  143



>ref|XP_010470493.1| PREDICTED: glutamine synthetase cytosolic isozyme 1-2-like isoform 
X1 [Camelina sativa]
Length=356

 Score =   240 bits (612),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 110/140 (79%), Positives = 126/140 (90%), Gaps = 0/140 (0%)
 Frame = +3

Query  321  IEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  500
            +  L+NLD++  T KIIAEYIW+GGSG+D RSK+RT+S PV  PS+LPKWNYDGSSTGQA
Sbjct  4    LADLVNLDLSDNTEKIIAEYIWVGGSGMDMRSKARTLSGPVTDPSKLPKWNYDGSSTGQA  63

Query  501  PGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVVSEV  680
            PG+DSEVILYPQAIFKDPFR GNNILV+CD YTPAGEPIPTNKRH AA+IFS+P VV+EV
Sbjct  64   PGQDSEVILYPQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRHAAAEIFSNPDVVAEV  123

Query  681  PWYGIEQEYTLLQQNVKWPL  740
            PWYGIEQEYTLLQ++V WPL
Sbjct  124  PWYGIEQEYTLLQKDVNWPL  143



>ref|XP_010450519.1| PREDICTED: glutamine synthetase cytosolic isozyme 1-1-like isoform 
X2 [Camelina sativa]
Length=276

 Score =   237 bits (605),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 108/143 (76%), Positives = 129/143 (90%), Gaps = 0/143 (0%)
 Frame = +3

Query  312  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  491
            ++ +  L+NL+++  T+KIIAEYIW+GGSG+D RSK+RT+S  V+ PS+LPKWNYDGSST
Sbjct  1    MSNLSDLVNLNLSDTTDKIIAEYIWVGGSGMDMRSKARTLSGSVKDPSDLPKWNYDGSST  60

Query  492  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVV  671
            GQAPGEDSEVILYPQAIFKDPFR GNNILV+CD YTPAGEPIPTNKRH AA++FS P VV
Sbjct  61   GQAPGEDSEVILYPQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRHAAAKVFSHPDVV  120

Query  672  SEVPWYGIEQEYTLLQQNVKWPL  740
            +EVPWYGIEQEYTLLQ++VKWP+
Sbjct  121  AEVPWYGIEQEYTLLQKDVKWPV  143



>emb|CDY49656.1| BnaC09g41340D [Brassica napus]
Length=356

 Score =   239 bits (611),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 109/143 (76%), Positives = 126/143 (88%), Gaps = 0/143 (0%)
 Frame = +3

Query  312  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  491
            ++ +  L+NLD++ YT KIIAEYIWIGGSG+D RSK+RT+  PV+ PSELPKWNYDGSST
Sbjct  1    MSALADLINLDLSDYTEKIIAEYIWIGGSGLDMRSKARTLPGPVKDPSELPKWNYDGSST  60

Query  492  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVV  671
            GQAPG DSEVILYPQAIFKDPFR GNNILV+CD YTPAGEPIPTNKRH AA+IFSDP V 
Sbjct  61   GQAPGSDSEVILYPQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRHAAAKIFSDPSVA  120

Query  672  SEVPWYGIEQEYTLLQQNVKWPL  740
            +E  WYGIEQEYTLLQ+++KWP+
Sbjct  121  AEETWYGIEQEYTLLQKDIKWPV  143



>ref|XP_009127475.1| PREDICTED: glutamine synthetase cytosolic isozyme 1-2 isoform 
X2 [Brassica rapa]
Length=272

 Score =   237 bits (604),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 111/143 (78%), Positives = 127/143 (89%), Gaps = 0/143 (0%)
 Frame = +3

Query  312  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  491
            ++ +  L+NLD++  T KIIAEYIW GGSG+D RSK+RT+  PV  PS+LPKWNYDGSST
Sbjct  1    MSLLTDLVNLDLSDNTEKIIAEYIWGGGSGMDMRSKARTLPGPVTDPSKLPKWNYDGSST  60

Query  492  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVV  671
            GQAPGEDSEVILYPQAIFKDPFR GNNILV+CDTYTPAGEPIPTNKRH AAQIFS+P VV
Sbjct  61   GQAPGEDSEVILYPQAIFKDPFRRGNNILVMCDTYTPAGEPIPTNKRHAAAQIFSNPDVV  120

Query  672  SEVPWYGIEQEYTLLQQNVKWPL  740
            +EVPWYGIEQEYTLLQ++V WP+
Sbjct  121  AEVPWYGIEQEYTLLQKDVNWPV  143



>gb|AAB61597.1| glutamine synthetase [Hevea brasiliensis]
Length=356

 Score =   239 bits (610),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 110/140 (79%), Positives = 126/140 (90%), Gaps = 0/140 (0%)
 Frame = +3

Query  321  IEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  500
            +  L+NL+++  T+KIIAEYIWIGGSG+D RSK+RT+S PV  PS+LPKWNYDGSSTGQA
Sbjct  4    LSDLINLNLSDTTDKIIAEYIWIGGSGMDMRSKARTLSGPVSDPSKLPKWNYDGSSTGQA  63

Query  501  PGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVVSEV  680
            PGEDSEVILYPQAIFKDPFR GNNILV+CD YTPAGEPIPTNKRH AA+IFS P VV+E 
Sbjct  64   PGEDSEVILYPQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRHAAAKIFSHPDVVAEE  123

Query  681  PWYGIEQEYTLLQQNVKWPL  740
            PWYGIEQEYTLLQ++VKWP+
Sbjct  124  PWYGIEQEYTLLQRDVKWPI  143



>gb|AGC24244.1| glutamine synthetase 1, partial [Brassica napus]
Length=137

 Score =   231 bits (590),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 106/133 (80%), Positives = 119/133 (89%), Gaps = 0/133 (0%)
 Frame = +3

Query  342  DVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQAPGEDSEV  521
            D++ YT KIIAEYIWIGGSG+D RSK+RT+  PV+ PSELPKWNYDGSSTGQAPG DSEV
Sbjct  4    DLSDYTEKIIAEYIWIGGSGLDMRSKARTLPGPVKDPSELPKWNYDGSSTGQAPGSDSEV  63

Query  522  ILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVVSEVPWYGIEQ  701
            ILYPQAIFKDPFR GNNILV+CD YTPAGEPIPTNKRH AA+IFSDP V +E  WYGIEQ
Sbjct  64   ILYPQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRHAAAKIFSDPSVAAEETWYGIEQ  123

Query  702  EYTLLQQNVKWPL  740
            EYTLLQ+++KWP+
Sbjct  124  EYTLLQKDIKWPV  136



>ref|XP_009785976.1| PREDICTED: glutamine synthetase isoform X1 [Nicotiana sylvestris]
Length=356

 Score =   239 bits (610),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 110/140 (79%), Positives = 125/140 (89%), Gaps = 0/140 (0%)
 Frame = +3

Query  321  IEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  500
            +  L+NL+++  T KIIAEYIWIGGSG+D RSK+RT+S PV  PSELPKWNYDGSSTGQA
Sbjct  4    LSDLINLNLSDSTQKIIAEYIWIGGSGMDLRSKARTLSGPVTDPSELPKWNYDGSSTGQA  63

Query  501  PGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVVSEV  680
            PGEDSEVILYPQAIFKDPFR GNNILV+CD YTPAGEPIPTNKRH AA+IFS+P VV+E 
Sbjct  64   PGEDSEVILYPQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRHAAAKIFSNPDVVAEE  123

Query  681  PWYGIEQEYTLLQQNVKWPL  740
            PWYGIEQEYTLLQ+++ WPL
Sbjct  124  PWYGIEQEYTLLQRDINWPL  143



>ref|XP_009370554.1| PREDICTED: glutamine synthetase cytosolic isozyme isoform X1 
[Pyrus x bretschneideri]
Length=356

 Score =   239 bits (610),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 112/140 (80%), Positives = 124/140 (89%), Gaps = 0/140 (0%)
 Frame = +3

Query  321  IEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  500
            +  L+NLD++  T KIIAEYIWIGGSG+D RSK+RT+  PV  PS+LPKWNYDGSSTGQA
Sbjct  4    LTDLINLDLSESTKKIIAEYIWIGGSGMDIRSKARTLPGPVSDPSKLPKWNYDGSSTGQA  63

Query  501  PGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVVSEV  680
            PGEDSEVILYPQAIFKDPFR GNNILVICDTYTP GEPIPTNKR  AA+IFS P VV+EV
Sbjct  64   PGEDSEVILYPQAIFKDPFRRGNNILVICDTYTPGGEPIPTNKRAAAAKIFSHPDVVAEV  123

Query  681  PWYGIEQEYTLLQQNVKWPL  740
            PWYGIEQEYTLLQ++VKWPL
Sbjct  124  PWYGIEQEYTLLQKDVKWPL  143



>ref|XP_006590378.1| PREDICTED: glutamine synthetase cytosolic isozyme 1 isoform X2 
[Glycine max]
Length=272

 Score =   236 bits (602),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 108/143 (76%), Positives = 127/143 (89%), Gaps = 0/143 (0%)
 Frame = +3

Query  312  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  491
            ++ +  L+NL+++  T K+IAEYIWIGGSG+D RSK+RT+  PV  PSELPKWNYDGSST
Sbjct  1    MSLLSDLINLNLSDTTEKVIAEYIWIGGSGMDLRSKARTLPGPVSDPSELPKWNYDGSST  60

Query  492  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVV  671
            GQAPGEDSEVILYPQAIF+DPFR GNNILVICD YTPAGEPIPTNKRH AA++FS P VV
Sbjct  61   GQAPGEDSEVILYPQAIFRDPFRRGNNILVICDAYTPAGEPIPTNKRHAAAKVFSHPDVV  120

Query  672  SEVPWYGIEQEYTLLQQNVKWPL  740
            +EVPWYGIEQEYTLLQ++++WPL
Sbjct  121  AEVPWYGIEQEYTLLQKDIQWPL  143



>ref|XP_009785977.1| PREDICTED: glutamine synthetase isoform X2 [Nicotiana sylvestris]
Length=356

 Score =   239 bits (609),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 110/140 (79%), Positives = 125/140 (89%), Gaps = 0/140 (0%)
 Frame = +3

Query  321  IEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  500
            +  L+NL+++  T KIIAEYIWIGGSG+D RSK+RT+S PV  PSELPKWNYDGSSTGQA
Sbjct  4    LSDLINLNLSDSTQKIIAEYIWIGGSGMDLRSKARTLSGPVTDPSELPKWNYDGSSTGQA  63

Query  501  PGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVVSEV  680
            PGEDSEVILYPQAIFKDPFR GNNILV+CD YTPAGEPIPTNKRH AA+IFS+P VV+E 
Sbjct  64   PGEDSEVILYPQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRHAAAKIFSNPDVVAEE  123

Query  681  PWYGIEQEYTLLQQNVKWPL  740
            PWYGIEQEYTLLQ+++ WPL
Sbjct  124  PWYGIEQEYTLLQRDINWPL  143



>gb|ACU15915.1| unknown [Glycine max]
Length=234

 Score =   234 bits (598),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 107/143 (75%), Positives = 126/143 (88%), Gaps = 0/143 (0%)
 Frame = +3

Query  312  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  491
            ++ +  L+NL+++    K+IAEYIWIGGSG+D RSK+RT+  PV  PSELPKWNYDGSST
Sbjct  1    MSLLSDLINLNLSDTIEKVIAEYIWIGGSGMDLRSKARTLPGPVSDPSELPKWNYDGSST  60

Query  492  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVV  671
            GQAPGEDSEVILYPQAIF+DPFR GNNILVICD YTPAGEPIPTNKRH AA++FS P VV
Sbjct  61   GQAPGEDSEVILYPQAIFRDPFRRGNNILVICDAYTPAGEPIPTNKRHAAAKVFSHPDVV  120

Query  672  SEVPWYGIEQEYTLLQQNVKWPL  740
            +EVPWYGIEQEYTLLQ++++WPL
Sbjct  121  AEVPWYGIEQEYTLLQKDIQWPL  143



>emb|CDY01727.1| BnaC04g30250D [Brassica napus]
Length=349

 Score =   238 bits (608),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 109/140 (78%), Positives = 126/140 (90%), Gaps = 0/140 (0%)
 Frame = +3

Query  321  IEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  500
            +  L+NL+++  T+KIIAEYIW+GGSG+D RSK+RT+  PV  PSELPKWNYDGSSTGQA
Sbjct  4    LTDLVNLNLSETTDKIIAEYIWVGGSGMDMRSKARTLPGPVSDPSELPKWNYDGSSTGQA  63

Query  501  PGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVVSEV  680
            PGEDSEVILYPQAIFKDPFR GNNILV+CD YTPAGEPIPTNKRH AA++FS P VV+EV
Sbjct  64   PGEDSEVILYPQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRHAAAKVFSHPDVVAEV  123

Query  681  PWYGIEQEYTLLQQNVKWPL  740
            PWYGIEQEYTLLQ++VKWP+
Sbjct  124  PWYGIEQEYTLLQKDVKWPV  143



>gb|AFW90613.1| glutamine synthetase GS1 [Solanum tuberosum]
Length=256

 Score =   235 bits (600),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 108/141 (77%), Positives = 124/141 (88%), Gaps = 0/141 (0%)
 Frame = +3

Query  318  RIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQ  497
             +  L+NL+++  ++KIIAEYIWIGGSG+D RSK+RT+S PV  PS+LPKWNYDGSSTGQ
Sbjct  3    HLSDLVNLNLSDSSDKIIAEYIWIGGSGMDVRSKARTLSGPVDDPSKLPKWNYDGSSTGQ  62

Query  498  APGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVVSE  677
            APGEDSEVILYPQAIFKDPFR GNNILVICD YTPAGEPIPTNKRH AA+IFS+P VV E
Sbjct  63   APGEDSEVILYPQAIFKDPFRRGNNILVICDCYTPAGEPIPTNKRHNAAKIFSNPDVVVE  122

Query  678  VPWYGIEQEYTLLQQNVKWPL  740
             PWYG+EQEYTLLQ+ + WPL
Sbjct  123  EPWYGLEQEYTLLQKEINWPL  143



>ref|XP_006300523.1| hypothetical protein CARUB_v10020543mg [Capsella rubella]
 gb|EOA33421.1| hypothetical protein CARUB_v10020543mg [Capsella rubella]
Length=356

 Score =   239 bits (609),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 109/140 (78%), Positives = 126/140 (90%), Gaps = 0/140 (0%)
 Frame = +3

Query  321  IEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  500
            +  L+NLD++  T KIIAEYIW+GGSG+D RSK+RT+S PV  PS+LPKWNYDGSSTGQA
Sbjct  4    LADLVNLDLSDNTEKIIAEYIWVGGSGMDMRSKARTLSGPVTDPSKLPKWNYDGSSTGQA  63

Query  501  PGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVVSEV  680
            PG+DSEVILYPQAIFKDPFR GNNILV+CD YTPAGEPIPTNKRH AA+IF++P VV+EV
Sbjct  64   PGQDSEVILYPQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRHAAAEIFNNPDVVAEV  123

Query  681  PWYGIEQEYTLLQQNVKWPL  740
            PWYGIEQEYTLLQ++V WPL
Sbjct  124  PWYGIEQEYTLLQKDVNWPL  143



>ref|XP_010415162.1| PREDICTED: glutamine synthetase cytosolic isozyme 1-2-like isoform 
X1 [Camelina sativa]
 ref|XP_010415163.1| PREDICTED: glutamine synthetase cytosolic isozyme 1-2-like isoform 
X2 [Camelina sativa]
Length=356

 Score =   239 bits (609),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 109/140 (78%), Positives = 126/140 (90%), Gaps = 0/140 (0%)
 Frame = +3

Query  321  IEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  500
            +  L+NLD++  T KIIAEYIW+GGSG+D RSK+RT+S PV  PS+LPKWNYDGSSTGQA
Sbjct  4    LADLVNLDLSDNTEKIIAEYIWVGGSGMDMRSKARTLSGPVTDPSKLPKWNYDGSSTGQA  63

Query  501  PGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVVSEV  680
            PG+DSEVIL+PQAIFKDPFR GNNILV+CD YTPAGEPIPTNKRH AA+IFS+P VV+EV
Sbjct  64   PGQDSEVILFPQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRHAAAEIFSNPDVVAEV  123

Query  681  PWYGIEQEYTLLQQNVKWPL  740
            PWYGIEQEYTLLQ++V WPL
Sbjct  124  PWYGIEQEYTLLQKDVNWPL  143



>ref|XP_010511548.1| PREDICTED: glutamine synthetase cytosolic isozyme 1-2 [Camelina 
sativa]
Length=356

 Score =   238 bits (608),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 109/140 (78%), Positives = 125/140 (89%), Gaps = 0/140 (0%)
 Frame = +3

Query  321  IEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  500
            +  L+NLD++  T KIIAEYIW+GGSG+D RSK+RT+S PV  PS+LPKWNYDGSSTGQA
Sbjct  4    LADLVNLDLSDNTEKIIAEYIWVGGSGMDMRSKARTLSGPVTDPSKLPKWNYDGSSTGQA  63

Query  501  PGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVVSEV  680
            PG+DSEVILYPQAIFKDPFR GNNILV+CD YTPAGEPIPTNKRH AA+IF +P VV+EV
Sbjct  64   PGQDSEVILYPQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRHAAAEIFCNPDVVAEV  123

Query  681  PWYGIEQEYTLLQQNVKWPL  740
            PWYGIEQEYTLLQ++V WPL
Sbjct  124  PWYGIEQEYTLLQKDVNWPL  143



>ref|XP_006284008.1| hypothetical protein CARUB_v10005130mg [Capsella rubella]
 gb|EOA16906.1| hypothetical protein CARUB_v10005130mg [Capsella rubella]
Length=356

 Score =   238 bits (608),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 109/143 (76%), Positives = 127/143 (89%), Gaps = 0/143 (0%)
 Frame = +3

Query  312  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  491
            ++ +  L+NL+++  T+KIIAEYIW+GGSG+D RSK+RT+  PV  PSELPKWNYDGSST
Sbjct  1    MSNLSDLINLNLSDTTDKIIAEYIWVGGSGMDMRSKARTLPGPVTDPSELPKWNYDGSST  60

Query  492  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVV  671
            GQAPGEDSEVILYPQAIFKDPFR GNNILV+CD YTPAGEPIPTNKRH AA++FS P VV
Sbjct  61   GQAPGEDSEVILYPQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRHAAAKVFSHPDVV  120

Query  672  SEVPWYGIEQEYTLLQQNVKWPL  740
            +EVPWYGIEQEYTLLQ+ VKWP+
Sbjct  121  AEVPWYGIEQEYTLLQKEVKWPV  143



>gb|AAG24873.1|AF301590_1 cytosolic glutamine synthetase GSbeta1 [Glycine max]
 gb|ACU23091.1| unknown [Glycine max]
 gb|KHN17957.1| Glutamine synthetase cytosolic isozyme 1 [Glycine soja]
Length=356

 Score =   238 bits (608),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 108/140 (77%), Positives = 125/140 (89%), Gaps = 0/140 (0%)
 Frame = +3

Query  321  IEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  500
            +  L+NL+++  T K+IAEYIWIGGSG+D RSK+RT+  PV  PSELPKWNYDGSSTGQA
Sbjct  4    LSDLINLNLSDTTEKVIAEYIWIGGSGMDLRSKARTLPGPVSDPSELPKWNYDGSSTGQA  63

Query  501  PGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVVSEV  680
            PGEDSEVILYPQAIF+DPFR GNNILVICD YTPAGEPIPTNKRH AA++FS P VV+EV
Sbjct  64   PGEDSEVILYPQAIFRDPFRRGNNILVICDAYTPAGEPIPTNKRHAAAKVFSHPDVVAEV  123

Query  681  PWYGIEQEYTLLQQNVKWPL  740
            PWYGIEQEYTLLQ++++WPL
Sbjct  124  PWYGIEQEYTLLQKDIQWPL  143



>gb|AHJ10959.1| cytosolic glutamine synthetase 1 isoform 1 [Lemna minor]
Length=356

 Score =   238 bits (608),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 111/140 (79%), Positives = 124/140 (89%), Gaps = 0/140 (0%)
 Frame = +3

Query  321  IEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  500
            +  L NL++T  T KIIAEYIWIGGSG+D RSK+RTISKPV  P ELPKWNYDGSSTGQA
Sbjct  4    LADLQNLNLTETTEKIIAEYIWIGGSGLDMRSKARTISKPVSDPKELPKWNYDGSSTGQA  63

Query  501  PGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVVSEV  680
            PGEDSEVILYPQAIF+DPFR GNNILV+CD YTPAGEPIPTNKR+RA+QIFS P VV+E 
Sbjct  64   PGEDSEVILYPQAIFRDPFRKGNNILVMCDCYTPAGEPIPTNKRYRASQIFSGPAVVAEE  123

Query  681  PWYGIEQEYTLLQQNVKWPL  740
             WYG+EQEYTLLQ++VKWPL
Sbjct  124  TWYGLEQEYTLLQKDVKWPL  143



>ref|XP_009127474.1| PREDICTED: glutamine synthetase cytosolic isozyme 1-2 isoform 
X1 [Brassica rapa]
Length=356

 Score =   238 bits (608),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 111/140 (79%), Positives = 125/140 (89%), Gaps = 0/140 (0%)
 Frame = +3

Query  321  IEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  500
            +  L+NLD++  T KIIAEYIW GGSG+D RSK+RT+  PV  PS+LPKWNYDGSSTGQA
Sbjct  4    LTDLVNLDLSDNTEKIIAEYIWGGGSGMDMRSKARTLPGPVTDPSKLPKWNYDGSSTGQA  63

Query  501  PGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVVSEV  680
            PGEDSEVILYPQAIFKDPFR GNNILV+CDTYTPAGEPIPTNKRH AAQIFS+P VV+EV
Sbjct  64   PGEDSEVILYPQAIFKDPFRRGNNILVMCDTYTPAGEPIPTNKRHAAAQIFSNPDVVAEV  123

Query  681  PWYGIEQEYTLLQQNVKWPL  740
            PWYGIEQEYTLLQ++V WP+
Sbjct  124  PWYGIEQEYTLLQKDVNWPV  143



>ref|XP_010450518.1| PREDICTED: glutamine synthetase cytosolic isozyme 1-1-like isoform 
X1 [Camelina sativa]
Length=356

 Score =   238 bits (608),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 108/143 (76%), Positives = 129/143 (90%), Gaps = 0/143 (0%)
 Frame = +3

Query  312  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  491
            ++ +  L+NL+++  T+KIIAEYIW+GGSG+D RSK+RT+S  V+ PS+LPKWNYDGSST
Sbjct  1    MSNLSDLVNLNLSDTTDKIIAEYIWVGGSGMDMRSKARTLSGSVKDPSDLPKWNYDGSST  60

Query  492  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVV  671
            GQAPGEDSEVILYPQAIFKDPFR GNNILV+CD YTPAGEPIPTNKRH AA++FS P VV
Sbjct  61   GQAPGEDSEVILYPQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRHAAAKVFSHPDVV  120

Query  672  SEVPWYGIEQEYTLLQQNVKWPL  740
            +EVPWYGIEQEYTLLQ++VKWP+
Sbjct  121  AEVPWYGIEQEYTLLQKDVKWPV  143



>sp|P04078.1|GLNA1_MEDSA RecName: Full=Glutamine synthetase cytosolic isozyme; AltName: 
Full=Glutamate--ammonia ligase [Medicago sativa]
 emb|CAA27570.1| glutamine synthetase [Medicago sativa]
 prf||1211328A synthetase,Gln
Length=356

 Score =   238 bits (607),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 109/140 (78%), Positives = 124/140 (89%), Gaps = 0/140 (0%)
 Frame = +3

Query  321  IEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  500
            +  L+NLD++  T KIIAEYIWIGGSG+D RSK+RT+  PV  PS+LPKWNYDGSSTGQA
Sbjct  4    LSDLINLDLSETTEKIIAEYIWIGGSGLDLRSKARTLPGPVTDPSQLPKWNYDGSSTGQA  63

Query  501  PGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVVSEV  680
            PGEDSEVI+YPQAIFKDPFR GNNILV+CD YTPAGEPIPTNKRH AA+IFS P VV+EV
Sbjct  64   PGEDSEVIIYPQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRHAAAKIFSHPDVVAEV  123

Query  681  PWYGIEQEYTLLQQNVKWPL  740
            PWYGIEQEYTLLQ+++ WPL
Sbjct  124  PWYGIEQEYTLLQKDINWPL  143



>emb|CAA58118.1| glutamate--ammonia ligase [Brassica napus]
 emb|CDX74573.1| BnaA04g08160D [Brassica napus]
Length=356

 Score =   238 bits (607),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 109/140 (78%), Positives = 125/140 (89%), Gaps = 0/140 (0%)
 Frame = +3

Query  321  IEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  500
            +  L+NL+++  T+KIIAEYIW+GGSG+D RSK+RT+  PV  PSELPKWNYDGSSTGQA
Sbjct  4    LTDLVNLNLSETTDKIIAEYIWVGGSGMDMRSKARTLPGPVSDPSELPKWNYDGSSTGQA  63

Query  501  PGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVVSEV  680
            PGEDSEVILYPQAIFKDPFR GNNILV+CD YTPAGEPIPTNKRH AA++FS P VV+EV
Sbjct  64   PGEDSEVILYPQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRHAAAKVFSHPDVVAEV  123

Query  681  PWYGIEQEYTLLQQNVKWPL  740
            PWYGIEQEYTLLQ++V WPL
Sbjct  124  PWYGIEQEYTLLQKDVNWPL  143



>ref|XP_009139734.1| PREDICTED: glutamine synthetase cytosolic isozyme 1-1 [Brassica 
rapa]
Length=356

 Score =   238 bits (607),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 108/140 (77%), Positives = 125/140 (89%), Gaps = 0/140 (0%)
 Frame = +3

Query  321  IEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  500
            +  L+NL+++  T+K+IAEYIW+GGSG+D RSK+RT+  PV  PSELPKWNYDGSSTGQA
Sbjct  4    LTDLVNLNLSETTDKVIAEYIWVGGSGMDMRSKARTLPGPVSDPSELPKWNYDGSSTGQA  63

Query  501  PGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVVSEV  680
            PGEDSEVILYPQAIFKDPFR GNNILV+CD YTPAGEPIPTNKRH AA++FS P VV+EV
Sbjct  64   PGEDSEVILYPQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRHAAAKVFSHPDVVAEV  123

Query  681  PWYGIEQEYTLLQQNVKWPL  740
            PWYGIEQEYTLLQ++V WPL
Sbjct  124  PWYGIEQEYTLLQKDVNWPL  143



>ref|XP_006372556.1| glutamate-ammonia ligase family protein [Populus trichocarpa]
 gb|ABK94934.1| unknown [Populus trichocarpa]
 gb|ABK95264.1| unknown [Populus trichocarpa]
 gb|ERP50353.1| glutamate-ammonia ligase family protein [Populus trichocarpa]
Length=356

 Score =   238 bits (606),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 110/140 (79%), Positives = 125/140 (89%), Gaps = 0/140 (0%)
 Frame = +3

Query  321  IEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  500
            +  L+NL+++  T KIIAEYIW+GGSG+D RSK RT+  PV  PS+LPKWNYDGSSTGQA
Sbjct  4    LSDLINLNLSDSTEKIIAEYIWVGGSGMDIRSKGRTLPGPVSDPSKLPKWNYDGSSTGQA  63

Query  501  PGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVVSEV  680
            PGEDSEVILYPQAIFKDPFR GNNILVICDTYTPAGEPIPTNKR +AA+IFS P VV+EV
Sbjct  64   PGEDSEVILYPQAIFKDPFRRGNNILVICDTYTPAGEPIPTNKRCKAAKIFSHPDVVAEV  123

Query  681  PWYGIEQEYTLLQQNVKWPL  740
            PWYG+EQEYTLLQ++VKWPL
Sbjct  124  PWYGLEQEYTLLQKDVKWPL  143



>ref|XP_003600702.1| Glutamine synthetase [Medicago truncatula]
 gb|AES70953.1| glutamine synthetase domain protein [Medicago truncatula]
Length=356

 Score =   238 bits (606),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 108/140 (77%), Positives = 124/140 (89%), Gaps = 0/140 (0%)
 Frame = +3

Query  321  IEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  500
            +  L+NLD++  T KIIAEYIWIGGSG+D RSK+RT+  PV  PS+LPKWNYDGSSTGQA
Sbjct  4    LSDLINLDLSETTEKIIAEYIWIGGSGLDLRSKARTLPGPVTDPSQLPKWNYDGSSTGQA  63

Query  501  PGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVVSEV  680
            PGEDSEVI+YPQAIFKDPFR GNNILV+CD YTPAGEPIPTNKRH AA++FS P VV+EV
Sbjct  64   PGEDSEVIIYPQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRHAAAKVFSHPDVVAEV  123

Query  681  PWYGIEQEYTLLQQNVKWPL  740
            PWYGIEQEYTLLQ+++ WPL
Sbjct  124  PWYGIEQEYTLLQKDINWPL  143



>ref|XP_009631593.1| PREDICTED: glutamine synthetase isoform X2 [Nicotiana tomentosiformis]
Length=272

 Score =   234 bits (598),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 108/143 (76%), Positives = 127/143 (89%), Gaps = 0/143 (0%)
 Frame = +3

Query  312  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  491
            ++ +  L+NL+++  T KIIAEYIWIGGSG+D RSK+RT+S PV  P++LPKWNYDGSST
Sbjct  1    MSMLSDLINLNLSDSTEKIIAEYIWIGGSGMDLRSKARTLSGPVTDPAKLPKWNYDGSST  60

Query  492  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVV  671
            GQAPGEDSEVILYPQAIFKDPFR GNNILV+CD YTPAGEPIPTNKRH AA+IFS+P VV
Sbjct  61   GQAPGEDSEVILYPQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRHAAAKIFSNPDVV  120

Query  672  SEVPWYGIEQEYTLLQQNVKWPL  740
            +E PWYGIEQEYTLLQ+++ WPL
Sbjct  121  AEEPWYGIEQEYTLLQRDINWPL  143



>dbj|BAH56851.1| AT1G66200 [Arabidopsis thaliana]
Length=271

 Score =   234 bits (598),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 106/143 (74%), Positives = 127/143 (89%), Gaps = 0/143 (0%)
 Frame = +3

Query  312  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  491
            ++ +  L+NLD++  + KIIAEYIW+GGSG+D RSK+RT+  PV  PS+LPKWNYDGSST
Sbjct  1    MSLLADLVNLDISDNSEKIIAEYIWVGGSGMDMRSKARTLPGPVTDPSKLPKWNYDGSST  60

Query  492  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVV  671
            GQAPG+DSEVILYPQAIFKDPFR GNNILV+CD YTPAGEPIPTNKRH AA+IF++P V+
Sbjct  61   GQAPGQDSEVILYPQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRHAAAEIFANPDVI  120

Query  672  SEVPWYGIEQEYTLLQQNVKWPL  740
            +EVPWYGIEQEYTLLQ++V WPL
Sbjct  121  AEVPWYGIEQEYTLLQKDVNWPL  143



>gb|ACF74298.1| glutamine synthetase GS56 [Arachis hypogaea]
Length=157

 Score =   230 bits (587),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 110/144 (76%), Positives = 124/144 (86%), Gaps = 1/144 (1%)
 Frame = +3

Query  312  VNRIEQLLNLDVTPY-TNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSS  488
            ++ +  L+NL+++   T KIIAEYIWIGGSG+D RSK+RTIS PV  PS+LPKWNYDGSS
Sbjct  1    MSLLSDLINLNLSESGTKKIIAEYIWIGGSGMDIRSKARTISGPVSDPSKLPKWNYDGSS  60

Query  489  TGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKV  668
            TGQAPGEDSEVILYPQAIFKDPFR G NILVICD YTPAGEPIPTNKRH AA+IFS P V
Sbjct  61   TGQAPGEDSEVILYPQAIFKDPFRRGENILVICDAYTPAGEPIPTNKRHNAAKIFSHPDV  120

Query  669  VSEVPWYGIEQEYTLLQQNVKWPL  740
             SE PWYGIEQEYTLLQ+++ WPL
Sbjct  121  ASEEPWYGIEQEYTLLQKDINWPL  144



>ref|XP_002873784.1| GLN1_4 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50043.1| GLN1_4 [Arabidopsis lyrata subsp. lyrata]
Length=356

 Score =   237 bits (605),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 107/143 (75%), Positives = 128/143 (90%), Gaps = 0/143 (0%)
 Frame = +3

Query  312  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  491
            ++ +  L+NLD++  T++IIAEYIWIGGSG+D RSK+RT+  PV+ PSELPKWNYDGSST
Sbjct  1    MSSLADLINLDLSDSTDQIIAEYIWIGGSGLDMRSKARTLPGPVKDPSELPKWNYDGSST  60

Query  492  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVV  671
            GQAPG+DSEVI+YPQAIFKDPFR GNNILV+CD YTPAGEPIPTNKRH AA+IFSDP VV
Sbjct  61   GQAPGDDSEVIIYPQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRHAAAKIFSDPSVV  120

Query  672  SEVPWYGIEQEYTLLQQNVKWPL  740
            +E  WYGIEQEYTLLQ+++KWP+
Sbjct  121  AEETWYGIEQEYTLLQKDIKWPV  143



>ref|XP_002888488.1| ATGSR2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64747.1| ATGSR2 [Arabidopsis lyrata subsp. lyrata]
Length=356

 Score =   237 bits (605),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 109/140 (78%), Positives = 125/140 (89%), Gaps = 0/140 (0%)
 Frame = +3

Query  321  IEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  500
            +  L+NLD++  + KIIAEYIW+GGSG+D RSK+RT+S PV  PS+LPKWNYDGSSTGQA
Sbjct  4    LADLVNLDLSDTSEKIIAEYIWVGGSGMDMRSKARTLSGPVTDPSKLPKWNYDGSSTGQA  63

Query  501  PGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVVSEV  680
            PG+DSEVILYPQAIFKDPFR GNNILV+CD YTPAGEPIPTNKRH AA IFS+P VV+EV
Sbjct  64   PGQDSEVILYPQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRHAAAVIFSNPDVVAEV  123

Query  681  PWYGIEQEYTLLQQNVKWPL  740
            PWYGIEQEYTLLQ++V WPL
Sbjct  124  PWYGIEQEYTLLQKDVNWPL  143



>gb|AAR86718.1| glutamine synthetase GS56 [Nicotiana attenuata]
Length=356

 Score =   237 bits (605),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 110/141 (78%), Positives = 123/141 (87%), Gaps = 0/141 (0%)
 Frame = +3

Query  318  RIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQ  497
             +  L+NL+++  T KIIAEYIWIGGSG+D RSK+RTIS PV  PS+LPKWNYDGSSTGQ
Sbjct  3    HLSDLVNLNLSDSTQKIIAEYIWIGGSGMDVRSKARTISGPVDDPSKLPKWNYDGSSTGQ  62

Query  498  APGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVVSE  677
            APGEDSEVILYPQAIFKDPFR GNNILVICD YTPAGEPIPTNKRH AA+IFS P VV E
Sbjct  63   APGEDSEVILYPQAIFKDPFRRGNNILVICDCYTPAGEPIPTNKRHNAAKIFSHPDVVVE  122

Query  678  VPWYGIEQEYTLLQQNVKWPL  740
             PWYG+EQEYTLLQ+++ WPL
Sbjct  123  EPWYGLEQEYTLLQKDINWPL  143



>ref|NP_001031240.1| glutamine synthetase [Arabidopsis thaliana]
 gb|AEE34475.1| glutamine synthetase [Arabidopsis thaliana]
Length=272

 Score =   234 bits (597),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 106/143 (74%), Positives = 127/143 (89%), Gaps = 0/143 (0%)
 Frame = +3

Query  312  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  491
            ++ +  L+NLD++  + KIIAEYIW+GGSG+D RSK+RT+  PV  PS+LPKWNYDGSST
Sbjct  1    MSLLADLVNLDISDNSEKIIAEYIWVGGSGMDMRSKARTLPGPVTDPSKLPKWNYDGSST  60

Query  492  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVV  671
            GQAPG+DSEVILYPQAIFKDPFR GNNILV+CD YTPAGEPIPTNKRH AA+IF++P V+
Sbjct  61   GQAPGQDSEVILYPQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRHAAAEIFANPDVI  120

Query  672  SEVPWYGIEQEYTLLQQNVKWPL  740
            +EVPWYGIEQEYTLLQ++V WPL
Sbjct  121  AEVPWYGIEQEYTLLQKDVNWPL  143



>ref|XP_008353857.1| PREDICTED: glutamine synthetase cytosolic isozyme [Malus domestica]
Length=356

 Score =   237 bits (604),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 111/140 (79%), Positives = 123/140 (88%), Gaps = 0/140 (0%)
 Frame = +3

Query  321  IEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  500
            +  L+NLD++  T KIIAEYIWIGGSG+D RSK+RT+  PV  PS+LPKWNYDGSSTGQA
Sbjct  4    LTDLINLDLSGSTKKIIAEYIWIGGSGMDIRSKARTLPGPVSDPSKLPKWNYDGSSTGQA  63

Query  501  PGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVVSEV  680
            PGEDSEVILYPQAIFKDPFR GNNILVICDTYTP GEPIPTNKR  AA+IFS P VV+EV
Sbjct  64   PGEDSEVILYPQAIFKDPFRRGNNILVICDTYTPGGEPIPTNKRAAAAKIFSHPDVVAEV  123

Query  681  PWYGIEQEYTLLQQNVKWPL  740
            PWYGIEQEYTLLQ++V WPL
Sbjct  124  PWYGIEQEYTLLQKDVXWPL  143



>ref|NP_198576.1| glutamine synthetase 1;1 [Arabidopsis thaliana]
 sp|Q56WN1.2|GLN11_ARATH RecName: Full=Glutamine synthetase cytosolic isozyme 1-1; AltName: 
Full=Glutamate--ammonia ligase GLN1;1; Short=GLN1;1 [Arabidopsis 
thaliana]
 gb|AAL16154.1|AF428386_1 AT5g37600/K12B20_50 [Arabidopsis thaliana]
 gb|AAL31940.1|AF419608_1 AT5g37600/K12B20_50 [Arabidopsis thaliana]
 dbj|BAB08306.1| glutamine synthetase [Arabidopsis thaliana]
 gb|AAL84997.1| AT5g37600/K12B20_50 [Arabidopsis thaliana]
 gb|AAN31893.1| putative glutamate-ammonia ligase [Arabidopsis thaliana]
 gb|AED94209.1| glutamine synthetase 1;1 [Arabidopsis thaliana]
Length=356

 Score =   237 bits (604),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 107/140 (76%), Positives = 126/140 (90%), Gaps = 0/140 (0%)
 Frame = +3

Query  321  IEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  500
            +  L+NL+++  T+KIIAEYIW+GGSG+D RSK+RT+  PV  PS+LPKWNYDGSSTGQA
Sbjct  4    VSDLINLNLSDSTDKIIAEYIWVGGSGMDMRSKARTLPGPVTDPSQLPKWNYDGSSTGQA  63

Query  501  PGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVVSEV  680
            PGEDSEVILYPQAIFKDPFR GNNILV+CD YTPAGEPIPTNKRH AA++FS+P V +EV
Sbjct  64   PGEDSEVILYPQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRHAAAKVFSNPDVAAEV  123

Query  681  PWYGIEQEYTLLQQNVKWPL  740
            PWYGIEQEYTLLQ++VKWP+
Sbjct  124  PWYGIEQEYTLLQKDVKWPV  143



>dbj|BAA04996.1| glutamine synthetase [Raphanus sativus]
Length=356

 Score =   237 bits (604),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 108/140 (77%), Positives = 125/140 (89%), Gaps = 0/140 (0%)
 Frame = +3

Query  321  IEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  500
            +  L+NL+++  T+KIIAEYIW+GGSG+D RSK+RT+  PV  PSELPKWNYDGSSTGQA
Sbjct  4    LTDLINLNLSETTDKIIAEYIWVGGSGMDMRSKARTLPGPVSDPSELPKWNYDGSSTGQA  63

Query  501  PGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVVSEV  680
            PGEDSEVILYPQAIFKDPFR  NNILV+CD YTPAGEPIPTNKRH AA++FS P VV+EV
Sbjct  64   PGEDSEVILYPQAIFKDPFRRANNILVMCDAYTPAGEPIPTNKRHAAAKVFSQPDVVAEV  123

Query  681  PWYGIEQEYTLLQQNVKWPL  740
            PWYGIEQEYTLLQ++VKWP+
Sbjct  124  PWYGIEQEYTLLQKDVKWPV  143



>sp|P12424.1|GLNA_NICPL RecName: Full=Glutamine synthetase; AltName: Full=Glutamate--ammonia 
ligase [Nicotiana plumbaginifolia]
 gb|AAA34066.1| glutamine synthetase (EC 6.3.1.2) [Nicotiana plumbaginifolia]
Length=356

 Score =   237 bits (604),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 108/140 (77%), Positives = 125/140 (89%), Gaps = 0/140 (0%)
 Frame = +3

Query  321  IEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  500
            +  L+NL+++  T KIIAEYIWIGGSG+D RSK+RT+S PV  P++LPKWNYDGSSTGQA
Sbjct  4    LSDLINLNLSDSTEKIIAEYIWIGGSGMDLRSKARTLSGPVTDPAKLPKWNYDGSSTGQA  63

Query  501  PGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVVSEV  680
            PGEDSEVILYPQAIFKDPFR GNNILV+CD YTPAGEPIPTNKRH AA+IFS+P VV+E 
Sbjct  64   PGEDSEVILYPQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRHAAAKIFSNPDVVAEE  123

Query  681  PWYGIEQEYTLLQQNVKWPL  740
            PWYGIEQEYTLLQ+++ WPL
Sbjct  124  PWYGIEQEYTLLQRDINWPL  143



>ref|XP_009629012.1| PREDICTED: glutamine synthetase-like [Nicotiana tomentosiformis]
Length=356

 Score =   237 bits (604),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 110/140 (79%), Positives = 123/140 (88%), Gaps = 0/140 (0%)
 Frame = +3

Query  321  IEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  500
            +  L+NL++T  T KIIAEYIWIGGSG+D RSK+RT+S PV+ PS+LPKWNYDGSSTGQA
Sbjct  4    LSDLINLNLTESTEKIIAEYIWIGGSGMDLRSKARTLSGPVKDPSQLPKWNYDGSSTGQA  63

Query  501  PGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVVSEV  680
            PGEDSEVILYPQAIFKDPFR GNNILV+CD YTPAGEPIPTNKRH AA+IFS P VV+E 
Sbjct  64   PGEDSEVILYPQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRHHAAKIFSKPDVVAEE  123

Query  681  PWYGIEQEYTLLQQNVKWPL  740
             WYGIEQEYTLLQ+ V WPL
Sbjct  124  TWYGIEQEYTLLQKEVNWPL  143



>ref|XP_007215605.1| hypothetical protein PRUPE_ppa007772mg [Prunus persica]
 gb|EMJ16804.1| hypothetical protein PRUPE_ppa007772mg [Prunus persica]
Length=356

 Score =   237 bits (604),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 110/140 (79%), Positives = 123/140 (88%), Gaps = 0/140 (0%)
 Frame = +3

Query  321  IEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  500
            +  L+NLD++  T K+IAEYIWIGGSG+D RSK+RT+  PV  PS+LPKWNYDGSSTGQA
Sbjct  4    LSDLINLDLSDSTEKVIAEYIWIGGSGMDLRSKARTLPGPVSDPSKLPKWNYDGSSTGQA  63

Query  501  PGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVVSEV  680
            PGEDSEVILYPQAIFKDPFR GNNILVICD YTPAGEPIPTNKR  AA+IFS P VV+EV
Sbjct  64   PGEDSEVILYPQAIFKDPFRRGNNILVICDAYTPAGEPIPTNKRAAAAKIFSHPDVVAEV  123

Query  681  PWYGIEQEYTLLQQNVKWPL  740
            PWYGIEQEYTLLQ++V WPL
Sbjct  124  PWYGIEQEYTLLQKDVHWPL  143



>gb|ABK93921.1| unknown [Populus trichocarpa]
Length=218

 Score =   232 bits (592),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 107/143 (75%), Positives = 127/143 (89%), Gaps = 0/143 (0%)
 Frame = +3

Query  312  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  491
            ++ +  L+NLD++  T+KIIAEYIWIGGSG+D RSK+RT++  V  P +LPKWNYDGSST
Sbjct  1    MSLLSDLINLDLSDTTDKIIAEYIWIGGSGMDLRSKARTLNGVVSDPHKLPKWNYDGSST  60

Query  492  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVV  671
            GQAPGEDSEVILYPQAIFKDPFR GNNILV+CD YTPAGEPIPTNKR+ AA+IFS P VV
Sbjct  61   GQAPGEDSEVILYPQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRYNAAKIFSHPDVV  120

Query  672  SEVPWYGIEQEYTLLQQNVKWPL  740
            +EVPWYGIEQEYTLLQ+++KWP+
Sbjct  121  AEVPWYGIEQEYTLLQKDLKWPI  143



>ref|XP_009385541.1| PREDICTED: glutamine synthetase nodule isozyme-like [Musa acuminata 
subsp. malaccensis]
Length=356

 Score =   236 bits (603),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 109/140 (78%), Positives = 125/140 (89%), Gaps = 0/140 (0%)
 Frame = +3

Query  321  IEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  500
            +  L+NLD++  T+KIIAEYIWIGGSG+D RSK+RT+  PV  PS+LPKWNYDGSSTGQA
Sbjct  4    LTDLINLDLSETTDKIIAEYIWIGGSGLDLRSKARTLPGPVTDPSQLPKWNYDGSSTGQA  63

Query  501  PGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVVSEV  680
            PGEDSEVILYPQAIFKDPFR GNNILV+CD YTPAGEPIPTNKR+ AA++FS P VV+E 
Sbjct  64   PGEDSEVILYPQAIFKDPFRRGNNILVMCDCYTPAGEPIPTNKRYNAAKVFSHPDVVAEE  123

Query  681  PWYGIEQEYTLLQQNVKWPL  740
            PWYGIEQEYTLLQ++VKWPL
Sbjct  124  PWYGIEQEYTLLQKDVKWPL  143



>ref|NP_001284433.1| glutamine synthetase cytosolic isozyme [Cucumis melo]
 gb|ABI30732.1| cytosolic glutamine synthetase [Cucumis melo]
Length=356

 Score =   236 bits (603),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 109/140 (78%), Positives = 124/140 (89%), Gaps = 0/140 (0%)
 Frame = +3

Query  321  IEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  500
            +  L+NL+++  T KIIAEYIWIGGSG+D RSK+RT+S PV  P +LPKWNYDGSSTGQA
Sbjct  4    LSDLINLNLSDSTEKIIAEYIWIGGSGMDLRSKARTLSGPVSDPPKLPKWNYDGSSTGQA  63

Query  501  PGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVVSEV  680
            PGEDSEVILYPQAIF+DPFR GNN LVICD YTPAGEPIPTNKRH AA+IFS P VV+EV
Sbjct  64   PGEDSEVILYPQAIFRDPFRRGNNTLVICDAYTPAGEPIPTNKRHAAAKIFSHPDVVAEV  123

Query  681  PWYGIEQEYTLLQQNVKWPL  740
            PWYGIEQEYTLLQ++VKWP+
Sbjct  124  PWYGIEQEYTLLQKDVKWPI  143



>ref|XP_002870545.1| ATGSR1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH46804.1| ATGSR1 [Arabidopsis lyrata subsp. lyrata]
Length=356

 Score =   236 bits (603),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 107/140 (76%), Positives = 125/140 (89%), Gaps = 0/140 (0%)
 Frame = +3

Query  321  IEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  500
            +  L+NL+++  T+KIIAEYIW+GGSG+D RSK+RT+  PV  PS+LPKWNYDGSSTGQA
Sbjct  4    VSDLINLNLSDITDKIIAEYIWVGGSGMDMRSKARTLPGPVTDPSQLPKWNYDGSSTGQA  63

Query  501  PGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVVSEV  680
            PGEDSEVILYPQAIFKDPFR GNNILV+CD YTPAGEPIPTNKRH AA++FS P V +EV
Sbjct  64   PGEDSEVILYPQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRHAAAKVFSHPDVAAEV  123

Query  681  PWYGIEQEYTLLQQNVKWPL  740
            PWYGIEQEYTLLQ++VKWP+
Sbjct  124  PWYGIEQEYTLLQKDVKWPV  143



>ref|XP_009393673.1| PREDICTED: glutamine synthetase nodule isozyme [Musa acuminata 
subsp. malaccensis]
Length=356

 Score =   236 bits (603),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 109/140 (78%), Positives = 124/140 (89%), Gaps = 0/140 (0%)
 Frame = +3

Query  321  IEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  500
            +  L+NL+++  T KIIAEYIWIGGSG+D RSK+RT+  PV  PS+LP WNYDGSSTGQA
Sbjct  4    LTDLVNLNLSETTEKIIAEYIWIGGSGLDIRSKARTLPGPVSDPSKLPTWNYDGSSTGQA  63

Query  501  PGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVVSEV  680
            PG+DSEVILYPQAIFKDPFR GNNILV+CD YTPAGEPIPTNKRH AA+IFS P VV+EV
Sbjct  64   PGDDSEVILYPQAIFKDPFRRGNNILVMCDCYTPAGEPIPTNKRHNAAKIFSHPDVVAEV  123

Query  681  PWYGIEQEYTLLQQNVKWPL  740
            PWYGIEQEYTLLQ++VKWPL
Sbjct  124  PWYGIEQEYTLLQKDVKWPL  143



>gb|AAP33167.1| cytosolic glutamine synthetase [Securigera parviflora]
Length=356

 Score =   236 bits (603),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 109/140 (78%), Positives = 124/140 (89%), Gaps = 0/140 (0%)
 Frame = +3

Query  321  IEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  500
            +  L+NL+++  T+KIIAEYIWIGGSG+D RSK+RT+  PV  PSELPKWNYDGSSTG+A
Sbjct  4    LSDLINLNLSETTDKIIAEYIWIGGSGLDLRSKARTLPGPVSDPSELPKWNYDGSSTGRA  63

Query  501  PGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVVSEV  680
            PGEDSEVILYPQAIFKDPFR G+NILVICD YTPAGEPIPTNKRH AA++FS P VV+EV
Sbjct  64   PGEDSEVILYPQAIFKDPFRRGSNILVICDAYTPAGEPIPTNKRHAAAKVFSHPDVVAEV  123

Query  681  PWYGIEQEYTLLQQNVKWPL  740
            PWYGIEQEYTLLQ+ V WPL
Sbjct  124  PWYGIEQEYTLLQKEVNWPL  143



>ref|XP_009800983.1| PREDICTED: glutamine synthetase-like [Nicotiana sylvestris]
Length=356

 Score =   236 bits (603),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 108/140 (77%), Positives = 125/140 (89%), Gaps = 0/140 (0%)
 Frame = +3

Query  321  IEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  500
            +  L+NL++T  T+KIIAEYIWIGGSG+D RSK+R++S PV+ PS+LPKWNYDGSSTGQA
Sbjct  4    LSDLINLNLTESTDKIIAEYIWIGGSGMDLRSKARSLSGPVEDPSKLPKWNYDGSSTGQA  63

Query  501  PGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVVSEV  680
            PGEDSEVILYPQAIFKDPFR GNNILV+CD YTPAGEPIPTNKRH AA+IFS+P VV+E 
Sbjct  64   PGEDSEVILYPQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRHHAAKIFSNPDVVAEE  123

Query  681  PWYGIEQEYTLLQQNVKWPL  740
             WYGIEQEYTLLQ+ + WPL
Sbjct  124  TWYGIEQEYTLLQKEINWPL  143



>ref|XP_009631592.1| PREDICTED: glutamine synthetase isoform X1 [Nicotiana tomentosiformis]
Length=356

 Score =   236 bits (602),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 108/143 (76%), Positives = 127/143 (89%), Gaps = 0/143 (0%)
 Frame = +3

Query  312  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  491
            ++ +  L+NL+++  T KIIAEYIWIGGSG+D RSK+RT+S PV  P++LPKWNYDGSST
Sbjct  1    MSMLSDLINLNLSDSTEKIIAEYIWIGGSGMDLRSKARTLSGPVTDPAKLPKWNYDGSST  60

Query  492  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVV  671
            GQAPGEDSEVILYPQAIFKDPFR GNNILV+CD YTPAGEPIPTNKRH AA+IFS+P VV
Sbjct  61   GQAPGEDSEVILYPQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRHAAAKIFSNPDVV  120

Query  672  SEVPWYGIEQEYTLLQQNVKWPL  740
            +E PWYGIEQEYTLLQ+++ WPL
Sbjct  121  AEEPWYGIEQEYTLLQRDINWPL  143



>ref|NP_001048045.1| Os02g0735200 [Oryza sativa Japonica Group]
 sp|P14656.1|GLN11_ORYSJ RecName: Full=Glutamine synthetase cytosolic isozyme 1-1; AltName: 
Full=Glutamate--ammonia ligase GLN1;1; Short=OsGLN1;1; 
AltName: Full=Glutamine synthetase shoot isozyme; AltName: 
Full=OsGS1;1 [Oryza sativa Japonica Group]
 emb|CAA32461.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAA95679.1| cytosolic glutamine synthethase 1;1 [Oryza sativa Japonica Group]
 dbj|BAA95678.1| cytosolic glutamine synthetase 1;1 [Oryza sativa Japonica Group]
 dbj|BAD15892.1| glutamine synthetase shoot isozyme [Oryza sativa Japonica Group]
 dbj|BAF09959.1| Os02g0735200 [Oryza sativa Japonica Group]
 gb|EAZ24534.1| hypothetical protein OsJ_08295 [Oryza sativa Japonica Group]
 dbj|BAG87764.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97064.1| unnamed protein product [Oryza sativa Japonica Group]
Length=356

 Score =   236 bits (602),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 109/140 (78%), Positives = 124/140 (89%), Gaps = 0/140 (0%)
 Frame = +3

Query  321  IEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  500
            +  L+NL+++  T KIIAEYIWIGGSG+D RSK+RT+S PV  PS+LPKWNYDGSSTGQA
Sbjct  4    LTDLVNLNLSDTTEKIIAEYIWIGGSGMDLRSKARTLSGPVTDPSKLPKWNYDGSSTGQA  63

Query  501  PGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVVSEV  680
            PGEDSEVILYPQAIFKDPFR GNNILV+CD YTPAGEPIPTNKRH AA+IFS P+V SE 
Sbjct  64   PGEDSEVILYPQAIFKDPFRKGNNILVMCDCYTPAGEPIPTNKRHNAAKIFSSPEVASEE  123

Query  681  PWYGIEQEYTLLQQNVKWPL  740
            PWYGIEQEYTLLQ+++ WPL
Sbjct  124  PWYGIEQEYTLLQKDINWPL  143



>emb|CAA71317.1| glutamine synthetase [Medicago truncatula]
Length=356

 Score =   236 bits (602),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 107/140 (76%), Positives = 123/140 (88%), Gaps = 0/140 (0%)
 Frame = +3

Query  321  IEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  500
            +  L+NLD++  T KIIAEYIWIGGSG+D RSK+RT+  PV  PS+LPKWNYDGSSTGQA
Sbjct  4    LSDLINLDLSETTEKIIAEYIWIGGSGLDLRSKARTLPGPVTDPSQLPKWNYDGSSTGQA  63

Query  501  PGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVVSEV  680
            PGEDSEVI+YPQAIFKDPFR GNNI V+CD YTPAGEPIPTNKRH AA++FS P VV+EV
Sbjct  64   PGEDSEVIIYPQAIFKDPFRRGNNIFVMCDAYTPAGEPIPTNKRHAAAKVFSHPDVVAEV  123

Query  681  PWYGIEQEYTLLQQNVKWPL  740
            PWYGIEQEYTLLQ+++ WPL
Sbjct  124  PWYGIEQEYTLLQKDINWPL  143



>gb|EYU30859.1| hypothetical protein MIMGU_mgv1a008986mg [Erythranthe guttata]
Length=356

 Score =   236 bits (602),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 110/140 (79%), Positives = 124/140 (89%), Gaps = 0/140 (0%)
 Frame = +3

Query  321  IEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  500
            I  LLNL++T  T  IIAEYIWIGGSGID RSK+RT+  PV  PS+LP+WNYDGSSTGQA
Sbjct  4    ISDLLNLNLTDSTKSIIAEYIWIGGSGIDIRSKARTLPGPVSDPSKLPRWNYDGSSTGQA  63

Query  501  PGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVVSEV  680
            PG+DSEVILYPQAIFKDPFR GNNILV+CD YTPAG+PIPTNKR+ AA+IFS P VV+EV
Sbjct  64   PGQDSEVILYPQAIFKDPFRRGNNILVMCDAYTPAGDPIPTNKRYSAAKIFSHPDVVAEV  123

Query  681  PWYGIEQEYTLLQQNVKWPL  740
            PWYGIEQEYTLLQ++VKWPL
Sbjct  124  PWYGIEQEYTLLQKDVKWPL  143



>emb|CDX69442.1| BnaA10g17910D [Brassica napus]
Length=356

 Score =   236 bits (602),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 108/140 (77%), Positives = 123/140 (88%), Gaps = 0/140 (0%)
 Frame = +3

Query  321  IEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  500
            +  L+NLD++  T KIIAEYIWIGGSG+D RSK+RT+  PV+ PSELPKWNYDGSSTGQA
Sbjct  4    LADLINLDLSDSTEKIIAEYIWIGGSGLDMRSKARTLPGPVKDPSELPKWNYDGSSTGQA  63

Query  501  PGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVVSEV  680
            PG DSEVILYPQAIFKDPFR GNNILV+CD YTPAGEPIPTNKRH AA+IFSDP V +E 
Sbjct  64   PGSDSEVILYPQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRHAAAKIFSDPSVAAEE  123

Query  681  PWYGIEQEYTLLQQNVKWPL  740
             WYGIEQEYTLLQ+++KWP+
Sbjct  124  TWYGIEQEYTLLQKDIKWPV  143



>gb|ACN36710.1| unknown [Zea mays]
Length=217

 Score =   231 bits (590),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 104/140 (74%), Positives = 123/140 (88%), Gaps = 0/140 (0%)
 Frame = +3

Query  321  IEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  500
            +  L+NLD++  T++IIAEYIWIGG+GID RSK+RT+  P+  PS+LPKWNYDGSSTGQA
Sbjct  4    LTDLVNLDLSDCTDRIIAEYIWIGGTGIDLRSKARTVKGPITDPSQLPKWNYDGSSTGQA  63

Query  501  PGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVVSEV  680
            PGEDSEVILYPQAIFKDPFR GN+ILV+CD YTP GEPIPTNKR+ AA++FS P V +EV
Sbjct  64   PGEDSEVILYPQAIFKDPFRKGNHILVMCDCYTPQGEPIPTNKRYSAAKVFSHPDVAAEV  123

Query  681  PWYGIEQEYTLLQQNVKWPL  740
            PWYGIEQEYTLLQ++V WPL
Sbjct  124  PWYGIEQEYTLLQKDVSWPL  143



>gb|KFK41041.1| hypothetical protein AALP_AA2G077900 [Arabis alpina]
Length=356

 Score =   236 bits (601),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 107/140 (76%), Positives = 125/140 (89%), Gaps = 0/140 (0%)
 Frame = +3

Query  321  IEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  500
            +  L+NLD++  T KIIAEYIW+GGSG+D RSK+RT+  PV  PS LP+WNYDGSSTGQA
Sbjct  4    LTDLINLDLSDSTEKIIAEYIWVGGSGLDMRSKARTLPGPVTDPSNLPRWNYDGSSTGQA  63

Query  501  PGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVVSEV  680
            PG+DSEVILYPQAIFKDPFR GNNILV+CD YTPAG+PIPTNKRH AA+IFS+P VV+EV
Sbjct  64   PGQDSEVILYPQAIFKDPFRRGNNILVMCDAYTPAGDPIPTNKRHAAAEIFSNPDVVAEV  123

Query  681  PWYGIEQEYTLLQQNVKWPL  740
            PWYGIEQEYTLLQ++VKWP+
Sbjct  124  PWYGIEQEYTLLQKDVKWPV  143



>ref|XP_004288594.1| PREDICTED: glutamine synthetase nodule isozyme [Fragaria vesca 
subsp. vesca]
Length=356

 Score =   236 bits (601),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 109/140 (78%), Positives = 125/140 (89%), Gaps = 0/140 (0%)
 Frame = +3

Query  321  IEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  500
            +  L+NLD++  T+KIIAEYIWIGGSG+D RSK+RT+  PV  PS+LPKWNYDGSSTGQA
Sbjct  4    LTDLINLDLSDSTDKIIAEYIWIGGSGMDLRSKARTLPGPVSDPSKLPKWNYDGSSTGQA  63

Query  501  PGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVVSEV  680
            PGEDSEVILYPQAIFKDPFR GNNILV+CD YTPAGEPIPTNKR+ AA+IFS P VV+EV
Sbjct  64   PGEDSEVILYPQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRNAAAKIFSHPGVVAEV  123

Query  681  PWYGIEQEYTLLQQNVKWPL  740
            PWYG+EQEYTLLQ++V WPL
Sbjct  124  PWYGLEQEYTLLQKDVNWPL  143



>ref|XP_009338856.1| PREDICTED: glutamine synthetase cytosolic isozyme-like [Pyrus 
x bretschneideri]
Length=356

 Score =   236 bits (601),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 111/140 (79%), Positives = 123/140 (88%), Gaps = 0/140 (0%)
 Frame = +3

Query  321  IEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  500
            +  L+NLD++  T KIIAEYIWIGGSG+D RSK+RT+  PV  PS+LPKWNYDGSST QA
Sbjct  4    VSDLINLDLSDSTKKIIAEYIWIGGSGMDIRSKARTLPGPVSDPSKLPKWNYDGSSTNQA  63

Query  501  PGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVVSEV  680
            PGEDSEVILYPQAIFKDPFR GNNILVICDTYTPAGEPIPTNKR  AA+IFS P VV+EV
Sbjct  64   PGEDSEVILYPQAIFKDPFRRGNNILVICDTYTPAGEPIPTNKRAAAAKIFSHPDVVAEV  123

Query  681  PWYGIEQEYTLLQQNVKWPL  740
             WYGIEQEYTLLQ++VKWPL
Sbjct  124  TWYGIEQEYTLLQKDVKWPL  143



>ref|XP_009772493.1| PREDICTED: glutamine synthetase cytosolic isozyme 1-1 [Nicotiana 
sylvestris]
Length=356

 Score =   236 bits (601),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 109/141 (77%), Positives = 122/141 (87%), Gaps = 0/141 (0%)
 Frame = +3

Query  318  RIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQ  497
             +  L+NL ++  T KIIAEYIWIGGSG+D RSK+RT+S PV  PS+LPKWNYDGSSTGQ
Sbjct  3    HLSDLVNLSLSDSTQKIIAEYIWIGGSGMDVRSKARTLSGPVDDPSKLPKWNYDGSSTGQ  62

Query  498  APGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVVSE  677
            APGEDSEVILYPQAIFKDPFR GNNILVICD YTPAGEPIPTNKRH AA+IFS P VV E
Sbjct  63   APGEDSEVILYPQAIFKDPFRRGNNILVICDCYTPAGEPIPTNKRHSAAKIFSHPDVVVE  122

Query  678  VPWYGIEQEYTLLQQNVKWPL  740
             PWYG+EQEYTLLQ+++ WPL
Sbjct  123  EPWYGLEQEYTLLQKDINWPL  143



>ref|NP_176794.1| glutamine synthetase [Arabidopsis thaliana]
 sp|Q8LCE1.2|GLN12_ARATH RecName: Full=Glutamine synthetase cytosolic isozyme 1-2; AltName: 
Full=Glutamate--ammonia ligase GLN1;2; Short=GLN1;2 [Arabidopsis 
thaliana]
 gb|AAG51310.1|AC026480_17 glutamine synthetase, putative [Arabidopsis thaliana]
 gb|AAM14052.1| putative glutamine synthetase [Arabidopsis thaliana]
 gb|AAM67495.1| putative glutamine synthetase [Arabidopsis thaliana]
 gb|AEE34474.1| glutamine synthetase [Arabidopsis thaliana]
Length=356

 Score =   236 bits (601),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 106/140 (76%), Positives = 125/140 (89%), Gaps = 0/140 (0%)
 Frame = +3

Query  321  IEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  500
            +  L+NLD++  + KIIAEYIW+GGSG+D RSK+RT+  PV  PS+LPKWNYDGSSTGQA
Sbjct  4    LADLVNLDISDNSEKIIAEYIWVGGSGMDMRSKARTLPGPVTDPSKLPKWNYDGSSTGQA  63

Query  501  PGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVVSEV  680
            PG+DSEVILYPQAIFKDPFR GNNILV+CD YTPAGEPIPTNKRH AA+IF++P V++EV
Sbjct  64   PGQDSEVILYPQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRHAAAEIFANPDVIAEV  123

Query  681  PWYGIEQEYTLLQQNVKWPL  740
            PWYGIEQEYTLLQ++V WPL
Sbjct  124  PWYGIEQEYTLLQKDVNWPL  143



>gb|AAM63710.1| glutamine synthetase, putative [Arabidopsis thaliana]
Length=356

 Score =   236 bits (601),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 106/140 (76%), Positives = 125/140 (89%), Gaps = 0/140 (0%)
 Frame = +3

Query  321  IEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  500
            +  L+NLD++  + KIIAEYIW+GGSG+D RSK+RT+  PV  PS+LPKWNYDGSSTGQA
Sbjct  4    LADLVNLDISDNSEKIIAEYIWVGGSGMDMRSKARTLPGPVTDPSKLPKWNYDGSSTGQA  63

Query  501  PGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVVSEV  680
            PG+DSEVILYPQAIFKDPFR GNNILV+CD YTPAGEPIPTNKRH AA+IF++P V++EV
Sbjct  64   PGQDSEVILYPQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRHAAAEIFANPDVIAEV  123

Query  681  PWYGIEQEYTLLQQNVKWPL  740
            PWYGIEQEYTLLQ++V WPL
Sbjct  124  PWYGIEQEYTLLQKDVNWPL  143



>dbj|BAE98486.1| glutamine synthetase like protein [Arabidopsis thaliana]
Length=356

 Score =   235 bits (600),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 106/140 (76%), Positives = 125/140 (89%), Gaps = 0/140 (0%)
 Frame = +3

Query  321  IEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  500
            +  L+NLD++  + KIIAEYIW+GGSG+D RSK+RT+  PV  PS+LPKWNYDGSSTGQA
Sbjct  4    LADLVNLDISDNSEKIIAEYIWVGGSGMDMRSKARTLPGPVTDPSKLPKWNYDGSSTGQA  63

Query  501  PGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVVSEV  680
            PG+DSEVILYPQAIFKDPFR GNNILV+CD YTPAGEPIPTNKRH AA+IF++P V++EV
Sbjct  64   PGQDSEVILYPQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRHAAAEIFANPDVIAEV  123

Query  681  PWYGIEQEYTLLQQNVKWPL  740
            PWYGIEQEYTLLQ++V WPL
Sbjct  124  PWYGIEQEYTLLQKDVNWPL  143



>ref|XP_008460506.1| PREDICTED: glutamine synthetase nodule isozyme-like [Cucumis 
melo]
Length=356

 Score =   235 bits (600),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 107/143 (75%), Positives = 125/143 (87%), Gaps = 0/143 (0%)
 Frame = +3

Query  312  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  491
            ++ +  L+NL++  +T+KIIAEYIW+GGSG D RSK+RTIS P   PS+LPKWNYDGSST
Sbjct  1    MSSLSDLINLNLCDFTDKIIAEYIWVGGSGTDVRSKARTISGPTSDPSKLPKWNYDGSST  60

Query  492  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVV  671
            GQAPG+DSEVILYPQAIF+DPFR GNNILVICD+YTPAGE IPTNKRH AA+IF  P VV
Sbjct  61   GQAPGQDSEVILYPQAIFRDPFRKGNNILVICDSYTPAGEAIPTNKRHGAAKIFRHPDVV  120

Query  672  SEVPWYGIEQEYTLLQQNVKWPL  740
            +E PWYGIEQEYTLLQ++VKWPL
Sbjct  121  AEEPWYGIEQEYTLLQKDVKWPL  143



>ref|XP_006374208.1| glutamine synthetase family protein [Populus trichocarpa]
 gb|ERP52005.1| glutamine synthetase family protein [Populus trichocarpa]
Length=348

 Score =   235 bits (599),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 107/140 (76%), Positives = 124/140 (89%), Gaps = 0/140 (0%)
 Frame = +3

Query  321  IEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  500
            +  L+NL+++  T+KIIAEYIWIGGSG+D RSK+RT+   V  P +LPKWNYDGSSTGQA
Sbjct  4    LTDLINLNLSDTTDKIIAEYIWIGGSGMDLRSKARTLDGAVSDPQKLPKWNYDGSSTGQA  63

Query  501  PGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVVSEV  680
            PGEDSEVILYPQAIFKDPFR GNNILV+CD YTPAGEPIPTNKRH AA+IFS P VV+EV
Sbjct  64   PGEDSEVILYPQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRHSAAKIFSHPDVVAEV  123

Query  681  PWYGIEQEYTLLQQNVKWPL  740
            PWYG+EQEYTLLQ+++KWPL
Sbjct  124  PWYGLEQEYTLLQKDLKWPL  143



>ref|XP_011035558.1| PREDICTED: glutamine synthetase cytosolic isozyme 2 [Populus 
euphratica]
Length=356

 Score =   235 bits (599),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 107/140 (76%), Positives = 124/140 (89%), Gaps = 0/140 (0%)
 Frame = +3

Query  321  IEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  500
            +  L+NL+++  T+KIIAEYIWIGGSG+D RSK+RT++  V  P +LPKWNYDGSSTGQA
Sbjct  4    LTDLINLNLSDTTDKIIAEYIWIGGSGMDLRSKARTLTGAVSDPKKLPKWNYDGSSTGQA  63

Query  501  PGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVVSEV  680
            PGEDSEVILYPQAIFKDPFR GNNILV+CD YTPAGEPIPTNKRH AA+IFS P V +EV
Sbjct  64   PGEDSEVILYPQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRHNAAKIFSHPDVAAEV  123

Query  681  PWYGIEQEYTLLQQNVKWPL  740
            PWYGIEQEYTLLQ+++KWPL
Sbjct  124  PWYGIEQEYTLLQKDLKWPL  143



>ref|XP_004162638.1| PREDICTED: glutamine synthetase nodule isozyme-like [Cucumis 
sativus]
Length=356

 Score =   235 bits (599),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 106/143 (74%), Positives = 126/143 (88%), Gaps = 0/143 (0%)
 Frame = +3

Query  312  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  491
            ++ +  L+NLD+  +T+KIIAEYIW+GGSG D RSK+RTIS P+  PS+LPKWNYDGSST
Sbjct  1    MSSLSDLINLDLCDFTDKIIAEYIWVGGSGKDVRSKARTISGPISDPSKLPKWNYDGSST  60

Query  492  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVV  671
            GQAPG+DSEVILYPQAIF+DPFR GNNILVICD+YTP+GE IPTNKRH AA+IFS P VV
Sbjct  61   GQAPGQDSEVILYPQAIFRDPFRRGNNILVICDSYTPSGEAIPTNKRHGAAKIFSHPDVV  120

Query  672  SEVPWYGIEQEYTLLQQNVKWPL  740
            +E PWYGIEQEYTLLQ++V WP+
Sbjct  121  AEEPWYGIEQEYTLLQKDVNWPI  143



>sp|P04770.1|GLNA1_PHAVU RecName: Full=Glutamine synthetase PR-1; AltName: Full=Gln isozyme 
beta; AltName: Full=Glutamate--ammonia ligase [Phaseolus 
vulgaris]
 emb|CAA27631.1| unnamed protein product [Phaseolus vulgaris]
 prf||1208270A synthetase R1,Gln
Length=356

 Score =   235 bits (599),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 107/140 (76%), Positives = 125/140 (89%), Gaps = 0/140 (0%)
 Frame = +3

Query  321  IEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  500
            +  L+NL+++  T K+IAEYIWIGGSG+D RSK+RT+  PV++PSELPKWNYDGSSTGQA
Sbjct  4    LSDLINLNLSDTTEKVIAEYIWIGGSGLDLRSKARTLPGPVKNPSELPKWNYDGSSTGQA  63

Query  501  PGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVVSEV  680
            PG+DSEVI+YPQAIFKDPFR GNNILVICD YTPAGEPIPTNKRH AA+IFS+P VV+E 
Sbjct  64   PGQDSEVIIYPQAIFKDPFRRGNNILVICDAYTPAGEPIPTNKRHNAAKIFSNPDVVAEE  123

Query  681  PWYGIEQEYTLLQQNVKWPL  740
            PWYGIEQEYTLLQ+ V WP+
Sbjct  124  PWYGIEQEYTLLQKEVNWPV  143



>ref|XP_006346760.1| PREDICTED: glutamine synthetase cytosolic isozyme 1-1-like [Solanum 
tuberosum]
Length=356

 Score =   235 bits (599),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 108/141 (77%), Positives = 123/141 (87%), Gaps = 0/141 (0%)
 Frame = +3

Query  318  RIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQ  497
             +  L+NL+++  + KIIAEYIWIGGSG+D RSK+RT+S PV  PS+LPKWNYDGSSTGQ
Sbjct  3    HLSDLVNLNLSDSSEKIIAEYIWIGGSGMDVRSKARTLSGPVDDPSKLPKWNYDGSSTGQ  62

Query  498  APGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVVSE  677
            APGEDSEVILYPQAIFKDPFR GNNILVICD YTPAGEPIPTNKRH AA+IFS+P VV E
Sbjct  63   APGEDSEVILYPQAIFKDPFRRGNNILVICDCYTPAGEPIPTNKRHNAAKIFSNPDVVVE  122

Query  678  VPWYGIEQEYTLLQQNVKWPL  740
             PWYG+EQEYTLLQ+ + WPL
Sbjct  123  EPWYGLEQEYTLLQKEINWPL  143



>gb|KJB10478.1| hypothetical protein B456_001G203300 [Gossypium raimondii]
 gb|KJB10480.1| hypothetical protein B456_001G203300 [Gossypium raimondii]
Length=259

 Score =   231 bits (590),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 108/143 (76%), Positives = 126/143 (88%), Gaps = 0/143 (0%)
 Frame = +3

Query  312  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  491
            ++ +  L+NL+++  T+KIIAEYIWIGGSG+D RSK+RT+S PV  PS+LPKWNYDGSST
Sbjct  1    MSLLTDLVNLNLSDCTDKIIAEYIWIGGSGMDLRSKARTLSGPVSDPSKLPKWNYDGSST  60

Query  492  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVV  671
            GQAPGEDSEVILYPQAIFKDPFR GNNILV+CD YTPAGEPIPTNKR  AA+IFS P V 
Sbjct  61   GQAPGEDSEVILYPQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRCNAAKIFSHPDVA  120

Query  672  SEVPWYGIEQEYTLLQQNVKWPL  740
            +E PWYGIEQEYTLLQ++VKWP+
Sbjct  121  AEEPWYGIEQEYTLLQKDVKWPI  143



>ref|XP_009121474.1| PREDICTED: glutamine synthetase cytosolic isozyme 1-4 [Brassica 
rapa]
Length=356

 Score =   235 bits (599),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 107/143 (75%), Positives = 124/143 (87%), Gaps = 0/143 (0%)
 Frame = +3

Query  312  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  491
            ++ +  L+NLD++  T KIIAEYIWIGGSG+D RSK+RT+  PV+ PSELPKWNYDGSST
Sbjct  1    MSALADLINLDLSDSTEKIIAEYIWIGGSGLDMRSKARTLPGPVKDPSELPKWNYDGSST  60

Query  492  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVV  671
            GQAPG DSEVILYPQAIFKDPFR GNNILV+CD YTPAGEPIP NKRH AA+IFSDP V 
Sbjct  61   GQAPGSDSEVILYPQAIFKDPFRRGNNILVMCDAYTPAGEPIPANKRHAAAKIFSDPSVA  120

Query  672  SEVPWYGIEQEYTLLQQNVKWPL  740
            +E  WYGIEQEYTLLQ+++KWP+
Sbjct  121  AEETWYGIEQEYTLLQKDIKWPV  143



>gb|KGN51032.1| Glutamine synthetase [Cucumis sativus]
Length=356

 Score =   234 bits (598),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 106/143 (74%), Positives = 125/143 (87%), Gaps = 0/143 (0%)
 Frame = +3

Query  312  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  491
            ++ +  L+NLD+  +T+KIIAEYIW+GGSG D RSK+RTIS P+  PS+LPKWNYDGSST
Sbjct  1    MSSLSDLINLDLCDFTDKIIAEYIWVGGSGKDVRSKARTISGPISDPSKLPKWNYDGSST  60

Query  492  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVV  671
            GQAPG+DSEVILYPQAIF+DPFR GNNILVICD+YTP GE IPTNKRH AA+IFS P VV
Sbjct  61   GQAPGQDSEVILYPQAIFRDPFRRGNNILVICDSYTPGGEAIPTNKRHGAAKIFSHPDVV  120

Query  672  SEVPWYGIEQEYTLLQQNVKWPL  740
            +E PWYGIEQEYTLLQ++V WP+
Sbjct  121  AEEPWYGIEQEYTLLQKDVNWPI  143



>gb|AIK03054.1| glutamine synthetase [Eichhornia crassipes]
Length=356

 Score =   234 bits (598),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 108/140 (77%), Positives = 124/140 (89%), Gaps = 0/140 (0%)
 Frame = +3

Query  321  IEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  500
            +  L+NL+++  T K+IAEYIWIGGSG+D RSK+RT+  PV  PS+LPKWNYDGSSTGQA
Sbjct  4    LTDLINLNLSDTTEKVIAEYIWIGGSGMDMRSKARTLPGPVTDPSQLPKWNYDGSSTGQA  63

Query  501  PGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVVSEV  680
            PGEDSEVILYPQAIFKDPFR GNNILV+CD YTPAGEPIPTN R+ AA+IFS P VV+EV
Sbjct  64   PGEDSEVILYPQAIFKDPFRRGNNILVMCDCYTPAGEPIPTNNRYNAAKIFSHPDVVAEV  123

Query  681  PWYGIEQEYTLLQQNVKWPL  740
            PWYGIEQEYTLLQ++VKWPL
Sbjct  124  PWYGIEQEYTLLQKDVKWPL  143



>sp|P32289.1|GLNA_VIGAC RecName: Full=Glutamine synthetase nodule isozyme; Short=GS; 
AltName: Full=Glutamate--ammonia ligase [Vigna aconitifolia]
 gb|AAA34239.1| glutamine synthetase [Vigna aconitifolia]
 prf||2106409A Gln synthetase
Length=356

 Score =   234 bits (598),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 108/140 (77%), Positives = 123/140 (88%), Gaps = 0/140 (0%)
 Frame = +3

Query  321  IEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  500
            +  L+NL+++  T KIIAEYIWIGGSG+D RSK+RT+  PV  PS+LPKWNYDGSSTGQA
Sbjct  4    LSDLINLNLSDTTEKIIAEYIWIGGSGLDLRSKARTLPGPVSDPSKLPKWNYDGSSTGQA  63

Query  501  PGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVVSEV  680
            PGEDSEVI+YPQAIFKDPFR GNNILV+CD YTPAGEPIPTNKRH AA+IFS P VV+E 
Sbjct  64   PGEDSEVIIYPQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRHNAAKIFSHPDVVAEE  123

Query  681  PWYGIEQEYTLLQQNVKWPL  740
            PWYGIEQEYTLLQ++V WPL
Sbjct  124  PWYGIEQEYTLLQKDVNWPL  143



>ref|XP_004236686.1| PREDICTED: glutamine synthetase cytosolic isozyme 1-1 [Solanum 
lycopersicum]
Length=356

 Score =   234 bits (598),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 108/141 (77%), Positives = 123/141 (87%), Gaps = 0/141 (0%)
 Frame = +3

Query  318  RIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQ  497
             +  L+NL+++  + KIIAEYIWIGGSG+D RSK+RT+S PV  PS+LPKWNYDGSSTGQ
Sbjct  3    HLSDLVNLNLSDSSEKIIAEYIWIGGSGMDVRSKARTLSGPVDDPSKLPKWNYDGSSTGQ  62

Query  498  APGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVVSE  677
            APGEDSEVILYPQAIFKDPFR GNNILVICD YTPAGEPIPTNKRH AA+IFS+P VV E
Sbjct  63   APGEDSEVILYPQAIFKDPFRRGNNILVICDCYTPAGEPIPTNKRHNAAKIFSNPNVVVE  122

Query  678  VPWYGIEQEYTLLQQNVKWPL  740
             PWYG+EQEYTLLQ+ + WPL
Sbjct  123  EPWYGLEQEYTLLQKEINWPL  143



>gb|KJB10479.1| hypothetical protein B456_001G203300 [Gossypium raimondii]
Length=309

 Score =   233 bits (594),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 108/140 (77%), Positives = 124/140 (89%), Gaps = 0/140 (0%)
 Frame = +3

Query  321  IEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  500
            +  L+NL+++  T+KIIAEYIWIGGSG+D RSK+RT+S PV  PS+LPKWNYDGSSTGQA
Sbjct  4    LTDLVNLNLSDCTDKIIAEYIWIGGSGMDLRSKARTLSGPVSDPSKLPKWNYDGSSTGQA  63

Query  501  PGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVVSEV  680
            PGEDSEVILYPQAIFKDPFR GNNILV+CD YTPAGEPIPTNKR  AA+IFS P V +E 
Sbjct  64   PGEDSEVILYPQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRCNAAKIFSHPDVAAEE  123

Query  681  PWYGIEQEYTLLQQNVKWPL  740
            PWYGIEQEYTLLQ++VKWP+
Sbjct  124  PWYGIEQEYTLLQKDVKWPI  143



>ref|XP_006405853.1| hypothetical protein EUTSA_v10027817mg [Eutrema salsugineum]
 gb|ESQ47306.1| hypothetical protein EUTSA_v10027817mg [Eutrema salsugineum]
Length=356

 Score =   234 bits (598),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 107/140 (76%), Positives = 124/140 (89%), Gaps = 0/140 (0%)
 Frame = +3

Query  321  IEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  500
            +  L+NL+++  T+KIIAEYIW+GGSG+D RSK+RT+  PV  PS+LPKWNYDGSSTGQA
Sbjct  4    LADLVNLNLSETTDKIIAEYIWVGGSGMDMRSKARTLPGPVSDPSKLPKWNYDGSSTGQA  63

Query  501  PGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVVSEV  680
            PGEDSEVILYPQAIFKDPFR GNNILV+CD YTPAGEPIPTNKRH AA++FS P VV+EV
Sbjct  64   PGEDSEVILYPQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRHAAAKVFSHPDVVAEV  123

Query  681  PWYGIEQEYTLLQQNVKWPL  740
            PWYGIEQEYTLLQ+ V WP+
Sbjct  124  PWYGIEQEYTLLQKEVNWPV  143



>sp|Q42899.2|GLNA1_LOTJA RecName: Full=Glutamine synthetase cytosolic isozyme; AltName: 
Full=GS1; AltName: Full=Glutamate--ammonia ligase [Lotus japonicus]
Length=356

 Score =   234 bits (598),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 107/140 (76%), Positives = 124/140 (89%), Gaps = 0/140 (0%)
 Frame = +3

Query  321  IEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  500
            +  L+NL+++  T+KIIAEYIWIGGSG+D RSK+RT+  PV  PS+LPKWNYDGSSTGQA
Sbjct  4    LSDLINLNLSETTDKIIAEYIWIGGSGLDMRSKARTLPGPVSDPSQLPKWNYDGSSTGQA  63

Query  501  PGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVVSEV  680
            PGEDSEVILYPQAIF+DPFR G+NILVICD YTPAGEPIPTNKRH AA++FS P VV+EV
Sbjct  64   PGEDSEVILYPQAIFRDPFRRGSNILVICDAYTPAGEPIPTNKRHAAAKVFSHPDVVAEV  123

Query  681  PWYGIEQEYTLLQQNVKWPL  740
            PWYGIEQEYTLLQ+ V WP+
Sbjct  124  PWYGIEQEYTLLQKEVNWPV  143



>gb|ABK94916.1| unknown [Populus trichocarpa]
Length=356

 Score =   234 bits (598),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 107/140 (76%), Positives = 124/140 (89%), Gaps = 0/140 (0%)
 Frame = +3

Query  321  IEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  500
            +  L+NL+++  T+KIIAEYIWIGGSG+D RSK+RT+   V  P +LPKWNYDGSSTGQA
Sbjct  4    LTDLINLNLSDTTDKIIAEYIWIGGSGMDLRSKARTLDGAVSDPQKLPKWNYDGSSTGQA  63

Query  501  PGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVVSEV  680
            PGEDSEVILYPQAIFKDPFR GNNILV+CD YTPAGEPIPTNKRH AA+IFS P VV+EV
Sbjct  64   PGEDSEVILYPQAIFKDPFRRGNNILVMCDAYTPAGEPIPTNKRHSAAKIFSHPDVVAEV  123

Query  681  PWYGIEQEYTLLQQNVKWPL  740
            PWYG+EQEYTLLQ+++KWPL
Sbjct  124  PWYGLEQEYTLLQKDLKWPL  143



>ref|XP_006400196.1| hypothetical protein EUTSA_v10013948mg [Eutrema salsugineum]
 dbj|BAJ34289.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ41649.1| hypothetical protein EUTSA_v10013948mg [Eutrema salsugineum]
Length=356

 Score =   234 bits (597),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 106/143 (74%), Positives = 127/143 (89%), Gaps = 0/143 (0%)
 Frame = +3

Query  312  VNRIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSST  491
            ++ +  L+NLD++  T +IIAEYIW+GGSG+D RSK+RT+  PV+ PSELPKWNYDGSST
Sbjct  1    MSALADLINLDLSNSTKQIIAEYIWVGGSGLDMRSKARTLPGPVKDPSELPKWNYDGSST  60

Query  492  GQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVV  671
            GQAPG+DSEVILYPQAIF+DPFR GNNILV+CD YTPAGEPIP+NKRH AA+IFSDP VV
Sbjct  61   GQAPGDDSEVILYPQAIFRDPFRRGNNILVMCDAYTPAGEPIPSNKRHAAAKIFSDPSVV  120

Query  672  SEVPWYGIEQEYTLLQQNVKWPL  740
            +E  WYGIEQEYTLLQ++VKWP+
Sbjct  121  AEETWYGIEQEYTLLQKDVKWPV  143



>ref|XP_009614064.1| PREDICTED: glutamine synthetase cytosolic isozyme 1-1-like [Nicotiana 
tomentosiformis]
Length=356

 Score =   234 bits (597),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 108/141 (77%), Positives = 122/141 (87%), Gaps = 0/141 (0%)
 Frame = +3

Query  318  RIEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQ  497
             +  L+NL+++  T KIIAEYIWIGGSG+D RSK+RT+S PV  PS+LPKWNYDGSSTGQ
Sbjct  3    HLSDLVNLNLSDSTQKIIAEYIWIGGSGMDVRSKARTLSGPVDDPSKLPKWNYDGSSTGQ  62

Query  498  APGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVVSE  677
            APGEDSEVILYPQAIFKDPFR GNNILVICD YTP GEPIPTNKRH AA+IFS P VV E
Sbjct  63   APGEDSEVILYPQAIFKDPFRRGNNILVICDCYTPTGEPIPTNKRHSAAKIFSHPDVVVE  122

Query  678  VPWYGIEQEYTLLQQNVKWPL  740
             PWYG+EQEYTLLQ+++ WPL
Sbjct  123  EPWYGLEQEYTLLQKDINWPL  143



>emb|CCO25538.1| glutamine synthetase [Pinus pinaster]
Length=355

 Score =   234 bits (597),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 109/140 (78%), Positives = 122/140 (87%), Gaps = 0/140 (0%)
 Frame = +3

Query  321  IEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  500
            +  L+NLD++  T KIIAEYIWIGGSG+D RSK+RT+S PV  P +LPKWNYDGSSTGQA
Sbjct  4    LTDLINLDLSDVTEKIIAEYIWIGGSGMDIRSKARTLSHPVTDPKDLPKWNYDGSSTGQA  63

Query  501  PGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVVSEV  680
            PG+DSEVILYPQAIF+DPFR GNNILVICDTYTPAGEPIPTNKR  AA+IFS P VV E 
Sbjct  64   PGKDSEVILYPQAIFRDPFRRGNNILVICDTYTPAGEPIPTNKRANAAKIFSHPDVVVEE  123

Query  681  PWYGIEQEYTLLQQNVKWPL  740
            PWYGIEQEYTLLQ++V WPL
Sbjct  124  PWYGIEQEYTLLQKDVNWPL  143



>ref|XP_006406687.1| hypothetical protein EUTSA_v10021026mg [Eutrema salsugineum]
 gb|ESQ48140.1| hypothetical protein EUTSA_v10021026mg [Eutrema salsugineum]
Length=354

 Score =   234 bits (597),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 105/140 (75%), Positives = 124/140 (89%), Gaps = 0/140 (0%)
 Frame = +3

Query  321  IEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  500
            +  L+NL+++  T KIIAEYIWIGGSG+D RSK+RT+  PV  PS+LPKWNYDGSSTGQA
Sbjct  4    LSDLVNLNLSDATEKIIAEYIWIGGSGMDIRSKARTLPGPVSDPSKLPKWNYDGSSTGQA  63

Query  501  PGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVVSEV  680
             G+DSEVILYPQAIF+DPFRGG NILV+CD YTPAG+PIPTNKRH+AA+IFSDPKV SE 
Sbjct  64   AGDDSEVILYPQAIFRDPFRGGKNILVMCDAYTPAGDPIPTNKRHKAAKIFSDPKVASEE  123

Query  681  PWYGIEQEYTLLQQNVKWPL  740
            PWYGIEQEYTL+Q++V WP+
Sbjct  124  PWYGIEQEYTLMQKDVNWPI  143



>gb|AFN42876.1| glutamine synthetase [Camellia sinensis]
Length=356

 Score =   234 bits (597),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 108/140 (77%), Positives = 122/140 (87%), Gaps = 0/140 (0%)
 Frame = +3

Query  321  IEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  500
            +  L+NLD++  T K+IAEYIWIGGSG+D RSK+RT+S PV  P +LPKWNYDGSSTGQA
Sbjct  4    LSDLINLDLSDTTEKVIAEYIWIGGSGMDLRSKARTLSGPVSDPKKLPKWNYDGSSTGQA  63

Query  501  PGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVVSEV  680
            PGEDSEVI+YPQAIFKDPFR GNNILV+CDTYTP GEPIPTNKR  AA+IFS P VV+E 
Sbjct  64   PGEDSEVIIYPQAIFKDPFRRGNNILVMCDTYTPGGEPIPTNKRFNAAKIFSHPDVVAEE  123

Query  681  PWYGIEQEYTLLQQNVKWPL  740
            PWYGIEQEYTLLQ+ VKWPL
Sbjct  124  PWYGIEQEYTLLQKQVKWPL  143



>ref|XP_009370058.1| PREDICTED: glutamine synthetase cytosolic isozyme-like [Pyrus 
x bretschneideri]
Length=356

 Score =   234 bits (597),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 110/140 (79%), Positives = 122/140 (87%), Gaps = 0/140 (0%)
 Frame = +3

Query  321  IEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  500
            +  L+NLD++  T KIIAEYIWIGGSG+D RSK+RT+  PV  PS+LPKWNYDGSST QA
Sbjct  4    VSDLINLDLSDSTKKIIAEYIWIGGSGMDIRSKARTLPGPVSDPSKLPKWNYDGSSTNQA  63

Query  501  PGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVVSEV  680
            PGEDSEVILYPQAIFKDPFR GNNILVICDTYTPAGEPIPTNKR  AA+IFS P VV+EV
Sbjct  64   PGEDSEVILYPQAIFKDPFRRGNNILVICDTYTPAGEPIPTNKRAAAAKIFSHPDVVAEV  123

Query  681  PWYGIEQEYTLLQQNVKWPL  740
             WYGIEQEYTLLQ++V WPL
Sbjct  124  TWYGIEQEYTLLQKDVNWPL  143



>ref|XP_004953842.1| PREDICTED: glutamine synthetase cytosolic isozyme 1-1-like [Setaria 
italica]
Length=356

 Score =   234 bits (597),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 108/140 (77%), Positives = 124/140 (89%), Gaps = 0/140 (0%)
 Frame = +3

Query  321  IEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  500
            +  L+NL+++  T KIIAEYIWIGGSG+D RSK+RT+S PV  PS+LPKWNYDGSSTGQA
Sbjct  4    LTDLVNLNLSDTTEKIIAEYIWIGGSGMDLRSKARTLSGPVTDPSKLPKWNYDGSSTGQA  63

Query  501  PGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVVSEV  680
            PGEDSEVILYPQAIFKDPFR GNNILV+CD YTPAGEPIPTNKRH AA+IFS+P+V +E 
Sbjct  64   PGEDSEVILYPQAIFKDPFRKGNNILVMCDCYTPAGEPIPTNKRHNAAKIFSNPEVSAEE  123

Query  681  PWYGIEQEYTLLQQNVKWPL  740
            PWYGIEQEYTLLQ++  WPL
Sbjct  124  PWYGIEQEYTLLQKDTNWPL  143



>emb|CAA63963.1| glutamate synthetase [Lotus japonicus]
Length=356

 Score =   234 bits (597),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 107/140 (76%), Positives = 124/140 (89%), Gaps = 0/140 (0%)
 Frame = +3

Query  321  IEQLLNLDVTPYTNKIIAEYIWIGGSGIDTRSKSRTISKPVQHPSELPKWNYDGSSTGQA  500
            +  L+NL+++  T+KIIAEYIWIGGSG+D RSK+RT+  PV  PS+LPKWNYDGSSTGQA
Sbjct  4    LSDLINLNLSETTDKIIAEYIWIGGSGLDMRSKARTLPGPVSDPSQLPKWNYDGSSTGQA  63

Query  501  PGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRHRAAQIFSDPKVVSEV  680
            PGEDSEVILYPQAIF+DPFR G+NILVICD YTPAGEPIPTNKRH AA++FS P VV+EV
Sbjct  64   PGEDSEVILYPQAIFRDPFRRGSNILVICDAYTPAGEPIPTNKRHAAAKVFSHPDVVAEV  123

Query  681  PWYGIEQEYTLLQQNVKWPL  740
            PWYGIEQEYTLLQ+ V WP+
Sbjct  124  PWYGIEQEYTLLQKEVNWPV  143



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1580279231195