BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMSF044I06

Length=800
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDN40869.1|  chromomethylase                                        170   5e-45   Nicotiana sylvestris
emb|CDN40870.1|  chromomethylase                                        170   4e-44   Nicotiana sylvestris
ref|XP_009590684.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    168   2e-43   Nicotiana tomentosiformis
ref|NP_001289523.1|  DNA (cytosine-5)-methyltransferase CMT3-like       167   6e-43   Nicotiana sylvestris
gb|AGH70220.1|  chromomethylase 3                                       165   2e-42   Nicotiana benthamiana
ref|XP_004252840.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    164   4e-42   
ref|XP_009625627.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    159   2e-40   Nicotiana tomentosiformis
ref|XP_009625628.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    159   3e-40   
ref|XP_006572936.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    157   9e-40   Glycine max [soybeans]
ref|XP_007014769.1|  Chromomethylase 1, putative isoform 4              156   2e-39   
ref|XP_009781267.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    156   3e-39   Nicotiana sylvestris
ref|XP_009781265.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    156   3e-39   Nicotiana sylvestris
ref|XP_009781266.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    156   3e-39   Nicotiana sylvestris
ref|XP_007014771.1|  Chromomethylase 1, putative isoform 6              155   3e-39   
ref|XP_009781264.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    156   3e-39   Nicotiana sylvestris
ref|XP_007014770.1|  Chromomethylase 1, putative isoform 5              155   3e-39   
ref|XP_007014768.1|  Chromomethylase 1, putative isoform 3              155   5e-39   
ref|XP_007014766.1|  Chromomethylase 1, putative isoform 1              155   5e-39   
ref|XP_007152975.1|  hypothetical protein PHAVU_004G176100g             155   5e-39   Phaseolus vulgaris [French bean]
ref|XP_004513046.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    154   9e-39   Cicer arietinum [garbanzo]
emb|CDP13153.1|  unnamed protein product                                154   2e-38   Coffea canephora [robusta coffee]
gb|KJB07908.1|  hypothetical protein B456_001G052000                    154   2e-38   Gossypium raimondii
ref|XP_006354167.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    153   3e-38   Solanum tuberosum [potatoes]
ref|XP_004228597.2|  PREDICTED: DNA (cytosine-5)-methyltransferas...    152   5e-38   Solanum lycopersicum
ref|XP_010043881.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    152   9e-38   Eucalyptus grandis [rose gum]
ref|XP_004513047.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    151   1e-37   Cicer arietinum [garbanzo]
gb|AEC12443.1|  chromomethylase 3                                       150   2e-37   Gossypium hirsutum [American cotton]
ref|XP_011089105.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    144   6e-35   Sesamum indicum [beniseed]
ref|XP_003636958.1|  DNA (cytosine-5)-methyltransferase                 137   1e-32   
gb|KDO62937.1|  hypothetical protein CISIN_1g047980mg                   135   3e-32   Citrus sinensis [apfelsine]
ref|XP_008451103.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    135   4e-32   Cucumis melo [Oriental melon]
ref|XP_006445885.1|  hypothetical protein CICLE_v10014232mg             135   4e-32   Citrus clementina [clementine]
ref|NP_001275877.1|  DNA (cytosine-5)-methyltransferase CMT3-like       135   6e-32   Citrus sinensis [apfelsine]
gb|KDO40233.1|  hypothetical protein CISIN_1g013949mg                   130   2e-31   Citrus sinensis [apfelsine]
ref|XP_008226363.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    133   4e-31   Prunus mume [ume]
ref|XP_009376742.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    132   5e-31   
gb|KJB16169.1|  hypothetical protein B456_002G216500                    131   7e-31   Gossypium raimondii
gb|KJB16170.1|  hypothetical protein B456_002G216500                    131   8e-31   Gossypium raimondii
gb|KJB16175.1|  hypothetical protein B456_002G216500                    131   8e-31   Gossypium raimondii
gb|AFV99137.1|  CMT-type cytosine DNA-methyltransferase 3c              132   8e-31   Malus domestica [apple tree]
gb|KJB16172.1|  hypothetical protein B456_002G216500                    131   9e-31   Gossypium raimondii
gb|KEH27204.1|  DNA (cytosine-5)-methyltransferase CMT3-like protein    132   9e-31   Medicago truncatula
gb|KEH27061.1|  DNA (cytosine-5)-methyltransferase CMT3-like protein    131   9e-31   Medicago truncatula
ref|XP_008390169.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    132   9e-31   
gb|KJB16171.1|  hypothetical protein B456_002G216500                    131   1e-30   Gossypium raimondii
gb|KJB16174.1|  hypothetical protein B456_002G216500                    131   1e-30   Gossypium raimondii
gb|KJB16168.1|  hypothetical protein B456_002G216500                    131   1e-30   Gossypium raimondii
gb|KJB16173.1|  hypothetical protein B456_002G216500                    131   1e-30   Gossypium raimondii
ref|XP_009390332.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    130   2e-30   Musa acuminata subsp. malaccensis [pisang utan]
gb|KEH27609.1|  DNA (cytosine-5)-methyltransferase CMT3-like protein    130   2e-30   Medicago truncatula
ref|XP_009390334.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    130   2e-30   
ref|XP_009364100.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    131   2e-30   Pyrus x bretschneideri [bai li]
ref|XP_009390335.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    130   2e-30   
ref|XP_003612312.1|  DNA (cytosine-5)-methyltransferase                 130   2e-30   Medicago truncatula
ref|XP_010541913.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    130   3e-30   Tarenaya hassleriana [spider flower]
ref|XP_002530367.1|  protein with unknown function                      129   5e-30   Ricinus communis
ref|NP_001280801.1|  DNA (cytosine-5)-methyltransferase CMT3            130   6e-30   Malus domestica [apple tree]
ref|XP_011462220.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    129   1e-29   Fragaria vesca subsp. vesca
ref|XP_010091206.1|  DNA (cytosine-5)-methyltransferase 1               129   1e-29   Morus notabilis
ref|XP_006573534.1|  PREDICTED: putative DNA (cytosine-5)-methylt...    128   1e-29   Glycine max [soybeans]
ref|XP_004288717.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    129   1e-29   Fragaria vesca subsp. vesca
ref|XP_006470820.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    127   2e-29   
gb|KHN40382.1|  DNA (cytosine-5)-methyltransferase 1                    127   2e-29   Glycine soja [wild soybean]
ref|XP_006431407.1|  hypothetical protein CICLE_v10000251mg             127   3e-29   Citrus clementina [clementine]
ref|XP_007041239.1|  Chromomethylase 1, putative                        127   3e-29   
dbj|BAC53936.1|  chromomethylase-like protein                           127   3e-29   Nicotiana tabacum [American tobacco]
gb|AFK80345.1|  chromomethylase 3                                       127   4e-29   Nicotiana benthamiana
ref|XP_004149031.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    127   4e-29   Cucumis sativus [cucumbers]
ref|XP_010936992.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    127   4e-29   Elaeis guineensis
gb|KDP34481.1|  hypothetical protein JCGZ_12764                         127   4e-29   Jatropha curcas
gb|KHN41840.1|  DNA (cytosine-5)-methyltransferase 1                    126   6e-29   Glycine soja [wild soybean]
gb|KDO42578.1|  hypothetical protein CISIN_1g0039742mg                  123   7e-29   Citrus sinensis [apfelsine]
ref|XP_006590741.1|  PREDICTED: putative DNA (cytosine-5)-methylt...    126   8e-29   Glycine max [soybeans]
gb|ABW96889.1|  CMT-type DNA-methyltransferase                          126   9e-29   Elaeis guineensis
gb|AIO05713.1|  CMT-type DNA-methyltransferase                          124   9e-29   Cocos nucifera
ref|XP_002299134.2|  hypothetical protein POPTR_0001s04700g             125   1e-28   
ref|XP_004512254.1|  PREDICTED: putative DNA (cytosine-5)-methylt...    125   1e-28   
ref|XP_011037978.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    125   2e-28   Populus euphratica
ref|XP_011037979.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    125   3e-28   Populus euphratica
emb|CAQ18903.1|  chromomethylase                                        124   4e-28   Nicotiana sylvestris
ref|XP_008797880.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    124   4e-28   Phoenix dactylifera
gb|AIU80190.1|  chromomethylase                                         124   5e-28   Hevea brasiliensis [jebe]
gb|KEH28933.1|  DNA (cytosine-5)-methyltransferase CMT1                 123   7e-28   Medicago truncatula
emb|CBI16477.3|  unnamed protein product                                123   8e-28   Vitis vinifera
ref|XP_007157973.1|  hypothetical protein PHAVU_002G113900g             122   1e-27   Phaseolus vulgaris [French bean]
emb|CBI29991.3|  unnamed protein product                                122   1e-27   Vitis vinifera
ref|XP_010316153.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    122   1e-27   
ref|XP_002275932.1|  PREDICTED: putative DNA (cytosine-5)-methylt...    122   2e-27   Vitis vinifera
gb|AEP33250.1|  CMT-type DNA-methyltransferase                          122   2e-27   Posidonia oceanica
ref|XP_010651344.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    122   3e-27   Vitis vinifera
gb|AAK71870.1|  chromomethylase 3                                       121   3e-27   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002888734.1|  chromomethylase CMT3                               121   4e-27   Arabidopsis lyrata subsp. lyrata
ref|XP_011459545.1|  PREDICTED: LOW QUALITY PROTEIN: DNA (cytosin...    120   1e-26   Fragaria vesca subsp. vesca
ref|NP_177135.1|  DNA (cytosine-5)-methyltransferase CMT3               119   2e-26   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008790945.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    119   3e-26   Phoenix dactylifera
ref|XP_010243148.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    118   5e-26   Nelumbo nucifera [Indian lotus]
gb|KEH25929.1|  DNA (cytosine-5)-methyltransferase CMT1                 117   5e-26   Medicago truncatula
gb|AAK69756.1|AF383170_1  chromomethylase CMT3                          117   8e-26   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010415637.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    117   9e-26   Camelina sativa [gold-of-pleasure]
ref|XP_010415636.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    117   9e-26   Camelina sativa [gold-of-pleasure]
ref|XP_010470978.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    117   9e-26   Camelina sativa [gold-of-pleasure]
ref|XP_010470977.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    117   9e-26   Camelina sativa [gold-of-pleasure]
dbj|BAF01425.1|  putative chromomethylase                               117   1e-25   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010908353.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    117   2e-25   Elaeis guineensis
ref|XP_010666617.1|  PREDICTED: putative DNA (cytosine-5)-methylt...    116   2e-25   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004170052.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    115   3e-25   
ref|XP_010533849.1|  PREDICTED: putative DNA (cytosine-5)-methylt...    115   4e-25   Tarenaya hassleriana [spider flower]
ref|XP_009148471.1|  PREDICTED: putative DNA (cytosine-5)-methylt...    115   5e-25   
emb|CDY19364.1|  BnaC05g08730D                                          115   5e-25   Brassica napus [oilseed rape]
gb|EMT24338.1|  DNA (cytosine-5)-methyltransferase 1                    115   5e-25   
emb|CDX97957.1|  BnaA06g07080D                                          114   5e-25   
ref|XP_002304879.1|  chromomethylase 3 family protein                   110   2e-24   
ref|XP_010673524.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    113   3e-24   Beta vulgaris subsp. vulgaris [field beet]
gb|AAL75761.1|  Putative DNA cytosine methyltransferase MET2a           112   4e-24   Oryza sativa Japonica Group [Japonica rice]
dbj|BAH37019.1|  chromomethylase OsMET2a                                112   5e-24   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010243382.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    112   6e-24   Nelumbo nucifera [Indian lotus]
gb|EEC70797.1|  hypothetical protein OsI_02246                          112   6e-24   Oryza sativa Indica Group [Indian rice]
gb|EEE50451.1|  hypothetical protein OsJ_30466                          111   8e-24   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011025397.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    109   1e-23   Populus euphratica
ref|XP_006854149.1|  hypothetical protein AMTR_s00048p00181490          111   1e-23   
ref|XP_006849583.1|  hypothetical protein AMTR_s00024p00193220          110   2e-23   
ref|XP_011075807.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    110   3e-23   Sesamum indicum [beniseed]
gb|EEE58631.1|  hypothetical protein OsJ_09996                          110   3e-23   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011075808.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    110   3e-23   Sesamum indicum [beniseed]
ref|XP_010243384.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    109   4e-23   Nelumbo nucifera [Indian lotus]
gb|EEC74798.1|  hypothetical protein OsI_10599                          110   4e-23   Oryza sativa Indica Group [Indian rice]
gb|EMT30784.1|  DNA (cytosine-5)-methyltransferase 1                    109   4e-23   
gb|AAN60988.1|  Putative DNA cytosine methyltransferase MET2a           110   5e-23   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006417360.1|  hypothetical protein EUTSA_v10006850mg             108   8e-23   Eutrema salsugineum [saltwater cress]
gb|AFW59438.1|  DNA (cytosine-5)-methyltransferase 1                    108   1e-22   
ref|NP_001104978.1|  DNA (cytosine-5)-methyltransferase 1               108   1e-22   Zea mays [maize]
tpg|DAA36033.1|  TPA: hypothetical protein ZEAMMB73_314017              107   1e-22   
sp|Q8LPU5.1|CMT3_MAIZE  RecName: Full=DNA (cytosine-5)-methyltran...    108   1e-22   Zea mays [maize]
ref|XP_006300613.1|  hypothetical protein CARUB_v10019805mg             107   1e-22   
ref|XP_006300392.1|  hypothetical protein CARUB_v10019778mg             107   2e-22   
ref|XP_007208072.1|  hypothetical protein PRUPE_ppa001672mg             107   2e-22   
ref|XP_004987095.1|  PREDICTED: LOW QUALITY PROTEIN: DNA (cytosin...    107   2e-22   
gb|KFK28331.1|  chromomethylase                                         107   3e-22   Arabis alpina [alpine rockcress]
ref|XP_002454088.1|  hypothetical protein SORBIDRAFT_04g024430          107   3e-22   
ref|NP_001105167.1|  DNA (cytosine-5)-methyltransferase 3               107   3e-22   
ref|XP_006390678.1|  hypothetical protein EUTSA_v10018159mg             106   3e-22   
pdb|4FT2|A  Chain A, Crystal Structure Of Zea Mays Zmet2 In Compl...    106   4e-22   synthetic construct
pdb|4FSX|A  Chain A, Crystal Structure Of Se-Substituted Zea Mays...    106   5e-22   Zea mays [maize]
ref|XP_010429914.1|  PREDICTED: putative DNA (cytosine-5)-methylt...    105   7e-22   Camelina sativa [gold-of-pleasure]
ref|XP_010429915.1|  PREDICTED: putative DNA (cytosine-5)-methylt...    105   7e-22   Camelina sativa [gold-of-pleasure]
gb|EMT28418.1|  DNA (cytosine-5)-methyltransferase 1                    106   8e-22   
ref|XP_002448525.1|  hypothetical protein SORBIDRAFT_06g028430          105   9e-22   Sorghum bicolor [broomcorn]
ref|XP_010662140.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    104   2e-21   
ref|XP_010662142.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    104   2e-21   Vitis vinifera
ref|XP_010662139.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    104   2e-21   Vitis vinifera
gb|EMS55851.1|  DNA (cytosine-5)-methyltransferase CMT2                 104   2e-21   Triticum urartu
gb|KDP44326.1|  hypothetical protein JCGZ_19193                         103   2e-21   Jatropha curcas
emb|CDY08836.1|  BnaA06g23880D                                          103   3e-21   Brassica napus [oilseed rape]
gb|EYU39242.1|  hypothetical protein MIMGU_mgv1a001319mg                103   3e-21   Erythranthe guttata [common monkey flower]
gb|EYU22416.1|  hypothetical protein MIMGU_mgv1a001955mg                103   5e-21   Erythranthe guttata [common monkey flower]
ref|XP_006361281.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    103   6e-21   Solanum tuberosum [potatoes]
ref|XP_010324482.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    102   1e-20   Solanum lycopersicum
ref|XP_010236739.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    102   1e-20   Brachypodium distachyon [annual false brome]
ref|XP_010234610.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    102   1e-20   Brachypodium distachyon [annual false brome]
dbj|BAF34637.1|  chromomethylase                                        101   2e-20   Brassica rapa
ref|XP_010230204.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    101   2e-20   Brachypodium distachyon [annual false brome]
emb|CDY14524.1|  BnaC03g49350D                                          101   2e-20   Brassica napus [oilseed rape]
ref|XP_007156278.1|  hypothetical protein PHAVU_003G273100g             101   2e-20   Phaseolus vulgaris [French bean]
gb|KHN10109.1|  DNA (cytosine-5)-methyltransferase CMT2                 101   3e-20   Glycine soja [wild soybean]
ref|XP_006599215.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    101   3e-20   Glycine max [soybeans]
gb|KFK30827.1|  hypothetical protein AALP_AA6G031000                    100   3e-20   Arabis alpina [alpine rockcress]
ref|XP_008448610.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    101   3e-20   Cucumis melo [Oriental melon]
ref|XP_006599216.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    100   3e-20   
gb|EPS61234.1|  chromomethylase-like protein                          92.0    4e-20   Genlisea aurea
ref|XP_009150572.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    100   4e-20   Brassica rapa
ref|XP_002439474.1|  hypothetical protein SORBIDRAFT_09g007390          101   4e-20   
ref|XP_008448611.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    100   5e-20   Cucumis melo [Oriental melon]
ref|XP_002889276.1|  hypothetical protein ARALYDRAFT_895912             100   5e-20   
ref|XP_007040779.1|  DNA-methyltransferase CMT2                         100   6e-20   
ref|XP_004983483.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...    100   6e-20   Setaria italica
gb|EYU45367.1|  hypothetical protein MIMGU_mgv1a020188mg                100   7e-20   Erythranthe guttata [common monkey flower]
ref|XP_003615342.1|  DNA (cytosine-5)-methyltransferase               99.8    7e-20   
emb|CBI26560.3|  unnamed protein product                              99.0    1e-19   Vitis vinifera
ref|XP_011465071.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  99.4    1e-19   Fragaria vesca subsp. vesca
ref|XP_004509555.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  99.4    1e-19   Cicer arietinum [garbanzo]
ref|XP_011465070.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  99.4    1e-19   Fragaria vesca subsp. vesca
ref|XP_011465072.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  99.0    2e-19   Fragaria vesca subsp. vesca
ref|XP_009392768.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  98.6    2e-19   
ref|XP_009392766.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  98.6    2e-19   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAC02661.1|  chromomethylase                                       94.4    2e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010677406.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  98.2    3e-19   Beta vulgaris subsp. vulgaris [field beet]
gb|AAB95486.1|  chromomethylase                                       97.1    5e-19   Arabidopsis arenosa
ref|XP_008373679.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  97.1    5e-19   
ref|XP_009373520.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  97.4    6e-19   
ref|XP_010449422.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  97.4    7e-19   Camelina sativa [gold-of-pleasure]
gb|KGN55702.1|  hypothetical protein Csa_3G006640                     96.7    1e-18   Cucumis sativus [cucumbers]
ref|XP_011028082.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  96.7    1e-18   Populus euphratica
ref|XP_004146191.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  96.7    1e-18   
ref|XP_011028081.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  96.3    1e-18   Populus euphratica
ref|XP_011028080.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  96.3    1e-18   Populus euphratica
gb|AAC02670.1|  chromomethylase                                       95.1    3e-18   Arabidopsis suecica
gb|AAC02662.1|  chromomethylase                                       94.7    3e-18   Arabidopsis thaliana [mouse-ear cress]
gb|AAC02665.1|  chromomethylase                                       94.4    3e-18   Arabidopsis thaliana [mouse-ear cress]
gb|AAC02667.1|  chromomethylase                                       94.4    3e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010665041.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  95.5    3e-18   Vitis vinifera
ref|NP_565245.1|  chromomethylase 1                                   94.7    3e-18   Arabidopsis thaliana [mouse-ear cress]
gb|AAB95485.1|  chromomethylase                                       94.7    3e-18   Arabidopsis thaliana [mouse-ear cress]
gb|AAC02663.1|  chromomethylase                                       94.7    3e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006414021.1|  hypothetical protein EUTSA_v10024250mg           95.1    3e-18   
ref|XP_010665031.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  95.1    3e-18   Vitis vinifera
ref|XP_010665035.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  95.1    3e-18   Vitis vinifera
ref|XP_011092593.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  94.7    5e-18   Sesamum indicum [beniseed]
ref|XP_010110416.1|  DNA (cytosine-5)-methyltransferase CMT2          94.0    1e-17   
ref|NP_193637.2|  chromomethylase 2                                   93.2    1e-17   Arabidopsis thaliana [mouse-ear cress]
gb|KJB25192.1|  hypothetical protein B456_004G180300                  93.2    1e-17   Gossypium raimondii
ref|XP_006282433.1|  hypothetical protein CARUB_v10003999mg           93.2    2e-17   
gb|KJB25190.1|  hypothetical protein B456_004G180300                  92.8    2e-17   Gossypium raimondii
gb|KJB25191.1|  hypothetical protein B456_004G180300                  92.8    2e-17   Gossypium raimondii
ref|XP_009625195.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  92.4    2e-17   Nicotiana tomentosiformis
ref|XP_010671153.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  92.0    3e-17   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006471441.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  92.0    3e-17   
ref|XP_006385690.1|  hypothetical protein POPTR_0003s09920g           91.7    4e-17   
ref|XP_006655109.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  91.7    5e-17   Oryza brachyantha
dbj|BAH37021.1|  chromomethylase OsMET2c                              89.7    1e-16   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010518849.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  89.4    2e-16   Tarenaya hassleriana [spider flower]
ref|XP_010054090.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  89.4    2e-16   Eucalyptus grandis [rose gum]
gb|KEH20304.1|  DNA (cytosine-5)-methyltransferase                    89.0    3e-16   Medicago truncatula
ref|XP_010518848.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  88.6    4e-16   Tarenaya hassleriana [spider flower]
ref|XP_004960650.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  88.6    4e-16   Setaria italica
ref|XP_004960649.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  88.6    4e-16   Setaria italica
ref|XP_010518846.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  88.6    5e-16   Tarenaya hassleriana [spider flower]
ref|XP_002870005.1|  chromomethylase 2                                88.2    6e-16   Arabidopsis lyrata subsp. lyrata
gb|EMS51591.1|  DNA (cytosine-5)-methyltransferase 1                  87.0    1e-15   Triticum urartu
gb|EPS61564.1|  hypothetical protein M569_13232                       84.3    2e-15   Genlisea aurea
ref|XP_009785637.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  84.3    7e-15   Nicotiana sylvestris
ref|NP_001280869.1|  DNA (cytosine-5)-methyltransferase CMT3-like     81.6    2e-14   Malus domestica [apple tree]
emb|CDP11756.1|  unnamed protein product                              82.4    3e-14   Coffea canephora [robusta coffee]
emb|CDX99400.1|  BnaC01g11520D                                        82.0    5e-14   
ref|XP_006662134.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  81.3    7e-14   
ref|XP_009132470.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  80.1    2e-13   Brassica rapa
emb|CDX78915.1|  BnaA01g09820D                                        80.1    2e-13   
ref|XP_009132479.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  80.1    2e-13   Brassica rapa
gb|AGT16212.1|  methyltransferase                                     79.7    2e-13   Saccharum hybrid cultivar R570
ref|XP_002886525.1|  predicted protein                                78.2    7e-13   
ref|XP_006599217.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  77.0    2e-12   
ref|XP_008238301.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  76.3    3e-12   
ref|XP_009364160.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  71.2    4e-12   
emb|CAJ01708.1|  chromomethylase 1                                    75.9    4e-12   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KDO58824.1|  hypothetical protein CISIN_1g046469mg                 75.5    5e-12   Citrus sinensis [apfelsine]
ref|XP_007210636.1|  hypothetical protein PRUPE_ppa019831mg           75.5    6e-12   
gb|AHB20163.1|  DNA methyltransferase                                 74.7    1e-11   Populus x canadensis [Canadian poplar]
ref|XP_010677408.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  74.3    1e-11   
ref|XP_011465073.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  73.6    2e-11   Fragaria vesca subsp. vesca
ref|XP_010677407.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  73.2    3e-11   Beta vulgaris subsp. vulgaris [field beet]
gb|EEE62800.1|  hypothetical protein OsJ_17603                        72.4    6e-11   Oryza sativa Japonica Group [Japonica rice]
gb|EEC78738.1|  hypothetical protein OsI_18945                        72.4    6e-11   Oryza sativa Indica Group [Indian rice]
gb|AHB20162.1|  DNA methyltransferase                                 70.5    2e-10   Populus x canadensis [Canadian poplar]
ref|XP_009343271.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  66.6    3e-10   Pyrus x bretschneideri [bai li]
ref|XP_007014767.1|  Chromomethylase 3, putative isoform 2            69.7    4e-10   
dbj|BAH37020.1|  chromomethylase OsMET2b                              69.7    4e-10   Oryza sativa Japonica Group [Japonica rice]
gb|EMS53431.1|  DNA (cytosine-5)-methyltransferase 1                  68.9    8e-10   Triticum urartu
gb|KJB25184.1|  hypothetical protein B456_004G180200                  68.2    2e-09   Gossypium raimondii
gb|EMS48088.1|  DNA (cytosine-5)-methyltransferase 1                  67.4    2e-09   Triticum urartu
emb|CAQ18902.1|  chromomethylase                                      62.0    3e-09   Nicotiana sylvestris
ref|XP_002990857.1|  hypothetical protein SELMODRAFT_132507           64.3    3e-08   
ref|XP_010257802.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  60.8    4e-08   Nelumbo nucifera [Indian lotus]
ref|XP_002974335.1|  hypothetical protein SELMODRAFT_30570            63.2    6e-08   
ref|XP_008349441.1|  PREDICTED: neurofilament heavy polypeptide-like  62.0    9e-08   
ref|XP_004506519.1|  PREDICTED: DNA (cytosine-5)-methyltransferas...  59.7    3e-07   
ref|XP_003628607.1|  Cytosine-specific methyltransferase              57.8    5e-07   
ref|XP_002519960.1|  protein with unknown function                    60.1    6e-07   
ref|XP_001769709.1|  predicted protein                                59.7    9e-07   
ref|XP_003599650.1|  Cytosine-specific methyltransferase              56.6    1e-06   
gb|AET03084.2|  DNA (cytosine-5)-methyltransferase CMT3               58.5    1e-06   Medicago truncatula
ref|XP_003609231.1|  Cytosine-specific methyltransferase              56.6    1e-05   
gb|EMT16647.1|  DNA (cytosine-5)-methyltransferase 2                  54.7    4e-05   
emb|CBI37413.3|  unnamed protein product                              54.3    6e-05   Vitis vinifera



>emb|CDN40869.1| chromomethylase, partial [Nicotiana sylvestris]
Length=597

 Score =   170 bits (431),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 88/155 (57%), Positives = 109/155 (70%), Gaps = 4/155 (3%)
 Frame = +3

Query  339  DDVAGGNLVRSQA-SPPERKRITTNVTNDEDSEFVGGPVLEEEAKQRWPHRYQKGTEKSN  515
            D+   G L +S A SP +RK   +    DE+    G PV + EA+QRWPHRY KG  K+N
Sbjct  107  DETEHGTLKKSLAVSPSKRKPKRSEKVKDEECVLSGEPVPDAEARQRWPHRYNKG--KAN  164

Query  516  GVTRSITSQDEFAGVLQAKRHFTAAKVDGLFYKLGDDAYVKAGEGEDNYICRIIEMFEAV  695
            G T+S+  QD+    LQAK HFT A VDG  Y L DDA+VKA +GE++YIC+I+E FEAV
Sbjct  165  G-TKSLNGQDDADQQLQAKCHFTQASVDGQIYYLEDDAHVKAADGEEDYICKIVEFFEAV  223

Query  696  DGALYFTAQWYYRAKDTVIKGCDEFVDKQRVFFSE  800
            DG  YFTAQW+YRAKDTVIK  D+F+DK+RVF SE
Sbjct  224  DGMQYFTAQWFYRAKDTVIKSHDQFIDKKRVFLSE  258



>emb|CDN40870.1| chromomethylase [Nicotiana sylvestris]
Length=901

 Score =   170 bits (430),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 88/155 (57%), Positives = 109/155 (70%), Gaps = 4/155 (3%)
 Frame = +3

Query  339  DDVAGGNLVRSQA-SPPERKRITTNVTNDEDSEFVGGPVLEEEAKQRWPHRYQKGTEKSN  515
            D+   G L +S A SP +RK   +    DE+    G PV + EA+QRWPHRY KG  K+N
Sbjct  107  DETEHGTLKKSLAVSPSKRKPKRSEKVKDEECVLSGEPVPDAEARQRWPHRYNKG--KAN  164

Query  516  GVTRSITSQDEFAGVLQAKRHFTAAKVDGLFYKLGDDAYVKAGEGEDNYICRIIEMFEAV  695
            G T+S+  QD+    LQAK HFT A VDG  Y L DDA+VKA +GE++YIC+I+E FEAV
Sbjct  165  G-TKSLNGQDDADQQLQAKCHFTQASVDGQIYYLEDDAHVKAADGEEDYICKIVEFFEAV  223

Query  696  DGALYFTAQWYYRAKDTVIKGCDEFVDKQRVFFSE  800
            DG  YFTAQW+YRAKDTVIK  D+F+DK+RVF SE
Sbjct  224  DGMQYFTAQWFYRAKDTVIKSHDQFIDKKRVFLSE  258



>ref|XP_009590684.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT3-like [Nicotiana 
tomentosiformis]
Length=903

 Score =   168 bits (425),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 87/155 (56%), Positives = 108/155 (70%), Gaps = 4/155 (3%)
 Frame = +3

Query  339  DDVAGGNLVRS-QASPPERKRITTNVTNDEDSEFVGGPVLEEEAKQRWPHRYQKGTEKSN  515
            D+   G L +S  ASP +RK        DE+    G PV + EA+QRWPHRY +G  K+N
Sbjct  109  DETEHGTLKKSLAASPSKRKPKRGENVKDEECVLYGEPVPDAEARQRWPHRYNRG--KAN  166

Query  516  GVTRSITSQDEFAGVLQAKRHFTAAKVDGLFYKLGDDAYVKAGEGEDNYICRIIEMFEAV  695
            G T+S+  QD+    LQAK HFT A VDG  Y L DDA+VKA +GE++YIC+I+E FEAV
Sbjct  167  G-TKSLNGQDDSDQQLQAKCHFTQASVDGQIYCLEDDAHVKAADGEEDYICKIVEFFEAV  225

Query  696  DGALYFTAQWYYRAKDTVIKGCDEFVDKQRVFFSE  800
            DG  YFTAQW+YRAKDTVIK  D+F+DK+RVF SE
Sbjct  226  DGMQYFTAQWFYRAKDTVIKSHDQFIDKKRVFLSE  260



>ref|NP_001289523.1| DNA (cytosine-5)-methyltransferase CMT3-like [Nicotiana sylvestris]
 emb|CDN40871.1| chromomethylase [Nicotiana sylvestris]
Length=901

 Score =   167 bits (422),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 87/155 (56%), Positives = 108/155 (70%), Gaps = 4/155 (3%)
 Frame = +3

Query  339  DDVAGGNLVRSQA-SPPERKRITTNVTNDEDSEFVGGPVLEEEAKQRWPHRYQKGTEKSN  515
            D+   G L +S A SP +RK   +    DE+    G PV + EA+QRWPHRY KG  K+N
Sbjct  107  DETEHGTLKKSLAVSPSKRKPKRSEKVKDEECVLSGEPVPDAEARQRWPHRYNKG--KAN  164

Query  516  GVTRSITSQDEFAGVLQAKRHFTAAKVDGLFYKLGDDAYVKAGEGEDNYICRIIEMFEAV  695
            G T+S+  QD+    LQAK HFT A VDG  Y L DDA+VKA +GE++YIC+I+E FEAV
Sbjct  165  G-TKSLNGQDDADQQLQAKCHFTQASVDGQIYYLEDDAHVKAADGEEDYICKIVEFFEAV  223

Query  696  DGALYFTAQWYYRAKDTVIKGCDEFVDKQRVFFSE  800
            DG  YFTAQW+Y AKDTVIK  D+F+DK+RVF SE
Sbjct  224  DGMQYFTAQWFYIAKDTVIKSHDQFIDKKRVFLSE  258



>gb|AGH70220.1| chromomethylase 3, partial [Nicotiana benthamiana]
Length=901

 Score =   165 bits (418),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 86/155 (55%), Positives = 108/155 (70%), Gaps = 4/155 (3%)
 Frame = +3

Query  339  DDVAGGNLVRSQA-SPPERKRITTNVTNDEDSEFVGGPVLEEEAKQRWPHRYQKGTEKSN  515
            D+   G L +S A SP +RK        +E+    G PV + EA+QRWPHRY +G  K+N
Sbjct  107  DETEHGTLKKSLAVSPSKRKPQRGEKVKEEECMLSGEPVPDVEARQRWPHRYNRG--KAN  164

Query  516  GVTRSITSQDEFAGVLQAKRHFTAAKVDGLFYKLGDDAYVKAGEGEDNYICRIIEMFEAV  695
            G T+S+  QD+    LQAK HFT A VDG  Y L DDA+VKA +GE++YIC+I+E FEAV
Sbjct  165  G-TKSLNGQDDSDQQLQAKCHFTQASVDGQIYCLEDDAHVKAADGEEDYICKIVEFFEAV  223

Query  696  DGALYFTAQWYYRAKDTVIKGCDEFVDKQRVFFSE  800
            DG  YFTAQW+YRAKDTVIK  D+F+DK+RVF SE
Sbjct  224  DGMQYFTAQWFYRAKDTVIKTHDQFIDKKRVFLSE  258



>ref|XP_004252840.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT3 [Solanum lycopersicum]
Length=933

 Score =   164 bits (416),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 84/155 (54%), Positives = 108/155 (70%), Gaps = 4/155 (3%)
 Frame = +3

Query  339  DDVAGGNLVRSQA-SPPERKRITTNVTNDEDSEFVGGPVLEEEAKQRWPHRYQKGTEKSN  515
            D +  G+L +S + SP +RK        DE+    G PV + EA+ +WPHRY KG E  N
Sbjct  136  DGMELGSLKKSLSISPSKRKPKRAEKVKDEECVLAGDPVPDAEARLKWPHRYNKGKE--N  193

Query  516  GVTRSITSQDEFAGVLQAKRHFTAAKVDGLFYKLGDDAYVKAGEGEDNYICRIIEMFEAV  695
            G T+S+  QD+   ++QAK HF+ A VDG  Y L DDA+VKA +GED+YIC+I+E FEAV
Sbjct  194  G-TKSLNGQDDPDQLIQAKCHFSRADVDGQIYYLEDDAHVKAADGEDDYICKIVEFFEAV  252

Query  696  DGALYFTAQWYYRAKDTVIKGCDEFVDKQRVFFSE  800
            DG  YFTAQW+YRAKDTVIK  D+F+DK+RVF SE
Sbjct  253  DGVQYFTAQWFYRAKDTVIKSHDQFIDKKRVFLSE  287



>ref|XP_009625627.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT3-like isoform 
X1 [Nicotiana tomentosiformis]
Length=856

 Score =   159 bits (402),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 75/140 (54%), Positives = 96/140 (69%), Gaps = 2/140 (1%)
 Frame = +3

Query  387  ERKRITTNVTNDEDSEFVGGPVLEEEAKQRWPHRY--QKGTEKSNGVTRSITSQDEFAGV  560
            ++ R       D++ EF G  +   EA+Q+WPHRY   K   KSNG   ++  QD+   +
Sbjct  68   QKVRRAAQANEDQECEFSGDSISHTEARQKWPHRYINHKDRVKSNGKPMTLNDQDDGDQL  127

Query  561  LQAKRHFTAAKVDGLFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRAK  740
            +QAK HFT A VDG  Y LGDDAYV+A   ED+YIC+I+E F+AVDG  YFTAQW+YRAK
Sbjct  128  IQAKCHFTQAVVDGQIYNLGDDAYVQASSDEDDYICKIVEFFQAVDGMQYFTAQWFYRAK  187

Query  741  DTVIKGCDEFVDKQRVFFSE  800
            DTVIK  D+F+D +RVFFSE
Sbjct  188  DTVIKAHDQFIDNKRVFFSE  207



>ref|XP_009625628.1| PREDICTED: DNA (cytosine-5)-methyltransferase 1-like isoform 
X2 [Nicotiana tomentosiformis]
Length=820

 Score =   159 bits (401),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 75/140 (54%), Positives = 96/140 (69%), Gaps = 2/140 (1%)
 Frame = +3

Query  387  ERKRITTNVTNDEDSEFVGGPVLEEEAKQRWPHRY--QKGTEKSNGVTRSITSQDEFAGV  560
            ++ R       D++ EF G  +   EA+Q+WPHRY   K   KSNG   ++  QD+   +
Sbjct  68   QKVRRAAQANEDQECEFSGDSISHTEARQKWPHRYINHKDRVKSNGKPMTLNDQDDGDQL  127

Query  561  LQAKRHFTAAKVDGLFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRAK  740
            +QAK HFT A VDG  Y LGDDAYV+A   ED+YIC+I+E F+AVDG  YFTAQW+YRAK
Sbjct  128  IQAKCHFTQAVVDGQIYNLGDDAYVQASSDEDDYICKIVEFFQAVDGMQYFTAQWFYRAK  187

Query  741  DTVIKGCDEFVDKQRVFFSE  800
            DTVIK  D+F+D +RVFFSE
Sbjct  188  DTVIKAHDQFIDNKRVFFSE  207



>ref|XP_006572936.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT3-like [Glycine 
max]
Length=875

 Score =   157 bits (398),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 82/155 (53%), Positives = 110/155 (71%), Gaps = 4/155 (3%)
 Frame = +3

Query  345  VAGGNLVRSQASPPERKRITTNVTNDE--DSEFVGGPVLEEEAKQRWPHRYQKGTEKSNG  518
            VA  ++V+ +A          NV++ E  ++ FVG PV +EEA++RWP RYQ+  +K + 
Sbjct  44   VAASSVVKEEAQASFTDVTDGNVSDGEGTNARFVGEPVPDEEARRRWPKRYQEKEKKQSA  103

Query  519  VTRSITSQDEFAGVLQAKRHFTAAKVDG-LFYKLGDDAYVKAGEGEDNYICRIIEMFEAV  695
              +S    DE   + QA+RH+T A+VDG + YKL DDA+VKA EGEDNYIC+I+E+FEA+
Sbjct  104  GPKS-NRNDEDEEIQQARRHYTQAEVDGCMLYKLYDDAHVKAEEGEDNYICKIVEIFEAI  162

Query  696  DGALYFTAQWYYRAKDTVIKGCDEFVDKQRVFFSE  800
            DGALYFTAQWYYRAKDTVIK     ++ +RVFFSE
Sbjct  163  DGALYFTAQWYYRAKDTVIKKLAYLIEPKRVFFSE  197



>ref|XP_007014769.1| Chromomethylase 1, putative isoform 4 [Theobroma cacao]
 gb|EOY32388.1| Chromomethylase 1, putative isoform 4 [Theobroma cacao]
Length=804

 Score =   156 bits (394),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 77/157 (49%), Positives = 112/157 (71%), Gaps = 7/157 (4%)
 Frame = +3

Query  345  VAGGNLVRSQASPPE----RKRITTNVTNDEDSEFVGGPVLEEEAKQRWPHRYQKGTEKS  512
            V GG+   S+ +P +    R+ +  N    +D+  +G PV +EEA++RWP RYQ G E+ 
Sbjct  109  VLGGDESGSKTTPSKLKVTRQAVNGNEDEKQDARLIGEPVPDEEARRRWPKRYQ-GVEQK  167

Query  513  NGVTRSITSQDEFAGVLQAKRHFTAAKVDG-LFYKLGDDAYVKAGEGEDNYICRIIEMFE  689
              V+++   +++ + ++QA+RH+T A+VDG + Y L DDA+VKA EG+D YIC+I+EMFE
Sbjct  168  QVVSKNSKDEND-SEIIQARRHYTQAEVDGRVLYNLYDDAHVKAEEGQDYYICKIVEMFE  226

Query  690  AVDGALYFTAQWYYRAKDTVIKGCDEFVDKQRVFFSE  800
            AVDG LYFTAQW+YRA+DTV+K     +DK+RVFFSE
Sbjct  227  AVDGTLYFTAQWFYRARDTVMKKLGHLIDKKRVFFSE  263



>ref|XP_009781267.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT3-like isoform 
X4 [Nicotiana sylvestris]
Length=859

 Score =   156 bits (394),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 73/140 (52%), Positives = 96/140 (69%), Gaps = 2/140 (1%)
 Frame = +3

Query  387  ERKRITTNVTNDEDSEFVGGPVLEEEAKQRWPHRY--QKGTEKSNGVTRSITSQDEFAGV  560
            ++ R  T   +D++ EF G  +   EA Q+WPHRY   K   K+NG   ++  QD+   +
Sbjct  119  QKVRRATQANDDQECEFSGDSISHAEAMQKWPHRYINHKDRVKANGKPMTLNDQDDADQL  178

Query  561  LQAKRHFTAAKVDGLFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRAK  740
            +QAK HF  A VDG  Y LGDDAYV+A   ED+YIC+I+E F+AVDG  YFTAQW+YRAK
Sbjct  179  IQAKCHFAQAVVDGQIYNLGDDAYVQASNDEDDYICKIVEFFQAVDGMQYFTAQWFYRAK  238

Query  741  DTVIKGCDEFVDKQRVFFSE  800
            DTVIK  D+F++ +RVFFSE
Sbjct  239  DTVIKAHDQFINNKRVFFSE  258



>ref|XP_009781265.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT3-like isoform 
X2 [Nicotiana sylvestris]
Length=907

 Score =   156 bits (395),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 73/140 (52%), Positives = 96/140 (69%), Gaps = 2/140 (1%)
 Frame = +3

Query  387  ERKRITTNVTNDEDSEFVGGPVLEEEAKQRWPHRY--QKGTEKSNGVTRSITSQDEFAGV  560
            ++ R  T   +D++ EF G  +   EA Q+WPHRY   K   K+NG   ++  QD+   +
Sbjct  119  QKVRRATQANDDQECEFSGDSISHAEAMQKWPHRYINHKDRVKANGKPMTLNDQDDADQL  178

Query  561  LQAKRHFTAAKVDGLFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRAK  740
            +QAK HF  A VDG  Y LGDDAYV+A   ED+YIC+I+E F+AVDG  YFTAQW+YRAK
Sbjct  179  IQAKCHFAQAVVDGQIYNLGDDAYVQASNDEDDYICKIVEFFQAVDGMQYFTAQWFYRAK  238

Query  741  DTVIKGCDEFVDKQRVFFSE  800
            DTVIK  D+F++ +RVFFSE
Sbjct  239  DTVIKAHDQFINNKRVFFSE  258



>ref|XP_009781266.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT3-like isoform 
X3 [Nicotiana sylvestris]
Length=871

 Score =   156 bits (394),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 73/140 (52%), Positives = 96/140 (69%), Gaps = 2/140 (1%)
 Frame = +3

Query  387  ERKRITTNVTNDEDSEFVGGPVLEEEAKQRWPHRY--QKGTEKSNGVTRSITSQDEFAGV  560
            ++ R  T   +D++ EF G  +   EA Q+WPHRY   K   K+NG   ++  QD+   +
Sbjct  119  QKVRRATQANDDQECEFSGDSISHAEAMQKWPHRYINHKDRVKANGKPMTLNDQDDADQL  178

Query  561  LQAKRHFTAAKVDGLFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRAK  740
            +QAK HF  A VDG  Y LGDDAYV+A   ED+YIC+I+E F+AVDG  YFTAQW+YRAK
Sbjct  179  IQAKCHFAQAVVDGQIYNLGDDAYVQASNDEDDYICKIVEFFQAVDGMQYFTAQWFYRAK  238

Query  741  DTVIKGCDEFVDKQRVFFSE  800
            DTVIK  D+F++ +RVFFSE
Sbjct  239  DTVIKAHDQFINNKRVFFSE  258



>ref|XP_007014771.1| Chromomethylase 1, putative isoform 6, partial [Theobroma cacao]
 gb|EOY32390.1| Chromomethylase 1, putative isoform 6, partial [Theobroma cacao]
Length=770

 Score =   155 bits (392),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 77/157 (49%), Positives = 112/157 (71%), Gaps = 7/157 (4%)
 Frame = +3

Query  345  VAGGNLVRSQASPPE----RKRITTNVTNDEDSEFVGGPVLEEEAKQRWPHRYQKGTEKS  512
            V GG+   S+ +P +    R+ +  N    +D+  +G PV +EEA++RWP RYQ G E+ 
Sbjct  66   VLGGDESGSKTTPSKLKVTRQAVNGNEDEKQDARLIGEPVPDEEARRRWPKRYQ-GVEQK  124

Query  513  NGVTRSITSQDEFAGVLQAKRHFTAAKVDG-LFYKLGDDAYVKAGEGEDNYICRIIEMFE  689
              V+++   +++ + ++QA+RH+T A+VDG + Y L DDA+VKA EG+D YIC+I+EMFE
Sbjct  125  QVVSKNSKDEND-SEIIQARRHYTQAEVDGRVLYNLYDDAHVKAEEGQDYYICKIVEMFE  183

Query  690  AVDGALYFTAQWYYRAKDTVIKGCDEFVDKQRVFFSE  800
            AVDG LYFTAQW+YRA+DTV+K     +DK+RVFFSE
Sbjct  184  AVDGTLYFTAQWFYRARDTVMKKLGHLIDKKRVFFSE  220



>ref|XP_009781264.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT3-like isoform 
X1 [Nicotiana sylvestris]
Length=913

 Score =   156 bits (394),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 73/140 (52%), Positives = 96/140 (69%), Gaps = 2/140 (1%)
 Frame = +3

Query  387  ERKRITTNVTNDEDSEFVGGPVLEEEAKQRWPHRY--QKGTEKSNGVTRSITSQDEFAGV  560
            ++ R  T   +D++ EF G  +   EA Q+WPHRY   K   K+NG   ++  QD+   +
Sbjct  119  QKVRRATQANDDQECEFSGDSISHAEAMQKWPHRYINHKDRVKANGKPMTLNDQDDADQL  178

Query  561  LQAKRHFTAAKVDGLFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRAK  740
            +QAK HF  A VDG  Y LGDDAYV+A   ED+YIC+I+E F+AVDG  YFTAQW+YRAK
Sbjct  179  IQAKCHFAQAVVDGQIYNLGDDAYVQASNDEDDYICKIVEFFQAVDGMQYFTAQWFYRAK  238

Query  741  DTVIKGCDEFVDKQRVFFSE  800
            DTVIK  D+F++ +RVFFSE
Sbjct  239  DTVIKAHDQFINNKRVFFSE  258



>ref|XP_007014770.1| Chromomethylase 1, putative isoform 5, partial [Theobroma cacao]
 gb|EOY32389.1| Chromomethylase 1, putative isoform 5, partial [Theobroma cacao]
Length=774

 Score =   155 bits (392),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 77/157 (49%), Positives = 112/157 (71%), Gaps = 7/157 (4%)
 Frame = +3

Query  345  VAGGNLVRSQASPPE----RKRITTNVTNDEDSEFVGGPVLEEEAKQRWPHRYQKGTEKS  512
            V GG+   S+ +P +    R+ +  N    +D+  +G PV +EEA++RWP RYQ G E+ 
Sbjct  66   VLGGDESGSKTTPSKLKVTRQAVNGNEDEKQDARLIGEPVPDEEARRRWPKRYQ-GVEQK  124

Query  513  NGVTRSITSQDEFAGVLQAKRHFTAAKVDG-LFYKLGDDAYVKAGEGEDNYICRIIEMFE  689
              V+++   +++ + ++QA+RH+T A+VDG + Y L DDA+VKA EG+D YIC+I+EMFE
Sbjct  125  QVVSKNSKDEND-SEIIQARRHYTQAEVDGRVLYNLYDDAHVKAEEGQDYYICKIVEMFE  183

Query  690  AVDGALYFTAQWYYRAKDTVIKGCDEFVDKQRVFFSE  800
            AVDG LYFTAQW+YRA+DTV+K     +DK+RVFFSE
Sbjct  184  AVDGTLYFTAQWFYRARDTVMKKLGHLIDKKRVFFSE  220



>ref|XP_007014768.1| Chromomethylase 1, putative isoform 3 [Theobroma cacao]
 gb|EOY32387.1| Chromomethylase 1, putative isoform 3 [Theobroma cacao]
Length=931

 Score =   155 bits (393),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 77/157 (49%), Positives = 112/157 (71%), Gaps = 7/157 (4%)
 Frame = +3

Query  345  VAGGNLVRSQASPPE----RKRITTNVTNDEDSEFVGGPVLEEEAKQRWPHRYQKGTEKS  512
            V GG+   S+ +P +    R+ +  N    +D+  +G PV +EEA++RWP RYQ G E+ 
Sbjct  109  VLGGDESGSKTTPSKLKVTRQAVNGNEDEKQDARLIGEPVPDEEARRRWPKRYQ-GVEQK  167

Query  513  NGVTRSITSQDEFAGVLQAKRHFTAAKVDG-LFYKLGDDAYVKAGEGEDNYICRIIEMFE  689
              V+++   +++ + ++QA+RH+T A+VDG + Y L DDA+VKA EG+D YIC+I+EMFE
Sbjct  168  QVVSKNSKDEND-SEIIQARRHYTQAEVDGRVLYNLYDDAHVKAEEGQDYYICKIVEMFE  226

Query  690  AVDGALYFTAQWYYRAKDTVIKGCDEFVDKQRVFFSE  800
            AVDG LYFTAQW+YRA+DTV+K     +DK+RVFFSE
Sbjct  227  AVDGTLYFTAQWFYRARDTVMKKLGHLIDKKRVFFSE  263



>ref|XP_007014766.1| Chromomethylase 1, putative isoform 1 [Theobroma cacao]
 gb|EOY32385.1| Chromomethylase 1, putative isoform 1 [Theobroma cacao]
Length=930

 Score =   155 bits (393),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 77/157 (49%), Positives = 112/157 (71%), Gaps = 7/157 (4%)
 Frame = +3

Query  345  VAGGNLVRSQASPPE----RKRITTNVTNDEDSEFVGGPVLEEEAKQRWPHRYQKGTEKS  512
            V GG+   S+ +P +    R+ +  N    +D+  +G PV +EEA++RWP RYQ G E+ 
Sbjct  109  VLGGDESGSKTTPSKLKVTRQAVNGNEDEKQDARLIGEPVPDEEARRRWPKRYQ-GVEQK  167

Query  513  NGVTRSITSQDEFAGVLQAKRHFTAAKVDG-LFYKLGDDAYVKAGEGEDNYICRIIEMFE  689
              V+++   +++ + ++QA+RH+T A+VDG + Y L DDA+VKA EG+D YIC+I+EMFE
Sbjct  168  QVVSKNSKDEND-SEIIQARRHYTQAEVDGRVLYNLYDDAHVKAEEGQDYYICKIVEMFE  226

Query  690  AVDGALYFTAQWYYRAKDTVIKGCDEFVDKQRVFFSE  800
            AVDG LYFTAQW+YRA+DTV+K     +DK+RVFFSE
Sbjct  227  AVDGTLYFTAQWFYRARDTVMKKLGHLIDKKRVFFSE  263



>ref|XP_007152975.1| hypothetical protein PHAVU_004G176100g [Phaseolus vulgaris]
 gb|ESW24969.1| hypothetical protein PHAVU_004G176100g [Phaseolus vulgaris]
Length=877

 Score =   155 bits (392),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 71/126 (56%), Positives = 97/126 (77%), Gaps = 1/126 (1%)
 Frame = +3

Query  426  DSEFVGGPVLEEEAKQRWPHRYQKGTEKSNGVTRSITSQDEFAGVLQAKRHFTAAKVDGL  605
            ++ F+G P+ EEEA++RWP RYQ+  +K +  ++S  +QDE   + QA+ H+  A+VDG 
Sbjct  72   NTRFIGEPIPEEEARRRWPKRYQEKEKKPSTGSKSNRNQDEDEEIHQARHHYLEAEVDGC  131

Query  606  -FYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRAKDTVIKGCDEFVDKQ  782
              YKL DDA+VKA EGEDNYIC+I+E+FE++DG+LYFTAQWYYRAKDTVIK     ++ +
Sbjct  132  TIYKLFDDAHVKADEGEDNYICKIVELFESIDGSLYFTAQWYYRAKDTVIKKLAYLIEPK  191

Query  783  RVFFSE  800
            RVFFSE
Sbjct  192  RVFFSE  197



>ref|XP_004513046.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT3-like isoform 
X1 [Cicer arietinum]
Length=864

 Score =   154 bits (390),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 72/126 (57%), Positives = 97/126 (77%), Gaps = 3/126 (2%)
 Frame = +3

Query  426  DSEFVGGPVLEEEAKQRWPHRYQKGTEKSNGVTRSITSQDEFAGVLQAKRHFTAAKVDGL  605
            +S FVG P+ +E+AK+RWP+RYQ+  +K +  ++S +S DE   +LQA+ H+T A++DG 
Sbjct  72   NSRFVGDPISDEKAKRRWPNRYQEKEKKPSTKSKSNSSDDE--EILQARHHYTEAEIDGC  129

Query  606  -FYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRAKDTVIKGCDEFVDKQ  782
              YKL DDA+VK  EG +NYIC+I+EMFEAVDG LYFTAQWYYRAKDTVI+     ++ +
Sbjct  130  TIYKLNDDAHVKGEEGGENYICKIVEMFEAVDGGLYFTAQWYYRAKDTVIQNLGHLIEPK  189

Query  783  RVFFSE  800
            RVFFSE
Sbjct  190  RVFFSE  195



>emb|CDP13153.1| unnamed protein product [Coffea canephora]
Length=887

 Score =   154 bits (389),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 76/148 (51%), Positives = 98/148 (66%), Gaps = 4/148 (3%)
 Frame = +3

Query  369  SQASPPERK---RITTNVTNDEDSEFVGGPVLEEEAKQRWPHRYQ-KGTEKSNGVTRSIT  536
            S  SP ERK   R+      + D  F+G PV ++EA+ RWPHRY  K   K N V +   
Sbjct  73   SPMSPAERKTKRRVLAENEEEGDFRFLGEPVADKEARCRWPHRYAVKQKRKQNAVLKDSK  132

Query  537  SQDEFAGVLQAKRHFTAAKVDGLFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFT  716
             +D+    + AKRHFT A+VDG  + L DDAYV+A  G+ NYIC+I+EMFE  DG  YFT
Sbjct  133  GEDDSEEFIDAKRHFTQAEVDGQIFNLEDDAYVQAEVGKRNYICKIVEMFEGTDGMPYFT  192

Query  717  AQWYYRAKDTVIKGCDEFVDKQRVFFSE  800
            AQW+YRA+DT+I  C EF+D++RVFFSE
Sbjct  193  AQWFYRAEDTIITECHEFIDEKRVFFSE  220



>gb|KJB07908.1| hypothetical protein B456_001G052000 [Gossypium raimondii]
Length=905

 Score =   154 bits (388),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 79/149 (53%), Positives = 107/149 (72%), Gaps = 9/149 (6%)
 Frame = +3

Query  369  SQASPPERKRITTNVTNDEDSE---FVGGPVLEEEAKQRWPHRYQ-KGTEKSNGVTRSIT  536
            S+ +P   K+  T+V  +ED E   F+G PV +EEA++RWP RYQ KG +K      S +
Sbjct  98   SKTTPKNSKKTKTDVAVNEDKEETKFLGEPVDDEEARRRWPKRYQGKGAKK----VISKS  153

Query  537  SQDEFAGVLQAKRHFTAAKVDG-LFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYF  713
            S  +   ++QA+RH+T AKVDG + + L DDA+VKA +GED YIC+I+EMFEAVDG LYF
Sbjct  154  SNGDSEEIIQARRHYTQAKVDGCMIFNLYDDAHVKAEDGEDCYICKIVEMFEAVDGDLYF  213

Query  714  TAQWYYRAKDTVIKGCDEFVDKQRVFFSE  800
            TAQW+YRA+DTV+K     +DK+RVFFS+
Sbjct  214  TAQWFYRAQDTVLKTLGHLIDKKRVFFSQ  242



>ref|XP_006354167.1| PREDICTED: DNA (cytosine-5)-methyltransferase 1-like [Solanum 
tuberosum]
Length=854

 Score =   153 bits (386),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 70/139 (50%), Positives = 93/139 (67%), Gaps = 1/139 (1%)
 Frame = +3

Query  387  ERKRITTNVTNDEDSEFVGGPVLEEEAKQRWPHRYQ-KGTEKSNGVTRSITSQDEFAGVL  563
            E +R+      +++  F G  V E EA+++WPHRY  K     NG   S+  QD+   ++
Sbjct  64   EVRRVVVQANEEQECAFYGETVPESEAREKWPHRYIIKDKMNVNGAPMSLNCQDDSNQLI  123

Query  564  QAKRHFTAAKVDGLFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRAKD  743
            QAK HF  A +D   YKLGDDAYVKA +GED+YIC+I+E F+ VD   YFTAQW+YRAKD
Sbjct  124  QAKCHFVQALIDNAIYKLGDDAYVKAADGEDDYICKIVEFFQGVDDMKYFTAQWFYRAKD  183

Query  744  TVIKGCDEFVDKQRVFFSE  800
            TVIK  D+F+D +RVF S+
Sbjct  184  TVIKAHDQFIDNKRVFLSD  202



>ref|XP_004228597.2| PREDICTED: DNA (cytosine-5)-methyltransferase 1 isoform X1 [Solanum 
lycopersicum]
Length=855

 Score =   152 bits (385),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 71/139 (51%), Positives = 95/139 (68%), Gaps = 1/139 (1%)
 Frame = +3

Query  387  ERKRITTNVTNDEDSEFVGGPVLEEEAKQRWPHRY-QKGTEKSNGVTRSITSQDEFAGVL  563
            E +R+      +++ EF G  VL+ EA+++WPHRY  K     N  + S+  Q +   ++
Sbjct  65   EVRRVAVRANEEQEGEFYGEIVLDSEARKKWPHRYILKDNVNINSASMSLNCQHDSDELI  124

Query  564  QAKRHFTAAKVDGLFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRAKD  743
            QAK HF  A VD + YKLGDDAYVKA E ED+YIC+I+E F+ VD   YFTAQW+YRAKD
Sbjct  125  QAKCHFAQALVDNVIYKLGDDAYVKAAEDEDDYICKIVEFFQGVDDMKYFTAQWFYRAKD  184

Query  744  TVIKGCDEFVDKQRVFFSE  800
            TVIK  D+F+DK+RVF S+
Sbjct  185  TVIKAHDQFIDKKRVFLSD  203



>ref|XP_010043881.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT3 [Eucalyptus 
grandis]
Length=874

 Score =   152 bits (383),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 70/122 (57%), Positives = 90/122 (74%), Gaps = 1/122 (1%)
 Frame = +3

Query  438  VGGPVLEEEAKQRWPHRYQKGTEKSNGVTRSITSQ-DEFAGVLQAKRHFTAAKVDGLFYK  614
            VG P+  EEA+Q+WP RY    +K   V+ +   + D    ++QAK H+  A VDG+FY 
Sbjct  82   VGAPIRNEEARQKWPKRYLGAGKKKKVVSVNGNKEGDNSEEIIQAKCHYKKANVDGVFYD  141

Query  615  LGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRAKDTVIKGCDEFVDKQRVFF  794
            +GDDAYVKAGEGEDNYIC+I+E+FEAVDG+L+F AQWYYRA+DTVIK     +D +RVFF
Sbjct  142  IGDDAYVKAGEGEDNYICKIVELFEAVDGSLHFCAQWYYRARDTVIKQLSYLIDDKRVFF  201

Query  795  SE  800
            SE
Sbjct  202  SE  203



>ref|XP_004513047.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT3-like isoform 
X2 [Cicer arietinum]
Length=863

 Score =   151 bits (382),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 70/126 (56%), Positives = 96/126 (76%), Gaps = 4/126 (3%)
 Frame = +3

Query  426  DSEFVGGPVLEEEAKQRWPHRYQKGTEKSNGVTRSITSQDEFAGVLQAKRHFTAAKVDGL  605
            +S FVG P+ +E+AK+RWP+RYQ+  +K +  ++S +  +E   +LQA+ H+T A++DG 
Sbjct  72   NSRFVGDPISDEKAKRRWPNRYQEKEKKPSTKSKSNSDDEE---ILQARHHYTEAEIDGC  128

Query  606  -FYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRAKDTVIKGCDEFVDKQ  782
              YKL DDA+VK  EG +NYIC+I+EMFEAVDG LYFTAQWYYRAKDTVI+     ++ +
Sbjct  129  TIYKLNDDAHVKGEEGGENYICKIVEMFEAVDGGLYFTAQWYYRAKDTVIQNLGHLIEPK  188

Query  783  RVFFSE  800
            RVFFSE
Sbjct  189  RVFFSE  194



>gb|AEC12443.1| chromomethylase 3 [Gossypium hirsutum]
Length=824

 Score =   150 bits (380),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 78/149 (52%), Positives = 106/149 (71%), Gaps = 9/149 (6%)
 Frame = +3

Query  369  SQASPPERKRITTNVTNDEDSE---FVGGPVLEEEAKQRWPHRYQ-KGTEKSNGVTRSIT  536
            S+ +P   K+   +V  +ED E   F+G PV +EEA++RWP RYQ KG +K      S +
Sbjct  21   SKTTPKNSKKTKKDVAVNEDEEETKFLGEPVDDEEARRRWPKRYQGKGAKK----VISKS  76

Query  537  SQDEFAGVLQAKRHFTAAKVDG-LFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYF  713
            S  +   ++QA+RH+T AKVDG + + L DDA+VKA +GED YIC+I+EMFEAVDG LYF
Sbjct  77   SNGDSEEIIQARRHYTQAKVDGCMIFNLYDDAHVKAEDGEDCYICKIVEMFEAVDGDLYF  136

Query  714  TAQWYYRAKDTVIKGCDEFVDKQRVFFSE  800
            TAQW+YRA+DTV+K     +DK+RVFFS+
Sbjct  137  TAQWFYRAQDTVLKTLGHLIDKKRVFFSQ  165



>ref|XP_011089105.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT3 [Sesamum indicum]
Length=859

 Score =   144 bits (362),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 70/141 (50%), Positives = 91/141 (65%), Gaps = 16/141 (11%)
 Frame = +3

Query  378  SPPERKRITTNVTNDEDSEFVGGPVLEEEAKQRWPHRYQKGTEKSNGVTRSITSQDEFAG  557
            SP  + R       + D+ F+G PV EEEA++RWPHRY K   ++               
Sbjct  72   SPGRKGRRNEEEEEEGDARFLGKPVPEEEARKRWPHRYLKNQSET---------------  116

Query  558  VLQAKRHFTAAKVDGLFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRA  737
             +QA+ HF  A+VDG  + L DD+YVKA EG++NYIC+IIE+F+AVDG+  FTAQWYYRA
Sbjct  117  -IQARCHFVQAEVDGQVFFLEDDSYVKAEEGKENYICKIIELFQAVDGSQNFTAQWYYRA  175

Query  738  KDTVIKGCDEFVDKQRVFFSE  800
             DTVIK C   +D +RVFFSE
Sbjct  176  SDTVIKNCGNLIDHKRVFFSE  196



>ref|XP_003636958.1| DNA (cytosine-5)-methyltransferase [Medicago truncatula]
 gb|KEH21528.1| DNA (cytosine-5)-methyltransferase CMT3-like protein [Medicago 
truncatula]
Length=827

 Score =   137 bits (344),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 68/140 (49%), Positives = 91/140 (65%), Gaps = 12/140 (9%)
 Frame = +3

Query  381  PPERKRITTNVTNDEDSEFVGGPVLEEEAKQRWPHRYQKGTEKSNGVTRSITSQDEFAGV  560
            P  RK+   +  N +D+ FVG P+  +EA+++WPHRY K  E S G +            
Sbjct  39   PSRRKKSKQSSVNSDDACFVGEPIPADEAQKKWPHRYTKNDELSEGES------------  86

Query  561  LQAKRHFTAAKVDGLFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRAK  740
            L+AK H+  AKVDG+ YKL D+AYVK  EG+++YI RI+EMFE  D   YFTAQW+YRA+
Sbjct  87   LKAKFHYHEAKVDGILYKLEDNAYVKGEEGKEDYIARIVEMFETPDEEQYFTAQWFYRAE  146

Query  741  DTVIKGCDEFVDKQRVFFSE  800
            DTVIK     VDK+R+F S+
Sbjct  147  DTVIKDHGNLVDKKRIFISD  166



>gb|KDO62937.1| hypothetical protein CISIN_1g047980mg, partial [Citrus sinensis]
Length=718

 Score =   135 bits (340),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 70/141 (50%), Positives = 95/141 (67%), Gaps = 10/141 (7%)
 Frame = +3

Query  393  KRITTNVTNDEDSE----FVGGPVLEEEAKQRWPHRYQKGTEKSNGVTRSITSQDEFAGV  560
            K++     +D+D E    F+G PV + EA+QRWP RY+   +K     R     D+   +
Sbjct  117  KKLPVRGEHDDDDEPEARFLGDPVPDGEARQRWPKRYEVKKQK-----RRNQKDDDEEEI  171

Query  561  LQAKRHFTAAKVDG-LFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRA  737
            +QAK H+  A+VDG + Y L DDA+VKA  GE++YIC+I+EMFEAVDG  YFTAQWYYRA
Sbjct  172  IQAKCHYMWAEVDGHITYDLFDDAHVKAESGEEDYICKIVEMFEAVDGTPYFTAQWYYRA  231

Query  738  KDTVIKGCDEFVDKQRVFFSE  800
            +DTVI+     +D++RVFFSE
Sbjct  232  RDTVIESNAHLIDQRRVFFSE  252



>ref|XP_008451103.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT3 [Cucumis melo]
Length=859

 Score =   135 bits (341),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 67/128 (52%), Positives = 87/128 (68%), Gaps = 3/128 (2%)
 Frame = +3

Query  417  NDEDSEFVGGPVLEEEAKQRWPHRYQKGTEKSNGVTRSITSQDEFAGVLQAKRHFTAAKV  596
            +D  + F+     + EA++RWP RY     K   V     S+D+   V+QA  H++ AKV
Sbjct  64   DDAPARFLEPHFPDREARERWPLRY---AGKKKKVVAEKNSRDDSEEVIQALHHYSQAKV  120

Query  597  DGLFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRAKDTVIKGCDEFVD  776
            D + Y L DDA+VKA +GED+YIC+IIEMFEAVDG LYFTAQWYYRAKDTV+K     ++
Sbjct  121  DNITYNLFDDAHVKAEDGEDDYICKIIEMFEAVDGELYFTAQWYYRAKDTVVKDHAHLIN  180

Query  777  KQRVFFSE  800
             +RVFFSE
Sbjct  181  DKRVFFSE  188



>ref|XP_006445885.1| hypothetical protein CICLE_v10014232mg [Citrus clementina]
 gb|ESR59125.1| hypothetical protein CICLE_v10014232mg [Citrus clementina]
Length=869

 Score =   135 bits (341),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 70/141 (50%), Positives = 95/141 (67%), Gaps = 10/141 (7%)
 Frame = +3

Query  393  KRITTNVTNDEDSE----FVGGPVLEEEAKQRWPHRYQKGTEKSNGVTRSITSQDEFAGV  560
            K++     +D+D E    F+G PV + EA+QRWP RY+   +K     R     D+   +
Sbjct  73   KKLPVRGEHDDDDEPEARFLGDPVPDGEARQRWPKRYELKKQK-----RRNQKDDDEEEI  127

Query  561  LQAKRHFTAAKVDG-LFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRA  737
            +QAK H+  A+VDG + Y L DDA+VKA  GE++YIC+I+EMFEAVDG  YFTAQWYYRA
Sbjct  128  IQAKCHYMRAEVDGHITYDLFDDAHVKAESGEEDYICKIVEMFEAVDGTPYFTAQWYYRA  187

Query  738  KDTVIKGCDEFVDKQRVFFSE  800
            +DTVI+     +D++RVFFSE
Sbjct  188  RDTVIESNAHLIDQRRVFFSE  208



>ref|NP_001275877.1| DNA (cytosine-5)-methyltransferase CMT3-like [Citrus sinensis]
 gb|AGU16982.1| CMT-type DNA-methyltransferase [Citrus sinensis]
Length=869

 Score =   135 bits (340),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 70/141 (50%), Positives = 95/141 (67%), Gaps = 10/141 (7%)
 Frame = +3

Query  393  KRITTNVTNDEDSE----FVGGPVLEEEAKQRWPHRYQKGTEKSNGVTRSITSQDEFAGV  560
            K++     +D+D E    F+G PV + EA+QRWP RY+   +K     R     D+   +
Sbjct  73   KKLPVRGEHDDDDEPEARFLGDPVPDGEARQRWPKRYEVKKQK-----RRNQKDDDEEEI  127

Query  561  LQAKRHFTAAKVDG-LFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRA  737
            +QAK H+  A+VDG + Y L DDA+VKA  GE++YIC+I+EMFEAVDG  YFTAQWYYRA
Sbjct  128  IQAKCHYMWAEVDGHITYDLFDDAHVKAESGEEDYICKIVEMFEAVDGTPYFTAQWYYRA  187

Query  738  KDTVIKGCDEFVDKQRVFFSE  800
            +DTVI+     +D++RVFFSE
Sbjct  188  RDTVIESNAHLIDQRRVFFSE  208



>gb|KDO40233.1| hypothetical protein CISIN_1g013949mg [Citrus sinensis]
Length=433

 Score =   130 bits (327),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 71/133 (53%), Positives = 92/133 (69%), Gaps = 7/133 (5%)
 Frame = +3

Query  420  DEDSEFVGGPVLEEEAKQRWPHRYQ---KGTEK---SNGVTRSITSQDEFAGVLQAKRHF  581
            D D  FVG PV  +EA +R+P RY+   KG +K   + GV+ SI + +E   VLQA+ H+
Sbjct  67   DSDLFFVGPPVSVDEALKRYPDRYKYSSKGHKKKKVAAGVS-SIGALNEEEEVLQARCHY  125

Query  582  TAAKVDGLFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRAKDTVIKGC  761
            T A VDG  Y LGDDAYVKA EG  +YI RI+E+FE+VDG  YF A+W+YRA+DTVIK  
Sbjct  126  TQASVDGCLYNLGDDAYVKAEEGAVDYIARIVELFESVDGEPYFKARWFYRAEDTVIKDL  185

Query  762  DEFVDKQRVFFSE  800
               VD++RVF S+
Sbjct  186  AYLVDRKRVFLSD  198



>ref|XP_008226363.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT3 [Prunus mume]
Length=869

 Score =   133 bits (334),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 69/150 (46%), Positives = 101/150 (67%), Gaps = 9/150 (6%)
 Frame = +3

Query  363  VRSQASPPER---KRITTNVTNDEDSEFVGGPVLEEEAKQRWPHRYQKGTEKSNGVTRSI  533
            +   ASPP +   K +      + +++F+G PV + EA++RWP RY    ++ +G   S 
Sbjct  41   MEKNASPPRKLKGKAVAVKDGEEPEAKFLGKPVKDTEARKRWPKRYLGKMKQVSGPNNS-  99

Query  534  TSQDEFAGVLQAKRHFTAAKVDGL-FYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALY  710
             +QDE A  +QA+ H+  A+VDG   + L DDA+V+AG+G + Y+C+I+EMFEA+DG LY
Sbjct  100  -NQDEDA--IQARGHYIKAEVDGRNIFDLYDDAHVQAGDGNEPYVCKIVEMFEAIDGTLY  156

Query  711  FTAQWYYRAKDTVIKGCDEFVDKQRVFFSE  800
            FTAQWYYR+ DTVIK C   +D++RVF SE
Sbjct  157  FTAQWYYRSPDTVIKEC-ATIDRRRVFLSE  185



>ref|XP_009376742.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT3-like [Pyrus 
x bretschneideri]
Length=989

 Score =   132 bits (333),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 73/150 (49%), Positives = 97/150 (65%), Gaps = 10/150 (7%)
 Frame = +3

Query  363  VRSQASPPERKRITTNVT----NDEDSEFVGGPVLEEEAKQRWPHRYQKGTEKSNGVTRS  530
            V   ASPP R  +T  V     + E++ FVG P+ +EEA++++P RY     K NG   S
Sbjct  167  VEKAASPP-RNPVTQEVAAADDDGEEARFVGEPMEDEEARKQYPKRYVGKKPKMNGQNNS  225

Query  531  ITSQDEFAGVLQAKRHFTAAKVDGLFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALY  710
               +D    ++QA  H+T A VDG+ Y L DDA+V +GE E+ YIC+I+EMFEA+ G LY
Sbjct  226  NDDED----IIQAHCHYTKALVDGINYDLYDDAHVFSGEKEEPYICKIVEMFEAIGGLLY  281

Query  711  FTAQWYYRAKDTVIKGCDEFVDKQRVFFSE  800
            FTAQWYYR++DTVIK C   V   RVFFS+
Sbjct  282  FTAQWYYRSRDTVIKHCAT-VACGRVFFSD  310



>gb|KJB16169.1| hypothetical protein B456_002G216500 [Gossypium raimondii]
Length=728

 Score =   131 bits (330),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 73/142 (51%), Positives = 89/142 (63%), Gaps = 5/142 (4%)
 Frame = +3

Query  381  PPERKRITTNVTNDEDSEFVGGPVLEEEAKQRWPHRYQ-KGTEKSNGVTRSITSQDEFAG  557
            PP+ K+    V  D D   VG P+   EA+QRWPHRYQ K   K   V  +  S DE   
Sbjct  34   PPKPKK-ARKVVPDSDLCLVGPPIAPAEARQRWPHRYQSKNKVKKQAVIEA--SNDEENE  90

Query  558  VLQAKRHFTAAKVDGLFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRA  737
            VLQAK H+  A VDG  YKLGD+AYVKA +G  +YI RI+E FE VD   +F AQW+YRA
Sbjct  91   VLQAKNHYVEAIVDGCRYKLGDNAYVKAEDGNLDYIARIVEFFETVDQEPFFKAQWFYRA  150

Query  738  KDTVI-KGCDEFVDKQRVFFSE  800
            +DTVI K     +DK+RVF S+
Sbjct  151  EDTVINKDNAHLIDKRRVFLSD  172



>gb|KJB16170.1| hypothetical protein B456_002G216500 [Gossypium raimondii]
Length=741

 Score =   131 bits (330),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 73/142 (51%), Positives = 89/142 (63%), Gaps = 5/142 (4%)
 Frame = +3

Query  381  PPERKRITTNVTNDEDSEFVGGPVLEEEAKQRWPHRYQ-KGTEKSNGVTRSITSQDEFAG  557
            PP+ K+    V  D D   VG P+   EA+QRWPHRYQ K   K   V  +  S DE   
Sbjct  34   PPKPKK-ARKVVPDSDLCLVGPPIAPAEARQRWPHRYQSKNKVKKQAVIEA--SNDEENE  90

Query  558  VLQAKRHFTAAKVDGLFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRA  737
            VLQAK H+  A VDG  YKLGD+AYVKA +G  +YI RI+E FE VD   +F AQW+YRA
Sbjct  91   VLQAKNHYVEAIVDGCRYKLGDNAYVKAEDGNLDYIARIVEFFETVDQEPFFKAQWFYRA  150

Query  738  KDTVI-KGCDEFVDKQRVFFSE  800
            +DTVI K     +DK+RVF S+
Sbjct  151  EDTVINKDNAHLIDKRRVFLSD  172



>gb|KJB16175.1| hypothetical protein B456_002G216500 [Gossypium raimondii]
Length=737

 Score =   131 bits (330),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 73/142 (51%), Positives = 89/142 (63%), Gaps = 5/142 (4%)
 Frame = +3

Query  381  PPERKRITTNVTNDEDSEFVGGPVLEEEAKQRWPHRYQ-KGTEKSNGVTRSITSQDEFAG  557
            PP+ K+    V  D D   VG P+   EA+QRWPHRYQ K   K   V  +  S DE   
Sbjct  34   PPKPKK-ARKVVPDSDLCLVGPPIAPAEARQRWPHRYQSKNKVKKQAVIEA--SNDEENE  90

Query  558  VLQAKRHFTAAKVDGLFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRA  737
            VLQAK H+  A VDG  YKLGD+AYVKA +G  +YI RI+E FE VD   +F AQW+YRA
Sbjct  91   VLQAKNHYVEAIVDGCRYKLGDNAYVKAEDGNLDYIARIVEFFETVDQEPFFKAQWFYRA  150

Query  738  KDTVI-KGCDEFVDKQRVFFSE  800
            +DTVI K     +DK+RVF S+
Sbjct  151  EDTVINKDNAHLIDKRRVFLSD  172



>gb|AFV99137.1| CMT-type cytosine DNA-methyltransferase 3c [Malus domestica]
Length=974

 Score =   132 bits (332),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 71/150 (47%), Positives = 97/150 (65%), Gaps = 10/150 (7%)
 Frame = +3

Query  363  VRSQASPPERKRITTNVT----NDEDSEFVGGPVLEEEAKQRWPHRYQKGTEKSNGVTRS  530
            V   ASPP RK +T  V     + E+S F+G P+ +EEA++++P RY     + NG   S
Sbjct  206  VEKAASPP-RKPVTQEVAAPDEDGEESRFIGKPMEDEEARKQYPKRYAGEKPQRNGQNNS  264

Query  531  ITSQDEFAGVLQAKRHFTAAKVDGLFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALY  710
               +D    ++QA+ H+T A VDG+ Y L DDA+V+    E+ YIC+I+EMFEA+ G LY
Sbjct  265  NDDED----IIQARCHYTKALVDGISYDLYDDAHVQGETKEEPYICKIVEMFEAIGGLLY  320

Query  711  FTAQWYYRAKDTVIKGCDEFVDKQRVFFSE  800
            FTAQWYYR++DTVIK C   V   RVFFS+
Sbjct  321  FTAQWYYRSRDTVIKHC-ATVACGRVFFSD  349



>gb|KJB16172.1| hypothetical protein B456_002G216500 [Gossypium raimondii]
Length=775

 Score =   131 bits (330),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 73/142 (51%), Positives = 89/142 (63%), Gaps = 5/142 (4%)
 Frame = +3

Query  381  PPERKRITTNVTNDEDSEFVGGPVLEEEAKQRWPHRYQ-KGTEKSNGVTRSITSQDEFAG  557
            PP+ K+    V  D D   VG P+   EA+QRWPHRYQ K   K   V  +  S DE   
Sbjct  34   PPKPKK-ARKVVPDSDLCLVGPPIAPAEARQRWPHRYQSKNKVKKQAVIEA--SNDEENE  90

Query  558  VLQAKRHFTAAKVDGLFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRA  737
            VLQAK H+  A VDG  YKLGD+AYVKA +G  +YI RI+E FE VD   +F AQW+YRA
Sbjct  91   VLQAKNHYVEAIVDGCRYKLGDNAYVKAEDGNLDYIARIVEFFETVDQEPFFKAQWFYRA  150

Query  738  KDTVI-KGCDEFVDKQRVFFSE  800
            +DTVI K     +DK+RVF S+
Sbjct  151  EDTVINKDNAHLIDKRRVFLSD  172



>gb|KEH27204.1| DNA (cytosine-5)-methyltransferase CMT3-like protein [Medicago 
truncatula]
Length=935

 Score =   132 bits (331),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 66/125 (53%), Positives = 89/125 (71%), Gaps = 5/125 (4%)
 Frame = +3

Query  429  SEFVGGPVLEEEAKQRWPHRYQKGTEKSNGVTRSITSQDEFAGVLQAKRHFTAAKVD-GL  605
            S+F+G P+  E AK RWP RYQ+  EK    +RS + ++E   V+ A+ H+T A+VD G+
Sbjct  144  SKFLGDPIPIEAAKLRWPKRYQE-KEKKKSRSRSNSDEEE---VILARCHYTEAQVDEGV  199

Query  606  FYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRAKDTVIKGCDEFVDKQR  785
             YKL DDAYV+    + ++IC+I+EMFEAVDG L+FTAQWYYRA DTVIK     ++ +R
Sbjct  200  IYKLYDDAYVQGETDDYHFICKIVEMFEAVDGGLFFTAQWYYRANDTVIKQLGNLIEPKR  259

Query  786  VFFSE  800
            VFFSE
Sbjct  260  VFFSE  264



>gb|KEH27061.1| DNA (cytosine-5)-methyltransferase CMT3-like protein [Medicago 
truncatula]
Length=835

 Score =   131 bits (330),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 66/140 (47%), Positives = 91/140 (65%), Gaps = 12/140 (9%)
 Frame = +3

Query  381  PPERKRITTNVTNDEDSEFVGGPVLEEEAKQRWPHRYQKGTEKSNGVTRSITSQDEFAGV  560
            P  RK+   +  N +D+ F+G P+  +EA+++WPHRY K  E         +S DE    
Sbjct  42   PSRRKKAKQSSVNSDDACFIGEPIPADEAQKKWPHRYTKNDE---------SSDDE---S  89

Query  561  LQAKRHFTAAKVDGLFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRAK  740
             +AK H+  AKVDG+ YKL D+AYVK  EG+++YI RI+E+FE  D   YFTAQW+YRA+
Sbjct  90   FKAKFHYREAKVDGILYKLDDNAYVKGEEGKEDYIARIVELFETPDEEQYFTAQWFYRAE  149

Query  741  DTVIKGCDEFVDKQRVFFSE  800
            DTVIK     VDK+R+F S+
Sbjct  150  DTVIKDHGNLVDKKRIFKSD  169



>ref|XP_008390169.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT3 [Malus domestica]
Length=1077

 Score =   132 bits (332),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 71/146 (49%), Positives = 97/146 (66%), Gaps = 10/146 (7%)
 Frame = +3

Query  375  ASPPERKRITTNVT----NDEDSEFVGGPVLEEEAKQRWPHRYQKGTEKSNGVTRSITSQ  542
            ASPP R  +T  V     + E++ F+G P+ +EEA++++P RY     K NG   S   +
Sbjct  134  ASPP-RNPVTQEVAAADDDGEEARFLGEPMEDEEARKQYPKRYVGKKPKMNGQNNSNDDE  192

Query  543  DEFAGVLQAKRHFTAAKVDGLFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQ  722
            D    ++QA+ H+T A VDG+ Y L DDA+V +GE E+ YIC+I+EMFEA+ G LYFTAQ
Sbjct  193  D----IIQARCHYTKALVDGINYDLYDDAHVFSGEKEEPYICKIVEMFEAIGGLLYFTAQ  248

Query  723  WYYRAKDTVIKGCDEFVDKQRVFFSE  800
            WYYR++DTVIK C   V   RVFFS+
Sbjct  249  WYYRSRDTVIKHCTT-VACGRVFFSD  273



>gb|KJB16171.1| hypothetical protein B456_002G216500 [Gossypium raimondii]
Length=760

 Score =   131 bits (330),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 73/142 (51%), Positives = 89/142 (63%), Gaps = 5/142 (4%)
 Frame = +3

Query  381  PPERKRITTNVTNDEDSEFVGGPVLEEEAKQRWPHRYQ-KGTEKSNGVTRSITSQDEFAG  557
            PP+ K+    V  D D   VG P+   EA+QRWPHRYQ K   K   V  +  S DE   
Sbjct  34   PPKPKK-ARKVVPDSDLCLVGPPIAPAEARQRWPHRYQSKNKVKKQAVIEA--SNDEENE  90

Query  558  VLQAKRHFTAAKVDGLFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRA  737
            VLQAK H+  A VDG  YKLGD+AYVKA +G  +YI RI+E FE VD   +F AQW+YRA
Sbjct  91   VLQAKNHYVEAIVDGCRYKLGDNAYVKAEDGNLDYIARIVEFFETVDQEPFFKAQWFYRA  150

Query  738  KDTVI-KGCDEFVDKQRVFFSE  800
            +DTVI K     +DK+RVF S+
Sbjct  151  EDTVINKDNAHLIDKRRVFLSD  172



>gb|KJB16174.1| hypothetical protein B456_002G216500 [Gossypium raimondii]
Length=838

 Score =   131 bits (330),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 73/142 (51%), Positives = 89/142 (63%), Gaps = 5/142 (4%)
 Frame = +3

Query  381  PPERKRITTNVTNDEDSEFVGGPVLEEEAKQRWPHRYQ-KGTEKSNGVTRSITSQDEFAG  557
            PP+ K+    V  D D   VG P+   EA+QRWPHRYQ K   K   V  +  S DE   
Sbjct  34   PPKPKK-ARKVVPDSDLCLVGPPIAPAEARQRWPHRYQSKNKVKKQAVIEA--SNDEENE  90

Query  558  VLQAKRHFTAAKVDGLFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRA  737
            VLQAK H+  A VDG  YKLGD+AYVKA +G  +YI RI+E FE VD   +F AQW+YRA
Sbjct  91   VLQAKNHYVEAIVDGCRYKLGDNAYVKAEDGNLDYIARIVEFFETVDQEPFFKAQWFYRA  150

Query  738  KDTVI-KGCDEFVDKQRVFFSE  800
            +DTVI K     +DK+RVF S+
Sbjct  151  EDTVINKDNAHLIDKRRVFLSD  172



>gb|KJB16168.1| hypothetical protein B456_002G216500 [Gossypium raimondii]
Length=851

 Score =   131 bits (330),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 73/142 (51%), Positives = 89/142 (63%), Gaps = 5/142 (4%)
 Frame = +3

Query  381  PPERKRITTNVTNDEDSEFVGGPVLEEEAKQRWPHRYQ-KGTEKSNGVTRSITSQDEFAG  557
            PP+ K+    V  D D   VG P+   EA+QRWPHRYQ K   K   V  +  S DE   
Sbjct  34   PPKPKK-ARKVVPDSDLCLVGPPIAPAEARQRWPHRYQSKNKVKKQAVIEA--SNDEENE  90

Query  558  VLQAKRHFTAAKVDGLFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRA  737
            VLQAK H+  A VDG  YKLGD+AYVKA +G  +YI RI+E FE VD   +F AQW+YRA
Sbjct  91   VLQAKNHYVEAIVDGCRYKLGDNAYVKAEDGNLDYIARIVEFFETVDQEPFFKAQWFYRA  150

Query  738  KDTVI-KGCDEFVDKQRVFFSE  800
            +DTVI K     +DK+RVF S+
Sbjct  151  EDTVINKDNAHLIDKRRVFLSD  172



>gb|KJB16173.1| hypothetical protein B456_002G216500 [Gossypium raimondii]
Length=836

 Score =   131 bits (329),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 73/142 (51%), Positives = 89/142 (63%), Gaps = 5/142 (4%)
 Frame = +3

Query  381  PPERKRITTNVTNDEDSEFVGGPVLEEEAKQRWPHRYQ-KGTEKSNGVTRSITSQDEFAG  557
            PP+ K+    V  D D   VG P+   EA+QRWPHRYQ K   K   V  +  S DE   
Sbjct  34   PPKPKK-ARKVVPDSDLCLVGPPIAPAEARQRWPHRYQSKNKVKKQAVIEA--SNDEENE  90

Query  558  VLQAKRHFTAAKVDGLFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRA  737
            VLQAK H+  A VDG  YKLGD+AYVKA +G  +YI RI+E FE VD   +F AQW+YRA
Sbjct  91   VLQAKNHYVEAIVDGCRYKLGDNAYVKAEDGNLDYIARIVEFFETVDQEPFFKAQWFYRA  150

Query  738  KDTVI-KGCDEFVDKQRVFFSE  800
            +DTVI K     +DK+RVF S+
Sbjct  151  EDTVINKDNAHLIDKRRVFLSD  172



>ref|XP_009390332.1| PREDICTED: DNA (cytosine-5)-methyltransferase 1-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=885

 Score =   130 bits (328),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 75/149 (50%), Positives = 94/149 (63%), Gaps = 12/149 (8%)
 Frame = +3

Query  378  SPPERKRITTNVTNDEDSE--FVGGPVLEEEAKQRWPHRYQKGTEKSNGVTRSITSQDEF  551
            SP +R   +    N+E  E  FVG P+ E EAK+ WP RYQ+    SNG  +   + DE 
Sbjct  90   SPKKRMGHSKKSKNEERPESCFVGNPIPEAEAKKLWPERYQRKRASSNGSAKR--ADDE-  146

Query  552  AGVLQAKRHFTAAKVDGLFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYY  731
              +L+AK H+  AKVDG+ YKL DDAYVKA EGE +YI RI+E FE  DG LYFTAQW++
Sbjct  147  -QLLRAKCHYREAKVDGVSYKLDDDAYVKAAEGELDYIGRIVEFFETTDGELYFTAQWFF  205

Query  732  RAKDTVIK------GCDEFVDKQRVFFSE  800
            RA+DTV+K      G     D +RVF SE
Sbjct  206  RAEDTVMKDHACCHGAKVVHDPRRVFLSE  234



>gb|KEH27609.1| DNA (cytosine-5)-methyltransferase CMT3-like protein [Medicago 
truncatula]
Length=830

 Score =   130 bits (328),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 67/140 (48%), Positives = 92/140 (66%), Gaps = 12/140 (9%)
 Frame = +3

Query  381  PPERKRITTNVTNDEDSEFVGGPVLEEEAKQRWPHRYQKGTEKSNGVTRSITSQDEFAGV  560
            P  RK+   +  N +D+ FVG P+  +EA+++WPHRY K  E         +S+DE    
Sbjct  43   PSRRKKAKQSSVNSDDACFVGEPIPADEAQKKWPHRYTKNDE---------SSEDE---S  90

Query  561  LQAKRHFTAAKVDGLFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRAK  740
            L+AK H+  AKVDG+ YKL D+AYVK  EG+++YI  I+EMFE  +   YFTAQW+YRA+
Sbjct  91   LKAKFHYREAKVDGILYKLEDNAYVKGEEGKEDYIATIVEMFETPEEEQYFTAQWFYRAE  150

Query  741  DTVIKGCDEFVDKQRVFFSE  800
            DTVIK     VDK+R+F S+
Sbjct  151  DTVIKDHGNLVDKKRIFKSD  170



>ref|XP_009390334.1| PREDICTED: DNA (cytosine-5)-methyltransferase 1-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=875

 Score =   130 bits (328),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 75/149 (50%), Positives = 94/149 (63%), Gaps = 12/149 (8%)
 Frame = +3

Query  378  SPPERKRITTNVTNDEDSE--FVGGPVLEEEAKQRWPHRYQKGTEKSNGVTRSITSQDEF  551
            SP +R   +    N+E  E  FVG P+ E EAK+ WP RYQ+    SNG  +   + DE 
Sbjct  90   SPKKRMGHSKKSKNEERPESCFVGNPIPEAEAKKLWPERYQRKRASSNGSAKR--ADDE-  146

Query  552  AGVLQAKRHFTAAKVDGLFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYY  731
              +L+AK H+  AKVDG+ YKL DDAYVKA EGE +YI RI+E FE  DG LYFTAQW++
Sbjct  147  -QLLRAKCHYREAKVDGVSYKLDDDAYVKAAEGELDYIGRIVEFFETTDGELYFTAQWFF  205

Query  732  RAKDTVIK------GCDEFVDKQRVFFSE  800
            RA+DTV+K      G     D +RVF SE
Sbjct  206  RAEDTVMKDHACCHGAKVVHDPRRVFLSE  234



>ref|XP_009364100.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT3-like isoform 
X1 [Pyrus x bretschneideri]
Length=1023

 Score =   131 bits (329),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 68/147 (46%), Positives = 96/147 (65%), Gaps = 9/147 (6%)
 Frame = +3

Query  372  QASPPERKRITTNVT----NDEDSEFVGGPVLEEEAKQRWPHRYQKGTEKSNGVTRSITS  539
            +A+ P RK +T  V     + E+S F+G P+ +EEA++++P RY     K NG   S   
Sbjct  208  KAASPLRKPVTQEVAAADEDGEESRFIGKPMEDEEARKQYPKRYAGEKPKRNGQNNSNDD  267

Query  540  QDEFAGVLQAKRHFTAAKVDGLFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTA  719
            +D    ++QA+ H+T A VDG+ Y L DDA+V+    E+ +IC+I+EMFEA+ G LYFTA
Sbjct  268  ED----IIQARCHYTKALVDGITYDLYDDAHVQGETKEEPFICKIVEMFEAIGGLLYFTA  323

Query  720  QWYYRAKDTVIKGCDEFVDKQRVFFSE  800
            QWYYR++DTVIK C   V   RVFFS+
Sbjct  324  QWYYRSRDTVIKHCAS-VACARVFFSD  349



>ref|XP_009390335.1| PREDICTED: DNA (cytosine-5)-methyltransferase 1-like isoform 
X3 [Musa acuminata subsp. malaccensis]
Length=873

 Score =   130 bits (328),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 75/149 (50%), Positives = 94/149 (63%), Gaps = 12/149 (8%)
 Frame = +3

Query  378  SPPERKRITTNVTNDEDSE--FVGGPVLEEEAKQRWPHRYQKGTEKSNGVTRSITSQDEF  551
            SP +R   +    N+E  E  FVG P+ E EAK+ WP RYQ+    SNG  +   + DE 
Sbjct  90   SPKKRMGHSKKSKNEERPESCFVGNPIPEAEAKKLWPERYQRKRASSNGSAKR--ADDE-  146

Query  552  AGVLQAKRHFTAAKVDGLFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYY  731
              +L+AK H+  AKVDG+ YKL DDAYVKA EGE +YI RI+E FE  DG LYFTAQW++
Sbjct  147  -QLLRAKCHYREAKVDGVSYKLDDDAYVKAAEGELDYIGRIVEFFETTDGELYFTAQWFF  205

Query  732  RAKDTVIK------GCDEFVDKQRVFFSE  800
            RA+DTV+K      G     D +RVF SE
Sbjct  206  RAEDTVMKDHACCHGAKVVHDPRRVFLSE  234



>ref|XP_003612312.1| DNA (cytosine-5)-methyltransferase [Medicago truncatula]
 gb|AES95270.1| DNA (cytosine-5)-methyltransferase CMT3-like protein [Medicago 
truncatula]
Length=835

 Score =   130 bits (328),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 67/140 (48%), Positives = 92/140 (66%), Gaps = 12/140 (9%)
 Frame = +3

Query  381  PPERKRITTNVTNDEDSEFVGGPVLEEEAKQRWPHRYQKGTEKSNGVTRSITSQDEFAGV  560
            P  RK+   +  N +D+ FVG P+  +EA+++WPHRY K  E         +S+DE    
Sbjct  43   PSRRKKAKQSSVNSDDACFVGEPIPADEAQKKWPHRYTKNDE---------SSEDE---S  90

Query  561  LQAKRHFTAAKVDGLFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRAK  740
            L+AK H+  AKVDG+ YKL D+AYVK  EG+++YI  I+EMFE  +   YFTAQW+YRA+
Sbjct  91   LKAKFHYREAKVDGILYKLEDNAYVKGEEGKEDYIATIVEMFETPEEEQYFTAQWFYRAE  150

Query  741  DTVIKGCDEFVDKQRVFFSE  800
            DTVIK     VDK+R+F S+
Sbjct  151  DTVIKDHGNLVDKKRIFKSD  170



>ref|XP_010541913.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT3 [Tarenaya 
hassleriana]
Length=874

 Score =   130 bits (327),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 67/128 (52%), Positives = 89/128 (70%), Gaps = 7/128 (5%)
 Frame = +3

Query  429  SEFVGGPVLEEEAKQRWPHRYQKGTEKSNGVTRSITSQDEFAGVLQAKRHFTAAKVD-GL  605
            ++F+G PV EEEA++RWP RY +  +K    ++  T +D    ++QA+RHF  A VD   
Sbjct  77   AKFIGEPVPEEEARRRWPQRYHEKKKKLLAWSKK-TKEDHNEDIIQAQRHFRQALVDDSE  135

Query  606  FYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRAKDTVI---KGCDEFVD  776
             Y L  DA+V+AGEGE+ YIC+I+EMFE+VDG LYFTAQW+YRA DTVI     C   +D
Sbjct  136  TYDLYVDAHVEAGEGEEPYICKIVEMFESVDGTLYFTAQWFYRACDTVIGNQHTC--LID  193

Query  777  KQRVFFSE  800
             +RVFFSE
Sbjct  194  NKRVFFSE  201



>ref|XP_002530367.1| protein with unknown function [Ricinus communis]
 gb|EEF32028.1| protein with unknown function [Ricinus communis]
Length=845

 Score =   129 bits (325),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 71/156 (46%), Positives = 95/156 (61%), Gaps = 17/156 (11%)
 Frame = +3

Query  354  GNLVRSQASPPERKRITTNVTNDEDSEFVGGPVLEEEAKQRWPHRYQ-------KGTEKS  512
            G +    A P E K+       D D  F+G P+   EA+++WP RY+        G+E  
Sbjct  27   GPITLLSARPKETKKAKL----DADLSFIGNPISATEARKKWPQRYKSQISKVKNGSEPQ  82

Query  513  NGVTRSITSQDEFAGVLQAKRHFTAAKVDGLFYKLGDDAYVKAGEGEDNYICRIIEMFEA  692
            NGV     S+D+   V QAK H+  A VDG+ Y LGDDAYVKA +G+ +YI RI+EMFE+
Sbjct  83   NGVL----SKDD--DVTQAKCHYKQAMVDGILYDLGDDAYVKAEDGKPDYIARIVEMFES  136

Query  693  VDGALYFTAQWYYRAKDTVIKGCDEFVDKQRVFFSE  800
            +DG   FTAQW+YRA+DTVIK   +  + +RVF SE
Sbjct  137  IDGEPLFTAQWFYRAEDTVIKDYVKTAESRRVFLSE  172



>ref|NP_001280801.1| DNA (cytosine-5)-methyltransferase CMT3 [Malus domestica]
 gb|AFV99136.1| CMT-type cytosine DNA-methyltransferase 3b [Malus domestica]
Length=1096

 Score =   130 bits (326),  Expect = 6e-30, Method: Composition-based stats.
 Identities = 71/150 (47%), Positives = 97/150 (65%), Gaps = 12/150 (8%)
 Frame = +3

Query  363  VRSQASPPERKRITTNVT----NDEDSEFVGGPVLEEEAKQRWPHRYQKGTEKSNGVTRS  530
            V   ASPP R  +T  V     + E++ F+G P+ +EEA++++P RY     K NG   S
Sbjct  151  VDKAASPP-RNPVTQEVAAADDDGEEARFLGEPMEDEEARKQYPKRYVGKKPKMNGQNNS  209

Query  531  ITSQDEFAGVLQAKRHFTAAKVDGLFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALY  710
               +D    ++QA+ H+T A VDG+ Y L DDA+  +GE E+ YIC+I+EMFEA+ G LY
Sbjct  210  NDDED----IIQARCHYTKALVDGINYDLYDDAH--SGEKEEPYICKIVEMFEAIGGLLY  263

Query  711  FTAQWYYRAKDTVIKGCDEFVDKQRVFFSE  800
            FTAQWYYR++DTVIK C   V   RVFFS+
Sbjct  264  FTAQWYYRSRDTVIKHCTT-VACGRVFFSD  292



>ref|XP_011462220.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT3-like isoform 
X2 [Fragaria vesca subsp. vesca]
Length=923

 Score =   129 bits (323),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 66/128 (52%), Positives = 89/128 (70%), Gaps = 9/128 (7%)
 Frame = +3

Query  429  SEFVGGPVLEEEAKQRWPHRYQKG---TEKSNGVTRSITSQDEFAGVLQAKRHFTAAKVD  599
            ++F+G PV  EEA++RWPHRY K     +   G + +    +EF   ++A RHF+ A+VD
Sbjct  129  AKFLGEPVDPEEARRRWPHRYTKPPIPKKLPYGASNNADDDEEF---IEACRHFSKAEVD  185

Query  600  GLFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRAKDTVIKGCDEF-VD  776
            G  Y L DDA+VKAG+ E  YIC+I EMFEAVDG LYF AQW+YR+KDT I+  D + +D
Sbjct  186  GCVYDLYDDAHVKAGKNELPYICKITEMFEAVDGLLYFNAQWFYRSKDTAIE--DSYHID  243

Query  777  KQRVFFSE  800
             +RVF+SE
Sbjct  244  SKRVFYSE  251



>ref|XP_010091206.1| DNA (cytosine-5)-methyltransferase 1 [Morus notabilis]
 gb|EXB43461.1| DNA (cytosine-5)-methyltransferase 1 [Morus notabilis]
Length=851

 Score =   129 bits (323),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 70/142 (49%), Positives = 91/142 (64%), Gaps = 5/142 (4%)
 Frame = +3

Query  384  PERKRITTNVTNDEDSEFVGGPVLEEEAKQRWPHRYQKGTEKSNGVTRSITSQDEFAGVL  563
            P+R +   N   D +S+ VG PV  EEAKQ+WP RYQ G E++N      T  ++  G  
Sbjct  56   PKRMKAKRN-DGDSESKLVGDPVPMEEAKQKWPRRYQ-GKERTNSPKEKETETEDEDGDF  113

Query  564  QAKRHFTAAKVDGLFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRAKD  743
            QAK H+T A V+G+ + L DDAYVKA + + +YI RI+E FE VDG  YFTAQW+YRA+D
Sbjct  114  QAKSHYTQAMVEGVVFNLNDDAYVKAEDDKPDYIARIVEFFEGVDGERYFTAQWFYRAED  173

Query  744  TVIKGC---DEFVDKQRVFFSE  800
            T IK      +  DK+RVF SE
Sbjct  174  TPIKDLANHAQMFDKRRVFLSE  195



>ref|XP_006573534.1| PREDICTED: putative DNA (cytosine-5)-methyltransferase CMT1-like 
[Glycine max]
 gb|KHN35974.1| DNA (cytosine-5)-methyltransferase 3 [Glycine soja]
Length=833

 Score =   128 bits (322),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 66/140 (47%), Positives = 88/140 (63%), Gaps = 1/140 (1%)
 Frame = +3

Query  381  PPERKRITTNVTNDEDSEFVGGPVLEEEAKQRWPHRYQKGTEKSNGVTRSITSQDEFAGV  560
            P +RK+   +  N  D+ FVG P+   EA+ +WPHRY    +K      S     E + V
Sbjct  23   PSQRKKPKHSAPN-PDACFVGKPIPSAEARAKWPHRYPSEVKKKAPARSSEEVTSENSEV  81

Query  561  LQAKRHFTAAKVDGLFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRAK  740
            + A+ H+  AKVDG+ Y L DDAYVKA +G+ +YI RI+EMFE VD    F AQW+YRA+
Sbjct  82   MLARCHYRQAKVDGVVYNLYDDAYVKAEDGKPDYIARIVEMFETVDKEQCFMAQWFYRAE  141

Query  741  DTVIKGCDEFVDKQRVFFSE  800
            DTVIK   + VDK+RVF S+
Sbjct  142  DTVIKNHGDLVDKKRVFISD  161



>ref|XP_004288717.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT3-like isoform 
X1 [Fragaria vesca subsp. vesca]
Length=965

 Score =   129 bits (323),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 66/128 (52%), Positives = 89/128 (70%), Gaps = 9/128 (7%)
 Frame = +3

Query  429  SEFVGGPVLEEEAKQRWPHRYQKG---TEKSNGVTRSITSQDEFAGVLQAKRHFTAAKVD  599
            ++F+G PV  EEA++RWPHRY K     +   G + +    +EF   ++A RHF+ A+VD
Sbjct  171  AKFLGEPVDPEEARRRWPHRYTKPPIPKKLPYGASNNADDDEEF---IEACRHFSKAEVD  227

Query  600  GLFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRAKDTVIKGCDEF-VD  776
            G  Y L DDA+VKAG+ E  YIC+I EMFEAVDG LYF AQW+YR+KDT I+  D + +D
Sbjct  228  GCVYDLYDDAHVKAGKNELPYICKITEMFEAVDGLLYFNAQWFYRSKDTAIE--DSYHID  285

Query  777  KQRVFFSE  800
             +RVF+SE
Sbjct  286  SKRVFYSE  293



>ref|XP_006470820.1| PREDICTED: DNA (cytosine-5)-methyltransferase 1-like [Citrus 
sinensis]
Length=845

 Score =   127 bits (320),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 68/136 (50%), Positives = 90/136 (66%), Gaps = 7/136 (5%)
 Frame = +3

Query  393  KRITTNVTNDEDSEFVGGPVLEEEAKQRWPHRYQKGTEKSNGVTRSITSQDEFAGVLQAK  572
            K+ T     D D  FVG PV  +EA +R+P RY+     S+   R++  ++E   VLQA+
Sbjct  58   KKKTQKNKPDSDLFFVGPPVSVDEALKRYPDRYKY----SSSGRRALNEEEE---VLQAR  110

Query  573  RHFTAAKVDGLFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRAKDTVI  752
             H+T A VDG  Y LGDDAYVKA EG  +YI RI+E+FE+VDG  YF A+W+YRA+DTVI
Sbjct  111  CHYTQASVDGCLYNLGDDAYVKAEEGAVDYIARIVELFESVDGEPYFKARWFYRAEDTVI  170

Query  753  KGCDEFVDKQRVFFSE  800
            K     VD++RVF S+
Sbjct  171  KDLAYLVDRKRVFLSD  186



>gb|KHN40382.1| DNA (cytosine-5)-methyltransferase 1 [Glycine soja]
Length=705

 Score =   127 bits (319),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 66/109 (61%), Positives = 82/109 (75%), Gaps = 5/109 (5%)
 Frame = +3

Query  477  WPHRYQKGTEKSNGVTRSITSQDEFAGVLQAKRHFTAAKVDG-LFYKLGDDAYVKAGEGE  653
            +P R + G    NG TR    +DE   + QA+RH+T A+VDG + YKL DDA+VKA EGE
Sbjct  14   FPTR-KPGAAGRNG-TRKRNDEDE--EIQQARRHYTQAEVDGCMLYKLYDDAHVKAEEGE  69

Query  654  DNYICRIIEMFEAVDGALYFTAQWYYRAKDTVIKGCDEFVDKQRVFFSE  800
            DNYIC+I+E+FEA+DGALYFTAQWYYRAKDTVIK     ++ +RVFFSE
Sbjct  70   DNYICKIVEIFEAIDGALYFTAQWYYRAKDTVIKKLAYLIEPKRVFFSE  118



>ref|XP_006431407.1| hypothetical protein CICLE_v10000251mg [Citrus clementina]
 gb|ESR44647.1| hypothetical protein CICLE_v10000251mg [Citrus clementina]
Length=859

 Score =   127 bits (320),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 72/142 (51%), Positives = 94/142 (66%), Gaps = 7/142 (5%)
 Frame = +3

Query  393  KRITTNVTNDEDSEFVGGPVLEEEAKQRWPHRYQ---KGTEK---SNGVTRSITSQDEFA  554
            K+ T     D D  FV  PV  +EA +R+P RY+   KG +K   + GV+ SI + +E  
Sbjct  58   KKKTQKNKPDSDLFFVSPPVSADEALKRYPDRYKYSSKGHKKKKVAAGVS-SIGALNEEE  116

Query  555  GVLQAKRHFTAAKVDGLFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYR  734
             VLQA+ H+T A VDG  Y LGDDAYVKA EG  +YI RI+E+FE+VDG  YF A+W+YR
Sbjct  117  EVLQARCHYTQASVDGCLYNLGDDAYVKAEEGAVDYIARIVELFESVDGEPYFKARWFYR  176

Query  735  AKDTVIKGCDEFVDKQRVFFSE  800
            A+DTVIK     VD++RVF S+
Sbjct  177  AEDTVIKDLACLVDRKRVFLSD  198



>ref|XP_007041239.1| Chromomethylase 1, putative [Theobroma cacao]
 gb|EOX97070.1| Chromomethylase 1, putative [Theobroma cacao]
Length=844

 Score =   127 bits (320),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 68/132 (52%), Positives = 86/132 (65%), Gaps = 4/132 (3%)
 Frame = +3

Query  411  VTNDEDSEFVGGPVLEEEAKQRWPHRYQ-KGTEKSNGVTRSITSQDEFAGVLQAKRHFTA  587
            V  D +   VG  +  +EA++RWP RYQ K   K   VT   TS DE   VLQA+ H+  
Sbjct  43   VARDAELCLVGPSIAADEARRRWPLRYQSKNKVKKQAVTE--TSNDEEDDVLQARNHYDK  100

Query  588  AKVDGLFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRAKDTVI-KGCD  764
            AKVDG  YKLGD+AYV+A +G  NYI RI+E+FE +D   YF AQW+YRA+DTVI K   
Sbjct  101  AKVDGCLYKLGDNAYVQAEDGNLNYIARIVELFETIDKKPYFKAQWFYRAEDTVINKDNA  160

Query  765  EFVDKQRVFFSE  800
              +DK+RVF S+
Sbjct  161  HLLDKRRVFLSD  172



>dbj|BAC53936.1| chromomethylase-like protein [Nicotiana tabacum]
Length=741

 Score =   127 bits (318),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 57/91 (63%), Positives = 71/91 (78%), Gaps = 0/91 (0%)
 Frame = +3

Query  528  SITSQDEFAGVLQAKRHFTAAKVDGLFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGAL  707
            ++  QD+   ++QAK HFT A VDG  Y LGDDAYV+A   ED+YIC+I+E F+AVDG  
Sbjct  2    TLNDQDDGDQLIQAKCHFTQAVVDGQIYNLGDDAYVQASSDEDDYICKIVEFFQAVDGMQ  61

Query  708  YFTAQWYYRAKDTVIKGCDEFVDKQRVFFSE  800
            YFTAQW+YRAKDTVIK  D+F+D +RVFFSE
Sbjct  62   YFTAQWFYRAKDTVIKAHDQFIDNKRVFFSE  92



>gb|AFK80345.1| chromomethylase 3 [Nicotiana benthamiana]
Length=740

 Score =   127 bits (318),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 57/90 (63%), Positives = 70/90 (78%), Gaps = 0/90 (0%)
 Frame = +3

Query  531  ITSQDEFAGVLQAKRHFTAAKVDGLFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALY  710
            +  QD+   ++QAK HFT A VDG  Y LGDDAYV+A   ED+YIC+I+E F+AVDG  Y
Sbjct  3    LNDQDDADHLIQAKCHFTQAVVDGQIYNLGDDAYVQASNDEDDYICKIVEFFQAVDGTQY  62

Query  711  FTAQWYYRAKDTVIKGCDEFVDKQRVFFSE  800
            FTAQW+YRAKDTVIK  D+F+D +RVFFSE
Sbjct  63   FTAQWFYRAKDTVIKAHDQFIDNKRVFFSE  92



>ref|XP_004149031.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT3-like [Cucumis 
sativus]
 gb|KGN66422.1| hypothetical protein Csa_1G604080 [Cucumis sativus]
Length=855

 Score =   127 bits (318),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 63/128 (49%), Positives = 84/128 (66%), Gaps = 3/128 (2%)
 Frame = +3

Query  417  NDEDSEFVGGPVLEEEAKQRWPHRYQKGTEKSNGVTRSITSQDEFAGVLQAKRHFTAAKV  596
            +D  + F+     + +A+ RWP RY +  +          S+D+   V+QA  H++ AKV
Sbjct  64   DDAPARFLQPHFPDSDARVRWPLRYARKKKNV---VEEKKSRDDSEEVIQALHHYSQAKV  120

Query  597  DGLFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRAKDTVIKGCDEFVD  776
            D + Y L DDA+VKA   ED+YIC+IIEMFEAVDG LYFTAQWYYRAKDTV+K     ++
Sbjct  121  DNITYNLLDDAHVKAEGEEDDYICKIIEMFEAVDGQLYFTAQWYYRAKDTVVKDHAHLIN  180

Query  777  KQRVFFSE  800
             +RVFFSE
Sbjct  181  DKRVFFSE  188



>ref|XP_010936992.1| PREDICTED: DNA (cytosine-5)-methyltransferase 1-like [Elaeis 
guineensis]
Length=925

 Score =   127 bits (319),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 62/132 (47%), Positives = 85/132 (64%), Gaps = 4/132 (3%)
 Frame = +3

Query  417  NDEDSEFVGGPVLEEEAKQRWPHRYQKGTEKSNGVTRSITSQDEFAGVLQAKRHFTAAKV  596
            N+ +  FVG PV ++EAK+RWP RYQ+       +  + + + +   VL+A+RH+  A V
Sbjct  124  NEVEHCFVGEPVPDDEAKKRWPERYQRKNAGKRALASASSKKSDEEEVLKARRHYWQAMV  183

Query  597  DGLFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRAKDTVIKGCDE---  767
            D + Y L DDAY+KAG+GE +YI RI+E FE  DG LYF AQW++RA+DTVIK       
Sbjct  184  DNVIYNLNDDAYIKAGDGEPDYIGRIVEFFETTDGQLYFAAQWFFRAEDTVIKEIAHDPK  243

Query  768  -FVDKQRVFFSE  800
               D +RVF SE
Sbjct  244  TVHDPRRVFLSE  255



>gb|KDP34481.1| hypothetical protein JCGZ_12764 [Jatropha curcas]
Length=848

 Score =   127 bits (318),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 68/155 (44%), Positives = 96/155 (62%), Gaps = 10/155 (6%)
 Frame = +3

Query  348  AGGN---LVRSQASPPERKRITTNVTNDEDSEFVGGPVLEEEAKQRWPHRYQKGTEKSNG  518
            AGG+   L+ S+A   ++ R+ + ++       VG P+   EA++ WP RYQ   +    
Sbjct  20   AGGDPITLLSSRAKKTKKARVNSELS------LVGKPIPAAEARKNWPLRYQSQNKVKGS  73

Query  519  VTRSITSQD-EFAGVLQAKRHFTAAKVDGLFYKLGDDAYVKAGEGEDNYICRIIEMFEAV  695
            VT +   +  E   +LQAK H+  A VDG+ Y LG+DAYVKA +G  NYI RI+E+FEAV
Sbjct  74   VTGTADGESREAEDLLQAKYHYKQATVDGILYNLGEDAYVKADDGSPNYIARIVELFEAV  133

Query  696  DGALYFTAQWYYRAKDTVIKGCDEFVDKQRVFFSE  800
            +G  YFTAQW+YR +DTVIK   +  + +RVF SE
Sbjct  134  NGEPYFTAQWFYRTEDTVIKDHVQPAESRRVFLSE  168



>gb|KHN41840.1| DNA (cytosine-5)-methyltransferase 1 [Glycine soja]
Length=823

 Score =   126 bits (317),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 61/139 (44%), Positives = 87/139 (63%), Gaps = 0/139 (0%)
 Frame = +3

Query  384  PERKRITTNVTNDEDSEFVGGPVLEEEAKQRWPHRYQKGTEKSNGVTRSITSQDEFAGVL  563
            P ++    +  ++ ++ F G P+   EA  +WPHRY    +K      S  +  E + V+
Sbjct  21   PSQRNKAKHPNSNSNACFAGKPIPPAEALAKWPHRYPSEGKKKGSARNSKEATSENSEVM  80

Query  564  QAKRHFTAAKVDGLFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRAKD  743
             A+ H+  AKVDG+ Y L DDAYVKA +G+ +YI RI+EMFE VD    FTAQW+YRA+D
Sbjct  81   PARCHYRQAKVDGVVYNLYDDAYVKAEDGKPDYIARIVEMFETVDKEQCFTAQWFYRAED  140

Query  744  TVIKGCDEFVDKQRVFFSE  800
            TVIK   + VDK+R+F S+
Sbjct  141  TVIKNHGDLVDKKRIFISD  159



>gb|KDO42578.1| hypothetical protein CISIN_1g0039742mg, partial [Citrus sinensis]
Length=401

 Score =   123 bits (309),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 63/127 (50%), Positives = 83/127 (65%), Gaps = 14/127 (11%)
 Frame = +3

Query  420  DEDSEFVGGPVLEEEAKQRWPHRYQKGTEKSNGVTRSITSQDEFAGVLQAKRHFTAAKVD  599
            D D  FV  PV  +EA +R+P RY           +++  ++E   VLQA+ H+T A VD
Sbjct  67   DSDLFFVSPPVSADEALKRYPDRY-----------KALNEEEE---VLQARCHYTQASVD  112

Query  600  GLFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRAKDTVIKGCDEFVDK  779
            G  Y LGDDAYVKA EG  +YI RI+E+FE+VDG  YF A+W+YRA+DTVIK     VD+
Sbjct  113  GCLYNLGDDAYVKAEEGAVDYIARIVELFESVDGEPYFKARWFYRAEDTVIKDLACLVDR  172

Query  780  QRVFFSE  800
            +RVF S+
Sbjct  173  KRVFLSD  179



>ref|XP_006590741.1| PREDICTED: putative DNA (cytosine-5)-methyltransferase CMT1-like 
[Glycine max]
Length=832

 Score =   126 bits (316),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 61/139 (44%), Positives = 87/139 (63%), Gaps = 0/139 (0%)
 Frame = +3

Query  384  PERKRITTNVTNDEDSEFVGGPVLEEEAKQRWPHRYQKGTEKSNGVTRSITSQDEFAGVL  563
            P ++    +  ++ ++ F G P+   EA  +WPHRY    +K      S  +  E + V+
Sbjct  21   PSQRNKAKHPNSNSNACFAGKPIPPAEALAKWPHRYPSEGKKKGSARTSKEATSENSEVM  80

Query  564  QAKRHFTAAKVDGLFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRAKD  743
             A+ H+  AKVDG+ Y L DDAYVKA +G+ +YI RI+EMFE VD    FTAQW+YRA+D
Sbjct  81   PARCHYRQAKVDGVVYNLYDDAYVKAEDGKPDYIARIVEMFETVDKEQCFTAQWFYRAED  140

Query  744  TVIKGCDEFVDKQRVFFSE  800
            TVIK   + VDK+R+F S+
Sbjct  141  TVIKNHGDLVDKKRIFISD  159



>gb|ABW96889.1| CMT-type DNA-methyltransferase [Elaeis guineensis]
Length=925

 Score =   126 bits (316),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 61/126 (48%), Positives = 82/126 (65%), Gaps = 4/126 (3%)
 Frame = +3

Query  435  FVGGPVLEEEAKQRWPHRYQKGTEKSNGVTRSITSQDEFAGVLQAKRHFTAAKVDGLFYK  614
            FVG PV ++EAK+RWP RYQ+       +  + + + +   VL+A+RH+  A VD + Y 
Sbjct  130  FVGEPVPDDEAKKRWPERYQRKNAGKRALASASSKKSDEEEVLKARRHYWQAMVDNVIYN  189

Query  615  LGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRAKDTVIKGCDE----FVDKQ  782
            L DDAY+KAG+GE +YI RI+E FE  DG LYF AQW++RA+DTVIK          D +
Sbjct  190  LNDDAYIKAGDGEPDYIGRIVEFFETTDGQLYFAAQWFFRAEDTVIKEIAHDPKTVHDPR  249

Query  783  RVFFSE  800
            RVF SE
Sbjct  250  RVFLSE  255



>gb|AIO05713.1| CMT-type DNA-methyltransferase, partial [Cocos nucifera]
Length=579

 Score =   124 bits (311),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 62/132 (47%), Positives = 82/132 (62%), Gaps = 4/132 (3%)
 Frame = +3

Query  417  NDEDSEFVGGPVLEEEAKQRWPHRYQKGTEKSNGVTRSITSQDEFAGVLQAKRHFTAAKV  596
            N+ +  FVG PVL+ EAK+RWP RYQ+       +    + + +   VLQA+RH+  A V
Sbjct  46   NEVEHCFVGDPVLDAEAKKRWPERYQRKNAGKRALASGSSKKSDEEEVLQARRHYWQAMV  105

Query  597  DGLFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRAKDTVIKGCDE---  767
            D + Y L DDAY+KAG+GE +YI RI+E FE  D  LYF AQW++R +DTVIK       
Sbjct  106  DNVIYNLNDDAYIKAGDGEPDYIGRIVEFFETTDRELYFAAQWFFRVEDTVIKELAHDPK  165

Query  768  -FVDKQRVFFSE  800
               D +RVF SE
Sbjct  166  TVHDPRRVFLSE  177



>ref|XP_002299134.2| hypothetical protein POPTR_0001s04700g [Populus trichocarpa]
 gb|EEE83939.2| hypothetical protein POPTR_0001s04700g [Populus trichocarpa]
Length=970

 Score =   125 bits (315),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 58/123 (47%), Positives = 86/123 (70%), Gaps = 3/123 (2%)
 Frame = +3

Query  435  FVGGPVLEEEAKQRWPHRYQKGTEKSNGVTRSITSQDEFAGVLQAKRHFTAAKVDGLFYK  614
            FVG  V + EA+++WPHRY    +    +++   S D+   +++A+ H+  A+VDG+ Y 
Sbjct  185  FVGNQVPDAEARKKWPHRYANKIKNKTPISKPSNSLDDSEEIIKARCHYKRAEVDGIIYN  244

Query  615  LGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRAKDTVIKGCDEFV-DKQRVF  791
            L DDA+V+A +GE +YICRIIEMFE+ D   +FTAQWYYR+ DT+IK  D+++ D + VF
Sbjct  245  LYDDAHVQASDGEADYICRIIEMFESEDRTPHFTAQWYYRSTDTIIK--DKYISDPKCVF  302

Query  792  FSE  800
            FSE
Sbjct  303  FSE  305



>ref|XP_004512254.1| PREDICTED: putative DNA (cytosine-5)-methyltransferase CMT1-like 
[Cicer arietinum]
Length=882

 Score =   125 bits (314),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 68/140 (49%), Positives = 87/140 (62%), Gaps = 6/140 (4%)
 Frame = +3

Query  381  PPERKRITTNVTNDEDSEFVGGPVLEEEAKQRWPHRYQKGTEKSNGVTRSITSQDEFAGV  560
            P +RK+   +  N   + FVG P+   EA+ +WP RY K  EK +    S  S       
Sbjct  19   PSQRKKAKHSRVNPV-ACFVGKPIPNAEAQSKWPRRYSKKGEKGSSNDGSNESD-----C  72

Query  561  LQAKRHFTAAKVDGLFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRAK  740
            LQAK H+  A VDG+ YKL D+AYVKA +G+ +YI RI+EMFE  D   YFTAQW+YRA+
Sbjct  73   LQAKCHYREANVDGVIYKLNDNAYVKAEDGKPDYIARIVEMFETPDKEHYFTAQWFYRAE  132

Query  741  DTVIKGCDEFVDKQRVFFSE  800
            DTVIK     VDK+RVF S+
Sbjct  133  DTVIKDHGNLVDKKRVFISD  152



>ref|XP_011037978.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT3 isoform X1 
[Populus euphratica]
Length=966

 Score =   125 bits (314),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 58/125 (46%), Positives = 87/125 (70%), Gaps = 3/125 (2%)
 Frame = +3

Query  429  SEFVGGPVLEEEAKQRWPHRYQKGTEKSNGVTRSITSQDEFAGVLQAKRHFTAAKVDGLF  608
            + FVG  V + EA+++WPHRY    +    +++   S D+   +++A+ H+  A+VDG+ 
Sbjct  180  ARFVGNQVPDAEARKKWPHRYANKIKNKTPISKPSNSLDDSEEIVKARCHYKRAEVDGII  239

Query  609  YKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRAKDTVIKGCDEFV-DKQR  785
            Y L DDA+V+A +GE +YICRIIEMFE+ D   +FTAQWYYR+ DT+IK  D+++ D + 
Sbjct  240  YNLYDDAHVQASDGEADYICRIIEMFESEDRTPHFTAQWYYRSTDTIIK--DKYILDPKC  297

Query  786  VFFSE  800
            VFFSE
Sbjct  298  VFFSE  302



>ref|XP_011037979.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT3 isoform X2 
[Populus euphratica]
Length=951

 Score =   125 bits (313),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 58/125 (46%), Positives = 87/125 (70%), Gaps = 3/125 (2%)
 Frame = +3

Query  429  SEFVGGPVLEEEAKQRWPHRYQKGTEKSNGVTRSITSQDEFAGVLQAKRHFTAAKVDGLF  608
            + FVG  V + EA+++WPHRY    +    +++   S D+   +++A+ H+  A+VDG+ 
Sbjct  165  ARFVGNQVPDAEARKKWPHRYANKIKNKTPISKPSNSLDDSEEIVKARCHYKRAEVDGII  224

Query  609  YKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRAKDTVIKGCDEFV-DKQR  785
            Y L DDA+V+A +GE +YICRIIEMFE+ D   +FTAQWYYR+ DT+IK  D+++ D + 
Sbjct  225  YNLYDDAHVQASDGEADYICRIIEMFESEDRTPHFTAQWYYRSTDTIIK--DKYILDPKC  282

Query  786  VFFSE  800
            VFFSE
Sbjct  283  VFFSE  287



>emb|CAQ18903.1| chromomethylase [Nicotiana sylvestris]
 emb|CAQ18904.1| chromomethylase [Nicotiana sylvestris]
 emb|CAQ18905.1| chromomethylase [Nicotiana sylvestris]
 emb|CAQ18906.1| chromomethylase [Nicotiana sylvestris]
Length=741

 Score =   124 bits (310),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 70/91 (77%), Gaps = 0/91 (0%)
 Frame = +3

Query  528  SITSQDEFAGVLQAKRHFTAAKVDGLFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGAL  707
            ++  QD+   ++QAK HF  A VDG  Y LGDDAYV+A   ED+YIC+I+E F+AVDG  
Sbjct  2    TLNDQDDADQLIQAKCHFAQAVVDGQIYNLGDDAYVQASNDEDDYICKIVEFFQAVDGMQ  61

Query  708  YFTAQWYYRAKDTVIKGCDEFVDKQRVFFSE  800
            YFTAQW+YRAKDTVIK  D+F++ +RVFFSE
Sbjct  62   YFTAQWFYRAKDTVIKAHDQFINNKRVFFSE  92



>ref|XP_008797880.1| PREDICTED: DNA (cytosine-5)-methyltransferase 1-like [Phoenix 
dactylifera]
Length=928

 Score =   124 bits (311),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 62/132 (47%), Positives = 84/132 (64%), Gaps = 4/132 (3%)
 Frame = +3

Query  417  NDEDSEFVGGPVLEEEAKQRWPHRYQKGTEKSNGVTRSITSQDEFAGVLQAKRHFTAAKV  596
            N+ +  FVG PV ++EAK+RWP RY K            + + +   V++A+RH+  A V
Sbjct  127  NEVEHCFVGDPVPDDEAKKRWPERYHKKNAGKRAPASGSSKKVDEEEVVKARRHYWQAMV  186

Query  597  DGLFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRAKDTVIK----GCD  764
            D + Y L DDAY+KAG+GE +YI RI+E FE +D  LYFTAQW++RA+DTVIK    G  
Sbjct  187  DNVIYNLNDDAYIKAGDGEPDYIGRIVEFFETIDRQLYFTAQWFFRAEDTVIKELAHGPK  246

Query  765  EFVDKQRVFFSE  800
               D +RVF SE
Sbjct  247  TVHDPRRVFLSE  258



>gb|AIU80190.1| chromomethylase [Hevea brasiliensis]
Length=851

 Score =   124 bits (310),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 64/139 (46%), Positives = 86/139 (62%), Gaps = 2/139 (1%)
 Frame = +3

Query  390  RKRITTNVTNDEDSEFVGGPVLEEEAKQRWPHRYQKGTE-KSNGVTRSIT-SQDEFAGVL  563
            R + T     D +   VG P+   EA+++WP RY+   + K   V  S   +  E   VL
Sbjct  31   RAKKTKKAKLDSELSLVGNPIPAAEARKKWPLRYKSQNKVKKGAVPESANGASGEEEDVL  90

Query  564  QAKRHFTAAKVDGLFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRAKD  743
            QAK H+T A VD + YKLGDDAYVKA +G  +YI RI+E+FE ++G  YFTAQW+YR +D
Sbjct  91   QAKCHYTQAMVDNVLYKLGDDAYVKADDGSPDYIARIVELFETIEGEPYFTAQWFYRTED  150

Query  744  TVIKGCDEFVDKQRVFFSE  800
            TVIK   +  + +RVF SE
Sbjct  151  TVIKDHAQSTESRRVFLSE  169



>gb|KEH28933.1| DNA (cytosine-5)-methyltransferase CMT1 [Medicago truncatula]
Length=843

 Score =   123 bits (309),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 63/142 (44%), Positives = 88/142 (62%), Gaps = 15/142 (11%)
 Frame = +3

Query  384  PERKRIT---TNVTNDEDSEFVGGPVLEEEAKQRWPHRYQKGTEKSNGVTRSITSQDEFA  554
            P R+R     ++V N +DS F+G P L +EAK RWPHRY K    S+  T          
Sbjct  42   PSRRRKAAQRSSVVNADDSFFIGDPFLADEAKTRWPHRYAKNDGSSDDDT----------  91

Query  555  GVLQAKRHFTAAKVDGLFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYR  734
              ++AK H+    VDG+ YKL D+AYVK  EG++NYI  I+E+F   +   YFTAQW+YR
Sbjct  92   --VKAKFHYREVNVDGVIYKLNDNAYVKGEEGKENYIAAIVELFVTHENEYYFTAQWFYR  149

Query  735  AKDTVIKGCDEFVDKQRVFFSE  800
            A+DTVIK   + +D++R+F S+
Sbjct  150  AEDTVIKNHGDLIDEKRIFKSD  171



>emb|CBI16477.3| unnamed protein product [Vitis vinifera]
Length=821

 Score =   123 bits (308),  Expect = 8e-28, Method: Composition-based stats.
 Identities = 57/126 (45%), Positives = 86/126 (68%), Gaps = 5/126 (4%)
 Frame = +3

Query  426  DSEFVGGPVLEEEAKQRWPHRYQKGTEKSNGVTRSITSQDEFAGVLQAKRHFTAAKVDG-  602
            D   VG  + +EEA+QRWP RY+    ++       +++D+   +++A+ H+  A++DG 
Sbjct  10   DCRLVGEVIPDEEARQRWPERYEPKVYRN----WFCSTKDDSEEIVKARCHYRQAEIDGR  65

Query  603  LFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRAKDTVIKGCDEFVDKQ  782
            +   L DDA+VKAG+  D+YIC+I+E+F A+DG  YFTAQW+YRA+DTVIK     +D +
Sbjct  66   VIVNLNDDAHVKAGDNADHYICKIVELFVALDGTPYFTAQWFYRARDTVIKDHANLIDNK  125

Query  783  RVFFSE  800
            RVFFSE
Sbjct  126  RVFFSE  131



>ref|XP_007157973.1| hypothetical protein PHAVU_002G113900g [Phaseolus vulgaris]
 gb|ESW29967.1| hypothetical protein PHAVU_002G113900g [Phaseolus vulgaris]
Length=838

 Score =   122 bits (307),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 62/141 (44%), Positives = 90/141 (64%), Gaps = 2/141 (1%)
 Frame = +3

Query  381  PPERKRITTNVTNDEDSEFVGGPVLEEEAKQRWPHRY-QKGTEKSNGVTRSITSQDEFAG  557
            P +RK+   +  N     FVG P+   EA+ +WPHRY  +G +K +  + S  +  E   
Sbjct  21   PSQRKKAKLSSPNPVVC-FVGKPIPVTEARAKWPHRYPSEGKKKGSSASISKEATGEDNE  79

Query  558  VLQAKRHFTAAKVDGLFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRA  737
            V+ A  H+  AK+DG+ + L DDAYVKA +G+ +YI RI+E+F  VD  +YF A+W+YRA
Sbjct  80   VMLATCHYRQAKIDGVVFNLHDDAYVKAEDGKPDYIARIVELFATVDNGMYFMARWFYRA  139

Query  738  KDTVIKGCDEFVDKQRVFFSE  800
            +DTVIK   + VDK+RVF S+
Sbjct  140  EDTVIKSHGDLVDKKRVFLSD  160



>emb|CBI29991.3| unnamed protein product [Vitis vinifera]
Length=827

 Score =   122 bits (307),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 62/129 (48%), Positives = 89/129 (69%), Gaps = 9/129 (7%)
 Frame = +3

Query  426  DSEFVGGPVLEEEAKQRWPHRY----QKGTEKSNGVTRSITSQDEFAGVLQAKRHFTAAK  593
            ++  VG P+   EA+Q+WP RY    +KG++ S     SI ++D    +LQA+RHFT A 
Sbjct  30   EASVVGAPISVNEARQKWPQRYISTFRKGSD-SRTKDESIEAED----ILQARRHFTEAV  84

Query  594  VDGLFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRAKDTVIKGCDEFV  773
            VDG  YKL D AYVKA +G+ ++I +I+E+FE +D   YFTAQW++RA+DTVIK     V
Sbjct  85   VDGCIYKLYDYAYVKAEDGQPDFIAKIVELFETIDREPYFTAQWFFRAEDTVIKDHAHLV  144

Query  774  DKQRVFFSE  800
            D++RVF+S+
Sbjct  145  DQKRVFYSD  153



>ref|XP_010316153.1| PREDICTED: DNA (cytosine-5)-methyltransferase 1 isoform X2 [Solanum 
lycopersicum]
Length=744

 Score =   122 bits (306),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 69/91 (76%), Gaps = 0/91 (0%)
 Frame = +3

Query  528  SITSQDEFAGVLQAKRHFTAAKVDGLFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGAL  707
            S+  Q +   ++QAK HF  A VD + YKLGDDAYVKA E ED+YIC+I+E F+ VD   
Sbjct  2    SLNCQHDSDELIQAKCHFAQALVDNVIYKLGDDAYVKAAEDEDDYICKIVEFFQGVDDMK  61

Query  708  YFTAQWYYRAKDTVIKGCDEFVDKQRVFFSE  800
            YFTAQW+YRAKDTVIK  D+F+DK+RVF S+
Sbjct  62   YFTAQWFYRAKDTVIKAHDQFIDKKRVFLSD  92



>ref|XP_002275932.1| PREDICTED: putative DNA (cytosine-5)-methyltransferase CMT1 [Vitis 
vinifera]
Length=829

 Score =   122 bits (305),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 62/131 (47%), Positives = 89/131 (68%), Gaps = 11/131 (8%)
 Frame = +3

Query  426  DSEFVGGPVLEEEAKQRWPHRY------QKGTEKSNGVTRSITSQDEFAGVLQAKRHFTA  587
            ++  VG P+   EA+Q+WP RY      +KG++ S     SI ++D    +LQA+RHFT 
Sbjct  30   EASVVGAPISVNEARQKWPQRYISTNKFRKGSD-SRTKDESIEAED----ILQARRHFTE  84

Query  588  AKVDGLFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRAKDTVIKGCDE  767
            A VDG  YKL D AYVKA +G+ ++I +I+E+FE +D   YFTAQW++RA+DTVIK    
Sbjct  85   AVVDGCIYKLYDYAYVKAEDGQPDFIAKIVELFETIDREPYFTAQWFFRAEDTVIKDHAH  144

Query  768  FVDKQRVFFSE  800
             VD++RVF+S+
Sbjct  145  LVDQKRVFYSD  155



>gb|AEP33250.1| CMT-type DNA-methyltransferase [Posidonia oceanica]
Length=802

 Score =   122 bits (305),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 59/127 (46%), Positives = 80/127 (63%), Gaps = 3/127 (2%)
 Frame = +3

Query  420  DEDSEFVGGPVLEEEAKQRWPHRYQKGTEKSNGVTRSITSQDEFAGVLQAKRHFTAAKVD  599
            D D  FVG P+ + EA++RWP RY K   + N +T     + E    L AK H+  A+V+
Sbjct  15   DHDCRFVGTPIPDGEARRRWPARYPKKPRQGNSITNGAAFEYE---DLLAKCHYERAEVE  71

Query  600  GLFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRAKDTVIKGCDEFVDK  779
            G  Y L DD YVKA  G+ +YI RI+E FEA+DG  YFTAQW++R +DT+I    +F D+
Sbjct  72   GFVYNLHDDVYVKAETGKPDYIGRIVEFFEAIDGEYYFTAQWFFRVEDTIIGSVGDFHDR  131

Query  780  QRVFFSE  800
             RVF S+
Sbjct  132  CRVFLSD  138



>ref|XP_010651344.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT3 [Vitis vinifera]
Length=965

 Score =   122 bits (305),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 60/129 (47%), Positives = 85/129 (66%), Gaps = 6/129 (5%)
 Frame = +3

Query  426  DSEFVGGPVLEEEAKQRWPHRYQ---KGTEKSNGVTRSITSQDEFAGVLQAKRHFTAAKV  596
            D   VG  + +EEA+QRWP RY+   K T+ S   +       E   +++A+ H+  A++
Sbjct  162  DCRLVGEVIPDEEARQRWPERYEPKKKNTQASGSKSSKDKDDSE--EIVKARCHYRQAEI  219

Query  597  DG-LFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRAKDTVIKGCDEFV  773
            DG +   L DDA+VKAG+  D+YIC+I+E+F A+DG  YFTAQW+YRA+DTVIK     +
Sbjct  220  DGRVIVNLNDDAHVKAGDNADHYICKIVELFVALDGTPYFTAQWFYRARDTVIKDHANLI  279

Query  774  DKQRVFFSE  800
            D +RVFFSE
Sbjct  280  DNKRVFFSE  288



>gb|AAK71870.1| chromomethylase 3 [Arabidopsis thaliana]
Length=839

 Score =   121 bits (304),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 59/126 (47%), Positives = 84/126 (67%), Gaps = 2/126 (2%)
 Frame = +3

Query  429  SEFVGGPVLEEEAKQRWPHRYQK-GTEKSNGVTRSITSQDEFAGVLQAKRHFTAAKVDG-  602
            + F+  P+ E EAK  WP RY+    +     +R  T  DE   +++A+ H+  A VD  
Sbjct  48   ARFLDEPIPESEAKSTWPDRYKPIEVQPPKASSRKKTKDDEKVEIIRARCHYRRAIVDER  107

Query  603  LFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRAKDTVIKGCDEFVDKQ  782
              Y+L DDAYV++GEG+D +IC+IIEMFE V+G LYFTA+W+YR  DTV+K  +  ++K+
Sbjct  108  QIYELNDDAYVQSGEGKDPFICKIIEMFEGVNGKLYFTARWFYRPSDTVMKEFEILINKK  167

Query  783  RVFFSE  800
            RVFFSE
Sbjct  168  RVFFSE  173



>ref|XP_002888734.1| chromomethylase CMT3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64993.1| chromomethylase CMT3 [Arabidopsis lyrata subsp. lyrata]
Length=838

 Score =   121 bits (303),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 59/126 (47%), Positives = 83/126 (66%), Gaps = 2/126 (2%)
 Frame = +3

Query  429  SEFVGGPVLEEEAKQRWPHRYQKGT-EKSNGVTRSITSQDEFAGVLQAKRHFTAAKVDG-  602
            + F+  P+ E EAK  WP RY+  T +K    +R+ T  DE   +++A+ H+  A VD  
Sbjct  48   ARFLDEPIPESEAKSTWPDRYKPITVQKPKAPSRNTTKDDEKDKIIRARCHYRRAIVDER  107

Query  603  LFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRAKDTVIKGCDEFVDKQ  782
              Y+L DDAYV+AGEG   ++C+I+EMFE  +G LYFTA+W+YRA DTV+K     +D +
Sbjct  108  QIYELNDDAYVQAGEGNQPFVCKIVEMFEGANGKLYFTARWFYRADDTVMKQFKILIDDK  167

Query  783  RVFFSE  800
            RVFFSE
Sbjct  168  RVFFSE  173



>ref|XP_011459545.1| PREDICTED: LOW QUALITY PROTEIN: DNA (cytosine-5)-methyltransferase 
CMT3-like [Fragaria vesca subsp. vesca]
Length=800

 Score =   120 bits (300),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 56/124 (45%), Positives = 83/124 (67%), Gaps = 2/124 (2%)
 Frame = +3

Query  435  FVGGPVLEEEAKQRWPHRYQKGTEKSNGVTRSITSQDEFAGVLQAKRHFTAAKVDGLFYK  614
            F+G P+ ++EA++RWP+RYQ   +K     +     +     +QA  H+  A+VDG+ Y 
Sbjct  36   FIGPPIPDDEARKRWPNRYQALKKKKVSRPKGGNKDEIDENSIQAMCHYVKAQVDGIVYN  95

Query  615  LGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRAKDTVIKGCDEFV--DKQRV  788
            L DDAYVKAG+G++ YIC+IIE F+   G++Y T+QWYYRAKDTVI+ C   V  + +R+
Sbjct  96   LLDDAYVKAGDGKEPYICKIIEFFKGEGGSMYVTSQWYYRAKDTVIEDCAGTVGIESKRI  155

Query  789  FFSE  800
            FF +
Sbjct  156  FFXD  159



>ref|NP_177135.1| DNA (cytosine-5)-methyltransferase CMT3 [Arabidopsis thaliana]
 sp|Q94F88.2|CMT3_ARATH RecName: Full=DNA (cytosine-5)-methyltransferase CMT3; AltName: 
Full=Chromomethylase 3; AltName: Full=Protein CHROMOMETHYLASE 
3 [Arabidopsis thaliana]
 gb|AAG52543.1|AC013289_10 putative chromomethylase; 17383-22406 [Arabidopsis thaliana]
 gb|AEE34973.1| DNA (cytosine-5)-methyltransferase CMT3 [Arabidopsis thaliana]
Length=839

 Score =   119 bits (297),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 58/126 (46%), Positives = 82/126 (65%), Gaps = 2/126 (2%)
 Frame = +3

Query  429  SEFVGGPVLEEEAKQRWPHRYQK-GTEKSNGVTRSITSQDEFAGVLQAKRHFTAAKVDG-  602
            + F+  P+ E EAK  WP RY+    +     +R  T  DE   +++A+ H+  A VD  
Sbjct  48   ARFLDEPIPESEAKSTWPDRYKPIEVQPPKASSRKKTKDDEKVEIIRARCHYRRAIVDER  107

Query  603  LFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRAKDTVIKGCDEFVDKQ  782
              Y+L DDAYV++GEG+D +IC+IIEMFE  +G LYFTA+W+YR  DTV+K  +  + K+
Sbjct  108  QIYELNDDAYVQSGEGKDPFICKIIEMFEGANGKLYFTARWFYRPSDTVMKEFEILIKKK  167

Query  783  RVFFSE  800
            RVFFSE
Sbjct  168  RVFFSE  173



>ref|XP_008790945.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2-like [Phoenix 
dactylifera]
Length=994

 Score =   119 bits (297),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 57/141 (40%), Positives = 87/141 (62%), Gaps = 1/141 (1%)
 Frame = +3

Query  381  PPERKRITTNVTN-DEDSEFVGGPVLEEEAKQRWPHRYQKGTEKSNGVTRSITSQDEFAG  557
            PP+  R ++ + N +E   FVG PV +EEA+QRWPH Y    +    ++R+  S+DE   
Sbjct  207  PPQMARASSVLKNVNEICFFVGDPVPDEEARQRWPHHYVDKGKIGKCLSRNGNSEDEDEI  266

Query  558  VLQAKRHFTAAKVDGLFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRA  737
            +L  K H+  A + G    +GD  YVK  +G+ NY+ RI+E FE + G  YFT QW++RA
Sbjct  267  ILDVKCHYLQASICGCILDIGDCTYVKGEKGKPNYVGRILEFFETIRGEYYFTVQWFFRA  326

Query  738  KDTVIKGCDEFVDKQRVFFSE  800
            +DT++K      DK+R+F+S+
Sbjct  327  EDTIMKVQGASHDKKRLFYSD  347



>ref|XP_010243148.1| PREDICTED: DNA (cytosine-5)-methyltransferase 1-like [Nelumbo 
nucifera]
Length=1126

 Score =   118 bits (296),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 64/151 (42%), Positives = 92/151 (61%), Gaps = 10/151 (7%)
 Frame = +3

Query  369  SQASPPERKR---ITTNVTNDED--SEFVGGPVLEEEAKQRWPHRYQKGTEKSNGVTRSI  533
            S   PP +K     + N + + D  S F+G PV  +EA+QRWP RY+   EK  G  RS+
Sbjct  350  SAEKPPPKKLKAAFSKNKSKESDTVSFFIGEPVPADEARQRWPWRYE---EKGRGSKRSL  406

Query  534  TSQD--EFAGVLQAKRHFTAAKVDGLFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGAL  707
             S +  E   +L  K H+T A++D   + LGD AYVK  EG  NY+ RI+E F+ ++G  
Sbjct  407  MSNNDEEDEIILNVKCHYTQAEIDKCIFNLGDCAYVKGKEGAQNYVGRILEFFKTMEGGD  466

Query  708  YFTAQWYYRAKDTVIKGCDEFVDKQRVFFSE  800
            YF  QW++RA+DTV+K    F DK+R+F+S+
Sbjct  467  YFRVQWFFRAEDTVMKDEATFHDKKRLFYSD  497



>gb|KEH25929.1| DNA (cytosine-5)-methyltransferase CMT1 [Medicago truncatula]
Length=843

 Score =   117 bits (294),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 60/141 (43%), Positives = 92/141 (65%), Gaps = 1/141 (1%)
 Frame = +3

Query  381  PPERKRITTNVTNDEDS-EFVGGPVLEEEAKQRWPHRYQKGTEKSNGVTRSITSQDEFAG  557
            PP+ KR T     D +   FVG P+  +EA+ +WPHRY K   +++  T ++ S  +   
Sbjct  41   PPKLKRATKRSAVDSNKICFVGKPIPVDEAQSKWPHRYLKKEIETHRDTIALCSGLKNND  100

Query  558  VLQAKRHFTAAKVDGLFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRA  737
             ++AK H+  AKVDG+ Y+L D+AYV+A +G+ + I RI+E+F + D   +FTAQW+YRA
Sbjct  101  CIKAKYHYRKAKVDGVIYELNDNAYVQAEKGKKDSIARILELFVSDDQQQFFTAQWFYRA  160

Query  738  KDTVIKGCDEFVDKQRVFFSE  800
            +DTV++     VDK+RVF S+
Sbjct  161  QDTVLQDHGRLVDKKRVFISD  181



>gb|AAK69756.1|AF383170_1 chromomethylase CMT3 [Arabidopsis thaliana]
Length=839

 Score =   117 bits (293),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 57/126 (45%), Positives = 82/126 (65%), Gaps = 2/126 (2%)
 Frame = +3

Query  429  SEFVGGPVLEEEAKQRWPHRYQK-GTEKSNGVTRSITSQDEFAGVLQAKRHFTAAKVDG-  602
            + F+  P+ E EAK  WP RY+    +     +R  T  DE   +++A+ H+  A VD  
Sbjct  48   ARFLDEPIPESEAKSTWPDRYKPIEVQPPKASSRKKTKDDEKVEIIRARCHYRRAIVDER  107

Query  603  LFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRAKDTVIKGCDEFVDKQ  782
              Y+L DDAYV++GEG+D +IC+IIEMFE  +G LYFTA+W+YR  DTV+K  +  + ++
Sbjct  108  QIYELNDDAYVQSGEGKDPFICKIIEMFEGANGKLYFTARWFYRPSDTVMKEFEILIKEK  167

Query  783  RVFFSE  800
            RVFFSE
Sbjct  168  RVFFSE  173



>ref|XP_010415637.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT3-like isoform 
X2 [Camelina sativa]
Length=834

 Score =   117 bits (293),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 60/127 (47%), Positives = 80/127 (63%), Gaps = 4/127 (3%)
 Frame = +3

Query  429  SEFVGGPVLEEEAKQRWPHRYQKGTEKSNGVTRSITSQ--DEFAGVLQAKRHFTAAKVD-  599
            + F+  P+ E EAK  WP RY K  E    V RS   +  D+   +++A+ HF  A VD 
Sbjct  48   ARFLDEPIPESEAKTAWPDRY-KPIEVKKPVARSRGKKKDDDVVEIIRARCHFRRAIVDE  106

Query  600  GLFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRAKDTVIKGCDEFVDK  779
             + Y+L DDAYV+AGEG   YIC+I+EMFE  +G LYF AQW+YRA DTVI   +  +  
Sbjct  107  SITYELNDDAYVQAGEGNAPYICKIVEMFEGANGKLYFAAQWFYRASDTVIGNLNALISD  166

Query  780  QRVFFSE  800
            +RVFFS+
Sbjct  167  KRVFFSK  173



>ref|XP_010415636.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT3-like isoform 
X1 [Camelina sativa]
Length=835

 Score =   117 bits (293),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 60/127 (47%), Positives = 80/127 (63%), Gaps = 4/127 (3%)
 Frame = +3

Query  429  SEFVGGPVLEEEAKQRWPHRYQKGTEKSNGVTRSITSQ--DEFAGVLQAKRHFTAAKVD-  599
            + F+  P+ E EAK  WP RY K  E    V RS   +  D+   +++A+ HF  A VD 
Sbjct  48   ARFLDEPIPESEAKTAWPDRY-KPIEVKKPVARSRGKKKDDDVVEIIRARCHFRRAIVDE  106

Query  600  GLFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRAKDTVIKGCDEFVDK  779
             + Y+L DDAYV+AGEG   YIC+I+EMFE  +G LYF AQW+YRA DTVI   +  +  
Sbjct  107  SITYELNDDAYVQAGEGNAPYICKIVEMFEGANGKLYFAAQWFYRASDTVIGNLNALISD  166

Query  780  QRVFFSE  800
            +RVFFS+
Sbjct  167  KRVFFSK  173



>ref|XP_010470978.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT3-like isoform 
X2 [Camelina sativa]
Length=830

 Score =   117 bits (293),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 60/127 (47%), Positives = 81/127 (64%), Gaps = 4/127 (3%)
 Frame = +3

Query  429  SEFVGGPVLEEEAKQRWPHRYQKGTEKSNGVTRSITSQ--DEFAGVLQAKRHFTAAKVD-  599
            + F+  P+ E EAK  WP RY K  E    V RS   +  D+   +++A+ HF  A VD 
Sbjct  48   ARFLDEPIPESEAKTAWPDRY-KPIEVKKPVARSRGKKKDDDVEEIIRARCHFRRAIVDE  106

Query  600  GLFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRAKDTVIKGCDEFVDK  779
             + Y+L DDAYV+AGEG   YIC+I+EMFE  +G LYF AQW+YRA DTVI   +  + +
Sbjct  107  SITYELNDDAYVQAGEGNAPYICKIVEMFEGANGKLYFAAQWFYRASDTVIGNLNALISE  166

Query  780  QRVFFSE  800
            +RVFFS+
Sbjct  167  KRVFFSK  173



>ref|XP_010470977.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT3-like isoform 
X1 [Camelina sativa]
Length=831

 Score =   117 bits (293),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 60/127 (47%), Positives = 81/127 (64%), Gaps = 4/127 (3%)
 Frame = +3

Query  429  SEFVGGPVLEEEAKQRWPHRYQKGTEKSNGVTRSITSQ--DEFAGVLQAKRHFTAAKVD-  599
            + F+  P+ E EAK  WP RY K  E    V RS   +  D+   +++A+ HF  A VD 
Sbjct  48   ARFLDEPIPESEAKTAWPDRY-KPIEVKKPVARSRGKKKDDDVEEIIRARCHFRRAIVDE  106

Query  600  GLFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRAKDTVIKGCDEFVDK  779
             + Y+L DDAYV+AGEG   YIC+I+EMFE  +G LYF AQW+YRA DTVI   +  + +
Sbjct  107  SITYELNDDAYVQAGEGNAPYICKIVEMFEGANGKLYFAAQWFYRASDTVIGNLNALISE  166

Query  780  QRVFFSE  800
            +RVFFS+
Sbjct  167  KRVFFSK  173



>dbj|BAF01425.1| putative chromomethylase [Arabidopsis thaliana]
Length=839

 Score =   117 bits (292),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 57/126 (45%), Positives = 82/126 (65%), Gaps = 2/126 (2%)
 Frame = +3

Query  429  SEFVGGPVLEEEAKQRWPHRYQK-GTEKSNGVTRSITSQDEFAGVLQAKRHFTAAKV-DG  602
            + F+  P+ E EAK  WP RY+    +     +R  T  DE   +++A+ H+  A V + 
Sbjct  48   ARFLDEPIPESEAKSTWPDRYKPIEVQPPKASSRKKTKDDEKVEIIRARCHYRRAIVGER  107

Query  603  LFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRAKDTVIKGCDEFVDKQ  782
              Y+L DDAYV++GEG+D +IC+IIEMFE  +G LYFTA+W+YR  DTV+K  +  + K+
Sbjct  108  QIYELNDDAYVQSGEGKDPFICKIIEMFEGANGKLYFTARWFYRPSDTVMKEFEILIKKK  167

Query  783  RVFFSE  800
            RVFFSE
Sbjct  168  RVFFSE  173



>ref|XP_010908353.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2-like [Elaeis 
guineensis]
Length=1011

 Score =   117 bits (292),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 56/141 (40%), Positives = 87/141 (62%), Gaps = 1/141 (1%)
 Frame = +3

Query  381  PPERKRITTNVTN-DEDSEFVGGPVLEEEAKQRWPHRYQKGTEKSNGVTRSITSQDEFAG  557
            PP+  R ++   N +E   FVG PV EEEA++RWPH Y +  ++S   +R+  ++DE   
Sbjct  201  PPKMTRASSASKNVNEICFFVGAPVPEEEARRRWPHHYVEKGKRSKCQSRNGNTEDEDEI  260

Query  558  VLQAKRHFTAAKVDGLFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRA  737
            +L  K H+  A + G    +GD  YVK  + + NY+ RI+E FE + G  YFT QW++RA
Sbjct  261  ILDVKCHYLQASICGCILDIGDCTYVKGEKRKPNYVGRILEFFETIRGEYYFTVQWFFRA  320

Query  738  KDTVIKGCDEFVDKQRVFFSE  800
            +DT++K      DK+R+F+S+
Sbjct  321  EDTIMKAQGASHDKKRLFYSD  341



>ref|XP_010666617.1| PREDICTED: putative DNA (cytosine-5)-methyltransferase CMT1 [Beta 
vulgaris subsp. vulgaris]
Length=832

 Score =   116 bits (290),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 59/128 (46%), Positives = 80/128 (63%), Gaps = 4/128 (3%)
 Frame = +3

Query  420  DEDSEFVGGPVLEEEAKQRWPHRY-QKGTEKSNGVTRSITSQDEFAGVLQAKRHFTAAKV  596
            D++  F G P+   EAKQ+WPHRY  KG              DE   ++QA RH+  A +
Sbjct  54   DDECRFTGEPIPVVEAKQQWPHRYLSKGKWAIRPAYAKGWESDE---IMQACRHYNEALI  110

Query  597  DGLFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRAKDTVIKGCDEFVD  776
            DG+  +L DD Y++A EG  +YI +I+E+FE VD   Y TAQW+YRA+DTVIK   E +D
Sbjct  111  DGVTVRLLDDVYIQAEEGTPDYITKIVELFETVDKEQYITAQWFYRAEDTVIKVHAELID  170

Query  777  KQRVFFSE  800
             +RVFFS+
Sbjct  171  NRRVFFSD  178



>ref|XP_004170052.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT3-like, partial 
[Cucumis sativus]
Length=753

 Score =   115 bits (289),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 53/81 (65%), Positives = 64/81 (79%), Gaps = 0/81 (0%)
 Frame = +3

Query  558  VLQAKRHFTAAKVDGLFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRA  737
            V+QA  H++ AKVD + Y L DDA+VKA   ED+YIC+IIEMFEAVDG LYFTAQWYYRA
Sbjct  6    VIQALHHYSQAKVDNITYNLLDDAHVKAEGEEDDYICKIIEMFEAVDGQLYFTAQWYYRA  65

Query  738  KDTVIKGCDEFVDKQRVFFSE  800
            KDTV+K     ++ +RVFFSE
Sbjct  66   KDTVVKDHAHLINDKRVFFSE  86



>ref|XP_010533849.1| PREDICTED: putative DNA (cytosine-5)-methyltransferase CMT1 [Tarenaya 
hassleriana]
Length=799

 Score =   115 bits (287),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 57/130 (44%), Positives = 79/130 (61%), Gaps = 4/130 (3%)
 Frame = +3

Query  420  DEDSEFVGGPVLEEEAKQRWPHRYQKGTEKSNGVTRSITSQDEFAG---VLQAKRHFTAA  590
            D D   VG P+   EA +RWP RY+       G    I ++    G   ++QAK H+  A
Sbjct  14   DPDPSLVGPPISATEAIERWPFRYRYSKSMKLGAV-DIPTRRGLEGEKDMMQAKHHYLQA  72

Query  591  KVDGLFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRAKDTVIKGCDEF  770
            KVDG+ + L DDAYV+A +G+ +YI +I+E FE +DG  YF AQW+YR +DTVIK     
Sbjct  73   KVDGVLFNLDDDAYVQAEDGKPDYIAKILEFFEGLDGEPYFRAQWFYRPEDTVIKNHAYL  132

Query  771  VDKQRVFFSE  800
            V ++RVF S+
Sbjct  133  VQEKRVFLSD  142



>ref|XP_009148471.1| PREDICTED: putative DNA (cytosine-5)-methyltransferase CMT1 [Brassica 
rapa]
Length=786

 Score =   115 bits (287),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 57/124 (46%), Positives = 76/124 (61%), Gaps = 2/124 (2%)
 Frame = +3

Query  426  DSEFVGGPVLEEEAKQRWPHRYQKGTEKSNGVTRSITSQDEFAGVLQAKRHFTAAKVDGL  605
            D  F G P+  EEA  +WP RY+    + +      T +D    + QAKRH++ A VDG 
Sbjct  9    DLSFTGEPISAEEAIAKWPSRYRSSKARVSATVG--TPKDGEENLEQAKRHYSQALVDGT  66

Query  606  FYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRAKDTVIKGCDEFVDKQR  785
             + LGDD YVKA +G  NYI +I+E FEA+DG  YF A+W+YR +DTVIK     V ++R
Sbjct  67   LFNLGDDVYVKAEDGNPNYIAKIVEFFEAIDGEPYFRARWFYRPEDTVIKTLASEVQEKR  126

Query  786  VFFS  797
            VF S
Sbjct  127  VFLS  130



>emb|CDY19364.1| BnaC05g08730D [Brassica napus]
Length=796

 Score =   115 bits (287),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 57/124 (46%), Positives = 75/124 (60%), Gaps = 1/124 (1%)
 Frame = +3

Query  426  DSEFVGGPVLEEEAKQRWPHRYQKGTEKSNGVTRSITSQDEFAGVLQAKRHFTAAKVDGL  605
            D  F G P+  EEA  +WP RY+    + +  T      D    + QAKRH++ A VDG 
Sbjct  9    DLSFTGEPISAEEAMTKWPSRYRSSKARVSA-TVGTPKDDGEENLEQAKRHYSQALVDGT  67

Query  606  FYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRAKDTVIKGCDEFVDKQR  785
             + LGDD YVKA +G  NYI +I+E FEA+DG  YF A+W+YR +DTVIK     V ++R
Sbjct  68   LFNLGDDVYVKAEDGNPNYIAKIVEFFEAIDGEPYFKARWFYRPEDTVIKTLANEVQEKR  127

Query  786  VFFS  797
            VF S
Sbjct  128  VFLS  131



>gb|EMT24338.1| DNA (cytosine-5)-methyltransferase 1 [Aegilops tauschii]
Length=826

 Score =   115 bits (287),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 61/131 (47%), Positives = 79/131 (60%), Gaps = 14/131 (11%)
 Frame = +3

Query  420  DEDSEFVGGPVLEEEAKQRWPHRYQKGTEKSNGVTRSITSQDEFAGVLQAKRHFTAAKVD  599
            DE+ EF+G PV  +EA+ +WP RYQ+G  K     R    +D     ++A+ H+ +A VD
Sbjct  111  DEEPEFLGEPVPADEARAKWPQRYQRGAPK-----RPEDEED-----MKARVHYRSAMVD  160

Query  600  GLFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRAKDTVIKGC----DE  767
            G+ Y LGDD YV AGE E +YI RI E FE VD   YFT +WY+R +DTVI       D 
Sbjct  161  GVVYALGDDVYVMAGENEADYIGRITEFFEGVDKTSYFTCRWYFRPEDTVISRAKFVNDH  220

Query  768  FVDKQRVFFSE  800
              D +RVF SE
Sbjct  221  THDPKRVFLSE  231



>emb|CDX97957.1| BnaA06g07080D [Brassica napus]
Length=788

 Score =   114 bits (286),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 57/124 (46%), Positives = 76/124 (61%), Gaps = 2/124 (2%)
 Frame = +3

Query  426  DSEFVGGPVLEEEAKQRWPHRYQKGTEKSNGVTRSITSQDEFAGVLQAKRHFTAAKVDGL  605
            D  F G P+  EEA  +WP RY+    + +      T +D    + QAKRH++ A VDG 
Sbjct  9    DLSFTGEPISAEEAIAKWPSRYRSSKARVSATVG--TPKDGEENLEQAKRHYSQALVDGT  66

Query  606  FYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRAKDTVIKGCDEFVDKQR  785
             + LGDD YVKA +G  NYI +I+E FEA+DG  YF A+W+YR +DTVIK     V ++R
Sbjct  67   LFNLGDDVYVKAEDGNPNYIAKIVEFFEAIDGEPYFRARWFYRPEDTVIKTLASEVQEKR  126

Query  786  VFFS  797
            VF S
Sbjct  127  VFLS  130



>ref|XP_002304879.1| chromomethylase 3 family protein [Populus trichocarpa]
 gb|EEE79858.1| chromomethylase 3 family protein [Populus trichocarpa]
Length=363

 Score =   110 bits (275),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 60/140 (43%), Positives = 85/140 (61%), Gaps = 25/140 (18%)
 Frame = +3

Query  393  KRITTNVTNDED---SEFVGGPVLEEEAKQRWPHRYQKGTEKSNGVTRSITSQDEFAGVL  563
            K+I+T V   ED   + FVG  +   EA+++WPHRY                      ++
Sbjct  92   KKISTPVKVKEDETPARFVGAQIPGAEARKKWPHRYANK-------------------IV  132

Query  564  QAKRHFTAAKVDGLFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRAKD  743
            +A+ H+T A+VD + Y L  DA+V+A +GE +YICRI EMFE+VD  LYFT QWYYR+  
Sbjct  133  KARCHYTRAEVDRIIYDLYYDAHVQASDGEPDYICRISEMFESVDRTLYFTTQWYYRSTV  192

Query  744  TVIKGCDEFV-DKQRVFFSE  800
            T+IK  D+++ D + VFFSE
Sbjct  193  TIIK--DKYISDPKCVFFSE  210



>ref|XP_010673524.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT3 [Beta vulgaris 
subsp. vulgaris]
Length=868

 Score =   113 bits (282),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 57/132 (43%), Positives = 86/132 (65%), Gaps = 5/132 (4%)
 Frame = +3

Query  411  VTNDE-DSEFVGGPVLEEEAKQRWPHRYQKGTEKSNGVTRSITSQDEFAGVLQAKRHFTA  587
            V N+E D  F+G  + ++EAK RWPHRY     + +   ++    DE   ++QAK H+  
Sbjct  68   VKNEELDCRFLGDSLPDDEAKLRWPHRYLPKVGQGSKRPKAADDDDE---IIQAKCHYLK  124

Query  588  AKVDG-LFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRAKDTVIKGCD  764
            A+VDG + ++L DDA+V++ +G+  YIC+I+E FE VDG  YF A+WYYR+ DTVIK   
Sbjct  125  AEVDGSMIFELNDDAHVQSEDGKPPYICKIVEFFEGVDGLPYFRAKWYYRSVDTVIKDSI  184

Query  765  EFVDKQRVFFSE  800
               +++R+F SE
Sbjct  185  TLREEKRIFPSE  196



>gb|AAL75761.1| Putative DNA cytosine methyltransferase MET2a [Oryza sativa Japonica 
Group]
Length=719

 Score =   112 bits (279),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 64/159 (40%), Positives = 89/159 (56%), Gaps = 17/159 (11%)
 Frame = +3

Query  342  DVAGGNLVRSQASPPERKRITTNVTNDEDSEFVGGPVLEEEAKQRWPHRYQKGTEKSNGV  521
            D     + R + + P R R  ++   D D EFVG P   +EA+ +WP RYQ+     N  
Sbjct  96   DAPAPGVARKRVAQPSRVRHGSD--GDHDPEFVGDPFPAKEARDKWPQRYQR-----NAA  148

Query  522  TRSITSQDEFAGVLQAKRHFTAAKVDGLFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDG  701
            TR    +++    ++A+ H+++AKVDG  Y L DD YVKA E + +YI RI E FE  D 
Sbjct  149  TRRPDEEED----IKARCHYSSAKVDGTLYCLHDDVYVKAEEDKADYIGRITEFFEGTDH  204

Query  702  ALYFTAQWYYRAKDTVIKGC------DEFVDKQRVFFSE  800
              YFT +W++RA+DTVI         DE  D +RVF SE
Sbjct  205  CHYFTCRWFFRAEDTVISSIMMENADDEKHDLKRVFLSE  243



>dbj|BAH37019.1| chromomethylase OsMET2a [Oryza sativa Japonica Group]
Length=907

 Score =   112 bits (279),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 64/159 (40%), Positives = 89/159 (56%), Gaps = 17/159 (11%)
 Frame = +3

Query  342  DVAGGNLVRSQASPPERKRITTNVTNDEDSEFVGGPVLEEEAKQRWPHRYQKGTEKSNGV  521
            D     + R + + P R R  ++   D D EFVG P   +EA+ +WP RYQ+     N  
Sbjct  96   DAPAPGVARKRVAQPSRVRHGSD--GDHDPEFVGDPFPAKEARDKWPQRYQR-----NAA  148

Query  522  TRSITSQDEFAGVLQAKRHFTAAKVDGLFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDG  701
            TR    +++    ++A+ H+++AKVDG  Y L DD YVKA E + +YI RI E FE  D 
Sbjct  149  TRRPDEEED----IKARCHYSSAKVDGTLYCLHDDVYVKAEEDKADYIGRITEFFEGTDH  204

Query  702  ALYFTAQWYYRAKDTVIKGC------DEFVDKQRVFFSE  800
              YFT +W++RA+DTVI         DE  D +RVF SE
Sbjct  205  CHYFTCRWFFRAEDTVISSIMMENADDEKHDLKRVFLSE  243



>ref|XP_010243382.1| PREDICTED: DNA (cytosine-5)-methyltransferase 1-like isoform 
X1 [Nelumbo nucifera]
Length=839

 Score =   112 bits (279),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 60/127 (47%), Positives = 79/127 (62%), Gaps = 3/127 (2%)
 Frame = +3

Query  426  DSEFVGGPVLEEEAKQRWPHRYQKGTEKSNGVTRSITSQDEFAG--VLQAKRHFTAAKVD  599
            +S   G PV  EEA++RW  RY K  +KS     S  ++ E     VL A+ H+  A+VD
Sbjct  32   ESRLYGEPVPAEEARERWLERYDKKQKKSKNARGSGGNKKEDTDEEVLLARCHYRQAEVD  91

Query  600  GLFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRAKDTVI-KGCDEFVD  776
            G  + L DDAYVK  EG+ NYI RI+E+FE  DG  YFTAQW+++A+DTVI K     +D
Sbjct  92   GCIFNLNDDAYVKGEEGKPNYIGRIVELFETTDGEPYFTAQWFFKAEDTVIGKDHSSLID  151

Query  777  KQRVFFS  797
             +RVF S
Sbjct  152  SRRVFLS  158



>gb|EEC70797.1| hypothetical protein OsI_02246 [Oryza sativa Indica Group]
Length=907

 Score =   112 bits (279),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 64/159 (40%), Positives = 89/159 (56%), Gaps = 17/159 (11%)
 Frame = +3

Query  342  DVAGGNLVRSQASPPERKRITTNVTNDEDSEFVGGPVLEEEAKQRWPHRYQKGTEKSNGV  521
            D     + R + + P R R  ++   D D EFVG P   +EA+ +WP RYQ+     N  
Sbjct  96   DAPSPGVARKRVAQPSRVRHGSD--GDHDPEFVGDPFPAKEARDKWPQRYQR-----NAA  148

Query  522  TRSITSQDEFAGVLQAKRHFTAAKVDGLFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDG  701
            TR    +++    ++A+ H+++AKVDG  Y L DD YVKA E + +YI RI E FE  D 
Sbjct  149  TRRPDEEED----IKARCHYSSAKVDGTLYCLHDDVYVKAEEDKADYIGRITEFFEGTDH  204

Query  702  ALYFTAQWYYRAKDTVIKGC------DEFVDKQRVFFSE  800
              YFT +W++RA+DTVI         DE  D +RVF SE
Sbjct  205  CRYFTCRWFFRAEDTVISSIMMENADDEKHDLKRVFLSE  243



>gb|EEE50451.1| hypothetical protein OsJ_30466 [Oryza sativa Japonica Group]
Length=907

 Score =   111 bits (278),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 64/159 (40%), Positives = 89/159 (56%), Gaps = 17/159 (11%)
 Frame = +3

Query  342  DVAGGNLVRSQASPPERKRITTNVTNDEDSEFVGGPVLEEEAKQRWPHRYQKGTEKSNGV  521
            D     + R + + P R R  ++   D D EFVG P   +EA+ +WP RYQ+     N  
Sbjct  96   DAPPPGVARKRVAQPSRVRHGSD--GDHDPEFVGDPFPAKEARDKWPQRYQR-----NAA  148

Query  522  TRSITSQDEFAGVLQAKRHFTAAKVDGLFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDG  701
            TR    +++    ++A+ H+++AKVDG  Y L DD YVKA E + +YI RI E FE  D 
Sbjct  149  TRRPDEEED----IKARCHYSSAKVDGTLYCLHDDVYVKAEEDKADYIGRITEFFEGTDH  204

Query  702  ALYFTAQWYYRAKDTVIKGC------DEFVDKQRVFFSE  800
              YFT +W++RA+DTVI         DE  D +RVF SE
Sbjct  205  CHYFTCRWFFRAEDTVISSIMMENADDEKHDLKRVFLSE  243



>ref|XP_011025397.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT3-like [Populus 
euphratica]
Length=514

 Score =   109 bits (273),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 62/140 (44%), Positives = 86/140 (61%), Gaps = 25/140 (18%)
 Frame = +3

Query  393  KRITTNVTNDED---SEFVGGPVLEEEAKQRWPHRYQKGTEKSNGVTRSITSQDEFAGVL  563
            K+I+T +   ED   + FVG  +   EA+++WPHRY      +N VT S           
Sbjct  143  KKISTPMKVKEDETLARFVGAQIPGAEARKKWPHRY------ANKVTFS-----------  185

Query  564  QAKRHFTAAKVDGLFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRAKD  743
              + H+T A VD + Y L  DAYV+A +GE +Y+CRI EMFE+VD  LYFT QWYYR+ D
Sbjct  186  --RCHYTRADVDRIIYDLYYDAYVQASDGEPDYLCRISEMFESVDRTLYFTTQWYYRSPD  243

Query  744  TVIKGCDEFV-DKQRVFFSE  800
            T+IK  ++++ D + VFFSE
Sbjct  244  TIIK--NKYISDPKCVFFSE  261



>ref|XP_006854149.1| hypothetical protein AMTR_s00048p00181490 [Amborella trichopoda]
 gb|ERN15616.1| hypothetical protein AMTR_s00048p00181490 [Amborella trichopoda]
Length=1183

 Score =   111 bits (278),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 59/138 (43%), Positives = 83/138 (60%), Gaps = 3/138 (2%)
 Frame = +3

Query  387  ERKRITTNVTNDEDSEFVGGPVLEEEAKQRWPHRYQKGTEKSNGVTRSITSQDEFAGVLQ  566
            +++++   VTN+E    +G PV  EEA  RWP RY    EKS   ++   S D    +L 
Sbjct  386  KKQKVGEKVTNEE-CRLIGAPVDLEEAHNRWPWRYN--VEKSGRNSKKNWSMDSDELILD  442

Query  567  AKRHFTAAKVDGLFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRAKDT  746
             + H+  A + G  + LGD AYVK  +G  NYI RI+E FE +DG  YF AQW++RA DT
Sbjct  443  VRCHYLQADICGHKFNLGDTAYVKGQKGGPNYIGRILEFFETMDGIQYFNAQWFFRAADT  502

Query  747  VIKGCDEFVDKQRVFFSE  800
            VI+G     DK+R+F+S+
Sbjct  503  VIQGLASQHDKKRIFYSD  520



>ref|XP_006849583.1| hypothetical protein AMTR_s00024p00193220 [Amborella trichopoda]
 gb|ERN11164.1| hypothetical protein AMTR_s00024p00193220 [Amborella trichopoda]
Length=884

 Score =   110 bits (275),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 64/152 (42%), Positives = 90/152 (59%), Gaps = 15/152 (10%)
 Frame = +3

Query  384  PERKRITTNVTN----------DE--DSEFVGGPVLEEEAKQRWPHRYQKGTEKSNGVTR  527
            P+R++ TT  T+          DE  DS  +G PV   EA++RW HRY K  +K    + 
Sbjct  67   PQRRKPTTASTSKASSKKARTSDEVPDSRLLGDPVPVSEAQRRWSHRYNKQKDKRGSTSS  126

Query  528  SITSQDEFAGVLQAKRHFTAAKVDGLFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGAL  707
            +  +  E A  L  K H+   +VDG  Y L D A VK  EG ++YI +I+E+FE  DG  
Sbjct  127  NGDNGGETA--LNVKCHYEQCEVDGCIYILNDSAIVKGEEGGEDYIGKIVELFETTDGQR  184

Query  708  YFTAQWYYRAKDTVIK-GCDEFVDKQRVFFSE  800
            YFTAQW+++A+DTVIK    +F DK+RVF+S+
Sbjct  185  YFTAQWFFKAQDTVIKEEAADFHDKKRVFYSD  216



>ref|XP_011075807.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2-like isoform 
X1 [Sesamum indicum]
Length=911

 Score =   110 bits (274),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 59/146 (40%), Positives = 90/146 (62%), Gaps = 7/146 (5%)
 Frame = +3

Query  369  SQASPPERKRITTNVTNDEDSEFVGGPVLEEEAKQRWPHRYQ--KGTEKSNGVTRS-ITS  539
            +Q SPP +KR     +  + S F+G P+ E+EA++RWP RY+  KG + +   ++  + +
Sbjct  100  TQKSPPSKKR----KSGKKVSFFIGDPIPEDEARRRWPWRYEGTKGLQNNRESSKHEVAN  155

Query  540  QDEFAGVLQAKRHFTAAKVDGLFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTA  719
             D+   VL  K H++ A++    + LGD AYVK  +G  NYI +I+E FE  DG  YF  
Sbjct  156  DDDEELVLNIKCHYSQAEILKTVFDLGDCAYVKGPKGGSNYIGKILEFFETTDGEEYFRV  215

Query  720  QWYYRAKDTVIKGCDEFVDKQRVFFS  797
            QW++RA+DTVIK      DK+R+F+S
Sbjct  216  QWFFRAEDTVIKDDGRSHDKKRLFYS  241



>gb|EEE58631.1| hypothetical protein OsJ_09996 [Oryza sativa Japonica Group]
Length=1033

 Score =   110 bits (274),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 63/146 (43%), Positives = 84/146 (58%), Gaps = 14/146 (10%)
 Frame = +3

Query  390  RKRI----TTNVTNDEDSEFVGGPVLEEEAKQRWPHRYQKGTEKSNGVTRSITSQDEFAG  557
            RKR+    T     D D  FVG PV ++EA+QRWP RY +  + S+ + +    +DE   
Sbjct  216  RKRVARPSTARRVEDSDDHFVGDPVPDDEARQRWPVRYSR--KGSDSLLKQEPDEDE---  270

Query  558  VLQAKRHFTAAKVDGLFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRA  737
             ++A+ H+ AA VD   Y L DD YVKAG  E+NYI RI E FE VD   YF+ QW++R 
Sbjct  271  EMKARCHYLAANVDDEIYHLDDDVYVKAGPDEENYIGRITEFFEGVDRGSYFSCQWFFRT  330

Query  738  KDTVI-----KGCDEFVDKQRVFFSE  800
             DTVI     K  D   + +RVF S+
Sbjct  331  ADTVISSKLLKVHDHRHNHKRVFLSK  356



>ref|XP_011075808.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2-like isoform 
X2 [Sesamum indicum]
Length=907

 Score =   110 bits (274),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 59/146 (40%), Positives = 90/146 (62%), Gaps = 7/146 (5%)
 Frame = +3

Query  369  SQASPPERKRITTNVTNDEDSEFVGGPVLEEEAKQRWPHRYQ--KGTEKSNGVTRS-ITS  539
            +Q SPP +KR     +  + S F+G P+ E+EA++RWP RY+  KG + +   ++  + +
Sbjct  100  TQKSPPSKKR----KSGKKVSFFIGDPIPEDEARRRWPWRYEGTKGLQNNRESSKHEVAN  155

Query  540  QDEFAGVLQAKRHFTAAKVDGLFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTA  719
             D+   VL  K H++ A++    + LGD AYVK  +G  NYI +I+E FE  DG  YF  
Sbjct  156  DDDEELVLNIKCHYSQAEILKTVFDLGDCAYVKGPKGGSNYIGKILEFFETTDGEEYFRV  215

Query  720  QWYYRAKDTVIKGCDEFVDKQRVFFS  797
            QW++RA+DTVIK      DK+R+F+S
Sbjct  216  QWFFRAEDTVIKDDGRSHDKKRLFYS  241



>ref|XP_010243384.1| PREDICTED: DNA (cytosine-5)-methyltransferase 1-like isoform 
X2 [Nelumbo nucifera]
Length=838

 Score =   109 bits (272),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 59/129 (46%), Positives = 79/129 (61%), Gaps = 8/129 (6%)
 Frame = +3

Query  426  DSEFVGGPVLEEEAKQRWPHRYQKGTEKSN----GVTRSITSQDEFAGVLQAKRHFTAAK  593
            +S   G PV  EEA++RW  RY K  +  N    G  +   + +E   VL A+ H+  A+
Sbjct  32   ESRLYGEPVPAEEARERWLERYDKKKKSKNARGSGGNKKEDTDEE---VLLARCHYRQAE  88

Query  594  VDGLFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRAKDTVI-KGCDEF  770
            VDG  + L DDAYVK  EG+ NYI RI+E+FE  DG  YFTAQW+++A+DTVI K     
Sbjct  89   VDGCIFNLNDDAYVKGEEGKPNYIGRIVELFETTDGEPYFTAQWFFKAEDTVIGKDHSSL  148

Query  771  VDKQRVFFS  797
            +D +RVF S
Sbjct  149  IDSRRVFLS  157



>gb|EEC74798.1| hypothetical protein OsI_10599 [Oryza sativa Indica Group]
Length=1760

 Score =   110 bits (274),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 63/146 (43%), Positives = 84/146 (58%), Gaps = 14/146 (10%)
 Frame = +3

Query  390  RKRI----TTNVTNDEDSEFVGGPVLEEEAKQRWPHRYQKGTEKSNGVTRSITSQDEFAG  557
            RKR+    T     D D  FVG PV ++EA+QRWP RY +  + S+ + +    +DE   
Sbjct  216  RKRVARPSTARRVEDSDDHFVGDPVPDDEARQRWPVRYSR--KGSDSLLKQEPDEDE---  270

Query  558  VLQAKRHFTAAKVDGLFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRA  737
             ++A+ H+ AA VD   Y L DD YVKAG  E+NYI RI E FE VD   YF+ QW++R 
Sbjct  271  EMKARCHYLAANVDDEIYHLDDDVYVKAGPDEENYIGRITEFFEGVDRGSYFSCQWFFRT  330

Query  738  KDTVI-----KGCDEFVDKQRVFFSE  800
             DTVI     K  D   + +RVF S+
Sbjct  331  ADTVISSKLLKVHDHRHNHKRVFLSK  356



>gb|EMT30784.1| DNA (cytosine-5)-methyltransferase 1 [Aegilops tauschii]
Length=731

 Score =   109 bits (272),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 62/150 (41%), Positives = 89/150 (59%), Gaps = 14/150 (9%)
 Frame = +3

Query  366  RSQASPPERKRITTNVTNDEDSEFVGGPVLEEEAKQRWPHRYQKGTEKSNGVTRSITSQD  545
            R + +PP  +R   + + D    FVG P+ +++A++RWP RY+  T+ S+  +R     +
Sbjct  70   RKRVAPPRAQR-RPDASADH---FVGEPIPDDKARRRWPSRYE--TKDSDSRSRRSNDPE  123

Query  546  EFAGVLQAKRHFTAAKVDGLFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQW  725
            E  G   A+ H+T+A VD   + L DD YVKAG  E+NYI RI E FE  D  LYFT +W
Sbjct  124  EEIG---ARCHYTSACVDDAIFNLNDDVYVKAGPNEENYIGRITEFFEGTDHVLYFTCRW  180

Query  726  YYRAKDTVIKG-----CDEFVDKQRVFFSE  800
            ++RA+DTVI        D   D++RVF SE
Sbjct  181  FFRAEDTVISPNLLEVHDHEHDRKRVFLSE  210



>gb|AAN60988.1| Putative DNA cytosine methyltransferase MET2a [Oryza sativa Japonica 
Group]
 gb|ABF94750.1| C-5 cytosine-specific DNA methylase family protein, expressed 
[Oryza sativa Japonica Group]
Length=1761

 Score =   110 bits (274),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 63/146 (43%), Positives = 84/146 (58%), Gaps = 14/146 (10%)
 Frame = +3

Query  390  RKRI----TTNVTNDEDSEFVGGPVLEEEAKQRWPHRYQKGTEKSNGVTRSITSQDEFAG  557
            RKR+    T     D D  FVG PV ++EA+QRWP RY +  + S+ + +    +DE   
Sbjct  216  RKRVARPSTARRVEDSDDHFVGDPVPDDEARQRWPVRYSR--KGSDSLLKQEPDEDE---  270

Query  558  VLQAKRHFTAAKVDGLFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRA  737
             ++A+ H+ AA VD   Y L DD YVKAG  E+NYI RI E FE VD   YF+ QW++R 
Sbjct  271  EMKARCHYLAANVDDEIYHLDDDVYVKAGPDEENYIGRITEFFEGVDRGSYFSCQWFFRT  330

Query  738  KDTVI-----KGCDEFVDKQRVFFSE  800
             DTVI     K  D   + +RVF S+
Sbjct  331  ADTVISSKLLKVHDHRHNHKRVFLSK  356



>ref|XP_006417360.1| hypothetical protein EUTSA_v10006850mg [Eutrema salsugineum]
 gb|ESQ35713.1| hypothetical protein EUTSA_v10006850mg [Eutrema salsugineum]
Length=784

 Score =   108 bits (270),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 53/124 (43%), Positives = 74/124 (60%), Gaps = 0/124 (0%)
 Frame = +3

Query  426  DSEFVGGPVLEEEAKQRWPHRYQKGTEKSNGVTRSITSQDEFAGVLQAKRHFTAAKVDGL  605
            D  F+G P   EEA ++WP RY+    + +    S  + D      QAK+H+  A VDG 
Sbjct  9    DLCFIGEPFSAEEAMRKWPFRYRSSKARKSVTVESPKAGDNKEEKQQAKQHYNRAIVDGN  68

Query  606  FYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRAKDTVIKGCDEFVDKQR  785
             + LGD+ YVKA EG+ NYI +I+E FE +DG  +F A+W+YR +DTVIK     +  +R
Sbjct  69   LFNLGDNVYVKAEEGKPNYIAKILEFFETIDGKPFFRARWFYRPEDTVIKAHAHELQDKR  128

Query  786  VFFS  797
            VF S
Sbjct  129  VFLS  132



>gb|AFW59438.1| DNA (cytosine-5)-methyltransferase 1 [Zea mays]
Length=915

 Score =   108 bits (269),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 62/157 (39%), Positives = 84/157 (54%), Gaps = 19/157 (12%)
 Frame = +3

Query  360  LVRSQASPPERKRI----TTNVTNDEDSEFVGGPVLEEEAKQRWPHRYQKGTEKSNGVTR  527
            +V   A  P +KR+          D + EF+G PV  +EA+  WP RY + T       +
Sbjct  111  VVAVAAGSPGKKRVGRRNAAAAAGDHEPEFIGSPVAADEARSNWPKRYGRST-----AAK  165

Query  528  SITSQDEFAGVLQAKRHFTAAKVDGLFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGAL  707
                ++E    L+A+ H+ +AKVD + Y LGDD YVKAGE E +YI RI E FE  D   
Sbjct  166  KPDEEEE----LKARCHYRSAKVDNVVYCLGDDVYVKAGENEADYIGRITEFFEGTDQCH  221

Query  708  YFTAQWYYRAKDTVIKGCDEFV------DKQRVFFSE  800
            YFT +W++RA+DTVI             D +RVF SE
Sbjct  222  YFTCRWFFRAEDTVINSLVSISVDGHKHDPRRVFLSE  258



>ref|NP_001104978.1| DNA (cytosine-5)-methyltransferase 1 [Zea mays]
 sp|Q9AXT8.1|CMT1_MAIZE RecName: Full=DNA (cytosine-5)-methyltransferase 1; AltName: 
Full=Chromomethylase 1; AltName: Full=DNA cytosine methyltransferase 
MET2a; AltName: Full=Zea methyltransferase2; Short=Zmet2 
[Zea mays]
 gb|AAK11516.1|AF243043_1 DNA cytosine methyltransferase MET2a [Zea mays]
 gb|ACX48824.1| chromomethylase [Zea mays]
Length=912

 Score =   108 bits (269),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 62/157 (39%), Positives = 84/157 (54%), Gaps = 19/157 (12%)
 Frame = +3

Query  360  LVRSQASPPERKRI----TTNVTNDEDSEFVGGPVLEEEAKQRWPHRYQKGTEKSNGVTR  527
            +V   A  P +KR+          D + EF+G PV  +EA+  WP RY + T       +
Sbjct  108  VVAVAAGSPGKKRVGRRNAAAAAGDHEPEFIGSPVAADEARSNWPKRYGRST-----AAK  162

Query  528  SITSQDEFAGVLQAKRHFTAAKVDGLFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGAL  707
                ++E    L+A+ H+ +AKVD + Y LGDD YVKAGE E +YI RI E FE  D   
Sbjct  163  KPDEEEE----LKARCHYRSAKVDNVVYCLGDDVYVKAGENEADYIGRITEFFEGTDQCH  218

Query  708  YFTAQWYYRAKDTVIKGCDEFV------DKQRVFFSE  800
            YFT +W++RA+DTVI             D +RVF SE
Sbjct  219  YFTCRWFFRAEDTVINSLVSISVDGHKHDPRRVFLSE  255



>tpg|DAA36033.1| TPA: hypothetical protein ZEAMMB73_314017 [Zea mays]
Length=849

 Score =   107 bits (268),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 62/151 (41%), Positives = 80/151 (53%), Gaps = 18/151 (12%)
 Frame = +3

Query  375  ASPPERKRI---TTNVTNDEDSEFVGGPVLEEEAKQRWPHRYQKGTEKSNGVTRSITSQD  545
            A  P +KR+   +   + D   EF+G PV   EA   WP RY++ T             D
Sbjct  118  AGSPGKKRVGRRSAAASGDHVPEFIGSPVAAAEAHSNWPKRYERST-----AANKPEEDD  172

Query  546  EFAGVLQAKRHFTAAKVDGLFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQW  725
            E    L+A+ H+ +AKVD + Y LGDD YVKAGE E +YI RI E FE  D   YFT +W
Sbjct  173  E----LKARCHYRSAKVDNIVYCLGDDVYVKAGENEADYIGRITEFFEGTDRCHYFTCRW  228

Query  726  YYRAKDTVIKGCDEF------VDKQRVFFSE  800
            ++RA+DTVI             D +RVF SE
Sbjct  229  FFRAEDTVINSLVSINVDGHKHDPRRVFLSE  259



>sp|Q8LPU5.1|CMT3_MAIZE RecName: Full=DNA (cytosine-5)-methyltransferase 3; AltName: 
Full=Chromomethylase 3; AltName: Full=DNA methyltransferase 
105 [Zea mays]
 gb|AAM28227.1| DNA methyltransferase 105 [Zea mays]
 tpg|DAA36032.1| TPA: DNA (cytosine-5)-methyltransferase 2 [Zea mays]
Length=915

 Score =   108 bits (269),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 62/151 (41%), Positives = 80/151 (53%), Gaps = 18/151 (12%)
 Frame = +3

Query  375  ASPPERKRI---TTNVTNDEDSEFVGGPVLEEEAKQRWPHRYQKGTEKSNGVTRSITSQD  545
            A  P +KR+   +   + D   EF+G PV   EA   WP RY++ T             D
Sbjct  118  AGSPGKKRVGRRSAAASGDHVPEFIGSPVAAAEAHSNWPKRYERST-----AANKPEEDD  172

Query  546  EFAGVLQAKRHFTAAKVDGLFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQW  725
            E    L+A+ H+ +AKVD + Y LGDD YVKAGE E +YI RI E FE  D   YFT +W
Sbjct  173  E----LKARCHYRSAKVDNIVYCLGDDVYVKAGENEADYIGRITEFFEGTDRCHYFTCRW  228

Query  726  YYRAKDTVIKGCDEF------VDKQRVFFSE  800
            ++RA+DTVI             D +RVF SE
Sbjct  229  FFRAEDTVINSLVSINVDGHKHDPRRVFLSE  259



>ref|XP_006300613.1| hypothetical protein CARUB_v10019805mg, partial [Capsella rubella]
 gb|EOA33511.1| hypothetical protein CARUB_v10019805mg, partial [Capsella rubella]
Length=824

 Score =   107 bits (268),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 57/126 (45%), Positives = 73/126 (58%), Gaps = 2/126 (2%)
 Frame = +3

Query  420  DEDSEFVGGPVLEEEAKQRWPHRYQKGTEKSNGVTRSITSQDEFAGVLQAKRHFTAAKVD  599
            + D  FVG P+   E+  RWP RYQ    K +  T    +      + QAKRH+  A VD
Sbjct  49   ESDLCFVGKPMSVVESMIRWPLRYQAKKPKLD--TPKTATNGPKKEIKQAKRHYEQALVD  106

Query  600  GLFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRAKDTVIKGCDEFVDK  779
            G+   L DD YV A  G+ NYI ++ E+FEA DG  YF AQW+YR +DTVIK   E V +
Sbjct  107  GVLINLNDDVYVTAESGKPNYIAKVAELFEADDGEPYFRAQWFYRPEDTVIKRFSELVQE  166

Query  780  QRVFFS  797
            +RVF S
Sbjct  167  KRVFLS  172



>ref|XP_006300392.1| hypothetical protein CARUB_v10019778mg, partial [Capsella rubella]
 gb|EOA33290.1| hypothetical protein CARUB_v10019778mg, partial [Capsella rubella]
Length=865

 Score =   107 bits (268),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 57/129 (44%), Positives = 79/129 (61%), Gaps = 5/129 (4%)
 Frame = +3

Query  429  SEFVGGPVLEEEAKQRWPHRYQK----GTEKSNGVTRSITSQDEFAGVLQAKRHFTAAKV  596
            + F+  P+ E EAK  WP RY+       +      +     DE   +++A+ HF  A V
Sbjct  68   ARFLDEPIPELEAKTTWPDRYKPIEVKKPKPPAKRKKKTDDDDEEEEIIRARCHFRRAIV  127

Query  597  DGL-FYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRAKDTVIKGCDEFV  773
            D    Y+L DDAYV+AGEG+  +IC+I+EMFE  DG LYFTAQW+YRA DTVI      +
Sbjct  128  DECQTYELNDDAYVEAGEGKAPFICKIVEMFEGADGKLYFTAQWFYRASDTVIGMHSALI  187

Query  774  DKQRVFFSE  800
            +++RVFFS+
Sbjct  188  NEKRVFFSK  196



>ref|XP_007208072.1| hypothetical protein PRUPE_ppa001672mg [Prunus persica]
 gb|EMJ09271.1| hypothetical protein PRUPE_ppa001672mg [Prunus persica]
Length=782

 Score =   107 bits (267),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 52/90 (58%), Positives = 70/90 (78%), Gaps = 4/90 (4%)
 Frame = +3

Query  534  TSQDEFAGVLQAKRHFTAAKVDGL-FYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALY  710
            ++QDE A  +QA+ H+  A+VDG   + L DDA+V+AG+G + Y+C+I+EMFEA+DG LY
Sbjct  10   SNQDEDA--IQARGHYIKAEVDGRNIFDLYDDAHVQAGDGNEPYVCKIVEMFEAIDGTLY  67

Query  711  FTAQWYYRAKDTVIKGCDEFVDKQRVFFSE  800
            FTAQWYYR+ DTVIK C   +DK+RVF SE
Sbjct  68   FTAQWYYRSPDTVIKECAT-IDKRRVFLSE  96



>ref|XP_004987095.1| PREDICTED: LOW QUALITY PROTEIN: DNA (cytosine-5)-methyltransferase 
1-like [Setaria italica]
Length=1608

 Score =   107 bits (268),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 61/147 (41%), Positives = 84/147 (57%), Gaps = 16/147 (11%)
 Frame = +3

Query  375  ASPPERKRITTNVTNDEDSEFVGGPVLEEEAKQRWPHRYQKGTEKSNGVTRSITSQDEFA  554
            A P   +R+  +V N     FVG P+ + EA+Q+WP RY   T+ S+  +R     +E  
Sbjct  184  ARPSTERRVDGSVDN-----FVGEPMPDHEARQKWPERYM--TKGSDSPSRRSGEDEE--  234

Query  555  GVLQAKRHFTAAKVDGLFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYR  734
              L+A+ H+ +A VD + Y+L DD YVKAG  E+NYI RI E F+ +D   YFT QW++R
Sbjct  235  --LKARCHYRSANVDNVIYQLDDDVYVKAGPNEENYIGRITEFFKGLDQGSYFTCQWFFR  292

Query  735  AKDTVI-----KGCDEFVDKQRVFFSE  800
              DT I     K  D   D +RVF SE
Sbjct  293  TADTAISSKLLKVHDHKHDHKRVFLSE  319



>gb|KFK28331.1| chromomethylase [Arabis alpina]
Length=781

 Score =   107 bits (266),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 53/126 (42%), Positives = 75/126 (60%), Gaps = 4/126 (3%)
 Frame = +3

Query  420  DEDSEFVGGPVLEEEAKQRWPHRYQKGTEKSNGVTRSITSQDEFAGVLQAKRHFTAAKVD  599
            + D  FVG PV  + A +RWP RY+    +      ++ + D+   +++AK HF  AKVD
Sbjct  17   NTDLHFVGEPVPRDIALRRWPFRYRSRKAR----IETLNNGDDEKDLVEAKHHFLKAKVD  72

Query  600  GLFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRAKDTVIKGCDEFVDK  779
             + + LGDD YV A  G  N++ +I+E FEA+ G  YF A+W+YRA DTVIK     V  
Sbjct  73   DVEFSLGDDVYVTAEPGMPNHLAKIVEFFEAIHGEPYFRARWFYRASDTVIKDLSSHVHP  132

Query  780  QRVFFS  797
            +RVF S
Sbjct  133  KRVFLS  138



>ref|XP_002454088.1| hypothetical protein SORBIDRAFT_04g024430 [Sorghum bicolor]
 gb|EES07064.1| hypothetical protein SORBIDRAFT_04g024430 [Sorghum bicolor]
Length=770

 Score =   107 bits (266),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 62/151 (41%), Positives = 81/151 (54%), Gaps = 18/151 (12%)
 Frame = +3

Query  375  ASPPERKRI---TTNVTNDEDSEFVGGPVLEEEAKQRWPHRYQKGTEKSNGVTRSITSQD  545
            A  P +KR+   +     D + EFVG  V   EA+  WP RY++ T  +         +D
Sbjct  121  AGSPGKKRVGRRSAAAGGDHEPEFVGNAVPAVEARSNWPKRYERSTAATK------PEED  174

Query  546  EFAGVLQAKRHFTAAKVDGLFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQW  725
            E    L+A+ H+ +AKVD + Y LGDD YVKAGE E +YI RI E FE  D   YFT  W
Sbjct  175  E---ELKARCHYRSAKVDNVVYCLGDDVYVKAGENEADYIGRITEFFEGTDRCHYFTCHW  231

Query  726  YYRAKDTVIKGC------DEFVDKQRVFFSE  800
            ++RA+DTVI             D +RVF SE
Sbjct  232  FFRAEDTVINSLVSINVDGHMHDPRRVFLSE  262



>ref|NP_001105167.1| DNA (cytosine-5)-methyltransferase 3 [Zea mays]
 sp|Q9ARI6.1|CMT2_MAIZE RecName: Full=DNA (cytosine-5)-methyltransferase 2; AltName: 
Full=Chromomethylase 2; AltName: Full=DNA cytosine methyltransferase 
MET5; AltName: Full=Zea methyltransferase5; Short=Zmet5 
[Zea mays]
 gb|AAK15805.1| chromomethylase [Zea mays]
Length=915

 Score =   107 bits (266),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 62/151 (41%), Positives = 80/151 (53%), Gaps = 18/151 (12%)
 Frame = +3

Query  375  ASPPERKRI---TTNVTNDEDSEFVGGPVLEEEAKQRWPHRYQKGTEKSNGVTRSITSQD  545
            A  P +KR+   +   + D   EF+G PV   EA   WP RY++ T             D
Sbjct  118  AGSPGKKRVGRRSAAASGDHVPEFIGSPVGAAEAHSNWPKRYERST-----AANKPEEDD  172

Query  546  EFAGVLQAKRHFTAAKVDGLFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQW  725
            E    L+A+ H+ +AKVD + Y LGDD YVKAGE E +YI RI E FE  D   YFT +W
Sbjct  173  E----LKARCHYRSAKVDNIVYCLGDDVYVKAGENEADYIGRITEFFEGTDRCHYFTCRW  228

Query  726  YYRAKDTVIKGCDEF------VDKQRVFFSE  800
            ++RA+DTVI             D +RVF SE
Sbjct  229  FFRAEDTVINSLVSINVDGHKHDPRRVFLSE  259



>ref|XP_006390678.1| hypothetical protein EUTSA_v10018159mg [Eutrema salsugineum]
 gb|ESQ27964.1| hypothetical protein EUTSA_v10018159mg [Eutrema salsugineum]
Length=774

 Score =   106 bits (265),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 53/121 (44%), Positives = 72/121 (60%), Gaps = 4/121 (3%)
 Frame = +3

Query  435  FVGGPVLEEEAKQRWPHRYQKGTEKSNGVTRSITSQDEFAGVLQAKRHFTAAKVDGLFYK  614
            FVG P+   EA  +WP RY     + + V      ++E    +QA  H+  A VDG+   
Sbjct  17   FVGEPIPLAEAMSKWPFRYSSSKARKS-VNVDCGEEEE---KMQATHHYRRANVDGIQIA  72

Query  615  LGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRAKDTVIKGCDEFVDKQRVFF  794
            LGDD YVKA E + NYI +I+E FE++D   YF A+W+YR +DTVIKG   +V + RVF 
Sbjct  73   LGDDVYVKAEENKPNYIAKIVEFFESIDKEAYFRARWFYRPEDTVIKGLAHYVQRNRVFL  132

Query  795  S  797
            S
Sbjct  133  S  133



>pdb|4FT2|A Chain A, Crystal Structure Of Zea Mays Zmet2 In Complex H3(1-15)k9me2 
Peptide And Sah
 pdb|4FT2|B Chain B, Crystal Structure Of Zea Mays Zmet2 In Complex H3(1-15)k9me2 
Peptide And Sah
 pdb|4FT4|B Chain B, Crystal Structure Of Zea Mays Zmet2 In Complex H3(1-32)k9me2 
Peptide And Sah
 pdb|4FT4|A Chain A, Crystal Structure Of Zea Mays Zmet2 In Complex H3(1-32)k9me2 
Peptide And Sah
Length=784

 Score =   106 bits (264),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 57/133 (43%), Positives = 76/133 (57%), Gaps = 15/133 (11%)
 Frame = +3

Query  420  DEDSEFVGGPVLEEEAKQRWPHRYQKGTEKSNGVTRSITSQDEFAGVLQAKRHFTAAKVD  599
            D + EF+G PV  +EA+  WP RY + T       +    ++E    L+A+ H+ +AKVD
Sbjct  4    DHEPEFIGSPVAADEARSNWPKRYGRST-----AAKKPDEEEE----LKARCHYRSAKVD  54

Query  600  GLFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRAKDTVIKGCDEFV--  773
             + Y LGDD YVKAGE E +YI RI E FE  D   YFT +W++RA+DTVI         
Sbjct  55   NVVYCLGDDVYVKAGENEADYIGRITEFFEGTDQCHYFTCRWFFRAEDTVINSLVSISVD  114

Query  774  ----DKQRVFFSE  800
                D +RVF SE
Sbjct  115  GHKHDPRRVFLSE  127



>pdb|4FSX|A Chain A, Crystal Structure Of Se-Substituted Zea Mays Zmet2 In 
Complex With Sah
 pdb|4FSX|B Chain B, Crystal Structure Of Se-Substituted Zea Mays Zmet2 In 
Complex With Sah
Length=784

 Score =   106 bits (264),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 57/133 (43%), Positives = 76/133 (57%), Gaps = 15/133 (11%)
 Frame = +3

Query  420  DEDSEFVGGPVLEEEAKQRWPHRYQKGTEKSNGVTRSITSQDEFAGVLQAKRHFTAAKVD  599
            D + EF+G PV  +EA+  WP RY + T       +    ++E    L+A+ H+ +AKVD
Sbjct  4    DHEPEFIGSPVAADEARSNWPKRYGRST-----AAKKPDEEEE----LKARCHYRSAKVD  54

Query  600  GLFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRAKDTVIKGCDEFV--  773
             + Y LGDD YVKAGE E +YI RI E FE  D   YFT +W++RA+DTVI         
Sbjct  55   NVVYCLGDDVYVKAGENEADYIGRITEFFEGTDQCHYFTCRWFFRAEDTVINSLVSISVD  114

Query  774  ----DKQRVFFSE  800
                D +RVF SE
Sbjct  115  GHKHDPRRVFLSE  127



>ref|XP_010429914.1| PREDICTED: putative DNA (cytosine-5)-methyltransferase CMT1 isoform 
X1 [Camelina sativa]
Length=796

 Score =   105 bits (263),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 55/129 (43%), Positives = 76/129 (59%), Gaps = 3/129 (2%)
 Frame = +3

Query  420  DEDSEFVGGPVLEEEAKQRWPHRYQKGTEKSNGVTRSITSQDEFAG---VLQAKRHFTAA  590
            + D  F G P+   E+  RWP RYQ    K +  T + T+    A    + QAKRH+  A
Sbjct  14   ESDLCFAGKPISVVESMIRWPLRYQVKKPKLDDTTPNKTAALNGAKEEEIKQAKRHYEQA  73

Query  591  KVDGLFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRAKDTVIKGCDEF  770
             VDG+   L DD YV A  G+ N+I ++IE+FEA DG  YF A+W+YR  DTVI+   + 
Sbjct  74   LVDGVLINLNDDVYVTADPGKANFIAKVIELFEAADGEPYFRARWFYRPDDTVIERFKQL  133

Query  771  VDKQRVFFS  797
            V+++RVF S
Sbjct  134  VEEKRVFLS  142



>ref|XP_010429915.1| PREDICTED: putative DNA (cytosine-5)-methyltransferase CMT1 isoform 
X2 [Camelina sativa]
Length=795

 Score =   105 bits (263),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 55/129 (43%), Positives = 76/129 (59%), Gaps = 3/129 (2%)
 Frame = +3

Query  420  DEDSEFVGGPVLEEEAKQRWPHRYQKGTEKSNGVTRSITSQDEFAG---VLQAKRHFTAA  590
            + D  F G P+   E+  RWP RYQ    K +  T + T+    A    + QAKRH+  A
Sbjct  14   ESDLCFAGKPISVVESMIRWPLRYQVKKPKLDDTTPNKTAALNGAKEEEIKQAKRHYEQA  73

Query  591  KVDGLFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRAKDTVIKGCDEF  770
             VDG+   L DD YV A  G+ N+I ++IE+FEA DG  YF A+W+YR  DTVI+   + 
Sbjct  74   LVDGVLINLNDDVYVTADPGKANFIAKVIELFEAADGEPYFRARWFYRPDDTVIERFKQL  133

Query  771  VDKQRVFFS  797
            V+++RVF S
Sbjct  134  VEEKRVFLS  142



>gb|EMT28418.1| DNA (cytosine-5)-methyltransferase 1 [Aegilops tauschii]
Length=1236

 Score =   106 bits (264),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 54/125 (43%), Positives = 77/125 (62%), Gaps = 4/125 (3%)
 Frame = +3

Query  435  FVGGPVLEEEAKQRWPHRYQKG---TEKSNGVTRSITSQDEFAGVLQAKRHFTAAKVDGL  605
            FVG  V EEEA+QRWPHRY+K     EK+N  T ++      A VL  K H+  A + G 
Sbjct  444  FVGEAVPEEEARQRWPHRYEKNHHFVEKANSYTSTLHYSAGNA-VLDVKCHYLQASISGS  502

Query  606  FYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRAKDTVIKGCDEFVDKQR  785
               +GD A+VK  EG+ NYI +I+E FE V G  Y   QW++RA+DT+++   +  D +R
Sbjct  503  TLCIGDCAFVKGPEGKPNYIGKILEFFETVAGEYYCRVQWFFRAEDTIMEDQAQSHDPRR  562

Query  786  VFFSE  800
            +F+S+
Sbjct  563  LFYSD  567



>ref|XP_002448525.1| hypothetical protein SORBIDRAFT_06g028430 [Sorghum bicolor]
 gb|EES12853.1| hypothetical protein SORBIDRAFT_06g028430 [Sorghum bicolor]
Length=913

 Score =   105 bits (262),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 63/151 (42%), Positives = 80/151 (53%), Gaps = 18/151 (12%)
 Frame = +3

Query  375  ASPPERKRI---TTNVTNDEDSEFVGGPVLEEEAKQRWPHRYQKGTEKSNGVTRSITSQD  545
            A  P +KR+   +     D + EFVG  V   EA+  WP RY++ T            +D
Sbjct  115  AGSPGKKRVGRRSAAAGGDHEPEFVGNAVPAAEARSNWPKRYERSTAAKK------PEED  168

Query  546  EFAGVLQAKRHFTAAKVDGLFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQW  725
            E    L AK H+ +AKVD + Y LGDD YVKAGE E +YI RI E FE  D   YFT +W
Sbjct  169  E---ELNAKCHYRSAKVDNVVYCLGDDVYVKAGENEADYIGRITEFFEGTDRCHYFTCRW  225

Query  726  YYRAKDTVIKGCDEF------VDKQRVFFSE  800
            ++RA+DTVI             D +RVF SE
Sbjct  226  FFRAEDTVINSLVSINVDGHKHDPRRVFLSE  256



>ref|XP_010662140.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2-like isoform 
X2 [Vitis vinifera]
 ref|XP_010662141.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2-like isoform 
X2 [Vitis vinifera]
Length=763

 Score =   104 bits (260),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 51/123 (41%), Positives = 77/123 (63%), Gaps = 0/123 (0%)
 Frame = +3

Query  429  SEFVGGPVLEEEAKQRWPHRYQKGTEKSNGVTRSITSQDEFAGVLQAKRHFTAAKVDGLF  608
            S  VG PV +EEA+QRWP RY++   +S G +      +E   VL  K H++ A+++   
Sbjct  107  SFLVGDPVPDEEARQRWPWRYEEKDRQSKGQSVKPNDDEEDELVLDVKCHYSQAEIEKCI  166

Query  609  YKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRAKDTVIKGCDEFVDKQRV  788
            + LGD AYVK  +G  NYI RI+E F+ +D   YF  QW++R +DTV++    F +K+R+
Sbjct  167  FNLGDCAYVKGKKGGRNYIGRILEFFKTMDDEDYFRVQWFFRPEDTVMEEEGAFHEKKRL  226

Query  789  FFS  797
            F+S
Sbjct  227  FYS  229



>ref|XP_010662142.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2-like isoform 
X3 [Vitis vinifera]
Length=731

 Score =   104 bits (260),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 51/123 (41%), Positives = 77/123 (63%), Gaps = 0/123 (0%)
 Frame = +3

Query  429  SEFVGGPVLEEEAKQRWPHRYQKGTEKSNGVTRSITSQDEFAGVLQAKRHFTAAKVDGLF  608
            S  VG PV +EEA+QRWP RY++   +S G +      +E   VL  K H++ A+++   
Sbjct  107  SFLVGDPVPDEEARQRWPWRYEEKDRQSKGQSVKPNDDEEDELVLDVKCHYSQAEIEKCI  166

Query  609  YKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRAKDTVIKGCDEFVDKQRV  788
            + LGD AYVK  +G  NYI RI+E F+ +D   YF  QW++R +DTV++    F +K+R+
Sbjct  167  FNLGDCAYVKGKKGGRNYIGRILEFFKTMDDEDYFRVQWFFRPEDTVMEEEGAFHEKKRL  226

Query  789  FFS  797
            F+S
Sbjct  227  FYS  229



>ref|XP_010662139.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2-like isoform 
X1 [Vitis vinifera]
Length=892

 Score =   104 bits (260),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 51/123 (41%), Positives = 77/123 (63%), Gaps = 0/123 (0%)
 Frame = +3

Query  429  SEFVGGPVLEEEAKQRWPHRYQKGTEKSNGVTRSITSQDEFAGVLQAKRHFTAAKVDGLF  608
            S  VG PV +EEA+QRWP RY++   +S G +      +E   VL  K H++ A+++   
Sbjct  107  SFLVGDPVPDEEARQRWPWRYEEKDRQSKGQSVKPNDDEEDELVLDVKCHYSQAEIEKCI  166

Query  609  YKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRAKDTVIKGCDEFVDKQRV  788
            + LGD AYVK  +G  NYI RI+E F+ +D   YF  QW++R +DTV++    F +K+R+
Sbjct  167  FNLGDCAYVKGKKGGRNYIGRILEFFKTMDDEDYFRVQWFFRPEDTVMEEEGAFHEKKRL  226

Query  789  FFS  797
            F+S
Sbjct  227  FYS  229



>gb|EMS55851.1| DNA (cytosine-5)-methyltransferase CMT2 [Triticum urartu]
Length=897

 Score =   104 bits (260),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 53/125 (42%), Positives = 77/125 (62%), Gaps = 4/125 (3%)
 Frame = +3

Query  435  FVGGPVLEEEAKQRWPHRYQKG---TEKSNGVTRSITSQDEFAGVLQAKRHFTAAKVDGL  605
            FVG  V EEEA+QRWPHRY+K     EK+N  T ++      A VL  K H+  A + G 
Sbjct  429  FVGEAVPEEEARQRWPHRYEKNHHFVEKANSYTSTLHYSAGNA-VLDVKCHYLQASISGS  487

Query  606  FYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRAKDTVIKGCDEFVDKQR  785
               +GD A+VK  EG+ +YI +I+E FE V G  Y   QW++RA+DT+++   +  D +R
Sbjct  488  TLCIGDCAFVKGPEGKPDYIGKILEFFETVAGEYYCRVQWFFRAEDTIMEDQAQSHDPRR  547

Query  786  VFFSE  800
            +F+S+
Sbjct  548  LFYSD  552



>gb|KDP44326.1| hypothetical protein JCGZ_19193 [Jatropha curcas]
Length=752

 Score =   103 bits (258),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 50/90 (56%), Positives = 69/90 (77%), Gaps = 2/90 (2%)
 Frame = +3

Query  534  TSQDEFAGVLQAKRHFTAAKVDGL-FYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALY  710
              +D+   V+ A+ H+  A+VDG   Y L DDA+VKA +GED+YIC+I+EMFEA+DG LY
Sbjct  1    MHKDDSDDVILARCHYRQAEVDGHNIYNLYDDAHVKAADGEDSYICKIVEMFEAIDGNLY  60

Query  711  FTAQWYYRAKDTVIKGCDEFVDKQRVFFSE  800
            FTAQW+YRA+DT IK   + ++++RVFFSE
Sbjct  61   FTAQWFYRARDTAIKHAYQ-MEQKRVFFSE  89



>emb|CDY08836.1| BnaA06g23880D [Brassica napus]
Length=805

 Score =   103 bits (258),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 53/128 (41%), Positives = 78/128 (61%), Gaps = 5/128 (4%)
 Frame = +3

Query  429  SEFVGGPVLEEEAKQRWPHRYQKGTEKSNGVTRSITSQDEFAG---VLQAKRHFTAAKVD  599
            S  +G P+ + EA+  WP RYQ   +K   V      + ++     +  A+RHF  A +D
Sbjct  56   SWVLGEPIADSEARTTWPERYQV-IQKKEVVPLPKKKKKKYVEEEEIFLARRHFRRAILD  114

Query  600  -GLFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRAKDTVIKGCDEFVD  776
              + Y L DDA+V++ E E  +IC+I E+FE  DG +YFTAQW+YRA DTVI+  +E +D
Sbjct  115  DSITYNLNDDAHVQSEEDEKPFICKIAEIFEGCDGKMYFTAQWFYRACDTVIQKHEEMID  174

Query  777  KQRVFFSE  800
             +RVF S+
Sbjct  175  DKRVFISD  182



>gb|EYU39242.1| hypothetical protein MIMGU_mgv1a001319mg [Erythranthe guttata]
Length=841

 Score =   103 bits (258),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 57/125 (46%), Positives = 75/125 (60%), Gaps = 19/125 (15%)
 Frame = +3

Query  435  FVGGPVLEEEAKQRWPHRYQKGTEKSNGVTRSITSQDEFAGVLQAKRHFTAAKVDGLFYK  614
            F+G PV  +EA++RWPHRYQK   +                V+QA+ HF  A+VDG  Y 
Sbjct  83   FLGEPVPADEARKRWPHRYQKINME----------------VVQARCHFLKAEVDGQIYF  126

Query  615  LGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRAKDTV---IKGCDEFVDKQR  785
            L DDAYV    G+ NYI +IIE+FEA+DG+  FTAQW+YR  DTV    K   +  + + 
Sbjct  127  LEDDAYVMGEPGKPNYIGKIIEIFEALDGSKNFTAQWFYRGGDTVRHSKKMPFKMFNTKC  186

Query  786  VFFSE  800
            VFFS+
Sbjct  187  VFFSD  191



>gb|EYU22416.1| hypothetical protein MIMGU_mgv1a001955mg [Erythranthe guttata]
Length=734

 Score =   103 bits (256),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 53/127 (42%), Positives = 74/127 (58%), Gaps = 18/127 (14%)
 Frame = +3

Query  420  DEDSEFVGGPVLEEEAKQRWPHRYQKGTEKSNGVTRSITSQDEFAGVLQAKRHFTAAKVD  599
            +++  F G P+  EEAK+RWPHRY                  EF    QA+ H+T A VD
Sbjct  35   EDEISFAGEPIPSEEAKRRWPHRY---------------VSKEFG---QARFHYTNAVVD  76

Query  600  GLFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRAKDTVIKGCDEFVDK  779
            G+ Y L +DAY++A + E NYI +I+EMFE V    +   QW+YRA +TVIK     +D 
Sbjct  77   GVEYDLLEDAYIEAPDNEPNYIAKIVEMFETVTRESFICTQWFYRANNTVIKEQYPLIDA  136

Query  780  QRVFFSE  800
            +RVF+S+
Sbjct  137  RRVFYSD  143



>ref|XP_006361281.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2-like [Solanum 
tuberosum]
Length=1086

 Score =   103 bits (257),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 54/153 (35%), Positives = 89/153 (58%), Gaps = 6/153 (4%)
 Frame = +3

Query  354  GNLVRSQASPPERKRITTNV-----TNDEDSEFVGGPVLEEEAKQRWPHRYQKGTEKSNG  518
            G++  +++  PE KRI  +          ++ F+G P+  EEA+++W  RY+    K   
Sbjct  276  GSVNYNESKGPEMKRIKNSAEKSVRKQKSNACFIGEPIDTEEAQEKWQWRYELKNRKMQR  335

Query  519  VTRSITSQDEFAGVLQAKRHFTAAKVDGLFYKLGDDAYVKAGEGEDNYICRIIEMFEAVD  698
                + S +E   +L  + H+  AKV G  + +GD A+VK GEG+  +I RI+E F+  +
Sbjct  336  QGWKLNSGEEDEIILNVECHYAQAKVAGFIFNIGDCAFVK-GEGKKKHIGRILEFFKTTE  394

Query  699  GALYFTAQWYYRAKDTVIKGCDEFVDKQRVFFS  797
            G  YF  QW++RA+DTV++G   F D++RVF+S
Sbjct  395  GEDYFRVQWFFRAEDTVLQGAASFHDRKRVFYS  427



>ref|XP_010324482.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2 [Solanum lycopersicum]
Length=1075

 Score =   102 bits (254),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 49/121 (40%), Positives = 75/121 (62%), Gaps = 1/121 (1%)
 Frame = +3

Query  435  FVGGPVLEEEAKQRWPHRYQKGTEKSNGVTRSITSQDEFAGVLQAKRHFTAAKVDGLFYK  614
            F+G P+  EEA+Q+W  RY+    K+      + S +E   +L  + H+  AKV G  + 
Sbjct  297  FIGEPIDTEEAQQQWQWRYELKNRKTQRQGWKLNSGEEDEIILNVECHYAQAKVAGFIFN  356

Query  615  LGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRAKDTVIKGCDEFVDKQRVFF  794
            +GD A+VK GEG+  +I RI+E F+  +G  YF  QW++RA+DTV++G   F D +RVF+
Sbjct  357  IGDCAFVK-GEGKKKHIGRILEFFKTTEGEDYFRVQWFFRAEDTVLQGAASFHDPKRVFY  415

Query  795  S  797
            S
Sbjct  416  S  416



>ref|XP_010236739.1| PREDICTED: DNA (cytosine-5)-methyltransferase 1-like [Brachypodium 
distachyon]
Length=897

 Score =   102 bits (253),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 60/154 (39%), Positives = 80/154 (52%), Gaps = 16/154 (10%)
 Frame = +3

Query  351  GGNLVRSQASPPERKRITTNVTNDEDSEFVGGPVLEEEAKQRWPHRYQKGTEKSNGVTRS  530
            G    R + + P R+R       D++ EFVG P   +EA+ +W  RYQ+         R 
Sbjct  104  GQATARRRVAQPTRER--NLAAGDKEPEFVGEPFPADEARSKWSQRYQRAA------PRR  155

Query  531  ITSQDEFAGVLQAKRHFTAAKVDGLFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALY  710
               + E    L+A+ H+ +A VDG  Y LGDD YVKA E E +YI RI E FE  D   Y
Sbjct  156  PDEEPE----LKARCHYRSANVDGTVYALGDDVYVKAAENEADYIGRITEFFEGTDRHCY  211

Query  711  FTAQWYYRAKDTVIKGC----DEFVDKQRVFFSE  800
            F  +W++R +DTVI       D   D +RVF SE
Sbjct  212  FACRWFFRPEDTVISTAKFVDDHTHDPKRVFLSE  245



>ref|XP_010234610.1| PREDICTED: DNA (cytosine-5)-methyltransferase 1-like [Brachypodium 
distachyon]
Length=894

 Score =   102 bits (253),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 59/149 (40%), Positives = 77/149 (52%), Gaps = 15/149 (10%)
 Frame = +3

Query  366  RSQASPPERKRITTNVTNDEDSEFVGGPVLEEEAKQRWPHRYQKGTEKSNGVTRSITSQD  545
            R + + P R R       D+D  FVG P    EA+ +WP RYQ     +         +D
Sbjct  108  RKRVAQPIRAR--NQAGGDKDHGFVGAPFPAGEARSKWPQRYQP----TKPRRPEEEEED  161

Query  546  EFAGVLQAKRHFTAAKVDGLFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQW  725
                  +A+ H+ +AKVD   Y LGDD YV AGE E +YI RI E FE +D   YFT +W
Sbjct  162  P-----KARCHYRSAKVDEAIYNLGDDVYVMAGENEPHYIGRITEFFEGIDKKCYFTCRW  216

Query  726  YYRAKDTVIKGC----DEFVDKQRVFFSE  800
            ++R +DTVI       D   D +RVF SE
Sbjct  217  FFRPEDTVISTAKFVNDHTHDPKRVFLSE  245



>dbj|BAF34637.1| chromomethylase [Brassica rapa]
Length=805

 Score =   101 bits (252),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 51/122 (42%), Positives = 75/122 (61%), Gaps = 5/122 (4%)
 Frame = +3

Query  447  PVLEEEAKQRWPHRYQKGTEKSNGVTRSITSQDEFAG---VLQAKRHFTAAKVD-GLFYK  614
            P+ + EA+  WP RYQ   +K   V      + ++     +  A+RHF  A +D  + Y 
Sbjct  62   PIADSEARTTWPERYQV-IQKKEVVPLPKKKKKKYVEEEEIFLARRHFRRAILDDSITYN  120

Query  615  LGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRAKDTVIKGCDEFVDKQRVFF  794
            L DDA+V++ E E  +IC+I E+FE  DG +YFTAQW+YRA DTVI+  +E +D +RVF 
Sbjct  121  LNDDAHVQSEEDEKPFICKIAEIFEGCDGKMYFTAQWFYRACDTVIQKHEEMIDDKRVFI  180

Query  795  SE  800
            S+
Sbjct  181  SD  182



>ref|XP_010230204.1| PREDICTED: DNA (cytosine-5)-methyltransferase 1-like [Brachypodium 
distachyon]
Length=956

 Score =   101 bits (252),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 60/146 (41%), Positives = 80/146 (55%), Gaps = 15/146 (10%)
 Frame = +3

Query  390  RKRI----TTNVTNDEDSEFVGGPVLEEEAKQRWPHRYQKGTEKSNGVTRSITSQDEFAG  557
            RKR+    T    +  +  FVG PV + EA+QRWP RY +  +  + V RS   +D    
Sbjct  143  RKRVARPSTERKVDASEDHFVGEPVPDHEARQRWPERY-RTKDSDSLVGRSAGEED----  197

Query  558  VLQAKRHFTAAKVDGLFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRA  737
             + A+ H+ +A VD   + L DD YVKAG  E+NYI RI E FE +D   YFT +W++R 
Sbjct  198  -ISARCHYRSACVDDAIFHLDDDVYVKAGPDEENYIGRIAEFFEGIDRGSYFTCRWFFRT  256

Query  738  KDTVIKG-----CDEFVDKQRVFFSE  800
             DTVI        D   D +RVF SE
Sbjct  257  ADTVISRKLLMVHDHKHDHKRVFLSE  282



>emb|CDY14524.1| BnaC03g49350D [Brassica napus]
Length=802

 Score =   101 bits (251),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 60/171 (35%), Positives = 92/171 (54%), Gaps = 19/171 (11%)
 Frame = +3

Query  342  DVAGGNLVRSQASP---------PERKRITTNV-----TNDEDSEFVGGPVLEEEAKQRW  479
            +++G    R + SP         P R R T  V     +  + S  +  P+ + EA+  W
Sbjct  13   EISGPTSTRPKRSPKAPVEVAAEPIRYRPTFKVELVVDSKKDPSWVLDEPIADSEARTTW  72

Query  480  PHRYQKGTEKSNGVTRSITSQDEFAG---VLQAKRHFTAAKVD-GLFYKLGDDAYVKAGE  647
            P RYQ   +K   V      + ++     +  A+RHF  A +D  + Y L DDA+V++ E
Sbjct  73   PERYQV-IQKKEVVPLPKKKKKKYVEEEEIFLARRHFRRAILDESITYNLFDDAHVQSDE  131

Query  648  GEDNYICRIIEMFEAVDGALYFTAQWYYRAKDTVIKGCDEFVDKQRVFFSE  800
             E  +IC+I+E+FE  DG +YFTAQW+YRA DT I+  +E +D +RVF S+
Sbjct  132  DEKPFICKIVEIFEGSDGKMYFTAQWFYRACDTAIQKHEEMIDHKRVFISD  182



>ref|XP_007156278.1| hypothetical protein PHAVU_003G273100g [Phaseolus vulgaris]
 gb|ESW28272.1| hypothetical protein PHAVU_003G273100g [Phaseolus vulgaris]
Length=1047

 Score =   101 bits (252),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 56/144 (39%), Positives = 84/144 (58%), Gaps = 7/144 (5%)
 Frame = +3

Query  384  PERKRITTNVTNDE--DSE----FVGGPVLEEEAKQRWPHRYQKGTEKSNGVTRSITSQD  545
            P RK+  T+ +  E  DSE    F+G P+ +EEA++RW  RY+   +K       I   +
Sbjct  266  PPRKKHKTSFSAKEGTDSESIAAFIGDPISDEEAQKRWGWRYELKDKKCKNQKLKINEGE  325

Query  546  EFAGVLQAKRHFTAAKVDGLFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQW  725
            E   +   K H+  A+V    + LGD A++K GEGE+ ++ +IIE F+  DG  YF  QW
Sbjct  326  EDEIIANVKCHYAQAEVGNCTFSLGDCAFIK-GEGEEKHVGKIIEFFQTTDGQSYFRVQW  384

Query  726  YYRAKDTVIKGCDEFVDKQRVFFS  797
            +YR +DTV++    F DK+RVF+S
Sbjct  385  FYRIQDTVVQDEGGFHDKRRVFYS  408



>gb|KHN10109.1| DNA (cytosine-5)-methyltransferase CMT2 [Glycine soja]
Length=1031

 Score =   101 bits (251),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 57/152 (38%), Positives = 86/152 (57%), Gaps = 7/152 (5%)
 Frame = +3

Query  360  LVRSQASPPERKRITTNVTNDE--DSE----FVGGPVLEEEAKQRWPHRYQKGTEKSNGV  521
            L  S   PP +K  T+  +  E  DSE    F+G P+ ++EA++RW  RY+   +K    
Sbjct  195  LPESDDRPPRKKFNTSTSSTKECIDSENFPSFIGDPIPDDEAQKRWGWRYELKDKKCKDN  254

Query  522  TRSITSQDEFAGVLQAKRHFTAAKVDGLFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDG  701
               I   +E   +   K H+  A++    + LGD A+VK GEGE+ ++ +IIE F+  DG
Sbjct  255  MFKINEGEEDEIIANVKCHYAQAEIGNCIFSLGDCAFVK-GEGEEKHVGKIIEFFQTTDG  313

Query  702  ALYFTAQWYYRAKDTVIKGCDEFVDKQRVFFS  797
              YF  QW+YR +DTV++    F DK+RVF+S
Sbjct  314  QNYFRVQWFYRIQDTVVQDEGGFHDKRRVFYS  345



>ref|XP_006599215.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2-like isoform 
X1 [Glycine max]
Length=1118

 Score =   101 bits (251),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 57/152 (38%), Positives = 86/152 (57%), Gaps = 7/152 (5%)
 Frame = +3

Query  360  LVRSQASPPERKRITTNVTNDE--DSE----FVGGPVLEEEAKQRWPHRYQKGTEKSNGV  521
            L  S   PP +K  T+  +  E  DSE    F+G P+ ++EA++RW  RY+   +K    
Sbjct  282  LPESDDRPPRKKFNTSTSSTKECIDSENFPSFIGDPIPDDEAQKRWGWRYELKDKKCKDN  341

Query  522  TRSITSQDEFAGVLQAKRHFTAAKVDGLFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDG  701
               I   +E   +   K H+  A++    + LGD A+VK GEGE+ ++ +IIE F+  DG
Sbjct  342  MFKINEGEEDEIIANVKCHYAQAEIGNCIFSLGDCAFVK-GEGEEKHVGKIIEFFQTTDG  400

Query  702  ALYFTAQWYYRAKDTVIKGCDEFVDKQRVFFS  797
              YF  QW+YR +DTV++    F DK+RVF+S
Sbjct  401  QNYFRVQWFYRIQDTVVQDEGGFHDKRRVFYS  432



>gb|KFK30827.1| hypothetical protein AALP_AA6G031000 [Arabis alpina]
Length=913

 Score =   100 bits (250),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 57/131 (44%), Positives = 81/131 (62%), Gaps = 10/131 (8%)
 Frame = +3

Query  429  SEFVGGPVLEEEAKQRWPHRYQKGTEKSNGVTRSITSQD------EFAGVLQAKRHFTAA  590
            + F+   + ++EA+  W  RY+   +    VT+   + D      EF   +  +RHF  A
Sbjct  84   ARFLDEAIPDDEARLIWSDRYKPKVKVVKVVTKKTKNYDDEDNEEEF---VLGRRHFRRA  140

Query  591  KVD-GLFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRAKDTVIKGCDE  767
             VD    ++L DDA+V+AG G D YIC+I+EMFE VDG LYFTAQWYYRA DTVI+  + 
Sbjct  141  IVDETHIFELNDDAHVEAGVGVDPYICKIVEMFEGVDGELYFTAQWYYRAVDTVIELHET  200

Query  768  FVDKQRVFFSE  800
             ++++RVF SE
Sbjct  201  LINEKRVFISE  211



>ref|XP_008448610.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2 isoform X1 
[Cucumis melo]
Length=1247

 Score =   101 bits (251),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 51/121 (42%), Positives = 71/121 (59%), Gaps = 1/121 (1%)
 Frame = +3

Query  435  FVGGPVLEEEAKQRWPHRYQKGTEKSNGVTRSITSQDEFAGVLQAKRHFTAAKVDGLFYK  614
            FVG PV  +EA+QRW  RY+   + S G   + +  DE   V+    H+T A +    + 
Sbjct  455  FVGDPVPADEAQQRWKWRYEMKNQISKGQKVTESDDDEDMIVVNVDCHYTQANIGNTVFS  514

Query  615  LGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRAKDTVIKGCDEFVDKQRVFF  794
            LGD  Y+K GEGE N++  IIE F+  DG  YF  QW+YR +DTVI+    F D +R+F+
Sbjct  515  LGDCVYIK-GEGEKNHVGTIIEFFKTTDGDNYFRGQWFYRVEDTVIQKEGAFHDPRRLFY  573

Query  795  S  797
            S
Sbjct  574  S  574



>ref|XP_006599216.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2-like isoform 
X2 [Glycine max]
Length=1042

 Score =   100 bits (250),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 57/152 (38%), Positives = 86/152 (57%), Gaps = 7/152 (5%)
 Frame = +3

Query  360  LVRSQASPPERKRITTNVTNDE--DSE----FVGGPVLEEEAKQRWPHRYQKGTEKSNGV  521
            L  S   PP +K  T+  +  E  DSE    F+G P+ ++EA++RW  RY+   +K    
Sbjct  206  LPESDDRPPRKKFNTSTSSTKECIDSENFPSFIGDPIPDDEAQKRWGWRYELKDKKCKDN  265

Query  522  TRSITSQDEFAGVLQAKRHFTAAKVDGLFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDG  701
               I   +E   +   K H+  A++    + LGD A+VK GEGE+ ++ +IIE F+  DG
Sbjct  266  MFKINEGEEDEIIANVKCHYAQAEIGNCIFSLGDCAFVK-GEGEEKHVGKIIEFFQTTDG  324

Query  702  ALYFTAQWYYRAKDTVIKGCDEFVDKQRVFFS  797
              YF  QW+YR +DTV++    F DK+RVF+S
Sbjct  325  QNYFRVQWFYRIQDTVVQDEGGFHDKRRVFYS  356



>gb|EPS61234.1| chromomethylase-like protein, partial [Genlisea aurea]
Length=64

 Score = 92.0 bits (227),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 42/63 (67%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = +3

Query  558  VLQAKRHFTAAKVDGLFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRA  737
            V+QAKRHF  A++D + Y +GDDAYVKA  G DNYIC+IIE F+A DG+  FTAQWYYRA
Sbjct  2    VVQAKRHFYKARLDDVIYAVGDDAYVKAEPGRDNYICKIIEFFQAEDGSKNFTAQWYYRA  61

Query  738  KDT  746
            +DT
Sbjct  62   EDT  64



>ref|XP_009150572.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT3 [Brassica 
rapa]
Length=805

 Score =   100 bits (249),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 51/122 (42%), Positives = 75/122 (61%), Gaps = 5/122 (4%)
 Frame = +3

Query  447  PVLEEEAKQRWPHRYQKGTEKSNGVTRSITSQDEFAG---VLQAKRHFTAAKVD-GLFYK  614
            P+ + EA+  WP RYQ   +K   V      + ++     +  A+RHF  A +D  + Y 
Sbjct  62   PIADSEARTTWPERYQV-IQKKEVVPLPKKKKKKYVEEEEIFLARRHFRRAILDDSITYN  120

Query  615  LGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRAKDTVIKGCDEFVDKQRVFF  794
            L DDA+V++ E E  +IC+I E+FE  DG +YFTAQW+YRA DTVI+  +E +D +RVF 
Sbjct  121  LYDDAHVQSEEDEKPFICKIAEIFEGCDGKMYFTAQWFYRACDTVIQKHEEMIDDKRVFI  180

Query  795  SE  800
            S+
Sbjct  181  SD  182



>ref|XP_002439474.1| hypothetical protein SORBIDRAFT_09g007390 [Sorghum bicolor]
 gb|EES17904.1| hypothetical protein SORBIDRAFT_09g007390 [Sorghum bicolor]
Length=1441

 Score =   101 bits (251),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 60/154 (39%), Positives = 88/154 (57%), Gaps = 17/154 (11%)
 Frame = +3

Query  378  SPPERKRITTNVTNDE--DSE-----FVGGPVLEEEAKQRWPHRYQ------KGTEKSNG  518
            S PE K + T+ T+ E  DS      FVG  V +EEA++RWPHRYQ      K  ++SN 
Sbjct  618  SAPENKPLDTHCTDSEMVDSMDGSYFFVGDAVPDEEAQKRWPHRYQNNHCLLKKDKRSNT  677

Query  519  VTRSITSQDEFAGVLQAKRHFTAAKVDGLFYKLGDDAYVKAGEGEDNYICRIIEMFEAVD  698
             T S   +     VL  K H+  A + G    +GD A++K  EG+ +YI R++E FE   
Sbjct  678  QTVSNVGK----AVLDVKCHYLEASICGSTLCIGDCAFIKGLEGKPHYIGRLLEFFETTA  733

Query  699  GALYFTAQWYYRAKDTVIKGCDEFVDKQRVFFSE  800
               YFT QW++RA+DTV++   +  D +R+F+S+
Sbjct  734  DEYYFTVQWFFRAEDTVMEDQAQSHDPRRLFYSD  767



>ref|XP_008448611.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2 isoform X2 
[Cucumis melo]
Length=1022

 Score =   100 bits (249),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 51/121 (42%), Positives = 71/121 (59%), Gaps = 1/121 (1%)
 Frame = +3

Query  435  FVGGPVLEEEAKQRWPHRYQKGTEKSNGVTRSITSQDEFAGVLQAKRHFTAAKVDGLFYK  614
            FVG PV  +EA+QRW  RY+   + S G   + +  DE   V+    H+T A +    + 
Sbjct  230  FVGDPVPADEAQQRWKWRYEMKNQISKGQKVTESDDDEDMIVVNVDCHYTQANIGNTVFS  289

Query  615  LGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRAKDTVIKGCDEFVDKQRVFF  794
            LGD  Y+K GEGE N++  IIE F+  DG  YF  QW+YR +DTVI+    F D +R+F+
Sbjct  290  LGDCVYIK-GEGEKNHVGTIIEFFKTTDGDNYFRGQWFYRVEDTVIQKEGAFHDPRRLFY  348

Query  795  S  797
            S
Sbjct  349  S  349



>ref|XP_002889276.1| hypothetical protein ARALYDRAFT_895912 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65535.1| hypothetical protein ARALYDRAFT_895912 [Arabidopsis lyrata subsp. 
lyrata]
Length=876

 Score =   100 bits (248),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 54/126 (43%), Positives = 69/126 (55%), Gaps = 2/126 (2%)
 Frame = +3

Query  420  DEDSEFVGGPVLEEEAKQRWPHRYQKGTEKSNGVTRSITSQDEFAGVLQAKRHFTAAKVD  599
            + D  F G PV   E+  RWPHRY     K    T   T  D+   +  AKRH+  A VD
Sbjct  14   ESDLCFAGKPVSVVESMIRWPHRYPSKKTKLEAATA--TKGDKKEKIKLAKRHYEQALVD  71

Query  600  GLFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRAKDTVIKGCDEFVDK  779
            G+   L DD YV    G+ N+I ++IEMFEA DG  Y   +W+YR  DT+I+   E V K
Sbjct  72   GVLINLNDDVYVTGLPGKLNFIGKVIEMFEADDGVPYSRIRWFYRPNDTLIERFAELVQK  131

Query  780  QRVFFS  797
            +RVF S
Sbjct  132  KRVFLS  137



>ref|XP_007040779.1| DNA-methyltransferase CMT2 [Theobroma cacao]
 gb|EOY25280.1| DNA-methyltransferase CMT2 [Theobroma cacao]
Length=1427

 Score =   100 bits (249),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 51/124 (41%), Positives = 74/124 (60%), Gaps = 1/124 (1%)
 Frame = +3

Query  426  DSEFVGGPVLEEEAKQRWPHRYQKGTEKSNGVTRSITSQDEFAGVLQAKRHFTAAKVDGL  605
            D  F+G P+ ++EA++RW  RY+    KS   + S+   DE   V   + H+  A++DG 
Sbjct  638  DPIFIGNPIPDDEAQERWRWRYEMKHIKSKRKSVSLDDDDEDKIVWNVECHYAQAEIDGC  697

Query  606  FYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRAKDTVIKGCDEFVDKQR  785
               LGD  Y+K GE    +I RI+E F+  DG  YF  QW+YRA+DTV+K    F DK+R
Sbjct  698  AINLGDCVYIK-GEEAKEHIGRILEFFKTTDGENYFRVQWFYRAEDTVLKQETAFHDKRR  756

Query  786  VFFS  797
            +F+S
Sbjct  757  LFYS  760



>ref|XP_004983483.1| PREDICTED: DNA (cytosine-5)-methyltransferase 3-like [Setaria 
italica]
Length=915

 Score =   100 bits (248),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 60/151 (40%), Positives = 80/151 (53%), Gaps = 21/151 (14%)
 Frame = +3

Query  384  PERKRIT------TNVTNDEDSEFVGGPVLEEEAKQRWPHRYQKGTEKSNGVTRSITSQD  545
            P +KR+       T    D + EFVG PV   EA+  WP RY +     +   R     +
Sbjct  118  PGKKRVAQPRKRGTAAAGDHEPEFVGEPVPAAEARANWPKRYDR-----SAAARRPEEDE  172

Query  546  EFAGVLQAKRHFTAAKVDGLFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQW  725
            E    ++A+ H+ +AKVD + Y LGDD YVKA E E +YI RI E FE  D   YFT +W
Sbjct  173  E----VKARCHYRSAKVDNIVYTLGDDVYVKAEENEADYIGRITEFFEGTDRCQYFTCRW  228

Query  726  YYRAKDTVIKG--CDEF----VDKQRVFFSE  800
            ++R +DTVI    C +      D +RVF SE
Sbjct  229  FFRPEDTVINSLVCIDVDGKKHDPRRVFLSE  259



>gb|EYU45367.1| hypothetical protein MIMGU_mgv1a020188mg [Erythranthe guttata]
Length=885

 Score =   100 bits (248),  Expect = 7e-20, Method: Composition-based stats.
 Identities = 54/142 (38%), Positives = 85/142 (60%), Gaps = 8/142 (6%)
 Frame = +3

Query  372  QASPPERKRITTNVTNDEDSEFVGGPVLEEEAKQRWPHRYQKGTEKSNGVTRSITSQDEF  551
            + SPP +K    + +  +D  F+G PV E+EA++ WP RY    +K+     +  + D+ 
Sbjct  98   EKSPPTKK----HKSGKKDYFFIGEPVHEDEARRLWPWRY----DKTEVYAAADDNDDDD  149

Query  552  AGVLQAKRHFTAAKVDGLFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYY  731
              V+  K H++ A++  + + LGD AYVK  EG  NY+ +I+E FE +DG  YF  QW++
Sbjct  150  VIVMNIKCHYSKAEIHKIVFDLGDCAYVKGPEGGPNYVGKILEFFETIDGEDYFRVQWFF  209

Query  732  RAKDTVIKGCDEFVDKQRVFFS  797
            RA+DTVIK      D +R+F+S
Sbjct  210  RAEDTVIKDDGRSHDNKRLFYS  231



>ref|XP_003615342.1| DNA (cytosine-5)-methyltransferase [Medicago truncatula]
 gb|AES98300.1| DNA (cytosine-5)-methyltransferase CMT3-like protein [Medicago 
truncatula]
Length=800

 Score = 99.8 bits (247),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 57/118 (48%), Positives = 78/118 (66%), Gaps = 9/118 (8%)
 Frame = +3

Query  384  PERKRITTNVTNDED----SEFVGGPVLEEEAKQRWPHRYQKGTEKSNGVTRSITSQDEF  551
            P+ + +  NV   +D    S+F+  P+L +EAK RWP RY    EK    TRS ++ DE 
Sbjct  102  PKSETVPMNVDGGDDEVSNSKFLRDPILLKEAKLRWPKRY---LEKEKKKTRSRSNSDE-  157

Query  552  AGVLQAKRHFTAAKVDG-LFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQ  722
              VLQA+ H+T AKVDG + YKL DDA+VK  + + ++IC+I+EMFEAVDG LYFT +
Sbjct  158  DEVLQARCHYTEAKVDGGVIYKLYDDAHVKGEKDDYHFICKIMEMFEAVDGELYFTPK  215



>emb|CBI26560.3| unnamed protein product [Vitis vinifera]
Length=847

 Score = 99.0 bits (245),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 51/123 (41%), Positives = 75/123 (61%), Gaps = 10/123 (8%)
 Frame = +3

Query  429  SEFVGGPVLEEEAKQRWPHRYQKGTEKSNGVTRSITSQDEFAGVLQAKRHFTAAKVDGLF  608
            S  VG PV +EEA+QRWP RY++              +DE   VL  K H++ A+++   
Sbjct  72   SFLVGDPVPDEEARQRWPWRYEEKVRDD--------EEDEL--VLDVKCHYSQAEIEKCI  121

Query  609  YKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRAKDTVIKGCDEFVDKQRV  788
            + LGD AYVKA +G  NYI RI+E F+ +D   YF  QW++R +DTV++    F +K+R+
Sbjct  122  FNLGDCAYVKASKGGRNYIGRILEFFKTMDDEDYFRVQWFFRPEDTVMEEEGAFHEKKRL  181

Query  789  FFS  797
            F+S
Sbjct  182  FYS  184



>ref|XP_011465071.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2 isoform X2 
[Fragaria vesca subsp. vesca]
Length=1082

 Score = 99.4 bits (246),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 49/125 (39%), Positives = 73/125 (58%), Gaps = 1/125 (1%)
 Frame = +3

Query  423  EDSEFVGGPVLEEEAKQRWPHRYQKGTEKSNGVTRSITSQDEFAGVLQAKRHFTAAKVDG  602
            E S F+G P+ + EA++RW  RYQ  +++S   +  +   +E   VL  + HF  AK+  
Sbjct  305  EPSFFIGDPIPDVEAQERWGWRYQMKSQRSKRQSMKLNDDEEDEIVLNVECHFAQAKIGN  364

Query  603  LFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRAKDTVIKGCDEFVDKQ  782
              + LGD  YV+  EG+ + + RI+E F   DG  YF  QW+YR +DTVIK      DK+
Sbjct  365  CIFSLGDCVYVQGNEGKKD-VGRILEFFRTTDGENYFRVQWFYRVEDTVIKEVGSSHDKR  423

Query  783  RVFFS  797
            R+F+S
Sbjct  424  RLFYS  428



>ref|XP_004509555.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2-like [Cicer 
arietinum]
Length=1093

 Score = 99.4 bits (246),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 53/147 (36%), Positives = 83/147 (56%), Gaps = 7/147 (5%)
 Frame = +3

Query  375  ASPPERKRITT----NVTNDEDS--EFVGGPVLEEEAKQRWPHRYQKGTEKSNGVTRSIT  536
             +PP++K  T+    N + +E S   F+G P+ ++EA++RW  RY+   +K       I 
Sbjct  170  GNPPKKKYKTSASLMNGSKNEKSIPSFIGDPIPDDEARKRWGWRYELKDKKCKDQVCKIN  229

Query  537  SQDEFAGVLQAKRHFTAAKVDGLFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFT  716
              +E   ++  K H+  A +    + LGD A++K GEG   YI +IIE F+  D   YF 
Sbjct  230  EDEEDEIIVNVKCHYAQANIGNCIFTLGDCAFIK-GEGAQKYIGKIIEFFQTTDSQNYFR  288

Query  717  AQWYYRAKDTVIKGCDEFVDKQRVFFS  797
             QW+YR +DTV+K    F DK+R+F+S
Sbjct  289  VQWFYRIQDTVVKDEGGFHDKRRLFYS  315



>ref|XP_011465070.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2 isoform X1 
[Fragaria vesca subsp. vesca]
Length=1089

 Score = 99.4 bits (246),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 49/125 (39%), Positives = 73/125 (58%), Gaps = 1/125 (1%)
 Frame = +3

Query  423  EDSEFVGGPVLEEEAKQRWPHRYQKGTEKSNGVTRSITSQDEFAGVLQAKRHFTAAKVDG  602
            E S F+G P+ + EA++RW  RYQ  +++S   +  +   +E   VL  + HF  AK+  
Sbjct  305  EPSFFIGDPIPDVEAQERWGWRYQMKSQRSKRQSMKLNDDEEDEIVLNVECHFAQAKIGN  364

Query  603  LFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRAKDTVIKGCDEFVDKQ  782
              + LGD  YV+  EG+ + + RI+E F   DG  YF  QW+YR +DTVIK      DK+
Sbjct  365  CIFSLGDCVYVQGNEGKKD-VGRILEFFRTTDGENYFRVQWFYRVEDTVIKEVGSSHDKR  423

Query  783  RVFFS  797
            R+F+S
Sbjct  424  RLFYS  428



>ref|XP_011465072.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2 isoform X3 
[Fragaria vesca subsp. vesca]
Length=999

 Score = 99.0 bits (245),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 49/125 (39%), Positives = 73/125 (58%), Gaps = 1/125 (1%)
 Frame = +3

Query  423  EDSEFVGGPVLEEEAKQRWPHRYQKGTEKSNGVTRSITSQDEFAGVLQAKRHFTAAKVDG  602
            E S F+G P+ + EA++RW  RYQ  +++S   +  +   +E   VL  + HF  AK+  
Sbjct  215  EPSFFIGDPIPDVEAQERWGWRYQMKSQRSKRQSMKLNDDEEDEIVLNVECHFAQAKIGN  274

Query  603  LFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRAKDTVIKGCDEFVDKQ  782
              + LGD  YV+  EG+ + + RI+E F   DG  YF  QW+YR +DTVIK      DK+
Sbjct  275  CIFSLGDCVYVQGNEGKKD-VGRILEFFRTTDGENYFRVQWFYRVEDTVIKEVGSSHDKR  333

Query  783  RVFFS  797
            R+F+S
Sbjct  334  RLFYS  338



>ref|XP_009392768.1| PREDICTED: DNA (cytosine-5)-methyltransferase 1-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=1098

 Score = 98.6 bits (244),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 54/132 (41%), Positives = 78/132 (59%), Gaps = 8/132 (6%)
 Frame = +3

Query  417  NDEDSEFVGGPVLEEEAKQRWPHRY----QKGTEKSNGVTRSITSQDEFAGVLQAKRHFT  584
            N+    FVG  V EE A+QRWPHR+    + G  KS+  T +I  +DE   +L  K H+ 
Sbjct  340  NNNACFFVGETVPEEVARQRWPHRFGWKDKGGNRKSS--TSNIDDEDEI--ILDVKCHYQ  395

Query  585  AAKVDGLFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRAKDTVIKGCD  764
             A + G  + +GD AYVK  + + NYI RI+E FE   G  Y   QW++RA+DTV+K   
Sbjct  396  KASICGCLFDIGDCAYVKGPKHKPNYIGRILEFFETKKGDYYCRVQWFFRAEDTVLKEQA  455

Query  765  EFVDKQRVFFSE  800
               D++R+F+S+
Sbjct  456  ALHDRKRLFYSD  467



>ref|XP_009392766.1| PREDICTED: DNA (cytosine-5)-methyltransferase 1-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=1098

 Score = 98.6 bits (244),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 54/132 (41%), Positives = 78/132 (59%), Gaps = 8/132 (6%)
 Frame = +3

Query  417  NDEDSEFVGGPVLEEEAKQRWPHRY----QKGTEKSNGVTRSITSQDEFAGVLQAKRHFT  584
            N+    FVG  V EE A+QRWPHR+    + G  KS+  T +I  +DE   +L  K H+ 
Sbjct  340  NNNACFFVGETVPEEVARQRWPHRFGWKDKGGNRKSS--TSNIDDEDEI--ILDVKCHYQ  395

Query  585  AAKVDGLFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRAKDTVIKGCD  764
             A + G  + +GD AYVK  + + NYI RI+E FE   G  Y   QW++RA+DTV+K   
Sbjct  396  KASICGCLFDIGDCAYVKGPKHKPNYIGRILEFFETKKGDYYCRVQWFFRAEDTVLKEQA  455

Query  765  EFVDKQRVFFSE  800
               D++R+F+S+
Sbjct  456  ALHDRKRLFYSD  467



>gb|AAC02661.1| chromomethylase [Arabidopsis thaliana]
Length=248

 Score = 94.4 bits (233),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 52/131 (40%), Positives = 70/131 (53%), Gaps = 6/131 (5%)
 Frame = +3

Query  420  DEDSEFVGGPVLEEEAKQRWPHRYQKGTEKSNGVTRSITS-----QDEFAGVLQAKRHFT  584
            + D  F G P+   E+  RWPHRYQ    K    T+   +     +DE   + QAK HF 
Sbjct  14   ESDLCFAGKPMSVVESTIRWPHRYQSKKTKLQAPTKKPANKGGKKEDE-EIIKQAKCHFD  72

Query  585  AAKVDGLFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRAKDTVIKGCD  764
             A VDG+   L DD YV    G+  +I ++IE+FEA DG  Y   +WYYR +DT+I+   
Sbjct  73   KALVDGVLINLNDDVYVTGLPGKLKFIAKVIELFEADDGVPYCRFRWYYRPEDTLIERFS  132

Query  765  EFVDKQRVFFS  797
              V  +RVF S
Sbjct  133  HLVQPKRVFLS  143



>ref|XP_010677406.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2 isoform X1 
[Beta vulgaris subsp. vulgaris]
Length=1060

 Score = 98.2 bits (243),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 50/121 (41%), Positives = 77/121 (64%), Gaps = 2/121 (2%)
 Frame = +3

Query  435  FVGGPVLEEEAKQRWPHRYQKGTEKSNGVTRSITSQDEFAGVLQAKRHFTAAKVDGLFYK  614
            F+G PV +EEA Q+W  RYQ    + NG + +  +++E    L+ K H+T A+++G  + 
Sbjct  285  FIGDPVPQEEALQKWGCRYQFKNRRINGGSLAGNAREENEPTLEVKCHYTQAEINGCIFH  344

Query  615  LGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRAKDTVIKGCDEFVDKQRVFF  794
            LGD A ++ GE +  +I RIIE FE +D   YF  QW+Y+ +DTV+K    F DK+R+F+
Sbjct  345  LGDCALIR-GENQ-KHIGRIIEFFETMDREDYFRVQWFYKPEDTVMKEEASFHDKKRIFY  402

Query  795  S  797
            S
Sbjct  403  S  403



>gb|AAB95486.1| chromomethylase [Arabidopsis arenosa]
 gb|AAC02671.1| chromomethylase [Arabidopsis arenosa]
Length=744

 Score = 97.1 bits (240),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 51/119 (43%), Positives = 66/119 (55%), Gaps = 4/119 (3%)
 Frame = +3

Query  441  GGPVLEEEAKQRWPHRYQKGTEKSNGVTRSITSQDEFAGVLQAKRHFTAAKVDGLFYKLG  620
            G PV   E+  RWPHRY     K    T+     D+   +  AKRH+  A VDG+   L 
Sbjct  13   GKPVSVVESMIRWPHRYPSKKTKLEAATKG----DKKEKIKLAKRHYEQALVDGVLINLN  68

Query  621  DDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRAKDTVIKGCDEFVDKQRVFFS  797
            DD YV    G+ N+I ++IEMFEA DG  Y   +W+YR  DT+I+   E V K+RVF S
Sbjct  69   DDVYVTHATGKLNFIGKVIEMFEADDGVPYCRIRWFYRPDDTLIERFAELVQKKRVFLS  127



>ref|XP_008373679.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2-like [Malus 
domestica]
Length=630

 Score = 97.1 bits (240),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 46/127 (36%), Positives = 76/127 (60%), Gaps = 1/127 (1%)
 Frame = +3

Query  417  NDEDSEFVGGPVLEEEAKQRWPHRYQKGTEKSNGVTRSITSQDEFAGVLQAKRHFTAAKV  596
            N + + F+G P+ + EA++RW  RY   +++S   +  +   +E   +L  + HF+ AK+
Sbjct  386  NIKSASFIGDPIPDVEAQERWGWRYXMKSQRSKRQSLKLNEDEEDEIILDVECHFSQAKI  445

Query  597  DGLFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRAKDTVIKGCDEFVD  776
                + LGD AY++  EG+  ++ RIIE F+  DG  YF  QW+Y+ +DTVIK      D
Sbjct  446  GDCIFDLGDCAYIEGDEGQ-KHVGRIIEFFKTADGEKYFRVQWFYKVEDTVIKEVGTSHD  504

Query  777  KQRVFFS  797
            K+R+F+S
Sbjct  505  KRRLFYS  511



>ref|XP_009373520.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2-like [Pyrus 
x bretschneideri]
Length=1384

 Score = 97.4 bits (241),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 48/146 (33%), Positives = 85/146 (58%), Gaps = 8/146 (5%)
 Frame = +3

Query  381  PPERKRITTNVTNDEDSE-------FVGGPVLEEEAKQRWPHRYQKGTEKSNGVTRSITS  539
            PP++++   +  N ++ +       F+G P+ + EA++RW  RY+  +++S   +  +  
Sbjct  522  PPKKRKTLDSSKNKQNKQESIKSASFIGDPIPDVEAQERWGWRYRMKSQRSKRQSLKLNE  581

Query  540  QDEFAGVLQAKRHFTAAKVDGLFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTA  719
             +E   +L  + HF+ AK+    + LGD AY++  EG+  ++ RIIE F+  DG  YF  
Sbjct  582  DEEDEIILDVECHFSQAKIGDCIFDLGDCAYIEGDEGQ-KHVGRIIEFFKTADGEKYFRV  640

Query  720  QWYYRAKDTVIKGCDEFVDKQRVFFS  797
            QW+Y+ +DTVIK      DK+R+F+S
Sbjct  641  QWFYKVEDTVIKEAGTSHDKRRLFYS  666



>ref|XP_010449422.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2-like [Camelina 
sativa]
Length=1242

 Score = 97.4 bits (241),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 56/139 (40%), Positives = 79/139 (57%), Gaps = 6/139 (4%)
 Frame = +3

Query  393  KRITTNVTNDEDSE----FVGGPVLEEEAKQRWPHRYQKGTEKSNGVTRSITSQDEFAGV  560
            KR+      ++D      F+G P+  EEA++RW  RY     KS   T   +  DE   V
Sbjct  451  KRVIGTAVQEQDKRSICFFIGEPISCEEAQERWRWRYDLKERKSKN-TGQQSKNDENKIV  509

Query  561  LQAKRHFTAAKVDGLFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRAK  740
               + H++ AKVDG  + LGD A +K GE E+N+I +I+E F+  DG  YF  QW+YRA 
Sbjct  510  ANVECHYSQAKVDGHTFSLGDFACIK-GEEEENHIGKIVEFFKTTDGESYFRVQWFYRAT  568

Query  741  DTVIKGCDEFVDKQRVFFS  797
            DTV+K      DK+R+F+S
Sbjct  569  DTVMKQQATNHDKRRLFYS  587



>gb|KGN55702.1| hypothetical protein Csa_3G006640 [Cucumis sativus]
Length=1239

 Score = 96.7 bits (239),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 50/123 (41%), Positives = 71/123 (58%), Gaps = 1/123 (1%)
 Frame = +3

Query  429  SEFVGGPVLEEEAKQRWPHRYQKGTEKSNGVTRSITSQDEFAGVLQAKRHFTAAKVDGLF  608
            S FVG PV  +EA+QRW  RY+   + +     + +  DE   V+    H+T A +    
Sbjct  454  SFFVGDPVPADEAQQRWKWRYEMKNQITKEQKVTESDDDEDMIVVNVDCHYTQANIGNTV  513

Query  609  YKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRAKDTVIKGCDEFVDKQRV  788
            + LGD  Y+K GEGE N++  IIE F+  DG  YF  QW+YR +DTVI+    F D +R+
Sbjct  514  FSLGDCVYIK-GEGEKNHVGTIIEFFKTTDGDNYFRGQWFYRVEDTVIQEEGAFHDPRRL  572

Query  789  FFS  797
            F+S
Sbjct  573  FYS  575



>ref|XP_011028082.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2 isoform X3 
[Populus euphratica]
Length=1056

 Score = 96.7 bits (239),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 46/124 (37%), Positives = 73/124 (59%), Gaps = 1/124 (1%)
 Frame = +3

Query  426  DSEFVGGPVLEEEAKQRWPHRYQKGTEKSNGVTRSITSQDEFAGVLQAKRHFTAAKVDGL  605
            +   +G P+  +EA++RW  RY+  ++++     ++   DE   V   + H+T A ++G 
Sbjct  430  NCSLIGDPIPHDEAQERWYWRYEMKSKRTKHSRLALDDDDEDKVVWNVECHYTQADIEGR  489

Query  606  FYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRAKDTVIKGCDEFVDKQR  785
               LGD  YVK GEG  N+I  I+E F+  D   YF  QW+YRA+DTV+K   +F D +R
Sbjct  490  IINLGDCVYVK-GEGAKNHIGSILEFFKTTDREDYFRVQWFYRAEDTVMKEAADFHDNKR  548

Query  786  VFFS  797
            +F+S
Sbjct  549  LFYS  552



>ref|XP_004146191.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2-like [Cucumis 
sativus]
 ref|XP_004164187.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2-like [Cucumis 
sativus]
Length=1243

 Score = 96.7 bits (239),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 50/123 (41%), Positives = 71/123 (58%), Gaps = 1/123 (1%)
 Frame = +3

Query  429  SEFVGGPVLEEEAKQRWPHRYQKGTEKSNGVTRSITSQDEFAGVLQAKRHFTAAKVDGLF  608
            S FVG PV  +EA+QRW  RY+   + +     + +  DE   V+    H+T A +    
Sbjct  472  SFFVGDPVPADEAQQRWKWRYEMKNQITKEQKVTESDDDEDMIVVNVDCHYTQANIGNTV  531

Query  609  YKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRAKDTVIKGCDEFVDKQRV  788
            + LGD  Y+K GEGE N++  IIE F+  DG  YF  QW+YR +DTVI+    F D +R+
Sbjct  532  FSLGDCVYIK-GEGEKNHVGTIIEFFKTTDGDNYFRGQWFYRVEDTVIQEEGAFHDPRRL  590

Query  789  FFS  797
            F+S
Sbjct  591  FYS  593



>ref|XP_011028081.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2 isoform X2 
[Populus euphratica]
Length=1167

 Score = 96.3 bits (238),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 46/124 (37%), Positives = 73/124 (59%), Gaps = 1/124 (1%)
 Frame = +3

Query  426  DSEFVGGPVLEEEAKQRWPHRYQKGTEKSNGVTRSITSQDEFAGVLQAKRHFTAAKVDGL  605
            +   +G P+  +EA++RW  RY+  ++++     ++   DE   V   + H+T A ++G 
Sbjct  430  NCSLIGDPIPHDEAQERWYWRYEMKSKRTKHSRLALDDDDEDKVVWNVECHYTQADIEGR  489

Query  606  FYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRAKDTVIKGCDEFVDKQR  785
               LGD  YVK GEG  N+I  I+E F+  D   YF  QW+YRA+DTV+K   +F D +R
Sbjct  490  IINLGDCVYVK-GEGAKNHIGSILEFFKTTDREDYFRVQWFYRAEDTVMKEAADFHDNKR  548

Query  786  VFFS  797
            +F+S
Sbjct  549  LFYS  552



>ref|XP_011028080.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2 isoform X1 
[Populus euphratica]
Length=1218

 Score = 96.3 bits (238),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 46/124 (37%), Positives = 73/124 (59%), Gaps = 1/124 (1%)
 Frame = +3

Query  426  DSEFVGGPVLEEEAKQRWPHRYQKGTEKSNGVTRSITSQDEFAGVLQAKRHFTAAKVDGL  605
            +   +G P+  +EA++RW  RY+  ++++     ++   DE   V   + H+T A ++G 
Sbjct  430  NCSLIGDPIPHDEAQERWYWRYEMKSKRTKHSRLALDDDDEDKVVWNVECHYTQADIEGR  489

Query  606  FYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRAKDTVIKGCDEFVDKQR  785
               LGD  YVK GEG  N+I  I+E F+  D   YF  QW+YRA+DTV+K   +F D +R
Sbjct  490  IINLGDCVYVK-GEGAKNHIGSILEFFKTTDREDYFRVQWFYRAEDTVMKEAADFHDNKR  548

Query  786  VFFS  797
            +F+S
Sbjct  549  LFYS  552



>gb|AAC02670.1| chromomethylase [Arabidopsis suecica]
Length=754

 Score = 95.1 bits (235),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 52/131 (40%), Positives = 70/131 (53%), Gaps = 6/131 (5%)
 Frame = +3

Query  420  DEDSEFVGGPVLEEEAKQRWPHRYQKGTEKSNGVTRSITS-----QDEFAGVLQAKRHFT  584
            + D  F G P+   E+  RWPHRYQ    K    T+   +     +DE   + QAK HF 
Sbjct  14   ESDLCFAGKPMSVVESTIRWPHRYQSKKTKLQAPTKKPANKGGKKEDE-EIIKQAKCHFD  72

Query  585  AAKVDGLFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRAKDTVIKGCD  764
             A VDG+   L DD YV    G+  +I ++IE+FEA DG  Y   +WYYR +DT+I+   
Sbjct  73   KALVDGVLINLNDDVYVTGLPGKLKFIAKVIELFEADDGVPYCRFRWYYRPEDTLIERFS  132

Query  765  EFVDKQRVFFS  797
              V  +RVF S
Sbjct  133  HLVQPKRVFLS  143



>gb|AAC02662.1| chromomethylase [Arabidopsis thaliana]
Length=754

 Score = 94.7 bits (234),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 52/131 (40%), Positives = 70/131 (53%), Gaps = 6/131 (5%)
 Frame = +3

Query  420  DEDSEFVGGPVLEEEAKQRWPHRYQKGTEKSNGVTRSITS-----QDEFAGVLQAKRHFT  584
            + D  F G P+   E+  RWPHRYQ    K    T+   +     +DE   + QAK HF 
Sbjct  14   ESDLCFAGKPMSVVESTIRWPHRYQSKKTKLQAPTKKPANKGGKKEDE-EIIKQAKCHFD  72

Query  585  AAKVDGLFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRAKDTVIKGCD  764
             A VDG+   L DD YV    G+  +I ++IE+FEA DG  Y   +WYYR +DT+I+   
Sbjct  73   KALVDGVLINLNDDVYVTGLPGKLKFIAKVIELFEADDGVPYCRFRWYYRPEDTLIERFS  132

Query  765  EFVDKQRVFFS  797
              V  +RVF S
Sbjct  133  HLVQPKRVFLS  143



>gb|AAC02665.1| chromomethylase [Arabidopsis thaliana]
 gb|AAC02668.1| chromomethylase [Arabidopsis thaliana]
Length=560

 Score = 94.4 bits (233),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 52/131 (40%), Positives = 70/131 (53%), Gaps = 6/131 (5%)
 Frame = +3

Query  420  DEDSEFVGGPVLEEEAKQRWPHRYQKGTEKSNGVTRSITS-----QDEFAGVLQAKRHFT  584
            + D  F G P+   E+  RWPHRYQ    K    T+   +     +DE   + QAK HF 
Sbjct  14   ESDLCFAGKPMSVVESTIRWPHRYQSKKTKLQAPTKKPANKGGKKEDE-EIIKQAKCHFD  72

Query  585  AAKVDGLFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRAKDTVIKGCD  764
             A VDG+   L DD YV    G+  +I ++IE+FEA DG  Y   +WYYR +DT+I+   
Sbjct  73   KALVDGVLINLNDDVYVTGLPGKLKFIAKVIELFEADDGVPYCRFRWYYRPEDTLIERFS  132

Query  765  EFVDKQRVFFS  797
              V  +RVF S
Sbjct  133  HLVQPKRVFLS  143



>gb|AAC02667.1| chromomethylase [Arabidopsis thaliana]
Length=560

 Score = 94.4 bits (233),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 52/131 (40%), Positives = 70/131 (53%), Gaps = 6/131 (5%)
 Frame = +3

Query  420  DEDSEFVGGPVLEEEAKQRWPHRYQKGTEKSNGVTRSITS-----QDEFAGVLQAKRHFT  584
            + D  F G P+   E+  RWPHRYQ    K    T+   +     +DE   + QAK HF 
Sbjct  14   ESDLCFAGKPMSVVESTIRWPHRYQSKKTKLQAPTKKPANKGGKKEDE-EIIKQAKCHFD  72

Query  585  AAKVDGLFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRAKDTVIKGCD  764
             A VDG+   L DD YV    G+  +I ++IE+FEA DG  Y   +WYYR +DT+I+   
Sbjct  73   KALVDGVLINLNDDVYVTGLPGKLKFIAKVIELFEADDGVPYCRFRWYYRPEDTLIERFS  132

Query  765  EFVDKQRVFFS  797
              V  +RVF S
Sbjct  133  HLVQPKRVFLS  143



>ref|XP_010665041.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2-like isoform 
X3 [Vitis vinifera]
Length=1349

 Score = 95.5 bits (236),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 51/124 (41%), Positives = 76/124 (61%), Gaps = 2/124 (2%)
 Frame = +3

Query  429  SEFVGGPVLEEEAKQRWPHRYQKGTEKSNGVTRSITSQD-EFAGVLQAKRHFTAAKVDGL  605
            S F+G PV ++EA++RW  RY    ++  G    + + D E   V   + H+T AK+DG 
Sbjct  655  SFFIGDPVPDKEAQERWHWRYDLKNKRFKGQGLKLNADDNEEEIVTNVECHYTQAKLDGT  714

Query  606  FYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRAKDTVIKGCDEFVDKQR  785
             + LGD A++K GEGE  ++ RI+E F+  +G  YF  QW+YRA+DTV+K      DK+R
Sbjct  715  IFNLGDCAHIK-GEGEQKHVGRILEFFKTTEGEDYFRVQWFYRAEDTVMKEEAASHDKKR  773

Query  786  VFFS  797
            +F S
Sbjct  774  IFCS  777



>ref|NP_565245.1| chromomethylase 1 [Arabidopsis thaliana]
 sp|O49139.2|CMT1_ARATH RecName: Full=Putative DNA (cytosine-5)-methyltransferase CMT1; 
AltName: Full=Chromomethylase 1; AltName: Full=Protein CHROMOMETHYLASE 
1 [Arabidopsis thaliana]
 gb|AAF14662.1|AC011713_10 Identical to gb|AF039367 ecotype Col-0 chromomethylase (CMT1) 
gene from Arabidopsis thaliana [Arabidopsis thaliana]
 gb|AAC02660.1| chromomethylase [Arabidopsis thaliana]
 gb|AEE36442.1| chromomethylase 1 [Arabidopsis thaliana]
Length=791

 Score = 94.7 bits (234),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 52/131 (40%), Positives = 70/131 (53%), Gaps = 6/131 (5%)
 Frame = +3

Query  420  DEDSEFVGGPVLEEEAKQRWPHRYQKGTEKSNGVTRSITS-----QDEFAGVLQAKRHFT  584
            + D  F G P+   E+  RWPHRYQ    K    T+   +     +DE   + QAK HF 
Sbjct  14   ESDLCFAGKPMSVVESTIRWPHRYQSKKTKLQAPTKKPANKGGKKEDE-EIIKQAKCHFD  72

Query  585  AAKVDGLFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRAKDTVIKGCD  764
             A VDG+   L DD YV    G+  +I ++IE+FEA DG  Y   +WYYR +DT+I+   
Sbjct  73   KALVDGVLINLNDDVYVTGLPGKLKFIAKVIELFEADDGVPYCRFRWYYRPEDTLIERFS  132

Query  765  EFVDKQRVFFS  797
              V  +RVF S
Sbjct  133  HLVQPKRVFLS  143



>gb|AAB95485.1| chromomethylase [Arabidopsis thaliana]
 gb|AAC02659.1| chromomethylase [Arabidopsis thaliana]
Length=791

 Score = 94.7 bits (234),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 52/131 (40%), Positives = 70/131 (53%), Gaps = 6/131 (5%)
 Frame = +3

Query  420  DEDSEFVGGPVLEEEAKQRWPHRYQKGTEKSNGVTRSITS-----QDEFAGVLQAKRHFT  584
            + D  F G P+   E+  RWPHRYQ    K    T+   +     +DE   + QAK HF 
Sbjct  14   ESDLCFAGKPMSVVESTIRWPHRYQSKKTKLQAPTKKPANKGGKKEDE-EIIKQAKCHFD  72

Query  585  AAKVDGLFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRAKDTVIKGCD  764
             A VDG+   L DD YV    G+  +I ++IE+FEA DG  Y   +WYYR +DT+I+   
Sbjct  73   KALVDGVLINLNDDVYVTGLPGKLKFIAKVIELFEADDGVPYCRFRWYYRPEDTLIERFS  132

Query  765  EFVDKQRVFFS  797
              V  +RVF S
Sbjct  133  HLVQPKRVFLS  143



>gb|AAC02663.1| chromomethylase [Arabidopsis thaliana]
Length=791

 Score = 94.7 bits (234),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 52/131 (40%), Positives = 70/131 (53%), Gaps = 6/131 (5%)
 Frame = +3

Query  420  DEDSEFVGGPVLEEEAKQRWPHRYQKGTEKSNGVTRSITS-----QDEFAGVLQAKRHFT  584
            + D  F G P+   E+  RWPHRYQ    K    T+   +     +DE   + QAK HF 
Sbjct  14   ESDLCFAGKPMSVVESTIRWPHRYQSKKTKLQAPTKKPANKGGKKEDE-EIIKQAKCHFD  72

Query  585  AAKVDGLFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRAKDTVIKGCD  764
             A VDG+   L DD YV    G+  +I ++IE+FEA DG  Y   +WYYR +DT+I+   
Sbjct  73   KALVDGVLINLNDDVYVTGLPGKLKFIAKVIELFEADDGVPYCRFRWYYRPEDTLIERFS  132

Query  765  EFVDKQRVFFS  797
              V  +RVF S
Sbjct  133  HLVQPKRVFLS  143



>ref|XP_006414021.1| hypothetical protein EUTSA_v10024250mg [Eutrema salsugineum]
 gb|ESQ55474.1| hypothetical protein EUTSA_v10024250mg [Eutrema salsugineum]
Length=1192

 Score = 95.1 bits (235),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 54/139 (39%), Positives = 77/139 (55%), Gaps = 6/139 (4%)
 Frame = +3

Query  393  KRITTNVTNDEDSE----FVGGPVLEEEAKQRWPHRYQKGTEKSNGVTRSITSQDEFAGV  560
            KR+T     D+       F+G P+  EEA++RW  RY     KS    +  +  DE   V
Sbjct  402  KRVTRTAVRDKHEHGIFFFIGEPIPCEEAQERWRWRYDLKERKSKSKDQQ-SEDDEDKIV  460

Query  561  LQAKRHFTAAKVDGLFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRAK  740
               + H+  AKVD   + LGD  Y+K GE E+ +I +I+E F+  DG  YF  QW+YRA 
Sbjct  461  ANVECHYLQAKVDNQTFSLGDFTYIK-GEEEEKHIGKIVEFFKTTDGECYFRVQWFYRAT  519

Query  741  DTVIKGCDEFVDKQRVFFS  797
            DTV+K    + DK+R+F+S
Sbjct  520  DTVMKQQATYHDKRRLFYS  538



>ref|XP_010665031.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2-like isoform 
X1 [Vitis vinifera]
Length=1432

 Score = 95.1 bits (235),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 51/124 (41%), Positives = 76/124 (61%), Gaps = 2/124 (2%)
 Frame = +3

Query  429  SEFVGGPVLEEEAKQRWPHRYQKGTEKSNGVTRSITSQD-EFAGVLQAKRHFTAAKVDGL  605
            S F+G PV ++EA++RW  RY    ++  G    + + D E   V   + H+T AK+DG 
Sbjct  655  SFFIGDPVPDKEAQERWHWRYDLKNKRFKGQGLKLNADDNEEEIVTNVECHYTQAKLDGT  714

Query  606  FYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRAKDTVIKGCDEFVDKQR  785
             + LGD A++K GEGE  ++ RI+E F+  +G  YF  QW+YRA+DTV+K      DK+R
Sbjct  715  IFNLGDCAHIK-GEGEQKHVGRILEFFKTTEGEDYFRVQWFYRAEDTVMKEEAASHDKKR  773

Query  786  VFFS  797
            +F S
Sbjct  774  IFCS  777



>ref|XP_010665035.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2-like isoform 
X2 [Vitis vinifera]
Length=1430

 Score = 95.1 bits (235),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 51/124 (41%), Positives = 76/124 (61%), Gaps = 2/124 (2%)
 Frame = +3

Query  429  SEFVGGPVLEEEAKQRWPHRYQKGTEKSNGVTRSITSQD-EFAGVLQAKRHFTAAKVDGL  605
            S F+G PV ++EA++RW  RY    ++  G    + + D E   V   + H+T AK+DG 
Sbjct  653  SFFIGDPVPDKEAQERWHWRYDLKNKRFKGQGLKLNADDNEEEIVTNVECHYTQAKLDGT  712

Query  606  FYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRAKDTVIKGCDEFVDKQR  785
             + LGD A++K GEGE  ++ RI+E F+  +G  YF  QW+YRA+DTV+K      DK+R
Sbjct  713  IFNLGDCAHIK-GEGEQKHVGRILEFFKTTEGEDYFRVQWFYRAEDTVMKEEAASHDKKR  771

Query  786  VFFS  797
            +F S
Sbjct  772  IFCS  775



>ref|XP_011092593.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2 [Sesamum indicum]
Length=1352

 Score = 94.7 bits (234),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 47/121 (39%), Positives = 74/121 (61%), Gaps = 2/121 (2%)
 Frame = +3

Query  435  FVGGPVLEEEAKQRWPHRYQKGTEKSNGVTRSITSQDEFAGVLQAKRHFTAAKVDGLFYK  614
            F+G P+ +EEA QRW  RY+  ++K  G +  + + +E   +L    H+  AKV      
Sbjct  575  FLGDPIPQEEADQRWQWRYELKSKK-RGQSWKLNAGEEDEIILNVDCHYAQAKVGSCVLN  633

Query  615  LGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRAKDTVIKGCDEFVDKQRVFF  794
            +GD  YVK GEG+  ++ RI+E F+ ++G  YF  QW++RA+DTV+K      DK+R+F+
Sbjct  634  IGDCVYVK-GEGKKKHVGRILEFFKTMEGEEYFRVQWFFRAEDTVLKDAALVHDKRRLFY  692

Query  795  S  797
            S
Sbjct  693  S  693



>ref|XP_010110416.1| DNA (cytosine-5)-methyltransferase CMT2 [Morus notabilis]
 gb|EXC26248.1| DNA (cytosine-5)-methyltransferase CMT2 [Morus notabilis]
Length=1399

 Score = 94.0 bits (232),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 47/135 (35%), Positives = 76/135 (56%), Gaps = 9/135 (7%)
 Frame = +3

Query  417  NDEDSEFVGGPVLEEEAKQRWPHRYQKG--------TEKSNGVTRSITSQDEFAGVLQAK  572
            N   S F+G P+ ++EA++RW  RY+           ++S   T  +   DE   VL  +
Sbjct  624  NPNISFFIGDPIPDDEAQERWHWRYELKDYSLCELENQQSKHRTSKLNDDDEDKVVLNVE  683

Query  573  RHFTAAKVDGLFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRAKDTVI  752
             HF  A+V    + LGD A+++ G+G+  ++ RI+E F+  DG  YF  QW+Y  +DTV+
Sbjct  684  CHFAQAQVGNCIFSLGDCAHIQ-GDGKKKHVGRIVEFFKTTDGEKYFRVQWFYPIEDTVV  742

Query  753  KGCDEFVDKQRVFFS  797
            +    F DK+R+F+S
Sbjct  743  QDVGAFHDKRRLFYS  757



>ref|NP_193637.2| chromomethylase 2 [Arabidopsis thaliana]
 sp|Q94F87.3|CMT2_ARATH RecName: Full=DNA (cytosine-5)-methyltransferase CMT2; AltName: 
Full=Chromomethylase 2; AltName: Full=Protein CHROMOMETHYLASE 
2 [Arabidopsis thaliana]
 gb|AEE84126.1| chromomethylase 2 [Arabidopsis thaliana]
Length=1295

 Score = 93.2 bits (230),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 54/140 (39%), Positives = 83/140 (59%), Gaps = 8/140 (6%)
 Frame = +3

Query  393  KRITTNVTNDEDSE----FVGGPVLEEEAKQRWPHRYQKGTEKSNGVTRSITSQD-EFAG  557
            KR+T     +++      F+G P+  EEA++RW  RY+    KS   +R   S+D E   
Sbjct  505  KRVTRTAVQEQNKRSICFFIGEPLSCEEAQERWRWRYELKERKSK--SRGQQSEDDEDKI  562

Query  558  VLQAKRHFTAAKVDGLFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRA  737
            V   + H++ AKVDG  + LGD AY+K GE E+ ++ +I+E F+  DG  YF  QW+YRA
Sbjct  563  VANVECHYSQAKVDGHTFSLGDFAYIK-GEEEETHVGQIVEFFKTTDGESYFRVQWFYRA  621

Query  738  KDTVIKGCDEFVDKQRVFFS  797
             DT+++      DK+R+F+S
Sbjct  622  TDTIMERQATNHDKRRLFYS  641



>gb|KJB25192.1| hypothetical protein B456_004G180300 [Gossypium raimondii]
Length=1056

 Score = 93.2 bits (230),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 51/130 (39%), Positives = 76/130 (58%), Gaps = 10/130 (8%)
 Frame = +3

Query  426  DSEFVGGPVLEEEAKQRWPHRYQKGTEKSNGVTRSITSQDEFAG------VLQAKRHFTA  587
            D  F+G P+ ++EA++RW  RY+    KSN   R + S D+         V   + H+  
Sbjct  396  DVIFIGNPIPDDEAQERWRWRYEMKNTKSN---RKLISSDDDDDDDEDKVVWNVECHYAQ  452

Query  588  AKVDGLFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRAKDTVIKGCDE  767
            A++DG    LGD  Y+K GE   ++I +I+E F+  DG  YF  QW+YRA+DTV+K    
Sbjct  453  AEIDGCTINLGDCVYIK-GEEAKHHIGKILEFFKTTDGENYFRVQWFYRAEDTVMKQEAA  511

Query  768  FVDKQRVFFS  797
            F D++RVF+S
Sbjct  512  FHDERRVFYS  521



>ref|XP_006282433.1| hypothetical protein CARUB_v10003999mg, partial [Capsella rubella]
 gb|EOA15331.1| hypothetical protein CARUB_v10003999mg, partial [Capsella rubella]
Length=1275

 Score = 93.2 bits (230),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 53/122 (43%), Positives = 74/122 (61%), Gaps = 4/122 (3%)
 Frame = +3

Query  435  FVGGPVLEEEAKQRWPHRYQKGTEKSNGVTRSITSQD-EFAGVLQAKRHFTAAKVDGLFY  611
            F+G P+  EEA++RW  RY     KS   +R   S+D E   V   + H++ AKVDG  +
Sbjct  502  FIGEPISCEEAQERWRWRYDLKERKSK--SRGQQSEDDEDKIVANVECHYSQAKVDGHTF  559

Query  612  KLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRAKDTVIKGCDEFVDKQRVF  791
             LGD A +K GE E+NY+ +I+E F+  DG  Y   QW+YRA DTV+K      DK+R+F
Sbjct  560  SLGDFACIK-GEEEENYVGKIVEFFKTTDGESYLRVQWFYRATDTVMKQQATNHDKRRLF  618

Query  792  FS  797
            +S
Sbjct  619  YS  620



>gb|KJB25190.1| hypothetical protein B456_004G180300 [Gossypium raimondii]
Length=1182

 Score = 92.8 bits (229),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 51/130 (39%), Positives = 76/130 (58%), Gaps = 10/130 (8%)
 Frame = +3

Query  426  DSEFVGGPVLEEEAKQRWPHRYQKGTEKSNGVTRSITSQDEFAG------VLQAKRHFTA  587
            D  F+G P+ ++EA++RW  RY+    KSN   R + S D+         V   + H+  
Sbjct  393  DVIFIGNPIPDDEAQERWRWRYEMKNTKSN---RKLISSDDDDDDDEDKVVWNVECHYAQ  449

Query  588  AKVDGLFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRAKDTVIKGCDE  767
            A++DG    LGD  Y+K GE   ++I +I+E F+  DG  YF  QW+YRA+DTV+K    
Sbjct  450  AEIDGCTINLGDCVYIK-GEEAKHHIGKILEFFKTTDGENYFRVQWFYRAEDTVMKQEAA  508

Query  768  FVDKQRVFFS  797
            F D++RVF+S
Sbjct  509  FHDERRVFYS  518



>gb|KJB25191.1| hypothetical protein B456_004G180300 [Gossypium raimondii]
Length=1185

 Score = 92.8 bits (229),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 51/130 (39%), Positives = 76/130 (58%), Gaps = 10/130 (8%)
 Frame = +3

Query  426  DSEFVGGPVLEEEAKQRWPHRYQKGTEKSNGVTRSITSQDEFAG------VLQAKRHFTA  587
            D  F+G P+ ++EA++RW  RY+    KSN   R + S D+         V   + H+  
Sbjct  396  DVIFIGNPIPDDEAQERWRWRYEMKNTKSN---RKLISSDDDDDDDEDKVVWNVECHYAQ  452

Query  588  AKVDGLFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRAKDTVIKGCDE  767
            A++DG    LGD  Y+K GE   ++I +I+E F+  DG  YF  QW+YRA+DTV+K    
Sbjct  453  AEIDGCTINLGDCVYIK-GEEAKHHIGKILEFFKTTDGENYFRVQWFYRAEDTVMKQEAA  511

Query  768  FVDKQRVFFS  797
            F D++RVF+S
Sbjct  512  FHDERRVFYS  521



>ref|XP_009625195.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2, partial [Nicotiana 
tomentosiformis]
Length=773

 Score = 92.4 bits (228),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 46/113 (41%), Positives = 68/113 (60%), Gaps = 1/113 (1%)
 Frame = +3

Query  459  EEAKQRWPHRYQKGTEKSNGVTRSITSQDEFAGVLQAKRHFTAAKVDGLFYKLGDDAYVK  638
            EEA++RW  RY     K+      + + +E   +   + H+  AKV G  + +GD AYVK
Sbjct  2    EEAQERWQWRYDLKGRKTKRQGWKLNAGEEDEIIFNVECHYAQAKVAGFTFNIGDCAYVK  61

Query  639  AGEGEDNYICRIIEMFEAVDGALYFTAQWYYRAKDTVIKGCDEFVDKQRVFFS  797
             GEG  N+I RI+E F+  +G  YF  QW++RA+DTV+KG   F D +R+F+S
Sbjct  62   -GEGRKNHIGRILEFFKTAEGEDYFRVQWFFRAEDTVLKGAASFHDTKRIFYS  113



>ref|XP_010671153.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2-like [Beta 
vulgaris subsp. vulgaris]
Length=841

 Score = 92.0 bits (227),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 46/124 (37%), Positives = 79/124 (64%), Gaps = 0/124 (0%)
 Frame = +3

Query  429  SEFVGGPVLEEEAKQRWPHRYQKGTEKSNGVTRSITSQDEFAGVLQAKRHFTAAKVDGLF  608
            S  +G P+ ++EA++RWP+RYQ   +++N   ++    D+   VL  K H++ A+V    
Sbjct  53   SFLIGDPIPDDEARRRWPYRYQNKRQRNNRGNKNSADDDDDELVLDVKCHYSQAEVVNHV  112

Query  609  YKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRAKDTVIKGCDEFVDKQRV  788
            + +GD AYVK  + + N+I RI+E F+ +D   YF  QW++RA+DTVI+   +  D++R+
Sbjct  113  FNIGDCAYVKGEKRKKNFIGRIVEFFKTMDDEDYFRVQWFFRAEDTVIEDEAKCHDERRL  172

Query  789  FFSE  800
            F S+
Sbjct  173  FLSD  176



>ref|XP_006471441.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2-like [Citrus 
sinensis]
Length=969

 Score = 92.0 bits (227),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 47/123 (38%), Positives = 72/123 (59%), Gaps = 1/123 (1%)
 Frame = +3

Query  429  SEFVGGPVLEEEAKQRWPHRYQKGTEKSNGVTRSITSQDEFAGVLQAKRHFTAAKVDGLF  608
            S F+G P+  EEA++RW  RY+   ++  G   +    DE   V   + H+  A++    
Sbjct  144  SYFIGDPIPNEEAQKRWGWRYEMKNQRYKGKDYASDDDDEDKIVSNVECHYAQARIGECI  203

Query  609  YKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRAKDTVIKGCDEFVDKQRV  788
            + LGD AY+K GEG   +I +I+E F+  DG  YF  QW+YRA+DTV+K    F D++ +
Sbjct  204  FDLGDCAYIK-GEGTQKHIGKILEFFKTTDGEEYFRVQWFYRAEDTVMKEAANFHDRKCL  262

Query  789  FFS  797
            F+S
Sbjct  263  FYS  265



>ref|XP_006385690.1| hypothetical protein POPTR_0003s09920g, partial [Populus trichocarpa]
 gb|ERP63487.1| hypothetical protein POPTR_0003s09920g, partial [Populus trichocarpa]
Length=972

 Score = 91.7 bits (226),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 48/129 (37%), Positives = 71/129 (55%), Gaps = 6/129 (5%)
 Frame = +3

Query  426  DSEFVGGPVLEEEAKQRWPHRYQKGTEKSNGVT-----RSITSQDEFAGVLQAKRHFTAA  590
            +   +G PV  +EA++RW  RY+        ++     R  +  DE   V   + H+T A
Sbjct  402  NCSLIGDPVAHDEAQERWHWRYEMKLLMVFCLSIFVYARLFSDDDEDKVVWNVECHYTQA  461

Query  591  KVDGLFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRAKDTVIKGCDEF  770
             ++G    LGD  YVK GEG  N+I  I+E F+  D   YF  QW+YRA+DTV+K   +F
Sbjct  462  NIEGRIINLGDCVYVK-GEGAKNHIGSILEFFKTTDREDYFRVQWFYRAEDTVMKEAADF  520

Query  771  VDKQRVFFS  797
             D +R+F+S
Sbjct  521  HDNKRLFYS  529



>ref|XP_006655109.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2-like [Oryza 
brachyantha]
Length=1221

 Score = 91.7 bits (226),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 50/136 (37%), Positives = 76/136 (56%), Gaps = 7/136 (5%)
 Frame = +3

Query  414  TNDEDSEFVGGPVLEEEAKQRWPHRYQ-------KGTEKSNGVTRSITSQDEFAGVLQAK  572
             +D    FVG  V + EA+Q+WPHRY+       K ++  +  T S T  +    VL  K
Sbjct  435  MDDGSCFFVGEAVPDYEARQKWPHRYEINDQIMKKFSDLKDKRTSSQTFVNAGKAVLDVK  494

Query  573  RHFTAAKVDGLFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRAKDTVI  752
             H+  AKV    + +GD A++K  EG+ NYI R++E FE   G  Y   QW++RA+DTV+
Sbjct  495  CHYLQAKVSTCTFCIGDCAFIKGPEGKPNYIGRLLEFFETKAGEYYVRVQWFFRAEDTVM  554

Query  753  KGCDEFVDKQRVFFSE  800
            K   +    +R+F+S+
Sbjct  555  KEQAQSHAPRRLFYSD  570



>dbj|BAH37021.1| chromomethylase OsMET2c [Oryza sativa Japonica Group]
Length=749

 Score = 89.7 bits (221),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 48/123 (39%), Positives = 73/123 (59%), Gaps = 2/123 (2%)
 Frame = +3

Query  438  VGGPVLEEEAKQRWPHRYQKGTE--KSNGVTRSITSQDEFAGVLQAKRHFTAAKVDGLFY  611
            VG  V ++EA+++WPHRY+   +  K +  T S T  +    VL  K H+  AKV    +
Sbjct  1    VGDAVPDDEARKQWPHRYEINDQIMKKDKRTSSQTFANAGKAVLDVKCHYLQAKVSRYTF  60

Query  612  KLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRAKDTVIKGCDEFVDKQRVF  791
             +G+ A+VK  EG+ NYI R++E FE   G  YF  QW++ A+DTVI    +  D +R+F
Sbjct  61   CIGECAFVKGPEGKPNYIGRLLEFFETKTGECYFRVQWFFTAEDTVIGEQAQSHDPRRLF  120

Query  792  FSE  800
            +S+
Sbjct  121  YSD  123



>ref|XP_010518849.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2 isoform X3 
[Tarenaya hassleriana]
Length=917

 Score = 89.4 bits (220),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 48/121 (40%), Positives = 71/121 (59%), Gaps = 2/121 (2%)
 Frame = +3

Query  435  FVGGPVLEEEAKQRWPHRYQKGTEKSNGVTRSITSQDEFAGVLQAKRHFTAAKVDGLFYK  614
            F+G P+  EEA +RW  RY     KS    + +   DE   V   + H++ A V+G  + 
Sbjct  140  FIGEPIPFEEALERWRWRYDLKKSKSRSRGQQLNDDDEDEIVASVECHYSQANVNGRTFS  199

Query  615  LGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRAKDTVIKGCDEFVDKQRVFF  794
            LGD AY++ GE E  ++ +IIE F+  DG  YF  QW+YRA+DTV+K      D++R+F+
Sbjct  200  LGDFAYIR-GE-EQKHVGKIIEFFKTTDGEGYFRVQWFYRAEDTVMKQQAAAHDERRLFY  257

Query  795  S  797
            S
Sbjct  258  S  258



>ref|XP_010054090.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2 isoform X1 
[Eucalyptus grandis]
 ref|XP_010054091.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2 isoform X1 
[Eucalyptus grandis]
 gb|KCW78468.1| hypothetical protein EUGRSUZ_D02616 [Eucalyptus grandis]
Length=1233

 Score = 89.4 bits (220),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 44/121 (36%), Positives = 72/121 (60%), Gaps = 1/121 (1%)
 Frame = +3

Query  435  FVGGPVLEEEAKQRWPHRYQKGTEKSNGVTRSITSQDEFAGVLQAKRHFTAAKVDGLFYK  614
            FVG  + E EAK+ W  RY   ++   G  +S+ S DE   +   K H+  A+V+G  ++
Sbjct  438  FVGDAIPENEAKKWWKWRYDMKSQTLEGGKKSLESDDEDEIITNVKCHYRQAEVNGCIFE  497

Query  615  LGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRAKDTVIKGCDEFVDKQRVFF  794
            +GD AY++  +G+  ++ RI+E F   D   Y   +W+YRA+DTV++    F DK+R+F+
Sbjct  498  IGDCAYLRGDKGK-KHVGRILEFFRTTDEEDYIRVRWFYRAEDTVMQNQSSFHDKKRLFY  556

Query  795  S  797
            S
Sbjct  557  S  557



>gb|KEH20304.1| DNA (cytosine-5)-methyltransferase [Medicago truncatula]
Length=1011

 Score = 89.0 bits (219),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 41/121 (34%), Positives = 71/121 (59%), Gaps = 1/121 (1%)
 Frame = +3

Query  435  FVGGPVLEEEAKQRWPHRYQKGTEKSNGVTRSITSQDEFAGVLQAKRHFTAAKVDGLFYK  614
            F+G P+ ++EA+++W  RY+   ++ N     I   +E   ++  K H+  A +    + 
Sbjct  194  FIGDPIPDDEARKKWGWRYKLKDKQCNDKVFIINEDEEDETIINVKCHYAQAIIGNCIFT  253

Query  615  LGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRAKDTVIKGCDEFVDKQRVFF  794
            +GD A +K GEGE  +I +I+E F   D   YF  QW+YR +DTV++   ++ DK+R+F+
Sbjct  254  VGDCASIK-GEGEQKHIGKIVEFFLTTDSKKYFRVQWFYRIQDTVVQDEGDYHDKRRLFY  312

Query  795  S  797
            S
Sbjct  313  S  313



>ref|XP_010518848.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2 isoform X2 
[Tarenaya hassleriana]
Length=1227

 Score = 88.6 bits (218),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 48/121 (40%), Positives = 71/121 (59%), Gaps = 2/121 (2%)
 Frame = +3

Query  435  FVGGPVLEEEAKQRWPHRYQKGTEKSNGVTRSITSQDEFAGVLQAKRHFTAAKVDGLFYK  614
            F+G P+  EEA +RW  RY     KS    + +   DE   V   + H++ A V+G  + 
Sbjct  513  FIGEPIPFEEALERWRWRYDLKKSKSRSRGQQLNDDDEDEIVASVECHYSQANVNGRTFS  572

Query  615  LGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRAKDTVIKGCDEFVDKQRVFF  794
            LGD AY++ GE E  ++ +IIE F+  DG  YF  QW+YRA+DTV+K      D++R+F+
Sbjct  573  LGDFAYIR-GE-EQKHVGKIIEFFKTTDGEGYFRVQWFYRAEDTVMKQQAAAHDERRLFY  630

Query  795  S  797
            S
Sbjct  631  S  631



>ref|XP_004960650.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2-like isoform 
X2 [Setaria italica]
Length=1295

 Score = 88.6 bits (218),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 45/124 (36%), Positives = 70/124 (56%), Gaps = 2/124 (2%)
 Frame = +3

Query  435  FVGGPVLEEEAKQRWPHRY--QKGTEKSNGVTRSITSQDEFAGVLQAKRHFTAAKVDGLF  608
            F+G  V  EEA+ RWP+RY       K +    + T  +    V   K H+  A V G  
Sbjct  512  FMGEAVPHEEARHRWPNRYGSNHCLLKKDKWRNTQTFSNAGKAVFDVKCHYLRASVCGST  571

Query  609  YKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRAKDTVIKGCDEFVDKQRV  788
              +GD A++K  EG+ +YI R++E FE   G  YF+ QW++RA+DTV++   +  D +R+
Sbjct  572  LCIGDCAFIKGPEGKPHYIGRLLEFFETSAGQYYFSVQWFFRAEDTVMEDQAQAHDPRRL  631

Query  789  FFSE  800
            F+S+
Sbjct  632  FYSD  635



>ref|XP_004960649.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2-like isoform 
X1 [Setaria italica]
Length=1296

 Score = 88.6 bits (218),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 45/124 (36%), Positives = 70/124 (56%), Gaps = 2/124 (2%)
 Frame = +3

Query  435  FVGGPVLEEEAKQRWPHRY--QKGTEKSNGVTRSITSQDEFAGVLQAKRHFTAAKVDGLF  608
            F+G  V  EEA+ RWP+RY       K +    + T  +    V   K H+  A V G  
Sbjct  512  FMGEAVPHEEARHRWPNRYGSNHCLLKKDKWRNTQTFSNAGKAVFDVKCHYLRASVCGST  571

Query  609  YKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRAKDTVIKGCDEFVDKQRV  788
              +GD A++K  EG+ +YI R++E FE   G  YF+ QW++RA+DTV++   +  D +R+
Sbjct  572  LCIGDCAFIKGPEGKPHYIGRLLEFFETSAGQYYFSVQWFFRAEDTVMEDQAQAHDPRRL  631

Query  789  FFSE  800
            F+S+
Sbjct  632  FYSD  635



>ref|XP_010518846.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2 isoform X1 
[Tarenaya hassleriana]
Length=1290

 Score = 88.6 bits (218),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 48/121 (40%), Positives = 71/121 (59%), Gaps = 2/121 (2%)
 Frame = +3

Query  435  FVGGPVLEEEAKQRWPHRYQKGTEKSNGVTRSITSQDEFAGVLQAKRHFTAAKVDGLFYK  614
            F+G P+  EEA +RW  RY     KS    + +   DE   V   + H++ A V+G  + 
Sbjct  513  FIGEPIPFEEALERWRWRYDLKKSKSRSRGQQLNDDDEDEIVASVECHYSQANVNGRTFS  572

Query  615  LGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRAKDTVIKGCDEFVDKQRVFF  794
            LGD AY++ GE E  ++ +IIE F+  DG  YF  QW+YRA+DTV+K      D++R+F+
Sbjct  573  LGDFAYIR-GE-EQKHVGKIIEFFKTTDGEGYFRVQWFYRAEDTVMKQQAAAHDERRLFY  630

Query  795  S  797
            S
Sbjct  631  S  631



>ref|XP_002870005.1| chromomethylase 2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH46264.1| chromomethylase 2 [Arabidopsis lyrata subsp. lyrata]
Length=1253

 Score = 88.2 bits (217),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 52/139 (37%), Positives = 77/139 (55%), Gaps = 6/139 (4%)
 Frame = +3

Query  393  KRITTNVTNDEDSE----FVGGPVLEEEAKQRWPHRYQKGTEKSNGVTRSITSQDEFAGV  560
            KR+T     +++      F+G P+  EEA++RW  RY     KS    +  +  DE   V
Sbjct  463  KRVTRTAVQEQNKRSICFFIGEPISCEEAQERWRWRYDLKERKSKSRGQQ-SEDDEDKIV  521

Query  561  LQAKRHFTAAKVDGLFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRAK  740
               + H+  AKVDG  + LGD A +K GE E+ ++ +I+E F+  D   YF  QW+YRA 
Sbjct  522  ANVECHYLQAKVDGHTFSLGDFACIK-GEEEETHVGKILEFFKTTDEESYFRVQWFYRAT  580

Query  741  DTVIKGCDEFVDKQRVFFS  797
            DTV+K      DK+R+F+S
Sbjct  581  DTVMKQQATNHDKKRLFYS  599



>gb|EMS51591.1| DNA (cytosine-5)-methyltransferase 1 [Triticum urartu]
Length=758

 Score = 87.0 bits (214),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 43/84 (51%), Positives = 54/84 (64%), Gaps = 4/84 (5%)
 Frame = +3

Query  561  LQAKRHFTAAKVDGLFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRAK  740
            ++A+ H+ +A VDG+ Y LGDD YV AGE E +YI RI E FE VD   YFT +WY+R +
Sbjct  25   MKARVHYRSAMVDGVVYALGDDVYVMAGENEADYIGRITEFFEGVDKTSYFTCRWYFRPE  84

Query  741  DTVIKGC----DEFVDKQRVFFSE  800
            DTVI       D   D +RVF SE
Sbjct  85   DTVISRAKFVNDHTHDPKRVFLSE  108



>gb|EPS61564.1| hypothetical protein M569_13232, partial [Genlisea aurea]
Length=383

 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 45/121 (37%), Positives = 68/121 (56%), Gaps = 2/121 (2%)
 Frame = +3

Query  435  FVGGPVLEEEAKQRWPHRYQKGTEKSNGVTRSITSQDEFAGVLQAKRHFTAAKVDGLFYK  614
            F+G P+ E+ A+QRW  RY     K+NG    +   +E   +L    H+  AKV      
Sbjct  14   FIGNPLPEDVARQRWQWRYDL-KHKNNGRRSKLNEDEEDEIILNVDCHYAQAKVGSWILN  72

Query  615  LGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRAKDTVIKGCDEFVDKQRVFF  794
            +GD   VK GE    +I RI+E F+ ++G  YF  QW++RA+DTV+K      D++R+F+
Sbjct  73   IGDCVCVK-GEETKEHIGRILEFFKTMEGEDYFRVQWFFRAEDTVLKDAASSHDERRLFY  131

Query  795  S  797
            S
Sbjct  132  S  132



>ref|XP_009785637.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2-like, partial 
[Nicotiana sylvestris]
Length=764

 Score = 84.3 bits (207),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 40/89 (45%), Positives = 59/89 (66%), Gaps = 1/89 (1%)
 Frame = +3

Query  531  ITSQDEFAGVLQAKRHFTAAKVDGLFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALY  710
            + + +E A +L  + H+  AKV G  + +GD AYVK GEG  N+I RI+E F+  +G  Y
Sbjct  17   LNAGEEDAIILNVECHYAQAKVAGFTFNIGDCAYVK-GEGRKNHIGRILEFFKTSEGEDY  75

Query  711  FTAQWYYRAKDTVIKGCDEFVDKQRVFFS  797
            F  QW++RA+DTV+KG   F D +R+F+S
Sbjct  76   FRVQWFFRAEDTVLKGAASFHDTKRIFYS  104



>ref|NP_001280869.1| DNA (cytosine-5)-methyltransferase CMT3-like [Malus domestica]
 gb|AFV99135.1| CMT-type cytosine DNA-methyltransferase 3a [Malus domestica]
Length=372

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 55/150 (37%), Positives = 78/150 (52%), Gaps = 20/150 (13%)
 Frame = +3

Query  363  VRSQASPPERKRITTNVT----NDEDSEFVGGPVLEEEAKQRWPHRYQKGTEKSNGVTRS  530
            V   AS P RK +T  V     + E+S F G P+ +EE ++++P RY    E    +  S
Sbjct  93   VEKAASLP-RKPVTQEVAAADEDGEESRFSGKPMEDEETRKQYPKRYVG--ENYALLAIS  149

Query  531  ITSQDEFAGVLQAKRHF---TAAKVDGLFYKL-------GDDAYVKA---GEGEDNYICR  671
                  F G  + ++     T  K   L +         G + + K    GE ++ YIC+
Sbjct  150  CECSMYFTGSRKERKKCYERTITKSIALCFDFDPCIGAEGKEEWAKKLQRGETKEPYICK  209

Query  672  IIEMFEAVDGALYFTAQWYYRAKDTVIKGC  761
            I+EMFEA+ G LYFTAQWYYR++DTVIK C
Sbjct  210  IVEMFEAIGGLLYFTAQWYYRSQDTVIKHC  239



>emb|CDP11756.1| unnamed protein product [Coffea canephora]
Length=792

 Score = 82.4 bits (202),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 43/115 (37%), Positives = 63/115 (55%), Gaps = 2/115 (2%)
 Frame = +3

Query  453  LEEEAKQRWPHRYQKGTEKSNGVTRSITSQDEFAGVLQAKRHFTAAKVDGLFYKLGDDAY  632
            L+E    +W  R+ +   +S  V  S   +++   +L    H+  A VDG    +GD AY
Sbjct  15   LQEIKSHQWKIRFLRKERESGRVLLSFAGEED-ETILNVDFHYAQANVDGCVLSIGDCAY  73

Query  633  VKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRAKDTVIKGCDEFVDKQRVFFS  797
            +K GEG   +I RI+E F    G  YF  QWY+R +DTVIK    F D++R+F+S
Sbjct  74   IK-GEGRKKHIGRILEFFRTTQGEDYFRVQWYFRVEDTVIKEAATFHDEKRIFYS  127



>emb|CDX99400.1| BnaC01g11520D [Brassica napus]
Length=1144

 Score = 82.0 bits (201),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 48/123 (39%), Positives = 70/123 (57%), Gaps = 2/123 (2%)
 Frame = +3

Query  429  SEFVGGPVLEEEAKQRWPHRYQKGTEKSNGVTRSITSQDEFAGVLQAKRHFTAAKVDGLF  608
            S F+G P+  EEAK+RW  RY     KS    +  +  DE   V   + H+  AKVD   
Sbjct  396  SFFIGEPIPCEEAKERWRWRYDLKEHKSKRRGQQ-SEDDEDMIVANVECHYLQAKVDNET  454

Query  609  YKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRAKDTVIKGCDEFVDKQRV  788
            + LGD A +  G+GE+  I +I+E+F+  DG  YF  QW YRA DTV++      +++R+
Sbjct  455  FSLGDFACL-MGDGEEPPIGKIVELFKTTDGESYFRVQWLYRATDTVMQKQAADHERRRL  513

Query  789  FFS  797
            F+S
Sbjct  514  FYS  516



>ref|XP_006662134.1| PREDICTED: DNA (cytosine-5)-methyltransferase 1-like [Oryza brachyantha]
Length=827

 Score = 81.3 bits (199),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 42/86 (49%), Positives = 53/86 (62%), Gaps = 6/86 (7%)
 Frame = +3

Query  561  LQAKRHFTAAKVDGLFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRAK  740
            L+A+ H+ +AKVDG+ Y L DD YVKA E + +YI RI E FE  D   YFT  W++RA+
Sbjct  77   LKARCHYRSAKVDGIVYCLHDDVYVKAEEDKADYIGRITEFFEGTDHCRYFTCCWFFRAE  136

Query  741  DTVIKGC------DEFVDKQRVFFSE  800
            DTVI         D   D +RVF SE
Sbjct  137  DTVISSMMMENVHDHNHDLKRVFLSE  162



>ref|XP_009132470.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2 isoform X1 
[Brassica rapa]
Length=1141

 Score = 80.1 bits (196),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 48/123 (39%), Positives = 68/123 (55%), Gaps = 2/123 (2%)
 Frame = +3

Query  429  SEFVGGPVLEEEAKQRWPHRYQKGTEKSNGVTRSITSQDEFAGVLQAKRHFTAAKVDGLF  608
            S F+G P+  EEAK+RW  RY     KS    +     DE   V   + H++ AKVD   
Sbjct  367  SFFIGEPIPCEEAKERWRWRYDLKEHKSKRRGQQ-AEDDEDMIVANVECHYSQAKVDNET  425

Query  609  YKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRAKDTVIKGCDEFVDKQRV  788
            + LGD A +  G GE+  I +I+E F+  DG  YF  QW YRA DTV++      +++R+
Sbjct  426  FSLGDFACL-MGNGEEPPIGKIVEFFKTTDGESYFRVQWLYRATDTVMQKQAADHERRRL  484

Query  789  FFS  797
            F+S
Sbjct  485  FYS  487



>emb|CDX78915.1| BnaA01g09820D [Brassica napus]
Length=1098

 Score = 80.1 bits (196),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 48/123 (39%), Positives = 68/123 (55%), Gaps = 2/123 (2%)
 Frame = +3

Query  429  SEFVGGPVLEEEAKQRWPHRYQKGTEKSNGVTRSITSQDEFAGVLQAKRHFTAAKVDGLF  608
            S F+G P+  EEAK+RW  RY     KS    +     DE   V   + H++ AKVD   
Sbjct  324  SFFIGEPIPCEEAKERWRWRYDLKEHKSKRRGQQ-AEDDEDMIVANVECHYSQAKVDNET  382

Query  609  YKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRAKDTVIKGCDEFVDKQRV  788
            + LGD A +  G GE+  I +I+E F+  DG  YF  QW YRA DTV++      +++R+
Sbjct  383  FSLGDFACL-MGNGEEPPIGKIVEFFKTTDGESYFRVQWLYRATDTVMQKQAADHERRRL  441

Query  789  FFS  797
            F+S
Sbjct  442  FYS  444



>ref|XP_009132479.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2 isoform X2 
[Brassica rapa]
Length=1119

 Score = 80.1 bits (196),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 48/123 (39%), Positives = 68/123 (55%), Gaps = 2/123 (2%)
 Frame = +3

Query  429  SEFVGGPVLEEEAKQRWPHRYQKGTEKSNGVTRSITSQDEFAGVLQAKRHFTAAKVDGLF  608
            S F+G P+  EEAK+RW  RY     KS    +     DE   V   + H++ AKVD   
Sbjct  367  SFFIGEPIPCEEAKERWRWRYDLKEHKSKRRGQQ-AEDDEDMIVANVECHYSQAKVDNET  425

Query  609  YKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRAKDTVIKGCDEFVDKQRV  788
            + LGD A +  G GE+  I +I+E F+  DG  YF  QW YRA DTV++      +++R+
Sbjct  426  FSLGDFACL-MGNGEEPPIGKIVEFFKTTDGESYFRVQWLYRATDTVMQKQAADHERRRL  484

Query  789  FFS  797
            F+S
Sbjct  485  FYS  487



>gb|AGT16212.1| methyltransferase [Saccharum hybrid cultivar R570]
Length=811

 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 48/135 (36%), Positives = 69/135 (51%), Gaps = 29/135 (21%)
 Frame = +3

Query  396  RITTNVTNDEDSEFVGGPVLEEEAKQRWPHRYQKGTEKSNGVTRSITSQDEFAGVLQAKR  575
            R T     D + EFVG PV   EA+  WP RY+          RS  +Q+E    ++A+ 
Sbjct  128  RRTAAAVGDHEPEFVGEPVPAPEARSSWPKRYE----------RSTAAQEEEE--VKARC  175

Query  576  HFTAAKVDGLFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRAKDT---  746
            H+ +AKVD + Y L         E + +YI RI E FE +D   YFT +W++RA+DT   
Sbjct  176  HYRSAKVDNVVYSL---------ENKADYIGRITEFFEGIDQCHYFTCRWFFRAEDTMDS  226

Query  747  -----VIKGCDEFVD  776
                 +I+ CD + D
Sbjct  227  KAKAQLIEHCDLYYD  241



>ref|XP_002886525.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH62784.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=732

 Score = 78.2 bits (191),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 42/83 (51%), Positives = 56/83 (67%), Gaps = 3/83 (4%)
 Frame = +3

Query  555  GVLQAKRHFTAAKVDGLFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYR  734
            G L+A  H+  A V+G+ Y L DD YV+A +GE N I +IIE+FE VDG  YF AQ +YR
Sbjct  14   GNLEATSHYDKALVNGVVYSLNDDIYVQA-KGEPNRIAKIIELFEGVDGEGYFRAQLFYR  72

Query  735  AKDTVIKGC--DEFVDKQRVFFS  797
            A+DTVI+    +   +K+RVF S
Sbjct  73   AEDTVIQDLAGEYLQEKRRVFLS  95



>ref|XP_006599217.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2-like isoform 
X3 [Glycine max]
Length=777

 Score = 77.0 bits (188),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/80 (44%), Positives = 52/80 (65%), Gaps = 1/80 (1%)
 Frame = +3

Query  558  VLQAKRHFTAAKVDGLFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRA  737
            +   K H+  A++    + LGD A+VK GEGE+ ++ +IIE F+  DG  YF  QW+YR 
Sbjct  13   IANVKCHYAQAEIGNCIFSLGDCAFVK-GEGEEKHVGKIIEFFQTTDGQNYFRVQWFYRI  71

Query  738  KDTVIKGCDEFVDKQRVFFS  797
            +DTV++    F DK+RVF+S
Sbjct  72   QDTVVQDEGGFHDKRRVFYS  91



>ref|XP_008238301.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2 [Prunus mume]
Length=752

 Score = 76.3 bits (186),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 34/80 (43%), Positives = 52/80 (65%), Gaps = 1/80 (1%)
 Frame = +3

Query  558  VLQAKRHFTAAKVDGLFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRA  737
            +L  + HF+ AK+    + LGD AY+K G+G   ++ RI+E F+  DG  YF  QW+Y+ 
Sbjct  13   ILNVECHFSQAKIGNCIFSLGDCAYIK-GDGGKKHVGRILEFFKTTDGENYFRVQWFYKV  71

Query  738  KDTVIKGCDEFVDKQRVFFS  797
            +DTVIK   +  DK+R+F+S
Sbjct  72   EDTVIKDVGDVHDKRRLFYS  91



>ref|XP_009364160.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT3-like [Pyrus 
x bretschneideri]
Length=132

 Score = 71.2 bits (173),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 32/56 (57%), Positives = 44/56 (79%), Gaps = 1/56 (2%)
 Frame = +3

Query  633  VKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRAKDTVIKGCDEFVDKQRVFFSE  800
            ++ G+ ++ YIC+I+E+FEA+ G LYFTAQWYYR++DTVIK C   V   RVFFS+
Sbjct  29   LQRGQTKEAYICKIVEIFEAIGGLLYFTAQWYYRSRDTVIKLCAT-VACGRVFFSD  83



>emb|CAJ01708.1| chromomethylase 1 [Hordeum vulgare subsp. vulgare]
Length=735

 Score = 75.9 bits (185),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 40/75 (53%), Positives = 47/75 (63%), Gaps = 4/75 (5%)
 Frame = +3

Query  588  AKVDGLFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRAKDTVIKGC--  761
            AKVD + Y LGDD YV AGE E +YI RI E FE VD   YFT +W++R +DTVI     
Sbjct  12   AKVDDVDYTLGDDVYVMAGENEADYIGRITEFFEGVDKTNYFTCRWFFRPEDTVISRAKF  71

Query  762  --DEFVDKQRVFFSE  800
              D   D +RVF SE
Sbjct  72   VNDHTHDPKRVFLSE  86



>gb|KDO58824.1| hypothetical protein CISIN_1g046469mg, partial [Citrus sinensis]
Length=521

 Score = 75.5 bits (184),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 54/85 (64%), Gaps = 1/85 (1%)
 Frame = +3

Query  543  DEFAGVLQAKRHFTAAKVDGLFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQ  722
            DE   V   + H+  A++    + LGD AY+K GEG   +I +I+E F+  DG  YF  Q
Sbjct  31   DEDKIVSNVECHYAQARIGECIFDLGDCAYIK-GEGTQKHIGKILEFFKTTDGEEYFRVQ  89

Query  723  WYYRAKDTVIKGCDEFVDKQRVFFS  797
            W+YRA+DTV+K   +F D++R+F+S
Sbjct  90   WFYRAEDTVMKEAADFHDRKRLFYS  114



>ref|XP_007210636.1| hypothetical protein PRUPE_ppa019831mg, partial [Prunus persica]
 gb|EMJ11835.1| hypothetical protein PRUPE_ppa019831mg, partial [Prunus persica]
Length=998

 Score = 75.5 bits (184),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 36/86 (42%), Positives = 55/86 (64%), Gaps = 3/86 (3%)
 Frame = +3

Query  540  QDEFAGVLQAKRHFTAAKVDGLFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTA  719
            +DE   +L  + HF+ AK+    + LGD AY+K G+G   ++ RI+E F+  DG  YF  
Sbjct  286  EDEI--ILNVECHFSQAKIGNCIFSLGDCAYIK-GDGGKKHVGRILEFFKTTDGKNYFRV  342

Query  720  QWYYRAKDTVIKGCDEFVDKQRVFFS  797
            QW+Y+ +DTVIK   +  DK+R+F+S
Sbjct  343  QWFYKVEDTVIKDVGDVHDKRRLFYS  368



>gb|AHB20163.1| DNA methyltransferase, partial [Populus x canadensis]
Length=760

 Score = 74.7 bits (182),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 52/85 (61%), Gaps = 1/85 (1%)
 Frame = +3

Query  543  DEFAGVLQAKRHFTAAKVDGLFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQ  722
            DE   V   + H+T A ++G    LGD  YVK GEG  N+I  I+E F+  D   YF  Q
Sbjct  6    DEDKVVWNVECHYTQANIEGRIINLGDCVYVK-GEGAKNHIGSILEFFKTTDREDYFRVQ  64

Query  723  WYYRAKDTVIKGCDEFVDKQRVFFS  797
            W+YRA+DTV+K   +F D +R+F+S
Sbjct  65   WFYRAEDTVMKEAADFHDNKRLFYS  89



>ref|XP_010677408.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2 isoform X3 
[Beta vulgaris subsp. vulgaris]
Length=773

 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 62/97 (64%), Gaps = 2/97 (2%)
 Frame = +3

Query  507  KSNGVTRSITSQDEFAGVLQAKRHFTAAKVDGLFYKLGDDAYVKAGEGEDNYICRIIEMF  686
            + NG + +  +++E    L+ K H+T A+++G  + LGD A ++ GE +  +I RIIE F
Sbjct  22   RINGGSLAGNAREENEPTLEVKCHYTQAEINGCIFHLGDCALIR-GENQ-KHIGRIIEFF  79

Query  687  EAVDGALYFTAQWYYRAKDTVIKGCDEFVDKQRVFFS  797
            E +D   YF  QW+Y+ +DTV+K    F DK+R+F+S
Sbjct  80   ETMDREDYFRVQWFYKPEDTVMKEEASFHDKKRIFYS  116



>ref|XP_011465073.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2 isoform X4 
[Fragaria vesca subsp. vesca]
Length=770

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 37/99 (37%), Positives = 56/99 (57%), Gaps = 1/99 (1%)
 Frame = +3

Query  501  TEKSNGVTRSITSQDEFAGVLQAKRHFTAAKVDGLFYKLGDDAYVKAGEGEDNYICRIIE  680
            +++S   +  +   +E   VL  + HF  AK+    + LGD  YV+  EG+ + + RI+E
Sbjct  12   SQRSKRQSMKLNDDEEDEIVLNVECHFAQAKIGNCIFSLGDCVYVQGNEGKKD-VGRILE  70

Query  681  MFEAVDGALYFTAQWYYRAKDTVIKGCDEFVDKQRVFFS  797
             F   DG  YF  QW+YR +DTVIK      DK+R+F+S
Sbjct  71   FFRTTDGENYFRVQWFYRVEDTVIKEVGSSHDKRRLFYS  109



>ref|XP_010677407.1| PREDICTED: DNA (cytosine-5)-methyltransferase CMT2 isoform X2 
[Beta vulgaris subsp. vulgaris]
Length=774

 Score = 73.2 bits (178),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 36/88 (41%), Positives = 58/88 (66%), Gaps = 2/88 (2%)
 Frame = +3

Query  534  TSQDEFAGVLQAKRHFTAAKVDGLFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYF  713
            ++++E    L+ K H+T A+++G  + LGD A ++ GE +  +I RIIE FE +D   YF
Sbjct  32   SAREENEPTLEVKCHYTQAEINGCIFHLGDCALIR-GENQ-KHIGRIIEFFETMDREDYF  89

Query  714  TAQWYYRAKDTVIKGCDEFVDKQRVFFS  797
              QW+Y+ +DTV+K    F DK+R+F+S
Sbjct  90   RVQWFYKPEDTVMKEEASFHDKKRIFYS  117



>gb|EEE62800.1| hypothetical protein OsJ_17603 [Oryza sativa Japonica Group]
Length=1190

 Score = 72.4 bits (176),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 68/129 (53%), Gaps = 8/129 (6%)
 Frame = +3

Query  414  TNDEDSEFVGGPVLEEEAKQRWPHRYQKGTEKSNGVTRSITSQDEFAGVLQAKRHFTAAK  593
            T+D    FVG  V ++EA+++WPHRY+   +      R  TS   FA ++          
Sbjct  360  TDDGSCFFVGDAVPDDEARKQWPHRYEINDQIMKKDKR--TSSQTFAKLVTVSFCVVFMY  417

Query  594  VDGLFYKLGDDAYVKAGEGEDNYICRIIEMFEAVDGALYFTAQWYYRAKDTVIKGCDEFV  773
            V   + ++ D    +  EG+ NYI R++E FE   G  YF  QW++ A+DTVI    +  
Sbjct  418  V---YLQMLD---FRGPEGKPNYIGRLLEFFETKTGECYFRVQWFFTAEDTVIGEQAQSH  471

Query  774  DKQRVFFSE  800
            D +R+F+S+
Sbjct  472  DPRRLFYSD  480



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1580279231195