BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF044I11

Length=778
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009599211.1|  PREDICTED: uncharacterized protein LOC104094898    225   1e-65   Nicotiana tomentosiformis
ref|XP_009769229.1|  PREDICTED: uncharacterized protein LOC104220112    216   3e-62   Nicotiana sylvestris
emb|CDP03590.1|  unnamed protein product                                205   4e-58   Coffea canephora [robusta coffee]
ref|XP_004247488.1|  PREDICTED: uncharacterized protein LOC101267646    199   8e-56   Solanum lycopersicum
ref|XP_011079798.1|  PREDICTED: uncharacterized protein LOC105163227    193   7e-54   Sesamum indicum [beniseed]
ref|XP_006358433.1|  PREDICTED: uncharacterized protein LOC102603657    187   2e-51   Solanum tuberosum [potatoes]
ref|XP_009774650.1|  PREDICTED: uncharacterized protein LOC104224666    179   1e-48   Nicotiana sylvestris
ref|XP_009607167.1|  PREDICTED: uncharacterized protein LOC104101431    177   1e-47   Nicotiana tomentosiformis
ref|XP_002524804.1|  conserved hypothetical protein                     166   1e-43   
ref|XP_002271361.1|  PREDICTED: uncharacterized protein LOC100256341    162   1e-42   Vitis vinifera
gb|KDP21510.1|  hypothetical protein JCGZ_21981                         162   2e-42   Jatropha curcas
ref|XP_006352790.1|  PREDICTED: uncharacterized protein LOC102602285    162   2e-42   Solanum tuberosum [potatoes]
ref|XP_010255802.1|  PREDICTED: uncharacterized protein LOC104596...    159   4e-41   Nelumbo nucifera [Indian lotus]
ref|XP_010255801.1|  PREDICTED: uncharacterized protein LOC104596...    159   4e-41   Nelumbo nucifera [Indian lotus]
ref|XP_010323031.1|  PREDICTED: uncharacterized protein LOC101258968    157   1e-40   Solanum lycopersicum
gb|KJB42034.1|  hypothetical protein B456_007G133500                    150   2e-39   Gossypium raimondii
ref|XP_011082539.1|  PREDICTED: uncharacterized protein LOC105165276    153   3e-39   Sesamum indicum [beniseed]
ref|XP_010279049.1|  PREDICTED: uncharacterized protein LOC104613055    151   2e-38   Nelumbo nucifera [Indian lotus]
ref|XP_004290685.2|  PREDICTED: uncharacterized protein LOC101299256    148   2e-37   Fragaria vesca subsp. vesca
ref|XP_007162387.1|  hypothetical protein PHAVU_001G147800g             148   2e-37   Phaseolus vulgaris [French bean]
ref|XP_007144595.1|  hypothetical protein PHAVU_007G168900g             145   3e-37   Phaseolus vulgaris [French bean]
gb|KJB42033.1|  hypothetical protein B456_007G133500                    147   3e-37   Gossypium raimondii
gb|EYU46628.1|  hypothetical protein MIMGU_mgv1a003933mg                147   4e-37   Erythranthe guttata [common monkey flower]
ref|XP_007050694.1|  Transport protein sec31 isoform 1                  147   5e-37   
ref|XP_011033673.1|  PREDICTED: uncharacterized protein LOC105132083    145   2e-36   Populus euphratica
ref|XP_007144596.1|  hypothetical protein PHAVU_007G168900g             145   2e-36   Phaseolus vulgaris [French bean]
ref|XP_006287389.1|  hypothetical protein CARUB_v10000595mg             145   3e-36   Capsella rubella
ref|XP_004496294.1|  PREDICTED: uncharacterized protein LOC101493086    144   4e-36   
gb|KHG19647.1|  putative alpha-ketoglutarate-dependent dioxygenas...    144   4e-36   Gossypium arboreum [tree cotton]
ref|XP_003520217.1|  PREDICTED: uncharacterized protein LOC100791586    144   5e-36   Glycine max [soybeans]
gb|KGN44860.1|  hypothetical protein Csa_7G392330                       144   9e-36   Cucumis sativus [cucumbers]
ref|XP_006588616.1|  PREDICTED: uncharacterized protein LOC100802371    143   1e-35   Glycine max [soybeans]
ref|XP_008451400.1|  PREDICTED: uncharacterized protein LOC103492703    143   1e-35   Cucumis melo [Oriental melon]
ref|XP_009356724.1|  PREDICTED: uncharacterized protein LOC103947542    142   2e-35   Pyrus x bretschneideri [bai li]
ref|XP_006604416.1|  PREDICTED: uncharacterized protein LOC100776...    139   2e-35   
ref|XP_008386575.1|  PREDICTED: uncharacterized protein LOC103449078    142   2e-35   Malus domestica [apple tree]
ref|XP_007201711.1|  hypothetical protein PRUPE_ppa003815mg             141   7e-35   Prunus persica
gb|KHN18902.1|  hypothetical protein glysoja_028271                     140   8e-35   Glycine soja [wild soybean]
ref|XP_007050695.1|  Oxidoreductase, 2OG-Fe(II) oxygenase family ...    139   1e-34   
ref|XP_004158952.1|  PREDICTED: uncharacterized LOC101203670            140   1e-34   
ref|XP_004148896.1|  PREDICTED: uncharacterized protein LOC101203670    140   1e-34   
ref|XP_008234920.1|  PREDICTED: uncharacterized protein LOC103333806    140   1e-34   Prunus mume [ume]
ref|XP_006396520.1|  hypothetical protein EUTSA_v10028541mg             139   2e-34   Eutrema salsugineum [saltwater cress]
ref|XP_006604415.1|  PREDICTED: uncharacterized protein LOC100776...    139   2e-34   Glycine max [soybeans]
gb|EPS66942.1|  hypothetical protein M569_07834                         132   3e-34   Genlisea aurea
ref|XP_006444148.1|  hypothetical protein CICLE_v10019581mg             139   4e-34   Citrus clementina [clementine]
ref|XP_006576883.1|  PREDICTED: uncharacterized protein LOC100796344    137   1e-33   
emb|CDY21924.1|  BnaC09g00300D                                          131   2e-33   Brassica napus [oilseed rape]
ref|XP_004493638.1|  PREDICTED: uncharacterized protein LOC101495753    137   2e-33   Cicer arietinum [garbanzo]
ref|XP_006380087.1|  hypothetical protein POPTR_0008s21800g             130   2e-33   
ref|XP_010070256.1|  PREDICTED: uncharacterized protein LOC104457...    136   2e-33   Eucalyptus grandis [rose gum]
ref|XP_002874886.1|  oxidoreductase                                     136   3e-33   
ref|XP_010455955.1|  PREDICTED: uncharacterized protein LOC104737461    135   8e-33   Camelina sativa [gold-of-pleasure]
ref|NP_192203.1|  oxidoreductase, 2OG-Fe(II) oxygenase family pro...    135   9e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002321056.1|  oxidoreductase family protein                      134   1e-32   
emb|CDY22086.1|  BnaA09g01150D                                          134   2e-32   Brassica napus [oilseed rape]
ref|XP_010070257.1|  PREDICTED: uncharacterized protein LOC104457...    134   2e-32   
ref|XP_010696340.1|  PREDICTED: uncharacterized protein LOC104908870    134   2e-32   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010038135.1|  PREDICTED: uncharacterized protein LOC104426697    134   3e-32   Eucalyptus grandis [rose gum]
ref|XP_010422515.1|  PREDICTED: uncharacterized protein LOC104707789    133   4e-32   Camelina sativa [gold-of-pleasure]
ref|XP_009111249.1|  PREDICTED: uncharacterized protein LOC103836707    132   8e-32   Brassica rapa
gb|KFK30895.1|  hypothetical protein AALP_AA6G039900                    132   1e-31   Arabis alpina [alpine rockcress]
ref|XP_010938799.1|  PREDICTED: uncharacterized protein LOC105057798    131   2e-31   Elaeis guineensis
ref|XP_010542876.1|  PREDICTED: uncharacterized protein LOC104815949    130   3e-31   Tarenaya hassleriana [spider flower]
ref|XP_003591621.1|  hypothetical protein MTR_1g089860                  130   4e-31   
gb|KEH23703.1|  2OG-Fe(II) oxygenase family oxidoreductase              129   6e-31   Medicago truncatula
gb|KEH43287.1|  2OG-Fe(II) oxygenase family oxidoreductase              128   7e-31   Medicago truncatula
ref|XP_010507817.1|  PREDICTED: uncharacterized protein LOC104784...    127   1e-30   Camelina sativa [gold-of-pleasure]
ref|XP_010507816.1|  PREDICTED: uncharacterized protein LOC104784...    127   1e-30   
ref|XP_009412173.1|  PREDICTED: uncharacterized protein LOC103993726    129   1e-30   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAT85148.1|  hypothetical protein                                    125   1e-30   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010430544.1|  PREDICTED: uncharacterized protein LOC104714781    129   2e-30   Camelina sativa [gold-of-pleasure]
gb|KEH43288.1|  2OG-Fe(II) oxygenase family oxidoreductase              127   4e-30   Medicago truncatula
ref|XP_010506854.1|  PREDICTED: uncharacterized protein LOC104783394    127   4e-30   Camelina sativa [gold-of-pleasure]
ref|XP_008779525.1|  PREDICTED: uncharacterized protein LOC103699262    121   5e-30   
gb|EMT23126.1|  hypothetical protein F775_27645                         121   6e-30   
ref|XP_002882147.1|  hypothetical protein ARALYDRAFT_322448             126   7e-30   
gb|KCW49947.1|  hypothetical protein EUGRSUZ_K03407                     126   1e-29   Eucalyptus grandis [rose gum]
ref|XP_010905740.1|  PREDICTED: uncharacterized protein LOC105032859    125   1e-29   Elaeis guineensis
gb|KJB23151.1|  hypothetical protein B456_004G083800                    125   2e-29   Gossypium raimondii
ref|XP_008809230.1|  PREDICTED: uncharacterized protein LOC103721...    125   3e-29   Phoenix dactylifera
ref|XP_008809229.1|  PREDICTED: uncharacterized protein LOC103721...    125   3e-29   Phoenix dactylifera
ref|NP_182329.2|  oxidoreductase, 2OG-Fe(II) oxygenase family pro...    124   3e-29   Arabidopsis thaliana [mouse-ear cress]
gb|AAD13711.1|  unknown protein                                         124   3e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010090348.1|  hypothetical protein L484_025013                   125   4e-29   
gb|ACG28401.1|  hypothetical protein                                    119   6e-29   Zea mays [maize]
gb|KHF97715.1|  putative alpha-ketoglutarate-dependent dioxygenas...    124   9e-29   Gossypium arboreum [tree cotton]
ref|XP_009402473.1|  PREDICTED: uncharacterized protein LOC103986253    123   1e-28   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDX80147.1|  BnaA05g00090D                                          122   1e-28   
ref|XP_009393115.1|  PREDICTED: uncharacterized protein LOC103978888    123   1e-28   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009142484.1|  PREDICTED: uncharacterized protein LOC103866...    122   2e-28   
ref|XP_009142483.1|  PREDICTED: uncharacterized protein LOC103866...    122   2e-28   Brassica rapa
gb|EEC79195.1|  hypothetical protein OsI_19903                          124   2e-28   Oryza sativa Indica Group [Indian rice]
ref|XP_003568474.1|  PREDICTED: uncharacterized protein LOC100841...    121   7e-28   Brachypodium distachyon [annual false brome]
dbj|BAJ97023.1|  predicted protein                                      121   7e-28   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010231391.1|  PREDICTED: uncharacterized protein LOC100841...    121   7e-28   Brachypodium distachyon [annual false brome]
ref|XP_008647787.1|  PREDICTED: oxidoreductase, 2OG-Fe oxygenase ...    120   2e-27   
emb|CDY55191.1|  BnaCnng28350D                                          119   3e-27   Brassica napus [oilseed rape]
ref|XP_010524003.1|  PREDICTED: uncharacterized protein LOC104802219    117   7e-27   Tarenaya hassleriana [spider flower]
ref|XP_008656187.1|  PREDICTED: uncharacterized protein LOC103635534    119   8e-27   Zea mays [maize]
ref|XP_002441065.1|  hypothetical protein SORBIDRAFT_09g019740          117   4e-26   Sorghum bicolor [broomcorn]
ref|XP_006296016.1|  hypothetical protein CARUB_v10025161mg             115   5e-26   Capsella rubella
gb|KFK37557.1|  hypothetical protein AALP_AA4G272300                    111   1e-24   Arabis alpina [alpine rockcress]
ref|XP_004962145.1|  PREDICTED: uncharacterized protein LOC101766885    111   3e-24   Setaria italica
ref|XP_006398000.1|  hypothetical protein EUTSA_v10001455mg             109   6e-24   Eutrema salsugineum [saltwater cress]
ref|XP_006850839.1|  hypothetical protein AMTR_s00025p00132890        95.1    2e-20   
ref|XP_002990560.1|  hypothetical protein SELMODRAFT_428958           97.8    2e-19   Selaginella moellendorffii
ref|XP_002983652.1|  hypothetical protein SELMODRAFT_422939           97.4    2e-19   Selaginella moellendorffii
ref|XP_010553493.1|  PREDICTED: uncharacterized protein LOC104823...  93.2    7e-18   Tarenaya hassleriana [spider flower]
ref|XP_010553484.1|  PREDICTED: uncharacterized protein LOC104823...  93.2    7e-18   Tarenaya hassleriana [spider flower]
ref|XP_010553471.1|  PREDICTED: uncharacterized protein LOC104823...  93.2    8e-18   Tarenaya hassleriana [spider flower]
gb|EPS61206.1|  hypothetical protein M569_13594                       86.3    1e-17   Genlisea aurea
ref|XP_002979579.1|  hypothetical protein SELMODRAFT_419200           89.7    9e-17   
ref|XP_002977694.1|  hypothetical protein SELMODRAFT_443630           89.4    1e-16   
gb|KGN49669.1|  hypothetical protein Csa_5G056080                     87.0    1e-16   Cucumis sativus [cucumbers]
gb|KJB30648.1|  hypothetical protein B456_005G153400                  88.6    2e-16   Gossypium raimondii
ref|XP_007045467.1|  Hydroxyproline-rich glycoprotein family prot...  88.6    3e-16   
ref|XP_007045468.1|  Hydroxyproline-rich glycoprotein family prot...  88.6    3e-16   
gb|KJB30646.1|  hypothetical protein B456_005G153400                  88.6    3e-16   Gossypium raimondii
gb|KJB30647.1|  hypothetical protein B456_005G153400                  88.6    3e-16   Gossypium raimondii
ref|XP_004297399.1|  PREDICTED: uncharacterized protein LOC101309147  87.8    4e-16   Fragaria vesca subsp. vesca
ref|XP_004142291.1|  PREDICTED: uncharacterized protein LOC101210274  87.8    5e-16   Cucumis sativus [cucumbers]
gb|KJB60865.1|  hypothetical protein B456_009G328700                  87.4    6e-16   Gossypium raimondii
gb|KJB60862.1|  hypothetical protein B456_009G328700                  87.4    6e-16   Gossypium raimondii
gb|KJB60866.1|  hypothetical protein B456_009G328700                  87.4    7e-16   Gossypium raimondii
gb|KJB60864.1|  hypothetical protein B456_009G328700                  87.0    7e-16   Gossypium raimondii
gb|KJB60863.1|  hypothetical protein B456_009G328700                  87.0    7e-16   Gossypium raimondii
ref|XP_010105545.1|  hypothetical protein L484_019288                 87.4    7e-16   Morus notabilis
ref|XP_010271173.1|  PREDICTED: uncharacterized protein LOC104607267  87.0    8e-16   Nelumbo nucifera [Indian lotus]
ref|XP_006849434.1|  hypothetical protein AMTR_s00024p00040890        87.0    8e-16   Amborella trichopoda
ref|XP_010241461.1|  PREDICTED: uncharacterized protein LOC104586031  87.0    8e-16   Nelumbo nucifera [Indian lotus]
ref|NP_563957.1|  hydroxyproline-rich glycoprotein-like protein       86.7    8e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006307004.1|  hypothetical protein CARUB_v10008596mg           87.0    9e-16   Capsella rubella
dbj|BAH19958.1|  AT1G14710                                            86.7    9e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010458983.1|  PREDICTED: uncharacterized protein LOC104740153  87.0    9e-16   Camelina sativa [gold-of-pleasure]
gb|AAF79247.1|AC006917_32  F10B6.11                                   86.7    1e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008454723.1|  PREDICTED: uncharacterized protein LOC103495...  86.7    1e-15   
ref|XP_008454722.1|  PREDICTED: uncharacterized protein LOC103495...  86.7    1e-15   Cucumis melo [Oriental melon]
ref|XP_002892824.1|  hypothetical protein ARALYDRAFT_471658           86.3    1e-15   
ref|XP_002527549.1|  conserved hypothetical protein                   85.9    2e-15   Ricinus communis
ref|XP_010476539.1|  PREDICTED: uncharacterized protein LOC104755...  85.5    3e-15   Camelina sativa [gold-of-pleasure]
ref|XP_010476540.1|  PREDICTED: uncharacterized protein LOC104755...  85.5    3e-15   Camelina sativa [gold-of-pleasure]
ref|XP_009390867.1|  PREDICTED: uncharacterized protein LOC103977...  85.5    3e-15   
ref|XP_011070539.1|  PREDICTED: uncharacterized protein LOC105156...  85.5    3e-15   Sesamum indicum [beniseed]
ref|XP_008360022.1|  PREDICTED: uncharacterized protein LOC103423718  85.5    3e-15   
ref|XP_011070538.1|  PREDICTED: uncharacterized protein LOC105156...  85.5    3e-15   Sesamum indicum [beniseed]
emb|CBI26785.3|  unnamed protein product                              85.5    3e-15   Vitis vinifera
ref|XP_010648352.1|  PREDICTED: uncharacterized protein LOC100252...  85.5    3e-15   
ref|XP_010648465.1|  PREDICTED: uncharacterized protein LOC100252...  85.5    3e-15   Vitis vinifera
ref|XP_009390865.1|  PREDICTED: uncharacterized protein LOC103977...  85.5    3e-15   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010648423.1|  PREDICTED: uncharacterized protein LOC100252...  85.5    3e-15   Vitis vinifera
ref|XP_009390866.1|  PREDICTED: uncharacterized protein LOC103977...  85.5    3e-15   
ref|XP_008220943.1|  PREDICTED: uncharacterized protein LOC103320980  85.1    3e-15   Prunus mume [ume]
gb|KHN28877.1|  hypothetical protein glysoja_025671                   85.1    4e-15   Glycine soja [wild soybean]
ref|XP_007225122.1|  hypothetical protein PRUPE_ppa002630mg           84.7    4e-15   
emb|CDY41098.1|  BnaC05g10890D                                        84.3    5e-15   Brassica napus [oilseed rape]
ref|XP_006585073.1|  PREDICTED: uncharacterized protein LOC100794176  84.7    5e-15   Glycine max [soybeans]
ref|XP_003524142.1|  PREDICTED: uncharacterized protein LOC100809...  84.3    7e-15   Glycine max [soybeans]
gb|KHN25979.1|  hypothetical protein glysoja_018833                   84.3    7e-15   Glycine soja [wild soybean]
ref|XP_006580091.1|  PREDICTED: uncharacterized protein LOC100809...  84.0    8e-15   Glycine max [soybeans]
emb|CAN65462.1|  hypothetical protein VITISV_002198                   84.3    8e-15   Vitis vinifera
ref|XP_002988627.1|  hypothetical protein SELMODRAFT_427277           83.6    8e-15   Selaginella moellendorffii
ref|XP_008381778.1|  PREDICTED: uncharacterized protein LOC103444603  84.0    9e-15   Malus domestica [apple tree]
ref|XP_009351588.1|  PREDICTED: uncharacterized protein LOC103943111  84.0    9e-15   Pyrus x bretschneideri [bai li]
ref|XP_008365818.1|  PREDICTED: uncharacterized protein LOC103429447  83.6    9e-15   
ref|XP_009607025.1|  PREDICTED: uncharacterized protein LOC104101279  83.2    1e-14   Nicotiana tomentosiformis
ref|XP_004513242.1|  PREDICTED: uncharacterized protein LOC101506...  83.2    2e-14   Cicer arietinum [garbanzo]
ref|XP_004513243.1|  PREDICTED: uncharacterized protein LOC101506...  83.2    2e-14   Cicer arietinum [garbanzo]
ref|XP_010032031.1|  PREDICTED: uncharacterized protein LOC104421...  83.2    2e-14   Eucalyptus grandis [rose gum]
gb|KCW51418.1|  hypothetical protein EUGRSUZ_J00953                   83.2    2e-14   Eucalyptus grandis [rose gum]
ref|XP_009772695.1|  PREDICTED: uncharacterized protein LOC104223045  82.8    2e-14   Nicotiana sylvestris
ref|XP_010032032.1|  PREDICTED: uncharacterized protein LOC104421...  82.8    2e-14   Eucalyptus grandis [rose gum]
ref|XP_010032030.1|  PREDICTED: uncharacterized protein LOC104421...  82.8    2e-14   Eucalyptus grandis [rose gum]
ref|XP_010032033.1|  PREDICTED: uncharacterized protein LOC104421...  82.8    2e-14   Eucalyptus grandis [rose gum]
ref|XP_007158785.1|  hypothetical protein PHAVU_002G181800g           82.8    2e-14   Phaseolus vulgaris [French bean]
ref|XP_007158786.1|  hypothetical protein PHAVU_002G181800g           82.8    2e-14   Phaseolus vulgaris [French bean]
ref|XP_010032035.1|  PREDICTED: uncharacterized protein LOC104421...  82.8    2e-14   Eucalyptus grandis [rose gum]
ref|XP_010032034.1|  PREDICTED: uncharacterized protein LOC104421...  82.8    2e-14   Eucalyptus grandis [rose gum]
emb|CDX81664.1|  BnaC08g39370D                                        82.0    2e-14   
ref|XP_011021727.1|  PREDICTED: uncharacterized protein LOC105123...  82.4    3e-14   Populus euphratica
ref|XP_011021729.1|  PREDICTED: uncharacterized protein LOC105123...  82.4    3e-14   Populus euphratica
gb|KDP38170.1|  hypothetical protein JCGZ_04813                       82.4    3e-14   Jatropha curcas
ref|XP_011021728.1|  PREDICTED: uncharacterized protein LOC105123...  82.4    3e-14   Populus euphratica
ref|XP_011021730.1|  PREDICTED: uncharacterized protein LOC105123...  82.4    3e-14   Populus euphratica
ref|XP_009110517.1|  PREDICTED: uncharacterized protein LOC103836054  81.6    4e-14   Brassica rapa
emb|CDY52029.1|  BnaA08g31420D                                        81.6    4e-14   Brassica napus [oilseed rape]
ref|XP_004513244.1|  PREDICTED: uncharacterized protein LOC101507475  81.6    5e-14   Cicer arietinum [garbanzo]
dbj|BAJ94215.1|  predicted protein                                    81.3    6e-14   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ92146.1|  predicted protein                                    81.3    6e-14   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDY33746.1|  BnaA09g45520D                                        80.9    7e-14   Brassica napus [oilseed rape]
emb|CDP05488.1|  unnamed protein product                              79.3    7e-14   Coffea canephora [robusta coffee]
gb|KHN04838.1|  hypothetical protein glysoja_050393                   77.8    7e-14   Glycine soja [wild soybean]
ref|XP_009148855.1|  PREDICTED: uncharacterized protein LOC103872267  80.9    8e-14   
ref|XP_004236917.1|  PREDICTED: uncharacterized protein LOC101261013  80.9    8e-14   Solanum lycopersicum
ref|XP_009117880.1|  PREDICTED: uncharacterized protein LOC103842949  80.5    8e-14   Brassica rapa
ref|XP_008795329.1|  PREDICTED: uncharacterized protein LOC103711107  80.9    1e-13   Phoenix dactylifera
ref|XP_006355042.1|  PREDICTED: uncharacterized protein LOC102600383  80.5    1e-13   Solanum tuberosum [potatoes]
ref|XP_003558397.1|  PREDICTED: uncharacterized protein LOC100828230  79.7    2e-13   Brachypodium distachyon [annual false brome]
ref|XP_006605475.1|  PREDICTED: uncharacterized protein LOC100814525  79.7    2e-13   
ref|XP_009380066.1|  PREDICTED: uncharacterized protein LOC103968538  79.7    2e-13   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHN01749.1|  hypothetical protein glysoja_047936                   79.7    2e-13   Glycine soja [wild soybean]
ref|XP_006583757.1|  PREDICTED: uncharacterized protein LOC100781773  79.3    2e-13   Glycine max [soybeans]
emb|CDY45282.1|  BnaA06g09520D                                        79.0    3e-13   Brassica napus [oilseed rape]
ref|XP_006416980.1|  hypothetical protein EUTSA_v10007113mg           78.6    4e-13   
ref|XP_010554385.1|  PREDICTED: uncharacterized protein LOC104824...  75.9    5e-13   Tarenaya hassleriana [spider flower]
emb|CDX84011.1|  BnaC08g16340D                                        78.2    5e-13   
ref|XP_010554384.1|  PREDICTED: uncharacterized protein LOC104824...  75.9    5e-13   Tarenaya hassleriana [spider flower]
ref|XP_002984873.1|  hypothetical protein SELMODRAFT_446040           78.2    6e-13   Selaginella moellendorffii
ref|XP_009404147.1|  PREDICTED: uncharacterized protein LOC103987...  78.2    6e-13   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009404146.1|  PREDICTED: uncharacterized protein LOC103987...  78.2    6e-13   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002985931.1|  hypothetical protein SELMODRAFT_446423           78.2    6e-13   Selaginella moellendorffii
ref|XP_006448091.1|  hypothetical protein CICLE_v10014588mg           78.2    6e-13   Citrus clementina [clementine]
ref|XP_009404148.1|  PREDICTED: uncharacterized protein LOC103987...  78.2    7e-13   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002315841.2|  hydroxyproline-rich glycoprotein                 78.2    7e-13   
gb|KEH40698.1|  hydroxyproline-rich glycoprotein family protein       77.8    7e-13   Medicago truncatula
ref|XP_010554378.1|  PREDICTED: uncharacterized protein LOC104824...  75.5    7e-13   Tarenaya hassleriana [spider flower]
ref|XP_010554383.1|  PREDICTED: uncharacterized protein LOC104824...  75.5    7e-13   Tarenaya hassleriana [spider flower]
gb|KEH40700.1|  hydroxyproline-rich glycoprotein family protein       77.4    1e-12   Medicago truncatula
gb|KDO60856.1|  hypothetical protein CISIN_1g006789mg                 77.4    1e-12   Citrus sinensis [apfelsine]
gb|KDO60855.1|  hypothetical protein CISIN_1g006789mg                 77.4    1e-12   Citrus sinensis [apfelsine]
ref|XP_006469304.1|  PREDICTED: uncharacterized protein LOC102618872  77.4    1e-12   Citrus sinensis [apfelsine]
ref|XP_006379789.1|  hypothetical protein POPTR_0008s13830g           77.4    1e-12   
gb|ABK95394.1|  unknown                                               77.4    1e-12   Populus trichocarpa [western balsam poplar]
ref|XP_011024645.1|  PREDICTED: uncharacterized protein LOC105125...  77.4    1e-12   Populus euphratica
ref|XP_002311547.2|  hydroxyproline-rich glycoprotein                 77.0    1e-12   
ref|XP_011024636.1|  PREDICTED: uncharacterized protein LOC105125...  77.0    1e-12   Populus euphratica
ref|XP_011024628.1|  PREDICTED: uncharacterized protein LOC105125...  77.0    1e-12   Populus euphratica
ref|XP_011024620.1|  PREDICTED: uncharacterized protein LOC105125...  77.0    1e-12   Populus euphratica
ref|XP_010906320.1|  PREDICTED: uncharacterized protein LOC105033...  77.0    2e-12   Elaeis guineensis
ref|XP_010906319.1|  PREDICTED: uncharacterized protein LOC105033...  77.0    2e-12   Elaeis guineensis
gb|ABF94870.1|  hydroxyproline-rich glycoprotein family protein, ...  76.3    3e-12   Oryza sativa Japonica Group [Japonica rice]
gb|EEC74839.1|  hypothetical protein OsI_10686                        76.3    3e-12   Oryza sativa Indica Group [Indian rice]
ref|XP_007153188.1|  hypothetical protein PHAVU_003G014200g           76.3    3e-12   Phaseolus vulgaris [French bean]
gb|EEE58665.1|  hypothetical protein OsJ_10079                        75.9    3e-12   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008798368.1|  PREDICTED: uncharacterized protein LOC103713273  75.9    4e-12   Phoenix dactylifera
ref|NP_001049502.1|  Os03g0238800                                     75.5    4e-12   
ref|XP_010939980.1|  PREDICTED: uncharacterized protein LOC105058678  75.9    4e-12   Elaeis guineensis
ref|XP_010936866.1|  PREDICTED: uncharacterized protein LOC105056...  75.1    6e-12   Elaeis guineensis
ref|XP_010936869.1|  PREDICTED: uncharacterized protein LOC105056...  75.1    6e-12   Elaeis guineensis
ref|XP_008787901.1|  PREDICTED: uncharacterized protein LOC103705814  75.1    7e-12   Phoenix dactylifera
ref|XP_008789249.1|  PREDICTED: uncharacterized protein LOC103706...  73.2    2e-11   Phoenix dactylifera
ref|XP_008789251.1|  PREDICTED: uncharacterized protein LOC103706...  72.4    3e-11   
ref|XP_006662146.1|  PREDICTED: uncharacterized protein LOC102714587  72.4    4e-11   Oryza brachyantha
ref|NP_001145739.1|  uncharacterized protein LOC100279246             71.6    8e-11   Zea mays [maize]
gb|AGT17402.1|  hypothetical protein SHCRBa_230_N09_F_20              71.2    9e-11   Saccharum hybrid cultivar R570
ref|XP_006649704.1|  PREDICTED: uncharacterized protein LOC102720214  71.2    1e-10   
ref|XP_002468197.1|  hypothetical protein SORBIDRAFT_01g041520        71.2    1e-10   
ref|NP_001064055.1|  Os10g0116900                                     68.9    6e-10   
gb|EAY77528.1|  hypothetical protein OsI_32569                        68.9    6e-10   Oryza sativa Indica Group [Indian rice]
gb|AAP51882.2|  hydroxyproline-rich glycoprotein family protein, ...  68.9    6e-10   Oryza sativa Japonica Group [Japonica rice]
gb|AAO72586.1|  unknown                                               67.0    3e-09   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002447529.1|  hypothetical protein SORBIDRAFT_06g002830        63.2    5e-09   
ref|XP_002449607.1|  hypothetical protein SORBIDRAFT_05g019880        60.1    3e-08   
ref|XP_010093749.1|  hypothetical protein L484_019151                 55.5    2e-06   
ref|XP_009390868.1|  PREDICTED: uncharacterized protein LOC103977...  50.8    6e-04   



>ref|XP_009599211.1| PREDICTED: uncharacterized protein LOC104094898 [Nicotiana tomentosiformis]
Length=548

 Score =   225 bits (573),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 118/188 (63%), Positives = 142/188 (76%), Gaps = 4/188 (2%)
 Frame = +2

Query  203  MPPAAGAVAQSNRVPLVPNVMPTVVQTPPAMVSDSFAKDAVIAWFRGEFAAANAVIDALC  382
            MPPAAG VA S+RV  +P      V  PP M+S++FAKDA++AWFRGEFAAANA+IDALC
Sbjct  1    MPPAAGVVANSDRVHFMPTAGGAPVVQPPPMMSETFAKDAILAWFRGEFAAANAIIDALC  60

Query  383  NHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQKYYTIADVALELRKVsakkaedrea  562
            NH+TQLE GG SEYESVFAAIHRRRLNWIPILQMQKYY+IADV LEL+KV     +  + 
Sbjct  61   NHITQLE-GGRSEYESVFAAIHRRRLNWIPILQMQKYYSIADVTLELKKV--AARKVTDV  117

Query  563  aaaasamadakhsaaaVMNVKISHASREEPVDNSENGGGEVVYEDSIRDDSHGSPESEIT  742
              +     + +     ++N K +    EE  +NSENGGGEVV EDSIR+DS+GSPESEIT
Sbjct  118  EQSDVKEEEKESEVKELLNEK-AKCHDEESFENSENGGGEVVDEDSIREDSNGSPESEIT  176

Query  743  DSGSQDVQ  766
            D+GSQ+VQ
Sbjct  177  DTGSQEVQ  184



>ref|XP_009769229.1| PREDICTED: uncharacterized protein LOC104220112 [Nicotiana sylvestris]
Length=544

 Score =   216 bits (549),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 118/189 (62%), Positives = 141/189 (75%), Gaps = 10/189 (5%)
 Frame = +2

Query  203  MPPAAGAVAQSNRVPLVPNVMPTVVQTPPAMVSDSFAKDAVIAWFRGEFAAANAVIDALC  382
            MPPAAG VA S+RV  +P      V  PP M+S++FAKDA++AWFRGEFAAANA+IDALC
Sbjct  1    MPPAAGVVANSDRVHFMPTAGGAPVVQPPPMMSETFAKDAILAWFRGEFAAANAIIDALC  60

Query  383  NHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQKYYTIADVALELRKVsakkaedrea  562
            NH+TQLE GG  EYESVFAAIHRRRLNWIPILQMQKYY+IADV LEL+KV+A++  D + 
Sbjct  61   NHITQLE-GGRLEYESVFAAIHRRRLNWIPILQMQKYYSIADVTLELKKVAAREVTDVKQ  119

Query  563  aaaasamadakhsaaaVMNVKISHASREEPVD-NSENGGGEVVYEDSIRDDSHGSPESEI  739
            +        +         VK S   + +  D  SENGGGEVV EDSIR+DS+GSPESEI
Sbjct  120  SDVNEEEKQS--------EVKESFNEKAKCHDEESENGGGEVVDEDSIREDSNGSPESEI  171

Query  740  TDSGSQDVQ  766
            TD+GSQ+VQ
Sbjct  172  TDTGSQEVQ  180



>emb|CDP03590.1| unnamed protein product [Coffea canephora]
Length=561

 Score =   205 bits (522),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 124/212 (58%), Positives = 147/212 (69%), Gaps = 25/212 (12%)
 Frame = +2

Query  203  MPPAAGAVAQSNRVPLV-PNVMPTVVQTPPAMVSDSFAKDAVIAWFRGEFAAANAVIDAL  379
            MPPAAG VAQS+RVP+V P VMPTV+Q  P ++ +++AKDA+IAWFRGEFAAANA+IDAL
Sbjct  1    MPPAAGVVAQSDRVPVVGPMVMPTVMQPAPGVMPEAYAKDAIIAWFRGEFAAANAIIDAL  60

Query  380  CNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQKYYTIADVALELRKVsakkae--d  553
            C+HL QLEGGGGSEYESVFAAIHRRRLNWIP+LQMQKYY+IADVALELRKV+A K    +
Sbjct  61   CSHLKQLEGGGGSEYESVFAAIHRRRLNWIPVLQMQKYYSIADVALELRKVAATKMMERE  120

Query  554  reaaaaasamadakhsaaaVMN----------VKISHASREEPVD--------NSENGGG  679
            R A  A +     K  A   MN          V +   + E PV           ENG G
Sbjct  121  RIAEEAEAKKKKKKKDAEEEMNKVAAAAGDIAVPLKEKAGENPVSEEEETISVGDENGNG  180

Query  680  EVV--YEDSIRDDSHGSPESEITDSGSQDVQP  769
            E+V   +DS +DDS    ESEITD+GS +V P
Sbjct  181  EIVGDGQDSTKDDSLA--ESEITDAGSHEVPP  210



>ref|XP_004247488.1| PREDICTED: uncharacterized protein LOC101267646 [Solanum lycopersicum]
Length=549

 Score =   199 bits (505),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 114/200 (57%), Positives = 136/200 (68%), Gaps = 30/200 (15%)
 Frame = +2

Query  203  MPPAAGAVAQSNRVPL-----VPNVMPTVVQTPPAMVSDSFAKDAVIAWFRGEFAAANAV  367
            MPPAAG VA S+RV       +P     V+Q P  M SD++AKDA+IAWFRGEFAAANA+
Sbjct  1    MPPAAGVVANSDRVSFGNSMVIPTPGAPVIQ-PAPMTSDTYAKDAIIAWFRGEFAAANAI  59

Query  368  IDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQKYYTIADVALELRKVsakka  547
            IDALCNH+TQLE G  SEYE VF+AIHRRRLNWIPILQMQKYY+IADV LELRK+     
Sbjct  60   IDALCNHITQLE-GDRSEYEPVFSAIHRRRLNWIPILQMQKYYSIADVTLELRKL-----  113

Query  548  edreaaaaasamadakhsaaaVMNVKISHASRE---EPV----DNSENGGGEVVYEDSIR  706
                        A        V +VK S   +E   E +    +++EN GGEVV  DS+R
Sbjct  114  -----------AARKVSDRVEVADVKQSEVVKESFNEKINCHDEDTENAGGEVVDVDSVR  162

Query  707  DDSHGSPESEITDSGSQDVQ  766
            +DS+GSPESEITD+GSQ+VQ
Sbjct  163  EDSNGSPESEITDTGSQEVQ  182



>ref|XP_011079798.1| PREDICTED: uncharacterized protein LOC105163227 [Sesamum indicum]
Length=544

 Score =   193 bits (491),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 113/199 (57%), Positives = 132/199 (66%), Gaps = 17/199 (9%)
 Frame = +2

Query  203  MPPAAGAVAQSNRVPLVPNVMPTVVQTP--PAMV--SDSFAKDAVIAWFRGEFAAANAVI  370
            MPPAAG + Q +R+P+ P V+P VVQ P  P M   S++FAKDA+IAWFRGEFAAANA+I
Sbjct  1    MPPAAGVLPQGDRIPMKPMVVPAVVQQPQLPMMTAASEAFAKDAIIAWFRGEFAAANAII  60

Query  371  DALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQKYYTIADVALELRKVsakkae  550
            DALC HLTQLEGG G  YES FAAIHRRRLNWIPILQMQKYY+IADV LEL KV+ KK  
Sbjct  61   DALCCHLTQLEGGAGV-YESAFAAIHRRRLNWIPILQMQKYYSIADVTLELNKVAEKKKA  119

Query  551  dreaaaaasamadakh-saaaVMNVKISHASR--EEPVDNSENGGGEVVYEDSIRDDSHG  721
            +                   A +N K     +  E  ++N+EN GGEVV ED        
Sbjct  120  ENIDVEVRKIQEVVDDGDCTAAINDKEKQKEKNLESSLENNENSGGEVVDEDFT------  173

Query  722  SPESEITDSGSQDVQPISE  778
               SEITD+GSQ+VQP SE
Sbjct  174  ---SEITDTGSQEVQPFSE  189



>ref|XP_006358433.1| PREDICTED: uncharacterized protein LOC102603657 [Solanum tuberosum]
Length=548

 Score =   187 bits (474),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 118/193 (61%), Positives = 136/193 (70%), Gaps = 17/193 (9%)
 Frame = +2

Query  203  MPPAAGAVAQSNRVPL-----VPNVMPTVVQTPPAMVSDSFAKDAVIAWFRGEFAAANAV  367
            MPPAAG VA S+RV       +P     V+Q PP M S++FAKDA+IAWFRGEFAAANA+
Sbjct  1    MPPAAGVVANSDRVSFGNSMVIPTAGAPVIQQPP-MTSETFAKDAIIAWFRGEFAAANAI  59

Query  368  IDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQKYYTIADVALELRKVsakka  547
            IDALCNH+TQLE G  SEYE VF+AIHRRRLNWIPILQMQKYY+IADV LELRK++A+K 
Sbjct  60   IDALCNHITQLE-GDRSEYEPVFSAIHRRRLNWIPILQMQKYYSIADVTLELRKLAARKV  118

Query  548  edreaaaaasamadakhsaaaVMNVKISHASREEPVDNSENGGGEVVYEDSIRDDSHGSP  727
             DR   A                 VK S   +    D SEN G EVV  DS+RDDS+GSP
Sbjct  119  SDRVEVADVKQSEV----------VKESFNEKINCHDESENAGSEVVDVDSVRDDSNGSP  168

Query  728  ESEITDSGSQDVQ  766
            ESEITD+GSQ+VQ
Sbjct  169  ESEITDTGSQEVQ  181



>ref|XP_009774650.1| PREDICTED: uncharacterized protein LOC104224666 [Nicotiana sylvestris]
Length=540

 Score =   179 bits (454),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 105/189 (56%), Positives = 127/189 (67%), Gaps = 14/189 (7%)
 Frame = +2

Query  203  MPPAAGAVAQSNRVPLVPNVMPTVVQTPPAMV-----SDSFAKDAVIAWFRGEFAAANAV  367
            MPPA  AV     VPL P   P               S++FAKDA++AWFRGEFAAANA+
Sbjct  1    MPPAVAAVGHHRVVPLAPTATPAAASPVVKPPPPTVVSETFAKDAILAWFRGEFAAANAI  60

Query  368  IDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQKYYTIADVALELRKVsakka  547
            IDALCNH+TQLEGG  SEYESVFAA+HRRRLNWIPILQMQKY +IA+V +ELRKV+ +K 
Sbjct  61   IDALCNHITQLEGGRSSEYESVFAAVHRRRLNWIPILQMQKYCSIAEVTVELRKVADRKL  120

Query  548  edreaaaaasamadakhsaaaVMNVKISHASREEPVDNSENGGGEVVYEDSIRDDSHGSP  727
            ++RE      A         ++   +ISH+     V++SENGG EVV E    D+SH SP
Sbjct  121  KEREEEELTDAKQSDAEGNGSLAEKEISHS-----VESSENGGSEVVDE----DESHDSP  171

Query  728  ESEITDSGS  754
            ESEITD+GS
Sbjct  172  ESEITDTGS  180



>ref|XP_009607167.1| PREDICTED: uncharacterized protein LOC104101431 [Nicotiana tomentosiformis]
Length=540

 Score =   177 bits (448),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 101/189 (53%), Positives = 123/189 (65%), Gaps = 14/189 (7%)
 Frame = +2

Query  203  MPPAAGAVAQSNRVPLVPNVMPTVVQTPPAMV-----SDSFAKDAVIAWFRGEFAAANAV  367
            M PA  AV     VPL P V P               S++FAKDA++AWFRGEFAAANA 
Sbjct  1    MSPAVAAVGHHRVVPLAPTVTPEAASPVVKPPPPTVVSETFAKDAILAWFRGEFAAANAT  60

Query  368  IDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQKYYTIADVALELRKVsakka  547
            IDALCNH+TQLEGG  SEYESVFAA+HRRRLNWIPILQMQKY +I +V +ELRKV+ +K 
Sbjct  61   IDALCNHITQLEGGRSSEYESVFAAVHRRRLNWIPILQMQKYCSITEVTVELRKVADRKL  120

Query  548  edreaaaaasamadakhsaaaVMNVKISHASREEPVDNSENGGGEVVYEDSIRDDSHGSP  727
            ++RE      A         ++ + +  H+     V++SEN G EVV E    D+SH SP
Sbjct  121  KEREEEELTEAKQSDAEVNGSLGDKESKHS-----VESSENAGSEVVDE----DESHDSP  171

Query  728  ESEITDSGS  754
            ESEITD+GS
Sbjct  172  ESEITDTGS  180



>ref|XP_002524804.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF37647.1| conserved hypothetical protein [Ricinus communis]
Length=550

 Score =   166 bits (419),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 97/192 (51%), Positives = 124/192 (65%), Gaps = 8/192 (4%)
 Frame = +2

Query  203  MPPAAGAVAQSNRV-PLVPNVMPTVVQTPPAMVSDSFAKDAVIAWFRGEFAAANAVIDAL  379
            MP AAG    ++R  P  P V+P  +Q PP M+SD+FAKDA++AWFRGEFAAANA+IDAL
Sbjct  1    MPMAAGPATPTDRAAPAGPTVVP--IQAPPMMISDAFAKDAILAWFRGEFAAANAIIDAL  58

Query  380  CNHLTQLE---GGGGSEYESVFAAIHRRRLNWIPILQMQKYYTIADVALELRKVsakkae  550
            C+HL QL     GGGSEYE+VFAAIHRRRLNWIP+LQMQKY++IADVA+ELRKV   + +
Sbjct  59   CSHLAQLNGGGAGGGSEYEAVFAAIHRRRLNWIPVLQMQKYHSIADVAVELRKV--AENK  116

Query  551  dreaaaaasamadakhsaaaVMNVKISHASREEPVDNSENGGGEVVYEDSIRDDSHGSPE  730
                      +  +      +  V +    +E+  D   +  G    E    D+   SP 
Sbjct  117  RSTNDCEMMKIDTSSTDKVVLKEVCLDDEKKEKVGDRITDCLGNGTVEHDGGDEEEDSPV  176

Query  731  SEITDSGSQDVQ  766
            S+ITDSGSQ+VQ
Sbjct  177  SDITDSGSQEVQ  188



>ref|XP_002271361.1| PREDICTED: uncharacterized protein LOC100256341 [Vitis vinifera]
Length=557

 Score =   162 bits (411),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 95/189 (50%), Positives = 121/189 (64%), Gaps = 10/189 (5%)
 Frame = +2

Query  215  AGAVAQSNRVPLVPNVMPTVVQTPPAMVSDSFAKDAVIAWFRGEFAAANAVIDALCNHLT  394
            AG V+   + P+   ++P  V        +SFAKDA+IAWFRGEFAAANA+ID LCNHL 
Sbjct  3    AGPVSAYEKAPMGQGMVPVSVPVQMPAAPESFAKDAIIAWFRGEFAAANAMIDTLCNHLA  62

Query  395  QLEGGGGSEYESVFAAIHRRRLNWIPILQMQKYYTIADVALELRKVsakkaedreaaaaa  574
            QL GG GSEYE VFAAIH RRLNWIPILQMQKY++IADVA+EL+ V     +  E    A
Sbjct  63   QLTGGVGSEYEKVFAAIHLRRLNWIPILQMQKYHSIADVAIELQNV---LDKKTENVGGA  119

Query  575  samadakhsaaaVMNVKISHASREEPVDNSEN-GGGEVVYEDSIRDDSHGSPESEITDSG  751
              +  ++ +    +  K    + EE + ++ N  G EVV E+        SP+S+ITDSG
Sbjct  120  EGVKISEEAMEVCLEGKKEKGTDEEVMKSNGNVDGDEVVVEE------EDSPDSDITDSG  173

Query  752  SQDVQPISE  778
            SQDVQP +E
Sbjct  174  SQDVQPTTE  182



>gb|KDP21510.1| hypothetical protein JCGZ_21981 [Jatropha curcas]
Length=550

 Score =   162 bits (411),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 92/194 (47%), Positives = 120/194 (62%), Gaps = 14/194 (7%)
 Frame = +2

Query  212  AAGAVAQSNRVPLVPNVMPTVVQTPPAMVSDSFAKDAVIAWFRGEFAAANAVIDALCNHL  391
            AAG  + ++R           VQTPP +++D++AKDA++ WFRGEFAAANA+IDALC+HL
Sbjct  2    AAGPASPTDRAVPPVMPAVVPVQTPPMLMADAYAKDAILGWFRGEFAAANAIIDALCSHL  61

Query  392  TQLEG--GGGSEYESVFAAIHRRRLNWIPILQMQKYYTIADVALELRKVsakkaedreaa  565
             Q+ G  G GSEY+SVFAAIHRRRLNWIP+LQMQKY++IADVA+ELR+V           
Sbjct  62   AQVSGSGGAGSEYDSVFAAIHRRRLNWIPVLQMQKYHSIADVAVELRRV---------TE  112

Query  566  aaasamadakhsaaaVMNVKISHASRE---EPVDNSENGGGEVVYEDSIRDDSHGSPESE  736
               +           VM  ++    +E   E V  S   G +   +     +   SPES+
Sbjct  113  RKLNEKKCEIEKKNEVMLKEVYLDEKEKVDEKVRESLESGIDDGDDGGEVVEEEDSPESD  172

Query  737  ITDSGSQDVQPISE  778
            ITDSGSQ+VQPI E
Sbjct  173  ITDSGSQEVQPIIE  186



>ref|XP_006352790.1| PREDICTED: uncharacterized protein LOC102602285 [Solanum tuberosum]
Length=514

 Score =   162 bits (409),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 94/177 (53%), Positives = 115/177 (65%), Gaps = 29/177 (16%)
 Frame = +2

Query  203  MPPAAGAVAQSNRVPLVPNVMPTVVQTPPAMVSDSFAKDAVIAWFRGEFAAANAVIDALC  382
            MPPAA  V   + VPL   V P    + P MVS++FAKDA++AWFRGEFAAANA+IDALC
Sbjct  1    MPPAAAVVGHHHVVPLDSKVTPAA--STPTMVSETFAKDAILAWFRGEFAAANAIIDALC  58

Query  383  NHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQKYYTIADVALELRKVsakkaedrea  562
            NH+TQLE GG +E+ESVFAAIHRRRLNWIPILQMQKY +IA+V L+LRKV+ +K ++RE 
Sbjct  59   NHITQLE-GGRAEHESVFAAIHRRRLNWIPILQMQKYCSIAEVTLDLRKVAERKIKERE-  116

Query  563  aaaasamadakhsaaaVMNVKISHASREEPVDNSENGGGEVVYEDSIRDDSHGSPES  733
                                 IS     + + +SENGG E+V       D   SPES
Sbjct  117  ------------------EFAISKQCDTQAITSSENGGNEIV-------DGDDSPES  148



>ref|XP_010255802.1| PREDICTED: uncharacterized protein LOC104596380 isoform X2 [Nelumbo 
nucifera]
Length=559

 Score =   159 bits (401),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 76/113 (67%), Positives = 92/113 (81%), Gaps = 8/113 (7%)
 Frame = +2

Query  203  MPPAAGAVAQSNRVPLVPNVMPTVVQTPPAMVSDSFAKDAVIAWFRGEFAAANAVIDALC  382
            MP AAG    S+R+P+  +V+P   Q P    +++FA+DA+IAWFRGEFAAANA+IDALC
Sbjct  1    MPTAAGPAPPSDRIPMA-SVLPMQTQMP----TETFARDAIIAWFRGEFAAANAIIDALC  55

Query  383  NHLTQLE---GGGGSEYESVFAAIHRRRLNWIPILQMQKYYTIADVALELRKV  532
            NHLTQ++   G G ++YESVFAAIHRRRLNWIPIL MQKYY+IADVALELRKV
Sbjct  56   NHLTQMDALFGNGTADYESVFAAIHRRRLNWIPILHMQKYYSIADVALELRKV  108



>ref|XP_010255801.1| PREDICTED: uncharacterized protein LOC104596380 isoform X1 [Nelumbo 
nucifera]
Length=560

 Score =   159 bits (401),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 76/113 (67%), Positives = 92/113 (81%), Gaps = 8/113 (7%)
 Frame = +2

Query  203  MPPAAGAVAQSNRVPLVPNVMPTVVQTPPAMVSDSFAKDAVIAWFRGEFAAANAVIDALC  382
            MP AAG    S+R+P+  +V+P   Q P    +++FA+DA+IAWFRGEFAAANA+IDALC
Sbjct  1    MPTAAGPAPPSDRIPMA-SVLPMQTQMP----TETFARDAIIAWFRGEFAAANAIIDALC  55

Query  383  NHLTQLE---GGGGSEYESVFAAIHRRRLNWIPILQMQKYYTIADVALELRKV  532
            NHLTQ++   G G ++YESVFAAIHRRRLNWIPIL MQKYY+IADVALELRKV
Sbjct  56   NHLTQMDALFGNGTADYESVFAAIHRRRLNWIPILHMQKYYSIADVALELRKV  108



>ref|XP_010323031.1| PREDICTED: uncharacterized protein LOC101258968 [Solanum lycopersicum]
Length=510

 Score =   157 bits (396),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 77/110 (70%), Positives = 89/110 (81%), Gaps = 6/110 (5%)
 Frame = +2

Query  203  MPPAAGAVAQSNRVPLVPNVMPTVVQTPPAMVSDSFAKDAVIAWFRGEFAAANAVIDALC  382
            MPPAA  V     VPL   V PT      +MVS++FAKDA++AWFRGEFAAANA+IDALC
Sbjct  1    MPPAADVVGHHRVVPLDSKVTPTA-----SMVSETFAKDAILAWFRGEFAAANAIIDALC  55

Query  383  NHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQKYYTIADVALELRKV  532
            NH+TQLE GG +E+ESVFAAIHRRRLNWIPILQMQKY +IA+V L+LRKV
Sbjct  56   NHITQLE-GGRAEHESVFAAIHRRRLNWIPILQMQKYCSIAEVTLDLRKV  104



>gb|KJB42034.1| hypothetical protein B456_007G133500 [Gossypium raimondii]
Length=337

 Score =   150 bits (380),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 74/112 (66%), Positives = 87/112 (78%), Gaps = 3/112 (3%)
 Frame = +2

Query  203  MPPAAGAVAQSNRVPLVPNVMPTVVQTPPAMVSDSFAKDAVIAWFRGEFAAANAVIDALC  382
            MP AAG  +   R   V + +  +VQ  PA VSD  AKD +I+WFRGEFAAANA+IDALC
Sbjct  1    MPMAAGPASPRERAQAVGSAIVPLVQAVPA-VSDVLAKDTIISWFRGEFAAANAIIDALC  59

Query  383  NHLTQLEGG--GGSEYESVFAAIHRRRLNWIPILQMQKYYTIADVALELRKV  532
             HL QL+GG  GGSEYE+VF AIHRRRLNWIP+LQMQKY++IADVA EL+KV
Sbjct  60   AHLAQLQGGRGGGSEYEAVFTAIHRRRLNWIPVLQMQKYHSIADVAEELKKV  111



>ref|XP_011082539.1| PREDICTED: uncharacterized protein LOC105165276 [Sesamum indicum]
Length=555

 Score =   153 bits (387),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 104/198 (53%), Positives = 127/198 (64%), Gaps = 6/198 (3%)
 Frame = +2

Query  203  MPPAAGAVAQSNRVPLVPNVMPTVVQTPPAMVSDSFAKDAVIAWFRGEFAAANAVIDALC  382
            MPPAAG V   +R+P  P   P +     A  S++FAKDA+IAWFRGEFAAANA+IDALC
Sbjct  1    MPPAAGVVTPGDRIPGKPMGAPQLQPLVTAAASEAFAKDAIIAWFRGEFAAANAIIDALC  60

Query  383  NHLTQLE---GGGGSEYESVFAAIHRRRLNWIPILQMQKYYTIADVALELRKVsakkaed  553
            NHL+QLE   GGG + YES FAAIHRRRLNWIPILQMQKYY IAD+ LEL+KV+ KK E+
Sbjct  61   NHLSQLEGGGGGGAAAYESAFAAIHRRRLNWIPILQMQKYYPIADITLELKKVAEKKREE  120

Query  554  reaaaaasamadakhsaaaVMNVKISHASR---EEPVDNSENGGGEVVYEDSIRDDSHGS  724
             +  A            +A+             E   ++++NGGGE+V ED        S
Sbjct  121  SDVDAKKIQELGNIGCTSAITEEDKESEKEKNIESSEESNDNGGGELVDEDGDGKVVDES  180

Query  725  PESEITDSGSQDVQPISE  778
             +SEITDSGSQ+VQ   E
Sbjct  181  LQSEITDSGSQEVQVFPE  198



>ref|XP_010279049.1| PREDICTED: uncharacterized protein LOC104613055 [Nelumbo nucifera]
Length=557

 Score =   151 bits (382),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 75/113 (66%), Positives = 87/113 (77%), Gaps = 12/113 (11%)
 Frame = +2

Query  203  MPPAAGAVAQSNRVPLVPNVMPTVVQTPPAMVSDSFAKDAVIAWFRGEFAAANAVIDALC  382
            MP AAG    S+R+P     M + +Q P    S++FA+DA+IAWFRGEFAAANA+IDALC
Sbjct  1    MPTAAGPAPPSDRIP-----MGSTMQMP----SEAFARDAIIAWFRGEFAAANAIIDALC  51

Query  383  NHLTQLE---GGGGSEYESVFAAIHRRRLNWIPILQMQKYYTIADVALELRKV  532
            NHLTQL+   G G + YESVF AIHRRRLNWIPIL MQKYY+IADV LELRKV
Sbjct  52   NHLTQLDTLFGNGTASYESVFEAIHRRRLNWIPILHMQKYYSIADVTLELRKV  104



>ref|XP_004290685.2| PREDICTED: uncharacterized protein LOC101299256 [Fragaria vesca 
subsp. vesca]
Length=538

 Score =   148 bits (374),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 91/170 (54%), Positives = 117/170 (69%), Gaps = 21/170 (12%)
 Frame = +2

Query  284  PPAM------VSDSFAKDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAI  445
            PPAM      V DS AKDA+I W+RGEFAAANA+IDALC HLTQL GGG +EY +VFAAI
Sbjct  20   PPAMGPAMMPVPDSVAKDAIIGWYRGEFAAANAIIDALCGHLTQLSGGG-AEYSAVFAAI  78

Query  446  HRRRLNWIPILQMQKYYTIADVALELRKVsakkaedreaaaaasamadakhsaaaVMNVK  625
            HRRR+NWIP+LQMQKY++IADV +ELR + AK A +R++      + +A+       N K
Sbjct  79   HRRRMNWIPVLQMQKYHSIADVMVELRNLGAKMAAERDSHHENGDVFEAED------NCK  132

Query  626  ISHASR----EEPVDNSENGGGEVVYEDSIRDDSHGSPESEITDSGSQDV  763
             S  ++    +E VD  E+   EV  ++   +D  GSPES+ITDSGSQ+V
Sbjct  133  SSEGAKSCVEDEKVD--ESNANEVAADEVTEED--GSPESDITDSGSQEV  178



>ref|XP_007162387.1| hypothetical protein PHAVU_001G147800g [Phaseolus vulgaris]
 gb|ESW34381.1| hypothetical protein PHAVU_001G147800g [Phaseolus vulgaris]
Length=516

 Score =   148 bits (373),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 82/168 (49%), Positives = 108/168 (64%), Gaps = 21/168 (13%)
 Frame = +2

Query  266  PTVVQTPPAMVSDSFAKDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAI  445
            P  +  PP +VSDSFAKDA++AWFRGEFAAANA+ID LC HL  L     SEYE+ FAAI
Sbjct  11   PPAMVPPPLLVSDSFAKDAILAWFRGEFAAANAIIDTLCGHLAHL-ATASSEYEATFAAI  69

Query  446  HRRRLNWIPILQMQKYYTIADVALELRKVsakkaedreaaaaasamadakhsaaaVMNVK  625
            HRRR+NWIP++QMQKY++IAD+ALELR+V+ +K E   A  + S             ++ 
Sbjct  70   HRRRMNWIPVIQMQKYHSIADIALELRRVADRKTETEGARKSES-------------SLD  116

Query  626  ISHASREEPVDNSENGGGEVVYEDSIRDDSHGSPESEITDSGSQDVQP  769
                  +E ++ + N   E   E       + SP+SEITDSGSQ++QP
Sbjct  117  DEQKLEKETLETAGNEADEAAPE-------YDSPDSEITDSGSQEMQP  157



>ref|XP_007144595.1| hypothetical protein PHAVU_007G168900g [Phaseolus vulgaris]
 ref|XP_007144597.1| hypothetical protein PHAVU_007G168900g [Phaseolus vulgaris]
 gb|ESW16589.1| hypothetical protein PHAVU_007G168900g [Phaseolus vulgaris]
 gb|ESW16591.1| hypothetical protein PHAVU_007G168900g [Phaseolus vulgaris]
Length=364

 Score =   145 bits (367),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 80/174 (46%), Positives = 106/174 (61%), Gaps = 33/174 (19%)
 Frame = +2

Query  245  PLVPNVMPTVVQTPPAMVSDSFAKDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEY  424
            P  P+  PT+V  PP +VSDSFAKDA++AWFRGEFAAANA+IDALC HL         +Y
Sbjct  5    PTAPSDRPTMV-PPPMLVSDSFAKDAILAWFRGEFAAANAIIDALCAHL----ATSAHDY  59

Query  425  ESVFAAIHRRRLNWIPILQMQKYYTIADVALELRKVsakkaedreaaaaasamadakhsa  604
            ++VFAAIHRRRLNWIP+LQMQKY++IADV LEL++                         
Sbjct  60   DAVFAAIHRRRLNWIPVLQMQKYHSIADVTLELQR-------------------------  94

Query  605  aaVMNVKISHASREEPVDNSENGGGEVVYEDSIRDDSHGSPESEITDSGSQDVQ  766
                + +  +A+ E+  +        VV  D+  +  + SP+SEITDSGSQ++Q
Sbjct  95   ---QSDRNHNAAAEDKSNEKTTSPESVVGNDAADEHEYESPQSEITDSGSQEMQ  145



>gb|KJB42033.1| hypothetical protein B456_007G133500 [Gossypium raimondii]
Length=557

 Score =   147 bits (372),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 74/112 (66%), Positives = 87/112 (78%), Gaps = 3/112 (3%)
 Frame = +2

Query  203  MPPAAGAVAQSNRVPLVPNVMPTVVQTPPAMVSDSFAKDAVIAWFRGEFAAANAVIDALC  382
            MP AAG  +   R   V + +  +VQ  PA VSD  AKD +I+WFRGEFAAANA+IDALC
Sbjct  1    MPMAAGPASPRERAQAVGSAIVPLVQAVPA-VSDVLAKDTIISWFRGEFAAANAIIDALC  59

Query  383  NHLTQLEGG--GGSEYESVFAAIHRRRLNWIPILQMQKYYTIADVALELRKV  532
             HL QL+GG  GGSEYE+VF AIHRRRLNWIP+LQMQKY++IADVA EL+KV
Sbjct  60   AHLAQLQGGRGGGSEYEAVFTAIHRRRLNWIPVLQMQKYHSIADVAEELKKV  111



>gb|EYU46628.1| hypothetical protein MIMGU_mgv1a003933mg [Erythranthe guttata]
Length=554

 Score =   147 bits (371),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 95/210 (45%), Positives = 128/210 (61%), Gaps = 33/210 (16%)
 Frame = +2

Query  203  MPPAAGAVAQSNRVPLVPNVMPTV-----------VQTPPAMVSDSFAKDAVIAWFRGEF  349
            MPPAA  + Q +RV + P  +P             + TP    S++FAKDA++AWFRGEF
Sbjct  1    MPPAACVLPQGDRVAVKPTFVPAAVQLQQQQPQVPMMTP---ASEAFAKDAILAWFRGEF  57

Query  350  AAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQKYYTIADVALELRK  529
            AAANA+IDALC HLTQL+ G  +   +  AAIHRRRLNWIPILQMQ+Y +IADV+LEL+K
Sbjct  58   AAANAIIDALCGHLTQLDDGAAAYESAF-AAIHRRRLNWIPILQMQRYCSIADVSLELKK  116

Query  530  VsakkaedreaaaaasamadakhsaaaVMNVKISHASR-------EEPVDNSENGGGEVV  688
            V   + +  E +   +   D   +      V+I+H  +       E  +++++NGGGEVV
Sbjct  117  V--SEKKSAENSHVDAKKIDQVVANGGCCTVEINHKEKQSETTNLETSLESNDNGGGEVV  174

Query  689  YEDSIRDDSHGSPESEITDSGSQDVQPISE  778
             ED           S+ITD+GSQ+VQP SE
Sbjct  175  DEDLT---------SDITDTGSQEVQPFSE  195



>ref|XP_007050694.1| Transport protein sec31 isoform 1 [Theobroma cacao]
 gb|EOX94851.1| Transport protein sec31 isoform 1 [Theobroma cacao]
Length=610

 Score =   147 bits (371),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 76/113 (67%), Positives = 91/113 (81%), Gaps = 5/113 (4%)
 Frame = +2

Query  203  MPPAAGAVAQSNRVPLV-PNVMPTVVQTPPAMVSDSFAKDAVIAWFRGEFAAANAVIDAL  379
            MP AAG  +   R   V P V+P ++Q  PA V+D FAKD++I+WFRGEFAAANA+IDAL
Sbjct  1    MPMAAGPASPRERAHAVGPTVVP-MMQAVPA-VADVFAKDSIISWFRGEFAAANAIIDAL  58

Query  380  CNHLTQLEGGG--GSEYESVFAAIHRRRLNWIPILQMQKYYTIADVALELRKV  532
            C HL QL GGG  GSEYE+VF+AIHRRRLNWIP+LQMQKY++IADVA EL+KV
Sbjct  59   CAHLAQLHGGGAGGSEYEAVFSAIHRRRLNWIPVLQMQKYHSIADVAAELKKV  111



>ref|XP_011033673.1| PREDICTED: uncharacterized protein LOC105132083 [Populus euphratica]
Length=521

 Score =   145 bits (367),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 82/160 (51%), Positives = 106/160 (66%), Gaps = 26/160 (16%)
 Frame = +2

Query  299  SDSFAKDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPIL  478
            +D+ AKDA++AWFRGEFAAANA+IDALC+HL QL+ G  SEYE+VFAAIH RRLNWIP+L
Sbjct  25   ADTIAKDAILAWFRGEFAAANAIIDALCSHLAQLDAG--SEYEAVFAAIHGRRLNWIPVL  82

Query  479  QMQKYYTIADVALELRKVsakkaedreaaaaasamadakhsaaaVMNVKISHASREEPVD  658
            QMQKY++IADVALEL++V+  K E                      NV+    S E+   
Sbjct  83   QMQKYHSIADVALELKRVAETKLEAASFG-----------------NVETDKFSDEKVKI  125

Query  659  NSENGGGEVVYEDSIRDDSHGSPESEITDSGSQDVQPISE  778
            + ENG          +++   SP+S+ITDSGSQ+V+P SE
Sbjct  126  SVENG-------HVAQEEEEDSPDSDITDSGSQEVKPASE  158



>ref|XP_007144596.1| hypothetical protein PHAVU_007G168900g [Phaseolus vulgaris]
 gb|ESW16590.1| hypothetical protein PHAVU_007G168900g [Phaseolus vulgaris]
Length=505

 Score =   145 bits (366),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 80/174 (46%), Positives = 106/174 (61%), Gaps = 33/174 (19%)
 Frame = +2

Query  245  PLVPNVMPTVVQTPPAMVSDSFAKDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEY  424
            P  P+  PT+V  PP +VSDSFAKDA++AWFRGEFAAANA+IDALC HL         +Y
Sbjct  5    PTAPSDRPTMV-PPPMLVSDSFAKDAILAWFRGEFAAANAIIDALCAHLAT----SAHDY  59

Query  425  ESVFAAIHRRRLNWIPILQMQKYYTIADVALELRKVsakkaedreaaaaasamadakhsa  604
            ++VFAAIHRRRLNWIP+LQMQKY++IADV LEL++                         
Sbjct  60   DAVFAAIHRRRLNWIPVLQMQKYHSIADVTLELQR-------------------------  94

Query  605  aaVMNVKISHASREEPVDNSENGGGEVVYEDSIRDDSHGSPESEITDSGSQDVQ  766
                + +  +A+ E+  +        VV  D+  +  + SP+SEITDSGSQ++Q
Sbjct  95   ---QSDRNHNAAAEDKSNEKTTSPESVVGNDAADEHEYESPQSEITDSGSQEMQ  145



>ref|XP_006287389.1| hypothetical protein CARUB_v10000595mg [Capsella rubella]
 gb|EOA20287.1| hypothetical protein CARUB_v10000595mg [Capsella rubella]
Length=563

 Score =   145 bits (365),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 97/193 (50%), Positives = 122/193 (63%), Gaps = 27/193 (14%)
 Frame = +2

Query  209  PAAGAVAQSNRVPLVPNVMPTVVQTPP-AMVSDSFAKDAVIAWFRGEFAAANAVIDALCN  385
            PA    A++  VP         VQ PP A+VSD   KDA+I+WFRGEFAAANA+IDA+C+
Sbjct  16   PAFATTAKAVTVP---------VQVPPGAVVSDGLGKDALISWFRGEFAAANAIIDAMCS  66

Query  386  HLTQLEGG-GGSEYESVFAAIHRRRLNWIPILQMQKYYTIADVALELRKVsakkaedrea  562
            HL   E    GSEYE+VFAAIHRRRLNWIP+LQMQKY++IA+VA+EL+KV+AKKAED + 
Sbjct  67   HLRATEEAVSGSEYEAVFAAIHRRRLNWIPVLQMQKYHSIAEVAIELQKVAAKKAEDLKQ  126

Query  563  aaaasamadakhsaaaVMNVKISHASREEPVDNSENGGGEVVYEDSIRDD----SHGSPE  730
                    +         ++K + A+ EE   +  N  GE V E+ I  D       SP 
Sbjct  127  KKKTEEAEE---------DLKETAAAEEEKKKDCFN--GEKVTENEINGDLEDVEDDSPT  175

Query  731  SEITDSGS-QDVQ  766
            S+ITDSGS QDV 
Sbjct  176  SDITDSGSHQDVH  188



>ref|XP_004496294.1| PREDICTED: uncharacterized protein LOC101493086 [Cicer arietinum]
Length=508

 Score =   144 bits (364),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 83/159 (52%), Positives = 98/159 (62%), Gaps = 29/159 (18%)
 Frame = +2

Query  293  MVSDSFAKDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIP  472
            +VSDSFAKDA++AWFRGEFAAANA+IDALC HL+QL     ++Y SVFAAIHRRRL+WIP
Sbjct  26   LVSDSFAKDAILAWFRGEFAAANAIIDALCTHLSQL--SSAADYSSVFAAIHRRRLHWIP  83

Query  473  ILQMQKYYTIADVALELRKVsakkaedreaaaaasamadakhsaaaVMNVKISHASREEP  652
            +LQMQKY++IADVAL+LRKV                            N  I    RE  
Sbjct  84   VLQMQKYHSIADVALQLRKVDE--------------------------NKNIVEEVREND  117

Query  653  VDNSENGGGEV-VYEDSIRDDSHGSPESEITDSGSQDVQ  766
            V   E    E  V E     + + SPESEITDSGSQ+ Q
Sbjct  118  VVVEEERKTEAKVIEAGDEHEEYDSPESEITDSGSQENQ  156



>gb|KHG19647.1| putative alpha-ketoglutarate-dependent dioxygenase ABH5 [Gossypium 
arboreum]
 gb|KHG21011.1| putative alpha-ketoglutarate-dependent dioxygenase ABH5 [Gossypium 
arboreum]
Length=557

 Score =   144 bits (364),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 73/112 (65%), Positives = 86/112 (77%), Gaps = 3/112 (3%)
 Frame = +2

Query  203  MPPAAGAVAQSNRVPLVPNVMPTVVQTPPAMVSDSFAKDAVIAWFRGEFAAANAVIDALC  382
            MP AAG  +   R   V + +  +VQ  PA VSD  AKD +I+WFRGEFAAANA+IDALC
Sbjct  1    MPMAAGPASPRERAQAVGSAIVPLVQAVPA-VSDVLAKDTIISWFRGEFAAANAIIDALC  59

Query  383  NHLTQLEGG--GGSEYESVFAAIHRRRLNWIPILQMQKYYTIADVALELRKV  532
             HL  L+GG  GGSEYE+VF AIHRRRLNWIP+LQMQKY++IADVA EL+KV
Sbjct  60   AHLALLQGGRGGGSEYEAVFTAIHRRRLNWIPVLQMQKYHSIADVAEELKKV  111



>ref|XP_003520217.1| PREDICTED: uncharacterized protein LOC100791586 [Glycine max]
Length=514

 Score =   144 bits (363),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 81/171 (47%), Positives = 106/171 (62%), Gaps = 30/171 (18%)
 Frame = +2

Query  254  PNVMPTVVQTPPAMVSDSFAKDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESV  433
            P+  PT+V  PP +VSDSFAKDA++AWFRGEFAAANA+IDALC HL+        +Y++V
Sbjct  10   PSDRPTMV-PPPMLVSDSFAKDAILAWFRGEFAAANAIIDALCAHLS---ASSAHDYDAV  65

Query  434  FAAIHRRRLNWIPILQMQKYYTIADVALELRKVsakkaedreaaaaasamadakhsaaaV  613
            F AIHRRRLNWIP+LQMQKY++IADV LEL +++ +      A                 
Sbjct  66   FTAIHRRRLNWIPVLQMQKYHSIADVTLELARLADRNHNSAAAEHETD------------  113

Query  614  MNVKISHASREEPVDNSENGGGEVVYEDSIRDDSHGSPESEITDSGSQDVQ  766
                     +  P ++  NGGG   +E+      + SPESEITDSGSQ++Q
Sbjct  114  --------DKTTPSESVGNGGGGDEHEE------YESPESEITDSGSQEMQ  150



>gb|KGN44860.1| hypothetical protein Csa_7G392330 [Cucumis sativus]
Length=583

 Score =   144 bits (362),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 70/110 (64%), Positives = 82/110 (75%), Gaps = 8/110 (7%)
 Frame = +2

Query  203  MPPAAGAVAQSNRVPLVPNVMPTVVQTPPAMVSDSFAKDAVIAWFRGEFAAANAVIDALC  382
            MP AAGA  ++      P VMP         V+D+ AKDAV+ WFRGEFAAANA+IDALC
Sbjct  1    MPMAAGATERAR-----PVVMPAAAAM---TVTDTLAKDAVLGWFRGEFAAANAIIDALC  52

Query  383  NHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQKYYTIADVALELRKV  532
             H+ Q+   GGSEYE+VF AIHRRRLNWIP+LQMQKY+ IADVA+ELRKV
Sbjct  53   GHMAQVSESGGSEYEAVFGAIHRRRLNWIPVLQMQKYHPIADVAVELRKV  102



>ref|XP_006588616.1| PREDICTED: uncharacterized protein LOC100802371 [Glycine max]
Length=511

 Score =   143 bits (360),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 85/185 (46%), Positives = 108/185 (58%), Gaps = 31/185 (17%)
 Frame = +2

Query  212  AAGAVAQSNRVPLVPNVMPTVVQTPPAMVSDSFAKDAVIAWFRGEFAAANAVIDALCNHL  391
            AAG  + S+R  +VP         PP +VSDSFAKDA++AWFRGEFAAANA+IDALC HL
Sbjct  2    AAGPTSLSDRSTMVP---------PPMLVSDSFAKDAILAWFRGEFAAANAIIDALCAHL  52

Query  392  TQLEGGGGSEYESVFAAIHRRRLNWIPILQMQKYYTIADVALELRKVsakkaedreaaaa  571
            +        +Y++VFAAIHRRRLNWIP+LQMQKY++IADV LEL +++ +          
Sbjct  53   SSAAASSAHDYDAVFAAIHRRRLNWIPVLQMQKYHSIADVTLELARLADRNHYAAAEDDD  112

Query  572  asamadakhsaaaVMNVKISHASREEPVDNSENGGGEVVYEDSIRDDSHGSPESEITDSG  751
            A    D K + +  +         EE             YE         SPESEITDSG
Sbjct  113  AKHETDEKTTPSESVGDGGGGDEHEE-------------YE---------SPESEITDSG  150

Query  752  SQDVQ  766
            SQ++Q
Sbjct  151  SQEMQ  155



>ref|XP_008451400.1| PREDICTED: uncharacterized protein LOC103492703 [Cucumis melo]
Length=578

 Score =   143 bits (360),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 71/110 (65%), Positives = 81/110 (74%), Gaps = 8/110 (7%)
 Frame = +2

Query  203  MPPAAGAVAQSNRVPLVPNVMPTVVQTPPAMVSDSFAKDAVIAWFRGEFAAANAVIDALC  382
            MP AAGA  +       P VMP         V+D+ AKDAV+ WFRGEFAAANA+IDALC
Sbjct  1    MPMAAGATDRGR-----PVVMPAAAAM---TVTDTLAKDAVLGWFRGEFAAANAIIDALC  52

Query  383  NHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQKYYTIADVALELRKV  532
             HL Q+   GGSEYE+VF AIHRRRLNWIP+LQMQKY+ IADVA+ELRKV
Sbjct  53   GHLAQVSESGGSEYEAVFGAIHRRRLNWIPVLQMQKYHPIADVAVELRKV  102



>ref|XP_009356724.1| PREDICTED: uncharacterized protein LOC103947542 [Pyrus x bretschneideri]
Length=545

 Score =   142 bits (359),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 88/179 (49%), Positives = 110/179 (61%), Gaps = 13/179 (7%)
 Frame = +2

Query  248  LVPNVMPTVVQTPPAMVSDSFAKDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYE  427
            L P +MP  +  P  +VSD+ AKDA+I W++GEFAAANA+IDALC HL QL GGG  EY 
Sbjct  19   LGPAMMP--MPAPVTVVSDAVAKDAIIGWYKGEFAAANAIIDALCGHLAQLSGGG-DEYA  75

Query  428  SVFAAIHRRRLNWIPILQMQKYYTIADVALELRKVsakkaedreaaaaasamadakhsaa  607
            SVFAAIHRRR+NWIP+LQMQKY++IADV +ELR V   K  + E   A     D   +  
Sbjct  76   SVFAAIHRRRINWIPVLQMQKYHSIADVMVELRNV-GSKKVEMEDQKACVENGDVSRTEE  134

Query  608  aVMNVKISHASREEPVDNSE------NGGGEVVYEDSIRDDSHGSPESEITDSGSQDVQ  766
               + ++     EE V  S+      NG G    E     D   SP+SEITD+GSQ+ Q
Sbjct  135  NCKSEEVKSCLDEEKVKESDEKVAESNGIGAAADEVG---DEEASPDSEITDAGSQEAQ  190



>ref|XP_006604416.1| PREDICTED: uncharacterized protein LOC100776159 isoform X2 [Glycine 
max]
Length=318

 Score =   139 bits (351),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 87/172 (51%), Positives = 110/172 (64%), Gaps = 29/172 (17%)
 Frame = +2

Query  266  PTVVQTPPAMVSDSFAKDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAI  445
            P +VQ PP +VSD FAKDA++AWF GEFAAANA+IDALC HL  L     S+Y++ FAAI
Sbjct  13   PAMVQ-PPLLVSDPFAKDAILAWFHGEFAAANAIIDALCGHLAHLA-AASSDYDAAFAAI  70

Query  446  HRRRLNWIPILQMQKYYTIADVALELRKVsakkaedreaaaaasamadakhsaaaVMNVK  625
            HRRRLNWIP++QMQKY++IADV LELR+V+ KK+E                        K
Sbjct  71   HRRRLNWIPVIQMQKYHSIADVTLELRRVAEKKSEHEA--------------------AK  110

Query  626  ISHASREE----PVDNSENGGGEVVYEDSIRDDSHGSPESEITDSGSQDVQP  769
             S +S EE      + +ENGG +    D      + SP+SEITDSGSQ++QP
Sbjct  111  KSESSFEEEGKLEKETAENGGND---GDDDAAPEYDSPDSEITDSGSQEMQP  159



>ref|XP_008386575.1| PREDICTED: uncharacterized protein LOC103449078 [Malus domestica]
Length=545

 Score =   142 bits (359),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 88/188 (47%), Positives = 112/188 (60%), Gaps = 11/188 (6%)
 Frame = +2

Query  221  AVAQSNRVPLVPNVMPTVVQTPPAMVSDSFAKDAVIAWFRGEFAAANAVIDALCNHLTQL  400
            AV+ ++    VP      +  P  +VSD+ AKDA+I W++GEFAAANA+IDALC HLTQL
Sbjct  8    AVSPTDGAAPVPGPSMMSMPAPVTVVSDAVAKDAIIGWYKGEFAAANAIIDALCGHLTQL  67

Query  401  EGGGGSEYESVFAAIHRRRLNWIPILQMQKYYTIADVALELRKVsakkaedreaaaaasa  580
              GGG EY SVFAAIHRRR+NWIP+LQMQKY++IADV +ELR V   K    E   A   
Sbjct  68   S-GGGDEYASVFAAIHRRRINWIPVLQMQKYHSIADVMVELRNV-GSKKVGMEDQKAYVE  125

Query  581  madakhsaaaVMNVKISHASREEPVDNSE------NGGGEVVYEDSIRDDSHGSPESEIT  742
                  +     + ++     EE V  S+      NG G    E +   D   SP+SEIT
Sbjct  126  NGGVSRTEEICKSEEVKSCLDEEKVKESDEKVAESNGIGAAADEVA---DEEASPDSEIT  182

Query  743  DSGSQDVQ  766
            D+GSQ+ Q
Sbjct  183  DAGSQEAQ  190



>ref|XP_007201711.1| hypothetical protein PRUPE_ppa003815mg [Prunus persica]
 gb|EMJ02910.1| hypothetical protein PRUPE_ppa003815mg [Prunus persica]
Length=547

 Score =   141 bits (355),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 86/168 (51%), Positives = 105/168 (63%), Gaps = 7/168 (4%)
 Frame = +2

Query  263  MPTVVQTPPAMVSDSFAKDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAA  442
            MPT    P AMVSD+ AKDA+I W+RGEFAAANA+ID+LC HLTQL  GGG+EY +VFAA
Sbjct  28   MPT--PAPVAMVSDAMAKDAIIGWYRGEFAAANAIIDSLCGHLTQLS-GGGAEYGAVFAA  84

Query  443  IHRRRLNWIPILQMQKYYTIADVALELRKVsakkaedreaaaaasamadakhsaaaVMNV  622
            IHRRR+NWIP+LQMQKY++IADV +ELR V AKKAE         +  D    +    + 
Sbjct  85   IHRRRINWIPVLQMQKYHSIADVMVELRNVGAKKAEKESEENGEVSGTDENCKSEEAKSC  144

Query  623  KISHASREEPVDNSENGGGEVVYEDSIRDDSHGSPESEITDSGSQDVQ  766
                  +E       NG            +   SP+SEITDSGSQ+ Q
Sbjct  145  LDEEKEKENEKVEESNGN----DAADEAIEEEASPDSEITDSGSQEAQ  188



>gb|KHN18902.1| hypothetical protein glysoja_028271 [Glycine soja]
Length=492

 Score =   140 bits (353),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 78/160 (49%), Positives = 102/160 (64%), Gaps = 30/160 (19%)
 Frame = +2

Query  293  MVSDSFAKDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIP  472
            +VSDSFAKDA++AWFRGEFAAANA+IDALC HL+        +Y++VFAAIHRRRLNWIP
Sbjct  2    LVSDSFAKDAILAWFRGEFAAANAIIDALCAHLSSAAASSAHDYDAVFAAIHRRRLNWIP  61

Query  473  ILQMQKYYTIADVALELRKVsakkaedreaaaaasamadakhsaaaVMNVKISHASREE-  649
            +LQMQKY++IADV LEL +++ +      A                       H + E+ 
Sbjct  62   VLQMQKYHSIADVTLELARLADRNHNAAAA----------------------EHETDEKT  99

Query  650  -PVDNSENGGGEVVYEDSIRDDSHGSPESEITDSGSQDVQ  766
             P ++  NGGG   +E+      + SPESEITDSGSQ++Q
Sbjct  100  TPSESVGNGGGGDEHEE------YESPESEITDSGSQEMQ  133



>ref|XP_007050695.1| Oxidoreductase, 2OG-Fe(II) oxygenase family protein, putative 
isoform 2, partial [Theobroma cacao]
 gb|EOX94852.1| Oxidoreductase, 2OG-Fe(II) oxygenase family protein, putative 
isoform 2, partial [Theobroma cacao]
Length=446

 Score =   139 bits (351),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 63/81 (78%), Positives = 74/81 (91%), Gaps = 2/81 (2%)
 Frame = +2

Query  296  VSDSFAKDAVIAWFRGEFAAANAVIDALCNHLTQLEGGG--GSEYESVFAAIHRRRLNWI  469
            V+D FAKD++I+WFRGEFAAANA+IDALC HL QL GGG  GSEYE+VF+AIHRRRLNWI
Sbjct  4    VADVFAKDSIISWFRGEFAAANAIIDALCAHLAQLHGGGAGGSEYEAVFSAIHRRRLNWI  63

Query  470  PILQMQKYYTIADVALELRKV  532
            P+LQMQKY++IADVA EL+KV
Sbjct  64   PVLQMQKYHSIADVAAELKKV  84



>ref|XP_004158952.1| PREDICTED: uncharacterized LOC101203670 [Cucumis sativus]
Length=548

 Score =   140 bits (352),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 68/107 (64%), Positives = 80/107 (75%), Gaps = 8/107 (7%)
 Frame = +2

Query  212  AAGAVAQSNRVPLVPNVMPTVVQTPPAMVSDSFAKDAVIAWFRGEFAAANAVIDALCNHL  391
            AAGA  ++      P VMP         V+D+ AKDAV+ WFRGEFAAANA+IDALC H+
Sbjct  2    AAGATERAR-----PVVMPAAAAM---TVTDTLAKDAVLGWFRGEFAAANAIIDALCGHM  53

Query  392  TQLEGGGGSEYESVFAAIHRRRLNWIPILQMQKYYTIADVALELRKV  532
             Q+   GGSEYE+VF AIHRRRLNWIP+LQMQKY+ IADVA+ELRKV
Sbjct  54   AQVSESGGSEYEAVFGAIHRRRLNWIPVLQMQKYHPIADVAVELRKV  100



>ref|XP_004148896.1| PREDICTED: uncharacterized protein LOC101203670 [Cucumis sativus]
Length=548

 Score =   140 bits (352),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 68/107 (64%), Positives = 80/107 (75%), Gaps = 8/107 (7%)
 Frame = +2

Query  212  AAGAVAQSNRVPLVPNVMPTVVQTPPAMVSDSFAKDAVIAWFRGEFAAANAVIDALCNHL  391
            AAGA  ++      P VMP         V+D+ AKDAV+ WFRGEFAAANA+IDALC H+
Sbjct  2    AAGATERAR-----PVVMPAAAAM---TVTDTLAKDAVLGWFRGEFAAANAIIDALCGHM  53

Query  392  TQLEGGGGSEYESVFAAIHRRRLNWIPILQMQKYYTIADVALELRKV  532
             Q+   GGSEYE+VF AIHRRRLNWIP+LQMQKY+ IADVA+ELRKV
Sbjct  54   AQVSESGGSEYEAVFGAIHRRRLNWIPVLQMQKYHPIADVAVELRKV  100



>ref|XP_008234920.1| PREDICTED: uncharacterized protein LOC103333806 [Prunus mume]
Length=549

 Score =   140 bits (352),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 84/161 (52%), Positives = 103/161 (64%), Gaps = 5/161 (3%)
 Frame = +2

Query  284  PPAMVSDSFAKDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLN  463
            P AMVSD+ AKDA+I W+RGEFAAANA+ID+LC HLTQL  GGG+EY +VFAAIHRRR+N
Sbjct  35   PVAMVSDAMAKDAIIGWYRGEFAAANAIIDSLCGHLTQLS-GGGAEYGAVFAAIHRRRIN  93

Query  464  WIPILQMQKYYTIADVALELRKVsakkaedreaaaaasamadakhsaaaVMNVKISHASR  643
            WIP+LQMQKY++IADV +ELR V AKKAE         + AD    +    +       +
Sbjct  94   WIPVLQMQKYHSIADVMVELRNVGAKKAEKESEENGEVSGADENCKSKEAKSCLDEEKEK  153

Query  644  EEPVDNSENGGGEVVYEDSIRDDSHGSPESEITDSGSQDVQ  766
            E       NG            +   SP+SEITDSGSQ+ Q
Sbjct  154  ENEKVEESNGN----DAADEAIEEEASPDSEITDSGSQEAQ  190



>ref|XP_006396520.1| hypothetical protein EUTSA_v10028541mg [Eutrema salsugineum]
 gb|ESQ37973.1| hypothetical protein EUTSA_v10028541mg [Eutrema salsugineum]
Length=571

 Score =   139 bits (351),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 90/168 (54%), Positives = 115/168 (68%), Gaps = 13/168 (8%)
 Frame = +2

Query  275  VQTPP-AMVSDSFAKDAVIAWFRGEFAAANAVIDALCNHLTQL--EGGGGSEYESVFAAI  445
            VQ PP A+VS+   KDA+I+WFRGEFAAANA+IDA+C HL +   E   GSEY++VFAAI
Sbjct  33   VQLPPGAVVSEGLGKDALISWFRGEFAAANAIIDAMCAHLRKTGDEAVSGSEYDAVFAAI  92

Query  446  HRRRLNWIPILQMQKYYTIADVALELRKVsakkaedreaaaaasamadakhsaaaVMNVK  625
            HRRRLNWIP+LQMQKY++IA+VA+EL+KV+AKKAED       +       + A  + VK
Sbjct  93   HRRRLNWIPVLQMQKYHSIAEVAIELQKVAAKKAEDLIERKTEAEDLKEMKTEAEEV-VK  151

Query  626  ISHASREEPVDNSENGGGEVVYEDSIRDDSHGSPESEITDSGS-QDVQ  766
             +  + E+  +N  NG  E V +D        SP S+ITDSGS QDVQ
Sbjct  152  KACFNGEKLTENELNGDVEEVEDD--------SPSSDITDSGSHQDVQ  191



>ref|XP_006604415.1| PREDICTED: uncharacterized protein LOC100776159 isoform X1 [Glycine 
max]
Length=518

 Score =   139 bits (351),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 87/172 (51%), Positives = 110/172 (64%), Gaps = 29/172 (17%)
 Frame = +2

Query  266  PTVVQTPPAMVSDSFAKDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAI  445
            P +VQ PP +VSD FAKDA++AWF GEFAAANA+IDALC HL  L     S+Y++ FAAI
Sbjct  13   PAMVQ-PPLLVSDPFAKDAILAWFHGEFAAANAIIDALCGHLAHLA-AASSDYDAAFAAI  70

Query  446  HRRRLNWIPILQMQKYYTIADVALELRKVsakkaedreaaaaasamadakhsaaaVMNVK  625
            HRRRLNWIP++QMQKY++IADV LELR+V+ KK+E                        K
Sbjct  71   HRRRLNWIPVIQMQKYHSIADVTLELRRVAEKKSEHEA--------------------AK  110

Query  626  ISHASREE----PVDNSENGGGEVVYEDSIRDDSHGSPESEITDSGSQDVQP  769
             S +S EE      + +ENGG +    D      + SP+SEITDSGSQ++QP
Sbjct  111  KSESSFEEEGKLEKETAENGGND---GDDDAAPEYDSPDSEITDSGSQEMQP  159



>gb|EPS66942.1| hypothetical protein M569_07834, partial [Genlisea aurea]
Length=152

 Score =   132 bits (332),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 77/161 (48%), Positives = 100/161 (62%), Gaps = 14/161 (9%)
 Frame = +2

Query  275  VQTPPAMVSDSFAKDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRR  454
            V  PP   +D+FAKDAVIAWFRGEFAAANA+IDALC HL ++EG  G+ YE+ F AIHRR
Sbjct  5    VMAPP---TDAFAKDAVIAWFRGEFAAANAIIDALCAHLARMEGEAGT-YEAAFTAIHRR  60

Query  455  RLNWIPILQMQKYYTIADVALELRKVsakkaedreaa-aaasamadakhsaaaVMNVKIS  631
            R+NWIPILQMQ +Y+IADVA EL KV+  +  +R  + +  +        +  +   K  
Sbjct  61   RMNWIPILQMQSFYSIADVATELNKVAEVRRGERVFSPSNEADSVADGGLSLPIYEDKPK  120

Query  632  HASREEPVDNSENGGGEVVYEDSIRDDSHGSPESEITDSGS  754
              + E  V ++EN GGE   +D           S ITDSG+
Sbjct  121  EKTPETSVSSNENAGGEAADDDFT---------SVITDSGT  152



>ref|XP_006444148.1| hypothetical protein CICLE_v10019581mg [Citrus clementina]
 ref|XP_006479782.1| PREDICTED: uncharacterized protein LOC102631062 [Citrus sinensis]
 gb|ESR57388.1| hypothetical protein CICLE_v10019581mg [Citrus clementina]
 gb|KDO68840.1| hypothetical protein CISIN_1g008986mg [Citrus sinensis]
Length=547

 Score =   139 bits (350),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 87/173 (50%), Positives = 106/173 (61%), Gaps = 16/173 (9%)
 Frame = +2

Query  275  VQTPPA-MVSDSFAKDAVIAWFRGEFAAANAVIDALCNHLTQLE--GGGGSEYESVFAAI  445
            VQ+PP  M+SD+FAKDA+IAWFRGEFAAANA+IDALC HL ++   GG GS YE VFAAI
Sbjct  21   VQSPPVVMMSDAFAKDAIIAWFRGEFAAANAIIDALCGHLAEVRGGGGIGSGYEKVFAAI  80

Query  446  HRRRLNWIPILQMQKYYTIADVALELRKVsakkaedreaaaaasamadakhsaaaVMNVK  625
            HRRR+NWI +LQMQKY++IA+V LELR V                  D +     +    
Sbjct  81   HRRRMNWISVLQMQKYHSIAEVTLELRNV--------TEKMVEEKKDDGEKKVDELKECL  132

Query  626  ISHASRE--EPVDNSENGGGEVVYEDSIRDDSHGSPESEITDSGSQDVQPISE  778
             S  S E  E +  SE             DD   SP S+ITDSGSQ++QPI+E
Sbjct  133  DSEKSTENGEKMTESEKKCEVEEETAVEEDD---SPNSDITDSGSQEMQPITE  182



>ref|XP_006576883.1| PREDICTED: uncharacterized protein LOC100796344 [Glycine max]
Length=520

 Score =   137 bits (345),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 78/159 (49%), Positives = 104/159 (65%), Gaps = 19/159 (12%)
 Frame = +2

Query  293  MVSDSFAKDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIP  472
            +VSDSFAKDA++AWFRGEFAAANA+ID+LC HL  L     S+Y++ F AIHRRRLNWIP
Sbjct  22   LVSDSFAKDAILAWFRGEFAAANAIIDSLCGHLAHL-AAASSDYDATFTAIHRRRLNWIP  80

Query  473  ILQMQKYYTIADVALELRKVsakkaedreaaaaasamadakhsaaaVMNVKISHASREEP  652
            ++QMQKY++IADV LELR+V+ KK E   A  + S+  +           K+   + E  
Sbjct  81   VIQMQKYHSIADVTLELRRVAEKKTETEAAKKSESSFDEEG---------KLEKQAVENG  131

Query  653  VDNSENGGGEVVYEDSIRDDSHGSPESEITDSGSQDVQP  769
             ++  +     VY+         SP+SEITDSGSQ++QP
Sbjct  132  GNDGGDDDAAPVYD---------SPDSEITDSGSQEMQP  161



>emb|CDY21924.1| BnaC09g00300D [Brassica napus]
Length=196

 Score =   131 bits (330),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 82/156 (53%), Positives = 103/156 (66%), Gaps = 13/156 (8%)
 Frame = +2

Query  281  TPPAMVSDSFAKDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRL  460
            TP A+VSD   KDA+I+WFRGEFAAANA+IDA+C+HL   E   GSEY++VFAAIHRRRL
Sbjct  26   TPVAVVSDGQGKDALISWFRGEFAAANAIIDAVCSHLR--EAVPGSEYDAVFAAIHRRRL  83

Query  461  NWIPILQMQKYYTIADVALELRKVsakkaedreaaaaasamadakhsaaaVMNVKISHAS  640
            NWIP+LQMQKY++IA+VA+EL+K+ AKKAED           D K S      +K    +
Sbjct  84   NWIPVLQMQKYHSIAEVAIELQKLEAKKAEDLVEEMKTETAEDLKQSRTETAEMKSVCFN  143

Query  641  REEPVDNSENGGGEVVYEDSIRDDSHGSPESEITDS  748
             E+  +N  NG         + DD   SP S+ITDS
Sbjct  144  GEKLTENELNG--------DVEDD---SPSSDITDS  168



>ref|XP_004493638.1| PREDICTED: uncharacterized protein LOC101495753 [Cicer arietinum]
Length=522

 Score =   137 bits (344),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 76/161 (47%), Positives = 101/161 (63%), Gaps = 20/161 (12%)
 Frame = +2

Query  284  PPAMVSDSFAKDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLN  463
            PP +VSDSFAKDA++AWFRGEFAAANA+ID+LC HL Q+     ++Y+S FAAIHRRR N
Sbjct  21   PPLLVSDSFAKDAILAWFRGEFAAANAIIDSLCGHLAQV-ASSSNDYDSAFAAIHRRRFN  79

Query  464  WIPILQMQKYYTIADVALELRKVsakkaedreaaaaasamadakhsaaaVMNVKISHASR  643
            WIP++QMQKY++IADV+LELRKV     E +  +         +      +   + +   
Sbjct  80   WIPVIQMQKYHSIADVSLELRKV----VEKKADSLDGETKISEEREIVEEVVECVGNEGE  135

Query  644  EEPVDNSENGGGEVVYEDSIRDDSHGSPESEITDSGSQDVQ  766
            E P + +     EV +          SP+SEITDSGSQ +Q
Sbjct  136  EAPAEMT-----EVCH----------SPDSEITDSGSQQIQ  161



>ref|XP_006380087.1| hypothetical protein POPTR_0008s21800g [Populus trichocarpa]
 gb|ERP57884.1| hypothetical protein POPTR_0008s21800g [Populus trichocarpa]
Length=160

 Score =   130 bits (326),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 58/77 (75%), Positives = 69/77 (90%), Gaps = 2/77 (3%)
 Frame = +2

Query  302  DSFAKDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQ  481
            D  AKD ++AWFR EFAAANA+IDALC+HL QL  G GSEYE+VFAAIHRRRLNWIP+LQ
Sbjct  26   DVIAKDVILAWFREEFAAANAIIDALCSHLAQL--GSGSEYEAVFAAIHRRRLNWIPVLQ  83

Query  482  MQKYYTIADVALELRKV  532
            MQKY++IADVAL+L++V
Sbjct  84   MQKYHSIADVALKLKRV  100



>ref|XP_010070256.1| PREDICTED: uncharacterized protein LOC104457030 isoform X1 [Eucalyptus 
grandis]
Length=525

 Score =   136 bits (343),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 75/162 (46%), Positives = 103/162 (64%), Gaps = 32/162 (20%)
 Frame = +2

Query  293  MVSDSFAKDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIP  472
            + +D+ A+D+V+AWFRGEFAAANA+IDALC HL QL GGGG+EYE+VFAA+HRRR+NWIP
Sbjct  40   LAADALARDSVMAWFRGEFAAANAIIDALCGHLVQL-GGGGTEYEAVFAAVHRRRMNWIP  98

Query  473  ILQMQKYYTIADVALELRKVsakkaedreaaaaasamadakhsaaaVMNVKISHASREEP  652
            +LQMQK+++IADVA+EL +V++                            ++ +A+    
Sbjct  99   VLQMQKFHSIADVAVELDRVAS----------------------------RMKNAAGGGG  130

Query  653  VDNSENGGGEVVYEDSIRDDSHGSPESEITDSGSQDVQPISE  778
                E G      E+   DD   SP+S+ITDSGS ++QP  E
Sbjct  131  EKEPEEGLAAEEEEEEEEDD---SPDSDITDSGSHEMQPALE  169



>ref|XP_002874886.1| oxidoreductase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH51145.1| oxidoreductase [Arabidopsis lyrata subsp. lyrata]
Length=565

 Score =   136 bits (343),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 88/167 (53%), Positives = 111/167 (66%), Gaps = 11/167 (7%)
 Frame = +2

Query  275  VQTPPA-MVSDSFAKDAVIAWFRGEFAAANAVIDALCNHLTQLEGG-GGSEYESVFAAIH  448
            VQ PP  +VS+   KDA+I+WFRGEFAAANA+IDA+C+HL   E    GSEYE+VFAAIH
Sbjct  31   VQVPPGTVVSEGLGKDALISWFRGEFAAANAIIDAMCSHLRITEEAVSGSEYEAVFAAIH  90

Query  449  RRRLNWIPILQMQKYYTIADVALELRKVsakkaedreaaaaasamadakhsaaaVMNVKI  628
            RRRLNWIP+LQMQKY++IA+VA+EL+KV+AKKAED +           + +A      K 
Sbjct  91   RRRLNWIPVLQMQKYHSIAEVAIELQKVAAKKAEDLKLKKTEEEEDLKEVAAEEEEVKKK  150

Query  629  SHASREEPVDNSENGGGEVVYEDSIRDDSHGSPESEITDSGS-QDVQ  766
               + E+  +N  NG  E V +D        SP S+ITDSGS QDV 
Sbjct  151  DCFNGEKLTENDVNGDVEDVEDD--------SPTSDITDSGSHQDVH  189



>ref|XP_010455955.1| PREDICTED: uncharacterized protein LOC104737461 [Camelina sativa]
Length=572

 Score =   135 bits (340),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 87/165 (53%), Positives = 108/165 (65%), Gaps = 17/165 (10%)
 Frame = +2

Query  293  MVSDSFAKDAVIAWFRGEFAAANAVIDALCNHL--TQLEGGGGSEYESVFAAIHRRRLNW  466
            +VS+   KDA+I+WFRGEFAAANA+IDA+C+HL  T  E   GSEYE+VFAAIHRRRLNW
Sbjct  43   VVSEGLGKDALISWFRGEFAAANAIIDAMCSHLRVTTEEAVSGSEYEAVFAAIHRRRLNW  102

Query  467  IPILQMQKYYTIADVALELRKVsakkaedreaaaaasamadakhsaaaVMNVKISHASRE  646
            IP+LQMQKY++IA+VA+EL+KV+AKKAED +      A       A          A+ +
Sbjct  103  IPVLQMQKYHSIAEVAIELQKVAAKKAEDLKLKKTEEADEQDLKEA----------AAEK  152

Query  647  EPVDNSENGGGEVVYEDSIRDD----SHGSPESEITDSGS-QDVQ  766
            E V   +   GE V E+ I  D       SP S+ITDSGS QDV 
Sbjct  153  EKVKKDDCIDGEKVTENEINGDVEDVEDDSPTSDITDSGSHQDVH  197



>ref|NP_192203.1| oxidoreductase, 2OG-Fe(II) oxygenase family protein [Arabidopsis 
thaliana]
 gb|AAC79112.1| hypothetical protein [Arabidopsis thaliana]
 emb|CAB77779.1| hypothetical protein [Arabidopsis thaliana]
 gb|AAM13042.1| unknown protein [Arabidopsis thaliana]
 gb|AAM91324.1| unknown protein [Arabidopsis thaliana]
 gb|AEE82253.1| oxidoreductase, 2OG-Fe(II) oxygenase family protein [Arabidopsis 
thaliana]
Length=569

 Score =   135 bits (339),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 89/169 (53%), Positives = 113/169 (67%), Gaps = 13/169 (8%)
 Frame = +2

Query  275  VQTPPA-MVSDSFAKDAVIAWFRGEFAAANAVIDALCNHLTQLEGG-GGSEYESVFAAIH  448
            VQ PPA +VS+   KDA+I+WFRGEFAAANA+IDA+C+HL   E    GSEYE+VFAAIH
Sbjct  33   VQVPPATVVSEGLGKDALISWFRGEFAAANAIIDAMCSHLRIAEEAVSGSEYEAVFAAIH  92

Query  449  RRRLNWIPILQMQKYYTIADVALELRKVsakkae--dreaaaaasamadakhsaaaVMNV  622
            RRRLNWIP+LQMQKY++IA+VA+EL+KV+AKKAE   ++     +     +  A     V
Sbjct  93   RRRLNWIPVLQMQKYHSIAEVAIELQKVAAKKAEDLKQKKTEEEAEEDLKEVVATEEEEV  152

Query  623  KISHASREEPVDNSENGGGEVVYEDSIRDDSHGSPESEITDSGS-QDVQ  766
            K    + E+  +N  NG  E V +D        SP S+ITDSGS QDV 
Sbjct  153  KKECFNGEKVTENDVNGDVEDVEDD--------SPTSDITDSGSHQDVH  193



>ref|XP_002321056.1| oxidoreductase family protein [Populus trichocarpa]
 gb|EEE99371.1| oxidoreductase family protein [Populus trichocarpa]
Length=551

 Score =   134 bits (338),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 78/155 (50%), Positives = 103/155 (66%), Gaps = 26/155 (17%)
 Frame = +2

Query  299  SDSFAKDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPIL  478
            +D+ AKDA++AWFRGEFAAANA+IDALC+HL QL+ G  SEYE+VFAAIH RRLNWIP+L
Sbjct  25   ADTIAKDAILAWFRGEFAAANAIIDALCSHLAQLDAG--SEYEAVFAAIHGRRLNWIPVL  82

Query  479  QMQKYYTIADVALELRKVsakkaedreaaaaasamadakhsaaaVMNVKISHASREEPVD  658
            QMQKY++IADVALEL++V                 A+ K  AA+  NV+    S E+   
Sbjct  83   QMQKYHSIADVALELKRV-----------------AETKLEAASFGNVETDKFSDEKVKI  125

Query  659  NSENGGGEVVYEDSIRDDSHGSPESEITDSGSQDV  763
            + ENG          +++   SP+S+ITDSG + +
Sbjct  126  SVENG-------HVAQEEEEDSPDSDITDSGFRTI  153



>emb|CDY22086.1| BnaA09g01150D [Brassica napus]
Length=584

 Score =   134 bits (337),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 95/201 (47%), Positives = 120/201 (60%), Gaps = 28/201 (14%)
 Frame = +2

Query  209  PAAGAVAQSNRVPLVPNVMP------------TVVQTPP--AMVSDSFAKDAVIAWFRGE  346
            PAA    +  R+P+   V P            T  +T P  A+VSD   KDA+I+WFRGE
Sbjct  24   PAAVKTTEIPRMPMTIAVTPSRQTDRSASPFATAAKTVPPVAVVSDGQGKDALISWFRGE  83

Query  347  FAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQKYYTIADVALELR  526
            FAAANA+IDA+C+HL   E   GSEY++VFAAIHRRRLNWIP+LQMQKY++IA+VA+EL+
Sbjct  84   FAAANAIIDAVCSHLR--EAVPGSEYDAVFAAIHRRRLNWIPVLQMQKYHSIAEVAIELQ  141

Query  527  KVsakkaedreaaaaasamadakhsaaaVMNVKISHASREEPVDNSENGGGEVVYEDSIR  706
            K+ AKKAED           D K S      +K    + E+  +N  NG         + 
Sbjct  142  KLEAKKAEDLVEEMKTETAEDLKQSRTETAEMKSVCFNGEKLTENELNG--------DVE  193

Query  707  DDSHGSPESEITDSGS-QDVQ  766
            DD   SP S+ITDSGS QDV 
Sbjct  194  DD---SPSSDITDSGSHQDVH  211



>ref|XP_010070257.1| PREDICTED: uncharacterized protein LOC104457030 isoform X2 [Eucalyptus 
grandis]
Length=553

 Score =   134 bits (336),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 74/80 (93%), Gaps = 1/80 (1%)
 Frame = +2

Query  293  MVSDSFAKDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIP  472
            + +D+ A+D+V+AWFRGEFAAANA+IDALC HL QL GGGG+EYE+VFAA+HRRR+NWIP
Sbjct  40   LAADALARDSVMAWFRGEFAAANAIIDALCGHLVQL-GGGGTEYEAVFAAVHRRRMNWIP  98

Query  473  ILQMQKYYTIADVALELRKV  532
            +LQMQK+++IADVA+EL +V
Sbjct  99   VLQMQKFHSIADVAVELDRV  118



>ref|XP_010696340.1| PREDICTED: uncharacterized protein LOC104908870 [Beta vulgaris 
subsp. vulgaris]
Length=546

 Score =   134 bits (336),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 84/193 (44%), Positives = 110/193 (57%), Gaps = 13/193 (7%)
 Frame = +2

Query  203  MPPAAGAVAQSNRVP-LVPNVMPTVVQTPPAMVSDSFAKDAVIAWFRGEFAAANAVIDAL  379
            M PAAG ++ S+  P + P      V TP         KD VI W+RGEFAA+NA+IDAL
Sbjct  1    MSPAAGPLSPSDGAPAMSPAFTGAGVLTPAQ-------KDKVIEWYRGEFAASNAIIDAL  53

Query  380  CNHLTQLEGGGGSE----YESVFAAIHRRRLNWIPILQMQKYYTIADVALELRKVsakka  547
            C+HL Q+ G G +E    YE VF+AIHRRRLNWIP+LQMQKY+TI+DVA ELRK +A++ 
Sbjct  54   CHHLVQIGGSGSAEIPAEYEGVFSAIHRRRLNWIPVLQMQKYFTISDVAHELRKAAARRE  113

Query  548  edreaaaaasamadakhsaaaVMNVKISHASREEPVDNSENGGGEVVYEDSIRDDSHGSP  727
            +    A   +     K     V  V        E +D+     G V     +  +   SP
Sbjct  114  KIEAEAVVETVAVGNKGGEERVKEVD-DFKIEGEVIDSDGKCNGNVNGNGCLSSEGEDSP  172

Query  728  ESEITDSGSQDVQ  766
            +SEITD+GS +V 
Sbjct  173  DSEITDTGSHEVH  185



>ref|XP_010038135.1| PREDICTED: uncharacterized protein LOC104426697 [Eucalyptus grandis]
Length=569

 Score =   134 bits (336),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 89/204 (44%), Positives = 121/204 (59%), Gaps = 21/204 (10%)
 Frame = +2

Query  212  AAGAVAQSNRVPLVPNVMPTVVQTP---PAMVSDSFAKDAVIAWFRGEFAAANAVIDALC  382
            AAG  + +N+ P      P  +Q P   P + +D+ A+D ++AWFRGEFAAANA+IDALC
Sbjct  2    AAGLASTANKTPC-----PLAIQMPRSYPVLAADALARDGMVAWFRGEFAAANAIIDALC  56

Query  383  NHLTQLEGGGG-SEYESVFAAIHRRRLNWIPILQMQKYYTIADVALELRKVsakkaedre  559
             HL +L GG G +EY  VF AIH+RRLNWIP+LQ Q++Y+IADV  EL++V+A+++    
Sbjct  57   GHLVELGGGAGWAEYGPVFTAIHQRRLNWIPVLQRQEFYSIADVVAELKRVAARRSAMAA  116

Query  560  aaaaasamadak-----hsaaaVMNVKIS-HASRE-----EPVDNSENGGGEVVYEDSIR  706
            AAA                +     VK S    RE     E V  S+ GGG       + 
Sbjct  117  AAAVEEEELVEVEGRDGSESFGAEEVKESERLEREKEGIPEKVMESDGGGGGDFEVVDVE  176

Query  707  DDSHGSPESEITDSGSQDVQPISE  778
            DDS  +  S++TDSGSQ++QP SE
Sbjct  177  DDSPAT-ASDVTDSGSQELQPTSE  199



>ref|XP_010422515.1| PREDICTED: uncharacterized protein LOC104707789 [Camelina sativa]
Length=575

 Score =   133 bits (335),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 88/166 (53%), Positives = 112/166 (67%), Gaps = 13/166 (8%)
 Frame = +2

Query  290  AMVSDSFAKDAVIAWFRGEFAAANAVIDALCNHL--TQLEGGGGSEYESVFAAIHRRRLN  463
             +VS+   KDA+I+WFRGEFAAANA+IDA+C+HL  T  E   GSEYE+VFAAIHRRRLN
Sbjct  41   TVVSEGLGKDALISWFRGEFAAANAIIDAMCSHLRVTTEEAVSGSEYEAVFAAIHRRRLN  100

Query  464  WIPILQMQKYYTIADVALELRKVsakkaedreaaaaasamadakhsaaaVMNVKISHASR  643
            WIP+LQMQKY++IA+VA+EL+KV+AKKAED +      A  D K +A A    +     +
Sbjct  101  WIPVLQMQKYHSIAEVAIELQKVAAKKAEDLKLKKTEEAEQDLKEAATAEEEEEKVIKKK  160

Query  644  EEPVDNSENGGGEVVYEDSIRDD----SHGSPESEITDSGS-QDVQ  766
            ++ +D      GE V E+ I  D       SP S+ITDSGS QDV 
Sbjct  161  DDCID------GEKVTENEINGDVEDVEDDSPTSDITDSGSHQDVH  200



>ref|XP_009111249.1| PREDICTED: uncharacterized protein LOC103836707 [Brassica rapa]
Length=585

 Score =   132 bits (333),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 93/202 (46%), Positives = 118/202 (58%), Gaps = 29/202 (14%)
 Frame = +2

Query  209  PAAGAVAQSNRVPLVPNVMP--------------TVVQTPP-AMVSDSFAKDAVIAWFRG  343
            PAA    +  R+P+   V P              T    PP A+VSD   KDA+I+WFRG
Sbjct  24   PAAVKTTEIPRMPMTIAVTPSRQTDRSASPFATATAKTVPPVAVVSDGQGKDALISWFRG  83

Query  344  EFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQKYYTIADVALEL  523
            EFAAANA+IDA+C+HL   E   GSEY++VFAAIHRRRLNWIP+LQMQKY++IA+VA+EL
Sbjct  84   EFAAANAIIDAVCSHLR--EAVPGSEYDAVFAAIHRRRLNWIPVLQMQKYHSIAEVAIEL  141

Query  524  RKVsakkaedreaaaaasamadakhsaaaVMNVKISHASREEPVDNSENGGGEVVYEDSI  703
            +K+ AKK ED           D K S      +K    + E+  ++  NG         +
Sbjct  142  QKLEAKKTEDLVEEMKTETAEDLKQSRTETAEMKSVCFNGEKLTESELNG--------DV  193

Query  704  RDDSHGSPESEITDSGS-QDVQ  766
             DD   SP S+ITDSGS QDV 
Sbjct  194  EDD---SPSSDITDSGSHQDVH  212



>gb|KFK30895.1| hypothetical protein AALP_AA6G039900 [Arabis alpina]
Length=564

 Score =   132 bits (331),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 84/184 (46%), Positives = 109/184 (59%), Gaps = 38/184 (21%)
 Frame = +2

Query  263  MPTVVQTPPAMVSDSFAKDAVIAWFRGEFAAANAVIDALCNHLTQLEGGG--------GS  418
            +P  +    A+VS+   KDA+I+WFRGEFAAANA+IDA+C+HL + +           GS
Sbjct  26   IPVQISQTGAVVSEGLGKDALISWFRGEFAAANAIIDAMCSHLRKTKTTADDEDDTVSGS  85

Query  419  EYESVFAAIHRRRLNWIPILQMQKYYTIADVALELRKVsakkaedreaaaaasamadakh  598
            EY++VFAAIHRRRLNWIP+LQMQKY++IA+VA+EL+KV                   A  
Sbjct  86   EYDAVFAAIHRRRLNWIPVLQMQKYHSIAEVAIELQKV-------------------AAK  126

Query  599  saaaVMNVKISHASREE--PVDNSENG-GGEVVYE----DSIRDDSHGSPESEITDSGS-  754
                +   KIS A  E+    + +E G  GE V E    D + DD   SP S+ITDSGS 
Sbjct  127  KTEDLKQRKISAAEDEDLKTEEATEKGFNGEKVTENGDVDDVEDD---SPSSDITDSGSH  183

Query  755  QDVQ  766
            QDV 
Sbjct  184  QDVH  187



>ref|XP_010938799.1| PREDICTED: uncharacterized protein LOC105057798 [Elaeis guineensis]
 ref|XP_010938800.1| PREDICTED: uncharacterized protein LOC105057798 [Elaeis guineensis]
Length=536

 Score =   131 bits (329),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/75 (77%), Positives = 67/75 (89%), Gaps = 2/75 (3%)
 Frame = +2

Query  308  FAKDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQ  487
            FA+DA+IAWFRGEFAAANA+IDALC HL Q+EGG  SEYE VFAAIHRRR+NWIP+L MQ
Sbjct  20   FARDAIIAWFRGEFAAANAIIDALCGHLAQIEGG--SEYEEVFAAIHRRRMNWIPVLHMQ  77

Query  488  KYYTIADVALELRKV  532
            KY++IADV  ELR+V
Sbjct  78   KYFSIADVVGELRRV  92



>ref|XP_010542876.1| PREDICTED: uncharacterized protein LOC104815949 [Tarenaya hassleriana]
Length=550

 Score =   130 bits (328),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 89/198 (45%), Positives = 116/198 (59%), Gaps = 41/198 (21%)
 Frame = +2

Query  203  MPPAAGAVAQSNRVPLVPNVMPTVVQTP---------PAMVSDSFAKDAVIAWFRGEFAA  355
            MP AA    Q++R       +PT V  P          A+V +   KDA++AWF+GEFAA
Sbjct  1    MPIAAATAPQTDRS------VPTAVAVPVPFQISAATAAVVPEGIGKDALLAWFKGEFAA  54

Query  356  ANAVIDALCNHLTQLEGGGGS---EYESVFAAIHRRRLNWIPILQMQKYYTIADVALELR  526
            ANA+IDALC+HL +   G  S   EYE+VFAA+HRRRLNWIP+LQMQKY++IA+VA+EL+
Sbjct  55   ANAIIDALCSHLKKASVGAASDESEYEAVFAALHRRRLNWIPVLQMQKYHSIAEVAIELQ  114

Query  527  KVsakkaedreaaaaasamadakhsaaaVMNVKISHASREEPVDNSENGGGEVVYEDSIR  706
            KV+AKKA D +   A                VK      E+  +N  NG  E V +D   
Sbjct  115  KVAAKKAADLKEKKAE--------------EVKAC-LEGEKVTENEPNGDVEEVEDD---  156

Query  707  DDSHGSPESEITDSGSQD  760
                 SP SEIT++GSQ+
Sbjct  157  -----SPSSEITEAGSQE  169



>ref|XP_003591621.1| hypothetical protein MTR_1g089860 [Medicago truncatula]
Length=513

 Score =   130 bits (326),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 72/158 (46%), Positives = 97/158 (61%), Gaps = 37/158 (23%)
 Frame = +2

Query  293  MVSDSFAKDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIP  472
            +VSDS+AKDA++AWF GEFAAANA+IDALC+HL+ L     ++Y +VFAAIHRRRL+WI 
Sbjct  31   LVSDSYAKDAILAWFHGEFAAANAIIDALCSHLSHLS--SAADYSNVFAAIHRRRLHWIQ  88

Query  473  ILQMQKYYTIADVALELRKVsakkaedreaaaaasamadakhsaaaVMNVKISHASREEP  652
            ILQMQKY++IADVAL+L+ V+                             K  +   ++ 
Sbjct  89   ILQMQKYHSIADVALQLKTVAD----------------------------KKKYQEEQKT  120

Query  653  VDNSENGGGEVVYEDSIRDDSHGSPESEITDSGSQDVQ  766
             +   +GGG+         + + SPESEITDSGSQ+ Q
Sbjct  121  EEKVIDGGGD-------EHEEYDSPESEITDSGSQENQ  151



>gb|KEH23703.1| 2OG-Fe(II) oxygenase family oxidoreductase [Medicago truncatula]
Length=514

 Score =   129 bits (325),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 78/163 (48%), Positives = 100/163 (61%), Gaps = 27/163 (17%)
 Frame = +2

Query  278  QTPPAMVSDSFAKDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRR  457
            Q  P  V DS+AKDA++AWF GEFAAANA+IDALC HL Q+     ++Y+S F A+HRRR
Sbjct  18   QPAPPFV-DSYAKDAMLAWFHGEFAAANAIIDALCGHLAQI-APSSNDYDSAFTAVHRRR  75

Query  458  LNWIPILQMQKYYTIADVALELRKVsakkaedreaaaaasamadakhsaaaVMNVKISHA  637
             NWIP++QMQKY++IADV LEL KV                    ++   +V  VK    
Sbjct  76   FNWIPVIQMQKYHSIADVTLELHKV-------------------VENKTESVEGVK---K  113

Query  638  SREEPVDNSENGGGEVVYEDSIRDDSHGSPESEITDSGSQDVQ  766
              EE V++  NGG +   E ++ DDS     SEITDSGSQ+VQ
Sbjct  114  IDEEVVESVRNGGVDDPAEVTVEDDSL---VSEITDSGSQEVQ  153



>gb|KEH43287.1| 2OG-Fe(II) oxygenase family oxidoreductase [Medicago truncatula]
Length=377

 Score =   128 bits (322),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 74/158 (47%), Positives = 101/158 (64%), Gaps = 24/158 (15%)
 Frame = +2

Query  293  MVSDSFAKDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIP  472
            +VSDS+AKDA++AWF GEFAAANA+IDALC+HL+ L     ++Y +VFAAIHRRRL+WI 
Sbjct  31   LVSDSYAKDAILAWFHGEFAAANAIIDALCSHLSHL--SSAADYSNVFAAIHRRRLHWIQ  88

Query  473  ILQMQKYYTIADVALELRKVsakkaedreaaaaasamadakhsaaaVMNVKISHASREEP  652
            ILQMQKY++IADVAL+L+ V+ KK    E                   ++ +     ++ 
Sbjct  89   ILQMQKYHSIADVALQLKTVADKKNTVEEVIQN---------------DIVVMEEEEQKT  133

Query  653  VDNSENGGGEVVYEDSIRDDSHGSPESEITDSGSQDVQ  766
             +   +GGG+         + + SPESEITDSGSQ+ Q
Sbjct  134  EEKVIDGGGD-------EHEEYDSPESEITDSGSQENQ  164



>ref|XP_010507817.1| PREDICTED: uncharacterized protein LOC104784489 isoform X2 [Camelina 
sativa]
Length=335

 Score =   127 bits (319),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 57/84 (68%), Positives = 69/84 (82%), Gaps = 1/84 (1%)
 Frame = +2

Query  275  VQTPPAMVSDSFAKDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRR  454
            VQ PP ++SDS AKD +I WFRGEFAAANA+IDALC HL Q   GG +EYE+V AA+HRR
Sbjct  9    VQHPPVLLSDSAAKDVMIKWFRGEFAAANAIIDALCGHLMQ-GCGGSAEYEAVMAALHRR  67

Query  455  RLNWIPILQMQKYYTIADVALELR  526
            RLNWIP+LQMQ Y++I+ V LEL+
Sbjct  68   RLNWIPVLQMQNYHSISQVTLELQ  91



>ref|XP_010507816.1| PREDICTED: uncharacterized protein LOC104784489 isoform X1 [Camelina 
sativa]
Length=339

 Score =   127 bits (319),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 57/84 (68%), Positives = 69/84 (82%), Gaps = 1/84 (1%)
 Frame = +2

Query  275  VQTPPAMVSDSFAKDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRR  454
            VQ PP ++SDS AKD +I WFRGEFAAANA+IDALC HL Q   GG +EYE+V AA+HRR
Sbjct  9    VQHPPVLLSDSAAKDVMIKWFRGEFAAANAIIDALCGHLMQ-GCGGSAEYEAVMAALHRR  67

Query  455  RLNWIPILQMQKYYTIADVALELR  526
            RLNWIP+LQMQ Y++I+ V LEL+
Sbjct  68   RLNWIPVLQMQNYHSISQVTLELQ  91



>ref|XP_009412173.1| PREDICTED: uncharacterized protein LOC103993726 [Musa acuminata 
subsp. malaccensis]
Length=561

 Score =   129 bits (324),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 57/75 (76%), Positives = 68/75 (91%), Gaps = 2/75 (3%)
 Frame = +2

Query  308  FAKDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQ  487
            +A+DA+IAWFRGEFAAANA+IDALC+HL Q+  GG +EYE+VFAA+HRRRLNWIP+L MQ
Sbjct  21   YARDAMIAWFRGEFAAANAIIDALCSHLAQI--GGAAEYEAVFAAVHRRRLNWIPVLHMQ  78

Query  488  KYYTIADVALELRKV  532
            KYY+IADVA ELR V
Sbjct  79   KYYSIADVAAELRVV  93



>gb|AAT85148.1| hypothetical protein [Oryza sativa Japonica Group]
Length=252

 Score =   125 bits (313),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 54/73 (74%), Positives = 64/73 (88%), Gaps = 2/73 (3%)
 Frame = +2

Query  314  KDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQKY  493
            +DAVI WFRGEFAAANAVIDALC HL Q+  GG +EYE+VFAA+HRRRLNW P+L MQK+
Sbjct  34   RDAVIGWFRGEFAAANAVIDALCGHLAQI--GGDAEYEAVFAALHRRRLNWFPVLHMQKF  91

Query  494  YTIADVALELRKV  532
            Y++ADVA ELR+V
Sbjct  92   YSVADVAAELRRV  104



>ref|XP_010430544.1| PREDICTED: uncharacterized protein LOC104714781 [Camelina sativa]
Length=567

 Score =   129 bits (323),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 87/164 (53%), Positives = 108/164 (66%), Gaps = 13/164 (8%)
 Frame = +2

Query  290  AMVSDSFAKDAVIAWFRGEFAAANAVIDALCNHL---TQLEGGGGSEYESVFAAIHRRRL  460
             +VS+   KDA+I+WFRGEFAAANA+IDA+C+HL   T+     GSEYE+VFAAIHRRRL
Sbjct  38   TVVSEGLGKDALISWFRGEFAAANAIIDAMCSHLRVTTEEAVSSGSEYEAVFAAIHRRRL  97

Query  461  NWIPILQMQKYYTIADVALELRKVsakkaedreaaaaasamadakhsaaaVMNVKISHAS  640
            NWIP+LQMQKY++IA+VA+EL+KV+AKK ED +         D K +AA     K     
Sbjct  98   NWIPVLQMQKYHSIAEVAIELQKVAAKKTEDLKLKKTEEVEQDLKEAAAEEKEEKKDDCI  157

Query  641  REEPVDNSE-NGGGEVVYEDSIRDDSHGSPESEITDSGS-QDVQ  766
              E V  +E NG  E V +D        SP S+ITDSGS QDV 
Sbjct  158  DGEKVTENEINGDVEDVEDD--------SPTSDITDSGSHQDVH  193



>gb|KEH43288.1| 2OG-Fe(II) oxygenase family oxidoreductase [Medicago truncatula]
Length=526

 Score =   127 bits (319),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 74/158 (47%), Positives = 101/158 (64%), Gaps = 24/158 (15%)
 Frame = +2

Query  293  MVSDSFAKDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIP  472
            +VSDS+AKDA++AWF GEFAAANA+IDALC+HL+ L     ++Y +VFAAIHRRRL+WI 
Sbjct  31   LVSDSYAKDAILAWFHGEFAAANAIIDALCSHLSHLS--SAADYSNVFAAIHRRRLHWIQ  88

Query  473  ILQMQKYYTIADVALELRKVsakkaedreaaaaasamadakhsaaaVMNVKISHASREEP  652
            ILQMQKY++IADVAL+L+ V+ KK    E                   ++ +     ++ 
Sbjct  89   ILQMQKYHSIADVALQLKTVADKKNTVEEVIQN---------------DIVVMEEEEQKT  133

Query  653  VDNSENGGGEVVYEDSIRDDSHGSPESEITDSGSQDVQ  766
             +   +GGG+         + + SPESEITDSGSQ+ Q
Sbjct  134  EEKVIDGGGD-------EHEEYDSPESEITDSGSQENQ  164



>ref|XP_010506854.1| PREDICTED: uncharacterized protein LOC104783394 [Camelina sativa]
Length=459

 Score =   127 bits (318),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 57/84 (68%), Positives = 69/84 (82%), Gaps = 1/84 (1%)
 Frame = +2

Query  275  VQTPPAMVSDSFAKDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRR  454
            VQ PP ++SDS AKD +I WFRGEFAAANA+IDALC HL Q   GG +EYE+V AA+HRR
Sbjct  9    VQPPPVLLSDSAAKDVMIKWFRGEFAAANAIIDALCGHLMQ-GCGGSAEYEAVMAALHRR  67

Query  455  RLNWIPILQMQKYYTIADVALELR  526
            RLNWIP+LQMQ Y++I+ V LEL+
Sbjct  68   RLNWIPVLQMQNYHSISQVTLELQ  91



>ref|XP_008779525.1| PREDICTED: uncharacterized protein LOC103699262, partial [Phoenix 
dactylifera]
Length=178

 Score =   121 bits (304),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 53/70 (76%), Positives = 61/70 (87%), Gaps = 2/70 (3%)
 Frame = +2

Query  314  KDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQKY  493
            +DA+IAWFRGEFAAANA+IDALC HL Q+EGG  SEYE VFAAIHRRR+NWIP+L MQKY
Sbjct  20   RDAIIAWFRGEFAAANAIIDALCGHLAQIEGG--SEYEEVFAAIHRRRMNWIPVLHMQKY  77

Query  494  YTIADVALEL  523
            ++IADV   L
Sbjct  78   FSIADVGGAL  87



>gb|EMT23126.1| hypothetical protein F775_27645 [Aegilops tauschii]
Length=190

 Score =   121 bits (304),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 52/74 (70%), Positives = 65/74 (88%), Gaps = 3/74 (4%)
 Frame = +2

Query  311  AKDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQK  490
            A+DAVI W+RGEFAAANAVIDALC HL Q+   GG++Y++VFAA+HRRRLNW P+L MQK
Sbjct  21   ARDAVIGWYRGEFAAANAVIDALCGHLAQI---GGADYDAVFAALHRRRLNWFPVLHMQK  77

Query  491  YYTIADVALELRKV  532
            +Y++ADVA ELR+V
Sbjct  78   FYSVADVAAELRRV  91



>ref|XP_002882147.1| hypothetical protein ARALYDRAFT_322448 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58406.1| hypothetical protein ARALYDRAFT_322448 [Arabidopsis lyrata subsp. 
lyrata]
Length=454

 Score =   126 bits (317),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 55/83 (66%), Positives = 71/83 (86%), Gaps = 1/83 (1%)
 Frame = +2

Query  284  PPAMVSDSFAKDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLN  463
            PP ++SDS AKDA++ WFRGEFAAANA+IDALC HL Q   GG ++YESV AA+HRRRLN
Sbjct  12   PPVLLSDSAAKDAMLTWFRGEFAAANAMIDALCAHLMQ-GSGGSAQYESVMAALHRRRLN  70

Query  464  WIPILQMQKYYTIADVALELRKV  532
            WIP+LQMQKY++I+ V L+L+++
Sbjct  71   WIPVLQMQKYHSISQVTLQLQQL  93



>gb|KCW49947.1| hypothetical protein EUGRSUZ_K03407 [Eucalyptus grandis]
Length=546

 Score =   126 bits (316),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 81/176 (46%), Positives = 109/176 (62%), Gaps = 13/176 (7%)
 Frame = +2

Query  287  PAMVSDSFAKDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGG-SEYESVFAAIHRRRLN  463
            P + +D+ A+D ++AWFRGEFAAANA+IDALC HL +L GG G +EY  VF AIH+RRLN
Sbjct  6    PVLAADALARDGMVAWFRGEFAAANAIIDALCGHLVELGGGAGWAEYGPVFTAIHQRRLN  65

Query  464  WIPILQMQKYYTIADVALELRKVsakkaedreaaaaasamadak-----hsaaaVMNVKI  628
            WIP+LQ Q++Y+IADV  EL++V+A+++    AAA                +     VK 
Sbjct  66   WIPVLQRQEFYSIADVVAELKRVAARRSAMAAAAAVEEEELVEVEGRDGSESFGAEEVKE  125

Query  629  S-HASRE-----EPVDNSENGGGEVVYEDSIRDDSHGSPESEITDSGSQDVQPISE  778
            S    RE     E V  S+ GGG       + DDS  +  S++TDSGSQ++QP SE
Sbjct  126  SERLEREKEGIPEKVMESDGGGGGDFEVVDVEDDSPAT-ASDVTDSGSQELQPTSE  180



>ref|XP_010905740.1| PREDICTED: uncharacterized protein LOC105032859 [Elaeis guineensis]
Length=525

 Score =   125 bits (315),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 54/75 (72%), Positives = 68/75 (91%), Gaps = 2/75 (3%)
 Frame = +2

Query  308  FAKDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQ  487
            FA+DA++AWFRGEFAAANA+IDALC HL +++GG  +EYE++FAAIHRRRLNWIP+L MQ
Sbjct  19   FARDAILAWFRGEFAAANAIIDALCGHLAEIDGG--AEYEALFAAIHRRRLNWIPVLHMQ  76

Query  488  KYYTIADVALELRKV  532
            KY++IADVA EL +V
Sbjct  77   KYFSIADVAGELHRV  91



>gb|KJB23151.1| hypothetical protein B456_004G083800 [Gossypium raimondii]
Length=555

 Score =   125 bits (315),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 73/113 (65%), Positives = 87/113 (77%), Gaps = 4/113 (4%)
 Frame = +2

Query  203  MPPAAGAVAQSNRV-PLVPNVMPTVVQTPPAMVSDSFAKDAVIAWFRGEFAAANAVIDAL  379
            MP AAGA     RV  + P  +  ++Q  PA V+D  AKD +I+WFRGEFAAANA+IDAL
Sbjct  1    MPMAAGAATPRERVQAMGPAAVVPMMQAVPA-VADVLAKDTIISWFRGEFAAANAIIDAL  59

Query  380  CNHLTQLE--GGGGSEYESVFAAIHRRRLNWIPILQMQKYYTIADVALELRKV  532
            C HL QL+  GG GSEYE+VFAAIHRRRLNWIP+LQMQKY++IADV  EL+KV
Sbjct  60   CGHLAQLQGGGGEGSEYEAVFAAIHRRRLNWIPVLQMQKYHSIADVTAELKKV  112



>ref|XP_008809230.1| PREDICTED: uncharacterized protein LOC103721002 isoform X2 [Phoenix 
dactylifera]
Length=527

 Score =   125 bits (313),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 66/74 (89%), Gaps = 2/74 (3%)
 Frame = +2

Query  302  DSFAKDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQ  481
            + FA+DA+IAWFRGEFAAANA+IDALC HL Q+EGG  +EYE++FAAIHRRR+NWIP+L 
Sbjct  16   EMFARDAIIAWFRGEFAAANAIIDALCGHLVQIEGG--AEYEALFAAIHRRRMNWIPVLH  73

Query  482  MQKYYTIADVALEL  523
            MQKY++IADV  EL
Sbjct  74   MQKYFSIADVTGEL  87



>ref|XP_008809229.1| PREDICTED: uncharacterized protein LOC103721002 isoform X1 [Phoenix 
dactylifera]
Length=545

 Score =   125 bits (313),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 54/72 (75%), Positives = 65/72 (90%), Gaps = 2/72 (3%)
 Frame = +2

Query  308  FAKDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQ  487
            FA+DA+IAWFRGEFAAANA+IDALC HL Q+EGG  +EYE++FAAIHRRR+NWIP+L MQ
Sbjct  18   FARDAIIAWFRGEFAAANAIIDALCGHLVQIEGG--AEYEALFAAIHRRRMNWIPVLHMQ  75

Query  488  KYYTIADVALEL  523
            KY++IADV  EL
Sbjct  76   KYFSIADVTGEL  87



>ref|NP_182329.2| oxidoreductase, 2OG-Fe(II) oxygenase family protein [Arabidopsis 
thaliana]
 gb|AEC10932.1| oxidoreductase, 2OG-Fe(II) oxygenase family protein [Arabidopsis 
thaliana]
Length=438

 Score =   124 bits (311),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 58/96 (60%), Positives = 74/96 (77%), Gaps = 6/96 (6%)
 Frame = +2

Query  242  VPLVPNVMPTVVQTPPAMVSDSFAKDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSE  421
             P  P + P VV     ++SDS AKDA++ WFRGEFAAANA+IDALC HL Q   GG ++
Sbjct  4    TPASPPLHPPVV-----LLSDSAAKDAMLTWFRGEFAAANAIIDALCAHLMQ-ASGGSAQ  57

Query  422  YESVFAAIHRRRLNWIPILQMQKYYTIADVALELRK  529
            YESV AA+HRRRLNWIP+LQMQKY++I+ V L+L++
Sbjct  58   YESVMAALHRRRLNWIPVLQMQKYHSISQVTLQLQQ  93



>gb|AAD13711.1| unknown protein [Arabidopsis thaliana]
Length=433

 Score =   124 bits (311),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 58/96 (60%), Positives = 74/96 (77%), Gaps = 6/96 (6%)
 Frame = +2

Query  242  VPLVPNVMPTVVQTPPAMVSDSFAKDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSE  421
             P  P + P VV     ++SDS AKDA++ WFRGEFAAANA+IDALC HL Q   GG ++
Sbjct  4    TPASPPLHPPVV-----LLSDSAAKDAMLTWFRGEFAAANAIIDALCAHLMQ-ASGGSAQ  57

Query  422  YESVFAAIHRRRLNWIPILQMQKYYTIADVALELRK  529
            YESV AA+HRRRLNWIP+LQMQKY++I+ V L+L++
Sbjct  58   YESVMAALHRRRLNWIPVLQMQKYHSISQVTLQLQQ  93



>ref|XP_010090348.1| hypothetical protein L484_025013 [Morus notabilis]
 gb|EXB39318.1| hypothetical protein L484_025013 [Morus notabilis]
Length=664

 Score =   125 bits (315),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 59/94 (63%), Positives = 72/94 (77%), Gaps = 5/94 (5%)
 Frame = +2

Query  251  VPNVMPTVVQTPPAMVSDSFAKDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYES  430
            VP  MPT V   P    D+FAK+A++AW+RGEFAA+NA+IDALC HL Q   GG   Y+ 
Sbjct  26   VPMTMPTPVTVMP----DAFAKEAMLAWYRGEFAASNAIIDALCGHLRQFP-GGNEIYKG  80

Query  431  VFAAIHRRRLNWIPILQMQKYYTIADVALELRKV  532
            VF AIHRRR+NWIP+LQMQKY+TIADV +EL +V
Sbjct  81   VFEAIHRRRVNWIPVLQMQKYHTIADVTMELCRV  114



>gb|ACG28401.1| hypothetical protein [Zea mays]
 gb|AFW77936.1| hypothetical protein ZEAMMB73_473012 [Zea mays]
Length=198

 Score =   119 bits (298),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 53/71 (75%), Positives = 60/71 (85%), Gaps = 1/71 (1%)
 Frame = +2

Query  311  AKDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQK  490
            A+DAVI WFRGEFAAANA+IDALC HL Q+ GGGG EY+ VFAAIHRRR NW P+L MQK
Sbjct  28   ARDAVIGWFRGEFAAANAMIDALCGHLAQI-GGGGPEYDPVFAAIHRRRANWFPVLHMQK  86

Query  491  YYTIADVALEL  523
            +Y +ADVA EL
Sbjct  87   FYPVADVAAEL  97



>gb|KHF97715.1| putative alpha-ketoglutarate-dependent dioxygenase ABH5 [Gossypium 
arboreum]
Length=549

 Score =   124 bits (310),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 72/113 (64%), Positives = 87/113 (77%), Gaps = 4/113 (4%)
 Frame = +2

Query  203  MPPAAGAVAQSNRV-PLVPNVMPTVVQTPPAMVSDSFAKDAVIAWFRGEFAAANAVIDAL  379
            MP AAGA     RV  + P  +  ++Q  PA V+D  AKD +I+WFRGEFAAANA+IDAL
Sbjct  1    MPMAAGAATPRERVQAMGPAAVVPMMQAVPA-VADVLAKDTIISWFRGEFAAANAIIDAL  59

Query  380  CNHLTQLE--GGGGSEYESVFAAIHRRRLNWIPILQMQKYYTIADVALELRKV  532
            C HL QL+  GG GSEYE+VFAAIHRRRLNWIP+LQMQKY++IADV  EL++V
Sbjct  60   CGHLAQLQGGGGEGSEYEAVFAAIHRRRLNWIPVLQMQKYHSIADVTAELKQV  112



>ref|XP_009402473.1| PREDICTED: uncharacterized protein LOC103986253 [Musa acuminata 
subsp. malaccensis]
Length=515

 Score =   123 bits (308),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 54/75 (72%), Positives = 65/75 (87%), Gaps = 2/75 (3%)
 Frame = +2

Query  308  FAKDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQ  487
            +A+DA+IAWFRGEFAAANA+ID LC HL Q+EGG   EYE+ FAAIHRRRLNWIP+L +Q
Sbjct  14   YARDAMIAWFRGEFAAANAIIDELCGHLAQIEGG--EEYEAAFAAIHRRRLNWIPVLHLQ  71

Query  488  KYYTIADVALELRKV  532
            KY++IADV+ ELR V
Sbjct  72   KYFSIADVSAELRLV  86



>emb|CDX80147.1| BnaA05g00090D [Brassica napus]
Length=445

 Score =   122 bits (307),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 73/164 (45%), Positives = 93/164 (57%), Gaps = 40/164 (24%)
 Frame = +2

Query  287  PAMVSDSFAKDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNW  466
            P ++SDS AKD +I WFRGEFAAANA+ID LC HL Q+    G EYE V AAIHRRR+NW
Sbjct  16   PVLLSDSAAKDVMITWFRGEFAAANAIIDELCGHLMQVSESAGEEYEGVMAAIHRRRMNW  75

Query  467  IPILQMQKYYTIADVALELRKVsakkaedreaaaaasamadakhsaaaVMNVKISHASRE  646
            IP+LQMQKY+ I+ V L+L+                        +AA + N K+      
Sbjct  76   IPLLQMQKYHPISQVTLQLQ----------------------TATAAKINNNKLIMI---  110

Query  647  EPVDNSENGGGEVVYEDSIRDDSHGSPESEITDSGSQDVQPISE  778
            +PV             DSI DD   SP S+ITDSGS++ + + E
Sbjct  111  DPV-------------DSILDDD--SPTSDITDSGSREEERVEE  139



>ref|XP_009393115.1| PREDICTED: uncharacterized protein LOC103978888 [Musa acuminata 
subsp. malaccensis]
Length=548

 Score =   123 bits (309),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 55/76 (72%), Positives = 65/76 (86%), Gaps = 2/76 (3%)
 Frame = +2

Query  296  VSDSFAKDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPI  475
            V + +A+DA+IAWFRGEFAAANA+IDALC HL Q+  G G EYE+VFAAIHRRRLNWIP+
Sbjct  5    VPEVYARDAMIAWFRGEFAAANAIIDALCGHLVQI--GEGKEYEAVFAAIHRRRLNWIPV  62

Query  476  LQMQKYYTIADVALEL  523
            L MQKYY+IAD+  EL
Sbjct  63   LHMQKYYSIADITDEL  78



>ref|XP_009142484.1| PREDICTED: uncharacterized protein LOC103866332 isoform X2 [Brassica 
rapa]
Length=475

 Score =   122 bits (306),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 73/164 (45%), Positives = 93/164 (57%), Gaps = 40/164 (24%)
 Frame = +2

Query  287  PAMVSDSFAKDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNW  466
            P ++SDS AKD +I WFRGEFAAANA+ID LC HL Q+    G EYE V AAIHRRR+NW
Sbjct  16   PVLLSDSAAKDVMITWFRGEFAAANAIIDELCGHLMQVSESAGEEYEGVMAAIHRRRMNW  75

Query  467  IPILQMQKYYTIADVALELRKVsakkaedreaaaaasamadakhsaaaVMNVKISHASRE  646
            IP+LQMQKY+ I+ V L+L+                        +AA + N K+      
Sbjct  76   IPLLQMQKYHPISQVTLQLQTA----------------------TAAKINNNKLIMI---  110

Query  647  EPVDNSENGGGEVVYEDSIRDDSHGSPESEITDSGSQDVQPISE  778
            +PV             DSI DD   SP S+ITDSGS++ + + E
Sbjct  111  DPV-------------DSILDDD--SPTSDITDSGSREEERVEE  139



>ref|XP_009142483.1| PREDICTED: uncharacterized protein LOC103866332 isoform X1 [Brassica 
rapa]
Length=476

 Score =   122 bits (306),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 73/164 (45%), Positives = 93/164 (57%), Gaps = 40/164 (24%)
 Frame = +2

Query  287  PAMVSDSFAKDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNW  466
            P ++SDS AKD +I WFRGEFAAANA+ID LC HL Q+    G EYE V AAIHRRR+NW
Sbjct  16   PVLLSDSAAKDVMITWFRGEFAAANAIIDELCGHLMQVSESAGEEYEGVMAAIHRRRMNW  75

Query  467  IPILQMQKYYTIADVALELRKVsakkaedreaaaaasamadakhsaaaVMNVKISHASRE  646
            IP+LQMQKY+ I+ V L+L+                        +AA + N K+      
Sbjct  76   IPLLQMQKYHPISQVTLQLQTA----------------------TAAKINNNKLIMI---  110

Query  647  EPVDNSENGGGEVVYEDSIRDDSHGSPESEITDSGSQDVQPISE  778
            +PV             DSI DD   SP S+ITDSGS++ + + E
Sbjct  111  DPV-------------DSILDDD--SPTSDITDSGSREEERVEE  139



>gb|EEC79195.1| hypothetical protein OsI_19903 [Oryza sativa Indica Group]
Length=670

 Score =   124 bits (310),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 54/73 (74%), Positives = 64/73 (88%), Gaps = 2/73 (3%)
 Frame = +2

Query  314  KDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQKY  493
            +DAVI WFRGEFAAANAVIDALC HL Q+  GG +EYE+VFAA+HRRRLNW P+L MQK+
Sbjct  34   RDAVIGWFRGEFAAANAVIDALCGHLAQI--GGDAEYEAVFAALHRRRLNWFPVLHMQKF  91

Query  494  YTIADVALELRKV  532
            Y++ADVA ELR+V
Sbjct  92   YSVADVAAELRRV  104



>ref|XP_003568474.1| PREDICTED: uncharacterized protein LOC100841736 isoform X2 [Brachypodium 
distachyon]
Length=552

 Score =   121 bits (304),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 63/70 (90%), Gaps = 2/70 (3%)
 Frame = +2

Query  314  KDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQKY  493
            +DAVI W+RGEFAAANAVIDALC HLTQ+  GGG+EY++VFAA+HRRRLNW P+L MQK+
Sbjct  16   RDAVIGWYRGEFAAANAVIDALCGHLTQI--GGGAEYDAVFAALHRRRLNWFPVLHMQKF  73

Query  494  YTIADVALEL  523
            Y++ADVA EL
Sbjct  74   YSVADVAAEL  83



>dbj|BAJ97023.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=550

 Score =   121 bits (304),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 52/74 (70%), Positives = 65/74 (88%), Gaps = 3/74 (4%)
 Frame = +2

Query  311  AKDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQK  490
            A+DAVI W+RGEFAAANAVIDALC HL Q+   GG++Y++VFAA+HRRRLNW P+L MQK
Sbjct  21   ARDAVIGWYRGEFAAANAVIDALCGHLAQI---GGADYDAVFAALHRRRLNWFPVLHMQK  77

Query  491  YYTIADVALELRKV  532
            +Y++ADVA ELR+V
Sbjct  78   FYSVADVAAELRRV  91



>ref|XP_010231391.1| PREDICTED: uncharacterized protein LOC100841736 isoform X1 [Brachypodium 
distachyon]
Length=553

 Score =   121 bits (304),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 63/70 (90%), Gaps = 2/70 (3%)
 Frame = +2

Query  314  KDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQKY  493
            +DAVI W+RGEFAAANAVIDALC HLTQ+  GGG+EY++VFAA+HRRRLNW P+L MQK+
Sbjct  16   RDAVIGWYRGEFAAANAVIDALCGHLTQI--GGGAEYDAVFAALHRRRLNWFPVLHMQKF  73

Query  494  YTIADVALEL  523
            Y++ADVA EL
Sbjct  74   YSVADVAAEL  83



>ref|XP_008647787.1| PREDICTED: oxidoreductase, 2OG-Fe oxygenase family protein isoform 
X1 [Zea mays]
 gb|AFW77937.1| hypothetical protein ZEAMMB73_473012 [Zea mays]
Length=573

 Score =   120 bits (301),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/71 (75%), Positives = 60/71 (85%), Gaps = 1/71 (1%)
 Frame = +2

Query  311  AKDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQK  490
            A+DAVI WFRGEFAAANA+IDALC HL Q+ GGGG EY+ VFAAIHRRR NW P+L MQK
Sbjct  28   ARDAVIGWFRGEFAAANAMIDALCGHLAQI-GGGGPEYDPVFAAIHRRRANWFPVLHMQK  86

Query  491  YYTIADVALEL  523
            +Y +ADVA EL
Sbjct  87   FYPVADVAAEL  97



>emb|CDY55191.1| BnaCnng28350D [Brassica napus]
Length=468

 Score =   119 bits (297),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 51/80 (64%), Positives = 62/80 (78%), Gaps = 0/80 (0%)
 Frame = +2

Query  287  PAMVSDSFAKDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNW  466
            P ++SDS AKD +I WFRGEFAAANA+ID LC HL Q+    G EYE V AAIHRRR+NW
Sbjct  16   PLLLSDSAAKDVMITWFRGEFAAANAIIDELCGHLMQVSESAGEEYEGVMAAIHRRRMNW  75

Query  467  IPILQMQKYYTIADVALELR  526
            IP+LQMQKY+ I+ V  +L+
Sbjct  76   IPLLQMQKYHPISQVTHQLQ  95



>ref|XP_010524003.1| PREDICTED: uncharacterized protein LOC104802219 [Tarenaya hassleriana]
Length=443

 Score =   117 bits (294),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 54/81 (67%), Positives = 65/81 (80%), Gaps = 3/81 (4%)
 Frame = +2

Query  287  PAMVSDSFAKDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNW  466
            P ++SD+ AKD +IAW RGEFAAANA+IDALC HL Q     GS+YE+V AAIHRRRLNW
Sbjct  16   PVLLSDAAAKDVMIAWLRGEFAAANAIIDALCGHLIQ---ALGSDYEAVMAAIHRRRLNW  72

Query  467  IPILQMQKYYTIADVALELRK  529
            IP+LQMQ Y++IA V  EL+K
Sbjct  73   IPLLQMQTYHSIAQVTAELQK  93



>ref|XP_008656187.1| PREDICTED: uncharacterized protein LOC103635534 [Zea mays]
 gb|AFW81532.1| hypothetical protein ZEAMMB73_697460 [Zea mays]
Length=584

 Score =   119 bits (297),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 50/71 (70%), Positives = 58/71 (82%), Gaps = 0/71 (0%)
 Frame = +2

Query  311  AKDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQK  490
            A DAVI WFRGEFAAANA+IDALC HL Q+ GGGG+EY+ VFAA+HRRR NW P+L MQK
Sbjct  28   AMDAVIGWFRGEFAAANAMIDALCGHLAQIGGGGGAEYDPVFAALHRRRANWFPVLHMQK  87

Query  491  YYTIADVALEL  523
            +Y + DV  EL
Sbjct  88   FYPVTDVNAEL  98



>ref|XP_002441065.1| hypothetical protein SORBIDRAFT_09g019740 [Sorghum bicolor]
 gb|EES19495.1| hypothetical protein SORBIDRAFT_09g019740 [Sorghum bicolor]
Length=595

 Score =   117 bits (292),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 50/71 (70%), Positives = 59/71 (83%), Gaps = 1/71 (1%)
 Frame = +2

Query  311  AKDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQK  490
            A+DAVI WFRGEFAAANA+IDALC HL Q+ GGGG+EY+ VFAA+HRRR NW P+L MQK
Sbjct  30   ARDAVIGWFRGEFAAANAMIDALCGHLAQI-GGGGAEYDPVFAALHRRRANWFPVLHMQK  88

Query  491  YYTIADVALEL  523
            +Y + DV  EL
Sbjct  89   FYPVTDVTAEL  99



>ref|XP_006296016.1| hypothetical protein CARUB_v10025161mg [Capsella rubella]
 gb|EOA28914.1| hypothetical protein CARUB_v10025161mg [Capsella rubella]
Length=459

 Score =   115 bits (288),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 54/77 (70%), Positives = 64/77 (83%), Gaps = 3/77 (4%)
 Frame = +2

Query  299  SDSFAKDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGS-EYESVFAAIHRRRLNWIPI  475
            SDS AKD +I WFRGEFAAANA+IDALC HL Q  G  GS EYE+V AA+HRRRLNWIP+
Sbjct  19   SDSAAKDVMITWFRGEFAAANAIIDALCGHLMQ--GSRGSPEYEAVMAALHRRRLNWIPV  76

Query  476  LQMQKYYTIADVALELR  526
            LQMQKY++I+ V L+L+
Sbjct  77   LQMQKYHSISQVTLQLQ  93



>gb|KFK37557.1| hypothetical protein AALP_AA4G272300 [Arabis alpina]
Length=464

 Score =   111 bits (277),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 64/162 (40%), Positives = 90/162 (56%), Gaps = 51/162 (31%)
 Frame = +2

Query  287  PAMVSDSFAKDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNW  466
            P +++DS    A+I WFRGEFAAANA+IDALC H+  +EG G  +Y +V AAIHRRR+NW
Sbjct  27   PLLLTDS---TAMITWFRGEFAAANAIIDALCGHI--MEGSGSEDYSAVMAAIHRRRMNW  81

Query  467  IPILQMQKYYTIADVALELRKVsakkaedreaaaaasamadakhsaaaVMNVKISHASRE  646
            IP+LQMQKY++I+ V LEL+                                KIS     
Sbjct  82   IPVLQMQKYHSISQVTLELQAA----------------------------TAKIS-----  108

Query  647  EPVDNSENGGGEVVYEDSIRDDSHGSPESEITDSGSQDVQPI  772
                        + +++++ DD   SP S+ITDSGS++ +P+
Sbjct  109  -----------LLKHQNALIDDD--SPSSDITDSGSREEEPV  137



>ref|XP_004962145.1| PREDICTED: uncharacterized protein LOC101766885 [Setaria italica]
Length=582

 Score =   111 bits (278),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 51/71 (72%), Positives = 60/71 (85%), Gaps = 0/71 (0%)
 Frame = +2

Query  311  AKDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQK  490
            A+DAVI WFRGEFAAANA+IDALC HL Q+ GGGG+EYE+ FAA+HRRR NW P+L MQK
Sbjct  25   ARDAVIGWFRGEFAAANAMIDALCGHLAQIGGGGGAEYEAAFAALHRRRANWFPVLHMQK  84

Query  491  YYTIADVALEL  523
            +Y +ADV  EL
Sbjct  85   FYPVADVTAEL  95



>ref|XP_006398000.1| hypothetical protein EUTSA_v10001455mg [Eutrema salsugineum]
 gb|ESQ39453.1| hypothetical protein EUTSA_v10001455mg [Eutrema salsugineum]
Length=434

 Score =   109 bits (272),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 47/81 (58%), Positives = 62/81 (77%), Gaps = 1/81 (1%)
 Frame = +2

Query  284  PPAMVSDSFAKDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLN  463
            PP ++S++ AK+ +I WFRGEFAAANA+IDALC HL Q+       Y  V AAIHRRR+N
Sbjct  8    PPVLLSETAAKEVMITWFRGEFAAANAIIDALCGHLIQISAAEEC-YSGVMAAIHRRRMN  66

Query  464  WIPILQMQKYYTIADVALELR  526
            WIP+LQMQK+++I+ V L L+
Sbjct  67   WIPLLQMQKFHSISQVTLHLQ  87



>ref|XP_006850839.1| hypothetical protein AMTR_s00025p00132890 [Amborella trichopoda]
 gb|ERN12420.1| hypothetical protein AMTR_s00025p00132890 [Amborella trichopoda]
Length=135

 Score = 95.1 bits (235),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/83 (55%), Positives = 59/83 (71%), Gaps = 2/83 (2%)
 Frame = +2

Query  287  PAMVSDSFA-KDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLN  463
            P    ++FA  DA++AWF GEFAAANA+ID LC HL +L     S+Y+SV A I++RRLN
Sbjct  18   PTHFPNTFAPNDALLAWFNGEFAAANAIIDLLCAHL-RLVSDRPSQYDSVLACINQRRLN  76

Query  464  WIPILQMQKYYTIADVALELRKV  532
            W P+L MQKY+ I DVA  L+ V
Sbjct  77   WAPVLHMQKYFPITDVAFALQLV  99



>ref|XP_002990560.1| hypothetical protein SELMODRAFT_428958 [Selaginella moellendorffii]
 gb|EFJ08437.1| hypothetical protein SELMODRAFT_428958 [Selaginella moellendorffii]
Length=556

 Score = 97.8 bits (242),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 55/73 (75%), Gaps = 1/73 (1%)
 Frame = +2

Query  314  KDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQKY  493
            +D  I+W +GEFAAANA+IDALC HL Q+ G  G EY+ V  ++H+RR NW P+L MQ+Y
Sbjct  34   RDVFISWLKGEFAAANAIIDALCQHLQQVVGRPG-EYDFVLGSVHQRRYNWNPVLHMQQY  92

Query  494  YTIADVALELRKV  532
            Y+IADV   L++V
Sbjct  93   YSIADVLFSLQQV  105



>ref|XP_002983652.1| hypothetical protein SELMODRAFT_422939 [Selaginella moellendorffii]
 gb|EFJ15148.1| hypothetical protein SELMODRAFT_422939 [Selaginella moellendorffii]
Length=556

 Score = 97.4 bits (241),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 55/73 (75%), Gaps = 1/73 (1%)
 Frame = +2

Query  314  KDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQKY  493
            +D  I+W +GEFAAANA+IDALC HL Q+ G  G EY+ V  ++H+RR NW P+L MQ+Y
Sbjct  34   RDVFISWLKGEFAAANAIIDALCQHLQQVVGRPG-EYDFVLGSVHQRRYNWNPVLHMQQY  92

Query  494  YTIADVALELRKV  532
            Y+IADV   L++V
Sbjct  93   YSIADVLFSLQQV  105



>ref|XP_010553493.1| PREDICTED: uncharacterized protein LOC104823550 isoform X3 [Tarenaya 
hassleriana]
Length=631

 Score = 93.2 bits (230),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 46/112 (41%), Positives = 67/112 (60%), Gaps = 10/112 (9%)
 Frame = +2

Query  197  LKMPPAAGAVAQSNRVPLVPNVMPTVVQTPPAMVSDSFAKDAVIAWFRGEFAAANAVIDA  376
            + MPP  G+V  S+++             PPA       +D  I+W R EFAAANA+ID+
Sbjct  1    MAMPP--GSVIPSDKMQF------PAASAPPAGHWIPDERDGFISWLRSEFAAANAIIDS  52

Query  377  LCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQKYYTIADVALELRKV  532
            LC HL  +  G   EY++V +AIH+RR NW P+L MQ+Y+ +ADV   L+++
Sbjct  53   LCQHLRAI--GDPGEYDAVISAIHQRRFNWTPVLHMQQYFPVADVVYTLQQI  102



>ref|XP_010553484.1| PREDICTED: uncharacterized protein LOC104823550 isoform X2 [Tarenaya 
hassleriana]
Length=633

 Score = 93.2 bits (230),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 46/112 (41%), Positives = 67/112 (60%), Gaps = 10/112 (9%)
 Frame = +2

Query  197  LKMPPAAGAVAQSNRVPLVPNVMPTVVQTPPAMVSDSFAKDAVIAWFRGEFAAANAVIDA  376
            + MPP  G+V  S+++             PPA       +D  I+W R EFAAANA+ID+
Sbjct  1    MAMPP--GSVIPSDKMQF------PAASAPPAGHWIPDERDGFISWLRSEFAAANAIIDS  52

Query  377  LCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQKYYTIADVALELRKV  532
            LC HL  +  G   EY++V +AIH+RR NW P+L MQ+Y+ +ADV   L+++
Sbjct  53   LCQHLRAI--GDPGEYDAVISAIHQRRFNWTPVLHMQQYFPVADVVYTLQQI  102



>ref|XP_010553471.1| PREDICTED: uncharacterized protein LOC104823550 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010553478.1| PREDICTED: uncharacterized protein LOC104823550 isoform X1 [Tarenaya 
hassleriana]
Length=635

 Score = 93.2 bits (230),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 46/112 (41%), Positives = 67/112 (60%), Gaps = 10/112 (9%)
 Frame = +2

Query  197  LKMPPAAGAVAQSNRVPLVPNVMPTVVQTPPAMVSDSFAKDAVIAWFRGEFAAANAVIDA  376
            + MPP  G+V  S+++             PPA       +D  I+W R EFAAANA+ID+
Sbjct  1    MAMPP--GSVIPSDKMQF------PAASAPPAGHWIPDERDGFISWLRSEFAAANAIIDS  52

Query  377  LCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQKYYTIADVALELRKV  532
            LC HL  +  G   EY++V +AIH+RR NW P+L MQ+Y+ +ADV   L+++
Sbjct  53   LCQHLRAI--GDPGEYDAVISAIHQRRFNWTPVLHMQQYFPVADVVYTLQQI  102



>gb|EPS61206.1| hypothetical protein M569_13594, partial [Genlisea aurea]
Length=108

 Score = 86.3 bits (212),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 37/73 (51%), Positives = 54/73 (74%), Gaps = 2/73 (3%)
 Frame = +2

Query  314  KDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQKY  493
            ++A + W RGEFAAANA+IDALC+HL  +  G   EY++V A++ +RR NW P+L MQ+Y
Sbjct  34   REAFLMWLRGEFAAANAMIDALCHHLRAV--GDHGEYDTVIASVQQRRCNWNPVLHMQQY  91

Query  494  YTIADVALELRKV  532
            +++ADV   L+ V
Sbjct  92   FSVADVVYALQNV  104



>ref|XP_002979579.1| hypothetical protein SELMODRAFT_419200 [Selaginella moellendorffii]
 gb|EFJ19468.1| hypothetical protein SELMODRAFT_419200 [Selaginella moellendorffii]
Length=561

 Score = 89.7 bits (221),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 54/73 (74%), Gaps = 2/73 (3%)
 Frame = +2

Query  314  KDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQKY  493
            +D  I+W RGEFAAANA+IDALC HL Q+ G  G EY+ V A I +RR +W PIL MQ Y
Sbjct  32   RDGFISWLRGEFAAANAIIDALCQHL-QMSGSPG-EYDLVVACIQQRRFSWNPILHMQHY  89

Query  494  YTIADVALELRKV  532
            Y++A+V + L++V
Sbjct  90   YSVAEVLMALQQV  102



>ref|XP_002977694.1| hypothetical protein SELMODRAFT_443630 [Selaginella moellendorffii]
 gb|EFJ21032.1| hypothetical protein SELMODRAFT_443630 [Selaginella moellendorffii]
Length=575

 Score = 89.4 bits (220),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 54/73 (74%), Gaps = 2/73 (3%)
 Frame = +2

Query  314  KDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQKY  493
            +D  I+W RGEFAAANA+IDALC HL Q+ G  G EY+ V A I +RR +W PIL MQ Y
Sbjct  18   RDGFISWLRGEFAAANAIIDALCQHL-QMSGSPG-EYDLVVACIQQRRFSWNPILHMQHY  75

Query  494  YTIADVALELRKV  532
            Y++A+V + L++V
Sbjct  76   YSVAEVLMALQQV  88



>gb|KGN49669.1| hypothetical protein Csa_5G056080 [Cucumis sativus]
Length=330

 Score = 87.0 bits (214),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 52/73 (71%), Gaps = 2/73 (3%)
 Frame = +2

Query  314  KDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQKY  493
            +D  I+W RGEFAA+NA+IDALC+HL  +  G   EY+ V   I +RR NW P+L MQ+Y
Sbjct  44   RDGFISWLRGEFAASNAIIDALCHHLRAV--GEPGEYDMVIGCIQQRRCNWTPVLHMQQY  101

Query  494  YTIADVALELRKV  532
            +++A+V   L++V
Sbjct  102  FSVAEVMYALQQV  114



>gb|KJB30648.1| hypothetical protein B456_005G153400 [Gossypium raimondii]
Length=653

 Score = 88.6 bits (218),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/73 (52%), Positives = 54/73 (74%), Gaps = 2/73 (3%)
 Frame = +2

Query  314  KDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQKY  493
            +D  I W RGEFAAANA+ID+LC HL ++  G   EYE+V A I +RR NW P+L MQ+Y
Sbjct  49   RDGFIYWLRGEFAAANAMIDSLCQHLREV--GEVGEYEAVIACIQQRRSNWNPVLHMQQY  106

Query  494  YTIADVALELRKV  532
            +++A+V+  L++V
Sbjct  107  FSVAEVSYALQQV  119



>ref|XP_007045467.1| Hydroxyproline-rich glycoprotein family protein, putative isoform 
1 [Theobroma cacao]
 ref|XP_007045469.1| Hydroxyproline-rich glycoprotein family protein, putative isoform 
1 [Theobroma cacao]
 gb|EOY01299.1| Hydroxyproline-rich glycoprotein family protein, putative isoform 
1 [Theobroma cacao]
 gb|EOY01301.1| Hydroxyproline-rich glycoprotein family protein, putative isoform 
1 [Theobroma cacao]
Length=681

 Score = 88.6 bits (218),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 37/73 (51%), Positives = 55/73 (75%), Gaps = 2/73 (3%)
 Frame = +2

Query  314  KDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQKY  493
            +D  I W RGEFAA+NA+ID+LC+HL ++  G   EYE+V A I +RR NW P+L MQ+Y
Sbjct  56   RDGFIYWLRGEFAASNAIIDSLCHHLREV--GEVGEYEAVIACIQQRRCNWNPVLHMQQY  113

Query  494  YTIADVALELRKV  532
            +++A+V+  L++V
Sbjct  114  FSVAEVSYALQQV  126



>ref|XP_007045468.1| Hydroxyproline-rich glycoprotein family protein, putative isoform 
2 [Theobroma cacao]
 ref|XP_007045470.1| Hydroxyproline-rich glycoprotein family protein, putative isoform 
2 [Theobroma cacao]
 gb|EOY01300.1| Hydroxyproline-rich glycoprotein family protein, putative isoform 
2 [Theobroma cacao]
 gb|EOY01302.1| Hydroxyproline-rich glycoprotein family protein, putative isoform 
2 [Theobroma cacao]
Length=680

 Score = 88.6 bits (218),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 37/73 (51%), Positives = 55/73 (75%), Gaps = 2/73 (3%)
 Frame = +2

Query  314  KDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQKY  493
            +D  I W RGEFAA+NA+ID+LC+HL ++  G   EYE+V A I +RR NW P+L MQ+Y
Sbjct  56   RDGFIYWLRGEFAASNAIIDSLCHHLREV--GEVGEYEAVIACIQQRRCNWNPVLHMQQY  113

Query  494  YTIADVALELRKV  532
            +++A+V+  L++V
Sbjct  114  FSVAEVSYALQQV  126



>gb|KJB30646.1| hypothetical protein B456_005G153400 [Gossypium raimondii]
Length=682

 Score = 88.6 bits (218),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 38/73 (52%), Positives = 54/73 (74%), Gaps = 2/73 (3%)
 Frame = +2

Query  314  KDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQKY  493
            +D  I W RGEFAAANA+ID+LC HL ++  G   EYE+V A I +RR NW P+L MQ+Y
Sbjct  49   RDGFIYWLRGEFAAANAMIDSLCQHLREV--GEVGEYEAVIACIQQRRSNWNPVLHMQQY  106

Query  494  YTIADVALELRKV  532
            +++A+V+  L++V
Sbjct  107  FSVAEVSYALQQV  119



>gb|KJB30647.1| hypothetical protein B456_005G153400 [Gossypium raimondii]
Length=683

 Score = 88.6 bits (218),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 38/73 (52%), Positives = 54/73 (74%), Gaps = 2/73 (3%)
 Frame = +2

Query  314  KDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQKY  493
            +D  I W RGEFAAANA+ID+LC HL ++  G   EYE+V A I +RR NW P+L MQ+Y
Sbjct  49   RDGFIYWLRGEFAAANAMIDSLCQHLREV--GEVGEYEAVIACIQQRRSNWNPVLHMQQY  106

Query  494  YTIADVALELRKV  532
            +++A+V+  L++V
Sbjct  107  FSVAEVSYALQQV  119



>ref|XP_004297399.1| PREDICTED: uncharacterized protein LOC101309147 [Fragaria vesca 
subsp. vesca]
Length=682

 Score = 87.8 bits (216),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 53/73 (73%), Gaps = 2/73 (3%)
 Frame = +2

Query  314  KDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQKY  493
            +D  I+W RGEFAAANA+ID+LC+HL  +  G  SEY+ V   + +RR NW P+L MQ+Y
Sbjct  41   RDGFISWLRGEFAAANAIIDSLCHHLRAV--GEPSEYDMVIGCVQQRRCNWTPVLHMQQY  98

Query  494  YTIADVALELRKV  532
            +++A+V   L++V
Sbjct  99   FSVAEVIYALQQV  111



>ref|XP_004142291.1| PREDICTED: uncharacterized protein LOC101210274 [Cucumis sativus]
 ref|XP_004156139.1| PREDICTED: uncharacterized LOC101210274 [Cucumis sativus]
Length=684

 Score = 87.8 bits (216),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 52/73 (71%), Gaps = 2/73 (3%)
 Frame = +2

Query  314  KDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQKY  493
            +D  I+W RGEFAA+NA+IDALC+HL  +  G   EY+ V   I +RR NW P+L MQ+Y
Sbjct  44   RDGFISWLRGEFAASNAIIDALCHHLRAV--GEPGEYDMVIGCIQQRRCNWTPVLHMQQY  101

Query  494  YTIADVALELRKV  532
            +++A+V   L++V
Sbjct  102  FSVAEVMYALQQV  114



>gb|KJB60865.1| hypothetical protein B456_009G328700 [Gossypium raimondii]
Length=646

 Score = 87.4 bits (215),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 38/73 (52%), Positives = 55/73 (75%), Gaps = 2/73 (3%)
 Frame = +2

Query  314  KDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQKY  493
            +D  I W RGEFAAANA+ID+LC+HL ++  G   EYE+V A I +RR +W P+L MQ+Y
Sbjct  63   RDGFIYWLRGEFAAANAMIDSLCHHLREV--GEVGEYEAVIACIQQRRCHWNPVLHMQQY  120

Query  494  YTIADVALELRKV  532
            ++IA+V+  L++V
Sbjct  121  FSIAEVSYALQQV  133



>gb|KJB60862.1| hypothetical protein B456_009G328700 [Gossypium raimondii]
Length=645

 Score = 87.4 bits (215),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 38/73 (52%), Positives = 55/73 (75%), Gaps = 2/73 (3%)
 Frame = +2

Query  314  KDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQKY  493
            +D  I W RGEFAAANA+ID+LC+HL ++  G   EYE+V A I +RR +W P+L MQ+Y
Sbjct  63   RDGFIYWLRGEFAAANAMIDSLCHHLREV--GEVGEYEAVIACIQQRRCHWNPVLHMQQY  120

Query  494  YTIADVALELRKV  532
            ++IA+V+  L++V
Sbjct  121  FSIAEVSYALQQV  133



>gb|KJB60866.1| hypothetical protein B456_009G328700 [Gossypium raimondii]
Length=646

 Score = 87.4 bits (215),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 38/73 (52%), Positives = 55/73 (75%), Gaps = 2/73 (3%)
 Frame = +2

Query  314  KDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQKY  493
            +D  I W RGEFAAANA+ID+LC+HL ++  G   EYE+V A I +RR +W P+L MQ+Y
Sbjct  63   RDGFIYWLRGEFAAANAMIDSLCHHLREV--GEVGEYEAVIACIQQRRCHWNPVLHMQQY  120

Query  494  YTIADVALELRKV  532
            ++IA+V+  L++V
Sbjct  121  FSIAEVSYALQQV  133



>gb|KJB60864.1| hypothetical protein B456_009G328700 [Gossypium raimondii]
Length=661

 Score = 87.0 bits (214),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 38/73 (52%), Positives = 55/73 (75%), Gaps = 2/73 (3%)
 Frame = +2

Query  314  KDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQKY  493
            +D  I W RGEFAAANA+ID+LC+HL ++  G   EYE+V A I +RR +W P+L MQ+Y
Sbjct  63   RDGFIYWLRGEFAAANAMIDSLCHHLREV--GEVGEYEAVIACIQQRRCHWNPVLHMQQY  120

Query  494  YTIADVALELRKV  532
            ++IA+V+  L++V
Sbjct  121  FSIAEVSYALQQV  133



>gb|KJB60863.1| hypothetical protein B456_009G328700 [Gossypium raimondii]
Length=616

 Score = 87.0 bits (214),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 38/73 (52%), Positives = 55/73 (75%), Gaps = 2/73 (3%)
 Frame = +2

Query  314  KDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQKY  493
            +D  I W RGEFAAANA+ID+LC+HL ++  G   EYE+V A I +RR +W P+L MQ+Y
Sbjct  34   RDGFIYWLRGEFAAANAMIDSLCHHLREV--GEVGEYEAVIACIQQRRCHWNPVLHMQQY  91

Query  494  YTIADVALELRKV  532
            ++IA+V+  L++V
Sbjct  92   FSIAEVSYALQQV  104



>ref|XP_010105545.1| hypothetical protein L484_019288 [Morus notabilis]
 gb|EXC05040.1| hypothetical protein L484_019288 [Morus notabilis]
Length=681

 Score = 87.4 bits (215),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 37/73 (51%), Positives = 53/73 (73%), Gaps = 2/73 (3%)
 Frame = +2

Query  314  KDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQKY  493
            +D  I+W RGEFAAANA+ID+LC+HL  +  G   EY++V A I  RR NW P+L MQ+Y
Sbjct  39   RDGFISWLRGEFAAANAMIDSLCHHLRAV--GEPGEYDAVIACIQLRRCNWNPVLHMQQY  96

Query  494  YTIADVALELRKV  532
            +++A+V   L++V
Sbjct  97   FSVAEVMFALQQV  109



>ref|XP_010271173.1| PREDICTED: uncharacterized protein LOC104607267 [Nelumbo nucifera]
Length=698

 Score = 87.0 bits (214),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 37/73 (51%), Positives = 53/73 (73%), Gaps = 2/73 (3%)
 Frame = +2

Query  314  KDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQKY  493
            +D  I+W RGEFAAANA+ID+LC+HL  +  G   EY+ V + I +RR NW P+L MQ+Y
Sbjct  38   RDGFISWLRGEFAAANAIIDSLCHHLRSI--GEPREYDVVISCIQQRRCNWNPVLHMQQY  95

Query  494  YTIADVALELRKV  532
            ++IA+V   L++V
Sbjct  96   FSIAEVMYALQQV  108



>ref|XP_006849434.1| hypothetical protein AMTR_s00024p00040890 [Amborella trichopoda]
 gb|ERN11015.1| hypothetical protein AMTR_s00024p00040890 [Amborella trichopoda]
Length=655

 Score = 87.0 bits (214),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 51/73 (70%), Gaps = 2/73 (3%)
 Frame = +2

Query  314  KDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQKY  493
            +D  I+W R EFAAANA+ID+LC HL  +  G   EYE+  A I +RR NW P+L MQ+Y
Sbjct  39   RDGFISWLRSEFAAANAIIDSLCYHLKAV--GSPGEYETTLAFIQQRRCNWTPVLHMQQY  96

Query  494  YTIADVALELRKV  532
            + +A++A  L++V
Sbjct  97   FPVAEIAYSLQQV  109



>ref|XP_010241461.1| PREDICTED: uncharacterized protein LOC104586031 [Nelumbo nucifera]
 ref|XP_010241536.1| PREDICTED: uncharacterized protein LOC104586031 [Nelumbo nucifera]
 ref|XP_010241609.1| PREDICTED: uncharacterized protein LOC104586031 [Nelumbo nucifera]
Length=696

 Score = 87.0 bits (214),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 35/73 (48%), Positives = 52/73 (71%), Gaps = 2/73 (3%)
 Frame = +2

Query  314  KDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQKY  493
            +D  I+W RGEFAAANA+ID+LC+HL  +  G   EY+ V   I +RR NW P+L MQ+Y
Sbjct  38   RDGFISWLRGEFAAANAIIDSLCHHLRSI--GEPGEYDVVIGCIQQRRCNWNPVLHMQQY  95

Query  494  YTIADVALELRKV  532
            +++A+V  +L++ 
Sbjct  96   FSVAEVMFQLQQA  108



>ref|NP_563957.1| hydroxyproline-rich glycoprotein-like protein [Arabidopsis thaliana]
 ref|NP_849663.1| hydroxyproline-rich glycoprotein-like protein [Arabidopsis thaliana]
 gb|AEE29212.1| hydroxyproline-rich glycoprotein-like protein [Arabidopsis thaliana]
 gb|AEE29213.1| hydroxyproline-rich glycoprotein-like protein [Arabidopsis thaliana]
Length=601

 Score = 86.7 bits (213),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 43/112 (38%), Positives = 62/112 (55%), Gaps = 13/112 (12%)
 Frame = +2

Query  197  LKMPPAAGAVAQSNRVPLVPNVMPTVVQTPPAMVSDSFAKDAVIAWFRGEFAAANAVIDA  376
            + MPP       S ++           Q PP        +D  I+W R EFAAANA+ID+
Sbjct  1    MAMPPPGNVTTPSEKL-----------QFPPPANWIPDERDGFISWLRAEFAAANAIIDS  49

Query  377  LCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQKYYTIADVALELRKV  532
            LC HL  +  G  +EYESV  +IH RRL W  +L MQ+++ +ADV+  L+++
Sbjct  50   LCQHLQAV--GDHNEYESVIGSIHHRRLAWSQVLTMQQFFPVADVSYNLQQI  99



>ref|XP_006307004.1| hypothetical protein CARUB_v10008596mg [Capsella rubella]
 gb|EOA39902.1| hypothetical protein CARUB_v10008596mg [Capsella rubella]
Length=619

 Score = 87.0 bits (214),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 39/86 (45%), Positives = 59/86 (69%), Gaps = 5/86 (6%)
 Frame = +2

Query  284  PPAMVSDSF---AKDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRR  454
            PPA V+ ++    +D  I+W R EFAAANA+ID+LC HL  +  G  +EY+SV  +IH R
Sbjct  19   PPANVAGNWIPDERDGFISWLRAEFAAANAIIDSLCQHLQTI--GDHNEYDSVIRSIHHR  76

Query  455  RLNWIPILQMQKYYTIADVALELRKV  532
            RL W  +L MQ++Y +A+V+  L+++
Sbjct  77   RLGWSQVLTMQQFYPVAEVSYNLQQI  102



>dbj|BAH19958.1| AT1G14710 [Arabidopsis thaliana]
Length=601

 Score = 86.7 bits (213),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 43/112 (38%), Positives = 62/112 (55%), Gaps = 13/112 (12%)
 Frame = +2

Query  197  LKMPPAAGAVAQSNRVPLVPNVMPTVVQTPPAMVSDSFAKDAVIAWFRGEFAAANAVIDA  376
            + MPP       S ++           Q PP        +D  I+W R EFAAANA+ID+
Sbjct  1    MAMPPPGNVTTPSEKL-----------QFPPPANWIPDERDGFISWLRAEFAAANAIIDS  49

Query  377  LCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQKYYTIADVALELRKV  532
            LC HL  +  G  +EYESV  +IH RRL W  +L MQ+++ +ADV+  L+++
Sbjct  50   LCQHLQAV--GDHNEYESVIGSIHHRRLAWSQVLTMQQFFPVADVSYNLQQI  99



>ref|XP_010458983.1| PREDICTED: uncharacterized protein LOC104740153 [Camelina sativa]
Length=625

 Score = 87.0 bits (214),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 52/73 (71%), Gaps = 2/73 (3%)
 Frame = +2

Query  314  KDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQKY  493
            +D  I+W R EFAAANA+ID+LC HL  +  G  +EYESV  +IH RRL W  +L MQ++
Sbjct  29   RDGFISWLRAEFAAANAIIDSLCQHLQTI--GDQNEYESVIGSIHHRRLGWSQVLTMQQF  86

Query  494  YTIADVALELRKV  532
            Y +A+V+  L+++
Sbjct  87   YPVAEVSYNLQQI  99



>gb|AAF79247.1|AC006917_32 F10B6.11 [Arabidopsis thaliana]
Length=625

 Score = 86.7 bits (213),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 43/112 (38%), Positives = 62/112 (55%), Gaps = 13/112 (12%)
 Frame = +2

Query  197  LKMPPAAGAVAQSNRVPLVPNVMPTVVQTPPAMVSDSFAKDAVIAWFRGEFAAANAVIDA  376
            + MPP       S ++           Q PP        +D  I+W R EFAAANA+ID+
Sbjct  1    MAMPPPGNVTTPSEKL-----------QFPPPANWIPDERDGFISWLRAEFAAANAIIDS  49

Query  377  LCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQKYYTIADVALELRKV  532
            LC HL  +  G  +EYESV  +IH RRL W  +L MQ+++ +ADV+  L+++
Sbjct  50   LCQHLQAV--GDHNEYESVIGSIHHRRLAWSQVLTMQQFFPVADVSYNLQQI  99



>ref|XP_008454723.1| PREDICTED: uncharacterized protein LOC103495063 isoform X2 [Cucumis 
melo]
Length=686

 Score = 86.7 bits (213),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 52/73 (71%), Gaps = 2/73 (3%)
 Frame = +2

Query  314  KDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQKY  493
            +D  I+W RGEFAA+NA+IDALC+HL  +  G   EY+ V   I +RR NW P+L MQ+Y
Sbjct  46   RDGFISWLRGEFAASNAMIDALCHHLRAV--GEPGEYDVVIGCIQQRRCNWTPVLHMQQY  103

Query  494  YTIADVALELRKV  532
            +++A+V   L++V
Sbjct  104  FSVAEVMYALQQV  116



>ref|XP_008454722.1| PREDICTED: uncharacterized protein LOC103495063 isoform X1 [Cucumis 
melo]
Length=690

 Score = 86.7 bits (213),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 52/73 (71%), Gaps = 2/73 (3%)
 Frame = +2

Query  314  KDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQKY  493
            +D  I+W RGEFAA+NA+IDALC+HL  +  G   EY+ V   I +RR NW P+L MQ+Y
Sbjct  46   RDGFISWLRGEFAASNAMIDALCHHLRAV--GEPGEYDVVIGCIQQRRCNWTPVLHMQQY  103

Query  494  YTIADVALELRKV  532
            +++A+V   L++V
Sbjct  104  FSVAEVMYALQQV  116



>ref|XP_002892824.1| hypothetical protein ARALYDRAFT_471658 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69083.1| hypothetical protein ARALYDRAFT_471658 [Arabidopsis lyrata subsp. 
lyrata]
Length=614

 Score = 86.3 bits (212),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 52/73 (71%), Gaps = 2/73 (3%)
 Frame = +2

Query  314  KDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQKY  493
            +D  I+W R EFAAANA+ID+LC HL  +  G  +EYESV  +IH RRL W  +L MQ++
Sbjct  29   RDGFISWLRAEFAAANAIIDSLCQHLQAI--GDHNEYESVIGSIHHRRLGWSQVLTMQQF  86

Query  494  YTIADVALELRKV  532
            + +ADV+  L+++
Sbjct  87   FPVADVSYNLQQI  99



>ref|XP_002527549.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF34858.1| conserved hypothetical protein [Ricinus communis]
Length=697

 Score = 85.9 bits (211),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 51/73 (70%), Gaps = 2/73 (3%)
 Frame = +2

Query  314  KDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQKY  493
            +D  I+W RGEFAAANA+ID+LC+HL     G   EY+ V   I +RR NW P+L MQ+Y
Sbjct  52   RDGFISWLRGEFAAANAIIDSLCHHLR--AAGEPGEYDVVIGCIQQRRCNWNPVLHMQQY  109

Query  494  YTIADVALELRKV  532
            +++ +V L L++V
Sbjct  110  FSVGEVILALQQV  122



>ref|XP_010476539.1| PREDICTED: uncharacterized protein LOC104755774 isoform X1 [Camelina 
sativa]
Length=626

 Score = 85.5 bits (210),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 35/73 (48%), Positives = 51/73 (70%), Gaps = 2/73 (3%)
 Frame = +2

Query  314  KDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQKY  493
            +D  I+W R EFAAANA+ID+LC HL  +  G  +EYESV  +IH RRL W  +L MQ++
Sbjct  33   RDGFISWLRAEFAAANAIIDSLCQHLQTI--GDQNEYESVIGSIHHRRLGWSQVLTMQQF  90

Query  494  YTIADVALELRKV  532
            Y + +V+  L+++
Sbjct  91   YPVTEVSYNLQQI  103



>ref|XP_010476540.1| PREDICTED: uncharacterized protein LOC104755774 isoform X2 [Camelina 
sativa]
Length=615

 Score = 85.5 bits (210),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 35/73 (48%), Positives = 51/73 (70%), Gaps = 2/73 (3%)
 Frame = +2

Query  314  KDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQKY  493
            +D  I+W R EFAAANA+ID+LC HL  +  G  +EYESV  +IH RRL W  +L MQ++
Sbjct  33   RDGFISWLRAEFAAANAIIDSLCQHLQTI--GDQNEYESVIGSIHHRRLGWSQVLTMQQF  90

Query  494  YTIADVALELRKV  532
            Y + +V+  L+++
Sbjct  91   YPVTEVSYNLQQI  103



>ref|XP_009390867.1| PREDICTED: uncharacterized protein LOC103977152 isoform X3 [Musa 
acuminata subsp. malaccensis]
Length=664

 Score = 85.5 bits (210),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 53/152 (35%), Positives = 78/152 (51%), Gaps = 25/152 (16%)
 Frame = +2

Query  314  KDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQKY  493
            +D  I+W RGEFAAANA+ID L NHL ++ G  G EY+ V   IH+RR +W PIL +Q+Y
Sbjct  36   RDGFISWLRGEFAAANAIIDLLINHL-RVAGEPG-EYDHVAGCIHQRRFHWTPILHLQQY  93

Query  494  YTIADVALELRKVsakkaedreaaaaasamadakhsaaaVMNVKISHASREEPVDNSENG  673
            + +ADV   L++V  ++                             H+ R +  D  ++G
Sbjct  94   FPVADVNYALQQVEWRQR----------------------QQTPQRHSYRRKEKDGRKSG  131

Query  674  GGEV-VYEDSIRDDSHGSPESEITDSGSQDVQ  766
             G   V+      +SHGSP S +T S   +V+
Sbjct  132  FGHTYVHRSDGVQESHGSPASGMTVSDVANVE  163



>ref|XP_011070539.1| PREDICTED: uncharacterized protein LOC105156173 isoform X2 [Sesamum 
indicum]
Length=650

 Score = 85.5 bits (210),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 52/73 (71%), Gaps = 2/73 (3%)
 Frame = +2

Query  314  KDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQKY  493
            ++  + W RGEFAAANA+IDALC+HL  +  G   EY+ V  +I +RR NW PIL MQ+Y
Sbjct  35   REGFLMWLRGEFAAANAIIDALCHHLRTV--GDPGEYDGVIGSIQQRRCNWNPILHMQQY  92

Query  494  YTIADVALELRKV  532
            +++A+V   L++V
Sbjct  93   FSVAEVLYALQQV  105



>ref|XP_008360022.1| PREDICTED: uncharacterized protein LOC103423718 [Malus domestica]
Length=687

 Score = 85.5 bits (210),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 52/73 (71%), Gaps = 2/73 (3%)
 Frame = +2

Query  314  KDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQKY  493
            +D  I+W RGEFAAANA+ID+LC+HL  +  G   EY+ V + I +RR NW P+L MQ+Y
Sbjct  42   RDGFISWLRGEFAAANAIIDSLCHHLRVV--GEPGEYDGVISCIQQRRCNWNPVLHMQQY  99

Query  494  YTIADVALELRKV  532
            +++A+V   L+ V
Sbjct  100  FSVAEVIYALQHV  112



>ref|XP_011070538.1| PREDICTED: uncharacterized protein LOC105156173 isoform X1 [Sesamum 
indicum]
Length=652

 Score = 85.5 bits (210),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 52/73 (71%), Gaps = 2/73 (3%)
 Frame = +2

Query  314  KDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQKY  493
            ++  + W RGEFAAANA+IDALC+HL  +  G   EY+ V  +I +RR NW PIL MQ+Y
Sbjct  35   REGFLMWLRGEFAAANAIIDALCHHLRTV--GDPGEYDGVIGSIQQRRCNWNPILHMQQY  92

Query  494  YTIADVALELRKV  532
            +++A+V   L++V
Sbjct  93   FSVAEVLYALQQV  105



>emb|CBI26785.3| unnamed protein product [Vitis vinifera]
Length=672

 Score = 85.5 bits (210),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 52/73 (71%), Gaps = 2/73 (3%)
 Frame = +2

Query  314  KDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQKY  493
            +D  I+W RGEFAAANA+ID+LCNHL  +  G   EY++V   I +RR NW  +L MQ+Y
Sbjct  42   RDGFISWLRGEFAAANAIIDSLCNHLRLI--GEPGEYDAVIGCIQQRRYNWSSVLHMQQY  99

Query  494  YTIADVALELRKV  532
            +++A+V   L++V
Sbjct  100  FSVAEVIYALQQV  112



>ref|XP_010648352.1| PREDICTED: uncharacterized protein LOC100252594 isoform X1 [Vitis 
vinifera]
 ref|XP_010648386.1| PREDICTED: uncharacterized protein LOC100252594 isoform X1 [Vitis 
vinifera]
Length=705

 Score = 85.5 bits (210),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 52/73 (71%), Gaps = 2/73 (3%)
 Frame = +2

Query  314  KDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQKY  493
            +D  I+W RGEFAAANA+ID+LCNHL  +  G   EY++V   I +RR NW  +L MQ+Y
Sbjct  42   RDGFISWLRGEFAAANAIIDSLCNHLRLI--GEPGEYDAVIGCIQQRRYNWSSVLHMQQY  99

Query  494  YTIADVALELRKV  532
            +++A+V   L++V
Sbjct  100  FSVAEVIYALQQV  112



>ref|XP_010648465.1| PREDICTED: uncharacterized protein LOC100252594 isoform X3 [Vitis 
vinifera]
Length=699

 Score = 85.5 bits (210),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 52/73 (71%), Gaps = 2/73 (3%)
 Frame = +2

Query  314  KDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQKY  493
            +D  I+W RGEFAAANA+ID+LCNHL  +  G   EY++V   I +RR NW  +L MQ+Y
Sbjct  42   RDGFISWLRGEFAAANAIIDSLCNHLRLI--GEPGEYDAVIGCIQQRRYNWSSVLHMQQY  99

Query  494  YTIADVALELRKV  532
            +++A+V   L++V
Sbjct  100  FSVAEVIYALQQV  112



>ref|XP_009390865.1| PREDICTED: uncharacterized protein LOC103977152 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009390869.1| PREDICTED: uncharacterized protein LOC103977152 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=685

 Score = 85.5 bits (210),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 53/152 (35%), Positives = 78/152 (51%), Gaps = 25/152 (16%)
 Frame = +2

Query  314  KDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQKY  493
            +D  I+W RGEFAAANA+ID L NHL ++ G  G EY+ V   IH+RR +W PIL +Q+Y
Sbjct  36   RDGFISWLRGEFAAANAIIDLLINHL-RVAGEPG-EYDHVAGCIHQRRFHWTPILHLQQY  93

Query  494  YTIADVALELRKVsakkaedreaaaaasamadakhsaaaVMNVKISHASREEPVDNSENG  673
            + +ADV   L++V  ++                             H+ R +  D  ++G
Sbjct  94   FPVADVNYALQQVEWRQR----------------------QQTPQRHSYRRKEKDGRKSG  131

Query  674  GGEV-VYEDSIRDDSHGSPESEITDSGSQDVQ  766
             G   V+      +SHGSP S +T S   +V+
Sbjct  132  FGHTYVHRSDGVQESHGSPASGMTVSDVANVE  163



>ref|XP_010648423.1| PREDICTED: uncharacterized protein LOC100252594 isoform X2 [Vitis 
vinifera]
Length=704

 Score = 85.5 bits (210),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 52/73 (71%), Gaps = 2/73 (3%)
 Frame = +2

Query  314  KDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQKY  493
            +D  I+W RGEFAAANA+ID+LCNHL  +  G   EY++V   I +RR NW  +L MQ+Y
Sbjct  42   RDGFISWLRGEFAAANAIIDSLCNHLRLI--GEPGEYDAVIGCIQQRRYNWSSVLHMQQY  99

Query  494  YTIADVALELRKV  532
            +++A+V   L++V
Sbjct  100  FSVAEVIYALQQV  112



>ref|XP_009390866.1| PREDICTED: uncharacterized protein LOC103977152 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=682

 Score = 85.5 bits (210),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 53/152 (35%), Positives = 78/152 (51%), Gaps = 25/152 (16%)
 Frame = +2

Query  314  KDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQKY  493
            +D  I+W RGEFAAANA+ID L NHL ++ G  G EY+ V   IH+RR +W PIL +Q+Y
Sbjct  36   RDGFISWLRGEFAAANAIIDLLINHL-RVAGEPG-EYDHVAGCIHQRRFHWTPILHLQQY  93

Query  494  YTIADVALELRKVsakkaedreaaaaasamadakhsaaaVMNVKISHASREEPVDNSENG  673
            + +ADV   L++V  ++                             H+ R +  D  ++G
Sbjct  94   FPVADVNYALQQVEWRQR----------------------QQTPQRHSYRRKEKDGRKSG  131

Query  674  GGEV-VYEDSIRDDSHGSPESEITDSGSQDVQ  766
             G   V+      +SHGSP S +T S   +V+
Sbjct  132  FGHTYVHRSDGVQESHGSPASGMTVSDVANVE  163



>ref|XP_008220943.1| PREDICTED: uncharacterized protein LOC103320980 [Prunus mume]
Length=691

 Score = 85.1 bits (209),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 51/73 (70%), Gaps = 2/73 (3%)
 Frame = +2

Query  314  KDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQKY  493
            +D  I+W RGEFAAANA+ID+LC+HL  +  G   EY+ V   I +RR NW P+L MQ+Y
Sbjct  42   RDGFISWLRGEFAAANAIIDSLCHHLRAV--GEPGEYDVVIGCIQQRRCNWNPVLHMQQY  99

Query  494  YTIADVALELRKV  532
            +++A+V   L+ V
Sbjct  100  FSVAEVIYALQHV  112



>gb|KHN28877.1| hypothetical protein glysoja_025671 [Glycine soja]
Length=679

 Score = 85.1 bits (209),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 37/73 (51%), Positives = 52/73 (71%), Gaps = 2/73 (3%)
 Frame = +2

Query  314  KDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQKY  493
            +D +I W R EFAAANA+ID+LC+HL  +  G   EY+ V  AI +RR NW  +L MQ+Y
Sbjct  44   RDGLIGWLRSEFAAANAIIDSLCHHLRVV--GDPGEYDMVIGAIQQRRCNWNQVLMMQQY  101

Query  494  YTIADVALELRKV  532
            +++ADVA  L++V
Sbjct  102  FSVADVAYALQQV  114



>ref|XP_007225122.1| hypothetical protein PRUPE_ppa002630mg [Prunus persica]
 gb|EMJ26321.1| hypothetical protein PRUPE_ppa002630mg [Prunus persica]
Length=650

 Score = 84.7 bits (208),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 51/73 (70%), Gaps = 2/73 (3%)
 Frame = +2

Query  314  KDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQKY  493
            +D  I+W RGEFAAANA+ID+LC+HL  +  G   EY+ V   I +RR NW P+L MQ+Y
Sbjct  42   RDGFISWLRGEFAAANAIIDSLCHHLRAV--GEPGEYDVVIGCIQQRRCNWNPVLHMQQY  99

Query  494  YTIADVALELRKV  532
            +++A+V   L+ V
Sbjct  100  FSVAEVIYALQHV  112



>emb|CDY41098.1| BnaC05g10890D [Brassica napus]
Length=589

 Score = 84.3 bits (207),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 43/96 (45%), Positives = 61/96 (64%), Gaps = 8/96 (8%)
 Frame = +2

Query  257  NVMP---TVVQTPPAMVSDSF---AKDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGS  418
            NV P    ++Q PP  V+ S+    +D  I+W RGEFAAANA+ID LCNHL  +  G  S
Sbjct  7    NVAPPSDKLIQFPPPAVAGSWIPDERDVYISWIRGEFAAANAIIDTLCNHLQAI--GDQS  64

Query  419  EYESVFAAIHRRRLNWIPILQMQKYYTIADVALELR  526
            +Y++V +A+  R+ +W   + MQ YYTIAD+   L+
Sbjct  65   QYDAVVSAVQHRQSSWSQAIYMQPYYTIADIYKALQ  100



>ref|XP_006585073.1| PREDICTED: uncharacterized protein LOC100794176 [Glycine max]
Length=683

 Score = 84.7 bits (208),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 37/73 (51%), Positives = 52/73 (71%), Gaps = 2/73 (3%)
 Frame = +2

Query  314  KDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQKY  493
            +D +I W R EFAAANA+ID+LC+HL  +  G   EY+ V  AI +RR NW  +L MQ+Y
Sbjct  48   RDGLIGWLRSEFAAANAIIDSLCHHLRVV--GDPGEYDMVVGAIQQRRCNWNQVLMMQQY  105

Query  494  YTIADVALELRKV  532
            +++ADVA  L++V
Sbjct  106  FSVADVAYALQQV  118



>ref|XP_003524142.1| PREDICTED: uncharacterized protein LOC100809865 isoform X1 [Glycine 
max]
Length=681

 Score = 84.3 bits (207),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 37/73 (51%), Positives = 52/73 (71%), Gaps = 2/73 (3%)
 Frame = +2

Query  314  KDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQKY  493
            +D +I W R EFAAANA+ID+LC+HL  +  G   EY+ V  AI +RR NW  +L MQ+Y
Sbjct  44   RDGLIGWLRSEFAAANAIIDSLCHHLRVV--GDPGEYDMVIGAIQQRRCNWNQVLMMQQY  101

Query  494  YTIADVALELRKV  532
            +++ADVA  L++V
Sbjct  102  FSVADVAHALQQV  114



>gb|KHN25979.1| hypothetical protein glysoja_018833 [Glycine soja]
Length=685

 Score = 84.3 bits (207),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 37/73 (51%), Positives = 52/73 (71%), Gaps = 2/73 (3%)
 Frame = +2

Query  314  KDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQKY  493
            +D +I W R EFAAANA+ID+LC+HL  +  G   EY+ V  AI +RR NW  +L MQ+Y
Sbjct  44   RDGLIGWLRSEFAAANAIIDSLCHHLRVV--GDPGEYDMVIGAIQQRRCNWNQVLMMQQY  101

Query  494  YTIADVALELRKV  532
            +++ADVA  L++V
Sbjct  102  FSVADVAHALQQV  114



>ref|XP_006580091.1| PREDICTED: uncharacterized protein LOC100809865 isoform X2 [Glycine 
max]
Length=641

 Score = 84.0 bits (206),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 37/73 (51%), Positives = 52/73 (71%), Gaps = 2/73 (3%)
 Frame = +2

Query  314  KDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQKY  493
            +D +I W R EFAAANA+ID+LC+HL  +  G   EY+ V  AI +RR NW  +L MQ+Y
Sbjct  44   RDGLIGWLRSEFAAANAIIDSLCHHLRVV--GDPGEYDMVIGAIQQRRCNWNQVLMMQQY  101

Query  494  YTIADVALELRKV  532
            +++ADVA  L++V
Sbjct  102  FSVADVAHALQQV  114



>emb|CAN65462.1| hypothetical protein VITISV_002198 [Vitis vinifera]
Length=1145

 Score = 84.3 bits (207),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 52/73 (71%), Gaps = 2/73 (3%)
 Frame = +2

Query  314  KDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQKY  493
            +D  I+W RGEFAAANA+ID+LCNHL  +  G   EY++V   I +RR NW  +L MQ+Y
Sbjct  40   RDGFISWLRGEFAAANAIIDSLCNHLRLI--GEPGEYDAVIGCIQQRRYNWSSVLHMQQY  97

Query  494  YTIADVALELRKV  532
            +++A+V   L++V
Sbjct  98   FSVAEVIYALQQV  110



>ref|XP_002988627.1| hypothetical protein SELMODRAFT_427277 [Selaginella moellendorffii]
 gb|EFJ10423.1| hypothetical protein SELMODRAFT_427277 [Selaginella moellendorffii]
Length=496

 Score = 83.6 bits (205),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 35/73 (48%), Positives = 51/73 (70%), Gaps = 2/73 (3%)
 Frame = +2

Query  314  KDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQKY  493
            +DA I W RGEFAAANA+ID+LC HL  +  G   EY+ V  +I +RR +W  +L MQ+Y
Sbjct  33   RDAFIGWLRGEFAAANAIIDSLCQHLHLI--GAPGEYDFVLGSIQQRRFSWNGVLHMQQY  90

Query  494  YTIADVALELRKV  532
            +++A+V   L++V
Sbjct  91   FSVAEVLFSLQQV  103



>ref|XP_008381778.1| PREDICTED: uncharacterized protein LOC103444603 [Malus domestica]
Length=690

 Score = 84.0 bits (206),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 35/73 (48%), Positives = 50/73 (68%), Gaps = 2/73 (3%)
 Frame = +2

Query  314  KDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQKY  493
            +D  I+W RGEFAAAN +ID+LC+HL  +  G   EY+ V   I +RR NW P+L MQ+Y
Sbjct  42   RDGFISWLRGEFAAANTIIDSLCHHLRAV--GDPGEYDVVIGCIQQRRCNWNPVLHMQQY  99

Query  494  YTIADVALELRKV  532
            +++A+V   L+ V
Sbjct  100  FSVAEVIYALQHV  112



>ref|XP_009351588.1| PREDICTED: uncharacterized protein LOC103943111 [Pyrus x bretschneideri]
 ref|XP_009351589.1| PREDICTED: uncharacterized protein LOC103943111 [Pyrus x bretschneideri]
Length=690

 Score = 84.0 bits (206),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 35/73 (48%), Positives = 50/73 (68%), Gaps = 2/73 (3%)
 Frame = +2

Query  314  KDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQKY  493
            +D  I+W RGEFAAAN +ID+LC+HL  +  G   EY+ V   I +RR NW P+L MQ+Y
Sbjct  42   RDGFISWLRGEFAAANTIIDSLCHHLRAV--GDPGEYDVVIGCIQQRRCNWNPVLHMQQY  99

Query  494  YTIADVALELRKV  532
            +++A+V   L+ V
Sbjct  100  FSVAEVIYALQHV  112



>ref|XP_008365818.1| PREDICTED: uncharacterized protein LOC103429447, partial [Malus 
domestica]
Length=640

 Score = 83.6 bits (205),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 35/73 (48%), Positives = 50/73 (68%), Gaps = 2/73 (3%)
 Frame = +2

Query  314  KDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQKY  493
            +D  I+W RGEFAAAN +ID+LC+HL  +  G   EY+ V   I +RR NW P+L MQ+Y
Sbjct  42   RDGFISWLRGEFAAANTIIDSLCHHLRAV--GDPGEYDVVIGCIQQRRCNWNPVLHMQQY  99

Query  494  YTIADVALELRKV  532
            +++A+V   L+ V
Sbjct  100  FSVAEVIYALQHV  112



>ref|XP_009607025.1| PREDICTED: uncharacterized protein LOC104101279 [Nicotiana tomentosiformis]
Length=638

 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 46/110 (42%), Positives = 63/110 (57%), Gaps = 12/110 (11%)
 Frame = +2

Query  230  QSNRVPLVPNVM-----PTVVQTPPA----MVSDSFAKDAVIAWFRGEFAAANAVIDALC  382
            QS    LVP  M        V+ PP      + D   +D  I+W RGEFAAANA+IDALC
Sbjct  2    QSGNATLVPEKMHGGGGGEAVEPPPHQQQWFMGDE--RDGFISWLRGEFAAANAIIDALC  59

Query  383  NHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQKYYTIADVALELRKV  532
            +HL +L G    EY+ V   + +RR NW  +L MQ+Y+++A+V   L +V
Sbjct  60   HHL-RLVGEQPGEYDGVIGCVQQRRGNWSTVLHMQQYFSVAEVIYALHQV  108



>ref|XP_004513242.1| PREDICTED: uncharacterized protein LOC101506929 isoform X1 [Cicer 
arietinum]
Length=669

 Score = 83.2 bits (204),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 51/73 (70%), Gaps = 2/73 (3%)
 Frame = +2

Query  314  KDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQKY  493
            +D  + W R EFAAANA+ID LC+HL  +  G G EY+ V  AI +RR NW  +L MQ+Y
Sbjct  43   RDGFMNWLRSEFAAANAIIDCLCHHLRVV--GEGGEYDPVVGAIQQRRCNWNQVLLMQQY  100

Query  494  YTIADVALELRKV  532
            Y++++VA  L++V
Sbjct  101  YSVSEVAYALQQV  113



>ref|XP_004513243.1| PREDICTED: uncharacterized protein LOC101506929 isoform X2 [Cicer 
arietinum]
Length=663

 Score = 83.2 bits (204),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 51/73 (70%), Gaps = 2/73 (3%)
 Frame = +2

Query  314  KDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQKY  493
            +D  + W R EFAAANA+ID LC+HL  +  G G EY+ V  AI +RR NW  +L MQ+Y
Sbjct  43   RDGFMNWLRSEFAAANAIIDCLCHHLRVV--GEGGEYDPVVGAIQQRRCNWNQVLLMQQY  100

Query  494  YTIADVALELRKV  532
            Y++++VA  L++V
Sbjct  101  YSVSEVAYALQQV  113



>ref|XP_010032031.1| PREDICTED: uncharacterized protein LOC104421688 isoform X2 [Eucalyptus 
grandis]
 gb|KCW51419.1| hypothetical protein EUGRSUZ_J00953 [Eucalyptus grandis]
Length=705

 Score = 83.2 bits (204),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/72 (49%), Positives = 48/72 (67%), Gaps = 1/72 (1%)
 Frame = +2

Query  314  KDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQKY  493
            +D  I+W RGEFAAANA+ID LC HL  +    G EYE+VF  I +RR NW  +L MQ+Y
Sbjct  66   RDGFISWLRGEFAAANAIIDGLCQHLRAISSEPG-EYEAVFGCIQQRRCNWNTVLYMQQY  124

Query  494  YTIADVALELRK  529
            + + +V   L++
Sbjct  125  FPVTEVMQTLKQ  136



>gb|KCW51418.1| hypothetical protein EUGRSUZ_J00953 [Eucalyptus grandis]
Length=700

 Score = 83.2 bits (204),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/72 (49%), Positives = 48/72 (67%), Gaps = 1/72 (1%)
 Frame = +2

Query  314  KDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQKY  493
            +D  I+W RGEFAAANA+ID LC HL  +    G EYE+VF  I +RR NW  +L MQ+Y
Sbjct  66   RDGFISWLRGEFAAANAIIDGLCQHLRAISSEPG-EYEAVFGCIQQRRCNWNTVLYMQQY  124

Query  494  YTIADVALELRK  529
            + + +V   L++
Sbjct  125  FPVTEVMQTLKQ  136



>ref|XP_009772695.1| PREDICTED: uncharacterized protein LOC104223045 [Nicotiana sylvestris]
Length=633

 Score = 82.8 bits (203),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 51/73 (70%), Gaps = 1/73 (1%)
 Frame = +2

Query  314  KDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQKY  493
            +D  I+W RGEFAAANA+IDALC+HL +L G    EY+ V   + +RR NW  +L MQ+Y
Sbjct  37   RDGFISWLRGEFAAANAIIDALCHHL-RLVGEQPGEYDGVIGCVQQRRGNWSTVLHMQQY  95

Query  494  YTIADVALELRKV  532
            +++A+V   L +V
Sbjct  96   FSVAEVIYALHQV  108



>ref|XP_010032032.1| PREDICTED: uncharacterized protein LOC104421688 isoform X3 [Eucalyptus 
grandis]
Length=693

 Score = 82.8 bits (203),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/72 (49%), Positives = 48/72 (67%), Gaps = 1/72 (1%)
 Frame = +2

Query  314  KDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQKY  493
            +D  I+W RGEFAAANA+ID LC HL  +    G EYE+VF  I +RR NW  +L MQ+Y
Sbjct  66   RDGFISWLRGEFAAANAIIDGLCQHLRAISSEPG-EYEAVFGCIQQRRCNWNTVLYMQQY  124

Query  494  YTIADVALELRK  529
            + + +V   L++
Sbjct  125  FPVTEVMQTLKQ  136



>ref|XP_010032030.1| PREDICTED: uncharacterized protein LOC104421688 isoform X1 [Eucalyptus 
grandis]
Length=708

 Score = 82.8 bits (203),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/72 (49%), Positives = 48/72 (67%), Gaps = 1/72 (1%)
 Frame = +2

Query  314  KDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQKY  493
            +D  I+W RGEFAAANA+ID LC HL  +    G EYE+VF  I +RR NW  +L MQ+Y
Sbjct  66   RDGFISWLRGEFAAANAIIDGLCQHLRAISSEPG-EYEAVFGCIQQRRCNWNTVLYMQQY  124

Query  494  YTIADVALELRK  529
            + + +V   L++
Sbjct  125  FPVTEVMQTLKQ  136



>ref|XP_010032033.1| PREDICTED: uncharacterized protein LOC104421688 isoform X4 [Eucalyptus 
grandis]
 gb|KCW51417.1| hypothetical protein EUGRSUZ_J00953 [Eucalyptus grandis]
Length=690

 Score = 82.8 bits (203),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/72 (49%), Positives = 48/72 (67%), Gaps = 1/72 (1%)
 Frame = +2

Query  314  KDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQKY  493
            +D  I+W RGEFAAANA+ID LC HL  +    G EYE+VF  I +RR NW  +L MQ+Y
Sbjct  66   RDGFISWLRGEFAAANAIIDGLCQHLRAISSEPG-EYEAVFGCIQQRRCNWNTVLYMQQY  124

Query  494  YTIADVALELRK  529
            + + +V   L++
Sbjct  125  FPVTEVMQTLKQ  136



>ref|XP_007158785.1| hypothetical protein PHAVU_002G181800g [Phaseolus vulgaris]
 gb|ESW30779.1| hypothetical protein PHAVU_002G181800g [Phaseolus vulgaris]
Length=671

 Score = 82.8 bits (203),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 51/73 (70%), Gaps = 2/73 (3%)
 Frame = +2

Query  314  KDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQKY  493
            +D +I W R EFAAANA+ID+LC+HL  +  G   EY+ V  AI +RR NW  +L MQ+Y
Sbjct  42   RDGLIGWLRSEFAAANAIIDSLCHHLRVV--GDPGEYDMVIGAIQQRRCNWNQVLLMQQY  99

Query  494  YTIADVALELRKV  532
            +++ADV   L++V
Sbjct  100  FSVADVTYTLQQV  112



>ref|XP_007158786.1| hypothetical protein PHAVU_002G181800g [Phaseolus vulgaris]
 gb|ESW30780.1| hypothetical protein PHAVU_002G181800g [Phaseolus vulgaris]
Length=630

 Score = 82.8 bits (203),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 51/73 (70%), Gaps = 2/73 (3%)
 Frame = +2

Query  314  KDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQKY  493
            +D +I W R EFAAANA+ID+LC+HL  +  G   EY+ V  AI +RR NW  +L MQ+Y
Sbjct  42   RDGLIGWLRSEFAAANAIIDSLCHHLRVV--GDPGEYDMVIGAIQQRRCNWNQVLLMQQY  99

Query  494  YTIADVALELRKV  532
            +++ADV   L++V
Sbjct  100  FSVADVTYTLQQV  112



>ref|XP_010032035.1| PREDICTED: uncharacterized protein LOC104421688 isoform X6 [Eucalyptus 
grandis]
 gb|KCW51416.1| hypothetical protein EUGRSUZ_J00953 [Eucalyptus grandis]
Length=663

 Score = 82.8 bits (203),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/72 (49%), Positives = 48/72 (67%), Gaps = 1/72 (1%)
 Frame = +2

Query  314  KDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQKY  493
            +D  I+W RGEFAAANA+ID LC HL  +    G EYE+VF  I +RR NW  +L MQ+Y
Sbjct  66   RDGFISWLRGEFAAANAIIDGLCQHLRAISSEPG-EYEAVFGCIQQRRCNWNTVLYMQQY  124

Query  494  YTIADVALELRK  529
            + + +V   L++
Sbjct  125  FPVTEVMQTLKQ  136



>ref|XP_010032034.1| PREDICTED: uncharacterized protein LOC104421688 isoform X5 [Eucalyptus 
grandis]
 gb|KCW51420.1| hypothetical protein EUGRSUZ_J00953 [Eucalyptus grandis]
Length=666

 Score = 82.8 bits (203),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/72 (49%), Positives = 48/72 (67%), Gaps = 1/72 (1%)
 Frame = +2

Query  314  KDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQKY  493
            +D  I+W RGEFAAANA+ID LC HL  +    G EYE+VF  I +RR NW  +L MQ+Y
Sbjct  66   RDGFISWLRGEFAAANAIIDGLCQHLRAISSEPG-EYEAVFGCIQQRRCNWNTVLYMQQY  124

Query  494  YTIADVALELRK  529
            + + +V   L++
Sbjct  125  FPVTEVMQTLKQ  136



>emb|CDX81664.1| BnaC08g39370D [Brassica napus]
Length=502

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 52/73 (71%), Gaps = 2/73 (3%)
 Frame = +2

Query  311  AKDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQK  490
             +D  I+W RGEFAAANA+ID+LC HL  +  G  +EYESV +AI  R+ +W  +L MQ+
Sbjct  12   GRDGFISWIRGEFAAANAIIDSLCQHL--VAAGDQNEYESVVSAIQHRQASWSQVLYMQQ  69

Query  491  YYTIADVALELRK  529
            +Y+IAD++  L +
Sbjct  70   FYSIADISHSLHQ  82



>ref|XP_011021727.1| PREDICTED: uncharacterized protein LOC105123720 isoform X1 [Populus 
euphratica]
Length=695

 Score = 82.4 bits (202),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 50/72 (69%), Gaps = 2/72 (3%)
 Frame = +2

Query  314  KDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQKY  493
            +D  I+W RGEFAAANA+ID+LC+HL  +  G   EY+ V   I +RR NW P+L MQ+Y
Sbjct  47   RDGFISWLRGEFAAANAIIDSLCHHLRAV--GEPGEYDLVVGCIQQRRCNWNPVLHMQQY  104

Query  494  YTIADVALELRK  529
            +++ +V   L++
Sbjct  105  FSVGEVVAALQQ  116



>ref|XP_011021729.1| PREDICTED: uncharacterized protein LOC105123720 isoform X3 [Populus 
euphratica]
Length=689

 Score = 82.4 bits (202),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 50/72 (69%), Gaps = 2/72 (3%)
 Frame = +2

Query  314  KDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQKY  493
            +D  I+W RGEFAAANA+ID+LC+HL  +  G   EY+ V   I +RR NW P+L MQ+Y
Sbjct  47   RDGFISWLRGEFAAANAIIDSLCHHLRAV--GEPGEYDLVVGCIQQRRCNWNPVLHMQQY  104

Query  494  YTIADVALELRK  529
            +++ +V   L++
Sbjct  105  FSVGEVVAALQQ  116



>gb|KDP38170.1| hypothetical protein JCGZ_04813 [Jatropha curcas]
Length=691

 Score = 82.4 bits (202),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 35/73 (48%), Positives = 51/73 (70%), Gaps = 2/73 (3%)
 Frame = +2

Query  314  KDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQKY  493
            +D  I+W RGEFAAANA+ID+LC+HL  +  G   EY+ V   I +RR NW  +L MQ+Y
Sbjct  48   RDGFISWLRGEFAAANAIIDSLCHHLRAV--GEPGEYDLVVGCIQQRRCNWNAVLHMQQY  105

Query  494  YTIADVALELRKV  532
            +++ +V L L++V
Sbjct  106  FSVGEVILALQQV  118



>ref|XP_011021728.1| PREDICTED: uncharacterized protein LOC105123720 isoform X2 [Populus 
euphratica]
Length=694

 Score = 82.4 bits (202),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 50/72 (69%), Gaps = 2/72 (3%)
 Frame = +2

Query  314  KDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQKY  493
            +D  I+W RGEFAAANA+ID+LC+HL  +  G   EY+ V   I +RR NW P+L MQ+Y
Sbjct  47   RDGFISWLRGEFAAANAIIDSLCHHLRAV--GEPGEYDLVVGCIQQRRCNWNPVLHMQQY  104

Query  494  YTIADVALELRK  529
            +++ +V   L++
Sbjct  105  FSVGEVVAALQQ  116



>ref|XP_011021730.1| PREDICTED: uncharacterized protein LOC105123720 isoform X4 [Populus 
euphratica]
Length=688

 Score = 82.4 bits (202),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 50/72 (69%), Gaps = 2/72 (3%)
 Frame = +2

Query  314  KDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQKY  493
            +D  I+W RGEFAAANA+ID+LC+HL  +  G   EY+ V   I +RR NW P+L MQ+Y
Sbjct  47   RDGFISWLRGEFAAANAIIDSLCHHLRAV--GEPGEYDLVVGCIQQRRCNWNPVLHMQQY  104

Query  494  YTIADVALELRK  529
            +++ +V   L++
Sbjct  105  FSVGEVVAALQQ  116



>ref|XP_009110517.1| PREDICTED: uncharacterized protein LOC103836054 [Brassica rapa]
 ref|XP_009110518.1| PREDICTED: uncharacterized protein LOC103836054 [Brassica rapa]
Length=580

 Score = 81.6 bits (200),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 50/73 (68%), Gaps = 2/73 (3%)
 Frame = +2

Query  311  AKDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQK  490
             +D  I+W RGEFAAANA+ID+LC HL  +  G  +EYE V +AI  R+ +W P+L MQ 
Sbjct  17   GRDGFISWIRGEFAAANAIIDSLCQHLVAI--GDQNEYEGVVSAIQHRQSSWSPVLYMQH  74

Query  491  YYTIADVALELRK  529
            ++ IADV+  L +
Sbjct  75   FFPIADVSYALEQ  87



>emb|CDY52029.1| BnaA08g31420D [Brassica napus]
Length=586

 Score = 81.6 bits (200),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 40/89 (45%), Positives = 55/89 (62%), Gaps = 4/89 (4%)
 Frame = +2

Query  263  MPTVVQTPPAMVSDSFAKDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAA  442
            MP     P   + D   +D  I+W RGEFAAANA+ID+LC HL  +  G  +EYE V +A
Sbjct  3    MPPGSVAPGNWIPD--GRDGFISWIRGEFAAANAIIDSLCQHLVAI--GDQNEYEGVVSA  58

Query  443  IHRRRLNWIPILQMQKYYTIADVALELRK  529
            I  R+ +W P+L MQ ++ IADV+  L +
Sbjct  59   IQHRQSSWSPVLYMQHFFPIADVSYALEQ  87



>ref|XP_004513244.1| PREDICTED: uncharacterized protein LOC101507475 [Cicer arietinum]
Length=657

 Score = 81.6 bits (200),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 35/73 (48%), Positives = 52/73 (71%), Gaps = 2/73 (3%)
 Frame = +2

Query  314  KDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQKY  493
            +D  + W R EFAAANA+ID LC+HL  ++ G  SEY+ V  AI +RR NW  +L MQ+Y
Sbjct  40   RDEFMIWLRSEFAAANAIIDCLCHHLCVVDEG--SEYDVVIGAIQQRRCNWNQVLLMQQY  97

Query  494  YTIADVALELRKV  532
            Y++++V+  L++V
Sbjct  98   YSVSEVSYALQQV  110



>dbj|BAJ94215.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=639

 Score = 81.3 bits (199),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 35/72 (49%), Positives = 51/72 (71%), Gaps = 2/72 (3%)
 Frame = +2

Query  314  KDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQKY  493
            +D  I+W RGEFAAANA+ID L  HL  +  G   EY+ VFAA+ +RR +W P++ MQ++
Sbjct  33   RDGFISWLRGEFAAANAIIDLLVVHLRAV--GDPGEYDHVFAAVQQRRHHWAPVIHMQQF  90

Query  494  YTIADVALELRK  529
            + +ADVA  L++
Sbjct  91   FPVADVAYALQQ  102



>dbj|BAJ92146.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=637

 Score = 81.3 bits (199),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 35/72 (49%), Positives = 51/72 (71%), Gaps = 2/72 (3%)
 Frame = +2

Query  314  KDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQKY  493
            +D  I+W RGEFAAANA+ID L  HL  +  G   EY+ VFAA+ +RR +W P++ MQ++
Sbjct  31   RDGFISWLRGEFAAANAIIDLLVVHLRAV--GDPGEYDHVFAAVQQRRHHWAPVIHMQQF  88

Query  494  YTIADVALELRK  529
            + +ADVA  L++
Sbjct  89   FPVADVAYALQQ  100



>emb|CDY33746.1| BnaA09g45520D [Brassica napus]
Length=498

 Score = 80.9 bits (198),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 52/73 (71%), Gaps = 2/73 (3%)
 Frame = +2

Query  311  AKDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQK  490
             +D  I+W RGEFAAANA+ID+LC HL  +  G  +EYESV +AI  R+ +W  +L MQ+
Sbjct  12   GRDGFISWIRGEFAAANAIIDSLCQHLVAV--GDQNEYESVVSAIQHRQASWSQVLYMQQ  69

Query  491  YYTIADVALELRK  529
            +Y+IAD++  L +
Sbjct  70   FYSIADISHFLHQ  82



>emb|CDP05488.1| unnamed protein product [Coffea canephora]
Length=319

 Score = 79.3 bits (194),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 50/73 (68%), Gaps = 2/73 (3%)
 Frame = +2

Query  314  KDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQKY  493
            ++  + W RGEFAAANA+IDALC+HL  +  G   EY+ V   I +RR NW  +L MQ+Y
Sbjct  54   REGFMLWLRGEFAAANAIIDALCHHLRVV--GEPGEYDGVIGCIQQRRCNWNSVLHMQQY  111

Query  494  YTIADVALELRKV  532
            +++ +VA  L++V
Sbjct  112  FSVNEVAYALQQV  124



>gb|KHN04838.1| hypothetical protein glysoja_050393 [Glycine soja]
Length=206

 Score = 77.8 bits (190),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 49/73 (67%), Gaps = 2/73 (3%)
 Frame = +2

Query  314  KDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQKY  493
            +D  I W R EFAAANA+ID+LC+HL  +  G   EY  V  AI +RR NW  +L MQ+Y
Sbjct  40   RDGFIGWLRSEFAAANAIIDSLCHHLRDV--GEPGEYNMVVGAIQQRRCNWTQVLLMQQY  97

Query  494  YTIADVALELRKV  532
            +++++V   L++V
Sbjct  98   FSVSEVVYALQQV  110



>ref|XP_009148855.1| PREDICTED: uncharacterized protein LOC103872267 [Brassica rapa]
Length=602

 Score = 80.9 bits (198),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 40/85 (47%), Positives = 55/85 (65%), Gaps = 5/85 (6%)
 Frame = +2

Query  281  TPPAMVSDSF---AKDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHR  451
            TPP  V+ S+    +D  I+W RGEFAAANA+ID LC HL  +  G  S+Y++V +AI  
Sbjct  18   TPPIAVAGSWIPDERDVYISWMRGEFAAANAIIDTLCQHLQAI--GDQSQYDAVISAIQH  75

Query  452  RRLNWIPILQMQKYYTIADVALELR  526
            R+ +W   + MQ YYTIAD+   L+
Sbjct  76   RQSSWSQAIYMQPYYTIADIYKALQ  100



>ref|XP_004236917.1| PREDICTED: uncharacterized protein LOC101261013 [Solanum lycopersicum]
Length=641

 Score = 80.9 bits (198),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 52/73 (71%), Gaps = 2/73 (3%)
 Frame = +2

Query  314  KDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQKY  493
            +D  I+W RGEFAA+NA+IDALC+HL +L G  G EY+ V   + +RR NW  +L MQ+Y
Sbjct  49   RDGFISWLRGEFAASNAIIDALCHHL-RLVGEPG-EYDGVIGCVQQRRANWNSVLHMQQY  106

Query  494  YTIADVALELRKV  532
            +++A+V   L +V
Sbjct  107  HSVAEVIYSLHQV  119



>ref|XP_009117880.1| PREDICTED: uncharacterized protein LOC103842949 [Brassica rapa]
 ref|XP_009117881.1| PREDICTED: uncharacterized protein LOC103842949 [Brassica rapa]
Length=495

 Score = 80.5 bits (197),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 35/73 (48%), Positives = 51/73 (70%), Gaps = 2/73 (3%)
 Frame = +2

Query  311  AKDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQK  490
             +D  I+W RGEFAAANA+ID+LC HL  +  G  +EYESV + I  R+ +W  +L MQ+
Sbjct  12   GRDGFISWIRGEFAAANAIIDSLCQHLVAV--GDQNEYESVVSTIQHRQASWSQVLYMQQ  69

Query  491  YYTIADVALELRK  529
            +Y+IAD++  L +
Sbjct  70   FYSIADISHSLHQ  82



>ref|XP_008795329.1| PREDICTED: uncharacterized protein LOC103711107 [Phoenix dactylifera]
 ref|XP_008795330.1| PREDICTED: uncharacterized protein LOC103711107 [Phoenix dactylifera]
 ref|XP_008795332.1| PREDICTED: uncharacterized protein LOC103711107 [Phoenix dactylifera]
 ref|XP_008795333.1| PREDICTED: uncharacterized protein LOC103711107 [Phoenix dactylifera]
 ref|XP_008795334.1| PREDICTED: uncharacterized protein LOC103711107 [Phoenix dactylifera]
 ref|XP_008795335.1| PREDICTED: uncharacterized protein LOC103711107 [Phoenix dactylifera]
Length=687

 Score = 80.9 bits (198),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 52/73 (71%), Gaps = 2/73 (3%)
 Frame = +2

Query  314  KDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQKY  493
            +D  I+W R EFAAANA+ID+L +HL  +  G   EY++V   IH+RR +W PIL +Q Y
Sbjct  39   RDGFISWIRAEFAAANAIIDSLVHHLRAI--GEPEEYDAVVGFIHQRRCSWNPILHLQHY  96

Query  494  YTIADVALELRKV  532
            Y++A+VA  L++V
Sbjct  97   YSVAEVAYALQQV  109



>ref|XP_006355042.1| PREDICTED: uncharacterized protein LOC102600383 [Solanum tuberosum]
Length=638

 Score = 80.5 bits (197),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 52/73 (71%), Gaps = 2/73 (3%)
 Frame = +2

Query  314  KDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQKY  493
            +D  I+W RGEFAA+NA+IDALC+HL +L G  G EY+ V   + +RR NW  +L MQ+Y
Sbjct  47   RDGFISWLRGEFAASNAIIDALCHHL-RLVGEPG-EYDGVIGCVQQRRANWNSVLHMQQY  104

Query  494  YTIADVALELRKV  532
            +++A+V   L +V
Sbjct  105  HSVAEVIYSLHQV  117



>ref|XP_003558397.1| PREDICTED: uncharacterized protein LOC100828230 [Brachypodium 
distachyon]
Length=669

 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 49/72 (68%), Gaps = 2/72 (3%)
 Frame = +2

Query  314  KDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQKY  493
            +D  I+W RGEFAAANA+ID L  HL     G   EY+ VFAA+ +RR +W P++ MQ++
Sbjct  36   RDGFISWLRGEFAAANAIIDLLVVHLRT--AGDPGEYDHVFAAVQQRRHHWTPVIHMQQF  93

Query  494  YTIADVALELRK  529
            + + DVA  L++
Sbjct  94   FPVTDVAYALQQ  105



>ref|XP_006605475.1| PREDICTED: uncharacterized protein LOC100814525 [Glycine max]
Length=626

 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 50/73 (68%), Gaps = 2/73 (3%)
 Frame = +2

Query  314  KDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQKY  493
            +D  I W R EFAAANA+ID+LC+HL  +  G   EY+ V  AI +RR NW  +L MQ+Y
Sbjct  36   RDGFIGWLRSEFAAANAIIDSLCHHLRCV--GEPGEYDMVVGAIQQRRCNWTQVLLMQQY  93

Query  494  YTIADVALELRKV  532
            +++++V   L++V
Sbjct  94   FSVSEVVCALQQV  106



>ref|XP_009380066.1| PREDICTED: uncharacterized protein LOC103968538 [Musa acuminata 
subsp. malaccensis]
Length=692

 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 49/73 (67%), Gaps = 2/73 (3%)
 Frame = +2

Query  314  KDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQKY  493
            +D  I+W RGEFAAANA+ID L +HL  +  G   EY+ +   IH+RR +W PIL +Q+Y
Sbjct  34   RDGFISWLRGEFAAANAIIDLLIHHLRVV--GEPGEYDHLAGCIHQRRFHWTPILHLQQY  91

Query  494  YTIADVALELRKV  532
            + +AD    L++V
Sbjct  92   FPVADAMYALQQV  104



>gb|KHN01749.1| hypothetical protein glysoja_047936 [Glycine soja]
Length=651

 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 49/73 (67%), Gaps = 2/73 (3%)
 Frame = +2

Query  314  KDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQKY  493
            +D  I W R EFAAANA+ID+LC+HL  +  G   EY  V  AI +RR NW  +L MQ+Y
Sbjct  40   RDGFIGWLRSEFAAANAIIDSLCHHLRDV--GEPGEYNMVVGAIQQRRCNWTQVLLMQQY  97

Query  494  YTIADVALELRKV  532
            +++++V   L++V
Sbjct  98   FSVSEVVYALQQV  110



>ref|XP_006583757.1| PREDICTED: uncharacterized protein LOC100781773 [Glycine max]
Length=664

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 49/73 (67%), Gaps = 2/73 (3%)
 Frame = +2

Query  314  KDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQKY  493
            +D  I W R EFAAANA+ID+LC+HL  +  G   EY  V  AI +RR NW  +L MQ+Y
Sbjct  40   RDGFIGWLRSEFAAANAIIDSLCHHLRDV--GEPGEYNMVVGAIQQRRCNWTQVLLMQQY  97

Query  494  YTIADVALELRKV  532
            +++++V   L++V
Sbjct  98   FSVSEVVYALQQV  110



>emb|CDY45282.1| BnaA06g09520D [Brassica napus]
Length=601

 Score = 79.0 bits (193),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 38/79 (48%), Positives = 52/79 (66%), Gaps = 5/79 (6%)
 Frame = +2

Query  284  PPAMVSDSF---AKDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRR  454
            PP  V+ S+    +D  I+W RGEFAAANA+ID LCNHL  +  G  S+Y++V + I  R
Sbjct  19   PPIAVAGSWIPDERDVYISWMRGEFAAANAIIDTLCNHLQAI--GDQSQYDAVVSVIQHR  76

Query  455  RLNWIPILQMQKYYTIADV  511
            + +W   + MQ YYTIAD+
Sbjct  77   QSSWSQAIYMQPYYTIADI  95



>ref|XP_006416980.1| hypothetical protein EUTSA_v10007113mg [Eutrema salsugineum]
 gb|ESQ35333.1| hypothetical protein EUTSA_v10007113mg [Eutrema salsugineum]
Length=609

 Score = 78.6 bits (192),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 61/97 (63%), Gaps = 7/97 (7%)
 Frame = +2

Query  257  NVMPT-VVQTPPAMVSDSF----AKDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSE  421
            NV P+  +Q PP  V+        +D  I+W RGEFAAANA+ID LC HL  +  G  +E
Sbjct  7    NVTPSDKLQFPPVAVAAGSWIPDGRDGFISWIRGEFAAANAIIDLLCQHL--VATGDHNE  64

Query  422  YESVFAAIHRRRLNWIPILQMQKYYTIADVALELRKV  532
            YE+V ++I  R+L W  +  MQ+++ IA+++  L++V
Sbjct  65   YEAVISSIRHRQLGWSQVTYMQQFFPIAEISHTLQQV  101



>ref|XP_010554385.1| PREDICTED: uncharacterized protein LOC104824118 isoform X5 [Tarenaya 
hassleriana]
 ref|XP_010554386.1| PREDICTED: uncharacterized protein LOC104824118 isoform X5 [Tarenaya 
hassleriana]
Length=250

 Score = 75.9 bits (185),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 47/73 (64%), Gaps = 2/73 (3%)
 Frame = +2

Query  314  KDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQKY  493
            +D  I W   E  AANA+ID LC HL  +E  G  EY++V A I +RR NW P+L MQ+Y
Sbjct  41   RDEFILWLWSESPAANAIIDLLCQHLHAVEDPG--EYDTVLAGISQRRYNWTPVLHMQQY  98

Query  494  YTIADVALELRKV  532
            + +ADV   L+++
Sbjct  99   FPVADVVYSLQQI  111



>emb|CDX84011.1| BnaC08g16340D [Brassica napus]
Length=518

 Score = 78.2 bits (191),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 35/73 (48%), Positives = 50/73 (68%), Gaps = 2/73 (3%)
 Frame = +2

Query  311  AKDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQK  490
             +D  I+W RGEFAAANA+ID+LC HL  +  G  +EYE V +AI +R+ +W  +L MQ 
Sbjct  17   GRDGFISWIRGEFAAANAIIDSLCQHLIAI--GDHNEYEGVVSAIQQRQSSWSQVLYMQH  74

Query  491  YYTIADVALELRK  529
            ++ IADV+  L +
Sbjct  75   FFPIADVSYALEQ  87



>ref|XP_010554384.1| PREDICTED: uncharacterized protein LOC104824118 isoform X4 [Tarenaya 
hassleriana]
Length=251

 Score = 75.9 bits (185),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 47/73 (64%), Gaps = 2/73 (3%)
 Frame = +2

Query  314  KDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQKY  493
            +D  I W   E  AANA+ID LC HL  +E  G  EY++V A I +RR NW P+L MQ+Y
Sbjct  41   RDEFILWLWSESPAANAIIDLLCQHLHAVEDPG--EYDTVLAGISQRRYNWTPVLHMQQY  98

Query  494  YTIADVALELRKV  532
            + +ADV   L+++
Sbjct  99   FPVADVVYSLQQI  111



>ref|XP_002984873.1| hypothetical protein SELMODRAFT_446040 [Selaginella moellendorffii]
 gb|EFJ14123.1| hypothetical protein SELMODRAFT_446040 [Selaginella moellendorffii]
Length=648

 Score = 78.2 bits (191),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 50/73 (68%), Gaps = 1/73 (1%)
 Frame = +2

Query  314  KDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQKY  493
            +D+ I+W R EFAAANA+IDA+C HL  +    G EY+ V   + +RR NW  +L MQ+Y
Sbjct  41   RDSFISWLRSEFAAANAIIDAMCQHLPVVASCPG-EYDFVLNCVRQRRYNWTAVLHMQQY  99

Query  494  YTIADVALELRKV  532
            +++ +V + L++V
Sbjct  100  FSVEEVVMALQQV  112



>ref|XP_009404147.1| PREDICTED: uncharacterized protein LOC103987543 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=619

 Score = 78.2 bits (191),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 52/73 (71%), Gaps = 2/73 (3%)
 Frame = +2

Query  314  KDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQKY  493
            +D  I+W RGEFAAANA+ID L +HL ++ G  G +Y+ +   IH+RR +W PIL +Q+Y
Sbjct  33   RDGFISWLRGEFAAANAIIDLLMHHL-RITGEPG-QYDHLAGCIHQRRFHWAPILHLQQY  90

Query  494  YTIADVALELRKV  532
            + +A+V   L++V
Sbjct  91   FPVANVMYALQRV  103



>ref|XP_009404146.1| PREDICTED: uncharacterized protein LOC103987543 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=627

 Score = 78.2 bits (191),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 52/73 (71%), Gaps = 2/73 (3%)
 Frame = +2

Query  314  KDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQKY  493
            +D  I+W RGEFAAANA+ID L +HL ++ G  G +Y+ +   IH+RR +W PIL +Q+Y
Sbjct  33   RDGFISWLRGEFAAANAIIDLLMHHL-RITGEPG-QYDHLAGCIHQRRFHWAPILHLQQY  90

Query  494  YTIADVALELRKV  532
            + +A+V   L++V
Sbjct  91   FPVANVMYALQRV  103



>ref|XP_002985931.1| hypothetical protein SELMODRAFT_446423 [Selaginella moellendorffii]
 gb|EFJ13108.1| hypothetical protein SELMODRAFT_446423 [Selaginella moellendorffii]
Length=648

 Score = 78.2 bits (191),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 50/73 (68%), Gaps = 1/73 (1%)
 Frame = +2

Query  314  KDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQKY  493
            +D+ I+W R EFAAANA+IDA+C HL  +    G EY+ V   + +RR NW  +L MQ+Y
Sbjct  41   RDSFISWLRSEFAAANAIIDAMCQHLPVVASCPG-EYDFVLNCVRQRRYNWTAVLHMQQY  99

Query  494  YTIADVALELRKV  532
            +++ +V + L++V
Sbjct  100  FSVEEVVMALQQV  112



>ref|XP_006448091.1| hypothetical protein CICLE_v10014588mg [Citrus clementina]
 gb|ESR61331.1| hypothetical protein CICLE_v10014588mg [Citrus clementina]
Length=635

 Score = 78.2 bits (191),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 37/90 (41%), Positives = 54/90 (60%), Gaps = 9/90 (10%)
 Frame = +2

Query  263  MPTVVQTPPAMVSDSFAKDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAA  442
            MP  +Q  PA        D  + W RGEFAAANA+ID LC+HL  +  G   EY+     
Sbjct  3    MPEKIQQLPA-------DDPFVMWLRGEFAAANAIIDTLCHHLRVI--GEPGEYDFAINC  53

Query  443  IHRRRLNWIPILQMQKYYTIADVALELRKV  532
            I +RR NW  +L +Q+Y+++++V L L++V
Sbjct  54   IQQRRCNWNSVLHLQQYFSVSEVMLALQQV  83



>ref|XP_009404148.1| PREDICTED: uncharacterized protein LOC103987543 isoform X3 [Musa 
acuminata subsp. malaccensis]
Length=616

 Score = 78.2 bits (191),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 52/73 (71%), Gaps = 2/73 (3%)
 Frame = +2

Query  314  KDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQKY  493
            +D  I+W RGEFAAANA+ID L +HL ++ G  G +Y+ +   IH+RR +W PIL +Q+Y
Sbjct  33   RDGFISWLRGEFAAANAIIDLLMHHL-RITGEPG-QYDHLAGCIHQRRFHWAPILHLQQY  90

Query  494  YTIADVALELRKV  532
            + +A+V   L++V
Sbjct  91   FPVANVMYALQRV  103



>ref|XP_002315841.2| hydroxyproline-rich glycoprotein [Populus trichocarpa]
 gb|EEF02012.2| hydroxyproline-rich glycoprotein [Populus trichocarpa]
Length=699

 Score = 78.2 bits (191),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 33/72 (46%), Positives = 49/72 (68%), Gaps = 2/72 (3%)
 Frame = +2

Query  314  KDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQKY  493
            +D  I+W RGEFAAANA+ID+LC+HL  +  G   EY+ V   I +RR NW  +L MQ+Y
Sbjct  47   RDGFISWLRGEFAAANAIIDSLCHHLRAV--GEPGEYDLVVGCIQQRRCNWNHVLHMQQY  104

Query  494  YTIADVALELRK  529
            +++ +V   L++
Sbjct  105  FSVGEVVAALQQ  116



>gb|KEH40698.1| hydroxyproline-rich glycoprotein family protein [Medicago truncatula]
Length=658

 Score = 77.8 bits (190),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 49/73 (67%), Gaps = 2/73 (3%)
 Frame = +2

Query  314  KDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQKY  493
            +D  + W R EFAAANA+ID LC HL  +  G   EY+ V  AI +RR+NW  +L MQ+Y
Sbjct  46   RDGFMNWIRSEFAAANAIIDCLCQHLGVI--GESGEYDHVVGAIQQRRVNWNQVLLMQQY  103

Query  494  YTIADVALELRKV  532
            +++ +VA  L++V
Sbjct  104  FSVNEVAYALQQV  116



>ref|XP_010554378.1| PREDICTED: uncharacterized protein LOC104824118 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010554379.1| PREDICTED: uncharacterized protein LOC104824118 isoform X2 [Tarenaya 
hassleriana]
 ref|XP_010554380.1| PREDICTED: uncharacterized protein LOC104824118 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010554381.1| PREDICTED: uncharacterized protein LOC104824118 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010554382.1| PREDICTED: uncharacterized protein LOC104824118 isoform X1 [Tarenaya 
hassleriana]
Length=269

 Score = 75.5 bits (184),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 47/73 (64%), Gaps = 2/73 (3%)
 Frame = +2

Query  314  KDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQKY  493
            +D  I W   E  AANA+ID LC HL  +E  G  EY++V A I +RR NW P+L MQ+Y
Sbjct  41   RDEFILWLWSESPAANAIIDLLCQHLHAVEDPG--EYDTVLAGISQRRYNWTPVLHMQQY  98

Query  494  YTIADVALELRKV  532
            + +ADV   L+++
Sbjct  99   FPVADVVYSLQQI  111



>ref|XP_010554383.1| PREDICTED: uncharacterized protein LOC104824118 isoform X3 [Tarenaya 
hassleriana]
Length=267

 Score = 75.5 bits (184),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 47/73 (64%), Gaps = 2/73 (3%)
 Frame = +2

Query  314  KDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQKY  493
            +D  I W   E  AANA+ID LC HL  +E  G  EY++V A I +RR NW P+L MQ+Y
Sbjct  41   RDEFILWLWSESPAANAIIDLLCQHLHAVEDPG--EYDTVLAGISQRRYNWTPVLHMQQY  98

Query  494  YTIADVALELRKV  532
            + +ADV   L+++
Sbjct  99   FPVADVVYSLQQI  111



>gb|KEH40700.1| hydroxyproline-rich glycoprotein family protein [Medicago truncatula]
Length=653

 Score = 77.4 bits (189),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 47/73 (64%), Gaps = 2/73 (3%)
 Frame = +2

Query  314  KDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQKY  493
            +D  + W R EFAAANA+ID LC HL     G   EY+ V  AI +RR+NW  +L MQ+Y
Sbjct  34   RDGFMNWLRSEFAAANAIIDCLCQHLG--VAGESGEYDHVVGAIQQRRINWNQVLLMQQY  91

Query  494  YTIADVALELRKV  532
            Y++ +V   L++V
Sbjct  92   YSVNEVEYALQQV  104



>gb|KDO60856.1| hypothetical protein CISIN_1g006789mg [Citrus sinensis]
Length=630

 Score = 77.4 bits (189),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 49/74 (66%), Gaps = 2/74 (3%)
 Frame = +2

Query  311  AKDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQK  490
            A D  + W RGEFAAANA+ID LC+HL  +  G   EY+     I +RR NW  +L +Q+
Sbjct  12   ADDPFVMWLRGEFAAANAIIDTLCHHLRVI--GEPGEYDFAINCIQQRRCNWNSVLHLQQ  69

Query  491  YYTIADVALELRKV  532
            Y+++++V L L++V
Sbjct  70   YFSVSEVMLALQQV  83



>gb|KDO60855.1| hypothetical protein CISIN_1g006789mg [Citrus sinensis]
Length=631

 Score = 77.4 bits (189),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 49/74 (66%), Gaps = 2/74 (3%)
 Frame = +2

Query  311  AKDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQK  490
            A D  + W RGEFAAANA+ID LC+HL  +  G   EY+     I +RR NW  +L +Q+
Sbjct  12   ADDPFVMWLRGEFAAANAIIDTLCHHLRVI--GEPGEYDFAINCIQQRRCNWNSVLHLQQ  69

Query  491  YYTIADVALELRKV  532
            Y+++++V L L++V
Sbjct  70   YFSVSEVMLALQQV  83



>ref|XP_006469304.1| PREDICTED: uncharacterized protein LOC102618872 [Citrus sinensis]
Length=627

 Score = 77.4 bits (189),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 49/74 (66%), Gaps = 2/74 (3%)
 Frame = +2

Query  311  AKDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQK  490
            A D  + W RGEFAAANA+ID LC+HL  +  G   EY+     I +RR NW  +L +Q+
Sbjct  12   ADDPFVMWLRGEFAAANAIIDTLCHHLRVI--GEPGEYDFAINCIQQRRCNWNSVLHLQQ  69

Query  491  YYTIADVALELRKV  532
            Y+++++V L L++V
Sbjct  70   YFSVSEVMLALQQV  83



>ref|XP_006379789.1| hypothetical protein POPTR_0008s13830g [Populus trichocarpa]
 gb|ERP57586.1| hypothetical protein POPTR_0008s13830g [Populus trichocarpa]
Length=693

 Score = 77.4 bits (189),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 46/66 (70%), Gaps = 2/66 (3%)
 Frame = +2

Query  314  KDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQKY  493
            +D  I+W RGEFAAANA+ID+LC+HL  +  G   EY+ V   I +RR NW  +L MQ+Y
Sbjct  46   RDGFISWLRGEFAAANAIIDSLCHHLRAV--GEAGEYDLVVGCIQQRRSNWNHVLHMQQY  103

Query  494  YTIADV  511
            +++ +V
Sbjct  104  FSVGEV  109



>gb|ABK95394.1| unknown [Populus trichocarpa]
Length=694

 Score = 77.4 bits (189),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 46/66 (70%), Gaps = 2/66 (3%)
 Frame = +2

Query  314  KDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQKY  493
            +D  I+W RGEFAAANA+ID+LC+HL  +  G   EY+ V   I +RR NW  +L MQ+Y
Sbjct  46   RDGFISWLRGEFAAANAIIDSLCHHLRAV--GEAGEYDLVVGCIQQRRSNWNHVLHMQQY  103

Query  494  YTIADV  511
            +++ +V
Sbjct  104  FSVGEV  109



>ref|XP_011024645.1| PREDICTED: uncharacterized protein LOC105125743 isoform X4 [Populus 
euphratica]
Length=692

 Score = 77.4 bits (189),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 46/66 (70%), Gaps = 2/66 (3%)
 Frame = +2

Query  314  KDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQKY  493
            +D  I+W RGEFAAANA+ID+LC+HL  +  G   EY+ V   I +RR NW  +L MQ+Y
Sbjct  46   RDGFISWLRGEFAAANAIIDSLCHHLRAV--GEAGEYDLVVGCIQQRRSNWNHVLHMQQY  103

Query  494  YTIADV  511
            +++ +V
Sbjct  104  FSVGEV  109



>ref|XP_002311547.2| hydroxyproline-rich glycoprotein [Populus trichocarpa]
 gb|EEE88914.2| hydroxyproline-rich glycoprotein [Populus trichocarpa]
Length=675

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 46/66 (70%), Gaps = 2/66 (3%)
 Frame = +2

Query  314  KDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQKY  493
            +D  I+W RGEFAAANA+ID+LC+HL  +  G   EY+ V   I +RR NW  +L MQ+Y
Sbjct  46   RDGFISWLRGEFAAANAIIDSLCHHLRAV--GEAGEYDLVVGCIQQRRSNWNHVLHMQQY  103

Query  494  YTIADV  511
            +++ +V
Sbjct  104  FSVGEV  109



>ref|XP_011024636.1| PREDICTED: uncharacterized protein LOC105125743 isoform X3 [Populus 
euphratica]
Length=693

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 46/66 (70%), Gaps = 2/66 (3%)
 Frame = +2

Query  314  KDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQKY  493
            +D  I+W RGEFAAANA+ID+LC+HL  +  G   EY+ V   I +RR NW  +L MQ+Y
Sbjct  46   RDGFISWLRGEFAAANAIIDSLCHHLRAV--GEAGEYDLVVGCIQQRRSNWNHVLHMQQY  103

Query  494  YTIADV  511
            +++ +V
Sbjct  104  FSVGEV  109



>ref|XP_011024628.1| PREDICTED: uncharacterized protein LOC105125743 isoform X2 [Populus 
euphratica]
Length=693

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 46/66 (70%), Gaps = 2/66 (3%)
 Frame = +2

Query  314  KDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQKY  493
            +D  I+W RGEFAAANA+ID+LC+HL  +  G   EY+ V   I +RR NW  +L MQ+Y
Sbjct  46   RDGFISWLRGEFAAANAIIDSLCHHLRAV--GEAGEYDLVVGCIQQRRSNWNHVLHMQQY  103

Query  494  YTIADV  511
            +++ +V
Sbjct  104  FSVGEV  109



>ref|XP_011024620.1| PREDICTED: uncharacterized protein LOC105125743 isoform X1 [Populus 
euphratica]
Length=694

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 46/66 (70%), Gaps = 2/66 (3%)
 Frame = +2

Query  314  KDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQKY  493
            +D  I+W RGEFAAANA+ID+LC+HL  +  G   EY+ V   I +RR NW  +L MQ+Y
Sbjct  46   RDGFISWLRGEFAAANAIIDSLCHHLRAV--GEAGEYDLVVGCIQQRRSNWNHVLHMQQY  103

Query  494  YTIADV  511
            +++ +V
Sbjct  104  FSVGEV  109



>ref|XP_010906320.1| PREDICTED: uncharacterized protein LOC105033283 isoform X2 [Elaeis 
guineensis]
Length=648

 Score = 77.0 bits (188),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 52/73 (71%), Gaps = 2/73 (3%)
 Frame = +2

Query  314  KDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQKY  493
            +D  I+W R EFAAANA+ID+L +HL  +  G   EY++V   I +RR +W P+L +Q+Y
Sbjct  39   RDGFISWIRAEFAAANAIIDSLVHHLRTI--GEPGEYDAVVGFIQQRRCSWNPVLHLQQY  96

Query  494  YTIADVALELRKV  532
            +++A+VA  L++V
Sbjct  97   FSVAEVAYALQQV  109



>ref|XP_010906319.1| PREDICTED: uncharacterized protein LOC105033283 isoform X1 [Elaeis 
guineensis]
Length=690

 Score = 77.0 bits (188),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 52/73 (71%), Gaps = 2/73 (3%)
 Frame = +2

Query  314  KDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQKY  493
            +D  I+W R EFAAANA+ID+L +HL  +  G   EY++V   I +RR +W P+L +Q+Y
Sbjct  39   RDGFISWIRAEFAAANAIIDSLVHHLRTI--GEPGEYDAVVGFIQQRRCSWNPVLHLQQY  96

Query  494  YTIADVALELRKV  532
            +++A+VA  L++V
Sbjct  97   FSVAEVAYALQQV  109



>gb|ABF94870.1| hydroxyproline-rich glycoprotein family protein, putative, expressed 
[Oryza sativa Japonica Group]
Length=658

 Score = 76.3 bits (186),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 49/73 (67%), Gaps = 2/73 (3%)
 Frame = +2

Query  314  KDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQKY  493
            +D  I+W RGEFAAANA+ID L  HL  +  G   E+E V AA+ +RR +W P++ MQ++
Sbjct  32   RDGFISWLRGEFAAANAIIDLLLLHLRSV--GEPGEFEHVAAAVQQRRHHWAPVIHMQQF  89

Query  494  YTIADVALELRKV  532
            + + DVA  L++ 
Sbjct  90   FPVGDVAYALQQA  102



>gb|EEC74839.1| hypothetical protein OsI_10686 [Oryza sativa Indica Group]
Length=658

 Score = 76.3 bits (186),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/72 (46%), Positives = 49/72 (68%), Gaps = 2/72 (3%)
 Frame = +2

Query  314  KDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQKY  493
            +D  I+W RGEFAAANA+ID L  HL  +  G   E+E V AA+ +RR +W P++ MQ++
Sbjct  32   RDGFISWLRGEFAAANAIIDLLLLHLRSV--GEPGEFEHVAAAVQQRRHHWAPVIHMQQF  89

Query  494  YTIADVALELRK  529
            + + DVA  L++
Sbjct  90   FPVGDVAYALQQ  101



>ref|XP_007153188.1| hypothetical protein PHAVU_003G014200g [Phaseolus vulgaris]
 gb|ESW25182.1| hypothetical protein PHAVU_003G014200g [Phaseolus vulgaris]
Length=691

 Score = 76.3 bits (186),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 48/73 (66%), Gaps = 2/73 (3%)
 Frame = +2

Query  314  KDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQKY  493
            +D  I W R EFAAANA+ID+LC HL  +  G    Y+ V  AI +RR NW  +L MQ+Y
Sbjct  41   RDGFIGWLRSEFAAANAIIDSLCQHLRVV--GEPGVYDMVVGAIQQRRCNWTQVLLMQQY  98

Query  494  YTIADVALELRKV  532
            +++++V   L++V
Sbjct  99   FSVSEVVYALQQV  111



>gb|EEE58665.1| hypothetical protein OsJ_10079 [Oryza sativa Japonica Group]
Length=626

 Score = 75.9 bits (185),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/72 (46%), Positives = 49/72 (68%), Gaps = 2/72 (3%)
 Frame = +2

Query  314  KDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQKY  493
            +D  I+W RGEFAAANA+ID L  HL  +  G   E+E V AA+ +RR +W P++ MQ++
Sbjct  32   RDGFISWLRGEFAAANAIIDLLLLHLRSV--GEPGEFEHVAAAVQQRRHHWAPVIHMQQF  89

Query  494  YTIADVALELRK  529
            + + DVA  L++
Sbjct  90   FPVGDVAYALQQ  101



>ref|XP_008798368.1| PREDICTED: uncharacterized protein LOC103713273 [Phoenix dactylifera]
Length=709

 Score = 75.9 bits (185),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 46/73 (63%), Gaps = 2/73 (3%)
 Frame = +2

Query  314  KDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQKY  493
            +D  I+W RGEFAAANA+ID L  HL     G   EY+ V   IH+RR  W P+L  Q+Y
Sbjct  40   RDGFISWLRGEFAAANAIIDILIQHLRAT--GEPGEYDHVAGCIHQRRSLWQPVLHFQQY  97

Query  494  YTIADVALELRKV  532
            + +A+V   L++V
Sbjct  98   FPVAEVMFALQQV  110



>ref|NP_001049502.1| Os03g0238800 [Oryza sativa Japonica Group]
 dbj|BAF11416.1| Os03g0238800, partial [Oryza sativa Japonica Group]
Length=563

 Score = 75.5 bits (184),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 33/72 (46%), Positives = 49/72 (68%), Gaps = 2/72 (3%)
 Frame = +2

Query  314  KDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQKY  493
            +D  I+W RGEFAAANA+ID L  HL  +  G   E+E V AA+ +RR +W P++ MQ++
Sbjct  32   RDGFISWLRGEFAAANAIIDLLLLHLRSV--GEPGEFEHVAAAVQQRRHHWAPVIHMQQF  89

Query  494  YTIADVALELRK  529
            + + DVA  L++
Sbjct  90   FPVGDVAYALQQ  101



>ref|XP_010939980.1| PREDICTED: uncharacterized protein LOC105058678 [Elaeis guineensis]
Length=707

 Score = 75.9 bits (185),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 48/73 (66%), Gaps = 2/73 (3%)
 Frame = +2

Query  314  KDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQKY  493
            +D  I+W RGEFAAANA+ID + +HL  +  G   EY+ V   IH+RR  W P+L  Q+Y
Sbjct  37   RDGFISWLRGEFAAANAIIDLMIHHLRAI--GEPGEYDHVAGCIHQRRSLWQPVLHFQQY  94

Query  494  YTIADVALELRKV  532
            + +A+V   L++V
Sbjct  95   FPVAEVMFALQQV  107



>ref|XP_010936866.1| PREDICTED: uncharacterized protein LOC105056388 isoform X1 [Elaeis 
guineensis]
 ref|XP_010936867.1| PREDICTED: uncharacterized protein LOC105056388 isoform X1 [Elaeis 
guineensis]
Length=708

 Score = 75.1 bits (183),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 46/73 (63%), Gaps = 2/73 (3%)
 Frame = +2

Query  314  KDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQKY  493
            +D  I+W RGEFAAAN++ID L  HL     G   EY+ V   IH+RR  W P+L  Q+Y
Sbjct  40   RDGFISWLRGEFAAANSIIDLLIQHLRAT--GEPGEYDHVVGCIHQRRSLWQPVLHFQQY  97

Query  494  YTIADVALELRKV  532
            + +A+V   L++V
Sbjct  98   FPVAEVMFALQQV  110



>ref|XP_010936869.1| PREDICTED: uncharacterized protein LOC105056388 isoform X2 [Elaeis 
guineensis]
Length=696

 Score = 75.1 bits (183),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 46/73 (63%), Gaps = 2/73 (3%)
 Frame = +2

Query  314  KDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQKY  493
            +D  I+W RGEFAAAN++ID L  HL     G   EY+ V   IH+RR  W P+L  Q+Y
Sbjct  40   RDGFISWLRGEFAAANSIIDLLIQHLRAT--GEPGEYDHVVGCIHQRRSLWQPVLHFQQY  97

Query  494  YTIADVALELRKV  532
            + +A+V   L++V
Sbjct  98   FPVAEVMFALQQV  110



>ref|XP_008787901.1| PREDICTED: uncharacterized protein LOC103705814 [Phoenix dactylifera]
Length=709

 Score = 75.1 bits (183),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 47/73 (64%), Gaps = 2/73 (3%)
 Frame = +2

Query  314  KDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQKY  493
            +D  I+W RGEFAAAN++ID L  HL  +  G   EY+ V   IH+RR  W P+L  Q+Y
Sbjct  39   RDGFISWLRGEFAAANSIIDLLIQHLRAI--GEPGEYDHVAGCIHQRRSLWQPVLHFQQY  96

Query  494  YTIADVALELRKV  532
            + +A+V   L++V
Sbjct  97   FPVAEVIFALQQV  109



>ref|XP_008789249.1| PREDICTED: uncharacterized protein LOC103706794 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008789250.1| PREDICTED: uncharacterized protein LOC103706794 isoform X1 [Phoenix 
dactylifera]
Length=688

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 51/73 (70%), Gaps = 2/73 (3%)
 Frame = +2

Query  314  KDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQKY  493
            +D  I+W R EF A+NA+ID+L +HL  +  G   EY++V   I +RR +W P+L +Q+Y
Sbjct  39   RDGFISWIRAEFVASNAIIDSLIHHLRVI--GEPGEYDAVVGFIQQRRCSWNPVLHLQQY  96

Query  494  YTIADVALELRKV  532
            +++A+VA  L++V
Sbjct  97   FSVAEVAYSLQQV  109



>ref|XP_008789251.1| PREDICTED: uncharacterized protein LOC103706794 isoform X2 [Phoenix 
dactylifera]
Length=393

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 51/73 (70%), Gaps = 2/73 (3%)
 Frame = +2

Query  314  KDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQKY  493
            +D  I+W R EF A+NA+ID+L +HL  +  G   EY++V   I +RR +W P+L +Q+Y
Sbjct  39   RDGFISWIRAEFVASNAIIDSLIHHLRVI--GEPGEYDAVVGFIQQRRCSWNPVLHLQQY  96

Query  494  YTIADVALELRKV  532
            +++A+VA  L++V
Sbjct  97   FSVAEVAYSLQQV  109



>ref|XP_006662146.1| PREDICTED: uncharacterized protein LOC102714587 [Oryza brachyantha]
Length=550

 Score = 72.4 bits (176),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 47/71 (66%), Gaps = 2/71 (3%)
 Frame = +2

Query  314  KDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQKY  493
            +D  +AW RGEFAAANA+ID L +HL  L   G      V AA+HRRRL W P++ +Q Y
Sbjct  5    RDGFVAWLRGEFAAANAIIDLLLDHLRGL--AGDPAAAPVAAAVHRRRLQWPPVIHLQYY  62

Query  494  YTIADVALELR  526
            + + +VAL L+
Sbjct  63   FPVNEVALALQ  73



>ref|NP_001145739.1| uncharacterized protein LOC100279246 [Zea mays]
 gb|ACL52493.1| unknown [Zea mays]
 tpg|DAA44310.1| TPA: hypothetical protein ZEAMMB73_610940 [Zea mays]
Length=653

 Score = 71.6 bits (174),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 29/73 (40%), Positives = 48/73 (66%), Gaps = 2/73 (3%)
 Frame = +2

Query  314  KDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQKY  493
            +D  I W RGEFAAANA++D L  HL  +   G  EY+ VF+ + +RR +W  ++ MQ++
Sbjct  28   RDGFITWLRGEFAAANAIVDHLIFHLRSISEPG--EYDHVFSLVQQRRHHWPHVIHMQQF  85

Query  494  YTIADVALELRKV  532
            + ++D+A  L++ 
Sbjct  86   FPVSDIAFALQQA  98



>gb|AGT17402.1| hypothetical protein SHCRBa_230_N09_F_20 [Saccharum hybrid cultivar 
R570]
Length=628

 Score = 71.2 bits (173),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 29/71 (41%), Positives = 46/71 (65%), Gaps = 2/71 (3%)
 Frame = +2

Query  314  KDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQKY  493
            +D  I W RGEFAAANA++D L  HL  +  G   EY+ VF+ + +RR +W  ++ MQ++
Sbjct  32   RDGFITWLRGEFAAANAIVDLLILHLRSI--GEPGEYDHVFSVVQQRRHHWTHVIHMQQF  89

Query  494  YTIADVALELR  526
            + + D+A  L+
Sbjct  90   FPVNDIAFALQ  100



>ref|XP_006649704.1| PREDICTED: uncharacterized protein LOC102720214 [Oryza brachyantha]
Length=637

 Score = 71.2 bits (173),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 46/72 (64%), Gaps = 2/72 (3%)
 Frame = +2

Query  314  KDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQKY  493
            +D  I+W RGEFAAANA+ID L  HL  +  G   E++ V AA+ +RRL W P++ MQ++
Sbjct  28   RDGFISWLRGEFAAANAIIDLLVVHLRAV--GEPGEFDHVAAAVQQRRLQWAPVIHMQQF  85

Query  494  YTIADVALELRK  529
            Y +      L++
Sbjct  86   YPVXXXPSALQQ  97



>ref|XP_002468197.1| hypothetical protein SORBIDRAFT_01g041520 [Sorghum bicolor]
 gb|EER95195.1| hypothetical protein SORBIDRAFT_01g041520 [Sorghum bicolor]
Length=631

 Score = 71.2 bits (173),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/71 (41%), Positives = 46/71 (65%), Gaps = 2/71 (3%)
 Frame = +2

Query  314  KDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQKY  493
            +D  I W RGEFAAANA++D L  HL  +  G   EY+ VF+ + +RR +W  ++ MQ++
Sbjct  35   RDGFITWLRGEFAAANAIVDLLILHLRAI--GEPGEYDHVFSVVQQRRHHWTHVIHMQQF  92

Query  494  YTIADVALELR  526
            + + D+A  L+
Sbjct  93   FPVNDIAFALQ  103



>ref|NP_001064055.1| Os10g0116900 [Oryza sativa Japonica Group]
 gb|AAL34938.1|AC079037_11 Unknown protein [Oryza sativa]
 gb|ABB46634.2| hydroxyproline-rich glycoprotein family protein, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF25969.1| Os10g0116900 [Oryza sativa Japonica Group]
 gb|EAZ15124.1| hypothetical protein OsJ_30537 [Oryza sativa Japonica Group]
 dbj|BAH00288.1| unnamed protein product [Oryza sativa Japonica Group]
Length=595

 Score = 68.9 bits (167),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 43/67 (64%), Gaps = 2/67 (3%)
 Frame = +2

Query  311  AKDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQK  490
             +D ++AW RGEFAAANA+ID L  H        G  +++V AA+ RRR +W P+L +Q 
Sbjct  29   GRDGLVAWLRGEFAAANAIIDLLLAHARDAADPAG--FDAVAAAVQRRRHHWAPVLHLQH  86

Query  491  YYTIADV  511
            Y+ + +V
Sbjct  87   YFPVTEV  93



>gb|EAY77528.1| hypothetical protein OsI_32569 [Oryza sativa Indica Group]
Length=595

 Score = 68.9 bits (167),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 43/67 (64%), Gaps = 2/67 (3%)
 Frame = +2

Query  311  AKDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQK  490
             +D ++AW RGEFAAANA+ID L  H        G  +++V AA+ RRR +W P+L +Q 
Sbjct  29   GRDGLVAWLRGEFAAANAIIDLLLAHARDAADPAG--FDAVAAAVQRRRHHWAPVLHLQH  86

Query  491  YYTIADV  511
            Y+ + +V
Sbjct  87   YFPVTEV  93



>gb|AAP51882.2| hydroxyproline-rich glycoprotein family protein, putative, expressed 
[Oryza sativa Japonica Group]
Length=596

 Score = 68.9 bits (167),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 43/67 (64%), Gaps = 2/67 (3%)
 Frame = +2

Query  311  AKDAVIAWFRGEFAAANAVIDALCNHLTQLEGGGGSEYESVFAAIHRRRLNWIPILQMQK  490
             +D ++AW RGEFAAANA+ID L  H        G  +++V AA+ RRR +W P+L +Q 
Sbjct  29   GRDGLVAWLRGEFAAANAIIDLLLAHARDAADPAG--FDAVAAAVQRRRHHWAPVLHLQH  86

Query  491  YYTIADV  511
            Y+ + +V
Sbjct  87   YFPVTEV  93



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1507754616730